data_4HYY
# 
_entry.id   4HYY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4HYY         
RCSB  RCSB076094   
WWPDB D_1000076094 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1V5W 
_pdbx_database_related.details        'The full-length DMC1 protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4HYY 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Du, L.'  1 
'Luo, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure of a filament of stacked octamers of human DMC1 recombinase.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            69 
_citation.page_first                382 
_citation.page_last                 386 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23545642 
_citation.pdbx_database_id_DOI      10.1107/S1744309113005678 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Du, L.'  1 
primary 'Luo, Y.' 2 
# 
_cell.entry_id           4HYY 
_cell.length_a           123.997 
_cell.length_b           123.997 
_cell.length_c           91.713 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4HYY 
_symmetry.space_group_name_H-M             'P 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                75 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Meiotic recombination protein DMC1/LIM15 homolog' 29567.510 4  ? ? 'ATPase domain' ? 
2 water   nat water                                              18.015    96 ? ? ?               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTEN
TFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQ
QKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPE
NEATFAITAGGIGDAKELEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTEN
TFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQ
QKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPE
NEATFAITAGGIGDAKELEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PHE n 
1 3   LEU n 
1 4   THR n 
1 5   ALA n 
1 6   PHE n 
1 7   GLU n 
1 8   TYR n 
1 9   SER n 
1 10  GLU n 
1 11  LYS n 
1 12  ARG n 
1 13  LYS n 
1 14  MET n 
1 15  VAL n 
1 16  PHE n 
1 17  HIS n 
1 18  ILE n 
1 19  THR n 
1 20  THR n 
1 21  GLY n 
1 22  SER n 
1 23  GLN n 
1 24  GLU n 
1 25  PHE n 
1 26  ASP n 
1 27  LYS n 
1 28  LEU n 
1 29  LEU n 
1 30  GLY n 
1 31  GLY n 
1 32  GLY n 
1 33  ILE n 
1 34  GLU n 
1 35  SER n 
1 36  MET n 
1 37  ALA n 
1 38  ILE n 
1 39  THR n 
1 40  GLU n 
1 41  ALA n 
1 42  PHE n 
1 43  GLY n 
1 44  GLU n 
1 45  PHE n 
1 46  ARG n 
1 47  THR n 
1 48  GLY n 
1 49  LYS n 
1 50  THR n 
1 51  GLN n 
1 52  LEU n 
1 53  SER n 
1 54  HIS n 
1 55  THR n 
1 56  LEU n 
1 57  CYS n 
1 58  VAL n 
1 59  THR n 
1 60  ALA n 
1 61  GLN n 
1 62  LEU n 
1 63  PRO n 
1 64  GLY n 
1 65  ALA n 
1 66  GLY n 
1 67  GLY n 
1 68  TYR n 
1 69  PRO n 
1 70  GLY n 
1 71  GLY n 
1 72  LYS n 
1 73  ILE n 
1 74  ILE n 
1 75  PHE n 
1 76  ILE n 
1 77  ASP n 
1 78  THR n 
1 79  GLU n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  ARG n 
1 84  PRO n 
1 85  ASP n 
1 86  ARG n 
1 87  LEU n 
1 88  ARG n 
1 89  ASP n 
1 90  ILE n 
1 91  ALA n 
1 92  ASP n 
1 93  ARG n 
1 94  PHE n 
1 95  ASN n 
1 96  VAL n 
1 97  ASP n 
1 98  HIS n 
1 99  ASP n 
1 100 ALA n 
1 101 VAL n 
1 102 LEU n 
1 103 ASP n 
1 104 ASN n 
1 105 VAL n 
1 106 LEU n 
1 107 TYR n 
1 108 ALA n 
1 109 ARG n 
1 110 ALA n 
1 111 TYR n 
1 112 THR n 
1 113 SER n 
1 114 GLU n 
1 115 HIS n 
1 116 GLN n 
1 117 MET n 
1 118 GLU n 
1 119 LEU n 
1 120 LEU n 
1 121 ASP n 
1 122 TYR n 
1 123 VAL n 
1 124 ALA n 
1 125 ALA n 
1 126 LYS n 
1 127 PHE n 
1 128 HIS n 
1 129 GLU n 
1 130 GLU n 
1 131 ALA n 
1 132 GLY n 
1 133 ILE n 
1 134 PHE n 
1 135 LYS n 
1 136 LEU n 
1 137 LEU n 
1 138 ILE n 
1 139 ILE n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 MET n 
1 144 ALA n 
1 145 LEU n 
1 146 PHE n 
1 147 ARG n 
1 148 VAL n 
1 149 ASP n 
1 150 PHE n 
1 151 SER n 
1 152 GLY n 
1 153 ARG n 
1 154 GLY n 
1 155 GLU n 
1 156 LEU n 
1 157 ALA n 
1 158 GLU n 
1 159 ARG n 
1 160 GLN n 
1 161 GLN n 
1 162 LYS n 
1 163 LEU n 
1 164 ALA n 
1 165 GLN n 
1 166 MET n 
1 167 LEU n 
1 168 SER n 
1 169 ARG n 
1 170 LEU n 
1 171 GLN n 
1 172 LYS n 
1 173 ILE n 
1 174 SER n 
1 175 GLU n 
1 176 GLU n 
1 177 TYR n 
1 178 ASN n 
1 179 VAL n 
1 180 ALA n 
1 181 VAL n 
1 182 PHE n 
1 183 VAL n 
1 184 THR n 
1 185 ASN n 
1 186 GLN n 
1 187 MET n 
1 188 THR n 
1 189 ALA n 
1 190 ASP n 
1 191 PRO n 
1 192 GLY n 
1 193 ALA n 
1 194 THR n 
1 195 MET n 
1 196 THR n 
1 197 PHE n 
1 198 GLN n 
1 199 ALA n 
1 200 ASP n 
1 201 PRO n 
1 202 LYS n 
1 203 LYS n 
1 204 PRO n 
1 205 ILE n 
1 206 GLY n 
1 207 GLY n 
1 208 HIS n 
1 209 ILE n 
1 210 LEU n 
1 211 ALA n 
1 212 HIS n 
1 213 ALA n 
1 214 SER n 
1 215 THR n 
1 216 THR n 
1 217 ARG n 
1 218 ILE n 
1 219 SER n 
1 220 LEU n 
1 221 ARG n 
1 222 LYS n 
1 223 GLY n 
1 224 ARG n 
1 225 GLY n 
1 226 GLU n 
1 227 LEU n 
1 228 ARG n 
1 229 ILE n 
1 230 ALA n 
1 231 LYS n 
1 232 ILE n 
1 233 TYR n 
1 234 ASP n 
1 235 SER n 
1 236 PRO n 
1 237 GLU n 
1 238 MET n 
1 239 PRO n 
1 240 GLU n 
1 241 ASN n 
1 242 GLU n 
1 243 ALA n 
1 244 THR n 
1 245 PHE n 
1 246 ALA n 
1 247 ILE n 
1 248 THR n 
1 249 ALA n 
1 250 GLY n 
1 251 GLY n 
1 252 ILE n 
1 253 GLY n 
1 254 ASP n 
1 255 ALA n 
1 256 LYS n 
1 257 GLU n 
1 258 LEU n 
1 259 GLU n 
1 260 HIS n 
1 261 HIS n 
1 262 HIS n 
1 263 HIS n 
1 264 HIS n 
1 265 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DMC1, DMC1H, LIM15' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-Rosetta2 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DMC1_HUMAN 
_struct_ref.pdbx_db_accession          Q14565 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTEN
TFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQ
QKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPE
NEATFAITAGGIGDAKE
;
_struct_ref.pdbx_align_begin           84 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4HYY A 1 ? 257 ? Q14565 84 ? 340 ? 84 340 
2 1 4HYY B 1 ? 257 ? Q14565 84 ? 340 ? 84 340 
3 1 4HYY C 1 ? 257 ? Q14565 84 ? 340 ? 84 340 
4 1 4HYY D 1 ? 257 ? Q14565 84 ? 340 ? 84 340 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4HYY LEU A 258 ? UNP Q14565 ? ? 'EXPRESSION TAG' 341 1  
1 4HYY GLU A 259 ? UNP Q14565 ? ? 'EXPRESSION TAG' 342 2  
1 4HYY HIS A 260 ? UNP Q14565 ? ? 'EXPRESSION TAG' 343 3  
1 4HYY HIS A 261 ? UNP Q14565 ? ? 'EXPRESSION TAG' 344 4  
1 4HYY HIS A 262 ? UNP Q14565 ? ? 'EXPRESSION TAG' 345 5  
1 4HYY HIS A 263 ? UNP Q14565 ? ? 'EXPRESSION TAG' 346 6  
1 4HYY HIS A 264 ? UNP Q14565 ? ? 'EXPRESSION TAG' 347 7  
1 4HYY HIS A 265 ? UNP Q14565 ? ? 'EXPRESSION TAG' 348 8  
2 4HYY LEU B 258 ? UNP Q14565 ? ? 'EXPRESSION TAG' 341 9  
2 4HYY GLU B 259 ? UNP Q14565 ? ? 'EXPRESSION TAG' 342 10 
2 4HYY HIS B 260 ? UNP Q14565 ? ? 'EXPRESSION TAG' 343 11 
2 4HYY HIS B 261 ? UNP Q14565 ? ? 'EXPRESSION TAG' 344 12 
2 4HYY HIS B 262 ? UNP Q14565 ? ? 'EXPRESSION TAG' 345 13 
2 4HYY HIS B 263 ? UNP Q14565 ? ? 'EXPRESSION TAG' 346 14 
2 4HYY HIS B 264 ? UNP Q14565 ? ? 'EXPRESSION TAG' 347 15 
2 4HYY HIS B 265 ? UNP Q14565 ? ? 'EXPRESSION TAG' 348 16 
3 4HYY LEU C 258 ? UNP Q14565 ? ? 'EXPRESSION TAG' 341 17 
3 4HYY GLU C 259 ? UNP Q14565 ? ? 'EXPRESSION TAG' 342 18 
3 4HYY HIS C 260 ? UNP Q14565 ? ? 'EXPRESSION TAG' 343 19 
3 4HYY HIS C 261 ? UNP Q14565 ? ? 'EXPRESSION TAG' 344 20 
3 4HYY HIS C 262 ? UNP Q14565 ? ? 'EXPRESSION TAG' 345 21 
3 4HYY HIS C 263 ? UNP Q14565 ? ? 'EXPRESSION TAG' 346 22 
3 4HYY HIS C 264 ? UNP Q14565 ? ? 'EXPRESSION TAG' 347 23 
3 4HYY HIS C 265 ? UNP Q14565 ? ? 'EXPRESSION TAG' 348 24 
4 4HYY LEU D 258 ? UNP Q14565 ? ? 'EXPRESSION TAG' 341 25 
4 4HYY GLU D 259 ? UNP Q14565 ? ? 'EXPRESSION TAG' 342 26 
4 4HYY HIS D 260 ? UNP Q14565 ? ? 'EXPRESSION TAG' 343 27 
4 4HYY HIS D 261 ? UNP Q14565 ? ? 'EXPRESSION TAG' 344 28 
4 4HYY HIS D 262 ? UNP Q14565 ? ? 'EXPRESSION TAG' 345 29 
4 4HYY HIS D 263 ? UNP Q14565 ? ? 'EXPRESSION TAG' 346 30 
4 4HYY HIS D 264 ? UNP Q14565 ? ? 'EXPRESSION TAG' 347 31 
4 4HYY HIS D 265 ? UNP Q14565 ? ? 'EXPRESSION TAG' 348 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4HYY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    
'6% PEG 3350, 0.5 M NaCl, 0.05 M MgCl2, 0.05 M HEPES-NACl, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 294.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-09-24 
_diffrn_detector.details                Mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     4HYY 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             47.5 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   42118 
_reflns.number_all                   43421 
_reflns.percent_possible_obs         97.0 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        25.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   82.1 
_reflns_shell.Rmerge_I_obs           0.419 
_reflns_shell.pdbx_Rsym_value        0.419 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        6.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6906 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4HYY 
_refine.ls_number_reflns_obs                     39104 
_refine.ls_number_reflns_all                     40632 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.45 
_refine.ls_d_res_high                            2.603 
_refine.ls_percent_reflns_obs                    96.24 
_refine.ls_R_factor_obs                          0.18187 
_refine.ls_R_factor_all                          0.18187 
_refine.ls_R_factor_R_work                       0.17851 
_refine.ls_R_factor_R_free                       0.24615 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2085 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.B_iso_mean                               67.350 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1V5W' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.452 
_refine.pdbx_overall_ESU_R_Free                  0.292 
_refine.overall_SU_ML                            0.220 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             22.484 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7536 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               7632 
_refine_hist.d_res_high                       2.603 
_refine_hist.d_res_low                        47.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.014  0.019  ? 7668  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.906  1.957  ? 10316 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       7.526  5.000  ? 956   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       38.868 23.516 ? 364   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       22.601 15.000 ? 1352  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       22.295 15.000 ? 60    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.131  0.200  ? 1144  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.007  0.020  ? 5784  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scbond_it                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.603 
_refine_ls_shell.d_res_low                        2.670 
_refine_ls_shell.number_reflns_R_work             2298 
_refine_ls_shell.R_factor_R_work                  0.296 
_refine_ls_shell.percent_reflns_obs               79.49 
_refine_ls_shell.R_factor_R_free                  0.368 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             140 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4HYY 
_struct.title                     'Filament of octameric rings of DMC1 recombinase from Homo sapiens' 
_struct.pdbx_descriptor           'Meiotic recombination protein DMC1/LIM15 homolog' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4HYY 
_struct_keywords.pdbx_keywords   RECOMBINATION 
_struct_keywords.text            'RecA homolog, DNA strand exchange, DNA, nucleus, Recombination' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 5   ? LYS A 13  ? ALA A 88  LYS A 96  1 ? 9  
HELX_P HELX_P2  2  SER A 22  ? LEU A 29  ? SER A 105 LEU A 112 1 ? 8  
HELX_P HELX_P3  3  GLY A 48  ? ALA A 60  ? GLY A 131 ALA A 143 1 ? 13 
HELX_P HELX_P4  4  GLY A 64  ? TYR A 68  ? GLY A 147 TYR A 151 5 ? 5  
HELX_P HELX_P5  5  ARG A 83  ? ASN A 95  ? ARG A 166 ASN A 178 1 ? 13 
HELX_P HELX_P6  6  ASP A 97  ? ASN A 104 ? ASP A 180 ASN A 187 1 ? 8  
HELX_P HELX_P7  7  THR A 112 ? GLU A 130 ? THR A 195 GLU A 213 1 ? 19 
HELX_P HELX_P8  8  MET A 143 ? PHE A 150 ? MET A 226 PHE A 233 1 ? 8  
HELX_P HELX_P9  9  GLU A 155 ? TYR A 177 ? GLU A 238 TYR A 260 1 ? 23 
HELX_P HELX_P10 10 GLY A 206 ? SER A 214 ? GLY A 289 SER A 297 1 ? 9  
HELX_P HELX_P11 11 MET A 238 ? GLU A 240 ? MET A 321 GLU A 323 5 ? 3  
HELX_P HELX_P12 12 THR B 4   ? MET B 14  ? THR B 87  MET B 97  1 ? 11 
HELX_P HELX_P13 13 SER B 22  ? LEU B 29  ? SER B 105 LEU B 112 1 ? 8  
HELX_P HELX_P14 14 GLY B 48  ? ALA B 60  ? GLY B 131 ALA B 143 1 ? 13 
HELX_P HELX_P15 15 GLY B 64  ? TYR B 68  ? GLY B 147 TYR B 151 5 ? 5  
HELX_P HELX_P16 16 ARG B 83  ? PHE B 94  ? ARG B 166 PHE B 177 1 ? 12 
HELX_P HELX_P17 17 ASP B 97  ? ASN B 104 ? ASP B 180 ASN B 187 1 ? 8  
HELX_P HELX_P18 18 THR B 112 ? GLU B 130 ? THR B 195 GLU B 213 1 ? 19 
HELX_P HELX_P19 19 MET B 143 ? PHE B 150 ? MET B 226 PHE B 233 1 ? 8  
HELX_P HELX_P20 20 GLU B 155 ? TYR B 177 ? GLU B 238 TYR B 260 1 ? 23 
HELX_P HELX_P21 21 GLY B 206 ? SER B 214 ? GLY B 289 SER B 297 1 ? 9  
HELX_P HELX_P22 22 MET B 238 ? GLU B 240 ? MET B 321 GLU B 323 5 ? 3  
HELX_P HELX_P23 23 THR C 4   ? MET C 14  ? THR C 87  MET C 97  1 ? 11 
HELX_P HELX_P24 24 SER C 22  ? LEU C 29  ? SER C 105 LEU C 112 1 ? 8  
HELX_P HELX_P25 25 GLY C 48  ? ALA C 60  ? GLY C 131 ALA C 143 1 ? 13 
HELX_P HELX_P26 26 GLY C 64  ? TYR C 68  ? GLY C 147 TYR C 151 5 ? 5  
HELX_P HELX_P27 27 ARG C 83  ? ASP C 85  ? ARG C 166 ASP C 168 5 ? 3  
HELX_P HELX_P28 28 ARG C 86  ? ASN C 95  ? ARG C 169 ASN C 178 1 ? 10 
HELX_P HELX_P29 29 ASP C 97  ? ASN C 104 ? ASP C 180 ASN C 187 1 ? 8  
HELX_P HELX_P30 30 THR C 112 ? GLU C 130 ? THR C 195 GLU C 213 1 ? 19 
HELX_P HELX_P31 31 MET C 143 ? PHE C 150 ? MET C 226 PHE C 233 1 ? 8  
HELX_P HELX_P32 32 GLY C 152 ? GLY C 154 ? GLY C 235 GLY C 237 5 ? 3  
HELX_P HELX_P33 33 GLU C 155 ? TYR C 177 ? GLU C 238 TYR C 260 1 ? 23 
HELX_P HELX_P34 34 GLY C 206 ? SER C 214 ? GLY C 289 SER C 297 1 ? 9  
HELX_P HELX_P35 35 MET C 238 ? GLU C 240 ? MET C 321 GLU C 323 5 ? 3  
HELX_P HELX_P36 36 ALA D 5   ? MET D 14  ? ALA D 88  MET D 97  1 ? 10 
HELX_P HELX_P37 37 SER D 22  ? GLY D 30  ? SER D 105 GLY D 113 1 ? 9  
HELX_P HELX_P38 38 GLY D 48  ? ALA D 60  ? GLY D 131 ALA D 143 1 ? 13 
HELX_P HELX_P39 39 GLY D 64  ? TYR D 68  ? GLY D 147 TYR D 151 5 ? 5  
HELX_P HELX_P40 40 ARG D 83  ? PHE D 94  ? ARG D 166 PHE D 177 1 ? 12 
HELX_P HELX_P41 41 ASP D 97  ? ASN D 104 ? ASP D 180 ASN D 187 1 ? 8  
HELX_P HELX_P42 42 THR D 112 ? GLU D 130 ? THR D 195 GLU D 213 1 ? 19 
HELX_P HELX_P43 43 MET D 143 ? PHE D 150 ? MET D 226 PHE D 233 1 ? 8  
HELX_P HELX_P44 44 GLU D 155 ? TYR D 177 ? GLU D 238 TYR D 260 1 ? 23 
HELX_P HELX_P45 45 GLY D 206 ? SER D 214 ? GLY D 289 SER D 297 1 ? 9  
HELX_P HELX_P46 46 MET D 238 ? GLU D 240 ? MET D 321 GLU D 323 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 140 A . ? ASP 223 A SER 141 A ? SER 224 A 1 -4.89  
2 SER 235 A . ? SER 318 A PRO 236 A ? PRO 319 A 1 -13.24 
3 ASP 140 B . ? ASP 223 B SER 141 B ? SER 224 B 1 4.01   
4 SER 235 B . ? SER 318 B PRO 236 B ? PRO 319 B 1 -17.06 
5 ASP 140 C . ? ASP 223 C SER 141 C ? SER 224 C 1 8.13   
6 SER 235 C . ? SER 318 C PRO 236 C ? PRO 319 C 1 -13.70 
7 ASP 140 D . ? ASP 223 D SER 141 D ? SER 224 D 1 1.94   
8 SER 235 D . ? SER 318 D PRO 236 D ? PRO 319 D 1 -0.70  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9  ? 
B ? 2  ? 
C ? 9  ? 
D ? 2  ? 
E ? 2  ? 
F ? 10 ? 
G ? 2  ? 
H ? 9  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
B 1 2  ? anti-parallel 
C 1 2  ? parallel      
C 2 3  ? parallel      
C 3 4  ? parallel      
C 4 5  ? parallel      
C 5 6  ? parallel      
C 6 7  ? anti-parallel 
C 7 8  ? anti-parallel 
C 8 9  ? anti-parallel 
D 1 2  ? anti-parallel 
E 1 2  ? anti-parallel 
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
F 3 4  ? anti-parallel 
F 4 5  ? parallel      
F 5 6  ? parallel      
F 6 7  ? parallel      
F 7 8  ? parallel      
F 8 9  ? parallel      
F 9 10 ? anti-parallel 
G 1 2  ? anti-parallel 
H 1 2  ? parallel      
H 2 3  ? parallel      
H 3 4  ? parallel      
H 4 5  ? parallel      
H 5 6  ? parallel      
H 6 7  ? anti-parallel 
H 7 8  ? anti-parallel 
H 8 9  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 3   ? THR A 4   ? LEU A 86  THR A 87  
A 2  VAL B 105 ? ARG B 109 ? VAL B 188 ARG B 192 
A 3  LYS B 72  ? ASP B 77  ? LYS B 155 ASP B 160 
A 4  PHE B 134 ? ASP B 140 ? PHE B 217 ASP B 223 
A 5  ALA B 180 ? ASN B 185 ? ALA B 263 ASN B 268 
A 6  ALA B 37  ? GLY B 43  ? ALA B 120 GLY B 126 
A 7  THR B 216 ? ARG B 221 ? THR B 299 ARG B 304 
A 8  LEU B 227 ? ILE B 232 ? LEU B 310 ILE B 315 
A 9  GLU B 242 ? ALA B 246 ? GLU B 325 ALA B 329 
B 1  HIS A 17  ? ILE A 18  ? HIS A 100 ILE A 101 
B 2  ILE A 33  ? GLU A 34  ? ILE A 116 GLU A 117 
C 1  VAL A 105 ? ARG A 109 ? VAL A 188 ARG A 192 
C 2  LYS A 72  ? ASP A 77  ? LYS A 155 ASP A 160 
C 3  PHE A 134 ? ASP A 140 ? PHE A 217 ASP A 223 
C 4  ALA A 180 ? ASN A 185 ? ALA A 263 ASN A 268 
C 5  ALA A 37  ? GLY A 43  ? ALA A 120 GLY A 126 
C 6  THR A 216 ? LYS A 222 ? THR A 299 LYS A 305 
C 7  LEU A 227 ? ILE A 232 ? LEU A 310 ILE A 315 
C 8  GLU A 242 ? THR A 248 ? GLU A 325 THR A 331 
C 9  GLY A 251 ? ASP A 254 ? GLY A 334 ASP A 337 
D 1  HIS B 17  ? ILE B 18  ? HIS B 100 ILE B 101 
D 2  ILE B 33  ? GLU B 34  ? ILE B 116 GLU B 117 
E 1  HIS C 17  ? ILE C 18  ? HIS C 100 ILE C 101 
E 2  ILE C 33  ? GLU C 34  ? ILE C 116 GLU C 117 
F 1  GLY C 251 ? GLY C 253 ? GLY C 334 GLY C 336 
F 2  GLU C 242 ? THR C 248 ? GLU C 325 THR C 331 
F 3  LEU C 227 ? ILE C 232 ? LEU C 310 ILE C 315 
F 4  THR C 216 ? LYS C 222 ? THR C 299 LYS C 305 
F 5  ALA C 37  ? GLY C 43  ? ALA C 120 GLY C 126 
F 6  ALA C 180 ? ASN C 185 ? ALA C 263 ASN C 268 
F 7  PHE C 134 ? ASP C 140 ? PHE C 217 ASP C 223 
F 8  LYS C 72  ? ASP C 77  ? LYS C 155 ASP C 160 
F 9  VAL C 105 ? ARG C 109 ? VAL C 188 ARG C 192 
F 10 LEU D 3   ? THR D 4   ? LEU D 86  THR D 87  
G 1  HIS D 17  ? ILE D 18  ? HIS D 100 ILE D 101 
G 2  ILE D 33  ? GLU D 34  ? ILE D 116 GLU D 117 
H 1  VAL D 105 ? ARG D 109 ? VAL D 188 ARG D 192 
H 2  LYS D 72  ? ASP D 77  ? LYS D 155 ASP D 160 
H 3  PHE D 134 ? ASP D 140 ? PHE D 217 ASP D 223 
H 4  ALA D 180 ? ASN D 185 ? ALA D 263 ASN D 268 
H 5  ALA D 37  ? PHE D 42  ? ALA D 120 PHE D 125 
H 6  THR D 216 ? LYS D 222 ? THR D 299 LYS D 305 
H 7  LEU D 227 ? ILE D 232 ? LEU D 310 ILE D 315 
H 8  GLU D 242 ? THR D 248 ? GLU D 325 THR D 331 
H 9  GLY D 251 ? ASP D 254 ? GLY D 334 ASP D 337 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N LEU A 3   ? N LEU A 86  O TYR B 107 ? O TYR B 190 
A 2 3  O LEU B 106 ? O LEU B 189 N PHE B 75  ? N PHE B 158 
A 3 4  N LYS B 72  ? N LYS B 155 O LYS B 135 ? O LYS B 218 
A 4 5  N LYS B 135 ? N LYS B 218 O ALA B 180 ? O ALA B 263 
A 5 6  O VAL B 181 ? O VAL B 264 N THR B 39  ? N THR B 122 
A 6 7  N GLU B 40  ? N GLU B 123 O THR B 216 ? O THR B 299 
A 7 8  N SER B 219 ? N SER B 302 O LYS B 231 ? O LYS B 314 
A 8 9  N ARG B 228 ? N ARG B 311 O PHE B 245 ? O PHE B 328 
B 1 2  N ILE A 18  ? N ILE A 101 O ILE A 33  ? O ILE A 116 
C 1 2  O LEU A 106 ? O LEU A 189 N PHE A 75  ? N PHE A 158 
C 2 3  N LYS A 72  ? N LYS A 155 O LYS A 135 ? O LYS A 218 
C 3 4  N LEU A 137 ? N LEU A 220 O PHE A 182 ? O PHE A 265 
C 4 5  O VAL A 183 ? O VAL A 266 N ALA A 41  ? N ALA A 124 
C 5 6  N GLU A 40  ? N GLU A 123 O ILE A 218 ? O ILE A 301 
C 6 7  N SER A 219 ? N SER A 302 O LYS A 231 ? O LYS A 314 
C 7 8  N ALA A 230 ? N ALA A 313 O ALA A 243 ? O ALA A 326 
C 8 9  N ALA A 246 ? N ALA A 329 O GLY A 253 ? O GLY A 336 
D 1 2  N ILE B 18  ? N ILE B 101 O ILE B 33  ? O ILE B 116 
E 1 2  N ILE C 18  ? N ILE C 101 O ILE C 33  ? O ILE C 116 
F 1 2  O GLY C 253 ? O GLY C 336 N ALA C 246 ? N ALA C 329 
F 2 3  O PHE C 245 ? O PHE C 328 N ARG C 228 ? N ARG C 311 
F 3 4  O ILE C 229 ? O ILE C 312 N ARG C 221 ? N ARG C 304 
F 4 5  O ILE C 218 ? O ILE C 301 N GLU C 40  ? N GLU C 123 
F 5 6  N THR C 39  ? N THR C 122 O VAL C 183 ? O VAL C 266 
F 6 7  O ALA C 180 ? O ALA C 263 N LYS C 135 ? N LYS C 218 
F 7 8  O ILE C 138 ? O ILE C 221 N ILE C 74  ? N ILE C 157 
F 8 9  N PHE C 75  ? N PHE C 158 O LEU C 106 ? O LEU C 189 
F 9 10 N TYR C 107 ? N TYR C 190 O LEU D 3   ? O LEU D 86  
G 1 2  N ILE D 18  ? N ILE D 101 O ILE D 33  ? O ILE D 116 
H 1 2  O LEU D 106 ? O LEU D 189 N PHE D 75  ? N PHE D 158 
H 2 3  N ILE D 74  ? N ILE D 157 O ILE D 138 ? O ILE D 221 
H 3 4  N LYS D 135 ? N LYS D 218 O ALA D 180 ? O ALA D 263 
H 4 5  O VAL D 183 ? O VAL D 266 N ALA D 41  ? N ALA D 124 
H 5 6  N GLU D 40  ? N GLU D 123 O THR D 216 ? O THR D 299 
H 6 7  N ARG D 221 ? N ARG D 304 O ILE D 229 ? O ILE D 312 
H 7 8  N ARG D 228 ? N ARG D 311 O PHE D 245 ? O PHE D 328 
H 8 9  N ALA D 246 ? N ALA D 329 O GLY D 253 ? O GLY D 336 
# 
_database_PDB_matrix.entry_id          4HYY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4HYY 
_atom_sites.fract_transf_matrix[1][1]   0.008065 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008065 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010904 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? -17.031 -38.984 -40.357 1.00 65.97  ? 84  GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? -15.863 -39.003 -39.358 1.00 75.35  ? 84  GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? -16.111 -39.693 -37.986 1.00 72.89  ? 84  GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? -15.271 -39.715 -37.051 1.00 59.06  ? 84  GLY A O   1 
ATOM   5    N N   . PHE A 1 2   ? -17.302 -40.262 -37.888 1.00 70.16  ? 85  PHE A N   1 
ATOM   6    C CA  . PHE A 1 2   ? -17.713 -40.975 -36.739 1.00 62.95  ? 85  PHE A CA  1 
ATOM   7    C C   . PHE A 1 2   ? -17.525 -42.408 -37.134 1.00 61.37  ? 85  PHE A C   1 
ATOM   8    O O   . PHE A 1 2   ? -17.290 -42.698 -38.294 1.00 62.72  ? 85  PHE A O   1 
ATOM   9    C CB  . PHE A 1 2   ? -19.188 -40.633 -36.473 1.00 63.13  ? 85  PHE A CB  1 
ATOM   10   C CG  . PHE A 1 2   ? -19.384 -39.231 -35.954 1.00 61.88  ? 85  PHE A CG  1 
ATOM   11   C CD1 . PHE A 1 2   ? -19.855 -39.010 -34.663 1.00 59.96  ? 85  PHE A CD1 1 
ATOM   12   C CD2 . PHE A 1 2   ? -19.035 -38.127 -36.732 1.00 62.18  ? 85  PHE A CD2 1 
ATOM   13   C CE1 . PHE A 1 2   ? -20.014 -37.719 -34.177 1.00 59.59  ? 85  PHE A CE1 1 
ATOM   14   C CE2 . PHE A 1 2   ? -19.188 -36.833 -36.244 1.00 62.36  ? 85  PHE A CE2 1 
ATOM   15   C CZ  . PHE A 1 2   ? -19.683 -36.626 -34.972 1.00 61.42  ? 85  PHE A CZ  1 
ATOM   16   N N   . LEU A 1 3   ? -17.567 -43.292 -36.157 1.00 57.30  ? 86  LEU A N   1 
ATOM   17   C CA  . LEU A 1 3   ? -17.780 -44.681 -36.419 1.00 56.41  ? 86  LEU A CA  1 
ATOM   18   C C   . LEU A 1 3   ? -18.844 -45.138 -35.399 1.00 56.96  ? 86  LEU A C   1 
ATOM   19   O O   . LEU A 1 3   ? -19.195 -44.350 -34.526 1.00 56.85  ? 86  LEU A O   1 
ATOM   20   C CB  . LEU A 1 3   ? -16.448 -45.437 -36.357 1.00 52.07  ? 86  LEU A CB  1 
ATOM   21   C CG  . LEU A 1 3   ? -15.607 -45.524 -35.102 1.00 52.41  ? 86  LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 3   ? -14.274 -46.205 -35.375 1.00 48.08  ? 86  LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 3   ? -15.363 -44.151 -34.498 1.00 56.87  ? 86  LEU A CD2 1 
ATOM   24   N N   . THR A 1 4   ? -19.407 -46.349 -35.520 1.00 53.25  ? 87  THR A N   1 
ATOM   25   C CA  . THR A 1 4   ? -20.380 -46.772 -34.530 1.00 49.39  ? 87  THR A CA  1 
ATOM   26   C C   . THR A 1 4   ? -19.646 -47.260 -33.299 1.00 48.11  ? 87  THR A C   1 
ATOM   27   O O   . THR A 1 4   ? -18.491 -47.594 -33.362 1.00 46.73  ? 87  THR A O   1 
ATOM   28   C CB  . THR A 1 4   ? -21.270 -47.890 -35.016 1.00 49.38  ? 87  THR A CB  1 
ATOM   29   O OG1 . THR A 1 4   ? -20.507 -49.099 -35.043 1.00 49.92  ? 87  THR A OG1 1 
ATOM   30   C CG2 . THR A 1 4   ? -21.867 -47.569 -36.370 1.00 47.14  ? 87  THR A CG2 1 
ATOM   31   N N   . ALA A 1 5   ? -20.308 -47.279 -32.162 1.00 49.98  ? 88  ALA A N   1 
ATOM   32   C CA  . ALA A 1 5   ? -19.639 -47.625 -30.930 1.00 49.44  ? 88  ALA A CA  1 
ATOM   33   C C   . ALA A 1 5   ? -19.230 -49.124 -30.984 1.00 51.91  ? 88  ALA A C   1 
ATOM   34   O O   . ALA A 1 5   ? -18.283 -49.569 -30.322 1.00 48.72  ? 88  ALA A O   1 
ATOM   35   C CB  . ALA A 1 5   ? -20.539 -47.316 -29.755 1.00 50.19  ? 88  ALA A CB  1 
ATOM   36   N N   . PHE A 1 6   ? -19.901 -49.880 -31.844 1.00 52.10  ? 89  PHE A N   1 
ATOM   37   C CA  . PHE A 1 6   ? -19.425 -51.217 -32.180 1.00 52.90  ? 89  PHE A CA  1 
ATOM   38   C C   . PHE A 1 6   ? -18.076 -51.240 -32.921 1.00 50.22  ? 89  PHE A C   1 
ATOM   39   O O   . PHE A 1 6   ? -17.173 -52.020 -32.571 1.00 49.34  ? 89  PHE A O   1 
ATOM   40   C CB  . PHE A 1 6   ? -20.484 -52.007 -32.965 1.00 56.37  ? 89  PHE A CB  1 
ATOM   41   C CG  . PHE A 1 6   ? -20.020 -53.357 -33.376 1.00 59.29  ? 89  PHE A CG  1 
ATOM   42   C CD1 . PHE A 1 6   ? -20.027 -54.414 -32.468 1.00 65.71  ? 89  PHE A CD1 1 
ATOM   43   C CD2 . PHE A 1 6   ? -19.533 -53.579 -34.665 1.00 60.15  ? 89  PHE A CD2 1 
ATOM   44   C CE1 . PHE A 1 6   ? -19.560 -55.675 -32.848 1.00 67.14  ? 89  PHE A CE1 1 
ATOM   45   C CE2 . PHE A 1 6   ? -19.089 -54.831 -35.047 1.00 61.60  ? 89  PHE A CE2 1 
ATOM   46   C CZ  . PHE A 1 6   ? -19.093 -55.873 -34.136 1.00 62.99  ? 89  PHE A CZ  1 
ATOM   47   N N   . GLU A 1 7   ? -17.947 -50.425 -33.962 1.00 48.92  ? 90  GLU A N   1 
ATOM   48   C CA  . GLU A 1 7   ? -16.681 -50.324 -34.672 1.00 48.34  ? 90  GLU A CA  1 
ATOM   49   C C   . GLU A 1 7   ? -15.567 -49.881 -33.727 1.00 48.21  ? 90  GLU A C   1 
ATOM   50   O O   . GLU A 1 7   ? -14.453 -50.464 -33.750 1.00 46.39  ? 90  GLU A O   1 
ATOM   51   C CB  . GLU A 1 7   ? -16.806 -49.432 -35.893 1.00 50.63  ? 90  GLU A CB  1 
ATOM   52   C CG  . GLU A 1 7   ? -17.587 -50.100 -37.017 1.00 56.29  ? 90  GLU A CG  1 
ATOM   53   C CD  . GLU A 1 7   ? -18.374 -49.134 -37.896 1.00 66.80  ? 90  GLU A CD  1 
ATOM   54   O OE1 . GLU A 1 7   ? -18.799 -49.581 -38.990 1.00 79.05  ? 90  GLU A OE1 1 
ATOM   55   O OE2 . GLU A 1 7   ? -18.615 -47.947 -37.518 1.00 66.12  ? 90  GLU A OE2 1 
ATOM   56   N N   . TYR A 1 8   ? -15.895 -48.917 -32.843 1.00 47.24  ? 91  TYR A N   1 
ATOM   57   C CA  . TYR A 1 8   ? -14.928 -48.384 -31.884 1.00 43.97  ? 91  TYR A CA  1 
ATOM   58   C C   . TYR A 1 8   ? -14.507 -49.511 -30.945 1.00 44.79  ? 91  TYR A C   1 
ATOM   59   O O   . TYR A 1 8   ? -13.308 -49.728 -30.718 1.00 43.14  ? 91  TYR A O   1 
ATOM   60   C CB  . TYR A 1 8   ? -15.462 -47.159 -31.126 1.00 40.94  ? 91  TYR A CB  1 
ATOM   61   C CG  . TYR A 1 8   ? -14.446 -46.476 -30.218 1.00 38.02  ? 91  TYR A CG  1 
ATOM   62   C CD1 . TYR A 1 8   ? -13.189 -46.121 -30.703 1.00 38.20  ? 91  TYR A CD1 1 
ATOM   63   C CD2 . TYR A 1 8   ? -14.749 -46.151 -28.885 1.00 39.89  ? 91  TYR A CD2 1 
ATOM   64   C CE1 . TYR A 1 8   ? -12.232 -45.488 -29.926 1.00 36.65  ? 91  TYR A CE1 1 
ATOM   65   C CE2 . TYR A 1 8   ? -13.813 -45.488 -28.076 1.00 39.84  ? 91  TYR A CE2 1 
ATOM   66   C CZ  . TYR A 1 8   ? -12.538 -45.169 -28.628 1.00 42.51  ? 91  TYR A CZ  1 
ATOM   67   O OH  . TYR A 1 8   ? -11.540 -44.527 -27.914 1.00 44.08  ? 91  TYR A OH  1 
ATOM   68   N N   . SER A 1 9   ? -15.487 -50.257 -30.446 1.00 43.86  ? 92  SER A N   1 
ATOM   69   C CA  . SER A 1 9   ? -15.192 -51.381 -29.568 1.00 43.76  ? 92  SER A CA  1 
ATOM   70   C C   . SER A 1 9   ? -14.227 -52.361 -30.204 1.00 43.35  ? 92  SER A C   1 
ATOM   71   O O   . SER A 1 9   ? -13.351 -52.872 -29.540 1.00 43.09  ? 92  SER A O   1 
ATOM   72   C CB  . SER A 1 9   ? -16.469 -52.117 -29.175 1.00 44.06  ? 92  SER A CB  1 
ATOM   73   O OG  . SER A 1 9   ? -16.150 -53.366 -28.641 1.00 48.59  ? 92  SER A OG  1 
ATOM   74   N N   . GLU A 1 10  ? -14.398 -52.608 -31.494 1.00 46.84  ? 93  GLU A N   1 
ATOM   75   C CA  . GLU A 1 10  ? -13.532 -53.514 -32.230 1.00 47.55  ? 93  GLU A CA  1 
ATOM   76   C C   . GLU A 1 10  ? -12.173 -52.906 -32.224 1.00 47.26  ? 93  GLU A C   1 
ATOM   77   O O   . GLU A 1 10  ? -11.163 -53.595 -32.155 1.00 52.15  ? 93  GLU A O   1 
ATOM   78   C CB  . GLU A 1 10  ? -13.989 -53.717 -33.681 1.00 49.94  ? 93  GLU A CB  1 
ATOM   79   C CG  . GLU A 1 10  ? -15.099 -54.747 -33.888 1.00 60.22  ? 93  GLU A CG  1 
ATOM   80   C CD  . GLU A 1 10  ? -14.923 -56.032 -33.050 1.00 68.81  ? 93  GLU A CD  1 
ATOM   81   O OE1 . GLU A 1 10  ? -14.413 -57.041 -33.591 1.00 77.47  ? 93  GLU A OE1 1 
ATOM   82   O OE2 . GLU A 1 10  ? -15.277 -56.049 -31.841 1.00 69.89  ? 93  GLU A OE2 1 
ATOM   83   N N   . LYS A 1 11  ? -12.125 -51.597 -32.266 1.00 46.18  ? 94  LYS A N   1 
ATOM   84   C CA  . LYS A 1 11  ? -10.839 -50.997 -32.345 1.00 45.53  ? 94  LYS A CA  1 
ATOM   85   C C   . LYS A 1 11  ? -10.138 -51.042 -30.952 1.00 45.35  ? 94  LYS A C   1 
ATOM   86   O O   . LYS A 1 11  ? -8.954  -51.241 -30.855 1.00 47.96  ? 94  LYS A O   1 
ATOM   87   C CB  . LYS A 1 11  ? -10.994 -49.632 -32.972 1.00 43.29  ? 94  LYS A CB  1 
ATOM   88   C CG  . LYS A 1 11  ? -9.734  -48.862 -33.047 1.00 47.41  ? 94  LYS A CG  1 
ATOM   89   C CD  . LYS A 1 11  ? -9.941  -47.551 -33.757 1.00 51.80  ? 94  LYS A CD  1 
ATOM   90   C CE  . LYS A 1 11  ? -8.586  -46.849 -33.794 1.00 54.04  ? 94  LYS A CE  1 
ATOM   91   N NZ  . LYS A 1 11  ? -8.875  -45.400 -33.965 1.00 59.41  ? 94  LYS A NZ  1 
ATOM   92   N N   . ARG A 1 12  ? -10.879 -50.920 -29.876 1.00 46.59  ? 95  ARG A N   1 
ATOM   93   C CA  . ARG A 1 12  ? -10.293 -51.003 -28.554 1.00 45.22  ? 95  ARG A CA  1 
ATOM   94   C C   . ARG A 1 12  ? -9.987  -52.420 -28.134 1.00 51.91  ? 95  ARG A C   1 
ATOM   95   O O   . ARG A 1 12  ? -9.307  -52.585 -27.130 1.00 50.71  ? 95  ARG A O   1 
ATOM   96   C CB  . ARG A 1 12  ? -11.270 -50.525 -27.505 1.00 46.87  ? 95  ARG A CB  1 
ATOM   97   C CG  . ARG A 1 12  ? -11.452 -49.030 -27.470 1.00 45.68  ? 95  ARG A CG  1 
ATOM   98   C CD  . ARG A 1 12  ? -11.632 -48.507 -26.054 1.00 42.62  ? 95  ARG A CD  1 
ATOM   99   N NE  . ARG A 1 12  ? -10.964 -47.247 -26.198 1.00 51.14  ? 95  ARG A NE  1 
ATOM   100  C CZ  . ARG A 1 12  ? -9.834  -46.879 -25.612 1.00 43.52  ? 95  ARG A CZ  1 
ATOM   101  N NH1 . ARG A 1 12  ? -9.248  -47.644 -24.703 1.00 37.14  ? 95  ARG A NH1 1 
ATOM   102  N NH2 . ARG A 1 12  ? -9.349  -45.680 -25.932 1.00 41.58  ? 95  ARG A NH2 1 
ATOM   103  N N   . LYS A 1 13  ? -10.503 -53.454 -28.813 1.00 50.08  ? 96  LYS A N   1 
ATOM   104  C CA  . LYS A 1 13  ? -10.115 -54.794 -28.391 1.00 49.94  ? 96  LYS A CA  1 
ATOM   105  C C   . LYS A 1 13  ? -8.578  -54.973 -28.521 1.00 48.90  ? 96  LYS A C   1 
ATOM   106  O O   . LYS A 1 13  ? -8.002  -55.949 -28.031 1.00 52.54  ? 96  LYS A O   1 
ATOM   107  C CB  . LYS A 1 13  ? -10.807 -55.881 -29.186 1.00 52.54  ? 96  LYS A CB  1 
ATOM   108  C CG  . LYS A 1 13  ? -12.299 -55.919 -29.105 1.00 62.40  ? 96  LYS A CG  1 
ATOM   109  C CD  . LYS A 1 13  ? -12.844 -56.500 -27.801 1.00 75.09  ? 96  LYS A CD  1 
ATOM   110  C CE  . LYS A 1 13  ? -14.340 -56.841 -27.931 1.00 76.14  ? 96  LYS A CE  1 
ATOM   111  N NZ  . LYS A 1 13  ? -14.986 -57.021 -26.601 1.00 81.48  ? 96  LYS A NZ  1 
ATOM   112  N N   . MET A 1 14  ? -7.919  -54.041 -29.180 1.00 43.61  ? 97  MET A N   1 
ATOM   113  C CA  . MET A 1 14  ? -6.528  -54.208 -29.529 1.00 45.31  ? 97  MET A CA  1 
ATOM   114  C C   . MET A 1 14  ? -5.618  -53.385 -28.658 1.00 41.91  ? 97  MET A C   1 
ATOM   115  O O   . MET A 1 14  ? -4.385  -53.497 -28.750 1.00 41.04  ? 97  MET A O   1 
ATOM   116  C CB  . MET A 1 14  ? -6.321  -53.863 -30.994 1.00 52.39  ? 97  MET A CB  1 
ATOM   117  C CG  . MET A 1 14  ? -7.075  -54.797 -31.951 1.00 64.87  ? 97  MET A CG  1 
ATOM   118  S SD  . MET A 1 14  ? -6.879  -54.408 -33.722 1.00 87.90  ? 97  MET A SD  1 
ATOM   119  C CE  . MET A 1 14  ? -6.862  -52.599 -33.779 1.00 76.98  ? 97  MET A CE  1 
ATOM   120  N N   . VAL A 1 15  ? -6.236  -52.556 -27.820 1.00 35.57  ? 98  VAL A N   1 
ATOM   121  C CA  . VAL A 1 15  ? -5.530  -51.856 -26.794 1.00 36.66  ? 98  VAL A CA  1 
ATOM   122  C C   . VAL A 1 15  ? -4.630  -52.786 -25.984 1.00 37.14  ? 98  VAL A C   1 
ATOM   123  O O   . VAL A 1 15  ? -5.025  -53.858 -25.607 1.00 41.54  ? 98  VAL A O   1 
ATOM   124  C CB  . VAL A 1 15  ? -6.497  -51.025 -25.895 1.00 38.21  ? 98  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 15  ? -5.818  -50.459 -24.630 1.00 31.91  ? 98  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 15  ? -7.078  -49.880 -26.730 1.00 36.48  ? 98  VAL A CG2 1 
ATOM   127  N N   . PHE A 1 16  ? -3.403  -52.352 -25.739 1.00 37.69  ? 99  PHE A N   1 
ATOM   128  C CA  . PHE A 1 16  ? -2.454  -53.110 -24.961 1.00 36.98  ? 99  PHE A CA  1 
ATOM   129  C C   . PHE A 1 16  ? -1.793  -52.324 -23.768 1.00 41.41  ? 99  PHE A C   1 
ATOM   130  O O   . PHE A 1 16  ? -1.964  -51.091 -23.650 1.00 44.85  ? 99  PHE A O   1 
ATOM   131  C CB  . PHE A 1 16  ? -1.443  -53.742 -25.910 1.00 31.44  ? 99  PHE A CB  1 
ATOM   132  C CG  . PHE A 1 16  ? -0.706  -52.773 -26.750 1.00 29.50  ? 99  PHE A CG  1 
ATOM   133  C CD1 . PHE A 1 16  ? 0.316   -52.009 -26.210 1.00 28.50  ? 99  PHE A CD1 1 
ATOM   134  C CD2 . PHE A 1 16  ? -1.034  -52.617 -28.120 1.00 28.16  ? 99  PHE A CD2 1 
ATOM   135  C CE1 . PHE A 1 16  ? 1.025   -51.148 -26.998 1.00 27.22  ? 99  PHE A CE1 1 
ATOM   136  C CE2 . PHE A 1 16  ? -0.334  -51.747 -28.923 1.00 25.89  ? 99  PHE A CE2 1 
ATOM   137  C CZ  . PHE A 1 16  ? 0.703   -51.013 -28.359 1.00 28.89  ? 99  PHE A CZ  1 
ATOM   138  N N   . HIS A 1 17  ? -1.071  -53.023 -22.892 1.00 37.91  ? 100 HIS A N   1 
ATOM   139  C CA  . HIS A 1 17  ? -0.268  -52.351 -21.867 1.00 42.07  ? 100 HIS A CA  1 
ATOM   140  C C   . HIS A 1 17  ? 1.159   -52.828 -21.916 1.00 45.34  ? 100 HIS A C   1 
ATOM   141  O O   . HIS A 1 17  ? 1.418   -54.027 -22.040 1.00 45.13  ? 100 HIS A O   1 
ATOM   142  C CB  . HIS A 1 17  ? -0.807  -52.596 -20.464 1.00 41.38  ? 100 HIS A CB  1 
ATOM   143  C CG  . HIS A 1 17  ? -2.235  -52.220 -20.296 1.00 43.55  ? 100 HIS A CG  1 
ATOM   144  N ND1 . HIS A 1 17  ? -2.621  -51.000 -19.841 1.00 50.71  ? 100 HIS A ND1 1 
ATOM   145  C CD2 . HIS A 1 17  ? -3.397  -52.932 -20.551 1.00 44.94  ? 100 HIS A CD2 1 
ATOM   146  C CE1 . HIS A 1 17  ? -3.971  -50.948 -19.805 1.00 48.45  ? 100 HIS A CE1 1 
ATOM   147  N NE2 . HIS A 1 17  ? -4.443  -52.132 -20.249 1.00 44.54  ? 100 HIS A NE2 1 
ATOM   148  N N   . ILE A 1 18  ? 2.105   -51.901 -21.806 1.00 44.18  ? 101 ILE A N   1 
ATOM   149  C CA  . ILE A 1 18  ? 3.507   -52.275 -21.696 1.00 40.46  ? 101 ILE A CA  1 
ATOM   150  C C   . ILE A 1 18  ? 3.903   -52.173 -20.244 1.00 41.99  ? 101 ILE A C   1 
ATOM   151  O O   . ILE A 1 18  ? 3.829   -51.103 -19.621 1.00 40.55  ? 101 ILE A O   1 
ATOM   152  C CB  . ILE A 1 18  ? 4.393   -51.424 -22.616 1.00 41.96  ? 101 ILE A CB  1 
ATOM   153  C CG1 . ILE A 1 18  ? 3.895   -51.615 -24.064 1.00 37.95  ? 101 ILE A CG1 1 
ATOM   154  C CG2 . ILE A 1 18  ? 5.859   -51.851 -22.469 1.00 38.24  ? 101 ILE A CG2 1 
ATOM   155  C CD1 . ILE A 1 18  ? 4.317   -50.549 -25.032 1.00 37.18  ? 101 ILE A CD1 1 
ATOM   156  N N   . THR A 1 19  ? 4.219   -53.329 -19.686 1.00 41.70  ? 102 THR A N   1 
ATOM   157  C CA  . THR A 1 19  ? 4.644   -53.450 -18.323 1.00 41.83  ? 102 THR A CA  1 
ATOM   158  C C   . THR A 1 19  ? 5.801   -52.431 -18.067 1.00 43.93  ? 102 THR A C   1 
ATOM   159  O O   . THR A 1 19  ? 6.567   -52.075 -18.978 1.00 44.16  ? 102 THR A O   1 
ATOM   160  C CB  . THR A 1 19  ? 5.054   -54.919 -18.018 1.00 42.69  ? 102 THR A CB  1 
ATOM   161  O OG1 . THR A 1 19  ? 5.393   -55.074 -16.639 1.00 47.11  ? 102 THR A OG1 1 
ATOM   162  C CG2 . THR A 1 19  ? 6.260   -55.396 -18.856 1.00 39.83  ? 102 THR A CG2 1 
ATOM   163  N N   . THR A 1 20  ? 5.888   -51.933 -16.839 1.00 44.75  ? 103 THR A N   1 
ATOM   164  C CA  . THR A 1 20  ? 6.903   -50.990 -16.472 1.00 44.64  ? 103 THR A CA  1 
ATOM   165  C C   . THR A 1 20  ? 8.064   -51.760 -15.899 1.00 48.03  ? 103 THR A C   1 
ATOM   166  O O   . THR A 1 20  ? 9.113   -51.186 -15.659 1.00 48.00  ? 103 THR A O   1 
ATOM   167  C CB  . THR A 1 20  ? 6.445   -50.168 -15.297 1.00 44.07  ? 103 THR A CB  1 
ATOM   168  O OG1 . THR A 1 20  ? 6.169   -51.072 -14.232 1.00 48.24  ? 103 THR A OG1 1 
ATOM   169  C CG2 . THR A 1 20  ? 5.222   -49.351 -15.616 1.00 43.48  ? 103 THR A CG2 1 
ATOM   170  N N   . GLY A 1 21  ? 7.862   -53.045 -15.611 1.00 50.30  ? 104 GLY A N   1 
ATOM   171  C CA  . GLY A 1 21  ? 8.871   -53.840 -14.898 1.00 49.89  ? 104 GLY A CA  1 
ATOM   172  C C   . GLY A 1 21  ? 8.631   -53.912 -13.396 1.00 54.58  ? 104 GLY A C   1 
ATOM   173  O O   . GLY A 1 21  ? 9.387   -54.586 -12.668 1.00 54.80  ? 104 GLY A O   1 
ATOM   174  N N   . SER A 1 22  ? 7.609   -53.188 -12.925 1.00 54.29  ? 105 SER A N   1 
ATOM   175  C CA  . SER A 1 22  ? 7.129   -53.304 -11.559 1.00 58.40  ? 105 SER A CA  1 
ATOM   176  C C   . SER A 1 22  ? 5.701   -53.853 -11.514 1.00 59.89  ? 105 SER A C   1 
ATOM   177  O O   . SER A 1 22  ? 4.804   -53.298 -12.121 1.00 59.63  ? 105 SER A O   1 
ATOM   178  C CB  . SER A 1 22  ? 7.186   -51.931 -10.864 1.00 60.28  ? 105 SER A CB  1 
ATOM   179  O OG  . SER A 1 22  ? 6.426   -51.909 -9.647  1.00 63.30  ? 105 SER A OG  1 
ATOM   180  N N   . GLN A 1 23  ? 5.470   -54.914 -10.759 1.00 67.41  ? 106 GLN A N   1 
ATOM   181  C CA  . GLN A 1 23  ? 4.101   -55.380 -10.578 1.00 69.77  ? 106 GLN A CA  1 
ATOM   182  C C   . GLN A 1 23  ? 3.280   -54.363 -9.805  1.00 66.03  ? 106 GLN A C   1 
ATOM   183  O O   . GLN A 1 23  ? 2.090   -54.194 -10.047 1.00 63.50  ? 106 GLN A O   1 
ATOM   184  C CB  . GLN A 1 23  ? 4.062   -56.729 -9.892  1.00 74.14  ? 106 GLN A CB  1 
ATOM   185  C CG  . GLN A 1 23  ? 4.766   -57.813 -10.681 1.00 82.72  ? 106 GLN A CG  1 
ATOM   186  C CD  . GLN A 1 23  ? 5.167   -58.972 -9.782  1.00 91.51  ? 106 GLN A CD  1 
ATOM   187  O OE1 . GLN A 1 23  ? 4.312   -59.594 -9.147  1.00 96.88  ? 106 GLN A OE1 1 
ATOM   188  N NE2 . GLN A 1 23  ? 6.470   -59.253 -9.701  1.00 88.24  ? 106 GLN A NE2 1 
ATOM   189  N N   . GLU A 1 24  ? 3.913   -53.660 -8.888  1.00 65.88  ? 107 GLU A N   1 
ATOM   190  C CA  . GLU A 1 24  ? 3.175   -52.633 -8.172  1.00 66.65  ? 107 GLU A CA  1 
ATOM   191  C C   . GLU A 1 24  ? 2.849   -51.499 -9.124  1.00 60.57  ? 107 GLU A C   1 
ATOM   192  O O   . GLU A 1 24  ? 1.696   -51.134 -9.275  1.00 59.98  ? 107 GLU A O   1 
ATOM   193  C CB  . GLU A 1 24  ? 3.933   -52.141 -6.936  1.00 69.68  ? 107 GLU A CB  1 
ATOM   194  C CG  . GLU A 1 24  ? 4.276   -53.255 -5.987  1.00 77.79  ? 107 GLU A CG  1 
ATOM   195  C CD  . GLU A 1 24  ? 3.101   -53.689 -5.106  1.00 84.75  ? 107 GLU A CD  1 
ATOM   196  O OE1 . GLU A 1 24  ? 3.274   -53.746 -3.853  1.00 94.57  ? 107 GLU A OE1 1 
ATOM   197  O OE2 . GLU A 1 24  ? 2.017   -53.990 -5.647  1.00 80.17  ? 107 GLU A OE2 1 
ATOM   198  N N   . PHE A 1 25  ? 3.864   -50.973 -9.791  1.00 56.40  ? 108 PHE A N   1 
ATOM   199  C CA  . PHE A 1 25  ? 3.646   -49.893 -10.740 1.00 55.35  ? 108 PHE A CA  1 
ATOM   200  C C   . PHE A 1 25  ? 2.582   -50.257 -11.801 1.00 53.78  ? 108 PHE A C   1 
ATOM   201  O O   . PHE A 1 25  ? 1.690   -49.444 -12.123 1.00 53.74  ? 108 PHE A O   1 
ATOM   202  C CB  . PHE A 1 25  ? 4.977   -49.496 -11.387 1.00 52.29  ? 108 PHE A CB  1 
ATOM   203  C CG  . PHE A 1 25  ? 5.020   -48.077 -11.894 1.00 48.28  ? 108 PHE A CG  1 
ATOM   204  C CD1 . PHE A 1 25  ? 6.244   -47.488 -12.229 1.00 47.03  ? 108 PHE A CD1 1 
ATOM   205  C CD2 . PHE A 1 25  ? 3.859   -47.333 -12.048 1.00 46.12  ? 108 PHE A CD2 1 
ATOM   206  C CE1 . PHE A 1 25  ? 6.308   -46.193 -12.721 1.00 42.99  ? 108 PHE A CE1 1 
ATOM   207  C CE2 . PHE A 1 25  ? 3.911   -46.035 -12.530 1.00 44.20  ? 108 PHE A CE2 1 
ATOM   208  C CZ  . PHE A 1 25  ? 5.138   -45.474 -12.873 1.00 42.90  ? 108 PHE A CZ  1 
ATOM   209  N N   . ASP A 1 26  ? 2.642   -51.480 -12.324 1.00 53.93  ? 109 ASP A N   1 
ATOM   210  C CA  . ASP A 1 26  ? 1.660   -51.918 -13.341 1.00 52.20  ? 109 ASP A CA  1 
ATOM   211  C C   . ASP A 1 26  ? 0.220   -51.884 -12.860 1.00 53.88  ? 109 ASP A C   1 
ATOM   212  O O   . ASP A 1 26  ? -0.680  -51.473 -13.599 1.00 50.64  ? 109 ASP A O   1 
ATOM   213  C CB  . ASP A 1 26  ? 1.971   -53.316 -13.833 1.00 51.40  ? 109 ASP A CB  1 
ATOM   214  C CG  . ASP A 1 26  ? 3.208   -53.366 -14.721 1.00 54.57  ? 109 ASP A CG  1 
ATOM   215  O OD1 . ASP A 1 26  ? 3.811   -52.306 -15.069 1.00 48.47  ? 109 ASP A OD1 1 
ATOM   216  O OD2 . ASP A 1 26  ? 3.572   -54.511 -15.066 1.00 57.04  ? 109 ASP A OD2 1 
ATOM   217  N N   . LYS A 1 27  ? 0.012   -52.355 -11.632 1.00 57.06  ? 110 LYS A N   1 
ATOM   218  C CA  . LYS A 1 27  ? -1.317  -52.441 -11.038 1.00 60.27  ? 110 LYS A CA  1 
ATOM   219  C C   . LYS A 1 27  ? -1.923  -51.051 -10.992 1.00 59.51  ? 110 LYS A C   1 
ATOM   220  O O   . LYS A 1 27  ? -3.082  -50.868 -11.323 1.00 56.57  ? 110 LYS A O   1 
ATOM   221  C CB  . LYS A 1 27  ? -1.241  -53.016 -9.615  1.00 65.64  ? 110 LYS A CB  1 
ATOM   222  C CG  . LYS A 1 27  ? -1.823  -54.409 -9.442  1.00 69.08  ? 110 LYS A CG  1 
ATOM   223  C CD  . LYS A 1 27  ? -2.372  -54.574 -8.026  1.00 80.59  ? 110 LYS A CD  1 
ATOM   224  C CE  . LYS A 1 27  ? -3.620  -53.721 -7.762  1.00 83.20  ? 110 LYS A CE  1 
ATOM   225  N NZ  . LYS A 1 27  ? -4.097  -53.867 -6.355  1.00 86.46  ? 110 LYS A NZ  1 
ATOM   226  N N   . LEU A 1 28  ? -1.107  -50.075 -10.605 1.00 60.53  ? 111 LEU A N   1 
ATOM   227  C CA  . LEU A 1 28  ? -1.518  -48.700 -10.548 1.00 61.76  ? 111 LEU A CA  1 
ATOM   228  C C   . LEU A 1 28  ? -2.053  -48.272 -11.891 1.00 60.19  ? 111 LEU A C   1 
ATOM   229  O O   . LEU A 1 28  ? -2.944  -47.456 -11.972 1.00 58.11  ? 111 LEU A O   1 
ATOM   230  C CB  . LEU A 1 28  ? -0.307  -47.844 -10.265 1.00 63.66  ? 111 LEU A CB  1 
ATOM   231  C CG  . LEU A 1 28  ? -0.393  -46.876 -9.103  1.00 71.21  ? 111 LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 28  ? 0.271   -45.545 -9.474  1.00 66.51  ? 111 LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 28  ? -1.851  -46.716 -8.671  1.00 73.24  ? 111 LEU A CD2 1 
ATOM   234  N N   . LEU A 1 29  ? -1.475  -48.825 -12.948 1.00 57.33  ? 112 LEU A N   1 
ATOM   235  C CA  . LEU A 1 29  ? -1.748  -48.391 -14.303 1.00 56.67  ? 112 LEU A CA  1 
ATOM   236  C C   . LEU A 1 29  ? -2.760  -49.295 -15.054 1.00 57.93  ? 112 LEU A C   1 
ATOM   237  O O   . LEU A 1 29  ? -2.990  -49.108 -16.268 1.00 62.51  ? 112 LEU A O   1 
ATOM   238  C CB  . LEU A 1 29  ? -0.416  -48.358 -15.065 1.00 54.36  ? 112 LEU A CB  1 
ATOM   239  C CG  . LEU A 1 29  ? 0.421   -47.090 -15.327 1.00 55.98  ? 112 LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 29  ? 0.121   -45.837 -14.511 1.00 54.10  ? 112 LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 29  ? 1.897   -47.452 -15.249 1.00 55.22  ? 112 LEU A CD2 1 
ATOM   242  N N   . GLY A 1 30  ? -3.336  -50.271 -14.348 1.00 51.86  ? 113 GLY A N   1 
ATOM   243  C CA  . GLY A 1 30  ? -4.242  -51.239 -14.946 1.00 50.98  ? 113 GLY A CA  1 
ATOM   244  C C   . GLY A 1 30  ? -3.559  -52.144 -15.961 1.00 53.64  ? 113 GLY A C   1 
ATOM   245  O O   . GLY A 1 30  ? -4.196  -52.663 -16.888 1.00 53.37  ? 113 GLY A O   1 
ATOM   246  N N   . GLY A 1 31  ? -2.249  -52.323 -15.797 1.00 51.00  ? 114 GLY A N   1 
ATOM   247  C CA  . GLY A 1 31  ? -1.511  -53.269 -16.593 1.00 43.52  ? 114 GLY A CA  1 
ATOM   248  C C   . GLY A 1 31  ? -0.160  -52.744 -17.018 1.00 41.87  ? 114 GLY A C   1 
ATOM   249  O O   . GLY A 1 31  ? 0.691   -53.538 -17.392 1.00 42.28  ? 114 GLY A O   1 
ATOM   250  N N   . GLY A 1 32  ? 0.034   -51.422 -16.963 1.00 39.23  ? 115 GLY A N   1 
ATOM   251  C CA  . GLY A 1 32  ? 1.241   -50.748 -17.474 1.00 38.59  ? 115 GLY A CA  1 
ATOM   252  C C   . GLY A 1 32  ? 0.868   -49.577 -18.399 1.00 39.53  ? 115 GLY A C   1 
ATOM   253  O O   . GLY A 1 32  ? -0.277  -49.159 -18.462 1.00 40.91  ? 115 GLY A O   1 
ATOM   254  N N   . ILE A 1 33  ? 1.837   -49.050 -19.127 1.00 39.27  ? 116 ILE A N   1 
ATOM   255  C CA  . ILE A 1 33  ? 1.638   -47.966 -20.105 1.00 40.22  ? 116 ILE A CA  1 
ATOM   256  C C   . ILE A 1 33  ? 0.628   -48.402 -21.182 1.00 40.16  ? 116 ILE A C   1 
ATOM   257  O O   . ILE A 1 33  ? 0.776   -49.485 -21.757 1.00 38.10  ? 116 ILE A O   1 
ATOM   258  C CB  . ILE A 1 33  ? 3.023   -47.587 -20.752 1.00 39.49  ? 116 ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 33  ? 4.075   -47.295 -19.676 1.00 42.45  ? 116 ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 33  ? 2.961   -46.388 -21.651 1.00 33.93  ? 116 ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 33  ? 3.626   -46.341 -18.574 1.00 41.11  ? 116 ILE A CD1 1 
ATOM   262  N N   . GLU A 1 34  ? -0.392  -47.568 -21.435 1.00 43.63  ? 117 GLU A N   1 
ATOM   263  C CA  . GLU A 1 34  ? -1.521  -47.950 -22.297 1.00 43.55  ? 117 GLU A CA  1 
ATOM   264  C C   . GLU A 1 34  ? -1.464  -47.354 -23.724 1.00 44.01  ? 117 GLU A C   1 
ATOM   265  O O   . GLU A 1 34  ? -1.200  -46.179 -23.903 1.00 46.25  ? 117 GLU A O   1 
ATOM   266  C CB  . GLU A 1 34  ? -2.833  -47.585 -21.640 1.00 43.38  ? 117 GLU A CB  1 
ATOM   267  C CG  . GLU A 1 34  ? -4.040  -48.247 -22.256 1.00 49.50  ? 117 GLU A CG  1 
ATOM   268  C CD  . GLU A 1 34  ? -5.382  -47.745 -21.719 1.00 59.37  ? 117 GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 34  ? -5.660  -47.881 -20.519 1.00 71.42  ? 117 GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 34  ? -6.197  -47.215 -22.504 1.00 71.46  ? 117 GLU A OE2 1 
ATOM   271  N N   . SER A 1 35  ? -1.711  -48.194 -24.717 1.00 38.60  ? 118 SER A N   1 
ATOM   272  C CA  . SER A 1 35  ? -2.040  -47.801 -26.073 1.00 39.02  ? 118 SER A CA  1 
ATOM   273  C C   . SER A 1 35  ? -3.143  -46.786 -26.203 1.00 38.88  ? 118 SER A C   1 
ATOM   274  O O   . SER A 1 35  ? -4.059  -46.785 -25.415 1.00 37.67  ? 118 SER A O   1 
ATOM   275  C CB  . SER A 1 35  ? -2.646  -49.029 -26.748 1.00 43.41  ? 118 SER A CB  1 
ATOM   276  O OG  . SER A 1 35  ? -1.613  -49.570 -27.442 1.00 47.75  ? 118 SER A OG  1 
ATOM   277  N N   . MET A 1 36  ? -3.131  -46.023 -27.296 1.00 38.94  ? 119 MET A N   1 
ATOM   278  C CA  . MET A 1 36  ? -4.248  -45.151 -27.646 1.00 35.87  ? 119 MET A CA  1 
ATOM   279  C C   . MET A 1 36  ? -4.339  -44.076 -26.593 1.00 33.55  ? 119 MET A C   1 
ATOM   280  O O   . MET A 1 36  ? -5.364  -43.436 -26.437 1.00 35.19  ? 119 MET A O   1 
ATOM   281  C CB  . MET A 1 36  ? -5.571  -45.946 -27.769 1.00 32.54  ? 119 MET A CB  1 
ATOM   282  C CG  . MET A 1 36  ? -5.618  -46.819 -28.995 1.00 35.28  ? 119 MET A CG  1 
ATOM   283  S SD  . MET A 1 36  ? -7.267  -47.424 -29.409 1.00 42.39  ? 119 MET A SD  1 
ATOM   284  C CE  . MET A 1 36  ? -8.134  -46.019 -30.132 1.00 37.81  ? 119 MET A CE  1 
ATOM   285  N N   . ALA A 1 37  ? -3.260  -43.882 -25.867 1.00 30.95  ? 120 ALA A N   1 
ATOM   286  C CA  . ALA A 1 37  ? -3.236  -42.874 -24.826 1.00 33.92  ? 120 ALA A CA  1 
ATOM   287  C C   . ALA A 1 37  ? -1.845  -42.267 -24.642 1.00 36.47  ? 120 ALA A C   1 
ATOM   288  O O   . ALA A 1 37  ? -0.846  -42.856 -25.038 1.00 40.66  ? 120 ALA A O   1 
ATOM   289  C CB  . ALA A 1 37  ? -3.710  -43.480 -23.538 1.00 31.50  ? 120 ALA A CB  1 
ATOM   290  N N   . ILE A 1 38  ? -1.775  -41.087 -24.048 1.00 39.17  ? 121 ILE A N   1 
ATOM   291  C CA  . ILE A 1 38  ? -0.521  -40.535 -23.587 1.00 37.58  ? 121 ILE A CA  1 
ATOM   292  C C   . ILE A 1 38  ? -0.378  -40.693 -22.084 1.00 39.08  ? 121 ILE A C   1 
ATOM   293  O O   . ILE A 1 38  ? -1.209  -40.264 -21.295 1.00 44.67  ? 121 ILE A O   1 
ATOM   294  C CB  . ILE A 1 38  ? -0.479  -39.071 -23.974 1.00 42.67  ? 121 ILE A CB  1 
ATOM   295  C CG1 . ILE A 1 38  ? -0.610  -38.966 -25.509 1.00 43.55  ? 121 ILE A CG1 1 
ATOM   296  C CG2 . ILE A 1 38  ? 0.788   -38.429 -23.447 1.00 41.79  ? 121 ILE A CG2 1 
ATOM   297  C CD1 . ILE A 1 38  ? -0.566  -37.560 -26.064 1.00 44.13  ? 121 ILE A CD1 1 
ATOM   298  N N   . THR A 1 39  ? 0.674   -41.344 -21.657 1.00 41.64  ? 122 THR A N   1 
ATOM   299  C CA  . THR A 1 39  ? 0.949   -41.411 -20.233 1.00 42.60  ? 122 THR A CA  1 
ATOM   300  C C   . THR A 1 39  ? 2.101   -40.458 -19.976 1.00 46.12  ? 122 THR A C   1 
ATOM   301  O O   . THR A 1 39  ? 3.092   -40.450 -20.719 1.00 50.54  ? 122 THR A O   1 
ATOM   302  C CB  . THR A 1 39  ? 1.330   -42.834 -19.828 1.00 43.67  ? 122 THR A CB  1 
ATOM   303  O OG1 . THR A 1 39  ? 0.240   -43.708 -20.161 1.00 49.76  ? 122 THR A OG1 1 
ATOM   304  C CG2 . THR A 1 39  ? 1.631   -42.921 -18.305 1.00 42.89  ? 122 THR A CG2 1 
ATOM   305  N N   . GLU A 1 40  ? 1.965   -39.630 -18.958 1.00 45.71  ? 123 GLU A N   1 
ATOM   306  C CA  . GLU A 1 40  ? 2.979   -38.664 -18.648 1.00 45.94  ? 123 GLU A CA  1 
ATOM   307  C C   . GLU A 1 40  ? 3.526   -38.942 -17.233 1.00 49.77  ? 123 GLU A C   1 
ATOM   308  O O   . GLU A 1 40  ? 2.750   -39.101 -16.259 1.00 46.23  ? 123 GLU A O   1 
ATOM   309  C CB  . GLU A 1 40  ? 2.372   -37.278 -18.710 1.00 48.05  ? 123 GLU A CB  1 
ATOM   310  C CG  . GLU A 1 40  ? 3.134   -36.255 -17.841 1.00 54.93  ? 123 GLU A CG  1 
ATOM   311  C CD  . GLU A 1 40  ? 2.467   -34.871 -17.737 1.00 57.75  ? 123 GLU A CD  1 
ATOM   312  O OE1 . GLU A 1 40  ? 1.243   -34.685 -18.041 1.00 57.59  ? 123 GLU A OE1 1 
ATOM   313  O OE2 . GLU A 1 40  ? 3.200   -33.939 -17.350 1.00 60.38  ? 123 GLU A OE2 1 
ATOM   314  N N   . ALA A 1 41  ? 4.851   -39.030 -17.122 1.00 47.45  ? 124 ALA A N   1 
ATOM   315  C CA  . ALA A 1 41  ? 5.483   -39.126 -15.808 1.00 47.25  ? 124 ALA A CA  1 
ATOM   316  C C   . ALA A 1 41  ? 6.245   -37.863 -15.581 1.00 52.00  ? 124 ALA A C   1 
ATOM   317  O O   . ALA A 1 41  ? 7.045   -37.415 -16.446 1.00 51.47  ? 124 ALA A O   1 
ATOM   318  C CB  . ALA A 1 41  ? 6.438   -40.292 -15.746 1.00 44.10  ? 124 ALA A CB  1 
ATOM   319  N N   . PHE A 1 42  ? 6.010   -37.281 -14.420 1.00 54.97  ? 125 PHE A N   1 
ATOM   320  C CA  . PHE A 1 42  ? 6.771   -36.127 -14.013 1.00 61.22  ? 125 PHE A CA  1 
ATOM   321  C C   . PHE A 1 42  ? 7.216   -36.326 -12.602 1.00 68.43  ? 125 PHE A C   1 
ATOM   322  O O   . PHE A 1 42  ? 6.626   -37.104 -11.852 1.00 76.04  ? 125 PHE A O   1 
ATOM   323  C CB  . PHE A 1 42  ? 5.959   -34.842 -14.137 1.00 59.10  ? 125 PHE A CB  1 
ATOM   324  C CG  . PHE A 1 42  ? 4.698   -34.843 -13.356 1.00 58.69  ? 125 PHE A CG  1 
ATOM   325  C CD1 . PHE A 1 42  ? 3.488   -35.135 -13.983 1.00 58.80  ? 125 PHE A CD1 1 
ATOM   326  C CD2 . PHE A 1 42  ? 4.704   -34.531 -11.990 1.00 61.54  ? 125 PHE A CD2 1 
ATOM   327  C CE1 . PHE A 1 42  ? 2.305   -35.133 -13.270 1.00 59.69  ? 125 PHE A CE1 1 
ATOM   328  C CE2 . PHE A 1 42  ? 3.527   -34.522 -11.260 1.00 62.63  ? 125 PHE A CE2 1 
ATOM   329  C CZ  . PHE A 1 42  ? 2.321   -34.812 -11.901 1.00 64.64  ? 125 PHE A CZ  1 
ATOM   330  N N   . GLY A 1 43  ? 8.252   -35.606 -12.235 1.00 70.55  ? 126 GLY A N   1 
ATOM   331  C CA  . GLY A 1 43  ? 8.910   -35.897 -11.016 1.00 76.25  ? 126 GLY A CA  1 
ATOM   332  C C   . GLY A 1 43  ? 10.011  -34.899 -10.855 1.00 89.82  ? 126 GLY A C   1 
ATOM   333  O O   . GLY A 1 43  ? 10.294  -34.104 -11.761 1.00 88.54  ? 126 GLY A O   1 
ATOM   334  N N   . GLU A 1 44  ? 10.605  -34.946 -9.670  1.00 101.81 ? 127 GLU A N   1 
ATOM   335  C CA  . GLU A 1 44  ? 11.814  -34.229 -9.349  1.00 109.85 ? 127 GLU A CA  1 
ATOM   336  C C   . GLU A 1 44  ? 12.929  -34.733 -10.270 1.00 113.32 ? 127 GLU A C   1 
ATOM   337  O O   . GLU A 1 44  ? 12.752  -35.678 -11.066 1.00 109.55 ? 127 GLU A O   1 
ATOM   338  C CB  . GLU A 1 44  ? 12.188  -34.516 -7.883  1.00 113.76 ? 127 GLU A CB  1 
ATOM   339  C CG  . GLU A 1 44  ? 12.629  -33.318 -7.040  1.00 117.21 ? 127 GLU A CG  1 
ATOM   340  C CD  . GLU A 1 44  ? 13.192  -33.719 -5.667  1.00 122.02 ? 127 GLU A CD  1 
ATOM   341  O OE1 . GLU A 1 44  ? 13.240  -34.932 -5.343  1.00 119.16 ? 127 GLU A OE1 1 
ATOM   342  O OE2 . GLU A 1 44  ? 13.599  -32.816 -4.899  1.00 121.28 ? 127 GLU A OE2 1 
ATOM   343  N N   . PHE A 1 45  ? 14.075  -34.075 -10.157 1.00 114.67 ? 128 PHE A N   1 
ATOM   344  C CA  . PHE A 1 45  ? 15.338  -34.594 -10.644 1.00 109.02 ? 128 PHE A CA  1 
ATOM   345  C C   . PHE A 1 45  ? 15.515  -36.006 -10.033 1.00 98.32  ? 128 PHE A C   1 
ATOM   346  O O   . PHE A 1 45  ? 14.845  -36.339 -9.061  1.00 103.31 ? 128 PHE A O   1 
ATOM   347  C CB  . PHE A 1 45  ? 16.483  -33.633 -10.215 1.00 120.15 ? 128 PHE A CB  1 
ATOM   348  C CG  . PHE A 1 45  ? 16.020  -32.364 -9.483  1.00 137.25 ? 128 PHE A CG  1 
ATOM   349  C CD1 . PHE A 1 45  ? 15.124  -31.455 -10.071 1.00 136.29 ? 128 PHE A CD1 1 
ATOM   350  C CD2 . PHE A 1 45  ? 16.512  -32.064 -8.197  1.00 145.52 ? 128 PHE A CD2 1 
ATOM   351  C CE1 . PHE A 1 45  ? 14.721  -30.306 -9.387  1.00 143.37 ? 128 PHE A CE1 1 
ATOM   352  C CE2 . PHE A 1 45  ? 16.115  -30.908 -7.517  1.00 146.62 ? 128 PHE A CE2 1 
ATOM   353  C CZ  . PHE A 1 45  ? 15.221  -30.029 -8.112  1.00 148.18 ? 128 PHE A CZ  1 
ATOM   354  N N   . ARG A 1 46  ? 16.376  -36.846 -10.601 1.00 91.09  ? 129 ARG A N   1 
ATOM   355  C CA  . ARG A 1 46  ? 16.808  -38.103 -9.937  1.00 89.21  ? 129 ARG A CA  1 
ATOM   356  C C   . ARG A 1 46  ? 15.690  -39.152 -9.735  1.00 85.29  ? 129 ARG A C   1 
ATOM   357  O O   . ARG A 1 46  ? 15.956  -40.323 -9.432  1.00 78.13  ? 129 ARG A O   1 
ATOM   358  C CB  . ARG A 1 46  ? 17.557  -37.835 -8.601  1.00 102.25 ? 129 ARG A CB  1 
ATOM   359  C CG  . ARG A 1 46  ? 18.604  -36.695 -8.571  1.00 110.02 ? 129 ARG A CG  1 
ATOM   360  C CD  . ARG A 1 46  ? 19.870  -36.945 -9.397  1.00 108.95 ? 129 ARG A CD  1 
ATOM   361  N NE  . ARG A 1 46  ? 19.631  -36.742 -10.832 1.00 109.76 ? 129 ARG A NE  1 
ATOM   362  C CZ  . ARG A 1 46  ? 20.354  -37.276 -11.820 1.00 110.13 ? 129 ARG A CZ  1 
ATOM   363  N NH1 . ARG A 1 46  ? 21.396  -38.066 -11.560 1.00 112.74 ? 129 ARG A NH1 1 
ATOM   364  N NH2 . ARG A 1 46  ? 20.028  -37.022 -13.081 1.00 100.83 ? 129 ARG A NH2 1 
ATOM   365  N N   . THR A 1 47  ? 14.439  -38.735 -9.913  1.00 83.09  ? 130 THR A N   1 
ATOM   366  C CA  . THR A 1 47  ? 13.338  -39.688 -9.989  1.00 83.07  ? 130 THR A CA  1 
ATOM   367  C C   . THR A 1 47  ? 13.346  -40.494 -11.303 1.00 89.51  ? 130 THR A C   1 
ATOM   368  O O   . THR A 1 47  ? 13.954  -40.086 -12.347 1.00 106.74 ? 130 THR A O   1 
ATOM   369  C CB  . THR A 1 47  ? 11.964  -39.039 -9.841  1.00 78.68  ? 130 THR A CB  1 
ATOM   370  O OG1 . THR A 1 47  ? 11.957  -38.145 -8.717  1.00 78.62  ? 130 THR A OG1 1 
ATOM   371  C CG2 . THR A 1 47  ? 10.980  -40.131 -9.606  1.00 78.66  ? 130 THR A CG2 1 
ATOM   372  N N   . GLY A 1 48  ? 12.656  -41.630 -11.257 1.00 76.14  ? 131 GLY A N   1 
ATOM   373  C CA  . GLY A 1 48  ? 12.741  -42.600 -12.338 1.00 68.03  ? 131 GLY A CA  1 
ATOM   374  C C   . GLY A 1 48  ? 12.356  -42.204 -13.748 1.00 59.30  ? 131 GLY A C   1 
ATOM   375  O O   . GLY A 1 48  ? 12.265  -43.077 -14.586 1.00 59.22  ? 131 GLY A O   1 
ATOM   376  N N   . LYS A 1 49  ? 12.125  -40.927 -14.043 1.00 57.09  ? 132 LYS A N   1 
ATOM   377  C CA  . LYS A 1 49  ? 11.600  -40.576 -15.373 1.00 54.41  ? 132 LYS A CA  1 
ATOM   378  C C   . LYS A 1 49  ? 12.432  -41.269 -16.434 1.00 54.52  ? 132 LYS A C   1 
ATOM   379  O O   . LYS A 1 49  ? 11.909  -42.018 -17.278 1.00 53.47  ? 132 LYS A O   1 
ATOM   380  C CB  . LYS A 1 49  ? 11.591  -39.074 -15.637 1.00 52.09  ? 132 LYS A CB  1 
ATOM   381  C CG  . LYS A 1 49  ? 10.698  -38.272 -14.711 1.00 51.43  ? 132 LYS A CG  1 
ATOM   382  C CD  . LYS A 1 49  ? 10.937  -36.771 -14.851 1.00 56.92  ? 132 LYS A CD  1 
ATOM   383  C CE  . LYS A 1 49  ? 12.273  -36.347 -14.239 1.00 59.89  ? 132 LYS A CE  1 
ATOM   384  N NZ  . LYS A 1 49  ? 12.453  -34.897 -14.432 1.00 62.01  ? 132 LYS A NZ  1 
ATOM   385  N N   . THR A 1 50  ? 13.743  -41.075 -16.353 1.00 56.30  ? 133 THR A N   1 
ATOM   386  C CA  . THR A 1 50  ? 14.637  -41.590 -17.378 1.00 56.90  ? 133 THR A CA  1 
ATOM   387  C C   . THR A 1 50  ? 14.891  -43.115 -17.277 1.00 51.97  ? 133 THR A C   1 
ATOM   388  O O   . THR A 1 50  ? 14.968  -43.818 -18.273 1.00 51.34  ? 133 THR A O   1 
ATOM   389  C CB  . THR A 1 50  ? 15.905  -40.730 -17.429 1.00 62.00  ? 133 THR A CB  1 
ATOM   390  O OG1 . THR A 1 50  ? 15.579  -39.468 -18.058 1.00 61.34  ? 133 THR A OG1 1 
ATOM   391  C CG2 . THR A 1 50  ? 17.001  -41.433 -18.219 1.00 62.05  ? 133 THR A CG2 1 
ATOM   392  N N   . GLN A 1 51  ? 14.954  -43.617 -16.067 1.00 50.76  ? 134 GLN A N   1 
ATOM   393  C CA  . GLN A 1 51  ? 15.039  -45.025 -15.822 1.00 51.22  ? 134 GLN A CA  1 
ATOM   394  C C   . GLN A 1 51  ? 13.860  -45.764 -16.375 1.00 50.41  ? 134 GLN A C   1 
ATOM   395  O O   . GLN A 1 51  ? 13.997  -46.889 -16.888 1.00 48.94  ? 134 GLN A O   1 
ATOM   396  C CB  . GLN A 1 51  ? 15.109  -45.252 -14.314 1.00 60.11  ? 134 GLN A CB  1 
ATOM   397  C CG  . GLN A 1 51  ? 16.498  -45.027 -13.760 1.00 71.76  ? 134 GLN A CG  1 
ATOM   398  C CD  . GLN A 1 51  ? 17.517  -45.949 -14.432 1.00 85.38  ? 134 GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 51  ? 18.288  -45.521 -15.320 1.00 84.16  ? 134 GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 51  ? 17.496  -47.241 -14.044 1.00 90.90  ? 134 GLN A NE2 1 
ATOM   401  N N   . LEU A 1 52  ? 12.687  -45.151 -16.240 1.00 49.61  ? 135 LEU A N   1 
ATOM   402  C CA  . LEU A 1 52  ? 11.470  -45.728 -16.779 1.00 50.53  ? 135 LEU A CA  1 
ATOM   403  C C   . LEU A 1 52  ? 11.562  -45.734 -18.299 1.00 49.75  ? 135 LEU A C   1 
ATOM   404  O O   . LEU A 1 52  ? 11.219  -46.714 -18.955 1.00 56.26  ? 135 LEU A O   1 
ATOM   405  C CB  . LEU A 1 52  ? 10.240  -44.943 -16.340 1.00 49.17  ? 135 LEU A CB  1 
ATOM   406  C CG  . LEU A 1 52  ? 8.926   -45.678 -15.987 1.00 50.30  ? 135 LEU A CG  1 
ATOM   407  C CD1 . LEU A 1 52  ? 7.777   -44.678 -15.998 1.00 46.13  ? 135 LEU A CD1 1 
ATOM   408  C CD2 . LEU A 1 52  ? 8.550   -46.877 -16.843 1.00 45.56  ? 135 LEU A CD2 1 
ATOM   409  N N   . SER A 1 53  ? 12.040  -44.642 -18.862 1.00 48.73  ? 136 SER A N   1 
ATOM   410  C CA  . SER A 1 53  ? 12.174  -44.561 -20.307 1.00 46.57  ? 136 SER A CA  1 
ATOM   411  C C   . SER A 1 53  ? 13.055  -45.679 -20.802 1.00 45.87  ? 136 SER A C   1 
ATOM   412  O O   . SER A 1 53  ? 12.684  -46.350 -21.747 1.00 51.91  ? 136 SER A O   1 
ATOM   413  C CB  . SER A 1 53  ? 12.735  -43.210 -20.717 1.00 46.98  ? 136 SER A CB  1 
ATOM   414  O OG  . SER A 1 53  ? 11.939  -42.172 -20.168 1.00 49.79  ? 136 SER A OG  1 
ATOM   415  N N   . HIS A 1 54  ? 14.198  -45.913 -20.160 1.00 43.56  ? 137 HIS A N   1 
ATOM   416  C CA  . HIS A 1 54  ? 15.098  -46.952 -20.655 1.00 44.35  ? 137 HIS A CA  1 
ATOM   417  C C   . HIS A 1 54  ? 14.462  -48.287 -20.520 1.00 45.18  ? 137 HIS A C   1 
ATOM   418  O O   . HIS A 1 54  ? 14.583  -49.136 -21.372 1.00 49.57  ? 137 HIS A O   1 
ATOM   419  C CB  . HIS A 1 54  ? 16.471  -46.920 -20.001 1.00 43.34  ? 137 HIS A CB  1 
ATOM   420  C CG  . HIS A 1 54  ? 17.333  -45.794 -20.469 1.00 46.71  ? 137 HIS A CG  1 
ATOM   421  N ND1 . HIS A 1 54  ? 17.220  -44.559 -19.985 1.00 51.66  ? 137 HIS A ND1 1 
ATOM   422  C CD2 . HIS A 1 54  ? 18.336  -45.741 -21.435 1.00 54.86  ? 137 HIS A CD2 1 
ATOM   423  C CE1 . HIS A 1 54  ? 18.114  -43.737 -20.592 1.00 52.19  ? 137 HIS A CE1 1 
ATOM   424  N NE2 . HIS A 1 54  ? 18.799  -44.457 -21.475 1.00 55.95  ? 137 HIS A NE2 1 
ATOM   425  N N   . THR A 1 55  ? 13.735  -48.475 -19.451 1.00 47.12  ? 138 THR A N   1 
ATOM   426  C CA  . THR A 1 55  ? 13.179  -49.775 -19.170 1.00 48.52  ? 138 THR A CA  1 
ATOM   427  C C   . THR A 1 55  ? 12.192  -50.139 -20.260 1.00 45.85  ? 138 THR A C   1 
ATOM   428  O O   . THR A 1 55  ? 12.219  -51.259 -20.808 1.00 46.26  ? 138 THR A O   1 
ATOM   429  C CB  . THR A 1 55  ? 12.519  -49.799 -17.777 1.00 46.99  ? 138 THR A CB  1 
ATOM   430  O OG1 . THR A 1 55  ? 13.539  -49.581 -16.776 1.00 44.68  ? 138 THR A OG1 1 
ATOM   431  C CG2 . THR A 1 55  ? 11.867  -51.112 -17.564 1.00 44.26  ? 138 THR A CG2 1 
ATOM   432  N N   . LEU A 1 56  ? 11.346  -49.177 -20.595 1.00 44.48  ? 139 LEU A N   1 
ATOM   433  C CA  . LEU A 1 56  ? 10.290  -49.429 -21.567 1.00 41.49  ? 139 LEU A CA  1 
ATOM   434  C C   . LEU A 1 56  ? 10.913  -49.755 -22.926 1.00 41.16  ? 139 LEU A C   1 
ATOM   435  O O   . LEU A 1 56  ? 10.321  -50.491 -23.704 1.00 38.74  ? 139 LEU A O   1 
ATOM   436  C CB  . LEU A 1 56  ? 9.318   -48.248 -21.648 1.00 39.54  ? 139 LEU A CB  1 
ATOM   437  C CG  . LEU A 1 56  ? 8.517   -47.867 -20.396 1.00 38.35  ? 139 LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 56  ? 7.824   -46.530 -20.601 1.00 37.91  ? 139 LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 56  ? 7.487   -48.936 -20.077 1.00 38.42  ? 139 LEU A CD2 1 
ATOM   440  N N   . CYS A 1 57  ? 12.112  -49.230 -23.200 1.00 37.11  ? 140 CYS A N   1 
ATOM   441  C CA  . CYS A 1 57  ? 12.789  -49.570 -24.445 1.00 38.14  ? 140 CYS A CA  1 
ATOM   442  C C   . CYS A 1 57  ? 12.948  -51.075 -24.574 1.00 41.31  ? 140 CYS A C   1 
ATOM   443  O O   . CYS A 1 57  ? 13.039  -51.615 -25.682 1.00 46.12  ? 140 CYS A O   1 
ATOM   444  C CB  . CYS A 1 57  ? 14.154  -48.897 -24.531 1.00 37.02  ? 140 CYS A CB  1 
ATOM   445  S SG  . CYS A 1 57  ? 14.028  -47.122 -24.900 1.00 38.56  ? 140 CYS A SG  1 
ATOM   446  N N   . VAL A 1 58  ? 12.937  -51.773 -23.449 1.00 40.00  ? 141 VAL A N   1 
ATOM   447  C CA  . VAL A 1 58  ? 13.113  -53.205 -23.496 1.00 41.48  ? 141 VAL A CA  1 
ATOM   448  C C   . VAL A 1 58  ? 11.798  -53.907 -23.286 1.00 41.71  ? 141 VAL A C   1 
ATOM   449  O O   . VAL A 1 58  ? 11.464  -54.838 -24.020 1.00 43.55  ? 141 VAL A O   1 
ATOM   450  C CB  . VAL A 1 58  ? 14.124  -53.676 -22.434 1.00 45.42  ? 141 VAL A CB  1 
ATOM   451  C CG1 . VAL A 1 58  ? 14.220  -55.191 -22.403 1.00 42.38  ? 141 VAL A CG1 1 
ATOM   452  C CG2 . VAL A 1 58  ? 15.496  -53.045 -22.698 1.00 44.41  ? 141 VAL A CG2 1 
ATOM   453  N N   . THR A 1 59  ? 11.037  -53.470 -22.294 1.00 39.37  ? 142 THR A N   1 
ATOM   454  C CA  . THR A 1 59  ? 9.801   -54.194 -21.987 1.00 38.29  ? 142 THR A CA  1 
ATOM   455  C C   . THR A 1 59  ? 8.805   -54.068 -23.087 1.00 36.99  ? 142 THR A C   1 
ATOM   456  O O   . THR A 1 59  ? 7.950   -54.976 -23.256 1.00 41.37  ? 142 THR A O   1 
ATOM   457  C CB  . THR A 1 59  ? 9.131   -53.790 -20.668 1.00 36.32  ? 142 THR A CB  1 
ATOM   458  O OG1 . THR A 1 59  ? 8.918   -52.380 -20.680 1.00 34.09  ? 142 THR A OG1 1 
ATOM   459  C CG2 . THR A 1 59  ? 10.003  -54.174 -19.495 1.00 36.72  ? 142 THR A CG2 1 
ATOM   460  N N   . ALA A 1 60  ? 8.889   -52.993 -23.853 1.00 32.62  ? 143 ALA A N   1 
ATOM   461  C CA  . ALA A 1 60  ? 7.999   -52.925 -25.033 1.00 35.35  ? 143 ALA A CA  1 
ATOM   462  C C   . ALA A 1 60  ? 8.287   -54.011 -26.091 1.00 36.88  ? 143 ALA A C   1 
ATOM   463  O O   . ALA A 1 60  ? 7.442   -54.273 -26.983 1.00 35.55  ? 143 ALA A O   1 
ATOM   464  C CB  . ALA A 1 60  ? 8.006   -51.552 -25.676 1.00 32.96  ? 143 ALA A CB  1 
ATOM   465  N N   . GLN A 1 61  ? 9.485   -54.604 -26.006 1.00 36.58  ? 144 GLN A N   1 
ATOM   466  C CA  . GLN A 1 61  ? 9.880   -55.622 -26.935 1.00 35.63  ? 144 GLN A CA  1 
ATOM   467  C C   . GLN A 1 61  ? 9.428   -56.984 -26.450 1.00 37.28  ? 144 GLN A C   1 
ATOM   468  O O   . GLN A 1 61  ? 9.372   -57.905 -27.208 1.00 37.34  ? 144 GLN A O   1 
ATOM   469  C CB  . GLN A 1 61  ? 11.373  -55.604 -27.142 1.00 36.24  ? 144 GLN A CB  1 
ATOM   470  C CG  . GLN A 1 61  ? 11.904  -54.220 -27.450 1.00 42.21  ? 144 GLN A CG  1 
ATOM   471  C CD  . GLN A 1 61  ? 13.294  -54.213 -28.117 1.00 44.08  ? 144 GLN A CD  1 
ATOM   472  O OE1 . GLN A 1 61  ? 13.623  -55.122 -28.870 1.00 47.50  ? 144 GLN A OE1 1 
ATOM   473  N NE2 . GLN A 1 61  ? 14.089  -53.173 -27.858 1.00 40.18  ? 144 GLN A NE2 1 
ATOM   474  N N   . LEU A 1 62  ? 9.113   -57.125 -25.176 1.00 40.65  ? 145 LEU A N   1 
ATOM   475  C CA  . LEU A 1 62  ? 8.829   -58.456 -24.601 1.00 41.17  ? 145 LEU A CA  1 
ATOM   476  C C   . LEU A 1 62  ? 7.417   -58.979 -24.863 1.00 41.33  ? 145 LEU A C   1 
ATOM   477  O O   . LEU A 1 62  ? 6.418   -58.223 -24.756 1.00 41.31  ? 145 LEU A O   1 
ATOM   478  C CB  . LEU A 1 62  ? 8.978   -58.314 -23.111 1.00 43.50  ? 145 LEU A CB  1 
ATOM   479  C CG  . LEU A 1 62  ? 10.389  -58.551 -22.606 1.00 45.81  ? 145 LEU A CG  1 
ATOM   480  C CD1 . LEU A 1 62  ? 11.432  -58.573 -23.721 1.00 43.15  ? 145 LEU A CD1 1 
ATOM   481  C CD2 . LEU A 1 62  ? 10.675  -57.561 -21.496 1.00 46.39  ? 145 LEU A CD2 1 
ATOM   482  N N   . PRO A 1 63  ? 7.283   -60.260 -25.216 1.00 41.99  ? 146 PRO A N   1 
ATOM   483  C CA  . PRO A 1 63  ? 5.838   -60.647 -25.238 1.00 42.61  ? 146 PRO A CA  1 
ATOM   484  C C   . PRO A 1 63  ? 5.205   -60.492 -23.822 1.00 44.13  ? 146 PRO A C   1 
ATOM   485  O O   . PRO A 1 63  ? 5.869   -60.766 -22.816 1.00 47.78  ? 146 PRO A O   1 
ATOM   486  C CB  . PRO A 1 63  ? 5.855   -62.108 -25.752 1.00 40.15  ? 146 PRO A CB  1 
ATOM   487  C CG  . PRO A 1 63  ? 7.297   -62.488 -25.941 1.00 38.73  ? 146 PRO A CG  1 
ATOM   488  C CD  . PRO A 1 63  ? 8.155   -61.261 -25.862 1.00 40.34  ? 146 PRO A CD  1 
ATOM   489  N N   . GLY A 1 64  ? 3.972   -60.013 -23.736 1.00 45.72  ? 147 GLY A N   1 
ATOM   490  C CA  . GLY A 1 64  ? 3.405   -59.600 -22.428 1.00 48.89  ? 147 GLY A CA  1 
ATOM   491  C C   . GLY A 1 64  ? 1.987   -60.075 -22.108 1.00 52.72  ? 147 GLY A C   1 
ATOM   492  O O   . GLY A 1 64  ? 1.467   -60.973 -22.775 1.00 58.17  ? 147 GLY A O   1 
ATOM   493  N N   . ALA A 1 65  ? 1.383   -59.505 -21.062 1.00 50.53  ? 148 ALA A N   1 
ATOM   494  C CA  . ALA A 1 65  ? 0.012   -59.828 -20.647 1.00 50.21  ? 148 ALA A CA  1 
ATOM   495  C C   . ALA A 1 65  ? -0.946  -59.456 -21.760 1.00 49.84  ? 148 ALA A C   1 
ATOM   496  O O   . ALA A 1 65  ? -0.553  -58.740 -22.664 1.00 51.84  ? 148 ALA A O   1 
ATOM   497  C CB  . ALA A 1 65  ? -0.372  -59.098 -19.367 1.00 47.23  ? 148 ALA A CB  1 
ATOM   498  N N   . GLY A 1 66  ? -2.173  -59.988 -21.732 1.00 49.50  ? 149 GLY A N   1 
ATOM   499  C CA  . GLY A 1 66  ? -3.226  -59.521 -22.625 1.00 46.62  ? 149 GLY A CA  1 
ATOM   500  C C   . GLY A 1 66  ? -3.103  -59.875 -24.099 1.00 48.14  ? 149 GLY A C   1 
ATOM   501  O O   . GLY A 1 66  ? -3.897  -59.418 -24.911 1.00 47.25  ? 149 GLY A O   1 
ATOM   502  N N   . GLY A 1 67  ? -2.125  -60.703 -24.445 1.00 49.48  ? 150 GLY A N   1 
ATOM   503  C CA  . GLY A 1 67  ? -1.886  -61.063 -25.829 1.00 48.09  ? 150 GLY A CA  1 
ATOM   504  C C   . GLY A 1 67  ? -0.832  -60.200 -26.504 1.00 47.05  ? 150 GLY A C   1 
ATOM   505  O O   . GLY A 1 67  ? -0.585  -60.332 -27.729 1.00 46.69  ? 150 GLY A O   1 
ATOM   506  N N   . TYR A 1 68  ? -0.190  -59.343 -25.720 1.00 43.30  ? 151 TYR A N   1 
ATOM   507  C CA  . TYR A 1 68  ? 0.720   -58.352 -26.278 1.00 42.23  ? 151 TYR A CA  1 
ATOM   508  C C   . TYR A 1 68  ? 1.949   -59.054 -26.816 1.00 43.32  ? 151 TYR A C   1 
ATOM   509  O O   . TYR A 1 68  ? 2.678   -59.699 -26.059 1.00 45.29  ? 151 TYR A O   1 
ATOM   510  C CB  . TYR A 1 68  ? 1.106   -57.339 -25.213 1.00 42.30  ? 151 TYR A CB  1 
ATOM   511  C CG  . TYR A 1 68  ? 2.151   -56.366 -25.675 1.00 44.85  ? 151 TYR A CG  1 
ATOM   512  C CD1 . TYR A 1 68  ? 1.809   -55.319 -26.523 1.00 44.45  ? 151 TYR A CD1 1 
ATOM   513  C CD2 . TYR A 1 68  ? 3.472   -56.461 -25.249 1.00 44.39  ? 151 TYR A CD2 1 
ATOM   514  C CE1 . TYR A 1 68  ? 2.744   -54.397 -26.947 1.00 41.13  ? 151 TYR A CE1 1 
ATOM   515  C CE2 . TYR A 1 68  ? 4.407   -55.543 -25.671 1.00 43.77  ? 151 TYR A CE2 1 
ATOM   516  C CZ  . TYR A 1 68  ? 4.037   -54.515 -26.531 1.00 42.42  ? 151 TYR A CZ  1 
ATOM   517  O OH  . TYR A 1 68  ? 4.946   -53.568 -26.991 1.00 43.09  ? 151 TYR A OH  1 
ATOM   518  N N   . PRO A 1 69  ? 2.168   -58.947 -28.135 1.00 42.37  ? 152 PRO A N   1 
ATOM   519  C CA  . PRO A 1 69  ? 3.240   -59.632 -28.869 1.00 40.41  ? 152 PRO A CA  1 
ATOM   520  C C   . PRO A 1 69  ? 4.647   -58.996 -28.764 1.00 42.65  ? 152 PRO A C   1 
ATOM   521  O O   . PRO A 1 69  ? 5.638   -59.646 -29.086 1.00 46.15  ? 152 PRO A O   1 
ATOM   522  C CB  . PRO A 1 69  ? 2.770   -59.560 -30.327 1.00 38.08  ? 152 PRO A CB  1 
ATOM   523  C CG  . PRO A 1 69  ? 1.930   -58.327 -30.397 1.00 36.28  ? 152 PRO A CG  1 
ATOM   524  C CD  . PRO A 1 69  ? 1.438   -57.983 -28.993 1.00 39.21  ? 152 PRO A CD  1 
ATOM   525  N N   . GLY A 1 70  ? 4.753   -57.744 -28.327 1.00 43.56  ? 153 GLY A N   1 
ATOM   526  C CA  . GLY A 1 70  ? 6.068   -57.092 -28.283 1.00 42.69  ? 153 GLY A CA  1 
ATOM   527  C C   . GLY A 1 70  ? 6.242   -56.467 -29.639 1.00 44.61  ? 153 GLY A C   1 
ATOM   528  O O   . GLY A 1 70  ? 5.592   -56.925 -30.606 1.00 44.38  ? 153 GLY A O   1 
ATOM   529  N N   . GLY A 1 71  ? 7.040   -55.391 -29.708 1.00 42.87  ? 154 GLY A N   1 
ATOM   530  C CA  . GLY A 1 71  ? 7.263   -54.668 -30.961 1.00 38.24  ? 154 GLY A CA  1 
ATOM   531  C C   . GLY A 1 71  ? 8.330   -53.638 -30.717 1.00 39.48  ? 154 GLY A C   1 
ATOM   532  O O   . GLY A 1 71  ? 8.980   -53.663 -29.700 1.00 39.57  ? 154 GLY A O   1 
ATOM   533  N N   . LYS A 1 72  ? 8.471   -52.727 -31.665 1.00 40.10  ? 155 LYS A N   1 
ATOM   534  C CA  . LYS A 1 72  ? 9.535   -51.754 -31.757 1.00 39.13  ? 155 LYS A CA  1 
ATOM   535  C C   . LYS A 1 72  ? 9.150   -50.422 -31.112 1.00 42.54  ? 155 LYS A C   1 
ATOM   536  O O   . LYS A 1 72  ? 7.954   -50.112 -30.912 1.00 41.56  ? 155 LYS A O   1 
ATOM   537  C CB  . LYS A 1 72  ? 9.796   -51.460 -33.236 1.00 39.18  ? 155 LYS A CB  1 
ATOM   538  C CG  . LYS A 1 72  ? 10.309  -52.654 -33.998 1.00 41.96  ? 155 LYS A CG  1 
ATOM   539  C CD  . LYS A 1 72  ? 11.066  -52.258 -35.243 1.00 41.27  ? 155 LYS A CD  1 
ATOM   540  C CE  . LYS A 1 72  ? 11.366  -53.525 -35.989 1.00 42.65  ? 155 LYS A CE  1 
ATOM   541  N NZ  . LYS A 1 72  ? 12.076  -53.164 -37.218 1.00 50.67  ? 155 LYS A NZ  1 
ATOM   542  N N   . ILE A 1 73  ? 10.171  -49.621 -30.826 1.00 38.12  ? 156 ILE A N   1 
ATOM   543  C CA  . ILE A 1 73  ? 9.994   -48.415 -30.060 1.00 36.59  ? 156 ILE A CA  1 
ATOM   544  C C   . ILE A 1 73  ? 10.626  -47.298 -30.846 1.00 37.03  ? 156 ILE A C   1 
ATOM   545  O O   . ILE A 1 73  ? 11.607  -47.521 -31.569 1.00 34.47  ? 156 ILE A O   1 
ATOM   546  C CB  . ILE A 1 73  ? 10.749  -48.527 -28.713 1.00 35.08  ? 156 ILE A CB  1 
ATOM   547  C CG1 . ILE A 1 73  ? 10.184  -49.690 -27.890 1.00 33.82  ? 156 ILE A CG1 1 
ATOM   548  C CG2 . ILE A 1 73  ? 10.751  -47.205 -27.960 1.00 28.97  ? 156 ILE A CG2 1 
ATOM   549  C CD1 . ILE A 1 73  ? 10.852  -51.011 -28.171 1.00 33.37  ? 156 ILE A CD1 1 
ATOM   550  N N   . ILE A 1 74  ? 10.064  -46.107 -30.693 1.00 36.17  ? 157 ILE A N   1 
ATOM   551  C CA  . ILE A 1 74  ? 10.665  -44.910 -31.231 1.00 37.28  ? 157 ILE A CA  1 
ATOM   552  C C   . ILE A 1 74  ? 10.913  -43.984 -30.057 1.00 35.22  ? 157 ILE A C   1 
ATOM   553  O O   . ILE A 1 74  ? 10.028  -43.783 -29.230 1.00 34.70  ? 157 ILE A O   1 
ATOM   554  C CB  . ILE A 1 74  ? 9.774   -44.247 -32.270 1.00 40.50  ? 157 ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 74  ? 9.953   -44.959 -33.595 1.00 44.88  ? 157 ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 74  ? 10.210  -42.817 -32.466 1.00 43.90  ? 157 ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 74  ? 9.158   -44.399 -34.764 1.00 47.90  ? 157 ILE A CD1 1 
ATOM   558  N N   . PHE A 1 75  ? 12.127  -43.423 -29.977 1.00 35.60  ? 158 PHE A N   1 
ATOM   559  C CA  . PHE A 1 75  ? 12.542  -42.682 -28.798 1.00 32.91  ? 158 PHE A CA  1 
ATOM   560  C C   . PHE A 1 75  ? 13.042  -41.328 -29.221 1.00 35.76  ? 158 PHE A C   1 
ATOM   561  O O   . PHE A 1 75  ? 13.943  -41.254 -30.071 1.00 43.51  ? 158 PHE A O   1 
ATOM   562  C CB  . PHE A 1 75  ? 13.636  -43.467 -28.076 1.00 30.75  ? 158 PHE A CB  1 
ATOM   563  C CG  . PHE A 1 75  ? 14.027  -42.890 -26.737 1.00 29.92  ? 158 PHE A CG  1 
ATOM   564  C CD1 . PHE A 1 75  ? 14.057  -43.694 -25.609 1.00 28.28  ? 158 PHE A CD1 1 
ATOM   565  C CD2 . PHE A 1 75  ? 14.359  -41.536 -26.599 1.00 31.26  ? 158 PHE A CD2 1 
ATOM   566  C CE1 . PHE A 1 75  ? 14.409  -43.182 -24.362 1.00 29.66  ? 158 PHE A CE1 1 
ATOM   567  C CE2 . PHE A 1 75  ? 14.733  -41.015 -25.334 1.00 33.70  ? 158 PHE A CE2 1 
ATOM   568  C CZ  . PHE A 1 75  ? 14.760  -41.850 -24.205 1.00 29.94  ? 158 PHE A CZ  1 
ATOM   569  N N   . ILE A 1 76  ? 12.474  -40.250 -28.665 1.00 36.04  ? 159 ILE A N   1 
ATOM   570  C CA  . ILE A 1 76  ? 12.900  -38.876 -29.028 1.00 33.10  ? 159 ILE A CA  1 
ATOM   571  C C   . ILE A 1 76  ? 13.455  -38.213 -27.794 1.00 36.96  ? 159 ILE A C   1 
ATOM   572  O O   . ILE A 1 76  ? 12.750  -38.081 -26.782 1.00 40.17  ? 159 ILE A O   1 
ATOM   573  C CB  . ILE A 1 76  ? 11.753  -38.038 -29.553 1.00 33.32  ? 159 ILE A CB  1 
ATOM   574  C CG1 . ILE A 1 76  ? 11.258  -38.611 -30.865 1.00 33.69  ? 159 ILE A CG1 1 
ATOM   575  C CG2 . ILE A 1 76  ? 12.181  -36.580 -29.771 1.00 33.93  ? 159 ILE A CG2 1 
ATOM   576  C CD1 . ILE A 1 76  ? 9.965   -37.971 -31.296 1.00 33.95  ? 159 ILE A CD1 1 
ATOM   577  N N   . ASP A 1 77  ? 14.724  -37.814 -27.879 1.00 36.21  ? 160 ASP A N   1 
ATOM   578  C CA  . ASP A 1 77  ? 15.495  -37.366 -26.763 1.00 35.09  ? 160 ASP A CA  1 
ATOM   579  C C   . ASP A 1 77  ? 15.717  -35.823 -26.859 1.00 37.08  ? 160 ASP A C   1 
ATOM   580  O O   . ASP A 1 77  ? 16.403  -35.317 -27.760 1.00 37.39  ? 160 ASP A O   1 
ATOM   581  C CB  . ASP A 1 77  ? 16.799  -38.160 -26.779 1.00 35.76  ? 160 ASP A CB  1 
ATOM   582  C CG  . ASP A 1 77  ? 17.719  -37.899 -25.531 1.00 40.05  ? 160 ASP A CG  1 
ATOM   583  O OD1 . ASP A 1 77  ? 17.398  -37.041 -24.681 1.00 39.44  ? 160 ASP A OD1 1 
ATOM   584  O OD2 . ASP A 1 77  ? 18.806  -38.550 -25.425 1.00 40.05  ? 160 ASP A OD2 1 
ATOM   585  N N   . THR A 1 78  ? 15.129  -35.065 -25.941 1.00 37.64  ? 161 THR A N   1 
ATOM   586  C CA  . THR A 1 78  ? 15.394  -33.634 -25.916 1.00 39.51  ? 161 THR A CA  1 
ATOM   587  C C   . THR A 1 78  ? 16.417  -33.327 -24.874 1.00 42.08  ? 161 THR A C   1 
ATOM   588  O O   . THR A 1 78  ? 16.854  -32.182 -24.733 1.00 45.98  ? 161 THR A O   1 
ATOM   589  C CB  . THR A 1 78  ? 14.162  -32.809 -25.529 1.00 38.75  ? 161 THR A CB  1 
ATOM   590  O OG1 . THR A 1 78  ? 13.786  -33.125 -24.196 1.00 39.87  ? 161 THR A OG1 1 
ATOM   591  C CG2 . THR A 1 78  ? 13.030  -33.057 -26.443 1.00 37.15  ? 161 THR A CG2 1 
ATOM   592  N N   . GLU A 1 79  ? 16.805  -34.354 -24.135 1.00 46.27  ? 162 GLU A N   1 
ATOM   593  C CA  . GLU A 1 79  ? 17.539  -34.167 -22.862 1.00 48.02  ? 162 GLU A CA  1 
ATOM   594  C C   . GLU A 1 79  ? 18.988  -34.575 -22.969 1.00 44.42  ? 162 GLU A C   1 
ATOM   595  O O   . GLU A 1 79  ? 19.743  -34.338 -22.056 1.00 40.27  ? 162 GLU A O   1 
ATOM   596  C CB  . GLU A 1 79  ? 16.877  -34.998 -21.759 1.00 55.98  ? 162 GLU A CB  1 
ATOM   597  C CG  . GLU A 1 79  ? 15.513  -34.480 -21.335 1.00 65.85  ? 162 GLU A CG  1 
ATOM   598  C CD  . GLU A 1 79  ? 15.564  -32.990 -21.073 1.00 72.17  ? 162 GLU A CD  1 
ATOM   599  O OE1 . GLU A 1 79  ? 14.997  -32.236 -21.901 1.00 78.26  ? 162 GLU A OE1 1 
ATOM   600  O OE2 . GLU A 1 79  ? 16.214  -32.578 -20.079 1.00 74.82  ? 162 GLU A OE2 1 
ATOM   601  N N   . ASN A 1 80  ? 19.339  -35.202 -24.097 1.00 42.25  ? 163 ASN A N   1 
ATOM   602  C CA  . ASN A 1 80  ? 20.651  -35.739 -24.337 1.00 41.47  ? 163 ASN A CA  1 
ATOM   603  C C   . ASN A 1 80  ? 20.989  -36.753 -23.282 1.00 41.52  ? 163 ASN A C   1 
ATOM   604  O O   . ASN A 1 80  ? 22.090  -36.749 -22.770 1.00 45.92  ? 163 ASN A O   1 
ATOM   605  C CB  . ASN A 1 80  ? 21.677  -34.614 -24.324 1.00 42.01  ? 163 ASN A CB  1 
ATOM   606  C CG  . ASN A 1 80  ? 22.980  -34.989 -25.019 1.00 43.41  ? 163 ASN A CG  1 
ATOM   607  O OD1 . ASN A 1 80  ? 23.070  -36.020 -25.647 1.00 43.48  ? 163 ASN A OD1 1 
ATOM   608  N ND2 . ASN A 1 80  ? 24.004  -34.126 -24.900 1.00 45.86  ? 163 ASN A ND2 1 
ATOM   609  N N   . THR A 1 81  ? 20.054  -37.619 -22.919 1.00 39.85  ? 164 THR A N   1 
ATOM   610  C CA  . THR A 1 81  ? 20.331  -38.557 -21.806 1.00 41.97  ? 164 THR A CA  1 
ATOM   611  C C   . THR A 1 81  ? 20.119  -40.041 -22.086 1.00 43.80  ? 164 THR A C   1 
ATOM   612  O O   . THR A 1 81  ? 20.251  -40.861 -21.159 1.00 49.19  ? 164 THR A O   1 
ATOM   613  C CB  . THR A 1 81  ? 19.588  -38.204 -20.489 1.00 41.27  ? 164 THR A CB  1 
ATOM   614  O OG1 . THR A 1 81  ? 18.228  -37.884 -20.764 1.00 43.88  ? 164 THR A OG1 1 
ATOM   615  C CG2 . THR A 1 81  ? 20.218  -37.019 -19.794 1.00 41.02  ? 164 THR A CG2 1 
ATOM   616  N N   . PHE A 1 82  ? 19.793  -40.387 -23.330 1.00 40.08  ? 165 PHE A N   1 
ATOM   617  C CA  . PHE A 1 82  ? 19.606  -41.770 -23.713 1.00 42.45  ? 165 PHE A CA  1 
ATOM   618  C C   . PHE A 1 82  ? 20.958  -42.472 -23.803 1.00 44.50  ? 165 PHE A C   1 
ATOM   619  O O   . PHE A 1 82  ? 21.924  -41.912 -24.286 1.00 43.27  ? 165 PHE A O   1 
ATOM   620  C CB  . PHE A 1 82  ? 18.881  -41.817 -25.062 1.00 43.44  ? 165 PHE A CB  1 
ATOM   621  C CG  . PHE A 1 82  ? 18.646  -43.209 -25.599 1.00 42.53  ? 165 PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 82  ? 19.298  -43.642 -26.761 1.00 42.99  ? 165 PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 82  ? 17.741  -44.065 -24.994 1.00 42.83  ? 165 PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 82  ? 19.052  -44.902 -27.299 1.00 39.53  ? 165 PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 82  ? 17.499  -45.326 -25.529 1.00 41.09  ? 165 PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 82  ? 18.175  -45.742 -26.662 1.00 40.26  ? 165 PHE A CZ  1 
ATOM   627  N N   . ARG A 1 83  ? 21.013  -43.714 -23.347 1.00 46.20  ? 166 ARG A N   1 
ATOM   628  C CA  . ARG A 1 83  ? 22.271  -44.401 -23.195 1.00 42.62  ? 166 ARG A CA  1 
ATOM   629  C C   . ARG A 1 83  ? 22.033  -45.821 -23.601 1.00 42.34  ? 166 ARG A C   1 
ATOM   630  O O   . ARG A 1 83  ? 21.559  -46.638 -22.811 1.00 47.55  ? 166 ARG A O   1 
ATOM   631  C CB  . ARG A 1 83  ? 22.700  -44.362 -21.732 1.00 41.50  ? 166 ARG A CB  1 
ATOM   632  C CG  . ARG A 1 83  ? 23.280  -43.049 -21.222 1.00 42.98  ? 166 ARG A CG  1 
ATOM   633  C CD  . ARG A 1 83  ? 24.558  -42.547 -21.930 1.00 44.41  ? 166 ARG A CD  1 
ATOM   634  N NE  . ARG A 1 83  ? 24.096  -41.422 -22.690 1.00 52.39  ? 166 ARG A NE  1 
ATOM   635  C CZ  . ARG A 1 83  ? 24.478  -40.169 -22.541 1.00 51.79  ? 166 ARG A CZ  1 
ATOM   636  N NH1 . ARG A 1 83  ? 25.441  -39.871 -21.726 1.00 52.58  ? 166 ARG A NH1 1 
ATOM   637  N NH2 . ARG A 1 83  ? 23.895  -39.224 -23.250 1.00 51.00  ? 166 ARG A NH2 1 
ATOM   638  N N   . PRO A 1 84  ? 22.340  -46.150 -24.842 1.00 40.49  ? 167 PRO A N   1 
ATOM   639  C CA  . PRO A 1 84  ? 22.164  -47.552 -25.245 1.00 44.50  ? 167 PRO A CA  1 
ATOM   640  C C   . PRO A 1 84  ? 22.770  -48.609 -24.281 1.00 47.71  ? 167 PRO A C   1 
ATOM   641  O O   . PRO A 1 84  ? 22.217  -49.697 -24.120 1.00 56.94  ? 167 PRO A O   1 
ATOM   642  C CB  . PRO A 1 84  ? 22.819  -47.595 -26.620 1.00 41.86  ? 167 PRO A CB  1 
ATOM   643  C CG  . PRO A 1 84  ? 22.706  -46.191 -27.155 1.00 38.05  ? 167 PRO A CG  1 
ATOM   644  C CD  . PRO A 1 84  ? 22.666  -45.271 -25.974 1.00 39.80  ? 167 PRO A CD  1 
ATOM   645  N N   . ASP A 1 85  ? 23.861  -48.271 -23.620 1.00 50.18  ? 168 ASP A N   1 
ATOM   646  C CA  . ASP A 1 85  ? 24.405  -49.104 -22.566 1.00 52.16  ? 168 ASP A CA  1 
ATOM   647  C C   . ASP A 1 85  ? 23.501  -49.437 -21.372 1.00 50.48  ? 168 ASP A C   1 
ATOM   648  O O   . ASP A 1 85  ? 23.569  -50.542 -20.849 1.00 48.26  ? 168 ASP A O   1 
ATOM   649  C CB  . ASP A 1 85  ? 25.738  -48.582 -22.084 1.00 56.57  ? 168 ASP A CB  1 
ATOM   650  C CG  . ASP A 1 85  ? 26.817  -49.626 -22.228 1.00 71.52  ? 168 ASP A CG  1 
ATOM   651  O OD1 . ASP A 1 85  ? 27.851  -49.557 -21.519 1.00 79.98  ? 168 ASP A OD1 1 
ATOM   652  O OD2 . ASP A 1 85  ? 26.616  -50.544 -23.070 1.00 75.37  ? 168 ASP A OD2 1 
ATOM   653  N N   . ARG A 1 86  ? 22.648  -48.526 -20.925 1.00 47.28  ? 169 ARG A N   1 
ATOM   654  C CA  . ARG A 1 86  ? 21.724  -48.988 -19.929 1.00 48.07  ? 169 ARG A CA  1 
ATOM   655  C C   . ARG A 1 86  ? 20.926  -50.143 -20.471 1.00 49.97  ? 169 ARG A C   1 
ATOM   656  O O   . ARG A 1 86  ? 20.577  -51.051 -19.718 1.00 52.93  ? 169 ARG A O   1 
ATOM   657  C CB  . ARG A 1 86  ? 20.770  -47.917 -19.467 1.00 49.24  ? 169 ARG A CB  1 
ATOM   658  C CG  . ARG A 1 86  ? 21.412  -46.850 -18.620 1.00 57.25  ? 169 ARG A CG  1 
ATOM   659  C CD  . ARG A 1 86  ? 22.131  -47.374 -17.373 1.00 63.06  ? 169 ARG A CD  1 
ATOM   660  N NE  . ARG A 1 86  ? 21.485  -48.484 -16.637 1.00 69.64  ? 169 ARG A NE  1 
ATOM   661  C CZ  . ARG A 1 86  ? 20.241  -48.509 -16.152 1.00 62.25  ? 169 ARG A CZ  1 
ATOM   662  N NH1 . ARG A 1 86  ? 19.400  -47.498 -16.343 1.00 60.41  ? 169 ARG A NH1 1 
ATOM   663  N NH2 . ARG A 1 86  ? 19.843  -49.581 -15.498 1.00 57.28  ? 169 ARG A NH2 1 
ATOM   664  N N   . LEU A 1 87  ? 20.606  -50.132 -21.767 1.00 50.55  ? 170 LEU A N   1 
ATOM   665  C CA  . LEU A 1 87  ? 19.657  -51.138 -22.239 1.00 53.23  ? 170 LEU A CA  1 
ATOM   666  C C   . LEU A 1 87  ? 20.286  -52.496 -22.148 1.00 59.78  ? 170 LEU A C   1 
ATOM   667  O O   . LEU A 1 87  ? 19.595  -53.508 -21.922 1.00 64.87  ? 170 LEU A O   1 
ATOM   668  C CB  . LEU A 1 87  ? 19.129  -50.900 -23.658 1.00 50.00  ? 170 LEU A CB  1 
ATOM   669  C CG  . LEU A 1 87  ? 18.506  -49.554 -23.989 1.00 47.44  ? 170 LEU A CG  1 
ATOM   670  C CD1 . LEU A 1 87  ? 17.806  -49.633 -25.313 1.00 42.59  ? 170 LEU A CD1 1 
ATOM   671  C CD2 . LEU A 1 87  ? 17.580  -49.049 -22.898 1.00 47.57  ? 170 LEU A CD2 1 
ATOM   672  N N   . ARG A 1 88  ? 21.604  -52.525 -22.303 1.00 61.47  ? 171 ARG A N   1 
ATOM   673  C CA  . ARG A 1 88  ? 22.266  -53.789 -22.251 1.00 60.65  ? 171 ARG A CA  1 
ATOM   674  C C   . ARG A 1 88  ? 22.008  -54.445 -20.880 1.00 62.58  ? 171 ARG A C   1 
ATOM   675  O O   . ARG A 1 88  ? 21.587  -55.621 -20.807 1.00 61.32  ? 171 ARG A O   1 
ATOM   676  C CB  . ARG A 1 88  ? 23.713  -53.662 -22.701 1.00 64.62  ? 171 ARG A CB  1 
ATOM   677  C CG  . ARG A 1 88  ? 23.796  -53.629 -24.250 1.00 65.20  ? 171 ARG A CG  1 
ATOM   678  C CD  . ARG A 1 88  ? 25.226  -53.780 -24.785 1.00 67.01  ? 171 ARG A CD  1 
ATOM   679  N NE  . ARG A 1 88  ? 25.661  -52.473 -25.240 1.00 73.38  ? 171 ARG A NE  1 
ATOM   680  C CZ  . ARG A 1 88  ? 25.981  -52.143 -26.496 1.00 73.33  ? 171 ARG A CZ  1 
ATOM   681  N NH1 . ARG A 1 88  ? 26.021  -53.043 -27.473 1.00 74.44  ? 171 ARG A NH1 1 
ATOM   682  N NH2 . ARG A 1 88  ? 26.305  -50.893 -26.767 1.00 70.95  ? 171 ARG A NH2 1 
ATOM   683  N N   . ASP A 1 89  ? 22.132  -53.672 -19.809 1.00 59.38  ? 172 ASP A N   1 
ATOM   684  C CA  . ASP A 1 89  ? 21.957  -54.226 -18.453 1.00 61.74  ? 172 ASP A CA  1 
ATOM   685  C C   . ASP A 1 89  ? 20.522  -54.710 -18.196 1.00 62.14  ? 172 ASP A C   1 
ATOM   686  O O   . ASP A 1 89  ? 20.284  -55.811 -17.671 1.00 63.58  ? 172 ASP A O   1 
ATOM   687  C CB  . ASP A 1 89  ? 22.371  -53.179 -17.430 1.00 72.20  ? 172 ASP A CB  1 
ATOM   688  C CG  . ASP A 1 89  ? 23.705  -52.444 -17.808 1.00 77.33  ? 172 ASP A CG  1 
ATOM   689  O OD1 . ASP A 1 89  ? 23.878  -51.237 -17.428 1.00 70.29  ? 172 ASP A OD1 1 
ATOM   690  O OD2 . ASP A 1 89  ? 24.571  -53.094 -18.461 1.00 77.42  ? 172 ASP A OD2 1 
ATOM   691  N N   . ILE A 1 90  ? 19.562  -53.888 -18.615 1.00 57.92  ? 173 ILE A N   1 
ATOM   692  C CA  . ILE A 1 90  ? 18.154  -54.209 -18.541 1.00 51.79  ? 173 ILE A CA  1 
ATOM   693  C C   . ILE A 1 90  ? 17.847  -55.448 -19.376 1.00 56.87  ? 173 ILE A C   1 
ATOM   694  O O   . ILE A 1 90  ? 17.035  -56.297 -18.949 1.00 60.07  ? 173 ILE A O   1 
ATOM   695  C CB  . ILE A 1 90  ? 17.327  -53.009 -19.031 1.00 48.76  ? 173 ILE A CB  1 
ATOM   696  C CG1 . ILE A 1 90  ? 17.552  -51.823 -18.091 1.00 47.11  ? 173 ILE A CG1 1 
ATOM   697  C CG2 . ILE A 1 90  ? 15.847  -53.343 -19.117 1.00 44.25  ? 173 ILE A CG2 1 
ATOM   698  C CD1 . ILE A 1 90  ? 17.170  -50.480 -18.639 1.00 40.34  ? 173 ILE A CD1 1 
ATOM   699  N N   . ALA A 1 91  ? 18.481  -55.562 -20.558 1.00 56.20  ? 174 ALA A N   1 
ATOM   700  C CA  . ALA A 1 91  ? 18.267  -56.734 -21.433 1.00 57.56  ? 174 ALA A CA  1 
ATOM   701  C C   . ALA A 1 91  ? 18.683  -58.039 -20.741 1.00 58.95  ? 174 ALA A C   1 
ATOM   702  O O   . ALA A 1 91  ? 18.070  -59.081 -20.906 1.00 61.13  ? 174 ALA A O   1 
ATOM   703  C CB  . ALA A 1 91  ? 18.997  -56.577 -22.760 1.00 53.56  ? 174 ALA A CB  1 
ATOM   704  N N   . ASP A 1 92  ? 19.738  -57.951 -19.958 1.00 63.35  ? 175 ASP A N   1 
ATOM   705  C CA  . ASP A 1 92  ? 20.202  -59.072 -19.162 1.00 67.32  ? 175 ASP A CA  1 
ATOM   706  C C   . ASP A 1 92  ? 19.149  -59.489 -18.154 1.00 63.17  ? 175 ASP A C   1 
ATOM   707  O O   . ASP A 1 92  ? 18.814  -60.676 -18.069 1.00 69.21  ? 175 ASP A O   1 
ATOM   708  C CB  . ASP A 1 92  ? 21.591  -58.771 -18.530 1.00 72.00  ? 175 ASP A CB  1 
ATOM   709  C CG  . ASP A 1 92  ? 22.714  -58.658 -19.605 1.00 76.88  ? 175 ASP A CG  1 
ATOM   710  O OD1 . ASP A 1 92  ? 22.493  -59.123 -20.754 1.00 84.60  ? 175 ASP A OD1 1 
ATOM   711  O OD2 . ASP A 1 92  ? 23.806  -58.119 -19.326 1.00 73.36  ? 175 ASP A OD2 1 
ATOM   712  N N   . ARG A 1 93  ? 18.593  -58.531 -17.425 1.00 56.50  ? 176 ARG A N   1 
ATOM   713  C CA  . ARG A 1 93  ? 17.567  -58.881 -16.473 1.00 56.77  ? 176 ARG A CA  1 
ATOM   714  C C   . ARG A 1 93  ? 16.415  -59.607 -17.175 1.00 57.49  ? 176 ARG A C   1 
ATOM   715  O O   . ARG A 1 93  ? 15.843  -60.530 -16.610 1.00 60.01  ? 176 ARG A O   1 
ATOM   716  C CB  . ARG A 1 93  ? 17.078  -57.653 -15.717 1.00 56.65  ? 176 ARG A CB  1 
ATOM   717  C CG  . ARG A 1 93  ? 15.886  -57.880 -14.787 1.00 56.89  ? 176 ARG A CG  1 
ATOM   718  C CD  . ARG A 1 93  ? 14.862  -56.814 -15.112 1.00 56.92  ? 176 ARG A CD  1 
ATOM   719  N NE  . ARG A 1 93  ? 13.701  -56.776 -14.235 1.00 58.11  ? 176 ARG A NE  1 
ATOM   720  C CZ  . ARG A 1 93  ? 13.019  -55.671 -13.959 1.00 53.83  ? 176 ARG A CZ  1 
ATOM   721  N NH1 . ARG A 1 93  ? 13.420  -54.521 -14.474 1.00 52.37  ? 176 ARG A NH1 1 
ATOM   722  N NH2 . ARG A 1 93  ? 11.965  -55.707 -13.152 1.00 51.83  ? 176 ARG A NH2 1 
ATOM   723  N N   . PHE A 1 94  ? 16.093  -59.234 -18.409 1.00 53.72  ? 177 PHE A N   1 
ATOM   724  C CA  . PHE A 1 94  ? 15.028  -59.932 -19.095 1.00 53.41  ? 177 PHE A CA  1 
ATOM   725  C C   . PHE A 1 94  ? 15.444  -61.063 -20.000 1.00 56.03  ? 177 PHE A C   1 
ATOM   726  O O   . PHE A 1 94  ? 14.596  -61.668 -20.647 1.00 58.71  ? 177 PHE A O   1 
ATOM   727  C CB  . PHE A 1 94  ? 14.170  -58.986 -19.877 1.00 49.58  ? 177 PHE A CB  1 
ATOM   728  C CG  . PHE A 1 94  ? 13.351  -58.099 -19.013 1.00 51.04  ? 177 PHE A CG  1 
ATOM   729  C CD1 . PHE A 1 94  ? 13.703  -56.741 -18.828 1.00 47.79  ? 177 PHE A CD1 1 
ATOM   730  C CD2 . PHE A 1 94  ? 12.216  -58.592 -18.390 1.00 49.40  ? 177 PHE A CD2 1 
ATOM   731  C CE1 . PHE A 1 94  ? 12.935  -55.909 -18.044 1.00 45.15  ? 177 PHE A CE1 1 
ATOM   732  C CE2 . PHE A 1 94  ? 11.429  -57.749 -17.614 1.00 48.39  ? 177 PHE A CE2 1 
ATOM   733  C CZ  . PHE A 1 94  ? 11.792  -56.418 -17.428 1.00 49.19  ? 177 PHE A CZ  1 
ATOM   734  N N   . ASN A 1 95  ? 16.729  -61.365 -20.047 1.00 59.51  ? 178 ASN A N   1 
ATOM   735  C CA  . ASN A 1 95  ? 17.190  -62.569 -20.746 1.00 61.44  ? 178 ASN A CA  1 
ATOM   736  C C   . ASN A 1 95  ? 17.020  -62.492 -22.242 1.00 58.12  ? 178 ASN A C   1 
ATOM   737  O O   . ASN A 1 95  ? 16.547  -63.424 -22.874 1.00 59.25  ? 178 ASN A O   1 
ATOM   738  C CB  . ASN A 1 95  ? 16.508  -63.808 -20.176 1.00 62.06  ? 178 ASN A CB  1 
ATOM   739  C CG  . ASN A 1 95  ? 17.117  -64.207 -18.860 1.00 69.04  ? 178 ASN A CG  1 
ATOM   740  O OD1 . ASN A 1 95  ? 18.345  -64.234 -18.705 1.00 72.17  ? 178 ASN A OD1 1 
ATOM   741  N ND2 . ASN A 1 95  ? 16.274  -64.492 -17.897 1.00 71.02  ? 178 ASN A ND2 1 
ATOM   742  N N   . VAL A 1 96  ? 17.457  -61.373 -22.788 1.00 55.93  ? 179 VAL A N   1 
ATOM   743  C CA  . VAL A 1 96  ? 17.247  -61.047 -24.172 1.00 56.31  ? 179 VAL A CA  1 
ATOM   744  C C   . VAL A 1 96  ? 18.540  -60.494 -24.810 1.00 56.29  ? 179 VAL A C   1 
ATOM   745  O O   . VAL A 1 96  ? 19.338  -59.841 -24.155 1.00 58.44  ? 179 VAL A O   1 
ATOM   746  C CB  . VAL A 1 96  ? 16.037  -60.094 -24.228 1.00 55.74  ? 179 VAL A CB  1 
ATOM   747  C CG1 . VAL A 1 96  ? 16.180  -59.043 -25.291 1.00 51.03  ? 179 VAL A CG1 1 
ATOM   748  C CG2 . VAL A 1 96  ? 14.749  -60.913 -24.391 1.00 53.10  ? 179 VAL A CG2 1 
ATOM   749  N N   . ASP A 1 97  ? 18.756  -60.789 -26.087 1.00 59.91  ? 180 ASP A N   1 
ATOM   750  C CA  . ASP A 1 97  ? 19.952  -60.385 -26.808 1.00 58.85  ? 180 ASP A CA  1 
ATOM   751  C C   . ASP A 1 97  ? 20.025  -58.856 -26.881 1.00 59.12  ? 180 ASP A C   1 
ATOM   752  O O   . ASP A 1 97  ? 19.022  -58.176 -27.190 1.00 58.65  ? 180 ASP A O   1 
ATOM   753  C CB  . ASP A 1 97  ? 19.905  -61.039 -28.186 1.00 65.35  ? 180 ASP A CB  1 
ATOM   754  C CG  . ASP A 1 97  ? 21.056  -60.627 -29.106 1.00 76.64  ? 180 ASP A CG  1 
ATOM   755  O OD1 . ASP A 1 97  ? 20.755  -60.443 -30.305 1.00 89.06  ? 180 ASP A OD1 1 
ATOM   756  O OD2 . ASP A 1 97  ? 22.235  -60.507 -28.684 1.00 78.41  ? 180 ASP A OD2 1 
ATOM   757  N N   . HIS A 1 98  ? 21.201  -58.313 -26.563 1.00 61.29  ? 181 HIS A N   1 
ATOM   758  C CA  . HIS A 1 98  ? 21.439  -56.861 -26.560 1.00 59.19  ? 181 HIS A CA  1 
ATOM   759  C C   . HIS A 1 98  ? 21.248  -56.295 -27.906 1.00 60.89  ? 181 HIS A C   1 
ATOM   760  O O   . HIS A 1 98  ? 20.557  -55.269 -28.045 1.00 64.71  ? 181 HIS A O   1 
ATOM   761  C CB  . HIS A 1 98  ? 22.830  -56.502 -26.117 1.00 61.85  ? 181 HIS A CB  1 
ATOM   762  C CG  . HIS A 1 98  ? 23.280  -57.225 -24.882 1.00 75.56  ? 181 HIS A CG  1 
ATOM   763  N ND1 . HIS A 1 98  ? 22.705  -58.376 -24.462 1.00 86.04  ? 181 HIS A ND1 1 
ATOM   764  C CD2 . HIS A 1 98  ? 24.321  -56.959 -23.999 1.00 75.70  ? 181 HIS A CD2 1 
ATOM   765  C CE1 . HIS A 1 98  ? 23.332  -58.804 -23.357 1.00 90.67  ? 181 HIS A CE1 1 
ATOM   766  N NE2 . HIS A 1 98  ? 24.312  -57.924 -23.065 1.00 82.74  ? 181 HIS A NE2 1 
ATOM   767  N N   . ASP A 1 99  ? 21.845  -56.942 -28.909 1.00 58.09  ? 182 ASP A N   1 
ATOM   768  C CA  . ASP A 1 99  ? 21.832  -56.411 -30.260 1.00 56.82  ? 182 ASP A CA  1 
ATOM   769  C C   . ASP A 1 99  ? 20.399  -56.329 -30.733 1.00 58.48  ? 182 ASP A C   1 
ATOM   770  O O   . ASP A 1 99  ? 19.959  -55.283 -31.216 1.00 62.46  ? 182 ASP A O   1 
ATOM   771  C CB  . ASP A 1 99  ? 22.678  -57.247 -31.210 1.00 61.29  ? 182 ASP A CB  1 
ATOM   772  C CG  . ASP A 1 99  ? 24.210  -57.037 -31.001 1.00 72.70  ? 182 ASP A CG  1 
ATOM   773  O OD1 . ASP A 1 99  ? 25.020  -57.764 -31.656 1.00 76.65  ? 182 ASP A OD1 1 
ATOM   774  O OD2 . ASP A 1 99  ? 24.611  -56.157 -30.184 1.00 65.82  ? 182 ASP A OD2 1 
ATOM   775  N N   . ALA A 1 100 ? 19.648  -57.407 -30.553 1.00 52.91  ? 183 ALA A N   1 
ATOM   776  C CA  . ALA A 1 100 ? 18.275  -57.415 -31.006 1.00 51.34  ? 183 ALA A CA  1 
ATOM   777  C C   . ALA A 1 100 ? 17.467  -56.251 -30.397 1.00 49.81  ? 183 ALA A C   1 
ATOM   778  O O   . ALA A 1 100 ? 16.726  -55.570 -31.126 1.00 47.85  ? 183 ALA A O   1 
ATOM   779  C CB  . ALA A 1 100 ? 17.620  -58.743 -30.682 1.00 52.19  ? 183 ALA A CB  1 
ATOM   780  N N   . VAL A 1 101 ? 17.628  -56.045 -29.082 1.00 44.63  ? 184 VAL A N   1 
ATOM   781  C CA  . VAL A 1 101 ? 16.940  -55.021 -28.353 1.00 43.93  ? 184 VAL A CA  1 
ATOM   782  C C   . VAL A 1 101 ? 17.313  -53.653 -28.904 1.00 42.30  ? 184 VAL A C   1 
ATOM   783  O O   . VAL A 1 101 ? 16.478  -52.810 -29.161 1.00 44.86  ? 184 VAL A O   1 
ATOM   784  C CB  . VAL A 1 101 ? 17.315  -55.080 -26.846 1.00 49.34  ? 184 VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 101 ? 16.905  -53.797 -26.128 1.00 45.65  ? 184 VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 101 ? 16.616  -56.234 -26.175 1.00 46.85  ? 184 VAL A CG2 1 
ATOM   787  N N   . LEU A 1 102 ? 18.591  -53.435 -29.083 1.00 44.52  ? 185 LEU A N   1 
ATOM   788  C CA  . LEU A 1 102 ? 19.108  -52.176 -29.605 1.00 45.50  ? 185 LEU A CA  1 
ATOM   789  C C   . LEU A 1 102 ? 18.732  -51.985 -31.086 1.00 46.42  ? 185 LEU A C   1 
ATOM   790  O O   . LEU A 1 102 ? 18.657  -50.853 -31.568 1.00 43.40  ? 185 LEU A O   1 
ATOM   791  C CB  . LEU A 1 102 ? 20.628  -52.186 -29.463 1.00 43.86  ? 185 LEU A CB  1 
ATOM   792  C CG  . LEU A 1 102 ? 21.414  -51.387 -28.445 1.00 45.90  ? 185 LEU A CG  1 
ATOM   793  C CD1 . LEU A 1 102 ? 20.857  -51.363 -27.030 1.00 50.13  ? 185 LEU A CD1 1 
ATOM   794  C CD2 . LEU A 1 102 ? 22.814  -51.989 -28.467 1.00 49.38  ? 185 LEU A CD2 1 
ATOM   795  N N   . ASP A 1 103 ? 18.504  -53.081 -31.806 1.00 45.88  ? 186 ASP A N   1 
ATOM   796  C CA  . ASP A 1 103 ? 18.033  -52.943 -33.161 1.00 49.29  ? 186 ASP A CA  1 
ATOM   797  C C   . ASP A 1 103 ? 16.600  -52.513 -33.244 1.00 47.07  ? 186 ASP A C   1 
ATOM   798  O O   . ASP A 1 103 ? 16.159  -52.069 -34.292 1.00 47.36  ? 186 ASP A O   1 
ATOM   799  C CB  . ASP A 1 103 ? 18.147  -54.245 -33.901 1.00 60.84  ? 186 ASP A CB  1 
ATOM   800  C CG  . ASP A 1 103 ? 19.092  -54.154 -35.036 1.00 71.67  ? 186 ASP A CG  1 
ATOM   801  O OD1 . ASP A 1 103 ? 18.623  -53.721 -36.115 1.00 86.70  ? 186 ASP A OD1 1 
ATOM   802  O OD2 . ASP A 1 103 ? 20.283  -54.505 -34.850 1.00 71.08  ? 186 ASP A OD2 1 
ATOM   803  N N   . ASN A 1 104 ? 15.845  -52.713 -32.169 1.00 42.23  ? 187 ASN A N   1 
ATOM   804  C CA  . ASN A 1 104 ? 14.422  -52.452 -32.244 1.00 39.43  ? 187 ASN A CA  1 
ATOM   805  C C   . ASN A 1 104 ? 14.005  -51.103 -31.665 1.00 36.99  ? 187 ASN A C   1 
ATOM   806  O O   . ASN A 1 104 ? 12.800  -50.848 -31.485 1.00 34.94  ? 187 ASN A O   1 
ATOM   807  C CB  . ASN A 1 104 ? 13.593  -53.582 -31.653 1.00 38.70  ? 187 ASN A CB  1 
ATOM   808  C CG  . ASN A 1 104 ? 13.736  -54.869 -32.402 1.00 39.92  ? 187 ASN A CG  1 
ATOM   809  O OD1 . ASN A 1 104 ? 13.780  -54.908 -33.624 1.00 43.09  ? 187 ASN A OD1 1 
ATOM   810  N ND2 . ASN A 1 104 ? 13.811  -55.938 -31.664 1.00 40.52  ? 187 ASN A ND2 1 
ATOM   811  N N   . VAL A 1 105 ? 14.983  -50.235 -31.428 1.00 34.61  ? 188 VAL A N   1 
ATOM   812  C CA  . VAL A 1 105 ? 14.680  -48.931 -30.913 1.00 35.06  ? 188 VAL A CA  1 
ATOM   813  C C   . VAL A 1 105 ? 15.213  -47.925 -31.892 1.00 37.41  ? 188 VAL A C   1 
ATOM   814  O O   . VAL A 1 105 ? 16.447  -47.906 -32.100 1.00 36.90  ? 188 VAL A O   1 
ATOM   815  C CB  . VAL A 1 105 ? 15.373  -48.688 -29.554 1.00 33.23  ? 188 VAL A CB  1 
ATOM   816  C CG1 . VAL A 1 105 ? 15.118  -47.273 -29.085 1.00 29.17  ? 188 VAL A CG1 1 
ATOM   817  C CG2 . VAL A 1 105 ? 14.892  -49.695 -28.550 1.00 31.41  ? 188 VAL A CG2 1 
ATOM   818  N N   . LEU A 1 106 ? 14.306  -47.129 -32.499 1.00 37.91  ? 189 LEU A N   1 
ATOM   819  C CA  . LEU A 1 106 ? 14.679  -45.963 -33.340 1.00 40.80  ? 189 LEU A CA  1 
ATOM   820  C C   . LEU A 1 106 ? 14.789  -44.697 -32.504 1.00 42.53  ? 189 LEU A C   1 
ATOM   821  O O   . LEU A 1 106 ? 13.889  -44.397 -31.677 1.00 40.84  ? 189 LEU A O   1 
ATOM   822  C CB  . LEU A 1 106 ? 13.691  -45.683 -34.462 1.00 45.75  ? 189 LEU A CB  1 
ATOM   823  C CG  . LEU A 1 106 ? 13.837  -46.269 -35.834 1.00 50.18  ? 189 LEU A CG  1 
ATOM   824  C CD1 . LEU A 1 106 ? 15.283  -46.137 -36.331 1.00 56.28  ? 189 LEU A CD1 1 
ATOM   825  C CD2 . LEU A 1 106 ? 13.470  -47.728 -35.671 1.00 57.85  ? 189 LEU A CD2 1 
ATOM   826  N N   . TYR A 1 107 ? 15.871  -43.951 -32.738 1.00 39.25  ? 190 TYR A N   1 
ATOM   827  C CA  . TYR A 1 107 ? 16.256  -42.874 -31.839 1.00 38.19  ? 190 TYR A CA  1 
ATOM   828  C C   . TYR A 1 107 ? 16.565  -41.646 -32.630 1.00 39.04  ? 190 TYR A C   1 
ATOM   829  O O   . TYR A 1 107 ? 17.224  -41.742 -33.711 1.00 35.10  ? 190 TYR A O   1 
ATOM   830  C CB  . TYR A 1 107 ? 17.515  -43.269 -31.081 1.00 39.38  ? 190 TYR A CB  1 
ATOM   831  C CG  . TYR A 1 107 ? 18.094  -42.180 -30.193 1.00 38.69  ? 190 TYR A CG  1 
ATOM   832  C CD1 . TYR A 1 107 ? 17.590  -41.958 -28.937 1.00 37.87  ? 190 TYR A CD1 1 
ATOM   833  C CD2 . TYR A 1 107 ? 19.173  -41.403 -30.608 1.00 44.20  ? 190 TYR A CD2 1 
ATOM   834  C CE1 . TYR A 1 107 ? 18.129  -41.016 -28.089 1.00 38.42  ? 190 TYR A CE1 1 
ATOM   835  C CE2 . TYR A 1 107 ? 19.742  -40.433 -29.756 1.00 43.58  ? 190 TYR A CE2 1 
ATOM   836  C CZ  . TYR A 1 107 ? 19.186  -40.243 -28.497 1.00 42.58  ? 190 TYR A CZ  1 
ATOM   837  O OH  . TYR A 1 107 ? 19.683  -39.293 -27.635 1.00 43.20  ? 190 TYR A OH  1 
ATOM   838  N N   . ALA A 1 108 ? 16.102  -40.510 -32.083 1.00 36.10  ? 191 ALA A N   1 
ATOM   839  C CA  . ALA A 1 108 ? 16.482  -39.153 -32.562 1.00 34.83  ? 191 ALA A CA  1 
ATOM   840  C C   . ALA A 1 108 ? 16.534  -38.181 -31.398 1.00 34.70  ? 191 ALA A C   1 
ATOM   841  O O   . ALA A 1 108 ? 15.711  -38.231 -30.467 1.00 34.68  ? 191 ALA A O   1 
ATOM   842  C CB  . ALA A 1 108 ? 15.517  -38.597 -33.597 1.00 31.49  ? 191 ALA A CB  1 
ATOM   843  N N   . ARG A 1 109 ? 17.502  -37.293 -31.510 1.00 33.88  ? 192 ARG A N   1 
ATOM   844  C CA  . ARG A 1 109 ? 17.669  -36.124 -30.698 1.00 34.46  ? 192 ARG A CA  1 
ATOM   845  C C   . ARG A 1 109 ? 16.800  -35.036 -31.328 1.00 35.00  ? 192 ARG A C   1 
ATOM   846  O O   . ARG A 1 109 ? 16.781  -34.910 -32.554 1.00 38.39  ? 192 ARG A O   1 
ATOM   847  C CB  . ARG A 1 109 ? 19.170  -35.704 -30.723 1.00 34.45  ? 192 ARG A CB  1 
ATOM   848  C CG  . ARG A 1 109 ? 20.087  -36.506 -29.817 1.00 31.88  ? 192 ARG A CG  1 
ATOM   849  C CD  . ARG A 1 109 ? 19.850  -36.056 -28.340 1.00 33.76  ? 192 ARG A CD  1 
ATOM   850  N NE  . ARG A 1 109 ? 20.681  -34.900 -27.906 1.00 33.38  ? 192 ARG A NE  1 
ATOM   851  C CZ  . ARG A 1 109 ? 20.169  -33.737 -27.535 1.00 32.96  ? 192 ARG A CZ  1 
ATOM   852  N NH1 . ARG A 1 109 ? 18.857  -33.620 -27.495 1.00 31.56  ? 192 ARG A NH1 1 
ATOM   853  N NH2 . ARG A 1 109 ? 20.943  -32.729 -27.165 1.00 32.51  ? 192 ARG A NH2 1 
ATOM   854  N N   . ALA A 1 110 ? 16.082  -34.262 -30.506 1.00 36.15  ? 193 ALA A N   1 
ATOM   855  C CA  . ALA A 1 110 ? 15.418  -33.037 -30.962 1.00 36.26  ? 193 ALA A CA  1 
ATOM   856  C C   . ALA A 1 110 ? 16.138  -31.857 -30.353 1.00 38.49  ? 193 ALA A C   1 
ATOM   857  O O   . ALA A 1 110 ? 16.418  -31.866 -29.162 1.00 41.81  ? 193 ALA A O   1 
ATOM   858  C CB  . ALA A 1 110 ? 13.959  -33.041 -30.589 1.00 33.74  ? 193 ALA A CB  1 
ATOM   859  N N   . TYR A 1 111 ? 16.485  -30.865 -31.169 1.00 41.95  ? 194 TYR A N   1 
ATOM   860  C CA  . TYR A 1 111 ? 17.324  -29.710 -30.746 1.00 40.41  ? 194 TYR A CA  1 
ATOM   861  C C   . TYR A 1 111 ? 16.548  -28.401 -30.630 1.00 42.98  ? 194 TYR A C   1 
ATOM   862  O O   . TYR A 1 111 ? 17.070  -27.420 -30.043 1.00 46.87  ? 194 TYR A O   1 
ATOM   863  C CB  . TYR A 1 111 ? 18.503  -29.516 -31.665 1.00 37.31  ? 194 TYR A CB  1 
ATOM   864  C CG  . TYR A 1 111 ? 19.461  -30.698 -31.696 1.00 39.32  ? 194 TYR A CG  1 
ATOM   865  C CD1 . TYR A 1 111 ? 19.445  -31.592 -32.785 1.00 38.72  ? 194 TYR A CD1 1 
ATOM   866  C CD2 . TYR A 1 111 ? 20.403  -30.942 -30.657 1.00 38.26  ? 194 TYR A CD2 1 
ATOM   867  C CE1 . TYR A 1 111 ? 20.302  -32.682 -32.855 1.00 36.90  ? 194 TYR A CE1 1 
ATOM   868  C CE2 . TYR A 1 111 ? 21.284  -32.040 -30.720 1.00 38.01  ? 194 TYR A CE2 1 
ATOM   869  C CZ  . TYR A 1 111 ? 21.230  -32.906 -31.839 1.00 40.56  ? 194 TYR A CZ  1 
ATOM   870  O OH  . TYR A 1 111 ? 22.070  -34.040 -31.975 1.00 40.37  ? 194 TYR A OH  1 
ATOM   871  N N   . THR A 1 112 ? 15.331  -28.374 -31.170 1.00 39.79  ? 195 THR A N   1 
ATOM   872  C CA  . THR A 1 112 ? 14.452  -27.216 -31.034 1.00 44.58  ? 195 THR A CA  1 
ATOM   873  C C   . THR A 1 112 ? 13.017  -27.703 -30.966 1.00 46.57  ? 195 THR A C   1 
ATOM   874  O O   . THR A 1 112 ? 12.721  -28.886 -31.236 1.00 43.22  ? 195 THR A O   1 
ATOM   875  C CB  . THR A 1 112 ? 14.538  -26.172 -32.217 1.00 45.84  ? 195 THR A CB  1 
ATOM   876  O OG1 . THR A 1 112 ? 13.892  -26.706 -33.389 1.00 47.21  ? 195 THR A OG1 1 
ATOM   877  C CG2 . THR A 1 112 ? 15.964  -25.730 -32.556 1.00 41.18  ? 195 THR A CG2 1 
ATOM   878  N N   . SER A 1 113 ? 12.138  -26.759 -30.623 1.00 52.59  ? 196 SER A N   1 
ATOM   879  C CA  . SER A 1 113 ? 10.688  -26.954 -30.566 1.00 51.64  ? 196 SER A CA  1 
ATOM   880  C C   . SER A 1 113 ? 10.201  -27.399 -31.892 1.00 50.81  ? 196 SER A C   1 
ATOM   881  O O   . SER A 1 113 ? 9.468   -28.364 -31.984 1.00 45.56  ? 196 SER A O   1 
ATOM   882  C CB  . SER A 1 113 ? 10.017  -25.616 -30.323 1.00 58.23  ? 196 SER A CB  1 
ATOM   883  O OG  . SER A 1 113 ? 9.667   -25.569 -28.973 1.00 69.37  ? 196 SER A OG  1 
ATOM   884  N N   . GLU A 1 114 ? 10.604  -26.643 -32.923 1.00 56.26  ? 197 GLU A N   1 
ATOM   885  C CA  . GLU A 1 114 ? 10.160  -26.905 -34.274 1.00 54.56  ? 197 GLU A CA  1 
ATOM   886  C C   . GLU A 1 114 ? 10.648  -28.266 -34.703 1.00 51.73  ? 197 GLU A C   1 
ATOM   887  O O   . GLU A 1 114 ? 9.859   -29.101 -35.160 1.00 51.14  ? 197 GLU A O   1 
ATOM   888  C CB  . GLU A 1 114 ? 10.536  -25.780 -35.198 1.00 60.99  ? 197 GLU A CB  1 
ATOM   889  C CG  . GLU A 1 114 ? 9.780   -24.536 -34.761 1.00 78.35  ? 197 GLU A CG  1 
ATOM   890  C CD  . GLU A 1 114 ? 9.237   -23.682 -35.903 1.00 93.56  ? 197 GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 114 ? 10.059  -23.211 -36.738 1.00 97.84  ? 197 GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 114 ? 7.992   -23.454 -35.936 1.00 90.41  ? 197 GLU A OE2 1 
ATOM   893  N N   . HIS A 1 115 ? 11.912  -28.536 -34.413 1.00 47.01  ? 198 HIS A N   1 
ATOM   894  C CA  . HIS A 1 115 ? 12.497  -29.783 -34.748 1.00 43.80  ? 198 HIS A CA  1 
ATOM   895  C C   . HIS A 1 115 ? 11.669  -30.913 -34.166 1.00 43.98  ? 198 HIS A C   1 
ATOM   896  O O   . HIS A 1 115 ? 11.363  -31.911 -34.844 1.00 40.66  ? 198 HIS A O   1 
ATOM   897  C CB  . HIS A 1 115 ? 13.890  -29.779 -34.178 1.00 43.31  ? 198 HIS A CB  1 
ATOM   898  C CG  . HIS A 1 115 ? 14.728  -30.929 -34.627 1.00 43.55  ? 198 HIS A CG  1 
ATOM   899  N ND1 . HIS A 1 115 ? 14.573  -31.520 -35.851 1.00 46.78  ? 198 HIS A ND1 1 
ATOM   900  C CD2 . HIS A 1 115 ? 15.776  -31.580 -34.008 1.00 41.29  ? 198 HIS A CD2 1 
ATOM   901  C CE1 . HIS A 1 115 ? 15.487  -32.487 -36.006 1.00 43.42  ? 198 HIS A CE1 1 
ATOM   902  N NE2 . HIS A 1 115 ? 16.215  -32.542 -34.864 1.00 44.52  ? 198 HIS A NE2 1 
ATOM   903  N N   . GLN A 1 116 ? 11.276  -30.749 -32.900 1.00 42.44  ? 199 GLN A N   1 
ATOM   904  C CA  . GLN A 1 116 ? 10.603  -31.796 -32.175 1.00 40.23  ? 199 GLN A CA  1 
ATOM   905  C C   . GLN A 1 116 ? 9.297   -32.115 -32.972 1.00 40.83  ? 199 GLN A C   1 
ATOM   906  O O   . GLN A 1 116 ? 8.910   -33.244 -33.126 1.00 39.85  ? 199 GLN A O   1 
ATOM   907  C CB  . GLN A 1 116 ? 10.374  -31.366 -30.693 1.00 38.13  ? 199 GLN A CB  1 
ATOM   908  C CG  . GLN A 1 116 ? 9.469   -32.325 -29.906 1.00 37.73  ? 199 GLN A CG  1 
ATOM   909  C CD  . GLN A 1 116 ? 9.267   -31.936 -28.442 1.00 41.09  ? 199 GLN A CD  1 
ATOM   910  O OE1 . GLN A 1 116 ? 8.282   -32.327 -27.815 1.00 40.45  ? 199 GLN A OE1 1 
ATOM   911  N NE2 . GLN A 1 116 ? 10.179  -31.140 -27.896 1.00 41.97  ? 199 GLN A NE2 1 
ATOM   912  N N   . MET A 1 117 ? 8.656   -31.112 -33.529 1.00 43.08  ? 200 MET A N   1 
ATOM   913  C CA  . MET A 1 117 ? 7.382   -31.324 -34.165 1.00 44.38  ? 200 MET A CA  1 
ATOM   914  C C   . MET A 1 117 ? 7.590   -31.925 -35.559 1.00 45.88  ? 200 MET A C   1 
ATOM   915  O O   . MET A 1 117 ? 6.798   -32.755 -35.980 1.00 48.59  ? 200 MET A O   1 
ATOM   916  C CB  . MET A 1 117 ? 6.594   -30.002 -34.171 1.00 47.50  ? 200 MET A CB  1 
ATOM   917  C CG  . MET A 1 117 ? 5.163   -30.022 -34.692 1.00 51.47  ? 200 MET A CG  1 
ATOM   918  S SD  . MET A 1 117 ? 4.001   -31.303 -34.114 1.00 61.68  ? 200 MET A SD  1 
ATOM   919  C CE  . MET A 1 117 ? 2.522   -30.606 -34.875 1.00 63.64  ? 200 MET A CE  1 
ATOM   920  N N   . GLU A 1 118 ? 8.658   -31.544 -36.258 1.00 47.11  ? 201 GLU A N   1 
ATOM   921  C CA  . GLU A 1 118 ? 9.057   -32.216 -37.521 1.00 48.93  ? 201 GLU A CA  1 
ATOM   922  C C   . GLU A 1 118 ? 9.387   -33.691 -37.340 1.00 46.62  ? 201 GLU A C   1 
ATOM   923  O O   . GLU A 1 118 ? 9.236   -34.451 -38.283 1.00 48.82  ? 201 GLU A O   1 
ATOM   924  C CB  . GLU A 1 118 ? 10.298  -31.597 -38.167 1.00 49.17  ? 201 GLU A CB  1 
ATOM   925  C CG  . GLU A 1 118 ? 10.172  -30.163 -38.632 1.00 58.08  ? 201 GLU A CG  1 
ATOM   926  C CD  . GLU A 1 118 ? 11.541  -29.499 -38.824 1.00 67.26  ? 201 GLU A CD  1 
ATOM   927  O OE1 . GLU A 1 118 ? 11.551  -28.276 -39.156 1.00 69.92  ? 201 GLU A OE1 1 
ATOM   928  O OE2 . GLU A 1 118 ? 12.599  -30.198 -38.638 1.00 65.75  ? 201 GLU A OE2 1 
ATOM   929  N N   . LEU A 1 119 ? 9.863   -34.082 -36.163 1.00 42.77  ? 202 LEU A N   1 
ATOM   930  C CA  . LEU A 1 119 ? 10.171  -35.480 -35.878 1.00 43.45  ? 202 LEU A CA  1 
ATOM   931  C C   . LEU A 1 119 ? 8.894   -36.303 -35.768 1.00 44.75  ? 202 LEU A C   1 
ATOM   932  O O   . LEU A 1 119 ? 8.857   -37.486 -36.151 1.00 42.77  ? 202 LEU A O   1 
ATOM   933  C CB  . LEU A 1 119 ? 10.947  -35.592 -34.555 1.00 44.50  ? 202 LEU A CB  1 
ATOM   934  C CG  . LEU A 1 119 ? 12.406  -35.097 -34.599 1.00 46.43  ? 202 LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 119 ? 13.099  -35.400 -33.286 1.00 44.13  ? 202 LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 119 ? 13.176  -35.653 -35.794 1.00 41.87  ? 202 LEU A CD2 1 
ATOM   937  N N   . LEU A 1 120 ? 7.842   -35.671 -35.250 1.00 42.58  ? 203 LEU A N   1 
ATOM   938  C CA  . LEU A 1 120 ? 6.558   -36.324 -35.163 1.00 43.35  ? 203 LEU A CA  1 
ATOM   939  C C   . LEU A 1 120 ? 6.000   -36.672 -36.513 1.00 45.86  ? 203 LEU A C   1 
ATOM   940  O O   . LEU A 1 120 ? 5.432   -37.758 -36.680 1.00 44.48  ? 203 LEU A O   1 
ATOM   941  C CB  . LEU A 1 120 ? 5.579   -35.481 -34.390 1.00 44.64  ? 203 LEU A CB  1 
ATOM   942  C CG  . LEU A 1 120 ? 5.583   -35.876 -32.911 1.00 49.37  ? 203 LEU A CG  1 
ATOM   943  C CD1 . LEU A 1 120 ? 6.829   -36.573 -32.431 1.00 47.15  ? 203 LEU A CD1 1 
ATOM   944  C CD2 . LEU A 1 120 ? 5.333   -34.720 -31.979 1.00 51.98  ? 203 LEU A CD2 1 
ATOM   945  N N   . ASP A 1 121 ? 6.196   -35.790 -37.494 1.00 48.98  ? 204 ASP A N   1 
ATOM   946  C CA  . ASP A 1 121 ? 5.602   -35.995 -38.805 1.00 51.65  ? 204 ASP A CA  1 
ATOM   947  C C   . ASP A 1 121 ? 6.266   -37.172 -39.411 1.00 50.93  ? 204 ASP A C   1 
ATOM   948  O O   . ASP A 1 121 ? 5.615   -38.085 -39.898 1.00 55.77  ? 204 ASP A O   1 
ATOM   949  C CB  . ASP A 1 121 ? 5.746   -34.767 -39.677 1.00 60.42  ? 204 ASP A CB  1 
ATOM   950  C CG  . ASP A 1 121 ? 4.848   -33.614 -39.218 1.00 72.50  ? 204 ASP A CG  1 
ATOM   951  O OD1 . ASP A 1 121 ? 4.056   -33.728 -38.193 1.00 71.67  ? 204 ASP A OD1 1 
ATOM   952  O OD2 . ASP A 1 121 ? 4.979   -32.578 -39.907 1.00 79.29  ? 204 ASP A OD2 1 
ATOM   953  N N   . TYR A 1 122 ? 7.572   -37.215 -39.267 1.00 49.99  ? 205 TYR A N   1 
ATOM   954  C CA  . TYR A 1 122 ? 8.302   -38.398 -39.643 1.00 51.11  ? 205 TYR A CA  1 
ATOM   955  C C   . TYR A 1 122 ? 7.843   -39.695 -38.917 1.00 50.49  ? 205 TYR A C   1 
ATOM   956  O O   . TYR A 1 122 ? 7.617   -40.697 -39.579 1.00 53.75  ? 205 TYR A O   1 
ATOM   957  C CB  . TYR A 1 122 ? 9.813   -38.171 -39.487 1.00 53.34  ? 205 TYR A CB  1 
ATOM   958  C CG  . TYR A 1 122 ? 10.567  -39.363 -39.966 1.00 59.47  ? 205 TYR A CG  1 
ATOM   959  C CD1 . TYR A 1 122 ? 10.958  -40.370 -39.075 1.00 62.34  ? 205 TYR A CD1 1 
ATOM   960  C CD2 . TYR A 1 122 ? 10.807  -39.554 -41.326 1.00 65.30  ? 205 TYR A CD2 1 
ATOM   961  C CE1 . TYR A 1 122 ? 11.628  -41.515 -39.522 1.00 68.46  ? 205 TYR A CE1 1 
ATOM   962  C CE2 . TYR A 1 122 ? 11.460  -40.702 -41.784 1.00 68.42  ? 205 TYR A CE2 1 
ATOM   963  C CZ  . TYR A 1 122 ? 11.873  -41.663 -40.884 1.00 67.40  ? 205 TYR A CZ  1 
ATOM   964  O OH  . TYR A 1 122 ? 12.513  -42.776 -41.342 1.00 74.00  ? 205 TYR A OH  1 
ATOM   965  N N   . VAL A 1 123 ? 7.733   -39.683 -37.579 1.00 44.21  ? 206 VAL A N   1 
ATOM   966  C CA  . VAL A 1 123 ? 7.229   -40.821 -36.840 1.00 40.00  ? 206 VAL A CA  1 
ATOM   967  C C   . VAL A 1 123 ? 5.831   -41.225 -37.377 1.00 43.79  ? 206 VAL A C   1 
ATOM   968  O O   . VAL A 1 123 ? 5.576   -42.402 -37.660 1.00 45.00  ? 206 VAL A O   1 
ATOM   969  C CB  . VAL A 1 123 ? 7.101   -40.454 -35.347 1.00 38.41  ? 206 VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 123 ? 6.181   -41.403 -34.585 1.00 31.56  ? 206 VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 123 ? 8.454   -40.379 -34.711 1.00 37.85  ? 206 VAL A CG2 1 
ATOM   972  N N   . ALA A 1 124 ? 4.930   -40.252 -37.520 1.00 41.83  ? 207 ALA A N   1 
ATOM   973  C CA  . ALA A 1 124 ? 3.601   -40.542 -37.976 1.00 41.77  ? 207 ALA A CA  1 
ATOM   974  C C   . ALA A 1 124 ? 3.672   -41.357 -39.244 1.00 48.73  ? 207 ALA A C   1 
ATOM   975  O O   . ALA A 1 124 ? 3.049   -42.419 -39.332 1.00 50.15  ? 207 ALA A O   1 
ATOM   976  C CB  . ALA A 1 124 ? 2.835   -39.272 -38.191 1.00 38.70  ? 207 ALA A CB  1 
ATOM   977  N N   . ALA A 1 125 ? 4.461   -40.897 -40.219 1.00 51.69  ? 208 ALA A N   1 
ATOM   978  C CA  . ALA A 1 125 ? 4.480   -41.562 -41.519 1.00 54.44  ? 208 ALA A CA  1 
ATOM   979  C C   . ALA A 1 125 ? 5.180   -42.919 -41.418 1.00 53.78  ? 208 ALA A C   1 
ATOM   980  O O   . ALA A 1 125 ? 4.842   -43.888 -42.091 1.00 56.30  ? 208 ALA A O   1 
ATOM   981  C CB  . ALA A 1 125 ? 5.124   -40.666 -42.562 1.00 58.71  ? 208 ALA A CB  1 
ATOM   982  N N   . LYS A 1 126 ? 6.117   -43.021 -40.509 1.00 52.18  ? 209 LYS A N   1 
ATOM   983  C CA  . LYS A 1 126 ? 6.742   -44.303 -40.283 1.00 54.42  ? 209 LYS A CA  1 
ATOM   984  C C   . LYS A 1 126 ? 5.705   -45.338 -39.765 1.00 58.19  ? 209 LYS A C   1 
ATOM   985  O O   . LYS A 1 126 ? 5.660   -46.480 -40.232 1.00 58.42  ? 209 LYS A O   1 
ATOM   986  C CB  . LYS A 1 126 ? 7.958   -44.101 -39.383 1.00 50.33  ? 209 LYS A CB  1 
ATOM   987  C CG  . LYS A 1 126 ? 8.524   -45.301 -38.657 1.00 52.19  ? 209 LYS A CG  1 
ATOM   988  C CD  . LYS A 1 126 ? 9.331   -46.224 -39.543 1.00 57.73  ? 209 LYS A CD  1 
ATOM   989  C CE  . LYS A 1 126 ? 10.702  -45.711 -39.944 1.00 55.59  ? 209 LYS A CE  1 
ATOM   990  N NZ  . LYS A 1 126 ? 11.280  -46.868 -40.707 1.00 54.11  ? 209 LYS A NZ  1 
ATOM   991  N N   . PHE A 1 127 ? 4.831   -44.915 -38.855 1.00 54.88  ? 210 PHE A N   1 
ATOM   992  C CA  . PHE A 1 127 ? 3.839   -45.819 -38.321 1.00 50.88  ? 210 PHE A CA  1 
ATOM   993  C C   . PHE A 1 127 ? 2.904   -46.223 -39.434 1.00 55.21  ? 210 PHE A C   1 
ATOM   994  O O   . PHE A 1 127 ? 2.394   -47.339 -39.454 1.00 61.14  ? 210 PHE A O   1 
ATOM   995  C CB  . PHE A 1 127 ? 3.038   -45.163 -37.185 1.00 46.22  ? 210 PHE A CB  1 
ATOM   996  C CG  . PHE A 1 127 ? 3.790   -45.025 -35.903 1.00 37.65  ? 210 PHE A CG  1 
ATOM   997  C CD1 . PHE A 1 127 ? 5.045   -45.574 -35.747 1.00 36.16  ? 210 PHE A CD1 1 
ATOM   998  C CD2 . PHE A 1 127 ? 3.216   -44.364 -34.848 1.00 35.44  ? 210 PHE A CD2 1 
ATOM   999  C CE1 . PHE A 1 127 ? 5.735   -45.412 -34.548 1.00 39.01  ? 210 PHE A CE1 1 
ATOM   1000 C CE2 . PHE A 1 127 ? 3.880   -44.204 -33.629 1.00 35.72  ? 210 PHE A CE2 1 
ATOM   1001 C CZ  . PHE A 1 127 ? 5.160   -44.726 -33.478 1.00 36.81  ? 210 PHE A CZ  1 
ATOM   1002 N N   . HIS A 1 128 ? 2.698   -45.312 -40.372 1.00 59.54  ? 211 HIS A N   1 
ATOM   1003 C CA  . HIS A 1 128 ? 1.739   -45.531 -41.442 1.00 66.76  ? 211 HIS A CA  1 
ATOM   1004 C C   . HIS A 1 128 ? 2.275   -46.503 -42.463 1.00 71.00  ? 211 HIS A C   1 
ATOM   1005 O O   . HIS A 1 128 ? 1.523   -47.142 -43.186 1.00 77.62  ? 211 HIS A O   1 
ATOM   1006 C CB  . HIS A 1 128 ? 1.302   -44.190 -42.042 1.00 69.17  ? 211 HIS A CB  1 
ATOM   1007 C CG  . HIS A 1 128 ? 0.478   -44.314 -43.307 1.00 76.78  ? 211 HIS A CG  1 
ATOM   1008 N ND1 . HIS A 1 128 ? -0.866  -44.232 -43.305 1.00 77.06  ? 211 HIS A ND1 1 
ATOM   1009 C CD2 . HIS A 1 128 ? 0.868   -44.494 -44.652 1.00 78.03  ? 211 HIS A CD2 1 
ATOM   1010 C CE1 . HIS A 1 128 ? -1.320  -44.389 -44.577 1.00 85.18  ? 211 HIS A CE1 1 
ATOM   1011 N NE2 . HIS A 1 128 ? -0.254  -44.543 -45.395 1.00 80.90  ? 211 HIS A NE2 1 
ATOM   1012 N N   . GLU A 1 129 ? 3.583   -46.660 -42.500 1.00 77.15  ? 212 GLU A N   1 
ATOM   1013 C CA  . GLU A 1 129 ? 4.191   -47.512 -43.501 1.00 80.72  ? 212 GLU A CA  1 
ATOM   1014 C C   . GLU A 1 129 ? 3.918   -48.963 -43.230 1.00 79.59  ? 212 GLU A C   1 
ATOM   1015 O O   . GLU A 1 129 ? 3.648   -49.739 -44.154 1.00 91.07  ? 212 GLU A O   1 
ATOM   1016 C CB  . GLU A 1 129 ? 5.683   -47.264 -43.590 1.00 85.34  ? 212 GLU A CB  1 
ATOM   1017 C CG  . GLU A 1 129 ? 6.052   -46.305 -44.711 1.00 86.33  ? 212 GLU A CG  1 
ATOM   1018 C CD  . GLU A 1 129 ? 7.464   -46.542 -45.198 1.00 92.40  ? 212 GLU A CD  1 
ATOM   1019 O OE1 . GLU A 1 129 ? 7.700   -46.346 -46.412 1.00 101.94 ? 212 GLU A OE1 1 
ATOM   1020 O OE2 . GLU A 1 129 ? 8.326   -46.941 -44.368 1.00 85.74  ? 212 GLU A OE2 1 
ATOM   1021 N N   . GLU A 1 130 ? 3.992   -49.357 -41.975 1.00 72.02  ? 213 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 130 ? 3.447   -50.656 -41.650 1.00 75.11  ? 213 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 130 ? 2.937   -50.619 -40.246 1.00 65.51  ? 213 GLU A C   1 
ATOM   1024 O O   . GLU A 1 130 ? 3.638   -50.217 -39.337 1.00 61.17  ? 213 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 130 ? 4.435   -51.810 -41.891 1.00 77.01  ? 213 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 130 ? 3.840   -53.219 -41.783 1.00 78.96  ? 213 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 130 ? 4.811   -54.316 -42.231 1.00 88.49  ? 213 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 130 ? 5.992   -53.999 -42.545 1.00 88.51  ? 213 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 130 ? 4.399   -55.505 -42.273 1.00 89.82  ? 213 GLU A OE2 1 
ATOM   1030 N N   . ALA A 1 131 ? 1.693   -51.052 -40.133 1.00 63.93  ? 214 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 131 ? 0.899   -50.959 -38.939 1.00 70.02  ? 214 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 131 ? 1.258   -52.132 -38.079 1.00 67.47  ? 214 ALA A C   1 
ATOM   1033 O O   . ALA A 1 131 ? 1.448   -53.247 -38.582 1.00 65.88  ? 214 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 131 ? -0.592  -51.021 -39.298 1.00 74.18  ? 214 ALA A CB  1 
ATOM   1035 N N   . GLY A 1 132 ? 1.353   -51.890 -36.781 1.00 62.56  ? 215 GLY A N   1 
ATOM   1036 C CA  . GLY A 1 132 ? 1.577   -52.987 -35.888 1.00 61.03  ? 215 GLY A CA  1 
ATOM   1037 C C   . GLY A 1 132 ? 3.023   -53.230 -35.589 1.00 59.37  ? 215 GLY A C   1 
ATOM   1038 O O   . GLY A 1 132 ? 3.309   -53.878 -34.606 1.00 71.36  ? 215 GLY A O   1 
ATOM   1039 N N   . ILE A 1 133 ? 3.948   -52.718 -36.391 1.00 55.52  ? 216 ILE A N   1 
ATOM   1040 C CA  . ILE A 1 133 ? 5.365   -52.962 -36.092 1.00 55.67  ? 216 ILE A CA  1 
ATOM   1041 C C   . ILE A 1 133 ? 5.844   -52.128 -34.875 1.00 52.76  ? 216 ILE A C   1 
ATOM   1042 O O   . ILE A 1 133 ? 6.446   -52.683 -33.930 1.00 48.43  ? 216 ILE A O   1 
ATOM   1043 C CB  . ILE A 1 133 ? 6.274   -52.902 -37.345 1.00 63.97  ? 216 ILE A CB  1 
ATOM   1044 C CG1 . ILE A 1 133 ? 5.943   -51.676 -38.198 1.00 77.83  ? 216 ILE A CG1 1 
ATOM   1045 C CG2 . ILE A 1 133 ? 6.041   -54.134 -38.239 1.00 58.09  ? 216 ILE A CG2 1 
ATOM   1046 C CD1 . ILE A 1 133 ? 7.040   -51.265 -39.180 1.00 91.78  ? 216 ILE A CD1 1 
ATOM   1047 N N   . PHE A 1 134 ? 5.510   -50.832 -34.828 1.00 45.07  ? 217 PHE A N   1 
ATOM   1048 C CA  . PHE A 1 134 ? 5.853   -50.022 -33.643 1.00 40.36  ? 217 PHE A CA  1 
ATOM   1049 C C   . PHE A 1 134 ? 4.776   -49.977 -32.582 1.00 38.17  ? 217 PHE A C   1 
ATOM   1050 O O   . PHE A 1 134 ? 3.611   -49.967 -32.900 1.00 38.58  ? 217 PHE A O   1 
ATOM   1051 C CB  . PHE A 1 134 ? 6.256   -48.615 -34.029 1.00 38.50  ? 217 PHE A CB  1 
ATOM   1052 C CG  . PHE A 1 134 ? 7.541   -48.556 -34.769 1.00 39.63  ? 217 PHE A CG  1 
ATOM   1053 C CD1 . PHE A 1 134 ? 7.573   -48.760 -36.158 1.00 40.96  ? 217 PHE A CD1 1 
ATOM   1054 C CD2 . PHE A 1 134 ? 8.727   -48.324 -34.092 1.00 40.58  ? 217 PHE A CD2 1 
ATOM   1055 C CE1 . PHE A 1 134 ? 8.782   -48.714 -36.877 1.00 41.83  ? 217 PHE A CE1 1 
ATOM   1056 C CE2 . PHE A 1 134 ? 9.952   -48.275 -34.797 1.00 44.43  ? 217 PHE A CE2 1 
ATOM   1057 C CZ  . PHE A 1 134 ? 9.976   -48.488 -36.192 1.00 41.96  ? 217 PHE A CZ  1 
ATOM   1058 N N   . LYS A 1 135 ? 5.184   -49.944 -31.311 1.00 38.70  ? 218 LYS A N   1 
ATOM   1059 C CA  . LYS A 1 135 ? 4.256   -50.112 -30.190 1.00 36.01  ? 218 LYS A CA  1 
ATOM   1060 C C   . LYS A 1 135 ? 4.303   -48.990 -29.211 1.00 35.88  ? 218 LYS A C   1 
ATOM   1061 O O   . LYS A 1 135 ? 3.305   -48.756 -28.543 1.00 42.12  ? 218 LYS A O   1 
ATOM   1062 C CB  . LYS A 1 135 ? 4.531   -51.404 -29.442 1.00 37.26  ? 218 LYS A CB  1 
ATOM   1063 C CG  . LYS A 1 135 ? 4.305   -52.674 -30.268 1.00 39.70  ? 218 LYS A CG  1 
ATOM   1064 C CD  . LYS A 1 135 ? 2.834   -52.949 -30.526 1.00 40.19  ? 218 LYS A CD  1 
ATOM   1065 C CE  . LYS A 1 135 ? 2.688   -54.084 -31.523 1.00 40.89  ? 218 LYS A CE  1 
ATOM   1066 N NZ  . LYS A 1 135 ? 1.498   -53.851 -32.408 1.00 45.35  ? 218 LYS A NZ  1 
ATOM   1067 N N   . LEU A 1 136 ? 5.433   -48.281 -29.143 1.00 34.00  ? 219 LEU A N   1 
ATOM   1068 C CA  . LEU A 1 136 ? 5.709   -47.276 -28.117 1.00 32.70  ? 219 LEU A CA  1 
ATOM   1069 C C   . LEU A 1 136 ? 6.420   -46.132 -28.775 1.00 36.52  ? 219 LEU A C   1 
ATOM   1070 O O   . LEU A 1 136 ? 7.218   -46.316 -29.736 1.00 34.09  ? 219 LEU A O   1 
ATOM   1071 C CB  . LEU A 1 136 ? 6.747   -47.772 -27.148 1.00 37.07  ? 219 LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 136 ? 6.805   -47.563 -25.637 1.00 40.27  ? 219 LEU A CG  1 
ATOM   1073 C CD1 . LEU A 1 136 ? 8.232   -47.692 -25.146 1.00 35.13  ? 219 LEU A CD1 1 
ATOM   1074 C CD2 . LEU A 1 136 ? 6.028   -46.366 -25.082 1.00 37.84  ? 219 LEU A CD2 1 
ATOM   1075 N N   . LEU A 1 137 ? 6.131   -44.953 -28.251 1.00 36.32  ? 220 LEU A N   1 
ATOM   1076 C CA  . LEU A 1 137 ? 6.700   -43.722 -28.697 1.00 34.15  ? 220 LEU A CA  1 
ATOM   1077 C C   . LEU A 1 137 ? 7.038   -43.021 -27.374 1.00 36.90  ? 220 LEU A C   1 
ATOM   1078 O O   . LEU A 1 137 ? 6.114   -42.721 -26.530 1.00 34.50  ? 220 LEU A O   1 
ATOM   1079 C CB  . LEU A 1 137 ? 5.659   -42.907 -29.408 1.00 36.02  ? 220 LEU A CB  1 
ATOM   1080 C CG  . LEU A 1 137 ? 6.212   -41.704 -30.229 1.00 40.41  ? 220 LEU A CG  1 
ATOM   1081 C CD1 . LEU A 1 137 ? 5.358   -40.446 -30.208 1.00 33.25  ? 220 LEU A CD1 1 
ATOM   1082 C CD2 . LEU A 1 137 ? 7.665   -41.391 -29.880 1.00 37.76  ? 220 LEU A CD2 1 
ATOM   1083 N N   . ILE A 1 138 ? 8.336   -42.805 -27.165 1.00 30.27  ? 221 ILE A N   1 
ATOM   1084 C CA  . ILE A 1 138 ? 8.766   -42.161 -25.955 1.00 32.95  ? 221 ILE A CA  1 
ATOM   1085 C C   . ILE A 1 138 ? 9.269   -40.812 -26.374 1.00 31.98  ? 221 ILE A C   1 
ATOM   1086 O O   . ILE A 1 138 ? 9.949   -40.712 -27.392 1.00 35.45  ? 221 ILE A O   1 
ATOM   1087 C CB  . ILE A 1 138 ? 9.908   -42.942 -25.274 1.00 33.87  ? 221 ILE A CB  1 
ATOM   1088 C CG1 . ILE A 1 138 ? 9.402   -44.270 -24.729 1.00 30.28  ? 221 ILE A CG1 1 
ATOM   1089 C CG2 . ILE A 1 138 ? 10.487  -42.118 -24.164 1.00 31.10  ? 221 ILE A CG2 1 
ATOM   1090 C CD1 . ILE A 1 138 ? 10.502  -45.265 -24.438 1.00 29.91  ? 221 ILE A CD1 1 
ATOM   1091 N N   . ILE A 1 139 ? 8.867   -39.777 -25.652 1.00 35.24  ? 222 ILE A N   1 
ATOM   1092 C CA  . ILE A 1 139 ? 9.433   -38.433 -25.757 1.00 36.05  ? 222 ILE A CA  1 
ATOM   1093 C C   . ILE A 1 139 ? 9.949   -38.002 -24.401 1.00 41.34  ? 222 ILE A C   1 
ATOM   1094 O O   . ILE A 1 139 ? 9.155   -37.780 -23.450 1.00 41.23  ? 222 ILE A O   1 
ATOM   1095 C CB  . ILE A 1 139 ? 8.417   -37.403 -26.219 1.00 36.82  ? 222 ILE A CB  1 
ATOM   1096 C CG1 . ILE A 1 139 ? 7.733   -37.890 -27.516 1.00 38.73  ? 222 ILE A CG1 1 
ATOM   1097 C CG2 . ILE A 1 139 ? 9.163   -36.076 -26.459 1.00 36.53  ? 222 ILE A CG2 1 
ATOM   1098 C CD1 . ILE A 1 139 ? 6.439   -37.196 -27.927 1.00 37.46  ? 222 ILE A CD1 1 
ATOM   1099 N N   . ASP A 1 140 ? 11.282  -37.886 -24.317 1.00 45.09  ? 223 ASP A N   1 
ATOM   1100 C CA  . ASP A 1 140 ? 11.995  -37.522 -23.104 1.00 44.73  ? 223 ASP A CA  1 
ATOM   1101 C C   . ASP A 1 140 ? 12.814  -36.255 -23.350 1.00 48.44  ? 223 ASP A C   1 
ATOM   1102 O O   . ASP A 1 140 ? 13.907  -36.320 -23.912 1.00 49.89  ? 223 ASP A O   1 
ATOM   1103 C CB  . ASP A 1 140 ? 12.927  -38.692 -22.702 1.00 48.59  ? 223 ASP A CB  1 
ATOM   1104 C CG  . ASP A 1 140 ? 13.613  -38.493 -21.290 1.00 55.70  ? 223 ASP A CG  1 
ATOM   1105 O OD1 . ASP A 1 140 ? 14.704  -39.056 -21.068 1.00 54.07  ? 223 ASP A OD1 1 
ATOM   1106 O OD2 . ASP A 1 140 ? 13.068  -37.787 -20.401 1.00 61.02  ? 223 ASP A OD2 1 
ATOM   1107 N N   . SER A 1 141 ? 12.323  -35.091 -22.941 1.00 49.17  ? 224 SER A N   1 
ATOM   1108 C CA  . SER A 1 141 ? 11.014  -34.909 -22.362 1.00 48.12  ? 224 SER A CA  1 
ATOM   1109 C C   . SER A 1 141 ? 10.171  -34.039 -23.282 1.00 46.96  ? 224 SER A C   1 
ATOM   1110 O O   . SER A 1 141 ? 10.672  -33.279 -24.102 1.00 51.64  ? 224 SER A O   1 
ATOM   1111 C CB  . SER A 1 141 ? 11.103  -34.187 -21.024 1.00 43.50  ? 224 SER A CB  1 
ATOM   1112 O OG  . SER A 1 141 ? 11.703  -32.956 -21.300 1.00 46.77  ? 224 SER A OG  1 
ATOM   1113 N N   . ILE A 1 142 ? 8.880   -34.112 -23.029 1.00 44.77  ? 225 ILE A N   1 
ATOM   1114 C CA  . ILE A 1 142 ? 7.838   -33.522 -23.810 1.00 46.29  ? 225 ILE A CA  1 
ATOM   1115 C C   . ILE A 1 142 ? 7.947   -32.023 -24.124 1.00 47.84  ? 225 ILE A C   1 
ATOM   1116 O O   . ILE A 1 142 ? 7.692   -31.635 -25.249 1.00 52.32  ? 225 ILE A O   1 
ATOM   1117 C CB  . ILE A 1 142 ? 6.450   -33.848 -23.149 1.00 44.60  ? 225 ILE A CB  1 
ATOM   1118 C CG1 . ILE A 1 142 ? 5.317   -33.429 -24.082 1.00 39.36  ? 225 ILE A CG1 1 
ATOM   1119 C CG2 . ILE A 1 142 ? 6.383   -33.265 -21.750 1.00 42.94  ? 225 ILE A CG2 1 
ATOM   1120 C CD1 . ILE A 1 142 ? 5.462   -34.132 -25.420 1.00 42.21  ? 225 ILE A CD1 1 
ATOM   1121 N N   . MET A 1 143 ? 8.312   -31.205 -23.151 1.00 47.96  ? 226 MET A N   1 
ATOM   1122 C CA  . MET A 1 143 ? 8.136   -29.781 -23.254 1.00 51.09  ? 226 MET A CA  1 
ATOM   1123 C C   . MET A 1 143 ? 9.364   -28.954 -22.921 1.00 51.51  ? 226 MET A C   1 
ATOM   1124 O O   . MET A 1 143 ? 9.278   -27.715 -22.903 1.00 51.15  ? 226 MET A O   1 
ATOM   1125 C CB  . MET A 1 143 ? 7.189   -29.403 -22.158 1.00 58.00  ? 226 MET A CB  1 
ATOM   1126 C CG  . MET A 1 143 ? 5.816   -29.031 -22.571 1.00 60.87  ? 226 MET A CG  1 
ATOM   1127 S SD  . MET A 1 143 ? 5.365   -28.212 -21.064 1.00 67.63  ? 226 MET A SD  1 
ATOM   1128 C CE  . MET A 1 143 ? 5.468   -26.508 -21.602 1.00 62.81  ? 226 MET A CE  1 
ATOM   1129 N N   . ALA A 1 144 ? 10.476  -29.587 -22.571 1.00 46.75  ? 227 ALA A N   1 
ATOM   1130 C CA  . ALA A 1 144 ? 11.676  -28.800 -22.289 1.00 45.29  ? 227 ALA A CA  1 
ATOM   1131 C C   . ALA A 1 144 ? 11.934  -27.766 -23.411 1.00 46.51  ? 227 ALA A C   1 
ATOM   1132 O O   . ALA A 1 144 ? 12.099  -26.588 -23.142 1.00 51.41  ? 227 ALA A O   1 
ATOM   1133 C CB  . ALA A 1 144 ? 12.870  -29.703 -22.081 1.00 42.17  ? 227 ALA A CB  1 
ATOM   1134 N N   . LEU A 1 145 ? 11.878  -28.191 -24.669 1.00 45.32  ? 228 LEU A N   1 
ATOM   1135 C CA  . LEU A 1 145 ? 12.162  -27.317 -25.808 1.00 46.42  ? 228 LEU A CA  1 
ATOM   1136 C C   . LEU A 1 145 ? 11.207  -26.118 -25.956 1.00 50.48  ? 228 LEU A C   1 
ATOM   1137 O O   . LEU A 1 145 ? 11.567  -25.078 -26.545 1.00 52.06  ? 228 LEU A O   1 
ATOM   1138 C CB  . LEU A 1 145 ? 12.182  -28.161 -27.084 1.00 45.32  ? 228 LEU A CB  1 
ATOM   1139 C CG  . LEU A 1 145 ? 13.351  -29.147 -27.028 1.00 43.81  ? 228 LEU A CG  1 
ATOM   1140 C CD1 . LEU A 1 145 ? 13.366  -30.071 -28.221 1.00 44.33  ? 228 LEU A CD1 1 
ATOM   1141 C CD2 . LEU A 1 145 ? 14.671  -28.400 -26.937 1.00 45.42  ? 228 LEU A CD2 1 
ATOM   1142 N N   . PHE A 1 146 ? 10.004  -26.253 -25.404 1.00 50.09  ? 229 PHE A N   1 
ATOM   1143 C CA  . PHE A 1 146 ? 9.003   -25.204 -25.522 1.00 53.34  ? 229 PHE A CA  1 
ATOM   1144 C C   . PHE A 1 146 ? 9.258   -24.108 -24.507 1.00 58.92  ? 229 PHE A C   1 
ATOM   1145 O O   . PHE A 1 146 ? 9.096   -22.934 -24.842 1.00 62.38  ? 229 PHE A O   1 
ATOM   1146 C CB  . PHE A 1 146 ? 7.563   -25.771 -25.482 1.00 49.23  ? 229 PHE A CB  1 
ATOM   1147 C CG  . PHE A 1 146 ? 7.219   -26.600 -26.705 1.00 47.80  ? 229 PHE A CG  1 
ATOM   1148 C CD1 . PHE A 1 146 ? 7.627   -27.954 -26.800 1.00 46.72  ? 229 PHE A CD1 1 
ATOM   1149 C CD2 . PHE A 1 146 ? 6.546   -26.029 -27.790 1.00 46.92  ? 229 PHE A CD2 1 
ATOM   1150 C CE1 . PHE A 1 146 ? 7.332   -28.706 -27.940 1.00 44.23  ? 229 PHE A CE1 1 
ATOM   1151 C CE2 . PHE A 1 146 ? 6.255   -26.775 -28.936 1.00 47.08  ? 229 PHE A CE2 1 
ATOM   1152 C CZ  . PHE A 1 146 ? 6.650   -28.113 -29.004 1.00 46.16  ? 229 PHE A CZ  1 
ATOM   1153 N N   . ARG A 1 147 ? 9.681   -24.484 -23.292 1.00 60.35  ? 230 ARG A N   1 
ATOM   1154 C CA  . ARG A 1 147 ? 10.153  -23.515 -22.303 1.00 66.59  ? 230 ARG A CA  1 
ATOM   1155 C C   . ARG A 1 147 ? 11.348  -22.747 -22.888 1.00 71.74  ? 230 ARG A C   1 
ATOM   1156 O O   . ARG A 1 147 ? 11.477  -21.521 -22.699 1.00 67.14  ? 230 ARG A O   1 
ATOM   1157 C CB  . ARG A 1 147 ? 10.597  -24.207 -21.008 1.00 69.27  ? 230 ARG A CB  1 
ATOM   1158 C CG  . ARG A 1 147 ? 9.485   -24.630 -20.066 1.00 74.73  ? 230 ARG A CG  1 
ATOM   1159 C CD  . ARG A 1 147 ? 9.843   -24.287 -18.624 1.00 83.83  ? 230 ARG A CD  1 
ATOM   1160 N NE  . ARG A 1 147 ? 10.656  -25.330 -17.989 1.00 86.96  ? 230 ARG A NE  1 
ATOM   1161 C CZ  . ARG A 1 147 ? 10.997  -25.358 -16.697 1.00 87.99  ? 230 ARG A CZ  1 
ATOM   1162 N NH1 . ARG A 1 147 ? 10.599  -24.393 -15.856 1.00 84.86  ? 230 ARG A NH1 1 
ATOM   1163 N NH2 . ARG A 1 147 ? 11.730  -26.374 -16.243 1.00 84.72  ? 230 ARG A NH2 1 
ATOM   1164 N N   . VAL A 1 148 ? 12.197  -23.499 -23.616 1.00 75.97  ? 231 VAL A N   1 
ATOM   1165 C CA  . VAL A 1 148 ? 13.439  -22.998 -24.254 1.00 81.00  ? 231 VAL A CA  1 
ATOM   1166 C C   . VAL A 1 148 ? 13.238  -21.945 -25.374 1.00 83.87  ? 231 VAL A C   1 
ATOM   1167 O O   . VAL A 1 148 ? 13.918  -20.923 -25.367 1.00 85.27  ? 231 VAL A O   1 
ATOM   1168 C CB  . VAL A 1 148 ? 14.395  -24.156 -24.710 1.00 77.22  ? 231 VAL A CB  1 
ATOM   1169 C CG1 . VAL A 1 148 ? 15.604  -23.648 -25.504 1.00 71.01  ? 231 VAL A CG1 1 
ATOM   1170 C CG2 . VAL A 1 148 ? 14.881  -24.945 -23.505 1.00 75.81  ? 231 VAL A CG2 1 
ATOM   1171 N N   . ASP A 1 149 ? 12.331  -22.192 -26.321 1.00 88.30  ? 232 ASP A N   1 
ATOM   1172 C CA  . ASP A 1 149 ? 12.114  -21.267 -27.455 1.00 90.00  ? 232 ASP A CA  1 
ATOM   1173 C C   . ASP A 1 149 ? 11.077  -20.182 -27.109 1.00 88.41  ? 232 ASP A C   1 
ATOM   1174 O O   . ASP A 1 149 ? 10.748  -19.351 -27.964 1.00 84.28  ? 232 ASP A O   1 
ATOM   1175 C CB  . ASP A 1 149 ? 11.665  -22.038 -28.728 1.00 94.25  ? 232 ASP A CB  1 
ATOM   1176 C CG  . ASP A 1 149 ? 12.712  -23.062 -29.241 1.00 94.98  ? 232 ASP A CG  1 
ATOM   1177 O OD1 . ASP A 1 149 ? 13.812  -23.198 -28.653 1.00 93.42  ? 232 ASP A OD1 1 
ATOM   1178 O OD2 . ASP A 1 149 ? 12.414  -23.746 -30.251 1.00 92.71  ? 232 ASP A OD2 1 
ATOM   1179 N N   . PHE A 1 150 ? 10.562  -20.228 -25.869 1.00 91.22  ? 233 PHE A N   1 
ATOM   1180 C CA  . PHE A 1 150 ? 9.440   -19.399 -25.371 1.00 96.35  ? 233 PHE A CA  1 
ATOM   1181 C C   . PHE A 1 150 ? 9.457   -19.249 -23.831 1.00 106.41 ? 233 PHE A C   1 
ATOM   1182 O O   . PHE A 1 150 ? 8.677   -19.935 -23.129 1.00 106.69 ? 233 PHE A O   1 
ATOM   1183 C CB  . PHE A 1 150 ? 8.065   -20.006 -25.737 1.00 86.64  ? 233 PHE A CB  1 
ATOM   1184 C CG  . PHE A 1 150 ? 7.882   -20.358 -27.192 1.00 85.99  ? 233 PHE A CG  1 
ATOM   1185 C CD1 . PHE A 1 150 ? 7.741   -19.364 -28.164 1.00 85.19  ? 233 PHE A CD1 1 
ATOM   1186 C CD2 . PHE A 1 150 ? 7.815   -21.709 -27.596 1.00 87.80  ? 233 PHE A CD2 1 
ATOM   1187 C CE1 . PHE A 1 150 ? 7.566   -19.700 -29.505 1.00 85.84  ? 233 PHE A CE1 1 
ATOM   1188 C CE2 . PHE A 1 150 ? 7.631   -22.055 -28.936 1.00 86.27  ? 233 PHE A CE2 1 
ATOM   1189 C CZ  . PHE A 1 150 ? 7.505   -21.041 -29.892 1.00 89.85  ? 233 PHE A CZ  1 
ATOM   1190 N N   . SER A 1 151 ? 10.336  -18.387 -23.305 1.00 112.19 ? 234 SER A N   1 
ATOM   1191 C CA  . SER A 1 151 ? 10.202  -17.878 -21.912 1.00 121.54 ? 234 SER A CA  1 
ATOM   1192 C C   . SER A 1 151 ? 10.441  -16.360 -21.766 1.00 127.20 ? 234 SER A C   1 
ATOM   1193 O O   . SER A 1 151 ? 10.905  -15.683 -22.690 1.00 127.47 ? 234 SER A O   1 
ATOM   1194 C CB  . SER A 1 151 ? 10.999  -18.704 -20.882 1.00 116.88 ? 234 SER A CB  1 
ATOM   1195 O OG  . SER A 1 151 ? 12.396  -18.605 -21.091 1.00 119.71 ? 234 SER A OG  1 
ATOM   1196 N N   . GLY A 1 152 ? 10.125  -15.833 -20.590 1.00 132.88 ? 235 GLY A N   1 
ATOM   1197 C CA  . GLY A 1 152 ? 9.763   -14.425 -20.470 1.00 139.42 ? 235 GLY A CA  1 
ATOM   1198 C C   . GLY A 1 152 ? 8.244   -14.469 -20.552 1.00 142.39 ? 235 GLY A C   1 
ATOM   1199 O O   . GLY A 1 152 ? 7.675   -14.911 -21.569 1.00 127.27 ? 235 GLY A O   1 
ATOM   1200 N N   . ARG A 1 153 ? 7.590   -14.029 -19.475 1.00 143.50 ? 236 ARG A N   1 
ATOM   1201 C CA  . ARG A 1 153 ? 6.166   -14.336 -19.246 1.00 138.19 ? 236 ARG A CA  1 
ATOM   1202 C C   . ARG A 1 153 ? 5.147   -13.859 -20.315 1.00 137.78 ? 236 ARG A C   1 
ATOM   1203 O O   . ARG A 1 153 ? 4.016   -14.372 -20.357 1.00 138.33 ? 236 ARG A O   1 
ATOM   1204 C CB  . ARG A 1 153 ? 5.709   -14.016 -17.790 1.00 137.09 ? 236 ARG A CB  1 
ATOM   1205 C CG  . ARG A 1 153 ? 6.453   -12.925 -17.012 1.00 135.55 ? 236 ARG A CG  1 
ATOM   1206 C CD  . ARG A 1 153 ? 5.906   -12.778 -15.580 1.00 136.62 ? 236 ARG A CD  1 
ATOM   1207 N NE  . ARG A 1 153 ? 6.575   -11.739 -14.774 1.00 137.80 ? 236 ARG A NE  1 
ATOM   1208 C CZ  . ARG A 1 153 ? 6.035   -11.107 -13.721 1.00 142.46 ? 236 ARG A CZ  1 
ATOM   1209 N NH1 . ARG A 1 153 ? 4.799   -11.393 -13.322 1.00 140.48 ? 236 ARG A NH1 1 
ATOM   1210 N NH2 . ARG A 1 153 ? 6.725   -10.169 -13.065 1.00 141.17 ? 236 ARG A NH2 1 
ATOM   1211 N N   . GLY A 1 154 ? 5.553   -12.931 -21.189 1.00 131.48 ? 237 GLY A N   1 
ATOM   1212 C CA  . GLY A 1 154 ? 4.650   -12.357 -22.205 1.00 127.05 ? 237 GLY A CA  1 
ATOM   1213 C C   . GLY A 1 154 ? 4.911   -12.826 -23.624 1.00 117.62 ? 237 GLY A C   1 
ATOM   1214 O O   . GLY A 1 154 ? 5.250   -12.042 -24.492 1.00 116.04 ? 237 GLY A O   1 
ATOM   1215 N N   . GLU A 1 155 ? 4.710   -14.116 -23.857 1.00 121.85 ? 238 GLU A N   1 
ATOM   1216 C CA  . GLU A 1 155 ? 5.179   -14.811 -25.066 1.00 117.26 ? 238 GLU A CA  1 
ATOM   1217 C C   . GLU A 1 155 ? 4.445   -16.169 -25.215 1.00 104.64 ? 238 GLU A C   1 
ATOM   1218 O O   . GLU A 1 155 ? 4.577   -16.865 -26.230 1.00 98.41  ? 238 GLU A O   1 
ATOM   1219 C CB  . GLU A 1 155 ? 6.712   -15.003 -24.969 1.00 122.09 ? 238 GLU A CB  1 
ATOM   1220 C CG  . GLU A 1 155 ? 7.407   -15.663 -26.157 1.00 127.53 ? 238 GLU A CG  1 
ATOM   1221 C CD  . GLU A 1 155 ? 7.209   -14.913 -27.463 1.00 133.52 ? 238 GLU A CD  1 
ATOM   1222 O OE1 . GLU A 1 155 ? 6.041   -14.775 -27.919 1.00 134.16 ? 238 GLU A OE1 1 
ATOM   1223 O OE2 . GLU A 1 155 ? 8.230   -14.476 -28.038 1.00 130.00 ? 238 GLU A OE2 1 
ATOM   1224 N N   . LEU A 1 156 ? 3.662   -16.516 -24.195 1.00 96.79  ? 239 LEU A N   1 
ATOM   1225 C CA  . LEU A 1 156 ? 2.991   -17.806 -24.119 1.00 97.95  ? 239 LEU A CA  1 
ATOM   1226 C C   . LEU A 1 156 ? 1.946   -17.998 -25.215 1.00 93.64  ? 239 LEU A C   1 
ATOM   1227 O O   . LEU A 1 156 ? 1.669   -19.117 -25.577 1.00 85.98  ? 239 LEU A O   1 
ATOM   1228 C CB  . LEU A 1 156 ? 2.348   -18.049 -22.736 1.00 101.85 ? 239 LEU A CB  1 
ATOM   1229 C CG  . LEU A 1 156 ? 2.915   -17.484 -21.422 1.00 106.42 ? 239 LEU A CG  1 
ATOM   1230 C CD1 . LEU A 1 156 ? 1.831   -17.485 -20.344 1.00 102.29 ? 239 LEU A CD1 1 
ATOM   1231 C CD2 . LEU A 1 156 ? 4.165   -18.230 -20.964 1.00 106.20 ? 239 LEU A CD2 1 
ATOM   1232 N N   . ALA A 1 157 ? 1.367   -16.920 -25.746 1.00 99.96  ? 240 ALA A N   1 
ATOM   1233 C CA  . ALA A 1 157 ? 0.346   -17.053 -26.794 1.00 96.69  ? 240 ALA A CA  1 
ATOM   1234 C C   . ALA A 1 157 ? 0.867   -17.957 -27.906 1.00 96.27  ? 240 ALA A C   1 
ATOM   1235 O O   . ALA A 1 157 ? 0.188   -18.892 -28.344 1.00 92.30  ? 240 ALA A O   1 
ATOM   1236 C CB  . ALA A 1 157 ? -0.019  -15.707 -27.358 1.00 95.30  ? 240 ALA A CB  1 
ATOM   1237 N N   . GLU A 1 158 ? 2.099   -17.684 -28.316 1.00 95.88  ? 241 GLU A N   1 
ATOM   1238 C CA  . GLU A 1 158 ? 2.749   -18.384 -29.406 1.00 92.83  ? 241 GLU A CA  1 
ATOM   1239 C C   . GLU A 1 158 ? 3.192   -19.817 -29.021 1.00 85.77  ? 241 GLU A C   1 
ATOM   1240 O O   . GLU A 1 158 ? 2.919   -20.792 -29.733 1.00 78.46  ? 241 GLU A O   1 
ATOM   1241 C CB  . GLU A 1 158 ? 3.928   -17.537 -29.875 1.00 100.28 ? 241 GLU A CB  1 
ATOM   1242 C CG  . GLU A 1 158 ? 3.858   -17.213 -31.352 1.00 110.49 ? 241 GLU A CG  1 
ATOM   1243 C CD  . GLU A 1 158 ? 3.852   -18.474 -32.195 1.00 109.96 ? 241 GLU A CD  1 
ATOM   1244 O OE1 . GLU A 1 158 ? 2.749   -18.909 -32.614 1.00 107.04 ? 241 GLU A OE1 1 
ATOM   1245 O OE2 . GLU A 1 158 ? 4.952   -19.040 -32.404 1.00 109.46 ? 241 GLU A OE2 1 
ATOM   1246 N N   . ARG A 1 159 ? 3.858   -19.926 -27.880 1.00 80.54  ? 242 ARG A N   1 
ATOM   1247 C CA  . ARG A 1 159 ? 4.214   -21.193 -27.295 1.00 75.10  ? 242 ARG A CA  1 
ATOM   1248 C C   . ARG A 1 159 ? 3.027   -22.119 -27.181 1.00 72.99  ? 242 ARG A C   1 
ATOM   1249 O O   . ARG A 1 159 ? 3.118   -23.291 -27.516 1.00 74.51  ? 242 ARG A O   1 
ATOM   1250 C CB  . ARG A 1 159 ? 4.759   -20.964 -25.893 1.00 78.88  ? 242 ARG A CB  1 
ATOM   1251 C CG  . ARG A 1 159 ? 5.344   -22.205 -25.243 1.00 76.40  ? 242 ARG A CG  1 
ATOM   1252 C CD  . ARG A 1 159 ? 5.783   -21.921 -23.823 1.00 78.77  ? 242 ARG A CD  1 
ATOM   1253 N NE  . ARG A 1 159 ? 4.833   -22.496 -22.882 1.00 80.40  ? 242 ARG A NE  1 
ATOM   1254 C CZ  . ARG A 1 159 ? 5.044   -22.629 -21.578 1.00 81.10  ? 242 ARG A CZ  1 
ATOM   1255 N NH1 . ARG A 1 159 ? 6.191   -22.208 -21.028 1.00 79.10  ? 242 ARG A NH1 1 
ATOM   1256 N NH2 . ARG A 1 159 ? 4.096   -23.195 -20.832 1.00 81.74  ? 242 ARG A NH2 1 
ATOM   1257 N N   . GLN A 1 160 ? 1.920   -21.589 -26.681 1.00 76.50  ? 243 GLN A N   1 
ATOM   1258 C CA  . GLN A 1 160 ? 0.761   -22.378 -26.337 1.00 70.18  ? 243 GLN A CA  1 
ATOM   1259 C C   . GLN A 1 160 ? 0.090   -22.929 -27.563 1.00 67.79  ? 243 GLN A C   1 
ATOM   1260 O O   . GLN A 1 160 ? -0.247  -24.111 -27.557 1.00 68.32  ? 243 GLN A O   1 
ATOM   1261 C CB  . GLN A 1 160 ? -0.224  -21.581 -25.493 1.00 79.90  ? 243 GLN A CB  1 
ATOM   1262 C CG  . GLN A 1 160 ? 0.357   -20.966 -24.221 1.00 90.65  ? 243 GLN A CG  1 
ATOM   1263 C CD  . GLN A 1 160 ? 0.717   -21.977 -23.136 1.00 93.35  ? 243 GLN A CD  1 
ATOM   1264 O OE1 . GLN A 1 160 ? 1.601   -22.834 -23.308 1.00 91.41  ? 243 GLN A OE1 1 
ATOM   1265 N NE2 . GLN A 1 160 ? 0.052   -21.855 -21.989 1.00 93.48  ? 243 GLN A NE2 1 
ATOM   1266 N N   . GLN A 1 161 ? -0.107  -22.124 -28.613 1.00 64.44  ? 244 GLN A N   1 
ATOM   1267 C CA  . GLN A 1 161 ? -0.626  -22.683 -29.874 1.00 64.70  ? 244 GLN A CA  1 
ATOM   1268 C C   . GLN A 1 161 ? 0.234   -23.890 -30.299 1.00 60.17  ? 244 GLN A C   1 
ATOM   1269 O O   . GLN A 1 161 ? -0.289  -24.985 -30.488 1.00 60.91  ? 244 GLN A O   1 
ATOM   1270 C CB  . GLN A 1 161 ? -0.720  -21.650 -31.008 1.00 72.33  ? 244 GLN A CB  1 
ATOM   1271 C CG  . GLN A 1 161 ? -1.334  -20.320 -30.590 1.00 85.05  ? 244 GLN A CG  1 
ATOM   1272 C CD  . GLN A 1 161 ? -2.068  -19.580 -31.713 1.00 96.08  ? 244 GLN A CD  1 
ATOM   1273 O OE1 . GLN A 1 161 ? -2.972  -20.128 -32.351 1.00 105.80 ? 244 GLN A OE1 1 
ATOM   1274 N NE2 . GLN A 1 161 ? -1.707  -18.309 -31.931 1.00 98.38  ? 244 GLN A NE2 1 
ATOM   1275 N N   . LYS A 1 162 ? 1.552   -23.682 -30.385 1.00 58.31  ? 245 LYS A N   1 
ATOM   1276 C CA  . LYS A 1 162 ? 2.545   -24.679 -30.832 1.00 53.49  ? 245 LYS A CA  1 
ATOM   1277 C C   . LYS A 1 162 ? 2.521   -25.946 -29.999 1.00 51.80  ? 245 LYS A C   1 
ATOM   1278 O O   . LYS A 1 162 ? 2.357   -27.041 -30.530 1.00 50.38  ? 245 LYS A O   1 
ATOM   1279 C CB  . LYS A 1 162 ? 3.968   -24.079 -30.847 1.00 53.06  ? 245 LYS A CB  1 
ATOM   1280 C CG  . LYS A 1 162 ? 4.339   -23.325 -32.122 1.00 54.61  ? 245 LYS A CG  1 
ATOM   1281 C CD  . LYS A 1 162 ? 3.927   -24.127 -33.348 1.00 57.40  ? 245 LYS A CD  1 
ATOM   1282 C CE  . LYS A 1 162 ? 4.335   -23.485 -34.651 1.00 62.52  ? 245 LYS A CE  1 
ATOM   1283 N NZ  . LYS A 1 162 ? 3.889   -22.060 -34.652 1.00 69.46  ? 245 LYS A NZ  1 
ATOM   1284 N N   . LEU A 1 163 ? 2.653   -25.791 -28.689 1.00 51.16  ? 246 LEU A N   1 
ATOM   1285 C CA  . LEU A 1 163 ? 2.507   -26.894 -27.794 1.00 48.52  ? 246 LEU A CA  1 
ATOM   1286 C C   . LEU A 1 163 ? 1.199   -27.651 -28.039 1.00 50.02  ? 246 LEU A C   1 
ATOM   1287 O O   . LEU A 1 163 ? 1.203   -28.899 -28.130 1.00 53.87  ? 246 LEU A O   1 
ATOM   1288 C CB  . LEU A 1 163 ? 2.616   -26.402 -26.372 1.00 50.52  ? 246 LEU A CB  1 
ATOM   1289 C CG  . LEU A 1 163 ? 2.411   -27.494 -25.331 1.00 53.44  ? 246 LEU A CG  1 
ATOM   1290 C CD1 . LEU A 1 163 ? 3.634   -28.369 -25.174 1.00 54.12  ? 246 LEU A CD1 1 
ATOM   1291 C CD2 . LEU A 1 163 ? 2.090   -26.811 -24.021 1.00 59.44  ? 246 LEU A CD2 1 
ATOM   1292 N N   . ALA A 1 164 ? 0.095   -26.920 -28.187 1.00 49.97  ? 247 ALA A N   1 
ATOM   1293 C CA  . ALA A 1 164 ? -1.210  -27.566 -28.341 1.00 52.98  ? 247 ALA A CA  1 
ATOM   1294 C C   . ALA A 1 164 ? -1.266  -28.318 -29.640 1.00 54.02  ? 247 ALA A C   1 
ATOM   1295 O O   . ALA A 1 164 ? -1.801  -29.420 -29.653 1.00 49.77  ? 247 ALA A O   1 
ATOM   1296 C CB  . ALA A 1 164 ? -2.364  -26.570 -28.255 1.00 53.15  ? 247 ALA A CB  1 
ATOM   1297 N N   . GLN A 1 165 ? -0.712  -27.719 -30.717 1.00 58.31  ? 248 GLN A N   1 
ATOM   1298 C CA  . GLN A 1 165 ? -0.580  -28.389 -32.027 1.00 60.74  ? 248 GLN A CA  1 
ATOM   1299 C C   . GLN A 1 165 ? 0.078   -29.769 -31.884 1.00 58.95  ? 248 GLN A C   1 
ATOM   1300 O O   . GLN A 1 165 ? -0.505  -30.807 -32.224 1.00 59.83  ? 248 GLN A O   1 
ATOM   1301 C CB  . GLN A 1 165 ? 0.242   -27.565 -33.006 1.00 66.79  ? 248 GLN A CB  1 
ATOM   1302 C CG  . GLN A 1 165 ? -0.507  -26.995 -34.200 1.00 75.09  ? 248 GLN A CG  1 
ATOM   1303 C CD  . GLN A 1 165 ? -0.568  -25.468 -34.164 1.00 82.96  ? 248 GLN A CD  1 
ATOM   1304 O OE1 . GLN A 1 165 ? 0.465   -24.784 -34.243 1.00 83.47  ? 248 GLN A OE1 1 
ATOM   1305 N NE2 . GLN A 1 165 ? -1.781  -24.924 -34.039 1.00 81.44  ? 248 GLN A NE2 1 
ATOM   1306 N N   . MET A 1 166 ? 1.285   -29.773 -31.345 1.00 54.34  ? 249 MET A N   1 
ATOM   1307 C CA  . MET A 1 166 ? 2.017   -30.995 -31.153 1.00 49.20  ? 249 MET A CA  1 
ATOM   1308 C C   . MET A 1 166 ? 1.256   -32.052 -30.364 1.00 47.44  ? 249 MET A C   1 
ATOM   1309 O O   . MET A 1 166 ? 1.238   -33.211 -30.743 1.00 42.78  ? 249 MET A O   1 
ATOM   1310 C CB  . MET A 1 166 ? 3.298   -30.683 -30.443 1.00 48.48  ? 249 MET A CB  1 
ATOM   1311 C CG  . MET A 1 166 ? 4.111   -31.926 -30.239 1.00 48.98  ? 249 MET A CG  1 
ATOM   1312 S SD  . MET A 1 166 ? 5.419   -31.559 -29.117 1.00 59.77  ? 249 MET A SD  1 
ATOM   1313 C CE  . MET A 1 166 ? 4.653   -31.707 -27.496 1.00 47.90  ? 249 MET A CE  1 
ATOM   1314 N N   . LEU A 1 167 ? 0.629   -31.644 -29.258 1.00 51.41  ? 250 LEU A N   1 
ATOM   1315 C CA  . LEU A 1 167 ? -0.077  -32.583 -28.391 1.00 45.26  ? 250 LEU A CA  1 
ATOM   1316 C C   . LEU A 1 167 ? -1.395  -33.096 -29.006 1.00 43.99  ? 250 LEU A C   1 
ATOM   1317 O O   . LEU A 1 167 ? -1.784  -34.235 -28.779 1.00 42.28  ? 250 LEU A O   1 
ATOM   1318 C CB  . LEU A 1 167 ? -0.263  -31.974 -27.002 1.00 48.52  ? 250 LEU A CB  1 
ATOM   1319 C CG  . LEU A 1 167 ? 1.034   -31.812 -26.166 1.00 48.80  ? 250 LEU A CG  1 
ATOM   1320 C CD1 . LEU A 1 167 ? 0.723   -31.130 -24.858 1.00 50.26  ? 250 LEU A CD1 1 
ATOM   1321 C CD2 . LEU A 1 167 ? 1.735   -33.124 -25.863 1.00 45.57  ? 250 LEU A CD2 1 
ATOM   1322 N N   . SER A 1 168 ? -2.058  -32.297 -29.838 1.00 45.39  ? 251 SER A N   1 
ATOM   1323 C CA  . SER A 1 168 ? -3.167  -32.856 -30.599 1.00 45.90  ? 251 SER A CA  1 
ATOM   1324 C C   . SER A 1 168 ? -2.683  -33.885 -31.630 1.00 42.57  ? 251 SER A C   1 
ATOM   1325 O O   . SER A 1 168 ? -3.264  -34.969 -31.679 1.00 43.13  ? 251 SER A O   1 
ATOM   1326 C CB  . SER A 1 168 ? -4.112  -31.805 -31.188 1.00 45.62  ? 251 SER A CB  1 
ATOM   1327 O OG  . SER A 1 168 ? -3.333  -30.872 -31.836 1.00 52.94  ? 251 SER A OG  1 
ATOM   1328 N N   . ARG A 1 169 ? -1.630  -33.575 -32.382 1.00 41.33  ? 252 ARG A N   1 
ATOM   1329 C CA  . ARG A 1 169 ? -0.909  -34.580 -33.190 1.00 49.39  ? 252 ARG A CA  1 
ATOM   1330 C C   . ARG A 1 169 ? -0.552  -35.881 -32.452 1.00 44.71  ? 252 ARG A C   1 
ATOM   1331 O O   . ARG A 1 169 ? -0.857  -36.996 -32.923 1.00 41.43  ? 252 ARG A O   1 
ATOM   1332 C CB  . ARG A 1 169 ? 0.385   -34.012 -33.832 1.00 58.34  ? 252 ARG A CB  1 
ATOM   1333 C CG  . ARG A 1 169 ? 0.118   -32.960 -34.893 1.00 80.82  ? 252 ARG A CG  1 
ATOM   1334 C CD  . ARG A 1 169 ? -0.621  -33.497 -36.115 1.00 99.37  ? 252 ARG A CD  1 
ATOM   1335 N NE  . ARG A 1 169 ? 0.285   -34.276 -36.968 1.00 120.15 ? 252 ARG A NE  1 
ATOM   1336 C CZ  . ARG A 1 169 ? 0.108   -35.548 -37.341 1.00 115.17 ? 252 ARG A CZ  1 
ATOM   1337 N NH1 . ARG A 1 169 ? -0.967  -36.243 -36.959 1.00 103.70 ? 252 ARG A NH1 1 
ATOM   1338 N NH2 . ARG A 1 169 ? 1.018   -36.121 -38.124 1.00 103.11 ? 252 ARG A NH2 1 
ATOM   1339 N N   . LEU A 1 170 ? 0.089   -35.734 -31.302 1.00 41.49  ? 253 LEU A N   1 
ATOM   1340 C CA  . LEU A 1 170 ? 0.395   -36.875 -30.465 1.00 42.13  ? 253 LEU A CA  1 
ATOM   1341 C C   . LEU A 1 170 ? -0.807  -37.774 -30.178 1.00 42.16  ? 253 LEU A C   1 
ATOM   1342 O O   . LEU A 1 170 ? -0.701  -39.016 -30.280 1.00 39.12  ? 253 LEU A O   1 
ATOM   1343 C CB  . LEU A 1 170 ? 0.974   -36.402 -29.161 1.00 43.32  ? 253 LEU A CB  1 
ATOM   1344 C CG  . LEU A 1 170 ? 2.469   -36.422 -29.147 1.00 45.29  ? 253 LEU A CG  1 
ATOM   1345 C CD1 . LEU A 1 170 ? 2.833   -36.326 -27.679 1.00 42.60  ? 253 LEU A CD1 1 
ATOM   1346 C CD2 . LEU A 1 170 ? 2.980   -37.735 -29.760 1.00 46.21  ? 253 LEU A CD2 1 
ATOM   1347 N N   . GLN A 1 171 ? -1.935  -37.147 -29.831 1.00 41.43  ? 254 GLN A N   1 
ATOM   1348 C CA  . GLN A 1 171 ? -3.133  -37.884 -29.426 1.00 39.52  ? 254 GLN A CA  1 
ATOM   1349 C C   . GLN A 1 171 ? -3.560  -38.676 -30.627 1.00 38.32  ? 254 GLN A C   1 
ATOM   1350 O O   . GLN A 1 171 ? -3.777  -39.909 -30.522 1.00 36.51  ? 254 GLN A O   1 
ATOM   1351 C CB  . GLN A 1 171 ? -4.267  -36.954 -28.974 1.00 41.20  ? 254 GLN A CB  1 
ATOM   1352 C CG  . GLN A 1 171 ? -4.065  -36.270 -27.620 1.00 43.35  ? 254 GLN A CG  1 
ATOM   1353 C CD  . GLN A 1 171 ? -5.383  -35.900 -26.915 1.00 44.43  ? 254 GLN A CD  1 
ATOM   1354 O OE1 . GLN A 1 171 ? -5.510  -36.070 -25.692 1.00 46.30  ? 254 GLN A OE1 1 
ATOM   1355 N NE2 . GLN A 1 171 ? -6.369  -35.450 -27.674 1.00 38.98  ? 254 GLN A NE2 1 
ATOM   1356 N N   . LYS A 1 172 ? -3.618  -37.974 -31.775 1.00 40.37  ? 255 LYS A N   1 
ATOM   1357 C CA  . LYS A 1 172 ? -4.088  -38.537 -33.072 1.00 37.35  ? 255 LYS A CA  1 
ATOM   1358 C C   . LYS A 1 172 ? -3.193  -39.681 -33.410 1.00 35.16  ? 255 LYS A C   1 
ATOM   1359 O O   . LYS A 1 172 ? -3.696  -40.728 -33.772 1.00 36.31  ? 255 LYS A O   1 
ATOM   1360 C CB  . LYS A 1 172 ? -4.044  -37.508 -34.173 1.00 40.31  ? 255 LYS A CB  1 
ATOM   1361 C CG  . LYS A 1 172 ? -5.329  -37.287 -34.929 1.00 45.50  ? 255 LYS A CG  1 
ATOM   1362 C CD  . LYS A 1 172 ? -5.788  -35.821 -34.853 1.00 48.03  ? 255 LYS A CD  1 
ATOM   1363 C CE  . LYS A 1 172 ? -4.981  -34.843 -35.687 1.00 49.93  ? 255 LYS A CE  1 
ATOM   1364 N NZ  . LYS A 1 172 ? -5.882  -33.775 -36.231 1.00 61.23  ? 255 LYS A NZ  1 
ATOM   1365 N N   . ILE A 1 173 ? -1.876  -39.519 -33.201 1.00 34.90  ? 256 ILE A N   1 
ATOM   1366 C CA  . ILE A 1 173 ? -0.900  -40.589 -33.476 1.00 36.07  ? 256 ILE A CA  1 
ATOM   1367 C C   . ILE A 1 173 ? -1.230  -41.860 -32.665 1.00 38.97  ? 256 ILE A C   1 
ATOM   1368 O O   . ILE A 1 173 ? -1.651  -42.880 -33.218 1.00 39.65  ? 256 ILE A O   1 
ATOM   1369 C CB  . ILE A 1 173 ? 0.548   -40.094 -33.236 1.00 36.95  ? 256 ILE A CB  1 
ATOM   1370 C CG1 . ILE A 1 173 ? 1.014   -39.275 -34.459 1.00 39.70  ? 256 ILE A CG1 1 
ATOM   1371 C CG2 . ILE A 1 173 ? 1.561   -41.239 -32.944 1.00 32.40  ? 256 ILE A CG2 1 
ATOM   1372 C CD1 . ILE A 1 173 ? 2.370   -38.588 -34.249 1.00 40.48  ? 256 ILE A CD1 1 
ATOM   1373 N N   . SER A 1 174 ? -0.963  -41.762 -31.364 1.00 40.67  ? 257 SER A N   1 
ATOM   1374 C CA  . SER A 1 174 ? -1.525  -42.533 -30.282 1.00 39.47  ? 257 SER A CA  1 
ATOM   1375 C C   . SER A 1 174 ? -2.790  -43.349 -30.611 1.00 42.36  ? 257 SER A C   1 
ATOM   1376 O O   . SER A 1 174 ? -2.784  -44.584 -30.596 1.00 41.45  ? 257 SER A O   1 
ATOM   1377 C CB  . SER A 1 174 ? -1.897  -41.480 -29.287 1.00 38.20  ? 257 SER A CB  1 
ATOM   1378 O OG  . SER A 1 174 ? -2.393  -42.032 -28.126 1.00 45.55  ? 257 SER A OG  1 
ATOM   1379 N N   . GLU A 1 175 ? -3.880  -42.655 -30.923 1.00 44.70  ? 258 GLU A N   1 
ATOM   1380 C CA  . GLU A 1 175 ? -5.190  -43.325 -31.178 1.00 41.64  ? 258 GLU A CA  1 
ATOM   1381 C C   . GLU A 1 175 ? -5.321  -43.953 -32.559 1.00 41.72  ? 258 GLU A C   1 
ATOM   1382 O O   . GLU A 1 175 ? -5.872  -45.047 -32.716 1.00 42.34  ? 258 GLU A O   1 
ATOM   1383 C CB  . GLU A 1 175 ? -6.329  -42.366 -30.861 1.00 41.54  ? 258 GLU A CB  1 
ATOM   1384 C CG  . GLU A 1 175 ? -6.230  -42.025 -29.380 1.00 42.19  ? 258 GLU A CG  1 
ATOM   1385 C CD  . GLU A 1 175 ? -7.169  -40.953 -28.904 1.00 46.96  ? 258 GLU A CD  1 
ATOM   1386 O OE1 . GLU A 1 175 ? -6.729  -40.171 -28.018 1.00 51.42  ? 258 GLU A OE1 1 
ATOM   1387 O OE2 . GLU A 1 175 ? -8.335  -40.906 -29.363 1.00 46.58  ? 258 GLU A OE2 1 
ATOM   1388 N N   . GLU A 1 176 ? -4.739  -43.311 -33.555 1.00 39.87  ? 259 GLU A N   1 
ATOM   1389 C CA  . GLU A 1 176 ? -4.943  -43.774 -34.892 1.00 40.81  ? 259 GLU A CA  1 
ATOM   1390 C C   . GLU A 1 176 ? -4.116  -45.018 -35.165 1.00 41.37  ? 259 GLU A C   1 
ATOM   1391 O O   . GLU A 1 176 ? -4.552  -45.879 -35.920 1.00 42.40  ? 259 GLU A O   1 
ATOM   1392 C CB  . GLU A 1 176 ? -4.610  -42.663 -35.846 1.00 45.57  ? 259 GLU A CB  1 
ATOM   1393 C CG  . GLU A 1 176 ? -5.006  -42.856 -37.289 1.00 60.94  ? 259 GLU A CG  1 
ATOM   1394 C CD  . GLU A 1 176 ? -4.538  -41.653 -38.129 1.00 81.82  ? 259 GLU A CD  1 
ATOM   1395 O OE1 . GLU A 1 176 ? -4.145  -40.596 -37.518 1.00 76.65  ? 259 GLU A OE1 1 
ATOM   1396 O OE2 . GLU A 1 176 ? -4.554  -41.758 -39.395 1.00 87.99  ? 259 GLU A OE2 1 
ATOM   1397 N N   . TYR A 1 177 ? -2.934  -45.127 -34.552 1.00 40.50  ? 260 TYR A N   1 
ATOM   1398 C CA  . TYR A 1 177 ? -1.986  -46.215 -34.877 1.00 40.54  ? 260 TYR A CA  1 
ATOM   1399 C C   . TYR A 1 177 ? -1.841  -47.234 -33.730 1.00 41.01  ? 260 TYR A C   1 
ATOM   1400 O O   . TYR A 1 177 ? -0.894  -48.012 -33.667 1.00 34.89  ? 260 TYR A O   1 
ATOM   1401 C CB  . TYR A 1 177 ? -0.622  -45.626 -35.217 1.00 43.20  ? 260 TYR A CB  1 
ATOM   1402 C CG  . TYR A 1 177 ? -0.606  -44.815 -36.481 1.00 44.85  ? 260 TYR A CG  1 
ATOM   1403 C CD1 . TYR A 1 177 ? -0.393  -43.443 -36.442 1.00 45.60  ? 260 TYR A CD1 1 
ATOM   1404 C CD2 . TYR A 1 177 ? -0.877  -45.408 -37.719 1.00 48.13  ? 260 TYR A CD2 1 
ATOM   1405 C CE1 . TYR A 1 177 ? -0.387  -42.680 -37.613 1.00 48.83  ? 260 TYR A CE1 1 
ATOM   1406 C CE2 . TYR A 1 177 ? -0.898  -44.657 -38.893 1.00 51.00  ? 260 TYR A CE2 1 
ATOM   1407 C CZ  . TYR A 1 177 ? -0.647  -43.289 -38.830 1.00 51.98  ? 260 TYR A CZ  1 
ATOM   1408 O OH  . TYR A 1 177 ? -0.661  -42.528 -39.973 1.00 58.53  ? 260 TYR A OH  1 
ATOM   1409 N N   . ASN A 1 178 ? -2.784  -47.194 -32.787 1.00 42.61  ? 261 ASN A N   1 
ATOM   1410 C CA  . ASN A 1 178 ? -2.712  -48.044 -31.599 1.00 37.78  ? 261 ASN A CA  1 
ATOM   1411 C C   . ASN A 1 178 ? -1.305  -48.154 -30.959 1.00 34.85  ? 261 ASN A C   1 
ATOM   1412 O O   . ASN A 1 178 ? -0.757  -49.265 -30.795 1.00 31.87  ? 261 ASN A O   1 
ATOM   1413 C CB  . ASN A 1 178 ? -3.233  -49.428 -31.927 1.00 32.89  ? 261 ASN A CB  1 
ATOM   1414 C CG  . ASN A 1 178 ? -3.480  -50.236 -30.676 1.00 34.19  ? 261 ASN A CG  1 
ATOM   1415 O OD1 . ASN A 1 178 ? -3.628  -49.662 -29.571 1.00 37.74  ? 261 ASN A OD1 1 
ATOM   1416 N ND2 . ASN A 1 178 ? -3.541  -51.575 -30.819 1.00 34.22  ? 261 ASN A ND2 1 
ATOM   1417 N N   . VAL A 1 179 ? -0.698  -47.021 -30.652 1.00 32.38  ? 262 VAL A N   1 
ATOM   1418 C CA  . VAL A 1 179 ? 0.595   -47.083 -30.009 1.00 35.25  ? 262 VAL A CA  1 
ATOM   1419 C C   . VAL A 1 179 ? 0.441   -46.489 -28.627 1.00 38.62  ? 262 VAL A C   1 
ATOM   1420 O O   . VAL A 1 179 ? -0.476  -45.694 -28.396 1.00 39.92  ? 262 VAL A O   1 
ATOM   1421 C CB  . VAL A 1 179 ? 1.709   -46.350 -30.768 1.00 36.04  ? 262 VAL A CB  1 
ATOM   1422 C CG1 . VAL A 1 179 ? 1.655   -46.626 -32.259 1.00 37.85  ? 262 VAL A CG1 1 
ATOM   1423 C CG2 . VAL A 1 179 ? 1.624   -44.873 -30.517 1.00 35.62  ? 262 VAL A CG2 1 
ATOM   1424 N N   . ALA A 1 180 ? 1.310   -46.892 -27.703 1.00 37.15  ? 263 ALA A N   1 
ATOM   1425 C CA  . ALA A 1 180 ? 1.364   -46.197 -26.422 1.00 38.17  ? 263 ALA A CA  1 
ATOM   1426 C C   . ALA A 1 180 ? 2.278   -45.010 -26.606 1.00 38.36  ? 263 ALA A C   1 
ATOM   1427 O O   . ALA A 1 180 ? 3.342   -45.137 -27.190 1.00 40.28  ? 263 ALA A O   1 
ATOM   1428 C CB  . ALA A 1 180 ? 1.909   -47.123 -25.351 1.00 35.21  ? 263 ALA A CB  1 
ATOM   1429 N N   . VAL A 1 181 ? 1.882   -43.839 -26.154 1.00 41.46  ? 264 VAL A N   1 
ATOM   1430 C CA  . VAL A 1 181 ? 2.895   -42.793 -26.023 1.00 37.52  ? 264 VAL A CA  1 
ATOM   1431 C C   . VAL A 1 181 ? 3.165   -42.425 -24.618 1.00 38.59  ? 264 VAL A C   1 
ATOM   1432 O O   . VAL A 1 181 ? 2.256   -42.301 -23.808 1.00 40.10  ? 264 VAL A O   1 
ATOM   1433 C CB  . VAL A 1 181 ? 2.754   -41.613 -26.992 1.00 40.13  ? 264 VAL A CB  1 
ATOM   1434 C CG1 . VAL A 1 181 ? 1.503   -41.703 -27.849 1.00 41.76  ? 264 VAL A CG1 1 
ATOM   1435 C CG2 . VAL A 1 181 ? 3.060   -40.266 -26.365 1.00 37.24  ? 264 VAL A CG2 1 
ATOM   1436 N N   . PHE A 1 182 ? 4.457   -42.355 -24.314 1.00 40.23  ? 265 PHE A N   1 
ATOM   1437 C CA  . PHE A 1 182 ? 4.915   -42.159 -22.956 1.00 38.67  ? 265 PHE A CA  1 
ATOM   1438 C C   . PHE A 1 182 ? 5.859   -40.980 -22.946 1.00 41.17  ? 265 PHE A C   1 
ATOM   1439 O O   . PHE A 1 182 ? 6.821   -40.971 -23.684 1.00 46.60  ? 265 PHE A O   1 
ATOM   1440 C CB  . PHE A 1 182 ? 5.645   -43.390 -22.447 1.00 32.85  ? 265 PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 182 ? 6.447   -43.116 -21.200 1.00 37.12  ? 265 PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 182 ? 5.818   -43.040 -19.953 1.00 36.01  ? 265 PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 182 ? 7.830   -42.921 -21.264 1.00 35.56  ? 265 PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 182 ? 6.553   -42.773 -18.795 1.00 38.98  ? 265 PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 182 ? 8.562   -42.640 -20.110 1.00 39.37  ? 265 PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 182 ? 7.926   -42.570 -18.863 1.00 38.34  ? 265 PHE A CZ  1 
ATOM   1447 N N   . VAL A 1 183 ? 5.618   -40.010 -22.085 1.00 44.07  ? 266 VAL A N   1 
ATOM   1448 C CA  . VAL A 1 183 ? 6.455   -38.796 -22.026 1.00 41.53  ? 266 VAL A CA  1 
ATOM   1449 C C   . VAL A 1 183 ? 6.857   -38.424 -20.584 1.00 42.82  ? 266 VAL A C   1 
ATOM   1450 O O   . VAL A 1 183 ? 6.108   -38.647 -19.623 1.00 42.89  ? 266 VAL A O   1 
ATOM   1451 C CB  . VAL A 1 183 ? 5.753   -37.598 -22.709 1.00 41.92  ? 266 VAL A CB  1 
ATOM   1452 C CG1 . VAL A 1 183 ? 5.288   -38.012 -24.089 1.00 38.84  ? 266 VAL A CG1 1 
ATOM   1453 C CG2 . VAL A 1 183 ? 4.544   -37.115 -21.896 1.00 40.88  ? 266 VAL A CG2 1 
ATOM   1454 N N   . THR A 1 184 ? 8.050   -37.864 -20.453 1.00 41.27  ? 267 THR A N   1 
ATOM   1455 C CA  . THR A 1 184 ? 8.461   -37.300 -19.222 1.00 42.76  ? 267 THR A CA  1 
ATOM   1456 C C   . THR A 1 184 ? 8.249   -35.788 -19.270 1.00 43.99  ? 267 THR A C   1 
ATOM   1457 O O   . THR A 1 184 ? 8.117   -35.171 -20.349 1.00 38.28  ? 267 THR A O   1 
ATOM   1458 C CB  . THR A 1 184 ? 9.919   -37.640 -18.931 1.00 46.88  ? 267 THR A CB  1 
ATOM   1459 O OG1 . THR A 1 184 ? 10.767  -36.878 -19.793 1.00 48.91  ? 267 THR A OG1 1 
ATOM   1460 C CG2 . THR A 1 184 ? 10.156  -39.132 -19.177 1.00 48.23  ? 267 THR A CG2 1 
ATOM   1461 N N   . ASN A 1 185 ? 8.163   -35.200 -18.076 1.00 47.00  ? 268 ASN A N   1 
ATOM   1462 C CA  . ASN A 1 185 ? 8.005   -33.788 -17.947 1.00 48.17  ? 268 ASN A CA  1 
ATOM   1463 C C   . ASN A 1 185 ? 8.580   -33.286 -16.608 1.00 54.07  ? 268 ASN A C   1 
ATOM   1464 O O   . ASN A 1 185 ? 8.711   -34.052 -15.651 1.00 56.70  ? 268 ASN A O   1 
ATOM   1465 C CB  . ASN A 1 185 ? 6.532   -33.460 -18.155 1.00 47.63  ? 268 ASN A CB  1 
ATOM   1466 C CG  . ASN A 1 185 ? 6.247   -31.978 -18.129 1.00 56.09  ? 268 ASN A CG  1 
ATOM   1467 O OD1 . ASN A 1 185 ? 5.262   -31.564 -17.542 1.00 63.08  ? 268 ASN A OD1 1 
ATOM   1468 N ND2 . ASN A 1 185 ? 7.121   -31.163 -18.730 1.00 58.22  ? 268 ASN A ND2 1 
ATOM   1469 N N   . GLN A 1 186 ? 8.922   -31.997 -16.558 1.00 59.70  ? 269 GLN A N   1 
ATOM   1470 C CA  . GLN A 1 186 ? 9.566   -31.337 -15.400 1.00 63.71  ? 269 GLN A CA  1 
ATOM   1471 C C   . GLN A 1 186 ? 8.572   -30.671 -14.468 1.00 71.00  ? 269 GLN A C   1 
ATOM   1472 O O   . GLN A 1 186 ? 7.390   -30.556 -14.781 1.00 75.86  ? 269 GLN A O   1 
ATOM   1473 C CB  . GLN A 1 186 ? 10.535  -30.259 -15.879 1.00 62.11  ? 269 GLN A CB  1 
ATOM   1474 C CG  . GLN A 1 186 ? 11.728  -30.773 -16.673 1.00 64.06  ? 269 GLN A CG  1 
ATOM   1475 C CD  . GLN A 1 186 ? 11.407  -31.055 -18.145 1.00 65.03  ? 269 GLN A CD  1 
ATOM   1476 O OE1 . GLN A 1 186 ? 10.858  -30.208 -18.853 1.00 65.74  ? 269 GLN A OE1 1 
ATOM   1477 N NE2 . GLN A 1 186 ? 11.756  -32.255 -18.606 1.00 59.92  ? 269 GLN A NE2 1 
ATOM   1478 N N   . MET A 1 187 ? 9.068   -30.192 -13.335 1.00 77.54  ? 270 MET A N   1 
ATOM   1479 C CA  . MET A 1 187 ? 8.230   -29.588 -12.308 1.00 83.75  ? 270 MET A CA  1 
ATOM   1480 C C   . MET A 1 187 ? 8.515   -28.075 -12.177 1.00 89.50  ? 270 MET A C   1 
ATOM   1481 O O   . MET A 1 187 ? 9.434   -27.569 -12.832 1.00 95.18  ? 270 MET A O   1 
ATOM   1482 C CB  . MET A 1 187 ? 8.515   -30.284 -10.975 1.00 85.97  ? 270 MET A CB  1 
ATOM   1483 C CG  . MET A 1 187 ? 8.365   -31.796 -10.980 1.00 86.93  ? 270 MET A CG  1 
ATOM   1484 S SD  . MET A 1 187 ? 6.825   -32.354 -10.239 1.00 95.84  ? 270 MET A SD  1 
ATOM   1485 C CE  . MET A 1 187 ? 7.247   -32.571 -8.496  1.00 94.01  ? 270 MET A CE  1 
ATOM   1486 N N   . THR A 1 188 ? 7.699   -27.368 -11.376 1.00 93.66  ? 271 THR A N   1 
ATOM   1487 C CA  . THR A 1 188 ? 8.075   -26.090 -10.675 1.00 97.28  ? 271 THR A CA  1 
ATOM   1488 C C   . THR A 1 188 ? 7.321   -25.944 -9.340  1.00 95.67  ? 271 THR A C   1 
ATOM   1489 O O   . THR A 1 188 ? 6.214   -26.484 -9.173  1.00 88.61  ? 271 THR A O   1 
ATOM   1490 C CB  . THR A 1 188 ? 7.877   -24.785 -11.514 1.00 96.99  ? 271 THR A CB  1 
ATOM   1491 O OG1 . THR A 1 188 ? 6.843   -24.964 -12.500 1.00 87.94  ? 271 THR A OG1 1 
ATOM   1492 C CG2 . THR A 1 188 ? 9.185   -24.356 -12.193 1.00 91.66  ? 271 THR A CG2 1 
ATOM   1493 N N   . LYS A 1 203 ? 4.089   -28.081 -8.927  1.00 84.03  ? 286 LYS A N   1 
ATOM   1494 C CA  . LYS A 1 203 ? 3.233   -28.882 -9.812  1.00 88.88  ? 286 LYS A CA  1 
ATOM   1495 C C   . LYS A 1 203 ? 3.917   -29.151 -11.198 1.00 85.43  ? 286 LYS A C   1 
ATOM   1496 O O   . LYS A 1 203 ? 5.041   -28.704 -11.429 1.00 86.22  ? 286 LYS A O   1 
ATOM   1497 C CB  . LYS A 1 203 ? 1.848   -28.217 -9.967  1.00 93.21  ? 286 LYS A CB  1 
ATOM   1498 C CG  . LYS A 1 203 ? 1.394   -27.290 -8.828  1.00 104.88 ? 286 LYS A CG  1 
ATOM   1499 C CD  . LYS A 1 203 ? 0.824   -27.985 -7.585  1.00 104.91 ? 286 LYS A CD  1 
ATOM   1500 C CE  . LYS A 1 203 ? 0.629   -26.990 -6.440  1.00 104.22 ? 286 LYS A CE  1 
ATOM   1501 N NZ  . LYS A 1 203 ? 1.871   -26.213 -6.143  1.00 106.86 ? 286 LYS A NZ  1 
ATOM   1502 N N   . PRO A 1 204 ? 3.265   -29.905 -12.117 1.00 85.39  ? 287 PRO A N   1 
ATOM   1503 C CA  . PRO A 1 204 ? 3.929   -30.103 -13.445 1.00 78.80  ? 287 PRO A CA  1 
ATOM   1504 C C   . PRO A 1 204 ? 3.830   -28.898 -14.391 1.00 73.49  ? 287 PRO A C   1 
ATOM   1505 O O   . PRO A 1 204 ? 2.867   -28.140 -14.317 1.00 77.83  ? 287 PRO A O   1 
ATOM   1506 C CB  . PRO A 1 204 ? 3.169   -31.298 -14.046 1.00 78.90  ? 287 PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 204 ? 1.841   -31.323 -13.329 1.00 83.46  ? 287 PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 204 ? 2.078   -30.776 -11.950 1.00 81.54  ? 287 PRO A CD  1 
ATOM   1509 N N   . ILE A 1 205 ? 4.802   -28.716 -15.280 1.00 69.53  ? 288 ILE A N   1 
ATOM   1510 C CA  . ILE A 1 205 ? 4.702   -27.629 -16.281 1.00 70.55  ? 288 ILE A CA  1 
ATOM   1511 C C   . ILE A 1 205 ? 3.682   -27.992 -17.364 1.00 64.32  ? 288 ILE A C   1 
ATOM   1512 O O   . ILE A 1 205 ? 3.183   -29.094 -17.365 1.00 67.54  ? 288 ILE A O   1 
ATOM   1513 C CB  . ILE A 1 205 ? 6.076   -27.175 -16.877 1.00 72.49  ? 288 ILE A CB  1 
ATOM   1514 C CG1 . ILE A 1 205 ? 6.818   -28.313 -17.589 1.00 70.08  ? 288 ILE A CG1 1 
ATOM   1515 C CG2 . ILE A 1 205 ? 6.967   -26.546 -15.805 1.00 72.56  ? 288 ILE A CG2 1 
ATOM   1516 C CD1 . ILE A 1 205 ? 8.056   -27.839 -18.331 1.00 71.22  ? 288 ILE A CD1 1 
ATOM   1517 N N   . GLY A 1 206 ? 3.327   -27.070 -18.247 1.00 64.11  ? 289 GLY A N   1 
ATOM   1518 C CA  . GLY A 1 206 ? 2.352   -27.382 -19.305 1.00 65.67  ? 289 GLY A CA  1 
ATOM   1519 C C   . GLY A 1 206 ? 0.910   -26.910 -19.170 1.00 68.33  ? 289 GLY A C   1 
ATOM   1520 O O   . GLY A 1 206 ? 0.158   -26.943 -20.160 1.00 66.97  ? 289 GLY A O   1 
ATOM   1521 N N   . GLY A 1 207 ? 0.521   -26.470 -17.966 1.00 68.93  ? 290 GLY A N   1 
ATOM   1522 C CA  . GLY A 1 207 ? -0.815  -25.916 -17.719 1.00 69.21  ? 290 GLY A CA  1 
ATOM   1523 C C   . GLY A 1 207 ? -1.966  -26.840 -18.096 1.00 68.83  ? 290 GLY A C   1 
ATOM   1524 O O   . GLY A 1 207 ? -1.832  -28.062 -18.088 1.00 69.90  ? 290 GLY A O   1 
ATOM   1525 N N   . HIS A 1 208 ? -3.101  -26.246 -18.447 1.00 72.18  ? 291 HIS A N   1 
ATOM   1526 C CA  . HIS A 1 208 ? -4.235  -26.990 -18.981 1.00 69.45  ? 291 HIS A CA  1 
ATOM   1527 C C   . HIS A 1 208 ? -3.901  -27.760 -20.231 1.00 61.81  ? 291 HIS A C   1 
ATOM   1528 O O   . HIS A 1 208 ? -4.481  -28.817 -20.453 1.00 57.29  ? 291 HIS A O   1 
ATOM   1529 C CB  . HIS A 1 208 ? -5.408  -26.067 -19.286 1.00 72.57  ? 291 HIS A CB  1 
ATOM   1530 C CG  . HIS A 1 208 ? -5.965  -25.357 -18.075 1.00 87.94  ? 291 HIS A CG  1 
ATOM   1531 N ND1 . HIS A 1 208 ? -5.645  -24.070 -17.767 1.00 93.80  ? 291 HIS A ND1 1 
ATOM   1532 C CD2 . HIS A 1 208 ? -6.879  -25.776 -17.100 1.00 88.84  ? 291 HIS A CD2 1 
ATOM   1533 C CE1 . HIS A 1 208 ? -6.313  -23.691 -16.649 1.00 91.85  ? 291 HIS A CE1 1 
ATOM   1534 N NE2 . HIS A 1 208 ? -7.058  -24.736 -16.238 1.00 90.53  ? 291 HIS A NE2 1 
ATOM   1535 N N   . ILE A 1 209 ? -3.016  -27.242 -21.080 1.00 57.71  ? 292 ILE A N   1 
ATOM   1536 C CA  . ILE A 1 209 ? -2.817  -27.854 -22.392 1.00 61.91  ? 292 ILE A CA  1 
ATOM   1537 C C   . ILE A 1 209 ? -2.320  -29.289 -22.214 1.00 61.71  ? 292 ILE A C   1 
ATOM   1538 O O   . ILE A 1 209 ? -2.847  -30.242 -22.823 1.00 60.84  ? 292 ILE A O   1 
ATOM   1539 C CB  . ILE A 1 209 ? -1.838  -27.059 -23.279 1.00 67.12  ? 292 ILE A CB  1 
ATOM   1540 C CG1 . ILE A 1 209 ? -2.284  -25.613 -23.361 1.00 76.23  ? 292 ILE A CG1 1 
ATOM   1541 C CG2 . ILE A 1 209 ? -1.753  -27.634 -24.696 1.00 63.83  ? 292 ILE A CG2 1 
ATOM   1542 C CD1 . ILE A 1 209 ? -1.182  -24.654 -23.760 1.00 84.67  ? 292 ILE A CD1 1 
ATOM   1543 N N   . LEU A 1 210 ? -1.346  -29.445 -21.327 1.00 61.11  ? 293 LEU A N   1 
ATOM   1544 C CA  . LEU A 1 210 ? -0.697  -30.721 -21.165 1.00 57.17  ? 293 LEU A CA  1 
ATOM   1545 C C   . LEU A 1 210 ? -1.534  -31.635 -20.303 1.00 55.15  ? 293 LEU A C   1 
ATOM   1546 O O   . LEU A 1 210 ? -1.620  -32.818 -20.548 1.00 55.18  ? 293 LEU A O   1 
ATOM   1547 C CB  . LEU A 1 210 ? 0.640   -30.515 -20.538 1.00 56.88  ? 293 LEU A CB  1 
ATOM   1548 C CG  . LEU A 1 210 ? 1.767   -31.321 -21.113 1.00 58.63  ? 293 LEU A CG  1 
ATOM   1549 C CD1 . LEU A 1 210 ? 2.751   -31.315 -19.971 1.00 68.45  ? 293 LEU A CD1 1 
ATOM   1550 C CD2 . LEU A 1 210 ? 1.433   -32.750 -21.492 1.00 57.17  ? 293 LEU A CD2 1 
ATOM   1551 N N   . ALA A 1 211 ? -2.160  -31.071 -19.289 1.00 54.75  ? 294 ALA A N   1 
ATOM   1552 C CA  . ALA A 1 211 ? -3.057  -31.824 -18.443 1.00 54.18  ? 294 ALA A CA  1 
ATOM   1553 C C   . ALA A 1 211 ? -4.133  -32.511 -19.305 1.00 54.23  ? 294 ALA A C   1 
ATOM   1554 O O   . ALA A 1 211 ? -4.460  -33.692 -19.114 1.00 52.31  ? 294 ALA A O   1 
ATOM   1555 C CB  . ALA A 1 211 ? -3.684  -30.894 -17.394 1.00 52.29  ? 294 ALA A CB  1 
ATOM   1556 N N   . HIS A 1 212 ? -4.655  -31.779 -20.289 1.00 53.12  ? 295 HIS A N   1 
ATOM   1557 C CA  . HIS A 1 212 ? -5.747  -32.301 -21.043 1.00 51.08  ? 295 HIS A CA  1 
ATOM   1558 C C   . HIS A 1 212 ? -5.289  -33.487 -21.920 1.00 51.91  ? 295 HIS A C   1 
ATOM   1559 O O   . HIS A 1 212 ? -6.030  -34.494 -22.110 1.00 48.92  ? 295 HIS A O   1 
ATOM   1560 C CB  . HIS A 1 212 ? -6.425  -31.194 -21.844 1.00 51.31  ? 295 HIS A CB  1 
ATOM   1561 C CG  . HIS A 1 212 ? -7.338  -31.721 -22.937 1.00 57.22  ? 295 HIS A CG  1 
ATOM   1562 N ND1 . HIS A 1 212 ? -6.897  -31.941 -24.246 1.00 54.31  ? 295 HIS A ND1 1 
ATOM   1563 C CD2 . HIS A 1 212 ? -8.663  -32.188 -22.875 1.00 57.24  ? 295 HIS A CD2 1 
ATOM   1564 C CE1 . HIS A 1 212 ? -7.900  -32.485 -24.958 1.00 56.01  ? 295 HIS A CE1 1 
ATOM   1565 N NE2 . HIS A 1 212 ? -8.985  -32.641 -24.123 1.00 63.19  ? 295 HIS A NE2 1 
ATOM   1566 N N   . ALA A 1 213 ? -4.076  -33.370 -22.459 1.00 49.66  ? 296 ALA A N   1 
ATOM   1567 C CA  . ALA A 1 213 ? -3.627  -34.279 -23.488 1.00 49.46  ? 296 ALA A CA  1 
ATOM   1568 C C   . ALA A 1 213 ? -3.210  -35.647 -22.965 1.00 50.53  ? 296 ALA A C   1 
ATOM   1569 O O   . ALA A 1 213 ? -3.329  -36.641 -23.694 1.00 51.57  ? 296 ALA A O   1 
ATOM   1570 C CB  . ALA A 1 213 ? -2.515  -33.657 -24.307 1.00 47.28  ? 296 ALA A CB  1 
ATOM   1571 N N   . SER A 1 214 ? -2.690  -35.692 -21.735 1.00 51.23  ? 297 SER A N   1 
ATOM   1572 C CA  . SER A 1 214 ? -2.210  -36.944 -21.146 1.00 49.25  ? 297 SER A CA  1 
ATOM   1573 C C   . SER A 1 214 ? -3.441  -37.571 -20.524 1.00 52.94  ? 297 SER A C   1 
ATOM   1574 O O   . SER A 1 214 ? -4.189  -36.883 -19.805 1.00 57.40  ? 297 SER A O   1 
ATOM   1575 C CB  . SER A 1 214 ? -1.176  -36.712 -20.040 1.00 51.53  ? 297 SER A CB  1 
ATOM   1576 O OG  . SER A 1 214 ? -0.175  -35.729 -20.355 1.00 55.68  ? 297 SER A OG  1 
ATOM   1577 N N   . THR A 1 215 ? -3.673  -38.856 -20.769 1.00 46.52  ? 298 THR A N   1 
ATOM   1578 C CA  . THR A 1 215 ? -4.850  -39.398 -20.197 1.00 49.58  ? 298 THR A CA  1 
ATOM   1579 C C   . THR A 1 215 ? -4.566  -40.048 -18.820 1.00 50.38  ? 298 THR A C   1 
ATOM   1580 O O   . THR A 1 215 ? -5.456  -40.286 -18.019 1.00 52.00  ? 298 THR A O   1 
ATOM   1581 C CB  . THR A 1 215 ? -5.707  -40.215 -21.230 1.00 54.38  ? 298 THR A CB  1 
ATOM   1582 O OG1 . THR A 1 215 ? -5.767  -41.599 -20.880 1.00 52.70  ? 298 THR A OG1 1 
ATOM   1583 C CG2 . THR A 1 215 ? -5.223  -40.034 -22.653 1.00 47.87  ? 298 THR A CG2 1 
ATOM   1584 N N   . THR A 1 216 ? -3.303  -40.284 -18.539 1.00 50.62  ? 299 THR A N   1 
ATOM   1585 C CA  . THR A 1 216 ? -2.869  -40.706 -17.227 1.00 49.41  ? 299 THR A CA  1 
ATOM   1586 C C   . THR A 1 216 ? -1.604  -39.925 -16.940 1.00 51.17  ? 299 THR A C   1 
ATOM   1587 O O   . THR A 1 216 ? -0.710  -39.883 -17.803 1.00 51.93  ? 299 THR A O   1 
ATOM   1588 C CB  . THR A 1 216 ? -2.491  -42.190 -17.258 1.00 48.05  ? 299 THR A CB  1 
ATOM   1589 O OG1 . THR A 1 216 ? -3.623  -42.934 -17.693 1.00 47.18  ? 299 THR A OG1 1 
ATOM   1590 C CG2 . THR A 1 216 ? -2.060  -42.692 -15.893 1.00 50.33  ? 299 THR A CG2 1 
ATOM   1591 N N   . ARG A 1 217 ? -1.534  -39.338 -15.741 1.00 52.24  ? 300 ARG A N   1 
ATOM   1592 C CA  . ARG A 1 217 ? -0.366  -38.572 -15.267 1.00 50.23  ? 300 ARG A CA  1 
ATOM   1593 C C   . ARG A 1 217 ? 0.099   -39.143 -13.939 1.00 51.67  ? 300 ARG A C   1 
ATOM   1594 O O   . ARG A 1 217 ? -0.689  -39.265 -12.994 1.00 52.55  ? 300 ARG A O   1 
ATOM   1595 C CB  . ARG A 1 217 ? -0.645  -37.064 -15.086 1.00 49.50  ? 300 ARG A CB  1 
ATOM   1596 C CG  . ARG A 1 217 ? -1.538  -36.379 -16.113 1.00 49.19  ? 300 ARG A CG  1 
ATOM   1597 C CD  . ARG A 1 217 ? -0.878  -35.109 -16.640 1.00 50.19  ? 300 ARG A CD  1 
ATOM   1598 N NE  . ARG A 1 217 ? -1.367  -33.881 -16.037 1.00 53.50  ? 300 ARG A NE  1 
ATOM   1599 C CZ  . ARG A 1 217 ? -0.693  -32.726 -15.978 1.00 55.45  ? 300 ARG A CZ  1 
ATOM   1600 N NH1 . ARG A 1 217 ? 0.525   -32.605 -16.479 1.00 55.13  ? 300 ARG A NH1 1 
ATOM   1601 N NH2 . ARG A 1 217 ? -1.242  -31.676 -15.385 1.00 59.54  ? 300 ARG A NH2 1 
ATOM   1602 N N   . ILE A 1 218 ? 1.390   -39.473 -13.898 1.00 50.85  ? 301 ILE A N   1 
ATOM   1603 C CA  . ILE A 1 218 ? 2.029   -40.082 -12.774 1.00 52.31  ? 301 ILE A CA  1 
ATOM   1604 C C   . ILE A 1 218 ? 3.031   -39.129 -12.160 1.00 55.79  ? 301 ILE A C   1 
ATOM   1605 O O   . ILE A 1 218 ? 3.940   -38.643 -12.833 1.00 51.65  ? 301 ILE A O   1 
ATOM   1606 C CB  . ILE A 1 218 ? 2.790   -41.334 -13.184 1.00 51.26  ? 301 ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 218 ? 1.843   -42.341 -13.784 1.00 55.63  ? 301 ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 218 ? 3.392   -42.037 -11.977 1.00 53.44  ? 301 ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 218 ? 2.596   -43.321 -14.674 1.00 59.02  ? 301 ILE A CD1 1 
ATOM   1610 N N   . SER A 1 219 ? 2.886   -38.893 -10.856 1.00 59.79  ? 302 SER A N   1 
ATOM   1611 C CA  . SER A 1 219 ? 3.911   -38.165 -10.142 1.00 61.69  ? 302 SER A CA  1 
ATOM   1612 C C   . SER A 1 219 ? 4.894   -39.143 -9.573  1.00 62.66  ? 302 SER A C   1 
ATOM   1613 O O   . SER A 1 219 ? 4.504   -40.208 -9.123  1.00 64.91  ? 302 SER A O   1 
ATOM   1614 C CB  . SER A 1 219 ? 3.341   -37.419 -8.984  1.00 65.98  ? 302 SER A CB  1 
ATOM   1615 O OG  . SER A 1 219 ? 4.406   -37.295 -8.068  1.00 72.34  ? 302 SER A OG  1 
ATOM   1616 N N   . LEU A 1 220 ? 6.163   -38.762 -9.566  1.00 63.81  ? 303 LEU A N   1 
ATOM   1617 C CA  . LEU A 1 220 ? 7.220   -39.601 -9.046  1.00 64.33  ? 303 LEU A CA  1 
ATOM   1618 C C   . LEU A 1 220 ? 8.035   -38.817 -8.035  1.00 71.66  ? 303 LEU A C   1 
ATOM   1619 O O   . LEU A 1 220 ? 8.180   -37.606 -8.157  1.00 75.57  ? 303 LEU A O   1 
ATOM   1620 C CB  . LEU A 1 220 ? 8.116   -40.057 -10.176 1.00 61.78  ? 303 LEU A CB  1 
ATOM   1621 C CG  . LEU A 1 220 ? 7.561   -40.866 -11.341 1.00 59.99  ? 303 LEU A CG  1 
ATOM   1622 C CD1 . LEU A 1 220 ? 8.615   -41.041 -12.429 1.00 52.63  ? 303 LEU A CD1 1 
ATOM   1623 C CD2 . LEU A 1 220 ? 7.100   -42.221 -10.805 1.00 61.99  ? 303 LEU A CD2 1 
ATOM   1624 N N   . ARG A 1 221 ? 8.547   -39.522 -7.030  1.00 77.11  ? 304 ARG A N   1 
ATOM   1625 C CA  . ARG A 1 221 ? 9.357   -38.966 -5.938  1.00 81.46  ? 304 ARG A CA  1 
ATOM   1626 C C   . ARG A 1 221 ? 10.031  -40.186 -5.277  1.00 87.08  ? 304 ARG A C   1 
ATOM   1627 O O   . ARG A 1 221 ? 9.656   -41.342 -5.562  1.00 86.54  ? 304 ARG A O   1 
ATOM   1628 C CB  . ARG A 1 221 ? 8.498   -38.166 -4.944  1.00 80.60  ? 304 ARG A CB  1 
ATOM   1629 C CG  . ARG A 1 221 ? 7.580   -39.036 -4.108  1.00 83.61  ? 304 ARG A CG  1 
ATOM   1630 C CD  . ARG A 1 221 ? 6.513   -38.263 -3.354  1.00 85.09  ? 304 ARG A CD  1 
ATOM   1631 N NE  . ARG A 1 221 ? 6.052   -39.039 -2.196  1.00 90.25  ? 304 ARG A NE  1 
ATOM   1632 C CZ  . ARG A 1 221 ? 4.925   -39.754 -2.123  1.00 90.55  ? 304 ARG A CZ  1 
ATOM   1633 N NH1 . ARG A 1 221 ? 4.071   -39.807 -3.148  1.00 84.96  ? 304 ARG A NH1 1 
ATOM   1634 N NH2 . ARG A 1 221 ? 4.644   -40.408 -0.997  1.00 91.36  ? 304 ARG A NH2 1 
ATOM   1635 N N   . LYS A 1 222 ? 11.015  -39.951 -4.411  1.00 87.63  ? 305 LYS A N   1 
ATOM   1636 C CA  . LYS A 1 222 ? 11.851  -41.050 -3.936  1.00 86.13  ? 305 LYS A CA  1 
ATOM   1637 C C   . LYS A 1 222 ? 11.570  -41.364 -2.513  1.00 87.77  ? 305 LYS A C   1 
ATOM   1638 O O   . LYS A 1 222 ? 11.258  -40.462 -1.771  1.00 91.69  ? 305 LYS A O   1 
ATOM   1639 C CB  . LYS A 1 222 ? 13.333  -40.711 -4.092  1.00 87.74  ? 305 LYS A CB  1 
ATOM   1640 C CG  . LYS A 1 222 ? 13.697  -39.240 -3.932  1.00 88.80  ? 305 LYS A CG  1 
ATOM   1641 C CD  . LYS A 1 222 ? 15.075  -38.978 -4.531  1.00 92.16  ? 305 LYS A CD  1 
ATOM   1642 C CE  . LYS A 1 222 ? 16.140  -39.895 -3.909  1.00 98.15  ? 305 LYS A CE  1 
ATOM   1643 N NZ  . LYS A 1 222 ? 17.520  -39.690 -4.441  1.00 94.10  ? 305 LYS A NZ  1 
ATOM   1644 N N   . GLY A 1 223 ? 11.657  -42.646 -2.149  1.00 89.90  ? 306 GLY A N   1 
ATOM   1645 C CA  . GLY A 1 223 ? 11.775  -43.095 -0.736  1.00 97.21  ? 306 GLY A CA  1 
ATOM   1646 C C   . GLY A 1 223 ? 13.233  -43.310 -0.317  1.00 97.44  ? 306 GLY A C   1 
ATOM   1647 O O   . GLY A 1 223 ? 14.133  -42.665 -0.854  1.00 91.01  ? 306 GLY A O   1 
ATOM   1648 N N   . ARG A 1 224 ? 13.477  -44.226 0.618   1.00 104.36 ? 307 ARG A N   1 
ATOM   1649 C CA  . ARG A 1 224 ? 14.845  -44.483 1.119   1.00 111.03 ? 307 ARG A CA  1 
ATOM   1650 C C   . ARG A 1 224 ? 15.820  -45.012 0.043   1.00 114.93 ? 307 ARG A C   1 
ATOM   1651 O O   . ARG A 1 224 ? 15.888  -46.218 -0.226  1.00 118.95 ? 307 ARG A O   1 
ATOM   1652 C CB  . ARG A 1 224 ? 14.809  -45.433 2.315   1.00 110.39 ? 307 ARG A CB  1 
ATOM   1653 C CG  . ARG A 1 224 ? 13.944  -46.664 2.092   1.00 109.78 ? 307 ARG A CG  1 
ATOM   1654 C CD  . ARG A 1 224 ? 13.315  -47.144 3.388   1.00 113.75 ? 307 ARG A CD  1 
ATOM   1655 N NE  . ARG A 1 224 ? 13.993  -48.298 3.980   1.00 115.02 ? 307 ARG A NE  1 
ATOM   1656 C CZ  . ARG A 1 224 ? 15.106  -48.253 4.717   1.00 118.21 ? 307 ARG A CZ  1 
ATOM   1657 N NH1 . ARG A 1 224 ? 15.724  -47.096 4.962   1.00 117.01 ? 307 ARG A NH1 1 
ATOM   1658 N NH2 . ARG A 1 224 ? 15.609  -49.384 5.211   1.00 121.61 ? 307 ARG A NH2 1 
ATOM   1659 N N   . GLY A 1 225 ? 16.570  -44.103 -0.573  1.00 112.70 ? 308 GLY A N   1 
ATOM   1660 C CA  . GLY A 1 225 ? 17.574  -44.486 -1.547  1.00 115.28 ? 308 GLY A CA  1 
ATOM   1661 C C   . GLY A 1 225 ? 16.957  -45.030 -2.819  1.00 120.82 ? 308 GLY A C   1 
ATOM   1662 O O   . GLY A 1 225 ? 16.284  -44.295 -3.550  1.00 129.20 ? 308 GLY A O   1 
ATOM   1663 N N   . GLU A 1 226 ? 17.175  -46.324 -3.075  1.00 123.06 ? 309 GLU A N   1 
ATOM   1664 C CA  . GLU A 1 226 ? 16.741  -47.000 -4.325  1.00 115.87 ? 309 GLU A CA  1 
ATOM   1665 C C   . GLU A 1 226 ? 15.213  -47.054 -4.514  1.00 106.17 ? 309 GLU A C   1 
ATOM   1666 O O   . GLU A 1 226 ? 14.726  -47.304 -5.621  1.00 100.54 ? 309 GLU A O   1 
ATOM   1667 C CB  . GLU A 1 226 ? 17.341  -48.420 -4.420  1.00 121.18 ? 309 GLU A CB  1 
ATOM   1668 C CG  . GLU A 1 226 ? 17.396  -49.161 -3.076  1.00 134.75 ? 309 GLU A CG  1 
ATOM   1669 C CD  . GLU A 1 226 ? 17.431  -50.688 -3.192  1.00 136.60 ? 309 GLU A CD  1 
ATOM   1670 O OE1 . GLU A 1 226 ? 16.832  -51.232 -4.161  1.00 128.68 ? 309 GLU A OE1 1 
ATOM   1671 O OE2 . GLU A 1 226 ? 18.043  -51.342 -2.295  1.00 126.81 ? 309 GLU A OE2 1 
ATOM   1672 N N   . LEU A 1 227 ? 14.476  -46.815 -3.430  1.00 98.28  ? 310 LEU A N   1 
ATOM   1673 C CA  . LEU A 1 227 ? 13.021  -46.879 -3.426  1.00 89.02  ? 310 LEU A CA  1 
ATOM   1674 C C   . LEU A 1 227 ? 12.386  -45.592 -3.927  1.00 82.53  ? 310 LEU A C   1 
ATOM   1675 O O   . LEU A 1 227 ? 12.725  -44.511 -3.459  1.00 79.80  ? 310 LEU A O   1 
ATOM   1676 C CB  . LEU A 1 227 ? 12.529  -47.167 -2.025  1.00 94.32  ? 310 LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 227 ? 11.387  -48.163 -1.973  1.00 95.40  ? 310 LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 227 ? 11.860  -49.509 -2.496  1.00 93.45  ? 310 LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 227 ? 10.913  -48.281 -0.532  1.00 104.52 ? 310 LEU A CD2 1 
ATOM   1680 N N   . ARG A 1 228 ? 11.491  -45.713 -4.910  1.00 77.92  ? 311 ARG A N   1 
ATOM   1681 C CA  . ARG A 1 228 ? 10.757  -44.568 -5.452  1.00 72.54  ? 311 ARG A CA  1 
ATOM   1682 C C   . ARG A 1 228 ? 9.258   -44.794 -5.352  1.00 70.72  ? 311 ARG A C   1 
ATOM   1683 O O   . ARG A 1 228 ? 8.806   -45.948 -5.322  1.00 73.49  ? 311 ARG A O   1 
ATOM   1684 C CB  . ARG A 1 228 ? 11.174  -44.290 -6.887  1.00 71.85  ? 311 ARG A CB  1 
ATOM   1685 C CG  . ARG A 1 228 ? 12.429  -43.458 -7.014  1.00 71.08  ? 311 ARG A CG  1 
ATOM   1686 C CD  . ARG A 1 228 ? 13.607  -44.215 -6.441  1.00 81.59  ? 311 ARG A CD  1 
ATOM   1687 N NE  . ARG A 1 228 ? 14.871  -43.483 -6.490  1.00 89.55  ? 311 ARG A NE  1 
ATOM   1688 C CZ  . ARG A 1 228 ? 15.061  -42.355 -7.173  1.00 92.79  ? 311 ARG A CZ  1 
ATOM   1689 N NH1 . ARG A 1 228 ? 14.059  -41.793 -7.859  1.00 87.52  ? 311 ARG A NH1 1 
ATOM   1690 N NH2 . ARG A 1 228 ? 16.258  -41.782 -7.161  1.00 95.50  ? 311 ARG A NH2 1 
ATOM   1691 N N   . ILE A 1 229 ? 8.494   -43.702 -5.265  1.00 68.31  ? 312 ILE A N   1 
ATOM   1692 C CA  . ILE A 1 229 ? 7.032   -43.775 -5.122  1.00 67.79  ? 312 ILE A CA  1 
ATOM   1693 C C   . ILE A 1 229 ? 6.320   -43.193 -6.343  1.00 65.67  ? 312 ILE A C   1 
ATOM   1694 O O   . ILE A 1 229 ? 6.651   -42.095 -6.832  1.00 61.44  ? 312 ILE A O   1 
ATOM   1695 C CB  . ILE A 1 229 ? 6.529   -42.960 -3.928  1.00 73.44  ? 312 ILE A CB  1 
ATOM   1696 C CG1 . ILE A 1 229 ? 7.302   -43.249 -2.594  1.00 78.19  ? 312 ILE A CG1 1 
ATOM   1697 C CG2 . ILE A 1 229 ? 5.016   -43.090 -3.826  1.00 74.60  ? 312 ILE A CG2 1 
ATOM   1698 C CD1 . ILE A 1 229 ? 7.439   -44.709 -2.186  1.00 78.41  ? 312 ILE A CD1 1 
ATOM   1699 N N   . ALA A 1 230 ? 5.329   -43.916 -6.838  1.00 63.86  ? 313 ALA A N   1 
ATOM   1700 C CA  . ALA A 1 230 ? 4.553   -43.400 -7.964  1.00 61.77  ? 313 ALA A CA  1 
ATOM   1701 C C   . ALA A 1 230 ? 3.139   -43.142 -7.514  1.00 64.20  ? 313 ALA A C   1 
ATOM   1702 O O   . ALA A 1 230 ? 2.629   -43.808 -6.613  1.00 66.26  ? 313 ALA A O   1 
ATOM   1703 C CB  . ALA A 1 230 ? 4.579   -44.357 -9.147  1.00 58.89  ? 313 ALA A CB  1 
ATOM   1704 N N   . LYS A 1 231 ? 2.506   -42.174 -8.153  1.00 63.31  ? 314 LYS A N   1 
ATOM   1705 C CA  . LYS A 1 231 ? 1.239   -41.661 -7.687  1.00 64.74  ? 314 LYS A CA  1 
ATOM   1706 C C   . LYS A 1 231 ? 0.484   -41.065 -8.874  1.00 64.19  ? 314 LYS A C   1 
ATOM   1707 O O   . LYS A 1 231 ? 1.080   -40.313 -9.686  1.00 61.28  ? 314 LYS A O   1 
ATOM   1708 C CB  . LYS A 1 231 ? 1.511   -40.626 -6.589  1.00 69.13  ? 314 LYS A CB  1 
ATOM   1709 C CG  . LYS A 1 231 ? 0.375   -39.650 -6.364  1.00 71.23  ? 314 LYS A CG  1 
ATOM   1710 C CD  . LYS A 1 231 ? 0.007   -39.609 -4.912  1.00 69.96  ? 314 LYS A CD  1 
ATOM   1711 C CE  . LYS A 1 231 ? -1.503  -39.515 -4.805  1.00 73.37  ? 314 LYS A CE  1 
ATOM   1712 N NZ  . LYS A 1 231 ? -2.023  -39.599 -3.402  1.00 78.22  ? 314 LYS A NZ  1 
ATOM   1713 N N   . ILE A 1 232 ? -0.788  -41.449 -9.022  1.00 62.47  ? 315 ILE A N   1 
ATOM   1714 C CA  . ILE A 1 232 ? -1.648  -40.804 -9.999  1.00 64.57  ? 315 ILE A CA  1 
ATOM   1715 C C   . ILE A 1 232 ? -1.825  -39.365 -9.569  1.00 71.48  ? 315 ILE A C   1 
ATOM   1716 O O   . ILE A 1 232 ? -2.252  -39.119 -8.434  1.00 83.22  ? 315 ILE A O   1 
ATOM   1717 C CB  . ILE A 1 232 ? -3.036  -41.449 -10.051 1.00 63.34  ? 315 ILE A CB  1 
ATOM   1718 C CG1 . ILE A 1 232 ? -3.046  -42.617 -11.011 1.00 60.59  ? 315 ILE A CG1 1 
ATOM   1719 C CG2 . ILE A 1 232 ? -4.070  -40.464 -10.567 1.00 63.08  ? 315 ILE A CG2 1 
ATOM   1720 C CD1 . ILE A 1 232 ? -2.379  -43.835 -10.452 1.00 63.38  ? 315 ILE A CD1 1 
ATOM   1721 N N   . TYR A 1 233 ? -1.482  -38.416 -10.437 1.00 74.59  ? 316 TYR A N   1 
ATOM   1722 C CA  . TYR A 1 233 ? -1.649  -37.002 -10.090 1.00 83.58  ? 316 TYR A CA  1 
ATOM   1723 C C   . TYR A 1 233 ? -3.132  -36.692 -10.015 1.00 92.22  ? 316 TYR A C   1 
ATOM   1724 O O   . TYR A 1 233 ? -3.949  -37.222 -10.796 1.00 83.71  ? 316 TYR A O   1 
ATOM   1725 C CB  . TYR A 1 233 ? -0.960  -36.076 -11.088 1.00 83.83  ? 316 TYR A CB  1 
ATOM   1726 C CG  . TYR A 1 233 ? -0.972  -34.597 -10.724 1.00 90.55  ? 316 TYR A CG  1 
ATOM   1727 C CD1 . TYR A 1 233 ? -0.235  -34.117 -9.633  1.00 93.25  ? 316 TYR A CD1 1 
ATOM   1728 C CD2 . TYR A 1 233 ? -1.687  -33.668 -11.500 1.00 91.65  ? 316 TYR A CD2 1 
ATOM   1729 C CE1 . TYR A 1 233 ? -0.218  -32.766 -9.317  1.00 96.07  ? 316 TYR A CE1 1 
ATOM   1730 C CE2 . TYR A 1 233 ? -1.694  -32.315 -11.183 1.00 91.93  ? 316 TYR A CE2 1 
ATOM   1731 C CZ  . TYR A 1 233 ? -0.955  -31.863 -10.097 1.00 99.03  ? 316 TYR A CZ  1 
ATOM   1732 O OH  . TYR A 1 233 ? -0.934  -30.511 -9.781  1.00 102.11 ? 316 TYR A OH  1 
ATOM   1733 N N   . ASP A 1 234 ? -3.441  -35.800 -9.081  1.00 103.90 ? 317 ASP A N   1 
ATOM   1734 C CA  . ASP A 1 234 ? -4.788  -35.596 -8.541  1.00 119.60 ? 317 ASP A CA  1 
ATOM   1735 C C   . ASP A 1 234 ? -5.246  -36.730 -7.623  1.00 114.76 ? 317 ASP A C   1 
ATOM   1736 O O   . ASP A 1 234 ? -6.371  -37.222 -7.716  1.00 117.01 ? 317 ASP A O   1 
ATOM   1737 C CB  . ASP A 1 234 ? -5.821  -35.218 -9.616  1.00 130.16 ? 317 ASP A CB  1 
ATOM   1738 C CG  . ASP A 1 234 ? -6.165  -33.734 -9.580  1.00 140.07 ? 317 ASP A CG  1 
ATOM   1739 O OD1 . ASP A 1 234 ? -7.359  -33.402 -9.415  1.00 143.61 ? 317 ASP A OD1 1 
ATOM   1740 O OD2 . ASP A 1 234 ? -5.235  -32.901 -9.683  1.00 134.97 ? 317 ASP A OD2 1 
ATOM   1741 N N   . SER A 1 235 ? -4.330  -37.125 -6.740  1.00 114.33 ? 318 SER A N   1 
ATOM   1742 C CA  . SER A 1 235 ? -4.609  -37.993 -5.594  1.00 113.66 ? 318 SER A CA  1 
ATOM   1743 C C   . SER A 1 235 ? -5.524  -39.171 -5.986  1.00 109.66 ? 318 SER A C   1 
ATOM   1744 O O   . SER A 1 235 ? -5.258  -39.794 -7.045  1.00 94.22  ? 318 SER A O   1 
ATOM   1745 C CB  . SER A 1 235 ? -5.114  -37.153 -4.396  1.00 114.04 ? 318 SER A CB  1 
ATOM   1746 O OG  . SER A 1 235 ? -4.037  -36.576 -3.662  1.00 109.42 ? 318 SER A OG  1 
ATOM   1747 N N   . PRO A 1 236 ? -6.540  -39.525 -5.134  1.00 107.98 ? 319 PRO A N   1 
ATOM   1748 C CA  . PRO A 1 236 ? -6.765  -39.112 -3.716  1.00 111.52 ? 319 PRO A CA  1 
ATOM   1749 C C   . PRO A 1 236 ? -5.770  -39.793 -2.767  1.00 114.24 ? 319 PRO A C   1 
ATOM   1750 O O   . PRO A 1 236 ? -5.029  -40.676 -3.220  1.00 112.26 ? 319 PRO A O   1 
ATOM   1751 C CB  . PRO A 1 236 ? -8.210  -39.553 -3.421  1.00 109.14 ? 319 PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 236 ? -8.544  -40.573 -4.462  1.00 112.00 ? 319 PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 236 ? -7.663  -40.333 -5.660  1.00 104.98 ? 319 PRO A CD  1 
ATOM   1754 N N   . GLU A 1 237 ? -5.726  -39.390 -1.487  1.00 116.14 ? 320 GLU A N   1 
ATOM   1755 C CA  . GLU A 1 237 ? -4.757  -39.984 -0.531  1.00 118.95 ? 320 GLU A CA  1 
ATOM   1756 C C   . GLU A 1 237 ? -5.141  -41.407 -0.075  1.00 123.13 ? 320 GLU A C   1 
ATOM   1757 O O   . GLU A 1 237 ? -5.182  -41.715 1.128   1.00 130.53 ? 320 GLU A O   1 
ATOM   1758 C CB  . GLU A 1 237 ? -4.440  -39.052 0.660   1.00 121.25 ? 320 GLU A CB  1 
ATOM   1759 C CG  . GLU A 1 237 ? -3.535  -37.865 0.327   1.00 117.77 ? 320 GLU A CG  1 
ATOM   1760 C CD  . GLU A 1 237 ? -2.095  -38.253 0.005   1.00 112.11 ? 320 GLU A CD  1 
ATOM   1761 O OE1 . GLU A 1 237 ? -1.273  -38.284 0.948   1.00 106.77 ? 320 GLU A OE1 1 
ATOM   1762 O OE2 . GLU A 1 237 ? -1.777  -38.494 -1.190  1.00 104.93 ? 320 GLU A OE2 1 
ATOM   1763 N N   . MET A 1 238 ? -5.414  -42.256 -1.071  1.00 120.00 ? 321 MET A N   1 
ATOM   1764 C CA  . MET A 1 238 ? -5.709  -43.684 -0.898  1.00 117.24 ? 321 MET A CA  1 
ATOM   1765 C C   . MET A 1 238 ? -4.501  -44.523 -1.379  1.00 113.85 ? 321 MET A C   1 
ATOM   1766 O O   . MET A 1 238 ? -3.885  -44.235 -2.430  1.00 99.51  ? 321 MET A O   1 
ATOM   1767 C CB  . MET A 1 238 ? -7.013  -44.088 -1.624  1.00 113.31 ? 321 MET A CB  1 
ATOM   1768 C CG  . MET A 1 238 ? -8.093  -43.002 -1.660  1.00 115.11 ? 321 MET A CG  1 
ATOM   1769 S SD  . MET A 1 238 ? -8.960  -42.750 -0.085  1.00 130.46 ? 321 MET A SD  1 
ATOM   1770 C CE  . MET A 1 238 ? -9.073  -40.961 0.061   1.00 125.25 ? 321 MET A CE  1 
ATOM   1771 N N   . PRO A 1 239 ? -4.138  -45.550 -0.586  1.00 116.96 ? 322 PRO A N   1 
ATOM   1772 C CA  . PRO A 1 239 ? -2.949  -46.367 -0.857  1.00 111.20 ? 322 PRO A CA  1 
ATOM   1773 C C   . PRO A 1 239 ? -3.013  -47.025 -2.225  1.00 100.23 ? 322 PRO A C   1 
ATOM   1774 O O   . PRO A 1 239 ? -1.975  -47.288 -2.835  1.00 99.84  ? 322 PRO A O   1 
ATOM   1775 C CB  . PRO A 1 239 ? -2.995  -47.426 0.256   1.00 113.73 ? 322 PRO A CB  1 
ATOM   1776 C CG  . PRO A 1 239 ? -4.422  -47.444 0.718   1.00 115.81 ? 322 PRO A CG  1 
ATOM   1777 C CD  . PRO A 1 239 ? -4.866  -46.022 0.607   1.00 115.97 ? 322 PRO A CD  1 
ATOM   1778 N N   . GLU A 1 240 ? -4.233  -47.276 -2.692  1.00 95.86  ? 323 GLU A N   1 
ATOM   1779 C CA  . GLU A 1 240 ? -4.463  -47.897 -3.985  1.00 92.47  ? 323 GLU A CA  1 
ATOM   1780 C C   . GLU A 1 240 ? -3.982  -47.034 -5.157  1.00 84.90  ? 323 GLU A C   1 
ATOM   1781 O O   . GLU A 1 240 ? -3.672  -47.584 -6.212  1.00 81.73  ? 323 GLU A O   1 
ATOM   1782 C CB  . GLU A 1 240 ? -5.931  -48.318 -4.170  1.00 98.52  ? 323 GLU A CB  1 
ATOM   1783 C CG  . GLU A 1 240 ? -6.963  -47.201 -4.008  1.00 110.77 ? 323 GLU A CG  1 
ATOM   1784 C CD  . GLU A 1 240 ? -8.057  -47.206 -5.081  1.00 110.91 ? 323 GLU A CD  1 
ATOM   1785 O OE1 . GLU A 1 240 ? -9.021  -46.412 -4.953  1.00 109.21 ? 323 GLU A OE1 1 
ATOM   1786 O OE2 . GLU A 1 240 ? -7.954  -47.984 -6.061  1.00 108.68 ? 323 GLU A OE2 1 
ATOM   1787 N N   . ASN A 1 241 ? -3.916  -45.707 -4.952  1.00 81.96  ? 324 ASN A N   1 
ATOM   1788 C CA  . ASN A 1 241 ? -3.370  -44.725 -5.925  1.00 75.74  ? 324 ASN A CA  1 
ATOM   1789 C C   . ASN A 1 241 ? -1.864  -44.418 -5.832  1.00 75.59  ? 324 ASN A C   1 
ATOM   1790 O O   . ASN A 1 241 ? -1.377  -43.528 -6.545  1.00 72.17  ? 324 ASN A O   1 
ATOM   1791 C CB  . ASN A 1 241 ? -4.117  -43.389 -5.859  1.00 76.70  ? 324 ASN A CB  1 
ATOM   1792 C CG  . ASN A 1 241 ? -5.623  -43.554 -5.816  1.00 80.98  ? 324 ASN A CG  1 
ATOM   1793 O OD1 . ASN A 1 241 ? -6.239  -43.871 -6.840  1.00 79.73  ? 324 ASN A OD1 1 
ATOM   1794 N ND2 . ASN A 1 241 ? -6.234  -43.319 -4.636  1.00 77.19  ? 324 ASN A ND2 1 
ATOM   1795 N N   . GLU A 1 242 ? -1.143  -45.110 -4.940  1.00 76.30  ? 325 GLU A N   1 
ATOM   1796 C CA  . GLU A 1 242 ? 0.313   -44.998 -4.851  1.00 74.53  ? 325 GLU A CA  1 
ATOM   1797 C C   . GLU A 1 242 ? 0.924   -46.351 -5.126  1.00 72.33  ? 325 GLU A C   1 
ATOM   1798 O O   . GLU A 1 242 ? 0.351   -47.360 -4.753  1.00 78.08  ? 325 GLU A O   1 
ATOM   1799 C CB  . GLU A 1 242 ? 0.761   -44.528 -3.456  1.00 83.73  ? 325 GLU A CB  1 
ATOM   1800 C CG  . GLU A 1 242 ? 0.270   -43.136 -3.051  1.00 91.79  ? 325 GLU A CG  1 
ATOM   1801 C CD  . GLU A 1 242 ? 1.309   -42.313 -2.284  1.00 97.70  ? 325 GLU A CD  1 
ATOM   1802 O OE1 . GLU A 1 242 ? 2.412   -42.838 -2.032  1.00 102.40 ? 325 GLU A OE1 1 
ATOM   1803 O OE2 . GLU A 1 242 ? 1.033   -41.136 -1.925  1.00 97.78  ? 325 GLU A OE2 1 
ATOM   1804 N N   . ALA A 1 243 ? 2.085   -46.388 -5.770  1.00 69.14  ? 326 ALA A N   1 
ATOM   1805 C CA  . ALA A 1 243 ? 2.892   -47.608 -5.782  1.00 68.31  ? 326 ALA A CA  1 
ATOM   1806 C C   . ALA A 1 243 ? 4.419   -47.464 -5.654  1.00 71.40  ? 326 ALA A C   1 
ATOM   1807 O O   . ALA A 1 243 ? 5.066   -46.467 -6.034  1.00 71.21  ? 326 ALA A O   1 
ATOM   1808 C CB  . ALA A 1 243 ? 2.539   -48.480 -6.953  1.00 65.40  ? 326 ALA A CB  1 
ATOM   1809 N N   . THR A 1 244 ? 4.998   -48.514 -5.112  1.00 76.29  ? 327 THR A N   1 
ATOM   1810 C CA  . THR A 1 244 ? 6.393   -48.495 -4.762  1.00 77.10  ? 327 THR A CA  1 
ATOM   1811 C C   . THR A 1 244 ? 7.209   -49.392 -5.658  1.00 77.31  ? 327 THR A C   1 
ATOM   1812 O O   . THR A 1 244 ? 6.846   -50.547 -5.963  1.00 79.23  ? 327 THR A O   1 
ATOM   1813 C CB  . THR A 1 244 ? 6.581   -48.812 -3.277  1.00 77.53  ? 327 THR A CB  1 
ATOM   1814 O OG1 . THR A 1 244 ? 6.208   -47.643 -2.537  1.00 78.56  ? 327 THR A OG1 1 
ATOM   1815 C CG2 . THR A 1 244 ? 8.025   -49.134 -2.965  1.00 78.34  ? 327 THR A CG2 1 
ATOM   1816 N N   . PHE A 1 245 ? 8.317   -48.829 -6.090  1.00 73.45  ? 328 PHE A N   1 
ATOM   1817 C CA  . PHE A 1 245 ? 9.188   -49.540 -6.983  1.00 75.11  ? 328 PHE A CA  1 
ATOM   1818 C C   . PHE A 1 245 ? 10.636  -49.219 -6.650  1.00 76.15  ? 328 PHE A C   1 
ATOM   1819 O O   . PHE A 1 245 ? 10.927  -48.392 -5.775  1.00 73.90  ? 328 PHE A O   1 
ATOM   1820 C CB  . PHE A 1 245 ? 8.834   -49.232 -8.461  1.00 69.37  ? 328 PHE A CB  1 
ATOM   1821 C CG  . PHE A 1 245 ? 9.125   -47.812 -8.908  1.00 65.35  ? 328 PHE A CG  1 
ATOM   1822 C CD1 . PHE A 1 245 ? 10.340  -47.486 -9.516  1.00 66.61  ? 328 PHE A CD1 1 
ATOM   1823 C CD2 . PHE A 1 245 ? 8.170   -46.814 -8.784  1.00 63.45  ? 328 PHE A CD2 1 
ATOM   1824 C CE1 . PHE A 1 245 ? 10.588  -46.179 -9.979  1.00 65.28  ? 328 PHE A CE1 1 
ATOM   1825 C CE2 . PHE A 1 245 ? 8.415   -45.520 -9.233  1.00 63.54  ? 328 PHE A CE2 1 
ATOM   1826 C CZ  . PHE A 1 245 ? 9.623   -45.195 -9.840  1.00 61.64  ? 328 PHE A CZ  1 
ATOM   1827 N N   . ALA A 1 246 ? 11.541  -49.880 -7.358  1.00 74.62  ? 329 ALA A N   1 
ATOM   1828 C CA  . ALA A 1 246 ? 12.954  -49.680 -7.120  1.00 73.83  ? 329 ALA A CA  1 
ATOM   1829 C C   . ALA A 1 246 ? 13.617  -49.537 -8.473  1.00 69.29  ? 329 ALA A C   1 
ATOM   1830 O O   . ALA A 1 246 ? 13.094  -50.037 -9.475  1.00 66.85  ? 329 ALA A O   1 
ATOM   1831 C CB  . ALA A 1 246 ? 13.535  -50.832 -6.318  1.00 70.87  ? 329 ALA A CB  1 
ATOM   1832 N N   . ILE A 1 247 ? 14.702  -48.762 -8.489  1.00 68.23  ? 330 ILE A N   1 
ATOM   1833 C CA  . ILE A 1 247 ? 15.591  -48.605 -9.633  1.00 67.53  ? 330 ILE A CA  1 
ATOM   1834 C C   . ILE A 1 247 ? 16.755  -49.607 -9.404  1.00 69.69  ? 330 ILE A C   1 
ATOM   1835 O O   . ILE A 1 247 ? 17.252  -49.733 -8.290  1.00 69.56  ? 330 ILE A O   1 
ATOM   1836 C CB  . ILE A 1 247 ? 16.068  -47.124 -9.772  1.00 65.52  ? 330 ILE A CB  1 
ATOM   1837 C CG1 . ILE A 1 247 ? 16.737  -46.607 -8.471  1.00 73.00  ? 330 ILE A CG1 1 
ATOM   1838 C CG2 . ILE A 1 247 ? 14.884  -46.192 -10.024 1.00 58.38  ? 330 ILE A CG2 1 
ATOM   1839 C CD1 . ILE A 1 247 ? 18.266  -46.639 -8.350  1.00 73.75  ? 330 ILE A CD1 1 
ATOM   1840 N N   . THR A 1 248 ? 17.150  -50.366 -10.425 1.00 67.31  ? 331 THR A N   1 
ATOM   1841 C CA  . THR A 1 248 ? 18.343  -51.205 -10.300 1.00 67.34  ? 331 THR A CA  1 
ATOM   1842 C C   . THR A 1 248 ? 19.130  -51.138 -11.559 1.00 66.65  ? 331 THR A C   1 
ATOM   1843 O O   . THR A 1 248 ? 18.731  -50.480 -12.518 1.00 64.83  ? 331 THR A O   1 
ATOM   1844 C CB  . THR A 1 248 ? 18.039  -52.703 -10.087 1.00 68.00  ? 331 THR A CB  1 
ATOM   1845 O OG1 . THR A 1 248 ? 16.875  -53.085 -10.833 1.00 63.15  ? 331 THR A OG1 1 
ATOM   1846 C CG2 . THR A 1 248 ? 17.844  -53.016 -8.608  1.00 72.55  ? 331 THR A CG2 1 
ATOM   1847 N N   . ALA A 1 249 ? 20.227  -51.878 -11.567 1.00 67.35  ? 332 ALA A N   1 
ATOM   1848 C CA  . ALA A 1 249 ? 20.978  -52.114 -12.777 1.00 66.93  ? 332 ALA A CA  1 
ATOM   1849 C C   . ALA A 1 249 ? 20.073  -52.670 -13.888 1.00 63.32  ? 332 ALA A C   1 
ATOM   1850 O O   . ALA A 1 249 ? 20.318  -52.411 -15.056 1.00 66.97  ? 332 ALA A O   1 
ATOM   1851 C CB  . ALA A 1 249 ? 22.134  -53.072 -12.488 1.00 68.01  ? 332 ALA A CB  1 
ATOM   1852 N N   . GLY A 1 250 ? 19.037  -53.426 -13.515 1.00 63.44  ? 333 GLY A N   1 
ATOM   1853 C CA  . GLY A 1 250 ? 18.118  -54.057 -14.468 1.00 57.02  ? 333 GLY A CA  1 
ATOM   1854 C C   . GLY A 1 250 ? 16.861  -53.236 -14.737 1.00 57.27  ? 333 GLY A C   1 
ATOM   1855 O O   . GLY A 1 250 ? 15.871  -53.748 -15.286 1.00 56.46  ? 333 GLY A O   1 
ATOM   1856 N N   . GLY A 1 251 ? 16.880  -51.960 -14.362 1.00 55.17  ? 334 GLY A N   1 
ATOM   1857 C CA  . GLY A 1 251 ? 15.742  -51.079 -14.645 1.00 53.68  ? 334 GLY A CA  1 
ATOM   1858 C C   . GLY A 1 251 ? 14.704  -51.026 -13.535 1.00 57.66  ? 334 GLY A C   1 
ATOM   1859 O O   . GLY A 1 251 ? 14.958  -51.417 -12.372 1.00 58.29  ? 334 GLY A O   1 
ATOM   1860 N N   . ILE A 1 252 ? 13.525  -50.521 -13.882 1.00 55.46  ? 335 ILE A N   1 
ATOM   1861 C CA  . ILE A 1 252 ? 12.484  -50.404 -12.898 1.00 54.33  ? 335 ILE A CA  1 
ATOM   1862 C C   . ILE A 1 252 ? 12.105  -51.820 -12.434 1.00 57.22  ? 335 ILE A C   1 
ATOM   1863 O O   . ILE A 1 252 ? 11.849  -52.705 -13.252 1.00 52.37  ? 335 ILE A O   1 
ATOM   1864 C CB  . ILE A 1 252 ? 11.296  -49.591 -13.427 1.00 51.66  ? 335 ILE A CB  1 
ATOM   1865 C CG1 . ILE A 1 252 ? 11.391  -48.119 -12.989 1.00 52.10  ? 335 ILE A CG1 1 
ATOM   1866 C CG2 . ILE A 1 252 ? 10.015  -50.072 -12.769 1.00 52.76  ? 335 ILE A CG2 1 
ATOM   1867 C CD1 . ILE A 1 252 ? 12.462  -47.287 -13.628 1.00 48.91  ? 335 ILE A CD1 1 
ATOM   1868 N N   . GLY A 1 253 ? 12.142  -52.042 -11.120 1.00 62.12  ? 336 GLY A N   1 
ATOM   1869 C CA  . GLY A 1 253 ? 11.873  -53.362 -10.534 1.00 65.76  ? 336 GLY A CA  1 
ATOM   1870 C C   . GLY A 1 253 ? 10.969  -53.240 -9.330  1.00 70.28  ? 336 GLY A C   1 
ATOM   1871 O O   . GLY A 1 253 ? 10.430  -52.155 -9.073  1.00 69.71  ? 336 GLY A O   1 
ATOM   1872 N N   . ASP A 1 254 ? 10.797  -54.335 -8.587  1.00 73.92  ? 337 ASP A N   1 
ATOM   1873 C CA  . ASP A 1 254 ? 9.929   -54.297 -7.408  1.00 76.67  ? 337 ASP A CA  1 
ATOM   1874 C C   . ASP A 1 254 ? 10.699  -54.147 -6.116  1.00 78.06  ? 337 ASP A C   1 
ATOM   1875 O O   . ASP A 1 254 ? 11.867  -54.491 -6.065  1.00 77.55  ? 337 ASP A O   1 
ATOM   1876 C CB  . ASP A 1 254 ? 9.056   -55.547 -7.328  1.00 80.90  ? 337 ASP A CB  1 
ATOM   1877 C CG  . ASP A 1 254 ? 8.013   -55.606 -8.425  1.00 83.33  ? 337 ASP A CG  1 
ATOM   1878 O OD1 . ASP A 1 254 ? 6.992   -54.851 -8.400  1.00 78.96  ? 337 ASP A OD1 1 
ATOM   1879 O OD2 . ASP A 1 254 ? 8.230   -56.445 -9.310  1.00 88.06  ? 337 ASP A OD2 1 
ATOM   1880 N N   . ALA A 1 255 ? 10.021  -53.618 -5.086  1.00 81.63  ? 338 ALA A N   1 
ATOM   1881 C CA  . ALA A 1 255 ? 10.444  -53.674 -3.667  1.00 79.92  ? 338 ALA A CA  1 
ATOM   1882 C C   . ALA A 1 255 ? 11.900  -54.032 -3.524  1.00 82.62  ? 338 ALA A C   1 
ATOM   1883 O O   . ALA A 1 255 ? 12.221  -55.168 -3.172  1.00 90.82  ? 338 ALA A O   1 
ATOM   1884 C CB  . ALA A 1 255 ? 9.594   -54.688 -2.911  1.00 79.01  ? 338 ALA A CB  1 
ATOM   1885 N N   . GLY B 1 1   ? -39.196 -16.186 -40.032 1.00 77.39  ? 84  GLY B N   1 
ATOM   1886 C CA  . GLY B 1 1   ? -38.408 -16.794 -38.854 1.00 80.77  ? 84  GLY B CA  1 
ATOM   1887 C C   . GLY B 1 1   ? -39.238 -17.003 -37.572 1.00 69.70  ? 84  GLY B C   1 
ATOM   1888 O O   . GLY B 1 1   ? -38.848 -17.711 -36.648 1.00 58.81  ? 84  GLY B O   1 
ATOM   1889 N N   . PHE B 1 2   ? -40.408 -16.377 -37.574 1.00 62.08  ? 85  PHE B N   1 
ATOM   1890 C CA  . PHE B 1 2   ? -41.419 -16.561 -36.596 1.00 55.99  ? 85  PHE B CA  1 
ATOM   1891 C C   . PHE B 1 2   ? -42.269 -17.724 -37.003 1.00 56.21  ? 85  PHE B C   1 
ATOM   1892 O O   . PHE B 1 2   ? -42.198 -18.190 -38.134 1.00 56.36  ? 85  PHE B O   1 
ATOM   1893 C CB  . PHE B 1 2   ? -42.221 -15.270 -36.530 1.00 57.06  ? 85  PHE B CB  1 
ATOM   1894 C CG  . PHE B 1 2   ? -41.374 -14.126 -36.100 1.00 57.84  ? 85  PHE B CG  1 
ATOM   1895 C CD1 . PHE B 1 2   ? -40.435 -13.597 -36.966 1.00 60.69  ? 85  PHE B CD1 1 
ATOM   1896 C CD2 . PHE B 1 2   ? -41.387 -13.700 -34.801 1.00 53.04  ? 85  PHE B CD2 1 
ATOM   1897 C CE1 . PHE B 1 2   ? -39.584 -12.597 -36.558 1.00 58.34  ? 85  PHE B CE1 1 
ATOM   1898 C CE2 . PHE B 1 2   ? -40.552 -12.696 -34.389 1.00 54.99  ? 85  PHE B CE2 1 
ATOM   1899 C CZ  . PHE B 1 2   ? -39.656 -12.132 -35.270 1.00 57.88  ? 85  PHE B CZ  1 
ATOM   1900 N N   . LEU B 1 3   ? -43.018 -18.238 -36.045 1.00 51.76  ? 86  LEU B N   1 
ATOM   1901 C CA  . LEU B 1 3   ? -44.101 -19.131 -36.335 1.00 51.85  ? 86  LEU B CA  1 
ATOM   1902 C C   . LEU B 1 3   ? -45.177 -18.792 -35.268 1.00 50.19  ? 86  LEU B C   1 
ATOM   1903 O O   . LEU B 1 3   ? -44.888 -18.030 -34.345 1.00 52.81  ? 86  LEU B O   1 
ATOM   1904 C CB  . LEU B 1 3   ? -43.608 -20.584 -36.352 1.00 52.25  ? 86  LEU B CB  1 
ATOM   1905 C CG  . LEU B 1 3   ? -43.059 -21.186 -35.060 1.00 53.50  ? 86  LEU B CG  1 
ATOM   1906 C CD1 . LEU B 1 3   ? -42.771 -22.662 -35.259 1.00 47.94  ? 86  LEU B CD1 1 
ATOM   1907 C CD2 . LEU B 1 3   ? -41.796 -20.476 -34.590 1.00 56.94  ? 86  LEU B CD2 1 
ATOM   1908 N N   . THR B 1 4   ? -46.420 -19.248 -35.402 1.00 45.68  ? 87  THR B N   1 
ATOM   1909 C CA  . THR B 1 4   ? -47.379 -18.851 -34.397 1.00 42.24  ? 87  THR B CA  1 
ATOM   1910 C C   . THR B 1 4   ? -47.195 -19.706 -33.158 1.00 41.49  ? 87  THR B C   1 
ATOM   1911 O O   . THR B 1 4   ? -46.588 -20.813 -33.185 1.00 39.00  ? 87  THR B O   1 
ATOM   1912 C CB  . THR B 1 4   ? -48.798 -18.996 -34.882 1.00 43.74  ? 87  THR B CB  1 
ATOM   1913 O OG1 . THR B 1 4   ? -49.183 -20.392 -34.891 1.00 44.02  ? 87  THR B OG1 1 
ATOM   1914 C CG2 . THR B 1 4   ? -48.903 -18.412 -36.244 1.00 44.11  ? 87  THR B CG2 1 
ATOM   1915 N N   . ALA B 1 5   ? -47.714 -19.195 -32.057 1.00 40.98  ? 88  ALA B N   1 
ATOM   1916 C CA  . ALA B 1 5   ? -47.618 -19.921 -30.816 1.00 41.14  ? 88  ALA B CA  1 
ATOM   1917 C C   . ALA B 1 5   ? -48.338 -21.255 -30.938 1.00 43.04  ? 88  ALA B C   1 
ATOM   1918 O O   . ALA B 1 5   ? -47.907 -22.223 -30.352 1.00 45.01  ? 88  ALA B O   1 
ATOM   1919 C CB  . ALA B 1 5   ? -48.154 -19.102 -29.669 1.00 40.86  ? 88  ALA B CB  1 
ATOM   1920 N N   . PHE B 1 6   ? -49.408 -21.306 -31.722 1.00 44.86  ? 89  PHE B N   1 
ATOM   1921 C CA  . PHE B 1 6   ? -50.021 -22.547 -32.054 1.00 47.74  ? 89  PHE B CA  1 
ATOM   1922 C C   . PHE B 1 6   ? -49.033 -23.458 -32.776 1.00 49.04  ? 89  PHE B C   1 
ATOM   1923 O O   . PHE B 1 6   ? -48.812 -24.594 -32.333 1.00 48.59  ? 89  PHE B O   1 
ATOM   1924 C CB  . PHE B 1 6   ? -51.251 -22.318 -32.923 1.00 55.19  ? 89  PHE B CB  1 
ATOM   1925 C CG  . PHE B 1 6   ? -51.936 -23.594 -33.353 1.00 57.64  ? 89  PHE B CG  1 
ATOM   1926 C CD1 . PHE B 1 6   ? -52.999 -24.120 -32.606 1.00 64.69  ? 89  PHE B CD1 1 
ATOM   1927 C CD2 . PHE B 1 6   ? -51.536 -24.269 -34.507 1.00 57.19  ? 89  PHE B CD2 1 
ATOM   1928 C CE1 . PHE B 1 6   ? -53.631 -25.310 -32.996 1.00 65.95  ? 89  PHE B CE1 1 
ATOM   1929 C CE2 . PHE B 1 6   ? -52.159 -25.453 -34.900 1.00 59.34  ? 89  PHE B CE2 1 
ATOM   1930 C CZ  . PHE B 1 6   ? -53.199 -25.972 -34.142 1.00 62.65  ? 89  PHE B CZ  1 
ATOM   1931 N N   . GLU B 1 7   ? -48.429 -23.010 -33.879 1.00 50.10  ? 90  GLU B N   1 
ATOM   1932 C CA  . GLU B 1 7   ? -47.511 -23.920 -34.590 1.00 51.21  ? 90  GLU B CA  1 
ATOM   1933 C C   . GLU B 1 7   ? -46.356 -24.358 -33.721 1.00 47.30  ? 90  GLU B C   1 
ATOM   1934 O O   . GLU B 1 7   ? -45.874 -25.469 -33.864 1.00 50.92  ? 90  GLU B O   1 
ATOM   1935 C CB  . GLU B 1 7   ? -46.975 -23.347 -35.871 1.00 56.49  ? 90  GLU B CB  1 
ATOM   1936 C CG  . GLU B 1 7   ? -48.027 -22.814 -36.819 1.00 65.93  ? 90  GLU B CG  1 
ATOM   1937 C CD  . GLU B 1 7   ? -47.382 -21.914 -37.857 1.00 74.37  ? 90  GLU B CD  1 
ATOM   1938 O OE1 . GLU B 1 7   ? -47.102 -22.457 -38.945 1.00 79.07  ? 90  GLU B OE1 1 
ATOM   1939 O OE2 . GLU B 1 7   ? -47.117 -20.699 -37.572 1.00 69.29  ? 90  GLU B OE2 1 
ATOM   1940 N N   . TYR B 1 8   ? -45.967 -23.514 -32.782 1.00 43.37  ? 91  TYR B N   1 
ATOM   1941 C CA  . TYR B 1 8   ? -44.867 -23.832 -31.871 1.00 43.66  ? 91  TYR B CA  1 
ATOM   1942 C C   . TYR B 1 8   ? -45.293 -24.834 -30.796 1.00 45.10  ? 91  TYR B C   1 
ATOM   1943 O O   . TYR B 1 8   ? -44.532 -25.716 -30.364 1.00 43.39  ? 91  TYR B O   1 
ATOM   1944 C CB  . TYR B 1 8   ? -44.356 -22.545 -31.184 1.00 40.82  ? 91  TYR B CB  1 
ATOM   1945 C CG  . TYR B 1 8   ? -43.166 -22.784 -30.295 1.00 37.81  ? 91  TYR B CG  1 
ATOM   1946 C CD1 . TYR B 1 8   ? -42.000 -23.356 -30.813 1.00 38.46  ? 91  TYR B CD1 1 
ATOM   1947 C CD2 . TYR B 1 8   ? -43.181 -22.419 -28.934 1.00 36.96  ? 91  TYR B CD2 1 
ATOM   1948 C CE1 . TYR B 1 8   ? -40.867 -23.569 -30.008 1.00 37.21  ? 91  TYR B CE1 1 
ATOM   1949 C CE2 . TYR B 1 8   ? -42.071 -22.616 -28.127 1.00 35.75  ? 91  TYR B CE2 1 
ATOM   1950 C CZ  . TYR B 1 8   ? -40.924 -23.197 -28.680 1.00 39.47  ? 91  TYR B CZ  1 
ATOM   1951 O OH  . TYR B 1 8   ? -39.801 -23.428 -27.949 1.00 43.82  ? 91  TYR B OH  1 
ATOM   1952 N N   . SER B 1 9   ? -46.516 -24.661 -30.339 1.00 42.91  ? 92  SER B N   1 
ATOM   1953 C CA  . SER B 1 9   ? -47.096 -25.603 -29.456 1.00 46.07  ? 92  SER B CA  1 
ATOM   1954 C C   . SER B 1 9   ? -47.160 -27.007 -30.085 1.00 49.57  ? 92  SER B C   1 
ATOM   1955 O O   . SER B 1 9   ? -46.829 -28.004 -29.437 1.00 56.80  ? 92  SER B O   1 
ATOM   1956 C CB  . SER B 1 9   ? -48.475 -25.125 -29.052 1.00 43.54  ? 92  SER B CB  1 
ATOM   1957 O OG  . SER B 1 9   ? -49.267 -26.244 -28.832 1.00 52.16  ? 92  SER B OG  1 
ATOM   1958 N N   . GLU B 1 10  ? -47.590 -27.091 -31.334 1.00 52.52  ? 93  GLU B N   1 
ATOM   1959 C CA  . GLU B 1 10  ? -47.557 -28.353 -32.059 1.00 54.49  ? 93  GLU B CA  1 
ATOM   1960 C C   . GLU B 1 10  ? -46.178 -28.949 -31.884 1.00 56.94  ? 93  GLU B C   1 
ATOM   1961 O O   . GLU B 1 10  ? -46.043 -30.134 -31.567 1.00 65.60  ? 93  GLU B O   1 
ATOM   1962 C CB  . GLU B 1 10  ? -47.838 -28.129 -33.543 1.00 55.27  ? 93  GLU B CB  1 
ATOM   1963 C CG  . GLU B 1 10  ? -49.311 -28.045 -33.887 1.00 64.72  ? 93  GLU B CG  1 
ATOM   1964 C CD  . GLU B 1 10  ? -50.152 -29.145 -33.239 1.00 75.85  ? 93  GLU B CD  1 
ATOM   1965 O OE1 . GLU B 1 10  ? -50.451 -30.151 -33.925 1.00 83.67  ? 93  GLU B OE1 1 
ATOM   1966 O OE2 . GLU B 1 10  ? -50.515 -29.023 -32.044 1.00 80.58  ? 93  GLU B OE2 1 
ATOM   1967 N N   . LYS B 1 11  ? -45.159 -28.105 -32.040 1.00 53.90  ? 94  LYS B N   1 
ATOM   1968 C CA  . LYS B 1 11  ? -43.785 -28.547 -32.086 1.00 52.62  ? 94  LYS B CA  1 
ATOM   1969 C C   . LYS B 1 11  ? -43.420 -29.085 -30.741 1.00 52.40  ? 94  LYS B C   1 
ATOM   1970 O O   . LYS B 1 11  ? -42.929 -30.179 -30.675 1.00 53.04  ? 94  LYS B O   1 
ATOM   1971 C CB  . LYS B 1 11  ? -42.864 -27.406 -32.463 1.00 52.63  ? 94  LYS B CB  1 
ATOM   1972 C CG  . LYS B 1 11  ? -41.633 -27.853 -33.180 1.00 54.11  ? 94  LYS B CG  1 
ATOM   1973 C CD  . LYS B 1 11  ? -40.762 -26.686 -33.604 1.00 60.08  ? 94  LYS B CD  1 
ATOM   1974 C CE  . LYS B 1 11  ? -39.321 -27.166 -33.800 1.00 63.95  ? 94  LYS B CE  1 
ATOM   1975 N NZ  . LYS B 1 11  ? -38.417 -25.988 -33.792 1.00 68.14  ? 94  LYS B NZ  1 
ATOM   1976 N N   . ARG B 1 12  ? -43.705 -28.337 -29.667 1.00 53.79  ? 95  ARG B N   1 
ATOM   1977 C CA  . ARG B 1 12  ? -43.522 -28.819 -28.276 1.00 49.20  ? 95  ARG B CA  1 
ATOM   1978 C C   . ARG B 1 12  ? -44.320 -30.055 -27.831 1.00 52.07  ? 95  ARG B C   1 
ATOM   1979 O O   . ARG B 1 12  ? -43.856 -30.724 -26.942 1.00 50.65  ? 95  ARG B O   1 
ATOM   1980 C CB  . ARG B 1 12  ? -43.876 -27.760 -27.278 1.00 47.81  ? 95  ARG B CB  1 
ATOM   1981 C CG  . ARG B 1 12  ? -42.965 -26.589 -27.250 1.00 42.03  ? 95  ARG B CG  1 
ATOM   1982 C CD  . ARG B 1 12  ? -42.604 -26.293 -25.831 1.00 41.88  ? 95  ARG B CD  1 
ATOM   1983 N NE  . ARG B 1 12  ? -41.286 -25.772 -25.984 1.00 47.59  ? 95  ARG B NE  1 
ATOM   1984 C CZ  . ARG B 1 12  ? -40.195 -26.294 -25.454 1.00 46.15  ? 95  ARG B CZ  1 
ATOM   1985 N NH1 . ARG B 1 12  ? -40.265 -27.316 -24.620 1.00 40.30  ? 95  ARG B NH1 1 
ATOM   1986 N NH2 . ARG B 1 12  ? -39.023 -25.742 -25.761 1.00 50.74  ? 95  ARG B NH2 1 
ATOM   1987 N N   . LYS B 1 13  ? -45.497 -30.362 -28.394 1.00 54.24  ? 96  LYS B N   1 
ATOM   1988 C CA  . LYS B 1 13  ? -46.108 -31.692 -28.132 1.00 57.77  ? 96  LYS B CA  1 
ATOM   1989 C C   . LYS B 1 13  ? -45.045 -32.813 -28.260 1.00 57.36  ? 96  LYS B C   1 
ATOM   1990 O O   . LYS B 1 13  ? -45.099 -33.828 -27.565 1.00 55.14  ? 96  LYS B O   1 
ATOM   1991 C CB  . LYS B 1 13  ? -47.252 -32.034 -29.094 1.00 61.11  ? 96  LYS B CB  1 
ATOM   1992 C CG  . LYS B 1 13  ? -48.492 -31.177 -29.038 1.00 75.07  ? 96  LYS B CG  1 
ATOM   1993 C CD  . LYS B 1 13  ? -49.015 -30.890 -27.628 1.00 85.64  ? 96  LYS B CD  1 
ATOM   1994 C CE  . LYS B 1 13  ? -50.541 -30.777 -27.618 1.00 84.69  ? 96  LYS B CE  1 
ATOM   1995 N NZ  . LYS B 1 13  ? -51.019 -29.618 -26.823 1.00 79.35  ? 96  LYS B NZ  1 
ATOM   1996 N N   . MET B 1 14  ? -44.084 -32.623 -29.157 1.00 56.13  ? 97  MET B N   1 
ATOM   1997 C CA  . MET B 1 14  ? -43.167 -33.697 -29.497 1.00 56.72  ? 97  MET B CA  1 
ATOM   1998 C C   . MET B 1 14  ? -41.914 -33.731 -28.654 1.00 53.36  ? 97  MET B C   1 
ATOM   1999 O O   . MET B 1 14  ? -41.028 -34.507 -28.938 1.00 55.67  ? 97  MET B O   1 
ATOM   2000 C CB  . MET B 1 14  ? -42.797 -33.632 -30.963 1.00 58.46  ? 97  MET B CB  1 
ATOM   2001 C CG  . MET B 1 14  ? -43.982 -33.967 -31.859 1.00 72.50  ? 97  MET B CG  1 
ATOM   2002 S SD  . MET B 1 14  ? -43.561 -33.933 -33.619 1.00 89.64  ? 97  MET B SD  1 
ATOM   2003 C CE  . MET B 1 14  ? -42.566 -32.423 -33.782 1.00 76.92  ? 97  MET B CE  1 
ATOM   2004 N N   . VAL B 1 15  ? -41.854 -32.900 -27.619 1.00 51.87  ? 98  VAL B N   1 
ATOM   2005 C CA  . VAL B 1 15  ? -40.724 -32.878 -26.690 1.00 51.78  ? 98  VAL B CA  1 
ATOM   2006 C C   . VAL B 1 15  ? -40.707 -34.137 -25.834 1.00 54.62  ? 98  VAL B C   1 
ATOM   2007 O O   . VAL B 1 15  ? -41.680 -34.434 -25.188 1.00 62.61  ? 98  VAL B O   1 
ATOM   2008 C CB  . VAL B 1 15  ? -40.807 -31.649 -25.764 1.00 50.67  ? 98  VAL B CB  1 
ATOM   2009 C CG1 . VAL B 1 15  ? -39.898 -31.781 -24.550 1.00 50.78  ? 98  VAL B CG1 1 
ATOM   2010 C CG2 . VAL B 1 15  ? -40.500 -30.375 -26.546 1.00 48.12  ? 98  VAL B CG2 1 
ATOM   2011 N N   . PHE B 1 16  ? -39.590 -34.862 -25.814 1.00 55.15  ? 99  PHE B N   1 
ATOM   2012 C CA  . PHE B 1 16  ? -39.432 -36.063 -24.973 1.00 52.30  ? 99  PHE B CA  1 
ATOM   2013 C C   . PHE B 1 16  ? -38.378 -35.896 -23.870 1.00 54.00  ? 99  PHE B C   1 
ATOM   2014 O O   . PHE B 1 16  ? -37.542 -34.999 -23.947 1.00 55.97  ? 99  PHE B O   1 
ATOM   2015 C CB  . PHE B 1 16  ? -39.079 -37.262 -25.838 1.00 46.21  ? 99  PHE B CB  1 
ATOM   2016 C CG  . PHE B 1 16  ? -37.896 -37.038 -26.717 1.00 45.19  ? 99  PHE B CG  1 
ATOM   2017 C CD1 . PHE B 1 16  ? -36.604 -37.295 -26.250 1.00 43.89  ? 99  PHE B CD1 1 
ATOM   2018 C CD2 . PHE B 1 16  ? -38.061 -36.566 -28.006 1.00 42.73  ? 99  PHE B CD2 1 
ATOM   2019 C CE1 . PHE B 1 16  ? -35.513 -37.111 -27.056 1.00 43.94  ? 99  PHE B CE1 1 
ATOM   2020 C CE2 . PHE B 1 16  ? -36.962 -36.368 -28.818 1.00 45.89  ? 99  PHE B CE2 1 
ATOM   2021 C CZ  . PHE B 1 16  ? -35.686 -36.633 -28.343 1.00 45.45  ? 99  PHE B CZ  1 
ATOM   2022 N N   . HIS B 1 17  ? -38.450 -36.744 -22.843 1.00 58.21  ? 100 HIS B N   1 
ATOM   2023 C CA  . HIS B 1 17  ? -37.427 -36.832 -21.797 1.00 58.79  ? 100 HIS B CA  1 
ATOM   2024 C C   . HIS B 1 17  ? -36.762 -38.160 -21.921 1.00 56.67  ? 100 HIS B C   1 
ATOM   2025 O O   . HIS B 1 17  ? -37.462 -39.127 -22.148 1.00 51.11  ? 100 HIS B O   1 
ATOM   2026 C CB  . HIS B 1 17  ? -38.052 -36.758 -20.418 1.00 61.95  ? 100 HIS B CB  1 
ATOM   2027 C CG  . HIS B 1 17  ? -38.645 -35.426 -20.103 1.00 68.83  ? 100 HIS B CG  1 
ATOM   2028 N ND1 . HIS B 1 17  ? -37.957 -34.461 -19.446 1.00 74.11  ? 100 HIS B ND1 1 
ATOM   2029 C CD2 . HIS B 1 17  ? -39.890 -34.887 -20.408 1.00 66.61  ? 100 HIS B CD2 1 
ATOM   2030 C CE1 . HIS B 1 17  ? -38.731 -33.366 -19.335 1.00 65.95  ? 100 HIS B CE1 1 
ATOM   2031 N NE2 . HIS B 1 17  ? -39.912 -33.632 -19.926 1.00 66.50  ? 100 HIS B NE2 1 
ATOM   2032 N N   . ILE B 1 18  ? -35.423 -38.223 -21.792 1.00 53.30  ? 101 ILE B N   1 
ATOM   2033 C CA  . ILE B 1 18  ? -34.728 -39.498 -21.722 1.00 51.03  ? 101 ILE B CA  1 
ATOM   2034 C C   . ILE B 1 18  ? -34.321 -39.770 -20.290 1.00 53.52  ? 101 ILE B C   1 
ATOM   2035 O O   . ILE B 1 18  ? -33.691 -38.932 -19.657 1.00 55.19  ? 101 ILE B O   1 
ATOM   2036 C CB  . ILE B 1 18  ? -33.461 -39.523 -22.554 1.00 49.23  ? 101 ILE B CB  1 
ATOM   2037 C CG1 . ILE B 1 18  ? -33.782 -39.242 -24.018 1.00 51.21  ? 101 ILE B CG1 1 
ATOM   2038 C CG2 . ILE B 1 18  ? -32.738 -40.864 -22.384 1.00 46.51  ? 101 ILE B CG2 1 
ATOM   2039 C CD1 . ILE B 1 18  ? -32.573 -38.796 -24.808 1.00 48.52  ? 101 ILE B CD1 1 
ATOM   2040 N N   . THR B 1 19  ? -34.674 -40.952 -19.807 1.00 52.22  ? 102 THR B N   1 
ATOM   2041 C CA  . THR B 1 19  ? -34.472 -41.314 -18.432 1.00 55.89  ? 102 THR B CA  1 
ATOM   2042 C C   . THR B 1 19  ? -32.972 -41.442 -18.098 1.00 58.12  ? 102 THR B C   1 
ATOM   2043 O O   . THR B 1 19  ? -32.196 -41.926 -18.905 1.00 61.36  ? 102 THR B O   1 
ATOM   2044 C CB  . THR B 1 19  ? -35.274 -42.597 -18.101 1.00 58.96  ? 102 THR B CB  1 
ATOM   2045 O OG1 . THR B 1 19  ? -34.927 -43.049 -16.805 1.00 58.85  ? 102 THR B OG1 1 
ATOM   2046 C CG2 . THR B 1 19  ? -35.014 -43.730 -19.087 1.00 58.31  ? 102 THR B CG2 1 
ATOM   2047 N N   . THR B 1 20  ? -32.560 -40.962 -16.932 1.00 58.43  ? 103 THR B N   1 
ATOM   2048 C CA  . THR B 1 20  ? -31.165 -41.049 -16.515 1.00 58.64  ? 103 THR B CA  1 
ATOM   2049 C C   . THR B 1 20  ? -30.874 -42.434 -15.944 1.00 62.78  ? 103 THR B C   1 
ATOM   2050 O O   . THR B 1 20  ? -29.718 -42.793 -15.777 1.00 64.21  ? 103 THR B O   1 
ATOM   2051 C CB  . THR B 1 20  ? -30.826 -40.077 -15.356 1.00 61.08  ? 103 THR B CB  1 
ATOM   2052 O OG1 . THR B 1 20  ? -31.589 -40.436 -14.177 1.00 64.30  ? 103 THR B OG1 1 
ATOM   2053 C CG2 . THR B 1 20  ? -31.095 -38.639 -15.732 1.00 58.75  ? 103 THR B CG2 1 
ATOM   2054 N N   . GLY B 1 21  ? -31.909 -43.181 -15.587 1.00 63.62  ? 104 GLY B N   1 
ATOM   2055 C CA  . GLY B 1 21  ? -31.721 -44.450 -14.903 1.00 68.21  ? 104 GLY B CA  1 
ATOM   2056 C C   . GLY B 1 21  ? -31.892 -44.320 -13.399 1.00 75.10  ? 104 GLY B C   1 
ATOM   2057 O O   . GLY B 1 21  ? -31.887 -45.325 -12.681 1.00 75.87  ? 104 GLY B O   1 
ATOM   2058 N N   . SER B 1 22  ? -32.055 -43.081 -12.918 1.00 76.74  ? 105 SER B N   1 
ATOM   2059 C CA  . SER B 1 22  ? -32.445 -42.819 -11.529 1.00 75.04  ? 105 SER B CA  1 
ATOM   2060 C C   . SER B 1 22  ? -33.807 -42.163 -11.470 1.00 76.11  ? 105 SER B C   1 
ATOM   2061 O O   . SER B 1 22  ? -33.938 -40.975 -11.736 1.00 78.71  ? 105 SER B O   1 
ATOM   2062 C CB  . SER B 1 22  ? -31.397 -41.949 -10.811 1.00 74.31  ? 105 SER B CB  1 
ATOM   2063 O OG  . SER B 1 22  ? -31.864 -41.402 -9.574  1.00 77.94  ? 105 SER B OG  1 
ATOM   2064 N N   . GLN B 1 23  ? -34.822 -42.933 -11.110 1.00 81.47  ? 106 GLN B N   1 
ATOM   2065 C CA  . GLN B 1 23  ? -36.142 -42.381 -10.745 1.00 84.05  ? 106 GLN B CA  1 
ATOM   2066 C C   . GLN B 1 23  ? -36.058 -41.080 -9.930  1.00 81.08  ? 106 GLN B C   1 
ATOM   2067 O O   . GLN B 1 23  ? -36.887 -40.165 -10.104 1.00 72.71  ? 106 GLN B O   1 
ATOM   2068 C CB  . GLN B 1 23  ? -36.943 -43.400 -9.919  1.00 91.77  ? 106 GLN B CB  1 
ATOM   2069 C CG  . GLN B 1 23  ? -36.914 -44.831 -10.436 1.00 100.05 ? 106 GLN B CG  1 
ATOM   2070 C CD  . GLN B 1 23  ? -37.189 -45.860 -9.337  1.00 108.49 ? 106 GLN B CD  1 
ATOM   2071 O OE1 . GLN B 1 23  ? -37.977 -45.605 -8.430  1.00 112.11 ? 106 GLN B OE1 1 
ATOM   2072 N NE2 . GLN B 1 23  ? -36.534 -47.027 -9.417  1.00 109.26 ? 106 GLN B NE2 1 
ATOM   2073 N N   . GLU B 1 24  ? -35.087 -41.021 -9.012  1.00 83.77  ? 107 GLU B N   1 
ATOM   2074 C CA  . GLU B 1 24  ? -34.918 -39.835 -8.175  1.00 85.16  ? 107 GLU B CA  1 
ATOM   2075 C C   . GLU B 1 24  ? -34.296 -38.733 -8.985  1.00 78.62  ? 107 GLU B C   1 
ATOM   2076 O O   . GLU B 1 24  ? -34.622 -37.570 -8.818  1.00 78.78  ? 107 GLU B O   1 
ATOM   2077 C CB  . GLU B 1 24  ? -34.063 -40.095 -6.931  1.00 92.02  ? 107 GLU B CB  1 
ATOM   2078 C CG  . GLU B 1 24  ? -34.730 -40.912 -5.833  1.00 103.47 ? 107 GLU B CG  1 
ATOM   2079 C CD  . GLU B 1 24  ? -36.226 -40.647 -5.677  1.00 108.82 ? 107 GLU B CD  1 
ATOM   2080 O OE1 . GLU B 1 24  ? -37.002 -41.625 -5.772  1.00 111.92 ? 107 GLU B OE1 1 
ATOM   2081 O OE2 . GLU B 1 24  ? -36.633 -39.478 -5.457  1.00 109.89 ? 107 GLU B OE2 1 
ATOM   2082 N N   . PHE B 1 25  ? -33.396 -39.098 -9.875  1.00 75.52  ? 108 PHE B N   1 
ATOM   2083 C CA  . PHE B 1 25  ? -32.771 -38.111 -10.733 1.00 74.39  ? 108 PHE B CA  1 
ATOM   2084 C C   . PHE B 1 25  ? -33.793 -37.527 -11.730 1.00 72.96  ? 108 PHE B C   1 
ATOM   2085 O O   . PHE B 1 25  ? -33.826 -36.308 -11.991 1.00 69.34  ? 108 PHE B O   1 
ATOM   2086 C CB  . PHE B 1 25  ? -31.603 -38.760 -11.461 1.00 72.98  ? 108 PHE B CB  1 
ATOM   2087 C CG  . PHE B 1 25  ? -30.545 -37.802 -11.876 1.00 71.88  ? 108 PHE B CG  1 
ATOM   2088 C CD1 . PHE B 1 25  ? -29.218 -38.189 -11.852 1.00 69.54  ? 108 PHE B CD1 1 
ATOM   2089 C CD2 . PHE B 1 25  ? -30.873 -36.509 -12.306 1.00 72.13  ? 108 PHE B CD2 1 
ATOM   2090 C CE1 . PHE B 1 25  ? -28.226 -37.312 -12.259 1.00 70.28  ? 108 PHE B CE1 1 
ATOM   2091 C CE2 . PHE B 1 25  ? -29.895 -35.621 -12.715 1.00 68.39  ? 108 PHE B CE2 1 
ATOM   2092 C CZ  . PHE B 1 25  ? -28.568 -36.024 -12.687 1.00 71.37  ? 108 PHE B CZ  1 
ATOM   2093 N N   . ASP B 1 26  ? -34.645 -38.412 -12.246 1.00 72.33  ? 109 ASP B N   1 
ATOM   2094 C CA  . ASP B 1 26  ? -35.664 -38.056 -13.212 1.00 70.39  ? 109 ASP B CA  1 
ATOM   2095 C C   . ASP B 1 26  ? -36.711 -37.065 -12.704 1.00 74.46  ? 109 ASP B C   1 
ATOM   2096 O O   . ASP B 1 26  ? -37.075 -36.149 -13.453 1.00 70.34  ? 109 ASP B O   1 
ATOM   2097 C CB  . ASP B 1 26  ? -36.315 -39.320 -13.740 1.00 72.08  ? 109 ASP B CB  1 
ATOM   2098 C CG  . ASP B 1 26  ? -35.354 -40.167 -14.573 1.00 76.86  ? 109 ASP B CG  1 
ATOM   2099 O OD1 . ASP B 1 26  ? -34.241 -39.701 -14.929 1.00 74.91  ? 109 ASP B OD1 1 
ATOM   2100 O OD2 . ASP B 1 26  ? -35.720 -41.316 -14.882 1.00 80.50  ? 109 ASP B OD2 1 
ATOM   2101 N N   . LYS B 1 27  ? -37.184 -37.244 -11.455 1.00 81.48  ? 110 LYS B N   1 
ATOM   2102 C CA  . LYS B 1 27  ? -38.164 -36.334 -10.841 1.00 86.21  ? 110 LYS B CA  1 
ATOM   2103 C C   . LYS B 1 27  ? -37.572 -34.949 -10.824 1.00 83.73  ? 110 LYS B C   1 
ATOM   2104 O O   . LYS B 1 27  ? -38.221 -33.993 -11.243 1.00 80.58  ? 110 LYS B O   1 
ATOM   2105 C CB  . LYS B 1 27  ? -38.577 -36.736 -9.409  1.00 97.98  ? 110 LYS B CB  1 
ATOM   2106 C CG  . LYS B 1 27  ? -37.631 -36.264 -8.287  1.00 109.38 ? 110 LYS B CG  1 
ATOM   2107 C CD  . LYS B 1 27  ? -38.305 -35.972 -6.940  1.00 114.29 ? 110 LYS B CD  1 
ATOM   2108 C CE  . LYS B 1 27  ? -38.761 -34.515 -6.828  1.00 116.34 ? 110 LYS B CE  1 
ATOM   2109 N NZ  . LYS B 1 27  ? -39.663 -34.269 -5.658  1.00 117.49 ? 110 LYS B NZ  1 
ATOM   2110 N N   . LEU B 1 28  ? -36.326 -34.859 -10.366 1.00 82.83  ? 111 LEU B N   1 
ATOM   2111 C CA  . LEU B 1 28  ? -35.612 -33.594 -10.299 1.00 81.45  ? 111 LEU B CA  1 
ATOM   2112 C C   . LEU B 1 28  ? -35.481 -32.939 -11.681 1.00 77.20  ? 111 LEU B C   1 
ATOM   2113 O O   . LEU B 1 28  ? -35.290 -31.736 -11.781 1.00 79.41  ? 111 LEU B O   1 
ATOM   2114 C CB  . LEU B 1 28  ? -34.231 -33.812 -9.672  1.00 80.20  ? 111 LEU B CB  1 
ATOM   2115 C CG  . LEU B 1 28  ? -33.364 -32.567 -9.485  1.00 77.22  ? 111 LEU B CG  1 
ATOM   2116 C CD1 . LEU B 1 28  ? -33.865 -31.775 -8.304  1.00 82.06  ? 111 LEU B CD1 1 
ATOM   2117 C CD2 . LEU B 1 28  ? -31.902 -32.901 -9.301  1.00 74.03  ? 111 LEU B CD2 1 
ATOM   2118 N N   . LEU B 1 29  ? -35.586 -33.728 -12.745 1.00 75.45  ? 112 LEU B N   1 
ATOM   2119 C CA  . LEU B 1 29  ? -35.501 -33.196 -14.116 1.00 69.39  ? 112 LEU B CA  1 
ATOM   2120 C C   . LEU B 1 29  ? -36.852 -33.112 -14.817 1.00 67.27  ? 112 LEU B C   1 
ATOM   2121 O O   . LEU B 1 29  ? -36.912 -32.760 -15.992 1.00 69.62  ? 112 LEU B O   1 
ATOM   2122 C CB  . LEU B 1 29  ? -34.604 -34.096 -14.945 1.00 67.03  ? 112 LEU B CB  1 
ATOM   2123 C CG  . LEU B 1 29  ? -33.193 -33.761 -15.435 1.00 66.41  ? 112 LEU B CG  1 
ATOM   2124 C CD1 . LEU B 1 29  ? -32.493 -32.588 -14.738 1.00 64.24  ? 112 LEU B CD1 1 
ATOM   2125 C CD2 . LEU B 1 29  ? -32.382 -35.059 -15.399 1.00 61.48  ? 112 LEU B CD2 1 
ATOM   2126 N N   . GLY B 1 30  ? -37.918 -33.476 -14.114 1.00 66.57  ? 113 GLY B N   1 
ATOM   2127 C CA  . GLY B 1 30  ? -39.266 -33.515 -14.669 1.00 63.43  ? 113 GLY B CA  1 
ATOM   2128 C C   . GLY B 1 30  ? -39.478 -34.526 -15.775 1.00 65.23  ? 113 GLY B C   1 
ATOM   2129 O O   . GLY B 1 30  ? -40.219 -34.247 -16.723 1.00 65.25  ? 113 GLY B O   1 
ATOM   2130 N N   . GLY B 1 31  ? -38.818 -35.688 -15.647 1.00 67.28  ? 114 GLY B N   1 
ATOM   2131 C CA  . GLY B 1 31  ? -38.950 -36.834 -16.558 1.00 62.32  ? 114 GLY B CA  1 
ATOM   2132 C C   . GLY B 1 31  ? -37.610 -37.356 -17.065 1.00 62.99  ? 114 GLY B C   1 
ATOM   2133 O O   . GLY B 1 31  ? -37.482 -38.536 -17.392 1.00 63.66  ? 114 GLY B O   1 
ATOM   2134 N N   . GLY B 1 32  ? -36.608 -36.483 -17.152 1.00 57.01  ? 115 GLY B N   1 
ATOM   2135 C CA  . GLY B 1 32  ? -35.304 -36.893 -17.655 1.00 55.21  ? 115 GLY B CA  1 
ATOM   2136 C C   . GLY B 1 32  ? -34.622 -35.768 -18.406 1.00 52.86  ? 115 GLY B C   1 
ATOM   2137 O O   . GLY B 1 32  ? -34.956 -34.614 -18.231 1.00 50.25  ? 115 GLY B O   1 
ATOM   2138 N N   . ILE B 1 33  ? -33.657 -36.122 -19.238 1.00 52.88  ? 116 ILE B N   1 
ATOM   2139 C CA  . ILE B 1 33  ? -32.921 -35.170 -20.070 1.00 53.32  ? 116 ILE B CA  1 
ATOM   2140 C C   . ILE B 1 33  ? -33.946 -34.732 -21.076 1.00 52.60  ? 116 ILE B C   1 
ATOM   2141 O O   . ILE B 1 33  ? -34.505 -35.569 -21.779 1.00 54.88  ? 116 ILE B O   1 
ATOM   2142 C CB  . ILE B 1 33  ? -31.725 -35.904 -20.799 1.00 53.00  ? 116 ILE B CB  1 
ATOM   2143 C CG1 . ILE B 1 33  ? -30.793 -36.520 -19.791 1.00 52.34  ? 116 ILE B CG1 1 
ATOM   2144 C CG2 . ILE B 1 33  ? -30.857 -34.973 -21.639 1.00 44.45  ? 116 ILE B CG2 1 
ATOM   2145 C CD1 . ILE B 1 33  ? -30.281 -35.476 -18.811 1.00 58.93  ? 116 ILE B CD1 1 
ATOM   2146 N N   . GLU B 1 34  ? -34.208 -33.437 -21.134 1.00 56.26  ? 117 GLU B N   1 
ATOM   2147 C CA  . GLU B 1 34  ? -35.285 -32.889 -21.976 1.00 54.28  ? 117 GLU B CA  1 
ATOM   2148 C C   . GLU B 1 34  ? -34.761 -32.577 -23.401 1.00 49.90  ? 117 GLU B C   1 
ATOM   2149 O O   . GLU B 1 34  ? -33.716 -31.921 -23.553 1.00 48.44  ? 117 GLU B O   1 
ATOM   2150 C CB  . GLU B 1 34  ? -35.803 -31.619 -21.298 1.00 56.76  ? 117 GLU B CB  1 
ATOM   2151 C CG  . GLU B 1 34  ? -37.055 -31.028 -21.913 1.00 67.85  ? 117 GLU B CG  1 
ATOM   2152 C CD  . GLU B 1 34  ? -37.776 -30.059 -20.978 1.00 72.24  ? 117 GLU B CD  1 
ATOM   2153 O OE1 . GLU B 1 34  ? -38.239 -30.455 -19.875 1.00 79.47  ? 117 GLU B OE1 1 
ATOM   2154 O OE2 . GLU B 1 34  ? -37.899 -28.887 -21.356 1.00 78.18  ? 117 GLU B OE2 1 
ATOM   2155 N N   . SER B 1 35  ? -35.473 -33.040 -24.432 1.00 44.31  ? 118 SER B N   1 
ATOM   2156 C CA  . SER B 1 35  ? -35.201 -32.621 -25.819 1.00 41.91  ? 118 SER B CA  1 
ATOM   2157 C C   . SER B 1 35  ? -35.457 -31.127 -26.073 1.00 42.82  ? 118 SER B C   1 
ATOM   2158 O O   . SER B 1 35  ? -35.985 -30.432 -25.233 1.00 45.81  ? 118 SER B O   1 
ATOM   2159 C CB  . SER B 1 35  ? -36.002 -33.461 -26.804 1.00 44.65  ? 118 SER B CB  1 
ATOM   2160 O OG  . SER B 1 35  ? -37.367 -33.097 -26.821 1.00 50.56  ? 118 SER B OG  1 
ATOM   2161 N N   . MET B 1 36  ? -35.036 -30.619 -27.222 1.00 44.93  ? 119 MET B N   1 
ATOM   2162 C CA  . MET B 1 36  ? -35.141 -29.193 -27.527 1.00 40.00  ? 119 MET B CA  1 
ATOM   2163 C C   . MET B 1 36  ? -34.454 -28.339 -26.473 1.00 42.32  ? 119 MET B C   1 
ATOM   2164 O O   . MET B 1 36  ? -34.841 -27.211 -26.198 1.00 45.15  ? 119 MET B O   1 
ATOM   2165 C CB  . MET B 1 36  ? -36.596 -28.810 -27.697 1.00 37.12  ? 119 MET B CB  1 
ATOM   2166 C CG  . MET B 1 36  ? -37.114 -29.131 -29.094 1.00 37.63  ? 119 MET B CG  1 
ATOM   2167 S SD  . MET B 1 36  ? -38.811 -28.550 -29.351 1.00 44.87  ? 119 MET B SD  1 
ATOM   2168 C CE  . MET B 1 36  ? -38.603 -26.808 -29.723 1.00 36.02  ? 119 MET B CE  1 
ATOM   2169 N N   . ALA B 1 37  ? -33.397 -28.867 -25.889 1.00 41.27  ? 120 ALA B N   1 
ATOM   2170 C CA  . ALA B 1 37  ? -32.716 -28.156 -24.842 1.00 41.09  ? 120 ALA B CA  1 
ATOM   2171 C C   . ALA B 1 37  ? -31.306 -28.722 -24.644 1.00 42.25  ? 120 ALA B C   1 
ATOM   2172 O O   . ALA B 1 37  ? -31.025 -29.875 -25.006 1.00 42.78  ? 120 ALA B O   1 
ATOM   2173 C CB  . ALA B 1 37  ? -33.510 -28.283 -23.559 1.00 39.62  ? 120 ALA B CB  1 
ATOM   2174 N N   . ILE B 1 38  ? -30.436 -27.895 -24.071 1.00 43.14  ? 121 ILE B N   1 
ATOM   2175 C CA  . ILE B 1 38  ? -29.164 -28.325 -23.519 1.00 45.77  ? 121 ILE B CA  1 
ATOM   2176 C C   . ILE B 1 38  ? -29.216 -28.484 -21.995 1.00 49.91  ? 121 ILE B C   1 
ATOM   2177 O O   . ILE B 1 38  ? -29.581 -27.553 -21.235 1.00 52.72  ? 121 ILE B O   1 
ATOM   2178 C CB  . ILE B 1 38  ? -28.044 -27.346 -23.894 1.00 48.16  ? 121 ILE B CB  1 
ATOM   2179 C CG1 . ILE B 1 38  ? -28.017 -27.192 -25.423 1.00 49.98  ? 121 ILE B CG1 1 
ATOM   2180 C CG2 . ILE B 1 38  ? -26.711 -27.840 -23.347 1.00 43.07  ? 121 ILE B CG2 1 
ATOM   2181 C CD1 . ILE B 1 38  ? -27.129 -26.077 -25.939 1.00 47.24  ? 121 ILE B CD1 1 
ATOM   2182 N N   . THR B 1 39  ? -28.839 -29.679 -21.566 1.00 47.35  ? 122 THR B N   1 
ATOM   2183 C CA  . THR B 1 39  ? -28.715 -30.016 -20.177 1.00 48.85  ? 122 THR B CA  1 
ATOM   2184 C C   . THR B 1 39  ? -27.232 -30.130 -19.830 1.00 50.52  ? 122 THR B C   1 
ATOM   2185 O O   . THR B 1 39  ? -26.512 -30.884 -20.463 1.00 49.18  ? 122 THR B O   1 
ATOM   2186 C CB  . THR B 1 39  ? -29.384 -31.366 -19.955 1.00 50.03  ? 122 THR B CB  1 
ATOM   2187 O OG1 . THR B 1 39  ? -30.746 -31.257 -20.354 1.00 51.30  ? 122 THR B OG1 1 
ATOM   2188 C CG2 . THR B 1 39  ? -29.352 -31.734 -18.525 1.00 53.64  ? 122 THR B CG2 1 
ATOM   2189 N N   . GLU B 1 40  ? -26.767 -29.388 -18.833 1.00 53.65  ? 123 GLU B N   1 
ATOM   2190 C CA  . GLU B 1 40  ? -25.348 -29.407 -18.507 1.00 56.90  ? 123 GLU B CA  1 
ATOM   2191 C C   . GLU B 1 40  ? -25.065 -29.976 -17.115 1.00 63.65  ? 123 GLU B C   1 
ATOM   2192 O O   . GLU B 1 40  ? -25.733 -29.602 -16.110 1.00 57.42  ? 123 GLU B O   1 
ATOM   2193 C CB  . GLU B 1 40  ? -24.738 -28.011 -18.601 1.00 57.90  ? 123 GLU B CB  1 
ATOM   2194 C CG  . GLU B 1 40  ? -23.296 -27.984 -18.100 1.00 62.48  ? 123 GLU B CG  1 
ATOM   2195 C CD  . GLU B 1 40  ? -22.728 -26.595 -17.894 1.00 66.81  ? 123 GLU B CD  1 
ATOM   2196 O OE1 . GLU B 1 40  ? -23.367 -25.595 -18.269 1.00 69.43  ? 123 GLU B OE1 1 
ATOM   2197 O OE2 . GLU B 1 40  ? -21.607 -26.504 -17.359 1.00 74.42  ? 123 GLU B OE2 1 
ATOM   2198 N N   . ALA B 1 41  ? -24.055 -30.851 -17.049 1.00 61.08  ? 124 ALA B N   1 
ATOM   2199 C CA  . ALA B 1 41  ? -23.697 -31.459 -15.770 1.00 61.29  ? 124 ALA B CA  1 
ATOM   2200 C C   . ALA B 1 41  ? -22.251 -31.215 -15.460 1.00 65.59  ? 124 ALA B C   1 
ATOM   2201 O O   . ALA B 1 41  ? -21.380 -31.553 -16.267 1.00 69.37  ? 124 ALA B O   1 
ATOM   2202 C CB  . ALA B 1 41  ? -24.000 -32.944 -15.762 1.00 55.27  ? 124 ALA B CB  1 
ATOM   2203 N N   . PHE B 1 42  ? -21.999 -30.606 -14.303 1.00 70.03  ? 125 PHE B N   1 
ATOM   2204 C CA  . PHE B 1 42  ? -20.640 -30.408 -13.847 1.00 73.98  ? 125 PHE B CA  1 
ATOM   2205 C C   . PHE B 1 42  ? -20.395 -30.852 -12.398 1.00 79.48  ? 125 PHE B C   1 
ATOM   2206 O O   . PHE B 1 42  ? -21.331 -31.206 -11.666 1.00 78.61  ? 125 PHE B O   1 
ATOM   2207 C CB  . PHE B 1 42  ? -20.212 -28.971 -14.068 1.00 74.05  ? 125 PHE B CB  1 
ATOM   2208 C CG  . PHE B 1 42  ? -21.119 -27.990 -13.450 1.00 74.35  ? 125 PHE B CG  1 
ATOM   2209 C CD1 . PHE B 1 42  ? -22.018 -27.294 -14.226 1.00 72.39  ? 125 PHE B CD1 1 
ATOM   2210 C CD2 . PHE B 1 42  ? -21.076 -27.757 -12.073 1.00 83.00  ? 125 PHE B CD2 1 
ATOM   2211 C CE1 . PHE B 1 42  ? -22.874 -26.366 -13.658 1.00 77.01  ? 125 PHE B CE1 1 
ATOM   2212 C CE2 . PHE B 1 42  ? -21.931 -26.834 -11.484 1.00 85.64  ? 125 PHE B CE2 1 
ATOM   2213 C CZ  . PHE B 1 42  ? -22.831 -26.132 -12.281 1.00 84.41  ? 125 PHE B CZ  1 
ATOM   2214 N N   . GLY B 1 43  ? -19.121 -30.826 -12.015 1.00 76.63  ? 126 GLY B N   1 
ATOM   2215 C CA  . GLY B 1 43  ? -18.624 -31.576 -10.890 1.00 84.52  ? 126 GLY B CA  1 
ATOM   2216 C C   . GLY B 1 43  ? -17.118 -31.699 -11.036 1.00 92.84  ? 126 GLY B C   1 
ATOM   2217 O O   . GLY B 1 43  ? -16.585 -31.609 -12.158 1.00 86.65  ? 126 GLY B O   1 
ATOM   2218 N N   . GLU B 1 44  ? -16.450 -31.915 -9.894  1.00 98.73  ? 127 GLU B N   1 
ATOM   2219 C CA  . GLU B 1 44  ? -14.988 -31.830 -9.753  1.00 99.52  ? 127 GLU B CA  1 
ATOM   2220 C C   . GLU B 1 44  ? -14.275 -33.126 -10.111 1.00 99.39  ? 127 GLU B C   1 
ATOM   2221 O O   . GLU B 1 44  ? -14.868 -34.023 -10.735 1.00 88.41  ? 127 GLU B O   1 
ATOM   2222 C CB  . GLU B 1 44  ? -14.595 -31.354 -8.321  1.00 101.79 ? 127 GLU B CB  1 
ATOM   2223 C CG  . GLU B 1 44  ? -13.978 -29.953 -8.268  1.00 100.89 ? 127 GLU B CG  1 
ATOM   2224 C CD  . GLU B 1 44  ? -14.030 -29.275 -6.894  1.00 112.97 ? 127 GLU B CD  1 
ATOM   2225 O OE1 . GLU B 1 44  ? -13.619 -29.896 -5.888  1.00 114.48 ? 127 GLU B OE1 1 
ATOM   2226 O OE2 . GLU B 1 44  ? -14.457 -28.091 -6.817  1.00 108.63 ? 127 GLU B OE2 1 
ATOM   2227 N N   . PHE B 1 45  ? -12.993 -33.173 -9.724  1.00 113.76 ? 128 PHE B N   1 
ATOM   2228 C CA  . PHE B 1 45  ? -12.104 -34.368 -9.732  1.00 125.04 ? 128 PHE B CA  1 
ATOM   2229 C C   . PHE B 1 45  ? -12.660 -35.656 -10.401 1.00 117.62 ? 128 PHE B C   1 
ATOM   2230 O O   . PHE B 1 45  ? -12.078 -36.138 -11.388 1.00 111.68 ? 128 PHE B O   1 
ATOM   2231 C CB  . PHE B 1 45  ? -11.592 -34.705 -8.296  1.00 134.45 ? 128 PHE B CB  1 
ATOM   2232 C CG  . PHE B 1 45  ? -10.462 -33.817 -7.773  1.00 146.39 ? 128 PHE B CG  1 
ATOM   2233 C CD1 . PHE B 1 45  ? -10.530 -32.413 -7.827  1.00 148.69 ? 128 PHE B CD1 1 
ATOM   2234 C CD2 . PHE B 1 45  ? -9.349  -34.398 -7.139  1.00 149.51 ? 128 PHE B CD2 1 
ATOM   2235 C CE1 . PHE B 1 45  ? -9.497  -31.623 -7.311  1.00 150.78 ? 128 PHE B CE1 1 
ATOM   2236 C CE2 . PHE B 1 45  ? -8.321  -33.609 -6.617  1.00 151.15 ? 128 PHE B CE2 1 
ATOM   2237 C CZ  . PHE B 1 45  ? -8.395  -32.221 -6.703  1.00 153.19 ? 128 PHE B CZ  1 
ATOM   2238 N N   . ARG B 1 46  ? -13.755 -36.212 -9.864  1.00 107.17 ? 129 ARG B N   1 
ATOM   2239 C CA  . ARG B 1 46  ? -14.209 -37.540 -10.276 1.00 103.85 ? 129 ARG B CA  1 
ATOM   2240 C C   . ARG B 1 46  ? -15.692 -37.744 -10.054 1.00 97.08  ? 129 ARG B C   1 
ATOM   2241 O O   . ARG B 1 46  ? -16.122 -38.806 -9.618  1.00 95.65  ? 129 ARG B O   1 
ATOM   2242 C CB  . ARG B 1 46  ? -13.420 -38.646 -9.536  1.00 112.67 ? 129 ARG B CB  1 
ATOM   2243 C CG  . ARG B 1 46  ? -12.832 -39.740 -10.432 1.00 111.42 ? 129 ARG B CG  1 
ATOM   2244 C CD  . ARG B 1 46  ? -13.172 -41.157 -9.962  1.00 114.97 ? 129 ARG B CD  1 
ATOM   2245 N NE  . ARG B 1 46  ? -14.513 -41.557 -10.417 1.00 118.27 ? 129 ARG B NE  1 
ATOM   2246 C CZ  . ARG B 1 46  ? -15.160 -42.669 -10.062 1.00 113.72 ? 129 ARG B CZ  1 
ATOM   2247 N NH1 . ARG B 1 46  ? -14.607 -43.548 -9.225  1.00 112.54 ? 129 ARG B NH1 1 
ATOM   2248 N NH2 . ARG B 1 46  ? -16.375 -42.896 -10.554 1.00 100.82 ? 129 ARG B NH2 1 
ATOM   2249 N N   . THR B 1 47  ? -16.494 -36.741 -10.359 1.00 103.40 ? 130 THR B N   1 
ATOM   2250 C CA  . THR B 1 47  ? -17.941 -36.986 -10.383 1.00 105.95 ? 130 THR B CA  1 
ATOM   2251 C C   . THR B 1 47  ? -18.467 -37.752 -11.634 1.00 114.89 ? 130 THR B C   1 
ATOM   2252 O O   . THR B 1 47  ? -17.751 -37.957 -12.677 1.00 111.78 ? 130 THR B O   1 
ATOM   2253 C CB  . THR B 1 47  ? -18.796 -35.726 -10.191 1.00 94.05  ? 130 THR B CB  1 
ATOM   2254 O OG1 . THR B 1 47  ? -18.081 -34.758 -9.424  1.00 89.49  ? 130 THR B OG1 1 
ATOM   2255 C CG2 . THR B 1 47  ? -20.059 -36.125 -9.502  1.00 90.30  ? 130 THR B CG2 1 
ATOM   2256 N N   . GLY B 1 48  ? -19.747 -38.130 -11.492 1.00 101.44 ? 131 GLY B N   1 
ATOM   2257 C CA  . GLY B 1 48  ? -20.400 -39.110 -12.328 1.00 85.40  ? 131 GLY B CA  1 
ATOM   2258 C C   . GLY B 1 48  ? -20.881 -38.534 -13.616 1.00 73.47  ? 131 GLY B C   1 
ATOM   2259 O O   . GLY B 1 48  ? -21.862 -39.019 -14.185 1.00 73.15  ? 131 GLY B O   1 
ATOM   2260 N N   . LYS B 1 49  ? -20.181 -37.500 -14.072 1.00 69.99  ? 132 LYS B N   1 
ATOM   2261 C CA  . LYS B 1 49  ? -20.416 -36.907 -15.377 1.00 62.19  ? 132 LYS B CA  1 
ATOM   2262 C C   . LYS B 1 49  ? -20.362 -38.036 -16.390 1.00 64.72  ? 132 LYS B C   1 
ATOM   2263 O O   . LYS B 1 49  ? -21.272 -38.224 -17.232 1.00 62.96  ? 132 LYS B O   1 
ATOM   2264 C CB  . LYS B 1 49  ? -19.330 -35.878 -15.698 1.00 56.48  ? 132 LYS B CB  1 
ATOM   2265 C CG  . LYS B 1 49  ? -19.319 -34.604 -14.849 1.00 59.23  ? 132 LYS B CG  1 
ATOM   2266 C CD  . LYS B 1 49  ? -18.008 -33.817 -14.999 1.00 61.68  ? 132 LYS B CD  1 
ATOM   2267 C CE  . LYS B 1 49  ? -16.895 -34.375 -14.104 1.00 69.68  ? 132 LYS B CE  1 
ATOM   2268 N NZ  . LYS B 1 49  ? -15.565 -33.761 -14.376 1.00 74.71  ? 132 LYS B NZ  1 
ATOM   2269 N N   . THR B 1 50  ? -19.289 -38.811 -16.291 1.00 66.51  ? 133 THR B N   1 
ATOM   2270 C CA  . THR B 1 50  ? -18.974 -39.780 -17.330 1.00 64.39  ? 133 THR B CA  1 
ATOM   2271 C C   . THR B 1 50  ? -19.784 -41.085 -17.194 1.00 62.20  ? 133 THR B C   1 
ATOM   2272 O O   . THR B 1 50  ? -20.177 -41.695 -18.181 1.00 59.52  ? 133 THR B O   1 
ATOM   2273 C CB  . THR B 1 50  ? -17.458 -39.985 -17.397 1.00 68.26  ? 133 THR B CB  1 
ATOM   2274 O OG1 . THR B 1 50  ? -16.854 -38.811 -17.968 1.00 66.68  ? 133 THR B OG1 1 
ATOM   2275 C CG2 . THR B 1 50  ? -17.104 -41.206 -18.225 1.00 68.85  ? 133 THR B CG2 1 
ATOM   2276 N N   . GLN B 1 51  ? -20.077 -41.488 -15.976 1.00 63.88  ? 134 GLN B N   1 
ATOM   2277 C CA  . GLN B 1 51  ? -21.055 -42.546 -15.797 1.00 68.09  ? 134 GLN B CA  1 
ATOM   2278 C C   . GLN B 1 51  ? -22.460 -42.168 -16.312 1.00 66.12  ? 134 GLN B C   1 
ATOM   2279 O O   . GLN B 1 51  ? -23.209 -43.038 -16.782 1.00 65.73  ? 134 GLN B O   1 
ATOM   2280 C CB  . GLN B 1 51  ? -21.102 -42.990 -14.332 1.00 76.63  ? 134 GLN B CB  1 
ATOM   2281 C CG  . GLN B 1 51  ? -19.941 -43.885 -13.917 1.00 88.97  ? 134 GLN B CG  1 
ATOM   2282 C CD  . GLN B 1 51  ? -19.813 -45.134 -14.797 1.00 92.27  ? 134 GLN B CD  1 
ATOM   2283 O OE1 . GLN B 1 51  ? -19.151 -45.115 -15.846 1.00 83.94  ? 134 GLN B OE1 1 
ATOM   2284 N NE2 . GLN B 1 51  ? -20.452 -46.230 -14.367 1.00 93.45  ? 134 GLN B NE2 1 
ATOM   2285 N N   . LEU B 1 52  ? -22.823 -40.889 -16.219 1.00 60.76  ? 135 LEU B N   1 
ATOM   2286 C CA  . LEU B 1 52  ? -24.096 -40.471 -16.766 1.00 60.48  ? 135 LEU B CA  1 
ATOM   2287 C C   . LEU B 1 52  ? -24.028 -40.581 -18.309 1.00 57.40  ? 135 LEU B C   1 
ATOM   2288 O O   . LEU B 1 52  ? -24.916 -41.167 -18.969 1.00 52.70  ? 135 LEU B O   1 
ATOM   2289 C CB  . LEU B 1 52  ? -24.430 -39.051 -16.344 1.00 59.90  ? 135 LEU B CB  1 
ATOM   2290 C CG  . LEU B 1 52  ? -25.878 -38.725 -15.924 1.00 63.63  ? 135 LEU B CG  1 
ATOM   2291 C CD1 . LEU B 1 52  ? -26.095 -37.238 -15.679 1.00 60.44  ? 135 LEU B CD1 1 
ATOM   2292 C CD2 . LEU B 1 52  ? -26.952 -39.253 -16.859 1.00 64.26  ? 135 LEU B CD2 1 
ATOM   2293 N N   . SER B 1 53  ? -22.960 -40.043 -18.873 1.00 52.42  ? 136 SER B N   1 
ATOM   2294 C CA  . SER B 1 53  ? -22.728 -40.174 -20.320 1.00 54.61  ? 136 SER B CA  1 
ATOM   2295 C C   . SER B 1 53  ? -22.972 -41.608 -20.813 1.00 50.98  ? 136 SER B C   1 
ATOM   2296 O O   . SER B 1 53  ? -23.822 -41.847 -21.674 1.00 44.71  ? 136 SER B O   1 
ATOM   2297 C CB  . SER B 1 53  ? -21.325 -39.682 -20.694 1.00 55.06  ? 136 SER B CB  1 
ATOM   2298 O OG  . SER B 1 53  ? -21.115 -38.391 -20.136 1.00 64.31  ? 136 SER B OG  1 
ATOM   2299 N N   . HIS B 1 54  ? -22.283 -42.572 -20.220 1.00 52.10  ? 137 HIS B N   1 
ATOM   2300 C CA  . HIS B 1 54  ? -22.449 -43.925 -20.690 1.00 49.95  ? 137 HIS B CA  1 
ATOM   2301 C C   . HIS B 1 54  ? -23.860 -44.408 -20.466 1.00 51.53  ? 137 HIS B C   1 
ATOM   2302 O O   . HIS B 1 54  ? -24.420 -45.129 -21.297 1.00 52.42  ? 137 HIS B O   1 
ATOM   2303 C CB  . HIS B 1 54  ? -21.406 -44.867 -20.104 1.00 50.62  ? 137 HIS B CB  1 
ATOM   2304 C CG  . HIS B 1 54  ? -19.992 -44.579 -20.552 1.00 52.21  ? 137 HIS B CG  1 
ATOM   2305 N ND1 . HIS B 1 54  ? -19.253 -43.584 -20.026 1.00 58.62  ? 137 HIS B ND1 1 
ATOM   2306 C CD2 . HIS B 1 54  ? -19.179 -45.219 -21.481 1.00 53.70  ? 137 HIS B CD2 1 
ATOM   2307 C CE1 . HIS B 1 54  ? -18.031 -43.570 -20.608 1.00 58.74  ? 137 HIS B CE1 1 
ATOM   2308 N NE2 . HIS B 1 54  ? -17.985 -44.576 -21.493 1.00 58.45  ? 137 HIS B NE2 1 
ATOM   2309 N N   . THR B 1 55  ? -24.490 -43.998 -19.376 1.00 53.29  ? 138 THR B N   1 
ATOM   2310 C CA  . THR B 1 55  ? -25.820 -44.544 -19.096 1.00 53.38  ? 138 THR B CA  1 
ATOM   2311 C C   . THR B 1 55  ? -26.831 -44.071 -20.149 1.00 56.73  ? 138 THR B C   1 
ATOM   2312 O O   . THR B 1 55  ? -27.673 -44.867 -20.615 1.00 59.32  ? 138 THR B O   1 
ATOM   2313 C CB  . THR B 1 55  ? -26.274 -44.246 -17.662 1.00 54.01  ? 138 THR B CB  1 
ATOM   2314 O OG1 . THR B 1 55  ? -25.280 -44.734 -16.747 1.00 54.50  ? 138 THR B OG1 1 
ATOM   2315 C CG2 . THR B 1 55  ? -27.607 -44.888 -17.381 1.00 51.57  ? 138 THR B CG2 1 
ATOM   2316 N N   . LEU B 1 56  ? -26.721 -42.809 -20.575 1.00 52.42  ? 139 LEU B N   1 
ATOM   2317 C CA  . LEU B 1 56  ? -27.666 -42.304 -21.567 1.00 50.21  ? 139 LEU B CA  1 
ATOM   2318 C C   . LEU B 1 56  ? -27.513 -42.978 -22.973 1.00 53.02  ? 139 LEU B C   1 
ATOM   2319 O O   . LEU B 1 56  ? -28.496 -43.087 -23.739 1.00 54.57  ? 139 LEU B O   1 
ATOM   2320 C CB  . LEU B 1 56  ? -27.637 -40.779 -21.632 1.00 47.34  ? 139 LEU B CB  1 
ATOM   2321 C CG  . LEU B 1 56  ? -28.073 -39.968 -20.403 1.00 44.75  ? 139 LEU B CG  1 
ATOM   2322 C CD1 . LEU B 1 56  ? -27.465 -38.571 -20.406 1.00 42.77  ? 139 LEU B CD1 1 
ATOM   2323 C CD2 . LEU B 1 56  ? -29.573 -39.873 -20.310 1.00 45.71  ? 139 LEU B CD2 1 
ATOM   2324 N N   . CYS B 1 57  ? -26.315 -43.465 -23.300 1.00 46.23  ? 140 CYS B N   1 
ATOM   2325 C CA  . CYS B 1 57  ? -26.142 -44.186 -24.545 1.00 44.80  ? 140 CYS B CA  1 
ATOM   2326 C C   . CYS B 1 57  ? -27.052 -45.415 -24.634 1.00 51.73  ? 140 CYS B C   1 
ATOM   2327 O O   . CYS B 1 57  ? -27.329 -45.910 -25.748 1.00 52.26  ? 140 CYS B O   1 
ATOM   2328 C CB  . CYS B 1 57  ? -24.710 -44.668 -24.690 1.00 43.02  ? 140 CYS B CB  1 
ATOM   2329 S SG  . CYS B 1 57  ? -23.495 -43.353 -24.826 1.00 50.41  ? 140 CYS B SG  1 
ATOM   2330 N N   . VAL B 1 58  ? -27.473 -45.936 -23.474 1.00 51.26  ? 141 VAL B N   1 
ATOM   2331 C CA  . VAL B 1 58  ? -28.337 -47.117 -23.446 1.00 51.77  ? 141 VAL B CA  1 
ATOM   2332 C C   . VAL B 1 58  ? -29.789 -46.693 -23.235 1.00 53.53  ? 141 VAL B C   1 
ATOM   2333 O O   . VAL B 1 58  ? -30.657 -47.035 -24.032 1.00 55.30  ? 141 VAL B O   1 
ATOM   2334 C CB  . VAL B 1 58  ? -27.902 -48.139 -22.377 1.00 51.91  ? 141 VAL B CB  1 
ATOM   2335 C CG1 . VAL B 1 58  ? -28.847 -49.315 -22.365 1.00 52.17  ? 141 VAL B CG1 1 
ATOM   2336 C CG2 . VAL B 1 58  ? -26.486 -48.651 -22.642 1.00 48.53  ? 141 VAL B CG2 1 
ATOM   2337 N N   . THR B 1 59  ? -30.050 -45.917 -22.191 1.00 52.44  ? 142 THR B N   1 
ATOM   2338 C CA  . THR B 1 59  ? -31.433 -45.525 -21.877 1.00 54.92  ? 142 THR B CA  1 
ATOM   2339 C C   . THR B 1 59  ? -32.118 -44.724 -22.965 1.00 53.50  ? 142 THR B C   1 
ATOM   2340 O O   . THR B 1 59  ? -33.335 -44.751 -23.031 1.00 60.46  ? 142 THR B O   1 
ATOM   2341 C CB  . THR B 1 59  ? -31.567 -44.695 -20.584 1.00 55.00  ? 142 THR B CB  1 
ATOM   2342 O OG1 . THR B 1 59  ? -30.794 -43.492 -20.708 1.00 55.63  ? 142 THR B OG1 1 
ATOM   2343 C CG2 . THR B 1 59  ? -31.125 -45.496 -19.363 1.00 56.27  ? 142 THR B CG2 1 
ATOM   2344 N N   . ALA B 1 60  ? -31.357 -44.007 -23.787 1.00 48.72  ? 143 ALA B N   1 
ATOM   2345 C CA  . ALA B 1 60  ? -31.941 -43.292 -24.917 1.00 50.28  ? 143 ALA B CA  1 
ATOM   2346 C C   . ALA B 1 60  ? -32.436 -44.225 -26.001 1.00 53.88  ? 143 ALA B C   1 
ATOM   2347 O O   . ALA B 1 60  ? -33.219 -43.834 -26.857 1.00 55.97  ? 143 ALA B O   1 
ATOM   2348 C CB  . ALA B 1 60  ? -30.949 -42.333 -25.510 1.00 46.78  ? 143 ALA B CB  1 
ATOM   2349 N N   . GLN B 1 61  ? -31.966 -45.461 -25.964 1.00 57.74  ? 144 GLN B N   1 
ATOM   2350 C CA  . GLN B 1 61  ? -32.374 -46.468 -26.924 1.00 56.00  ? 144 GLN B CA  1 
ATOM   2351 C C   . GLN B 1 61  ? -33.675 -47.152 -26.547 1.00 58.85  ? 144 GLN B C   1 
ATOM   2352 O O   . GLN B 1 61  ? -34.222 -47.895 -27.353 1.00 60.20  ? 144 GLN B O   1 
ATOM   2353 C CB  . GLN B 1 61  ? -31.294 -47.527 -27.027 1.00 54.92  ? 144 GLN B CB  1 
ATOM   2354 C CG  . GLN B 1 61  ? -29.917 -46.951 -27.250 1.00 56.23  ? 144 GLN B CG  1 
ATOM   2355 C CD  . GLN B 1 61  ? -29.093 -47.842 -28.131 1.00 54.38  ? 144 GLN B CD  1 
ATOM   2356 O OE1 . GLN B 1 61  ? -29.652 -48.618 -28.887 1.00 58.69  ? 144 GLN B OE1 1 
ATOM   2357 N NE2 . GLN B 1 61  ? -27.769 -47.756 -28.025 1.00 48.33  ? 144 GLN B NE2 1 
ATOM   2358 N N   . LEU B 1 62  ? -34.160 -46.925 -25.326 1.00 59.65  ? 145 LEU B N   1 
ATOM   2359 C CA  . LEU B 1 62  ? -35.242 -47.749 -24.784 1.00 61.83  ? 145 LEU B CA  1 
ATOM   2360 C C   . LEU B 1 62  ? -36.587 -47.047 -24.871 1.00 60.76  ? 145 LEU B C   1 
ATOM   2361 O O   . LEU B 1 62  ? -36.653 -45.844 -24.650 1.00 59.68  ? 145 LEU B O   1 
ATOM   2362 C CB  . LEU B 1 62  ? -34.981 -48.121 -23.326 1.00 59.79  ? 145 LEU B CB  1 
ATOM   2363 C CG  . LEU B 1 62  ? -33.651 -48.660 -22.840 1.00 59.73  ? 145 LEU B CG  1 
ATOM   2364 C CD1 . LEU B 1 62  ? -33.832 -48.913 -21.353 1.00 65.53  ? 145 LEU B CD1 1 
ATOM   2365 C CD2 . LEU B 1 62  ? -33.236 -49.944 -23.535 1.00 59.55  ? 145 LEU B CD2 1 
ATOM   2366 N N   . PRO B 1 63  ? -37.665 -47.802 -25.164 1.00 62.84  ? 146 PRO B N   1 
ATOM   2367 C CA  . PRO B 1 63  ? -38.982 -47.139 -25.038 1.00 66.77  ? 146 PRO B CA  1 
ATOM   2368 C C   . PRO B 1 63  ? -39.136 -46.683 -23.582 1.00 69.02  ? 146 PRO B C   1 
ATOM   2369 O O   . PRO B 1 63  ? -38.821 -47.445 -22.658 1.00 70.56  ? 146 PRO B O   1 
ATOM   2370 C CB  . PRO B 1 63  ? -39.997 -48.246 -25.395 1.00 67.38  ? 146 PRO B CB  1 
ATOM   2371 C CG  . PRO B 1 63  ? -39.231 -49.533 -25.312 1.00 67.73  ? 146 PRO B CG  1 
ATOM   2372 C CD  . PRO B 1 63  ? -37.766 -49.249 -25.426 1.00 60.95  ? 146 PRO B CD  1 
ATOM   2373 N N   . GLY B 1 64  ? -39.544 -45.437 -23.377 1.00 70.53  ? 147 GLY B N   1 
ATOM   2374 C CA  . GLY B 1 64  ? -39.673 -44.905 -22.024 1.00 73.59  ? 147 GLY B CA  1 
ATOM   2375 C C   . GLY B 1 64  ? -41.074 -44.383 -21.825 1.00 80.15  ? 147 GLY B C   1 
ATOM   2376 O O   . GLY B 1 64  ? -41.943 -44.638 -22.658 1.00 83.62  ? 147 GLY B O   1 
ATOM   2377 N N   . ALA B 1 65  ? -41.290 -43.648 -20.726 1.00 85.54  ? 148 ALA B N   1 
ATOM   2378 C CA  . ALA B 1 65  ? -42.571 -42.963 -20.439 1.00 84.88  ? 148 ALA B CA  1 
ATOM   2379 C C   . ALA B 1 65  ? -43.012 -42.010 -21.563 1.00 81.67  ? 148 ALA B C   1 
ATOM   2380 O O   . ALA B 1 65  ? -42.197 -41.611 -22.399 1.00 74.46  ? 148 ALA B O   1 
ATOM   2381 C CB  . ALA B 1 65  ? -42.501 -42.225 -19.096 1.00 83.93  ? 148 ALA B CB  1 
ATOM   2382 N N   . GLY B 1 66  ? -44.308 -41.686 -21.598 1.00 82.06  ? 149 GLY B N   1 
ATOM   2383 C CA  . GLY B 1 66  ? -44.829 -40.678 -22.521 1.00 77.75  ? 149 GLY B CA  1 
ATOM   2384 C C   . GLY B 1 66  ? -44.873 -41.068 -23.994 1.00 77.94  ? 149 GLY B C   1 
ATOM   2385 O O   . GLY B 1 66  ? -45.012 -40.192 -24.866 1.00 68.72  ? 149 GLY B O   1 
ATOM   2386 N N   . GLY B 1 67  ? -44.783 -42.375 -24.276 1.00 81.22  ? 150 GLY B N   1 
ATOM   2387 C CA  . GLY B 1 67  ? -44.720 -42.857 -25.663 1.00 80.50  ? 150 GLY B CA  1 
ATOM   2388 C C   . GLY B 1 67  ? -43.393 -42.614 -26.399 1.00 78.52  ? 150 GLY B C   1 
ATOM   2389 O O   . GLY B 1 67  ? -43.333 -42.683 -27.639 1.00 79.99  ? 150 GLY B O   1 
ATOM   2390 N N   . TYR B 1 68  ? -42.329 -42.326 -25.649 1.00 70.84  ? 151 TYR B N   1 
ATOM   2391 C CA  . TYR B 1 68  ? -40.966 -42.300 -26.209 1.00 64.50  ? 151 TYR B CA  1 
ATOM   2392 C C   . TYR B 1 68  ? -40.477 -43.681 -26.714 1.00 62.79  ? 151 TYR B C   1 
ATOM   2393 O O   . TYR B 1 68  ? -40.289 -44.633 -25.920 1.00 60.14  ? 151 TYR B O   1 
ATOM   2394 C CB  . TYR B 1 68  ? -39.996 -41.723 -25.188 1.00 60.69  ? 151 TYR B CB  1 
ATOM   2395 C CG  . TYR B 1 68  ? -38.548 -41.678 -25.600 1.00 59.26  ? 151 TYR B CG  1 
ATOM   2396 C CD1 . TYR B 1 68  ? -38.030 -40.579 -26.265 1.00 54.75  ? 151 TYR B CD1 1 
ATOM   2397 C CD2 . TYR B 1 68  ? -37.668 -42.722 -25.273 1.00 58.80  ? 151 TYR B CD2 1 
ATOM   2398 C CE1 . TYR B 1 68  ? -36.695 -40.541 -26.648 1.00 49.34  ? 151 TYR B CE1 1 
ATOM   2399 C CE2 . TYR B 1 68  ? -36.329 -42.658 -25.615 1.00 53.40  ? 151 TYR B CE2 1 
ATOM   2400 C CZ  . TYR B 1 68  ? -35.855 -41.569 -26.305 1.00 51.48  ? 151 TYR B CZ  1 
ATOM   2401 O OH  . TYR B 1 68  ? -34.514 -41.492 -26.656 1.00 54.61  ? 151 TYR B OH  1 
ATOM   2402 N N   . PRO B 1 69  ? -40.249 -43.773 -28.043 1.00 58.85  ? 152 PRO B N   1 
ATOM   2403 C CA  . PRO B 1 69  ? -39.888 -45.011 -28.776 1.00 58.64  ? 152 PRO B CA  1 
ATOM   2404 C C   . PRO B 1 69  ? -38.435 -45.427 -28.587 1.00 58.61  ? 152 PRO B C   1 
ATOM   2405 O O   . PRO B 1 69  ? -38.075 -46.539 -28.924 1.00 57.05  ? 152 PRO B O   1 
ATOM   2406 C CB  . PRO B 1 69  ? -40.047 -44.602 -30.238 1.00 56.94  ? 152 PRO B CB  1 
ATOM   2407 C CG  . PRO B 1 69  ? -39.797 -43.097 -30.244 1.00 52.21  ? 152 PRO B CG  1 
ATOM   2408 C CD  . PRO B 1 69  ? -40.203 -42.569 -28.902 1.00 51.34  ? 152 PRO B CD  1 
ATOM   2409 N N   . GLY B 1 70  ? -37.587 -44.525 -28.090 1.00 58.82  ? 153 GLY B N   1 
ATOM   2410 C CA  . GLY B 1 70  ? -36.150 -44.794 -28.096 1.00 57.86  ? 153 GLY B CA  1 
ATOM   2411 C C   . GLY B 1 70  ? -35.620 -44.477 -29.477 1.00 58.01  ? 153 GLY B C   1 
ATOM   2412 O O   . GLY B 1 70  ? -36.398 -44.287 -30.405 1.00 64.78  ? 153 GLY B O   1 
ATOM   2413 N N   . GLY B 1 71  ? -34.299 -44.389 -29.609 1.00 57.84  ? 154 GLY B N   1 
ATOM   2414 C CA  . GLY B 1 71  ? -33.649 -43.974 -30.852 1.00 52.65  ? 154 GLY B CA  1 
ATOM   2415 C C   . GLY B 1 71  ? -32.136 -43.934 -30.688 1.00 54.47  ? 154 GLY B C   1 
ATOM   2416 O O   . GLY B 1 71  ? -31.586 -44.462 -29.717 1.00 54.26  ? 154 GLY B O   1 
ATOM   2417 N N   . LYS B 1 72  ? -31.473 -43.293 -31.649 1.00 53.24  ? 155 LYS B N   1 
ATOM   2418 C CA  . LYS B 1 72  ? -30.024 -43.283 -31.793 1.00 46.16  ? 155 LYS B CA  1 
ATOM   2419 C C   . LYS B 1 72  ? -29.334 -42.097 -31.087 1.00 44.51  ? 155 LYS B C   1 
ATOM   2420 O O   . LYS B 1 72  ? -29.968 -41.038 -30.788 1.00 43.21  ? 155 LYS B O   1 
ATOM   2421 C CB  . LYS B 1 72  ? -29.684 -43.275 -33.270 1.00 44.26  ? 155 LYS B CB  1 
ATOM   2422 C CG  . LYS B 1 72  ? -29.653 -44.652 -33.859 1.00 50.03  ? 155 LYS B CG  1 
ATOM   2423 C CD  . LYS B 1 72  ? -29.635 -44.627 -35.373 1.00 49.74  ? 155 LYS B CD  1 
ATOM   2424 C CE  . LYS B 1 72  ? -29.467 -46.038 -35.885 1.00 54.02  ? 155 LYS B CE  1 
ATOM   2425 N NZ  . LYS B 1 72  ? -29.301 -46.082 -37.361 1.00 57.06  ? 155 LYS B NZ  1 
ATOM   2426 N N   . ILE B 1 73  ? -28.041 -42.272 -30.826 1.00 36.77  ? 156 ILE B N   1 
ATOM   2427 C CA  . ILE B 1 73  ? -27.326 -41.306 -30.045 1.00 38.53  ? 156 ILE B CA  1 
ATOM   2428 C C   . ILE B 1 73  ? -26.090 -40.910 -30.781 1.00 41.61  ? 156 ILE B C   1 
ATOM   2429 O O   . ILE B 1 73  ? -25.491 -41.751 -31.488 1.00 40.71  ? 156 ILE B O   1 
ATOM   2430 C CB  . ILE B 1 73  ? -26.852 -41.890 -28.686 1.00 41.95  ? 156 ILE B CB  1 
ATOM   2431 C CG1 . ILE B 1 73  ? -28.039 -42.176 -27.761 1.00 37.49  ? 156 ILE B CG1 1 
ATOM   2432 C CG2 . ILE B 1 73  ? -25.831 -40.967 -28.003 1.00 37.57  ? 156 ILE B CG2 1 
ATOM   2433 C CD1 . ILE B 1 73  ? -28.609 -43.548 -27.992 1.00 39.72  ? 156 ILE B CD1 1 
ATOM   2434 N N   . ILE B 1 74  ? -25.699 -39.641 -30.617 1.00 39.15  ? 157 ILE B N   1 
ATOM   2435 C CA  . ILE B 1 74  ? -24.380 -39.256 -31.048 1.00 37.61  ? 157 ILE B CA  1 
ATOM   2436 C C   . ILE B 1 74  ? -23.503 -38.874 -29.888 1.00 36.42  ? 157 ILE B C   1 
ATOM   2437 O O   . ILE B 1 74  ? -23.925 -38.143 -28.989 1.00 36.06  ? 157 ILE B O   1 
ATOM   2438 C CB  . ILE B 1 74  ? -24.377 -38.121 -32.027 1.00 37.26  ? 157 ILE B CB  1 
ATOM   2439 C CG1 . ILE B 1 74  ? -25.158 -38.522 -33.253 1.00 41.86  ? 157 ILE B CG1 1 
ATOM   2440 C CG2 . ILE B 1 74  ? -22.944 -37.843 -32.445 1.00 38.36  ? 157 ILE B CG2 1 
ATOM   2441 C CD1 . ILE B 1 74  ? -24.747 -37.718 -34.472 1.00 43.37  ? 157 ILE B CD1 1 
ATOM   2442 N N   . PHE B 1 75  ? -22.248 -39.323 -29.966 1.00 36.30  ? 158 PHE B N   1 
ATOM   2443 C CA  . PHE B 1 75  ? -21.304 -39.172 -28.882 1.00 37.88  ? 158 PHE B CA  1 
ATOM   2444 C C   . PHE B 1 75  ? -20.006 -38.543 -29.341 1.00 39.53  ? 158 PHE B C   1 
ATOM   2445 O O   . PHE B 1 75  ? -19.245 -39.183 -30.041 1.00 47.72  ? 158 PHE B O   1 
ATOM   2446 C CB  . PHE B 1 75  ? -21.081 -40.533 -28.172 1.00 33.38  ? 158 PHE B CB  1 
ATOM   2447 C CG  . PHE B 1 75  ? -20.523 -40.402 -26.781 1.00 32.27  ? 158 PHE B CG  1 
ATOM   2448 C CD1 . PHE B 1 75  ? -21.204 -40.904 -25.700 1.00 34.00  ? 158 PHE B CD1 1 
ATOM   2449 C CD2 . PHE B 1 75  ? -19.314 -39.732 -26.552 1.00 31.21  ? 158 PHE B CD2 1 
ATOM   2450 C CE1 . PHE B 1 75  ? -20.698 -40.770 -24.402 1.00 32.43  ? 158 PHE B CE1 1 
ATOM   2451 C CE2 . PHE B 1 75  ? -18.797 -39.614 -25.260 1.00 30.47  ? 158 PHE B CE2 1 
ATOM   2452 C CZ  . PHE B 1 75  ? -19.497 -40.135 -24.187 1.00 31.70  ? 158 PHE B CZ  1 
ATOM   2453 N N   . ILE B 1 76  ? -19.767 -37.276 -28.960 1.00 47.50  ? 159 ILE B N   1 
ATOM   2454 C CA  . ILE B 1 76  ? -18.453 -36.585 -29.168 1.00 42.07  ? 159 ILE B CA  1 
ATOM   2455 C C   . ILE B 1 76  ? -17.657 -36.540 -27.829 1.00 43.62  ? 159 ILE B C   1 
ATOM   2456 O O   . ILE B 1 76  ? -18.134 -36.028 -26.825 1.00 43.61  ? 159 ILE B O   1 
ATOM   2457 C CB  . ILE B 1 76  ? -18.647 -35.176 -29.717 1.00 40.25  ? 159 ILE B CB  1 
ATOM   2458 C CG1 . ILE B 1 76  ? -19.319 -35.244 -31.084 1.00 41.16  ? 159 ILE B CG1 1 
ATOM   2459 C CG2 . ILE B 1 76  ? -17.330 -34.402 -29.755 1.00 36.17  ? 159 ILE B CG2 1 
ATOM   2460 C CD1 . ILE B 1 76  ? -19.900 -33.913 -31.523 1.00 42.89  ? 159 ILE B CD1 1 
ATOM   2461 N N   . ASP B 1 77  ? -16.445 -37.082 -27.869 1.00 41.84  ? 160 ASP B N   1 
ATOM   2462 C CA  . ASP B 1 77  ? -15.585 -37.330 -26.756 1.00 40.84  ? 160 ASP B CA  1 
ATOM   2463 C C   . ASP B 1 77  ? -14.337 -36.409 -26.920 1.00 43.69  ? 160 ASP B C   1 
ATOM   2464 O O   . ASP B 1 77  ? -13.657 -36.403 -27.981 1.00 41.56  ? 160 ASP B O   1 
ATOM   2465 C CB  . ASP B 1 77  ? -15.173 -38.801 -26.886 1.00 42.88  ? 160 ASP B CB  1 
ATOM   2466 C CG  . ASP B 1 77  ? -14.390 -39.362 -25.656 1.00 47.57  ? 160 ASP B CG  1 
ATOM   2467 O OD1 . ASP B 1 77  ? -14.048 -38.612 -24.717 1.00 45.54  ? 160 ASP B OD1 1 
ATOM   2468 O OD2 . ASP B 1 77  ? -14.122 -40.604 -25.642 1.00 50.59  ? 160 ASP B OD2 1 
ATOM   2469 N N   . THR B 1 78  ? -14.015 -35.664 -25.877 1.00 40.63  ? 161 THR B N   1 
ATOM   2470 C CA  . THR B 1 78  ? -12.895 -34.730 -25.916 1.00 41.10  ? 161 THR B CA  1 
ATOM   2471 C C   . THR B 1 78  ? -11.992 -35.176 -24.808 1.00 46.18  ? 161 THR B C   1 
ATOM   2472 O O   . THR B 1 78  ? -10.849 -34.718 -24.691 1.00 53.86  ? 161 THR B O   1 
ATOM   2473 C CB  . THR B 1 78  ? -13.363 -33.279 -25.646 1.00 39.49  ? 161 THR B CB  1 
ATOM   2474 O OG1 . THR B 1 78  ? -13.797 -33.172 -24.290 1.00 40.05  ? 161 THR B OG1 1 
ATOM   2475 C CG2 . THR B 1 78  ? -14.564 -32.908 -26.557 1.00 36.86  ? 161 THR B CG2 1 
ATOM   2476 N N   . GLU B 1 79  ? -12.507 -36.093 -23.994 1.00 45.60  ? 162 GLU B N   1 
ATOM   2477 C CA  . GLU B 1 79  ? -11.793 -36.565 -22.801 1.00 49.92  ? 162 GLU B CA  1 
ATOM   2478 C C   . GLU B 1 79  ? -11.045 -37.881 -23.030 1.00 49.58  ? 162 GLU B C   1 
ATOM   2479 O O   . GLU B 1 79  ? -10.304 -38.323 -22.115 1.00 49.10  ? 162 GLU B O   1 
ATOM   2480 C CB  . GLU B 1 79  ? -12.751 -36.781 -21.599 1.00 52.12  ? 162 GLU B CB  1 
ATOM   2481 C CG  . GLU B 1 79  ? -13.503 -35.559 -21.133 1.00 60.16  ? 162 GLU B CG  1 
ATOM   2482 C CD  . GLU B 1 79  ? -12.605 -34.369 -21.127 1.00 64.44  ? 162 GLU B CD  1 
ATOM   2483 O OE1 . GLU B 1 79  ? -12.649 -33.597 -22.110 1.00 73.48  ? 162 GLU B OE1 1 
ATOM   2484 O OE2 . GLU B 1 79  ? -11.814 -34.249 -20.179 1.00 67.63  ? 162 GLU B OE2 1 
ATOM   2485 N N   . ASN B 1 80  ? -11.290 -38.537 -24.181 1.00 42.89  ? 163 ASN B N   1 
ATOM   2486 C CA  . ASN B 1 80  ? -10.737 -39.861 -24.432 1.00 41.34  ? 163 ASN B CA  1 
ATOM   2487 C C   . ASN B 1 80  ? -11.150 -40.814 -23.276 1.00 41.70  ? 163 ASN B C   1 
ATOM   2488 O O   . ASN B 1 80  ? -10.366 -41.639 -22.824 1.00 36.05  ? 163 ASN B O   1 
ATOM   2489 C CB  . ASN B 1 80  ? -9.204  -39.727 -24.532 1.00 43.65  ? 163 ASN B CB  1 
ATOM   2490 C CG  . ASN B 1 80  ? -8.525  -40.923 -25.140 1.00 44.11  ? 163 ASN B CG  1 
ATOM   2491 O OD1 . ASN B 1 80  ? -9.156  -41.741 -25.797 1.00 53.88  ? 163 ASN B OD1 1 
ATOM   2492 N ND2 . ASN B 1 80  ? -7.204  -41.025 -24.935 1.00 45.28  ? 163 ASN B ND2 1 
ATOM   2493 N N   . THR B 1 81  ? -12.387 -40.687 -22.791 1.00 40.81  ? 164 THR B N   1 
ATOM   2494 C CA  . THR B 1 81  ? -12.890 -41.656 -21.824 1.00 41.81  ? 164 THR B CA  1 
ATOM   2495 C C   . THR B 1 81  ? -14.122 -42.468 -22.211 1.00 44.50  ? 164 THR B C   1 
ATOM   2496 O O   . THR B 1 81  ? -14.639 -43.211 -21.347 1.00 44.75  ? 164 THR B O   1 
ATOM   2497 C CB  . THR B 1 81  ? -13.219 -40.987 -20.509 1.00 41.31  ? 164 THR B CB  1 
ATOM   2498 O OG1 . THR B 1 81  ? -13.994 -39.838 -20.808 1.00 43.43  ? 164 THR B OG1 1 
ATOM   2499 C CG2 . THR B 1 81  ? -11.903 -40.624 -19.703 1.00 41.54  ? 164 THR B CG2 1 
ATOM   2500 N N   . PHE B 1 82  ? -14.601 -42.370 -23.468 1.00 38.62  ? 165 PHE B N   1 
ATOM   2501 C CA  . PHE B 1 82  ? -15.667 -43.265 -23.879 1.00 38.09  ? 165 PHE B CA  1 
ATOM   2502 C C   . PHE B 1 82  ? -15.172 -44.717 -23.948 1.00 39.52  ? 165 PHE B C   1 
ATOM   2503 O O   . PHE B 1 82  ? -14.053 -45.001 -24.349 1.00 40.61  ? 165 PHE B O   1 
ATOM   2504 C CB  . PHE B 1 82  ? -16.263 -42.812 -25.186 1.00 43.26  ? 165 PHE B CB  1 
ATOM   2505 C CG  . PHE B 1 82  ? -17.349 -43.724 -25.717 1.00 46.59  ? 165 PHE B CG  1 
ATOM   2506 C CD1 . PHE B 1 82  ? -17.152 -44.467 -26.890 1.00 45.36  ? 165 PHE B CD1 1 
ATOM   2507 C CD2 . PHE B 1 82  ? -18.556 -43.847 -25.060 1.00 49.00  ? 165 PHE B CD2 1 
ATOM   2508 C CE1 . PHE B 1 82  ? -18.150 -45.274 -27.408 1.00 44.83  ? 165 PHE B CE1 1 
ATOM   2509 C CE2 . PHE B 1 82  ? -19.551 -44.663 -25.568 1.00 49.13  ? 165 PHE B CE2 1 
ATOM   2510 C CZ  . PHE B 1 82  ? -19.348 -45.381 -26.740 1.00 45.48  ? 165 PHE B CZ  1 
ATOM   2511 N N   . ARG B 1 83  ? -15.973 -45.654 -23.491 1.00 43.95  ? 166 ARG B N   1 
ATOM   2512 C CA  . ARG B 1 83  ? -15.516 -47.054 -23.480 1.00 43.86  ? 166 ARG B CA  1 
ATOM   2513 C C   . ARG B 1 83  ? -16.727 -47.858 -23.781 1.00 43.48  ? 166 ARG B C   1 
ATOM   2514 O O   . ARG B 1 83  ? -17.565 -48.035 -22.886 1.00 45.92  ? 166 ARG B O   1 
ATOM   2515 C CB  . ARG B 1 83  ? -15.017 -47.513 -22.090 1.00 45.75  ? 166 ARG B CB  1 
ATOM   2516 C CG  . ARG B 1 83  ? -13.738 -46.899 -21.507 1.00 44.53  ? 166 ARG B CG  1 
ATOM   2517 C CD  . ARG B 1 83  ? -12.463 -47.329 -22.241 1.00 44.89  ? 166 ARG B CD  1 
ATOM   2518 N NE  . ARG B 1 83  ? -11.966 -46.135 -22.899 1.00 49.20  ? 166 ARG B NE  1 
ATOM   2519 C CZ  . ARG B 1 83  ? -10.826 -45.551 -22.604 1.00 49.50  ? 166 ARG B CZ  1 
ATOM   2520 N NH1 . ARG B 1 83  ? -10.051 -46.060 -21.680 1.00 57.72  ? 166 ARG B NH1 1 
ATOM   2521 N NH2 . ARG B 1 83  ? -10.481 -44.440 -23.214 1.00 53.04  ? 166 ARG B NH2 1 
ATOM   2522 N N   . PRO B 1 84  ? -16.836 -48.360 -25.025 1.00 41.63  ? 167 PRO B N   1 
ATOM   2523 C CA  . PRO B 1 84  ? -17.950 -49.237 -25.369 1.00 47.02  ? 167 PRO B CA  1 
ATOM   2524 C C   . PRO B 1 84  ? -18.126 -50.426 -24.418 1.00 50.03  ? 167 PRO B C   1 
ATOM   2525 O O   . PRO B 1 84  ? -19.213 -50.964 -24.308 1.00 51.65  ? 167 PRO B O   1 
ATOM   2526 C CB  . PRO B 1 84  ? -17.581 -49.722 -26.754 1.00 41.52  ? 167 PRO B CB  1 
ATOM   2527 C CG  . PRO B 1 84  ? -16.768 -48.630 -27.314 1.00 39.50  ? 167 PRO B CG  1 
ATOM   2528 C CD  . PRO B 1 84  ? -15.936 -48.177 -26.162 1.00 38.28  ? 167 PRO B CD  1 
ATOM   2529 N N   . ASP B 1 85  ? -17.073 -50.816 -23.718 1.00 58.43  ? 168 ASP B N   1 
ATOM   2530 C CA  . ASP B 1 85  ? -17.199 -51.989 -22.878 1.00 69.26  ? 168 ASP B CA  1 
ATOM   2531 C C   . ASP B 1 85  ? -18.127 -51.749 -21.695 1.00 69.97  ? 168 ASP B C   1 
ATOM   2532 O O   . ASP B 1 85  ? -18.883 -52.638 -21.293 1.00 76.38  ? 168 ASP B O   1 
ATOM   2533 C CB  . ASP B 1 85  ? -15.842 -52.535 -22.448 1.00 74.52  ? 168 ASP B CB  1 
ATOM   2534 C CG  . ASP B 1 85  ? -15.712 -54.006 -22.753 1.00 87.26  ? 168 ASP B CG  1 
ATOM   2535 O OD1 . ASP B 1 85  ? -16.275 -54.831 -21.987 1.00 95.96  ? 168 ASP B OD1 1 
ATOM   2536 O OD2 . ASP B 1 85  ? -15.080 -54.332 -23.788 1.00 93.06  ? 168 ASP B OD2 1 
ATOM   2537 N N   . ARG B 1 86  ? -18.081 -50.535 -21.161 1.00 66.88  ? 169 ARG B N   1 
ATOM   2538 C CA  . ARG B 1 86  ? -18.985 -50.144 -20.104 1.00 67.70  ? 169 ARG B CA  1 
ATOM   2539 C C   . ARG B 1 86  ? -20.449 -50.280 -20.495 1.00 63.55  ? 169 ARG B C   1 
ATOM   2540 O O   . ARG B 1 86  ? -21.262 -50.587 -19.653 1.00 63.13  ? 169 ARG B O   1 
ATOM   2541 C CB  . ARG B 1 86  ? -18.712 -48.715 -19.652 1.00 73.51  ? 169 ARG B CB  1 
ATOM   2542 C CG  . ARG B 1 86  ? -17.759 -48.597 -18.480 1.00 81.75  ? 169 ARG B CG  1 
ATOM   2543 C CD  . ARG B 1 86  ? -17.818 -49.829 -17.559 1.00 96.55  ? 169 ARG B CD  1 
ATOM   2544 N NE  . ARG B 1 86  ? -19.089 -50.048 -16.834 1.00 90.33  ? 169 ARG B NE  1 
ATOM   2545 C CZ  . ARG B 1 86  ? -19.965 -49.102 -16.511 1.00 79.15  ? 169 ARG B CZ  1 
ATOM   2546 N NH1 . ARG B 1 86  ? -19.740 -47.831 -16.838 1.00 74.02  ? 169 ARG B NH1 1 
ATOM   2547 N NH2 . ARG B 1 86  ? -21.067 -49.436 -15.858 1.00 71.46  ? 169 ARG B NH2 1 
ATOM   2548 N N   . LEU B 1 87  ? -20.788 -50.071 -21.765 1.00 60.35  ? 170 LEU B N   1 
ATOM   2549 C CA  . LEU B 1 87  ? -22.192 -50.126 -22.154 1.00 60.87  ? 170 LEU B CA  1 
ATOM   2550 C C   . LEU B 1 87  ? -22.740 -51.532 -22.093 1.00 69.69  ? 170 LEU B C   1 
ATOM   2551 O O   . LEU B 1 87  ? -23.955 -51.717 -21.961 1.00 77.63  ? 170 LEU B O   1 
ATOM   2552 C CB  . LEU B 1 87  ? -22.451 -49.538 -23.547 1.00 61.06  ? 170 LEU B CB  1 
ATOM   2553 C CG  . LEU B 1 87  ? -21.988 -48.118 -23.909 1.00 58.82  ? 170 LEU B CG  1 
ATOM   2554 C CD1 . LEU B 1 87  ? -22.425 -47.775 -25.314 1.00 55.80  ? 170 LEU B CD1 1 
ATOM   2555 C CD2 . LEU B 1 87  ? -22.563 -47.114 -22.945 1.00 56.44  ? 170 LEU B CD2 1 
ATOM   2556 N N   . ARG B 1 88  ? -21.867 -52.533 -22.162 1.00 70.31  ? 171 ARG B N   1 
ATOM   2557 C CA  . ARG B 1 88  ? -22.373 -53.865 -22.319 1.00 71.75  ? 171 ARG B CA  1 
ATOM   2558 C C   . ARG B 1 88  ? -22.997 -54.325 -20.979 1.00 81.61  ? 171 ARG B C   1 
ATOM   2559 O O   . ARG B 1 88  ? -23.990 -55.072 -20.962 1.00 83.00  ? 171 ARG B O   1 
ATOM   2560 C CB  . ARG B 1 88  ? -21.326 -54.797 -22.958 1.00 74.79  ? 171 ARG B CB  1 
ATOM   2561 C CG  . ARG B 1 88  ? -21.155 -54.603 -24.479 1.00 74.89  ? 171 ARG B CG  1 
ATOM   2562 C CD  . ARG B 1 88  ? -19.965 -55.395 -25.049 1.00 83.14  ? 171 ARG B CD  1 
ATOM   2563 N NE  . ARG B 1 88  ? -20.296 -56.730 -25.609 1.00 99.71  ? 171 ARG B NE  1 
ATOM   2564 C CZ  . ARG B 1 88  ? -19.921 -57.928 -25.109 1.00 104.45 ? 171 ARG B CZ  1 
ATOM   2565 N NH1 . ARG B 1 88  ? -19.193 -58.018 -23.997 1.00 106.82 ? 171 ARG B NH1 1 
ATOM   2566 N NH2 . ARG B 1 88  ? -20.276 -59.064 -25.717 1.00 90.99  ? 171 ARG B NH2 1 
ATOM   2567 N N   . ASP B 1 89  ? -22.467 -53.810 -19.870 1.00 78.46  ? 172 ASP B N   1 
ATOM   2568 C CA  . ASP B 1 89  ? -23.038 -54.058 -18.545 1.00 78.03  ? 172 ASP B CA  1 
ATOM   2569 C C   . ASP B 1 89  ? -24.406 -53.429 -18.365 1.00 82.78  ? 172 ASP B C   1 
ATOM   2570 O O   . ASP B 1 89  ? -25.352 -54.057 -17.839 1.00 86.53  ? 172 ASP B O   1 
ATOM   2571 C CB  . ASP B 1 89  ? -22.146 -53.450 -17.481 1.00 83.70  ? 172 ASP B CB  1 
ATOM   2572 C CG  . ASP B 1 89  ? -20.850 -54.197 -17.318 1.00 91.77  ? 172 ASP B CG  1 
ATOM   2573 O OD1 . ASP B 1 89  ? -19.866 -53.814 -18.023 1.00 80.44  ? 172 ASP B OD1 1 
ATOM   2574 O OD2 . ASP B 1 89  ? -20.842 -55.139 -16.461 1.00 91.71  ? 172 ASP B OD2 1 
ATOM   2575 N N   . ILE B 1 90  ? -24.487 -52.162 -18.769 1.00 73.92  ? 173 ILE B N   1 
ATOM   2576 C CA  . ILE B 1 90  ? -25.658 -51.345 -18.547 1.00 68.17  ? 173 ILE B CA  1 
ATOM   2577 C C   . ILE B 1 90  ? -26.786 -51.926 -19.384 1.00 66.07  ? 173 ILE B C   1 
ATOM   2578 O O   . ILE B 1 90  ? -27.939 -51.992 -18.941 1.00 64.91  ? 173 ILE B O   1 
ATOM   2579 C CB  . ILE B 1 90  ? -25.304 -49.901 -18.905 1.00 66.16  ? 173 ILE B CB  1 
ATOM   2580 C CG1 . ILE B 1 90  ? -24.282 -49.378 -17.900 1.00 61.96  ? 173 ILE B CG1 1 
ATOM   2581 C CG2 . ILE B 1 90  ? -26.520 -49.011 -18.933 1.00 61.06  ? 173 ILE B CG2 1 
ATOM   2582 C CD1 . ILE B 1 90  ? -23.541 -48.164 -18.410 1.00 57.45  ? 173 ILE B CD1 1 
ATOM   2583 N N   . ALA B 1 91  ? -26.406 -52.412 -20.563 1.00 62.59  ? 174 ALA B N   1 
ATOM   2584 C CA  . ALA B 1 91  ? -27.275 -53.182 -21.435 1.00 67.15  ? 174 ALA B CA  1 
ATOM   2585 C C   . ALA B 1 91  ? -27.937 -54.382 -20.734 1.00 73.16  ? 174 ALA B C   1 
ATOM   2586 O O   . ALA B 1 91  ? -29.144 -54.607 -20.881 1.00 79.96  ? 174 ALA B O   1 
ATOM   2587 C CB  . ALA B 1 91  ? -26.503 -53.643 -22.648 1.00 62.52  ? 174 ALA B CB  1 
ATOM   2588 N N   . ASP B 1 92  ? -27.151 -55.127 -19.969 1.00 73.73  ? 175 ASP B N   1 
ATOM   2589 C CA  . ASP B 1 92  ? -27.650 -56.259 -19.196 1.00 80.91  ? 175 ASP B CA  1 
ATOM   2590 C C   . ASP B 1 92  ? -28.643 -55.845 -18.134 1.00 80.78  ? 175 ASP B C   1 
ATOM   2591 O O   . ASP B 1 92  ? -29.684 -56.478 -17.973 1.00 86.95  ? 175 ASP B O   1 
ATOM   2592 C CB  . ASP B 1 92  ? -26.498 -57.005 -18.543 1.00 88.48  ? 175 ASP B CB  1 
ATOM   2593 C CG  . ASP B 1 92  ? -25.826 -57.958 -19.498 1.00 98.32  ? 175 ASP B CG  1 
ATOM   2594 O OD1 . ASP B 1 92  ? -25.648 -57.590 -20.681 1.00 97.98  ? 175 ASP B OD1 1 
ATOM   2595 O OD2 . ASP B 1 92  ? -25.488 -59.091 -19.078 1.00 116.29 ? 175 ASP B OD2 1 
ATOM   2596 N N   . ARG B 1 93  ? -28.319 -54.780 -17.412 1.00 75.79  ? 176 ARG B N   1 
ATOM   2597 C CA  . ARG B 1 93  ? -29.237 -54.218 -16.440 1.00 74.40  ? 176 ARG B CA  1 
ATOM   2598 C C   . ARG B 1 93  ? -30.564 -53.930 -17.116 1.00 74.07  ? 176 ARG B C   1 
ATOM   2599 O O   . ARG B 1 93  ? -31.607 -54.154 -16.543 1.00 75.70  ? 176 ARG B O   1 
ATOM   2600 C CB  . ARG B 1 93  ? -28.655 -52.949 -15.822 1.00 70.95  ? 176 ARG B CB  1 
ATOM   2601 C CG  . ARG B 1 93  ? -29.626 -52.155 -14.979 1.00 73.34  ? 176 ARG B CG  1 
ATOM   2602 C CD  . ARG B 1 93  ? -29.150 -50.714 -14.911 1.00 71.35  ? 176 ARG B CD  1 
ATOM   2603 N NE  . ARG B 1 93  ? -30.102 -49.827 -14.248 1.00 69.38  ? 176 ARG B NE  1 
ATOM   2604 C CZ  . ARG B 1 93  ? -29.872 -48.548 -13.960 1.00 67.32  ? 176 ARG B CZ  1 
ATOM   2605 N NH1 . ARG B 1 93  ? -28.719 -47.963 -14.262 1.00 63.81  ? 176 ARG B NH1 1 
ATOM   2606 N NH2 . ARG B 1 93  ? -30.802 -47.847 -13.351 1.00 68.42  ? 176 ARG B NH2 1 
ATOM   2607 N N   . PHE B 1 94  ? -30.516 -53.469 -18.356 1.00 72.43  ? 177 PHE B N   1 
ATOM   2608 C CA  . PHE B 1 94  ? -31.743 -53.206 -19.068 1.00 73.87  ? 177 PHE B CA  1 
ATOM   2609 C C   . PHE B 1 94  ? -32.200 -54.358 -19.979 1.00 78.15  ? 177 PHE B C   1 
ATOM   2610 O O   . PHE B 1 94  ? -33.120 -54.205 -20.755 1.00 81.08  ? 177 PHE B O   1 
ATOM   2611 C CB  . PHE B 1 94  ? -31.645 -51.877 -19.840 1.00 71.95  ? 177 PHE B CB  1 
ATOM   2612 C CG  . PHE B 1 94  ? -31.622 -50.648 -18.957 1.00 69.10  ? 177 PHE B CG  1 
ATOM   2613 C CD1 . PHE B 1 94  ? -30.453 -49.901 -18.811 1.00 62.87  ? 177 PHE B CD1 1 
ATOM   2614 C CD2 . PHE B 1 94  ? -32.784 -50.229 -18.263 1.00 70.88  ? 177 PHE B CD2 1 
ATOM   2615 C CE1 . PHE B 1 94  ? -30.440 -48.771 -17.989 1.00 64.21  ? 177 PHE B CE1 1 
ATOM   2616 C CE2 . PHE B 1 94  ? -32.778 -49.104 -17.434 1.00 65.46  ? 177 PHE B CE2 1 
ATOM   2617 C CZ  . PHE B 1 94  ? -31.599 -48.380 -17.294 1.00 66.64  ? 177 PHE B CZ  1 
ATOM   2618 N N   . ASN B 1 95  ? -31.586 -55.523 -19.887 1.00 83.89  ? 178 ASN B N   1 
ATOM   2619 C CA  . ASN B 1 95  ? -32.012 -56.641 -20.731 1.00 89.07  ? 178 ASN B CA  1 
ATOM   2620 C C   . ASN B 1 95  ? -32.148 -56.371 -22.244 1.00 88.14  ? 178 ASN B C   1 
ATOM   2621 O O   . ASN B 1 95  ? -33.187 -56.692 -22.812 1.00 91.91  ? 178 ASN B O   1 
ATOM   2622 C CB  . ASN B 1 95  ? -33.340 -57.189 -20.212 1.00 93.79  ? 178 ASN B CB  1 
ATOM   2623 C CG  . ASN B 1 95  ? -33.184 -57.950 -18.915 1.00 100.76 ? 178 ASN B CG  1 
ATOM   2624 O OD1 . ASN B 1 95  ? -32.324 -58.831 -18.791 1.00 99.21  ? 178 ASN B OD1 1 
ATOM   2625 N ND2 . ASN B 1 95  ? -34.021 -57.617 -17.934 1.00 102.01 ? 178 ASN B ND2 1 
ATOM   2626 N N   . VAL B 1 96  ? -31.126 -55.785 -22.883 1.00 85.55  ? 179 VAL B N   1 
ATOM   2627 C CA  . VAL B 1 96  ? -31.090 -55.625 -24.369 1.00 86.38  ? 179 VAL B CA  1 
ATOM   2628 C C   . VAL B 1 96  ? -29.735 -56.058 -24.978 1.00 80.88  ? 179 VAL B C   1 
ATOM   2629 O O   . VAL B 1 96  ? -28.682 -55.963 -24.310 1.00 75.65  ? 179 VAL B O   1 
ATOM   2630 C CB  . VAL B 1 96  ? -31.444 -54.177 -24.831 1.00 93.17  ? 179 VAL B CB  1 
ATOM   2631 C CG1 . VAL B 1 96  ? -31.487 -54.084 -26.362 1.00 98.85  ? 179 VAL B CG1 1 
ATOM   2632 C CG2 . VAL B 1 96  ? -32.776 -53.711 -24.250 1.00 82.99  ? 179 VAL B CG2 1 
ATOM   2633 N N   . ASP B 1 97  ? -29.747 -56.526 -26.232 1.00 77.45  ? 180 ASP B N   1 
ATOM   2634 C CA  . ASP B 1 97  ? -28.505 -57.032 -26.811 1.00 82.11  ? 180 ASP B CA  1 
ATOM   2635 C C   . ASP B 1 97  ? -27.426 -55.942 -26.942 1.00 90.60  ? 180 ASP B C   1 
ATOM   2636 O O   . ASP B 1 97  ? -27.703 -54.810 -27.373 1.00 92.71  ? 180 ASP B O   1 
ATOM   2637 C CB  . ASP B 1 97  ? -28.705 -57.786 -28.120 1.00 78.89  ? 180 ASP B CB  1 
ATOM   2638 C CG  . ASP B 1 97  ? -27.709 -58.960 -28.256 1.00 93.23  ? 180 ASP B CG  1 
ATOM   2639 O OD1 . ASP B 1 97  ? -26.484 -58.716 -28.473 1.00 85.30  ? 180 ASP B OD1 1 
ATOM   2640 O OD2 . ASP B 1 97  ? -28.149 -60.141 -28.123 1.00 98.69  ? 180 ASP B OD2 1 
ATOM   2641 N N   . HIS B 1 98  ? -26.201 -56.291 -26.542 1.00 94.07  ? 181 HIS B N   1 
ATOM   2642 C CA  . HIS B 1 98  ? -25.100 -55.337 -26.491 1.00 87.67  ? 181 HIS B CA  1 
ATOM   2643 C C   . HIS B 1 98  ? -24.724 -54.935 -27.868 1.00 84.69  ? 181 HIS B C   1 
ATOM   2644 O O   . HIS B 1 98  ? -24.426 -53.774 -28.119 1.00 87.42  ? 181 HIS B O   1 
ATOM   2645 C CB  . HIS B 1 98  ? -23.907 -55.924 -25.777 1.00 92.98  ? 181 HIS B CB  1 
ATOM   2646 C CG  . HIS B 1 98  ? -24.201 -57.221 -25.080 1.00 113.09 ? 181 HIS B CG  1 
ATOM   2647 N ND1 . HIS B 1 98  ? -24.883 -57.283 -23.920 1.00 116.42 ? 181 HIS B ND1 1 
ATOM   2648 C CD2 . HIS B 1 98  ? -23.883 -58.540 -25.427 1.00 122.35 ? 181 HIS B CD2 1 
ATOM   2649 C CE1 . HIS B 1 98  ? -25.002 -58.575 -23.541 1.00 128.34 ? 181 HIS B CE1 1 
ATOM   2650 N NE2 . HIS B 1 98  ? -24.386 -59.341 -24.462 1.00 129.53 ? 181 HIS B NE2 1 
ATOM   2651 N N   . ASP B 1 99  ? -24.736 -55.903 -28.775 1.00 89.35  ? 182 ASP B N   1 
ATOM   2652 C CA  . ASP B 1 99  ? -24.512 -55.647 -30.187 1.00 84.99  ? 182 ASP B CA  1 
ATOM   2653 C C   . ASP B 1 99  ? -25.394 -54.479 -30.601 1.00 76.42  ? 182 ASP B C   1 
ATOM   2654 O O   . ASP B 1 99  ? -24.880 -53.401 -30.822 1.00 77.73  ? 182 ASP B O   1 
ATOM   2655 C CB  . ASP B 1 99  ? -24.742 -56.915 -31.045 1.00 97.06  ? 182 ASP B CB  1 
ATOM   2656 C CG  . ASP B 1 99  ? -23.581 -57.936 -30.928 1.00 106.54 ? 182 ASP B CG  1 
ATOM   2657 O OD1 . ASP B 1 99  ? -23.836 -59.170 -31.039 1.00 111.87 ? 182 ASP B OD1 1 
ATOM   2658 O OD2 . ASP B 1 99  ? -22.417 -57.496 -30.718 1.00 89.13  ? 182 ASP B OD2 1 
ATOM   2659 N N   . ALA B 1 100 ? -26.708 -54.667 -30.635 1.00 69.24  ? 183 ALA B N   1 
ATOM   2660 C CA  . ALA B 1 100 ? -27.643 -53.626 -31.089 1.00 67.10  ? 183 ALA B CA  1 
ATOM   2661 C C   . ALA B 1 100 ? -27.473 -52.238 -30.443 1.00 65.21  ? 183 ALA B C   1 
ATOM   2662 O O   . ALA B 1 100 ? -27.727 -51.203 -31.099 1.00 64.50  ? 183 ALA B O   1 
ATOM   2663 C CB  . ALA B 1 100 ? -29.083 -54.093 -30.914 1.00 71.09  ? 183 ALA B CB  1 
ATOM   2664 N N   . VAL B 1 101 ? -27.074 -52.220 -29.167 1.00 59.68  ? 184 VAL B N   1 
ATOM   2665 C CA  . VAL B 1 101 ? -26.862 -50.976 -28.426 1.00 55.17  ? 184 VAL B CA  1 
ATOM   2666 C C   . VAL B 1 101 ? -25.687 -50.220 -29.046 1.00 54.40  ? 184 VAL B C   1 
ATOM   2667 O O   . VAL B 1 101 ? -25.763 -49.025 -29.339 1.00 49.79  ? 184 VAL B O   1 
ATOM   2668 C CB  . VAL B 1 101 ? -26.509 -51.244 -26.943 1.00 53.59  ? 184 VAL B CB  1 
ATOM   2669 C CG1 . VAL B 1 101 ? -25.809 -50.031 -26.297 1.00 46.32  ? 184 VAL B CG1 1 
ATOM   2670 C CG2 . VAL B 1 101 ? -27.743 -51.666 -26.173 1.00 55.61  ? 184 VAL B CG2 1 
ATOM   2671 N N   . LEU B 1 102 ? -24.598 -50.953 -29.215 1.00 51.56  ? 185 LEU B N   1 
ATOM   2672 C CA  . LEU B 1 102 ? -23.361 -50.427 -29.685 1.00 49.76  ? 185 LEU B CA  1 
ATOM   2673 C C   . LEU B 1 102 ? -23.478 -49.955 -31.154 1.00 51.09  ? 185 LEU B C   1 
ATOM   2674 O O   . LEU B 1 102 ? -22.748 -49.059 -31.611 1.00 50.52  ? 185 LEU B O   1 
ATOM   2675 C CB  . LEU B 1 102 ? -22.341 -51.538 -29.504 1.00 51.35  ? 185 LEU B CB  1 
ATOM   2676 C CG  . LEU B 1 102 ? -21.225 -51.433 -28.438 1.00 51.51  ? 185 LEU B CG  1 
ATOM   2677 C CD1 . LEU B 1 102 ? -21.530 -50.604 -27.192 1.00 52.42  ? 185 LEU B CD1 1 
ATOM   2678 C CD2 . LEU B 1 102 ? -20.745 -52.805 -28.073 1.00 49.45  ? 185 LEU B CD2 1 
ATOM   2679 N N   . ASP B 1 103 ? -24.437 -50.538 -31.865 1.00 50.78  ? 186 ASP B N   1 
ATOM   2680 C CA  . ASP B 1 103 ? -24.813 -50.083 -33.183 1.00 53.48  ? 186 ASP B CA  1 
ATOM   2681 C C   . ASP B 1 103 ? -25.564 -48.757 -33.242 1.00 51.06  ? 186 ASP B C   1 
ATOM   2682 O O   . ASP B 1 103 ? -25.525 -48.062 -34.247 1.00 50.04  ? 186 ASP B O   1 
ATOM   2683 C CB  . ASP B 1 103 ? -25.683 -51.124 -33.839 1.00 63.71  ? 186 ASP B CB  1 
ATOM   2684 C CG  . ASP B 1 103 ? -24.938 -51.906 -34.858 1.00 76.44  ? 186 ASP B CG  1 
ATOM   2685 O OD1 . ASP B 1 103 ? -24.949 -51.419 -36.021 1.00 82.78  ? 186 ASP B OD1 1 
ATOM   2686 O OD2 . ASP B 1 103 ? -24.314 -52.950 -34.486 1.00 76.23  ? 186 ASP B OD2 1 
ATOM   2687 N N   . ASN B 1 104 ? -26.285 -48.419 -32.193 1.00 44.87  ? 187 ASN B N   1 
ATOM   2688 C CA  . ASN B 1 104 ? -27.120 -47.269 -32.278 1.00 44.97  ? 187 ASN B CA  1 
ATOM   2689 C C   . ASN B 1 104 ? -26.476 -45.999 -31.705 1.00 43.18  ? 187 ASN B C   1 
ATOM   2690 O O   . ASN B 1 104 ? -27.171 -45.013 -31.460 1.00 45.01  ? 187 ASN B O   1 
ATOM   2691 C CB  . ASN B 1 104 ? -28.519 -47.573 -31.715 1.00 49.94  ? 187 ASN B CB  1 
ATOM   2692 C CG  . ASN B 1 104 ? -29.229 -48.689 -32.492 1.00 57.41  ? 187 ASN B CG  1 
ATOM   2693 O OD1 . ASN B 1 104 ? -29.191 -48.740 -33.724 1.00 57.89  ? 187 ASN B OD1 1 
ATOM   2694 N ND2 . ASN B 1 104 ? -29.854 -49.604 -31.765 1.00 61.05  ? 187 ASN B ND2 1 
ATOM   2695 N N   . VAL B 1 105 ? -25.149 -46.003 -31.578 1.00 37.99  ? 188 VAL B N   1 
ATOM   2696 C CA  . VAL B 1 105 ? -24.417 -44.876 -31.024 1.00 36.81  ? 188 VAL B CA  1 
ATOM   2697 C C   . VAL B 1 105 ? -23.279 -44.508 -31.962 1.00 42.40  ? 188 VAL B C   1 
ATOM   2698 O O   . VAL B 1 105 ? -22.417 -45.374 -32.283 1.00 39.53  ? 188 VAL B O   1 
ATOM   2699 C CB  . VAL B 1 105 ? -23.713 -45.257 -29.721 1.00 35.30  ? 188 VAL B CB  1 
ATOM   2700 C CG1 . VAL B 1 105 ? -22.867 -44.107 -29.218 1.00 32.71  ? 188 VAL B CG1 1 
ATOM   2701 C CG2 . VAL B 1 105 ? -24.692 -45.717 -28.679 1.00 33.36  ? 188 VAL B CG2 1 
ATOM   2702 N N   . LEU B 1 106 ? -23.264 -43.248 -32.406 1.00 43.01  ? 189 LEU B N   1 
ATOM   2703 C CA  . LEU B 1 106 ? -22.209 -42.752 -33.298 1.00 40.92  ? 189 LEU B CA  1 
ATOM   2704 C C   . LEU B 1 106 ? -21.191 -41.972 -32.488 1.00 43.69  ? 189 LEU B C   1 
ATOM   2705 O O   . LEU B 1 106 ? -21.553 -41.114 -31.676 1.00 46.00  ? 189 LEU B O   1 
ATOM   2706 C CB  . LEU B 1 106 ? -22.760 -41.843 -34.362 1.00 41.35  ? 189 LEU B CB  1 
ATOM   2707 C CG  . LEU B 1 106 ? -23.067 -42.314 -35.749 1.00 47.22  ? 189 LEU B CG  1 
ATOM   2708 C CD1 . LEU B 1 106 ? -22.215 -43.533 -36.076 1.00 50.35  ? 189 LEU B CD1 1 
ATOM   2709 C CD2 . LEU B 1 106 ? -24.530 -42.651 -35.794 1.00 49.54  ? 189 LEU B CD2 1 
ATOM   2710 N N   . TYR B 1 107 ? -19.919 -42.238 -32.764 1.00 42.43  ? 190 TYR B N   1 
ATOM   2711 C CA  . TYR B 1 107 ? -18.839 -41.852 -31.890 1.00 40.36  ? 190 TYR B CA  1 
ATOM   2712 C C   . TYR B 1 107 ? -17.787 -41.118 -32.699 1.00 44.39  ? 190 TYR B C   1 
ATOM   2713 O O   . TYR B 1 107 ? -17.440 -41.556 -33.834 1.00 43.90  ? 190 TYR B O   1 
ATOM   2714 C CB  . TYR B 1 107 ? -18.161 -43.090 -31.300 1.00 40.76  ? 190 TYR B CB  1 
ATOM   2715 C CG  . TYR B 1 107 ? -17.032 -42.722 -30.377 1.00 40.13  ? 190 TYR B CG  1 
ATOM   2716 C CD1 . TYR B 1 107 ? -17.289 -42.026 -29.221 1.00 39.82  ? 190 TYR B CD1 1 
ATOM   2717 C CD2 . TYR B 1 107 ? -15.729 -42.999 -30.694 1.00 39.87  ? 190 TYR B CD2 1 
ATOM   2718 C CE1 . TYR B 1 107 ? -16.298 -41.670 -28.366 1.00 41.07  ? 190 TYR B CE1 1 
ATOM   2719 C CE2 . TYR B 1 107 ? -14.695 -42.616 -29.861 1.00 38.40  ? 190 TYR B CE2 1 
ATOM   2720 C CZ  . TYR B 1 107 ? -14.996 -41.961 -28.688 1.00 44.56  ? 190 TYR B CZ  1 
ATOM   2721 O OH  . TYR B 1 107 ? -14.021 -41.554 -27.809 1.00 46.60  ? 190 TYR B OH  1 
ATOM   2722 N N   . ALA B 1 108 ? -17.254 -40.044 -32.105 1.00 37.46  ? 191 ALA B N   1 
ATOM   2723 C CA  . ALA B 1 108 ? -16.080 -39.350 -32.664 1.00 36.48  ? 191 ALA B CA  1 
ATOM   2724 C C   . ALA B 1 108 ? -15.339 -38.685 -31.535 1.00 36.66  ? 191 ALA B C   1 
ATOM   2725 O O   . ALA B 1 108 ? -15.966 -38.170 -30.560 1.00 38.37  ? 191 ALA B O   1 
ATOM   2726 C CB  . ALA B 1 108 ? -16.472 -38.307 -33.698 1.00 29.42  ? 191 ALA B CB  1 
ATOM   2727 N N   . ARG B 1 109 ? -14.022 -38.711 -31.668 1.00 33.26  ? 192 ARG B N   1 
ATOM   2728 C CA  . ARG B 1 109 ? -13.133 -38.038 -30.756 1.00 36.10  ? 192 ARG B CA  1 
ATOM   2729 C C   . ARG B 1 109 ? -13.025 -36.664 -31.335 1.00 36.69  ? 192 ARG B C   1 
ATOM   2730 O O   . ARG B 1 109 ? -13.036 -36.542 -32.523 1.00 39.34  ? 192 ARG B O   1 
ATOM   2731 C CB  . ARG B 1 109 ? -11.739 -38.708 -30.744 1.00 35.43  ? 192 ARG B CB  1 
ATOM   2732 C CG  . ARG B 1 109 ? -11.649 -39.938 -29.839 1.00 34.14  ? 192 ARG B CG  1 
ATOM   2733 C CD  . ARG B 1 109 ? -11.395 -39.553 -28.363 1.00 34.76  ? 192 ARG B CD  1 
ATOM   2734 N NE  . ARG B 1 109 ? -10.037 -39.085 -28.055 1.00 36.10  ? 192 ARG B NE  1 
ATOM   2735 C CZ  . ARG B 1 109 ? -9.765  -37.871 -27.556 1.00 40.53  ? 192 ARG B CZ  1 
ATOM   2736 N NH1 . ARG B 1 109 ? -10.744 -37.024 -27.335 1.00 47.62  ? 192 ARG B NH1 1 
ATOM   2737 N NH2 . ARG B 1 109 ? -8.541  -37.482 -27.258 1.00 38.23  ? 192 ARG B NH2 1 
ATOM   2738 N N   . ALA B 1 110 ? -12.914 -35.638 -30.503 1.00 41.39  ? 193 ALA B N   1 
ATOM   2739 C CA  . ALA B 1 110 ? -12.518 -34.286 -30.949 1.00 40.51  ? 193 ALA B CA  1 
ATOM   2740 C C   . ALA B 1 110 ? -11.160 -33.970 -30.354 1.00 41.68  ? 193 ALA B C   1 
ATOM   2741 O O   . ALA B 1 110 ? -10.961 -34.160 -29.144 1.00 45.07  ? 193 ALA B O   1 
ATOM   2742 C CB  . ALA B 1 110 ? -13.527 -33.275 -30.448 1.00 39.33  ? 193 ALA B CB  1 
ATOM   2743 N N   . TYR B 1 111 ? -10.231 -33.498 -31.174 1.00 41.30  ? 194 TYR B N   1 
ATOM   2744 C CA  . TYR B 1 111 ? -8.846  -33.186 -30.728 1.00 42.22  ? 194 TYR B CA  1 
ATOM   2745 C C   . TYR B 1 111 ? -8.500  -31.676 -30.642 1.00 44.91  ? 194 TYR B C   1 
ATOM   2746 O O   . TYR B 1 111 ? -7.461  -31.318 -30.095 1.00 50.48  ? 194 TYR B O   1 
ATOM   2747 C CB  . TYR B 1 111 ? -7.822  -33.854 -31.635 1.00 39.97  ? 194 TYR B CB  1 
ATOM   2748 C CG  . TYR B 1 111 ? -7.987  -35.334 -31.709 1.00 40.99  ? 194 TYR B CG  1 
ATOM   2749 C CD1 . TYR B 1 111 ? -8.605  -35.936 -32.829 1.00 40.18  ? 194 TYR B CD1 1 
ATOM   2750 C CD2 . TYR B 1 111 ? -7.514  -36.166 -30.682 1.00 39.11  ? 194 TYR B CD2 1 
ATOM   2751 C CE1 . TYR B 1 111 ? -8.783  -37.314 -32.906 1.00 37.71  ? 194 TYR B CE1 1 
ATOM   2752 C CE2 . TYR B 1 111 ? -7.679  -37.558 -30.765 1.00 41.36  ? 194 TYR B CE2 1 
ATOM   2753 C CZ  . TYR B 1 111 ? -8.328  -38.118 -31.876 1.00 43.60  ? 194 TYR B CZ  1 
ATOM   2754 O OH  . TYR B 1 111 ? -8.517  -39.500 -31.945 1.00 46.71  ? 194 TYR B OH  1 
ATOM   2755 N N   . THR B 1 112 ? -9.333  -30.816 -31.210 1.00 42.80  ? 195 THR B N   1 
ATOM   2756 C CA  . THR B 1 112 ? -9.148  -29.353 -31.141 1.00 46.29  ? 195 THR B CA  1 
ATOM   2757 C C   . THR B 1 112 ? -10.528 -28.719 -31.063 1.00 44.79  ? 195 THR B C   1 
ATOM   2758 O O   . THR B 1 112 ? -11.511 -29.358 -31.435 1.00 43.20  ? 195 THR B O   1 
ATOM   2759 C CB  . THR B 1 112 ? -8.365  -28.736 -32.367 1.00 48.30  ? 195 THR B CB  1 
ATOM   2760 O OG1 . THR B 1 112 ? -9.227  -28.637 -33.509 1.00 52.53  ? 195 THR B OG1 1 
ATOM   2761 C CG2 . THR B 1 112 ? -7.106  -29.522 -32.755 1.00 41.10  ? 195 THR B CG2 1 
ATOM   2762 N N   . SER B 1 113 ? -10.587 -27.516 -30.496 1.00 48.03  ? 196 SER B N   1 
ATOM   2763 C CA  . SER B 1 113 ? -11.685 -26.555 -30.629 1.00 46.29  ? 196 SER B CA  1 
ATOM   2764 C C   . SER B 1 113 ? -12.330 -26.641 -31.966 1.00 47.31  ? 196 SER B C   1 
ATOM   2765 O O   . SER B 1 113 ? -13.514 -26.880 -32.091 1.00 43.42  ? 196 SER B O   1 
ATOM   2766 C CB  . SER B 1 113 ? -11.084 -25.156 -30.664 1.00 51.72  ? 196 SER B CB  1 
ATOM   2767 O OG  . SER B 1 113 ? -11.198 -24.532 -29.433 1.00 63.01  ? 196 SER B OG  1 
ATOM   2768 N N   . GLU B 1 114 ? -11.536 -26.357 -32.994 1.00 52.44  ? 197 GLU B N   1 
ATOM   2769 C CA  . GLU B 1 114 ? -12.092 -26.250 -34.311 1.00 54.65  ? 197 GLU B CA  1 
ATOM   2770 C C   . GLU B 1 114 ? -12.691 -27.590 -34.709 1.00 52.56  ? 197 GLU B C   1 
ATOM   2771 O O   . GLU B 1 114 ? -13.823 -27.663 -35.202 1.00 55.58  ? 197 GLU B O   1 
ATOM   2772 C CB  . GLU B 1 114 ? -11.040 -25.770 -35.278 1.00 60.95  ? 197 GLU B CB  1 
ATOM   2773 C CG  . GLU B 1 114 ? -10.890 -24.266 -35.211 1.00 82.83  ? 197 GLU B CG  1 
ATOM   2774 C CD  . GLU B 1 114 ? -10.517 -23.659 -36.557 1.00 98.25  ? 197 GLU B CD  1 
ATOM   2775 O OE1 . GLU B 1 114 ? -9.734  -24.322 -37.298 1.00 99.82  ? 197 GLU B OE1 1 
ATOM   2776 O OE2 . GLU B 1 114 ? -11.006 -22.531 -36.862 1.00 92.20  ? 197 GLU B OE2 1 
ATOM   2777 N N   . HIS B 1 115 ? -11.938 -28.650 -34.436 1.00 45.37  ? 198 HIS B N   1 
ATOM   2778 C CA  . HIS B 1 115 ? -12.339 -29.945 -34.806 1.00 42.56  ? 198 HIS B CA  1 
ATOM   2779 C C   . HIS B 1 115 ? -13.724 -30.141 -34.239 1.00 43.38  ? 198 HIS B C   1 
ATOM   2780 O O   . HIS B 1 115 ? -14.623 -30.622 -34.925 1.00 43.04  ? 198 HIS B O   1 
ATOM   2781 C CB  . HIS B 1 115 ? -11.305 -30.942 -34.298 1.00 41.92  ? 198 HIS B CB  1 
ATOM   2782 C CG  . HIS B 1 115 ? -11.557 -32.372 -34.725 1.00 43.88  ? 198 HIS B CG  1 
ATOM   2783 N ND1 . HIS B 1 115 ? -12.115 -32.697 -35.930 1.00 43.96  ? 198 HIS B ND1 1 
ATOM   2784 C CD2 . HIS B 1 115 ? -11.276 -33.596 -34.076 1.00 41.63  ? 198 HIS B CD2 1 
ATOM   2785 C CE1 . HIS B 1 115 ? -12.169 -34.059 -36.054 1.00 41.21  ? 198 HIS B CE1 1 
ATOM   2786 N NE2 . HIS B 1 115 ? -11.665 -34.603 -34.917 1.00 41.61  ? 198 HIS B NE2 1 
ATOM   2787 N N   . GLN B 1 116 ? -13.917 -29.695 -32.999 1.00 42.25  ? 199 GLN B N   1 
ATOM   2788 C CA  . GLN B 1 116 ? -15.113 -29.979 -32.260 1.00 41.14  ? 199 GLN B CA  1 
ATOM   2789 C C   . GLN B 1 116 ? -16.229 -29.253 -32.999 1.00 44.48  ? 199 GLN B C   1 
ATOM   2790 O O   . GLN B 1 116 ? -17.280 -29.812 -33.230 1.00 50.60  ? 199 GLN B O   1 
ATOM   2791 C CB  . GLN B 1 116 ? -14.981 -29.527 -30.786 1.00 38.89  ? 199 GLN B CB  1 
ATOM   2792 C CG  . GLN B 1 116 ? -16.194 -29.822 -29.891 1.00 40.66  ? 199 GLN B CG  1 
ATOM   2793 C CD  . GLN B 1 116 ? -16.100 -29.219 -28.462 1.00 45.85  ? 199 GLN B CD  1 
ATOM   2794 O OE1 . GLN B 1 116 ? -17.118 -28.789 -27.881 1.00 45.63  ? 199 GLN B OE1 1 
ATOM   2795 N NE2 . GLN B 1 116 ? -14.889 -29.161 -27.906 1.00 43.09  ? 199 GLN B NE2 1 
ATOM   2796 N N   . MET B 1 117 ? -15.991 -28.022 -33.402 1.00 47.12  ? 200 MET B N   1 
ATOM   2797 C CA  . MET B 1 117 ? -16.978 -27.286 -34.172 1.00 50.78  ? 200 MET B CA  1 
ATOM   2798 C C   . MET B 1 117 ? -17.256 -27.961 -35.541 1.00 52.03  ? 200 MET B C   1 
ATOM   2799 O O   . MET B 1 117 ? -18.421 -28.027 -35.948 1.00 53.79  ? 200 MET B O   1 
ATOM   2800 C CB  . MET B 1 117 ? -16.541 -25.816 -34.321 1.00 53.51  ? 200 MET B CB  1 
ATOM   2801 C CG  . MET B 1 117 ? -17.562 -24.848 -34.917 1.00 56.84  ? 200 MET B CG  1 
ATOM   2802 S SD  . MET B 1 117 ? -19.220 -24.919 -34.175 1.00 62.34  ? 200 MET B SD  1 
ATOM   2803 C CE  . MET B 1 117 ? -19.927 -23.322 -34.622 1.00 56.86  ? 200 MET B CE  1 
ATOM   2804 N N   . GLU B 1 118 ? -16.241 -28.502 -36.222 1.00 46.90  ? 201 GLU B N   1 
ATOM   2805 C CA  . GLU B 1 118 ? -16.514 -29.232 -37.474 1.00 50.25  ? 201 GLU B CA  1 
ATOM   2806 C C   . GLU B 1 118 ? -17.391 -30.448 -37.307 1.00 50.66  ? 201 GLU B C   1 
ATOM   2807 O O   . GLU B 1 118 ? -18.259 -30.721 -38.135 1.00 55.22  ? 201 GLU B O   1 
ATOM   2808 C CB  . GLU B 1 118 ? -15.251 -29.675 -38.159 1.00 51.06  ? 201 GLU B CB  1 
ATOM   2809 C CG  . GLU B 1 118 ? -14.519 -28.505 -38.747 1.00 60.36  ? 201 GLU B CG  1 
ATOM   2810 C CD  . GLU B 1 118 ? -13.167 -28.904 -39.284 1.00 72.45  ? 201 GLU B CD  1 
ATOM   2811 O OE1 . GLU B 1 118 ? -12.702 -28.182 -40.217 1.00 72.53  ? 201 GLU B OE1 1 
ATOM   2812 O OE2 . GLU B 1 118 ? -12.600 -29.930 -38.777 1.00 64.03  ? 201 GLU B OE2 1 
ATOM   2813 N N   . LEU B 1 119 ? -17.178 -31.179 -36.227 1.00 46.70  ? 202 LEU B N   1 
ATOM   2814 C CA  . LEU B 1 119 ? -18.019 -32.308 -35.927 1.00 44.16  ? 202 LEU B CA  1 
ATOM   2815 C C   . LEU B 1 119 ? -19.502 -31.917 -35.781 1.00 42.08  ? 202 LEU B C   1 
ATOM   2816 O O   . LEU B 1 119 ? -20.389 -32.660 -36.240 1.00 40.80  ? 202 LEU B O   1 
ATOM   2817 C CB  . LEU B 1 119 ? -17.491 -33.026 -34.698 1.00 41.61  ? 202 LEU B CB  1 
ATOM   2818 C CG  . LEU B 1 119 ? -16.155 -33.787 -34.912 1.00 42.29  ? 202 LEU B CG  1 
ATOM   2819 C CD1 . LEU B 1 119 ? -15.656 -34.244 -33.541 1.00 37.32  ? 202 LEU B CD1 1 
ATOM   2820 C CD2 . LEU B 1 119 ? -16.219 -34.957 -35.909 1.00 34.55  ? 202 LEU B CD2 1 
ATOM   2821 N N   . LEU B 1 120 ? -19.778 -30.741 -35.220 1.00 39.11  ? 203 LEU B N   1 
ATOM   2822 C CA  . LEU B 1 120 ? -21.167 -30.350 -35.071 1.00 40.82  ? 203 LEU B CA  1 
ATOM   2823 C C   . LEU B 1 120 ? -21.827 -30.108 -36.420 1.00 48.22  ? 203 LEU B C   1 
ATOM   2824 O O   . LEU B 1 120 ? -23.002 -30.477 -36.599 1.00 49.31  ? 203 LEU B O   1 
ATOM   2825 C CB  . LEU B 1 120 ? -21.336 -29.185 -34.135 1.00 43.65  ? 203 LEU B CB  1 
ATOM   2826 C CG  . LEU B 1 120 ? -21.515 -29.431 -32.608 1.00 51.02  ? 203 LEU B CG  1 
ATOM   2827 C CD1 . LEU B 1 120 ? -22.400 -30.624 -32.238 1.00 48.74  ? 203 LEU B CD1 1 
ATOM   2828 C CD2 . LEU B 1 120 ? -20.220 -29.604 -31.851 1.00 48.08  ? 203 LEU B CD2 1 
ATOM   2829 N N   . ASP B 1 121 ? -21.071 -29.592 -37.398 1.00 50.74  ? 204 ASP B N   1 
ATOM   2830 C CA  . ASP B 1 121 ? -21.609 -29.381 -38.774 1.00 59.46  ? 204 ASP B CA  1 
ATOM   2831 C C   . ASP B 1 121 ? -22.050 -30.679 -39.376 1.00 57.76  ? 204 ASP B C   1 
ATOM   2832 O O   . ASP B 1 121 ? -23.109 -30.795 -39.955 1.00 63.12  ? 204 ASP B O   1 
ATOM   2833 C CB  . ASP B 1 121 ? -20.568 -28.779 -39.734 1.00 69.06  ? 204 ASP B CB  1 
ATOM   2834 C CG  . ASP B 1 121 ? -20.228 -27.337 -39.406 1.00 76.75  ? 204 ASP B CG  1 
ATOM   2835 O OD1 . ASP B 1 121 ? -21.019 -26.671 -38.685 1.00 74.06  ? 204 ASP B OD1 1 
ATOM   2836 O OD2 . ASP B 1 121 ? -19.142 -26.895 -39.854 1.00 83.66  ? 204 ASP B OD2 1 
ATOM   2837 N N   . TYR B 1 122 ? -21.205 -31.666 -39.240 1.00 56.32  ? 205 TYR B N   1 
ATOM   2838 C CA  . TYR B 1 122 ? -21.542 -32.978 -39.685 1.00 56.95  ? 205 TYR B CA  1 
ATOM   2839 C C   . TYR B 1 122 ? -22.800 -33.583 -38.984 1.00 55.10  ? 205 TYR B C   1 
ATOM   2840 O O   . TYR B 1 122 ? -23.707 -34.057 -39.656 1.00 59.99  ? 205 TYR B O   1 
ATOM   2841 C CB  . TYR B 1 122 ? -20.317 -33.867 -39.498 1.00 58.77  ? 205 TYR B CB  1 
ATOM   2842 C CG  . TYR B 1 122 ? -20.546 -35.211 -40.063 1.00 66.51  ? 205 TYR B CG  1 
ATOM   2843 C CD1 . TYR B 1 122 ? -20.767 -36.298 -39.223 1.00 65.25  ? 205 TYR B CD1 1 
ATOM   2844 C CD2 . TYR B 1 122 ? -20.600 -35.406 -41.455 1.00 73.62  ? 205 TYR B CD2 1 
ATOM   2845 C CE1 . TYR B 1 122 ? -21.007 -37.561 -39.738 1.00 69.72  ? 205 TYR B CE1 1 
ATOM   2846 C CE2 . TYR B 1 122 ? -20.848 -36.667 -41.978 1.00 78.52  ? 205 TYR B CE2 1 
ATOM   2847 C CZ  . TYR B 1 122 ? -21.040 -37.731 -41.106 1.00 72.93  ? 205 TYR B CZ  1 
ATOM   2848 O OH  . TYR B 1 122 ? -21.272 -38.976 -41.587 1.00 82.49  ? 205 TYR B OH  1 
ATOM   2849 N N   . VAL B 1 123 ? -22.817 -33.596 -37.649 1.00 45.46  ? 206 VAL B N   1 
ATOM   2850 C CA  . VAL B 1 123 ? -23.978 -33.987 -36.875 1.00 42.62  ? 206 VAL B CA  1 
ATOM   2851 C C   . VAL B 1 123 ? -25.262 -33.216 -37.260 1.00 45.29  ? 206 VAL B C   1 
ATOM   2852 O O   . VAL B 1 123 ? -26.328 -33.836 -37.418 1.00 45.16  ? 206 VAL B O   1 
ATOM   2853 C CB  . VAL B 1 123 ? -23.699 -33.747 -35.392 1.00 38.25  ? 206 VAL B CB  1 
ATOM   2854 C CG1 . VAL B 1 123 ? -24.971 -33.767 -34.533 1.00 32.51  ? 206 VAL B CG1 1 
ATOM   2855 C CG2 . VAL B 1 123 ? -22.657 -34.704 -34.941 1.00 35.62  ? 206 VAL B CG2 1 
ATOM   2856 N N   . ALA B 1 124 ? -25.192 -31.892 -37.407 1.00 40.91  ? 207 ALA B N   1 
ATOM   2857 C CA  . ALA B 1 124 ? -26.410 -31.194 -37.884 1.00 48.33  ? 207 ALA B CA  1 
ATOM   2858 C C   . ALA B 1 124 ? -26.874 -31.813 -39.212 1.00 55.55  ? 207 ALA B C   1 
ATOM   2859 O O   . ALA B 1 124 ? -28.009 -32.302 -39.320 1.00 62.71  ? 207 ALA B O   1 
ATOM   2860 C CB  . ALA B 1 124 ? -26.239 -29.676 -37.998 1.00 38.45  ? 207 ALA B CB  1 
ATOM   2861 N N   . ALA B 1 125 ? -25.964 -31.844 -40.188 1.00 62.01  ? 208 ALA B N   1 
ATOM   2862 C CA  . ALA B 1 125 ? -26.226 -32.376 -41.520 1.00 65.73  ? 208 ALA B CA  1 
ATOM   2863 C C   . ALA B 1 125 ? -26.807 -33.795 -41.455 1.00 64.77  ? 208 ALA B C   1 
ATOM   2864 O O   . ALA B 1 125 ? -27.731 -34.145 -42.196 1.00 64.81  ? 208 ALA B O   1 
ATOM   2865 C CB  . ALA B 1 125 ? -24.948 -32.343 -42.341 1.00 67.08  ? 208 ALA B CB  1 
ATOM   2866 N N   . LYS B 1 126 ? -26.292 -34.591 -40.533 1.00 56.14  ? 209 LYS B N   1 
ATOM   2867 C CA  . LYS B 1 126 ? -26.743 -35.939 -40.418 1.00 56.79  ? 209 LYS B CA  1 
ATOM   2868 C C   . LYS B 1 126 ? -28.169 -35.960 -39.840 1.00 62.47  ? 209 LYS B C   1 
ATOM   2869 O O   . LYS B 1 126 ? -29.045 -36.555 -40.445 1.00 66.98  ? 209 LYS B O   1 
ATOM   2870 C CB  . LYS B 1 126 ? -25.712 -36.747 -39.644 1.00 54.93  ? 209 LYS B CB  1 
ATOM   2871 C CG  . LYS B 1 126 ? -26.246 -37.861 -38.771 1.00 57.45  ? 209 LYS B CG  1 
ATOM   2872 C CD  . LYS B 1 126 ? -26.355 -39.156 -39.533 1.00 55.98  ? 209 LYS B CD  1 
ATOM   2873 C CE  . LYS B 1 126 ? -25.001 -39.815 -39.698 1.00 51.91  ? 209 LYS B CE  1 
ATOM   2874 N NZ  . LYS B 1 126 ? -25.237 -40.983 -40.601 1.00 54.20  ? 209 LYS B NZ  1 
ATOM   2875 N N   . PHE B 1 127 ? -28.436 -35.280 -38.720 1.00 63.08  ? 210 PHE B N   1 
ATOM   2876 C CA  . PHE B 1 127 ? -29.846 -35.130 -38.266 1.00 60.69  ? 210 PHE B CA  1 
ATOM   2877 C C   . PHE B 1 127 ? -30.792 -34.679 -39.423 1.00 63.92  ? 210 PHE B C   1 
ATOM   2878 O O   . PHE B 1 127 ? -31.896 -35.205 -39.578 1.00 60.96  ? 210 PHE B O   1 
ATOM   2879 C CB  . PHE B 1 127 ? -29.993 -34.166 -37.084 1.00 53.22  ? 210 PHE B CB  1 
ATOM   2880 C CG  . PHE B 1 127 ? -29.304 -34.602 -35.809 1.00 46.52  ? 210 PHE B CG  1 
ATOM   2881 C CD1 . PHE B 1 127 ? -28.864 -35.910 -35.616 1.00 44.38  ? 210 PHE B CD1 1 
ATOM   2882 C CD2 . PHE B 1 127 ? -29.143 -33.688 -34.771 1.00 39.20  ? 210 PHE B CD2 1 
ATOM   2883 C CE1 . PHE B 1 127 ? -28.261 -36.276 -34.408 1.00 47.61  ? 210 PHE B CE1 1 
ATOM   2884 C CE2 . PHE B 1 127 ? -28.556 -34.051 -33.554 1.00 40.48  ? 210 PHE B CE2 1 
ATOM   2885 C CZ  . PHE B 1 127 ? -28.109 -35.340 -33.358 1.00 44.34  ? 210 PHE B CZ  1 
ATOM   2886 N N   . HIS B 1 128 ? -30.350 -33.731 -40.247 1.00 64.65  ? 211 HIS B N   1 
ATOM   2887 C CA  . HIS B 1 128 ? -31.195 -33.220 -41.352 1.00 71.60  ? 211 HIS B CA  1 
ATOM   2888 C C   . HIS B 1 128 ? -31.583 -34.286 -42.323 1.00 75.82  ? 211 HIS B C   1 
ATOM   2889 O O   . HIS B 1 128 ? -32.690 -34.308 -42.827 1.00 77.50  ? 211 HIS B O   1 
ATOM   2890 C CB  . HIS B 1 128 ? -30.483 -32.139 -42.131 1.00 68.29  ? 211 HIS B CB  1 
ATOM   2891 C CG  . HIS B 1 128 ? -31.411 -31.194 -42.820 1.00 72.61  ? 211 HIS B CG  1 
ATOM   2892 N ND1 . HIS B 1 128 ? -31.561 -29.903 -42.424 1.00 75.86  ? 211 HIS B ND1 1 
ATOM   2893 C CD2 . HIS B 1 128 ? -32.266 -31.379 -43.899 1.00 72.76  ? 211 HIS B CD2 1 
ATOM   2894 C CE1 . HIS B 1 128 ? -32.468 -29.300 -43.201 1.00 71.36  ? 211 HIS B CE1 1 
ATOM   2895 N NE2 . HIS B 1 128 ? -32.894 -30.204 -44.115 1.00 77.70  ? 211 HIS B NE2 1 
ATOM   2896 N N   . GLU B 1 129 ? -30.656 -35.194 -42.560 1.00 82.12  ? 212 GLU B N   1 
ATOM   2897 C CA  . GLU B 1 129 ? -30.735 -36.117 -43.650 1.00 87.26  ? 212 GLU B CA  1 
ATOM   2898 C C   . GLU B 1 129 ? -31.860 -37.113 -43.488 1.00 92.06  ? 212 GLU B C   1 
ATOM   2899 O O   . GLU B 1 129 ? -32.332 -37.696 -44.476 1.00 109.19 ? 212 GLU B O   1 
ATOM   2900 C CB  . GLU B 1 129 ? -29.396 -36.801 -43.833 1.00 89.11  ? 212 GLU B CB  1 
ATOM   2901 C CG  . GLU B 1 129 ? -28.651 -36.308 -45.057 1.00 85.79  ? 212 GLU B CG  1 
ATOM   2902 C CD  . GLU B 1 129 ? -28.135 -37.490 -45.866 1.00 101.23 ? 212 GLU B CD  1 
ATOM   2903 O OE1 . GLU B 1 129 ? -28.675 -37.719 -46.982 1.00 113.77 ? 212 GLU B OE1 1 
ATOM   2904 O OE2 . GLU B 1 129 ? -27.229 -38.224 -45.372 1.00 90.54  ? 212 GLU B OE2 1 
ATOM   2905 N N   . GLU B 1 130 ? -32.292 -37.307 -42.254 1.00 84.96  ? 213 GLU B N   1 
ATOM   2906 C CA  . GLU B 1 130 ? -33.579 -37.936 -41.986 1.00 88.11  ? 213 GLU B CA  1 
ATOM   2907 C C   . GLU B 1 130 ? -33.802 -37.739 -40.524 1.00 79.40  ? 213 GLU B C   1 
ATOM   2908 O O   . GLU B 1 130 ? -32.848 -37.782 -39.772 1.00 73.18  ? 213 GLU B O   1 
ATOM   2909 C CB  . GLU B 1 130 ? -33.602 -39.435 -42.320 1.00 102.63 ? 213 GLU B CB  1 
ATOM   2910 C CG  . GLU B 1 130 ? -34.956 -40.116 -42.062 1.00 109.34 ? 213 GLU B CG  1 
ATOM   2911 C CD  . GLU B 1 130 ? -34.931 -41.635 -42.235 1.00 116.89 ? 213 GLU B CD  1 
ATOM   2912 O OE1 . GLU B 1 130 ? -33.856 -42.267 -42.077 1.00 121.68 ? 213 GLU B OE1 1 
ATOM   2913 O OE2 . GLU B 1 130 ? -36.003 -42.206 -42.525 1.00 115.58 ? 213 GLU B OE2 1 
ATOM   2914 N N   . ALA B 1 131 ? -35.061 -37.552 -40.136 1.00 78.09  ? 214 ALA B N   1 
ATOM   2915 C CA  . ALA B 1 131 ? -35.398 -37.053 -38.809 1.00 79.99  ? 214 ALA B CA  1 
ATOM   2916 C C   . ALA B 1 131 ? -36.270 -38.000 -38.008 1.00 76.65  ? 214 ALA B C   1 
ATOM   2917 O O   . ALA B 1 131 ? -36.864 -38.926 -38.551 1.00 78.59  ? 214 ALA B O   1 
ATOM   2918 C CB  . ALA B 1 131 ? -36.040 -35.671 -38.904 1.00 84.53  ? 214 ALA B CB  1 
ATOM   2919 N N   . GLY B 1 132 ? -36.322 -37.774 -36.701 1.00 70.81  ? 215 GLY B N   1 
ATOM   2920 C CA  . GLY B 1 132 ? -36.995 -38.701 -35.808 1.00 71.05  ? 215 GLY B CA  1 
ATOM   2921 C C   . GLY B 1 132 ? -36.101 -39.873 -35.440 1.00 72.12  ? 215 GLY B C   1 
ATOM   2922 O O   . GLY B 1 132 ? -36.484 -40.696 -34.624 1.00 80.16  ? 215 GLY B O   1 
ATOM   2923 N N   . ILE B 1 133 ? -34.909 -39.943 -36.027 1.00 67.69  ? 216 ILE B N   1 
ATOM   2924 C CA  . ILE B 1 133 ? -33.996 -41.092 -35.846 1.00 68.30  ? 216 ILE B CA  1 
ATOM   2925 C C   . ILE B 1 133 ? -33.045 -40.982 -34.638 1.00 60.90  ? 216 ILE B C   1 
ATOM   2926 O O   . ILE B 1 133 ? -32.907 -41.952 -33.883 1.00 57.73  ? 216 ILE B O   1 
ATOM   2927 C CB  . ILE B 1 133 ? -33.207 -41.454 -37.138 1.00 70.92  ? 216 ILE B CB  1 
ATOM   2928 C CG1 . ILE B 1 133 ? -32.674 -40.196 -37.889 1.00 79.96  ? 216 ILE B CG1 1 
ATOM   2929 C CG2 . ILE B 1 133 ? -34.115 -42.265 -38.079 1.00 66.61  ? 216 ILE B CG2 1 
ATOM   2930 C CD1 . ILE B 1 133 ? -32.568 -38.843 -37.140 1.00 74.98  ? 216 ILE B CD1 1 
ATOM   2931 N N   . PHE B 1 134 ? -32.423 -39.809 -34.456 1.00 51.96  ? 217 PHE B N   1 
ATOM   2932 C CA  . PHE B 1 134 ? -31.471 -39.570 -33.381 1.00 48.54  ? 217 PHE B CA  1 
ATOM   2933 C C   . PHE B 1 134 ? -32.159 -38.827 -32.253 1.00 51.27  ? 217 PHE B C   1 
ATOM   2934 O O   . PHE B 1 134 ? -33.018 -38.003 -32.529 1.00 52.55  ? 217 PHE B O   1 
ATOM   2935 C CB  . PHE B 1 134 ? -30.280 -38.787 -33.883 1.00 46.80  ? 217 PHE B CB  1 
ATOM   2936 C CG  . PHE B 1 134 ? -29.282 -39.627 -34.645 1.00 49.84  ? 217 PHE B CG  1 
ATOM   2937 C CD1 . PHE B 1 134 ? -29.361 -39.752 -36.055 1.00 49.51  ? 217 PHE B CD1 1 
ATOM   2938 C CD2 . PHE B 1 134 ? -28.266 -40.314 -33.963 1.00 46.32  ? 217 PHE B CD2 1 
ATOM   2939 C CE1 . PHE B 1 134 ? -28.432 -40.527 -36.757 1.00 48.00  ? 217 PHE B CE1 1 
ATOM   2940 C CE2 . PHE B 1 134 ? -27.343 -41.099 -34.651 1.00 44.26  ? 217 PHE B CE2 1 
ATOM   2941 C CZ  . PHE B 1 134 ? -27.439 -41.222 -36.041 1.00 49.08  ? 217 PHE B CZ  1 
ATOM   2942 N N   . LYS B 1 135 ? -31.832 -39.133 -30.993 1.00 46.39  ? 218 LYS B N   1 
ATOM   2943 C CA  . LYS B 1 135 ? -32.605 -38.553 -29.893 1.00 45.54  ? 218 LYS B CA  1 
ATOM   2944 C C   . LYS B 1 135 ? -31.753 -37.812 -28.913 1.00 47.36  ? 218 LYS B C   1 
ATOM   2945 O O   . LYS B 1 135 ? -32.311 -36.991 -28.154 1.00 46.52  ? 218 LYS B O   1 
ATOM   2946 C CB  . LYS B 1 135 ? -33.395 -39.601 -29.124 1.00 48.89  ? 218 LYS B CB  1 
ATOM   2947 C CG  . LYS B 1 135 ? -34.389 -40.426 -29.939 1.00 50.59  ? 218 LYS B CG  1 
ATOM   2948 C CD  . LYS B 1 135 ? -35.583 -39.593 -30.365 1.00 51.31  ? 218 LYS B CD  1 
ATOM   2949 C CE  . LYS B 1 135 ? -36.293 -40.192 -31.568 1.00 55.52  ? 218 LYS B CE  1 
ATOM   2950 N NZ  . LYS B 1 135 ? -37.239 -39.223 -32.192 1.00 55.50  ? 218 LYS B NZ  1 
ATOM   2951 N N   . LEU B 1 136 ? -30.433 -38.094 -28.956 1.00 41.81  ? 219 LEU B N   1 
ATOM   2952 C CA  . LEU B 1 136 ? -29.430 -37.555 -28.044 1.00 41.20  ? 219 LEU B CA  1 
ATOM   2953 C C   . LEU B 1 136 ? -28.171 -37.126 -28.755 1.00 42.03  ? 219 LEU B C   1 
ATOM   2954 O O   . LEU B 1 136 ? -27.709 -37.782 -29.675 1.00 44.23  ? 219 LEU B O   1 
ATOM   2955 C CB  . LEU B 1 136 ? -28.954 -38.638 -27.110 1.00 46.57  ? 219 LEU B CB  1 
ATOM   2956 C CG  . LEU B 1 136 ? -28.999 -38.448 -25.595 1.00 48.48  ? 219 LEU B CG  1 
ATOM   2957 C CD1 . LEU B 1 136 ? -28.072 -39.438 -24.901 1.00 41.13  ? 219 LEU B CD1 1 
ATOM   2958 C CD2 . LEU B 1 136 ? -28.741 -37.021 -25.179 1.00 44.50  ? 219 LEU B CD2 1 
ATOM   2959 N N   . LEU B 1 137 ? -27.591 -36.037 -28.292 1.00 41.40  ? 220 LEU B N   1 
ATOM   2960 C CA  . LEU B 1 137 ? -26.290 -35.616 -28.720 1.00 38.56  ? 220 LEU B CA  1 
ATOM   2961 C C   . LEU B 1 137 ? -25.597 -35.462 -27.376 1.00 42.55  ? 220 LEU B C   1 
ATOM   2962 O O   . LEU B 1 137 ? -26.045 -34.650 -26.532 1.00 39.19  ? 220 LEU B O   1 
ATOM   2963 C CB  . LEU B 1 137 ? -26.346 -34.260 -29.360 1.00 38.28  ? 220 LEU B CB  1 
ATOM   2964 C CG  . LEU B 1 137 ? -25.155 -33.896 -30.253 1.00 45.47  ? 220 LEU B CG  1 
ATOM   2965 C CD1 . LEU B 1 137 ? -25.092 -32.399 -30.572 1.00 40.27  ? 220 LEU B CD1 1 
ATOM   2966 C CD2 . LEU B 1 137 ? -23.803 -34.352 -29.728 1.00 43.22  ? 220 LEU B CD2 1 
ATOM   2967 N N   . ILE B 1 138 ? -24.525 -36.233 -27.162 1.00 35.32  ? 221 ILE B N   1 
ATOM   2968 C CA  . ILE B 1 138 ? -23.767 -36.071 -25.948 1.00 36.45  ? 221 ILE B CA  1 
ATOM   2969 C C   . ILE B 1 138 ? -22.435 -35.471 -26.310 1.00 37.28  ? 221 ILE B C   1 
ATOM   2970 O O   . ILE B 1 138 ? -21.773 -35.938 -27.256 1.00 41.79  ? 221 ILE B O   1 
ATOM   2971 C CB  . ILE B 1 138 ? -23.483 -37.423 -25.273 1.00 35.41  ? 221 ILE B CB  1 
ATOM   2972 C CG1 . ILE B 1 138 ? -24.793 -38.116 -24.857 1.00 31.92  ? 221 ILE B CG1 1 
ATOM   2973 C CG2 . ILE B 1 138 ? -22.469 -37.197 -24.163 1.00 31.93  ? 221 ILE B CG2 1 
ATOM   2974 C CD1 . ILE B 1 138 ? -24.624 -39.570 -24.439 1.00 32.30  ? 221 ILE B CD1 1 
ATOM   2975 N N   . ILE B 1 139 ? -22.002 -34.468 -25.566 1.00 39.61  ? 222 ILE B N   1 
ATOM   2976 C CA  . ILE B 1 139 ? -20.636 -33.960 -25.734 1.00 38.18  ? 222 ILE B CA  1 
ATOM   2977 C C   . ILE B 1 139 ? -19.892 -33.983 -24.407 1.00 42.47  ? 222 ILE B C   1 
ATOM   2978 O O   . ILE B 1 139 ? -20.243 -33.253 -23.477 1.00 43.48  ? 222 ILE B O   1 
ATOM   2979 C CB  . ILE B 1 139 ? -20.618 -32.525 -26.266 1.00 37.51  ? 222 ILE B CB  1 
ATOM   2980 C CG1 . ILE B 1 139 ? -21.409 -32.389 -27.584 1.00 37.39  ? 222 ILE B CG1 1 
ATOM   2981 C CG2 . ILE B 1 139 ? -19.162 -32.060 -26.417 1.00 36.46  ? 222 ILE B CG2 1 
ATOM   2982 C CD1 . ILE B 1 139 ? -21.917 -30.976 -27.896 1.00 39.39  ? 222 ILE B CD1 1 
ATOM   2983 N N   . ASP B 1 140 ? -18.842 -34.795 -24.330 1.00 46.78  ? 223 ASP B N   1 
ATOM   2984 C CA  . ASP B 1 140 ? -18.089 -34.991 -23.096 1.00 48.87  ? 223 ASP B CA  1 
ATOM   2985 C C   . ASP B 1 140 ? -16.601 -34.708 -23.426 1.00 51.86  ? 223 ASP B C   1 
ATOM   2986 O O   . ASP B 1 140 ? -15.890 -35.577 -23.949 1.00 50.23  ? 223 ASP B O   1 
ATOM   2987 C CB  . ASP B 1 140 ? -18.321 -36.447 -22.630 1.00 52.08  ? 223 ASP B CB  1 
ATOM   2988 C CG  . ASP B 1 140 ? -17.682 -36.773 -21.268 1.00 56.76  ? 223 ASP B CG  1 
ATOM   2989 O OD1 . ASP B 1 140 ? -17.484 -37.971 -20.969 1.00 59.93  ? 223 ASP B OD1 1 
ATOM   2990 O OD2 . ASP B 1 140 ? -17.369 -35.853 -20.495 1.00 61.29  ? 223 ASP B OD2 1 
ATOM   2991 N N   . SER B 1 141 ? -16.119 -33.503 -23.127 1.00 49.16  ? 224 SER B N   1 
ATOM   2992 C CA  . SER B 1 141 ? -16.895 -32.495 -22.440 1.00 52.01  ? 224 SER B CA  1 
ATOM   2993 C C   . SER B 1 141 ? -16.966 -31.238 -23.276 1.00 49.88  ? 224 SER B C   1 
ATOM   2994 O O   . SER B 1 141 ? -16.257 -31.098 -24.256 1.00 52.06  ? 224 SER B O   1 
ATOM   2995 C CB  . SER B 1 141 ? -16.247 -32.163 -21.104 1.00 51.25  ? 224 SER B CB  1 
ATOM   2996 O OG  . SER B 1 141 ? -14.982 -31.666 -21.380 1.00 55.58  ? 224 SER B OG  1 
ATOM   2997 N N   . ILE B 1 142 ? -17.800 -30.306 -22.845 1.00 51.18  ? 225 ILE B N   1 
ATOM   2998 C CA  . ILE B 1 142 ? -18.203 -29.166 -23.664 1.00 49.29  ? 225 ILE B CA  1 
ATOM   2999 C C   . ILE B 1 142 ? -17.120 -28.165 -24.058 1.00 46.93  ? 225 ILE B C   1 
ATOM   3000 O O   . ILE B 1 142 ? -17.108 -27.737 -25.179 1.00 48.21  ? 225 ILE B O   1 
ATOM   3001 C CB  . ILE B 1 142 ? -19.414 -28.416 -23.038 1.00 46.31  ? 225 ILE B CB  1 
ATOM   3002 C CG1 . ILE B 1 142 ? -20.000 -27.408 -24.042 1.00 40.25  ? 225 ILE B CG1 1 
ATOM   3003 C CG2 . ILE B 1 142 ? -18.993 -27.773 -21.735 1.00 47.65  ? 225 ILE B CG2 1 
ATOM   3004 C CD1 . ILE B 1 142 ? -20.397 -28.078 -25.340 1.00 37.07  ? 225 ILE B CD1 1 
ATOM   3005 N N   . MET B 1 143 ? -16.218 -27.826 -23.156 1.00 53.57  ? 226 MET B N   1 
ATOM   3006 C CA  . MET B 1 143 ? -15.346 -26.653 -23.274 1.00 58.50  ? 226 MET B CA  1 
ATOM   3007 C C   . MET B 1 143 ? -13.873 -26.956 -23.088 1.00 59.21  ? 226 MET B C   1 
ATOM   3008 O O   . MET B 1 143 ? -13.023 -26.044 -23.199 1.00 57.90  ? 226 MET B O   1 
ATOM   3009 C CB  . MET B 1 143 ? -15.627 -25.745 -22.089 1.00 65.79  ? 226 MET B CB  1 
ATOM   3010 C CG  . MET B 1 143 ? -16.609 -24.655 -22.331 1.00 69.97  ? 226 MET B CG  1 
ATOM   3011 S SD  . MET B 1 143 ? -16.148 -23.453 -21.105 1.00 75.96  ? 226 MET B SD  1 
ATOM   3012 C CE  . MET B 1 143 ? -14.529 -22.947 -21.718 1.00 82.15  ? 226 MET B CE  1 
ATOM   3013 N N   . ALA B 1 144 ? -13.565 -28.185 -22.699 1.00 54.34  ? 227 ALA B N   1 
ATOM   3014 C CA  . ALA B 1 144 ? -12.178 -28.487 -22.307 1.00 58.72  ? 227 ALA B CA  1 
ATOM   3015 C C   . ALA B 1 144 ? -11.152 -28.052 -23.396 1.00 58.90  ? 227 ALA B C   1 
ATOM   3016 O O   . ALA B 1 144 ? -10.154 -27.364 -23.101 1.00 60.72  ? 227 ALA B O   1 
ATOM   3017 C CB  . ALA B 1 144 ? -12.034 -29.955 -21.949 1.00 56.44  ? 227 ALA B CB  1 
ATOM   3018 N N   . LEU B 1 145 ? -11.458 -28.404 -24.654 1.00 53.67  ? 228 LEU B N   1 
ATOM   3019 C CA  . LEU B 1 145 ? -10.710 -27.966 -25.825 1.00 50.03  ? 228 LEU B CA  1 
ATOM   3020 C C   . LEU B 1 145 ? -10.638 -26.461 -25.992 1.00 52.82  ? 228 LEU B C   1 
ATOM   3021 O O   . LEU B 1 145 ? -9.676  -25.978 -26.557 1.00 56.15  ? 228 LEU B O   1 
ATOM   3022 C CB  . LEU B 1 145 ? -11.285 -28.606 -27.084 1.00 48.99  ? 228 LEU B CB  1 
ATOM   3023 C CG  . LEU B 1 145 ? -11.153 -30.137 -27.106 1.00 50.29  ? 228 LEU B CG  1 
ATOM   3024 C CD1 . LEU B 1 145 ? -11.881 -30.748 -28.301 1.00 46.53  ? 228 LEU B CD1 1 
ATOM   3025 C CD2 . LEU B 1 145 ? -9.688  -30.532 -27.102 1.00 45.05  ? 228 LEU B CD2 1 
ATOM   3026 N N   . PHE B 1 146 ? -11.643 -25.719 -25.522 1.00 51.31  ? 229 PHE B N   1 
ATOM   3027 C CA  . PHE B 1 146 ? -11.560 -24.265 -25.578 1.00 55.17  ? 229 PHE B CA  1 
ATOM   3028 C C   . PHE B 1 146 ? -10.591 -23.680 -24.565 1.00 61.24  ? 229 PHE B C   1 
ATOM   3029 O O   . PHE B 1 146 ? -9.905  -22.720 -24.872 1.00 64.96  ? 229 PHE B O   1 
ATOM   3030 C CB  . PHE B 1 146 ? -12.940 -23.622 -25.505 1.00 53.82  ? 229 PHE B CB  1 
ATOM   3031 C CG  . PHE B 1 146 ? -13.780 -23.949 -26.704 1.00 52.89  ? 229 PHE B CG  1 
ATOM   3032 C CD1 . PHE B 1 146 ? -14.366 -25.212 -26.824 1.00 48.22  ? 229 PHE B CD1 1 
ATOM   3033 C CD2 . PHE B 1 146 ? -13.901 -23.038 -27.753 1.00 49.64  ? 229 PHE B CD2 1 
ATOM   3034 C CE1 . PHE B 1 146 ? -15.081 -25.523 -27.952 1.00 49.96  ? 229 PHE B CE1 1 
ATOM   3035 C CE2 . PHE B 1 146 ? -14.614 -23.348 -28.887 1.00 48.38  ? 229 PHE B CE2 1 
ATOM   3036 C CZ  . PHE B 1 146 ? -15.212 -24.582 -28.985 1.00 49.78  ? 229 PHE B CZ  1 
ATOM   3037 N N   . ARG B 1 147 ? -10.511 -24.270 -23.378 1.00 63.88  ? 230 ARG B N   1 
ATOM   3038 C CA  . ARG B 1 147 ? -9.482  -23.908 -22.444 1.00 68.61  ? 230 ARG B CA  1 
ATOM   3039 C C   . ARG B 1 147 ? -8.106  -24.173 -23.091 1.00 73.77  ? 230 ARG B C   1 
ATOM   3040 O O   . ARG B 1 147 ? -7.186  -23.345 -22.968 1.00 74.99  ? 230 ARG B O   1 
ATOM   3041 C CB  . ARG B 1 147 ? -9.641  -24.683 -21.135 1.00 70.76  ? 230 ARG B CB  1 
ATOM   3042 C CG  . ARG B 1 147 ? -10.779 -24.195 -20.266 1.00 77.19  ? 230 ARG B CG  1 
ATOM   3043 C CD  . ARG B 1 147 ? -10.376 -24.120 -18.798 1.00 84.74  ? 230 ARG B CD  1 
ATOM   3044 N NE  . ARG B 1 147 ? -10.492 -25.399 -18.092 1.00 87.87  ? 230 ARG B NE  1 
ATOM   3045 C CZ  . ARG B 1 147 ? -10.411 -25.545 -16.766 1.00 92.99  ? 230 ARG B CZ  1 
ATOM   3046 N NH1 . ARG B 1 147 ? -10.219 -24.493 -15.975 1.00 101.77 ? 230 ARG B NH1 1 
ATOM   3047 N NH2 . ARG B 1 147 ? -10.528 -26.750 -16.218 1.00 94.98  ? 230 ARG B NH2 1 
ATOM   3048 N N   . VAL B 1 148 ? -7.993  -25.295 -23.816 1.00 71.76  ? 231 VAL B N   1 
ATOM   3049 C CA  . VAL B 1 148 ? -6.713  -25.740 -24.407 1.00 77.38  ? 231 VAL B CA  1 
ATOM   3050 C C   . VAL B 1 148 ? -6.206  -24.838 -25.571 1.00 84.01  ? 231 VAL B C   1 
ATOM   3051 O O   . VAL B 1 148 ? -5.036  -24.402 -25.568 1.00 87.74  ? 231 VAL B O   1 
ATOM   3052 C CB  . VAL B 1 148 ? -6.711  -27.294 -24.725 1.00 76.18  ? 231 VAL B CB  1 
ATOM   3053 C CG1 . VAL B 1 148 ? -5.538  -27.749 -25.595 1.00 68.41  ? 231 VAL B CG1 1 
ATOM   3054 C CG2 . VAL B 1 148 ? -6.708  -28.109 -23.438 1.00 70.06  ? 231 VAL B CG2 1 
ATOM   3055 N N   . ASP B 1 149 ? -7.077  -24.539 -26.537 1.00 83.86  ? 232 ASP B N   1 
ATOM   3056 C CA  . ASP B 1 149 ? -6.684  -23.732 -27.695 1.00 88.05  ? 232 ASP B CA  1 
ATOM   3057 C C   . ASP B 1 149 ? -6.519  -22.244 -27.375 1.00 90.94  ? 232 ASP B C   1 
ATOM   3058 O O   . ASP B 1 149 ? -5.957  -21.517 -28.177 1.00 95.02  ? 232 ASP B O   1 
ATOM   3059 C CB  . ASP B 1 149 ? -7.663  -23.934 -28.874 1.00 89.58  ? 232 ASP B CB  1 
ATOM   3060 C CG  . ASP B 1 149 ? -7.614  -25.368 -29.456 1.00 90.78  ? 232 ASP B CG  1 
ATOM   3061 O OD1 . ASP B 1 149 ? -6.921  -26.238 -28.896 1.00 90.11  ? 232 ASP B OD1 1 
ATOM   3062 O OD2 . ASP B 1 149 ? -8.279  -25.638 -30.475 1.00 88.88  ? 232 ASP B OD2 1 
ATOM   3063 N N   . PHE B 1 150 ? -7.000  -21.797 -26.211 1.00 96.24  ? 233 PHE B N   1 
ATOM   3064 C CA  . PHE B 1 150 ? -7.047  -20.361 -25.846 1.00 99.28  ? 233 PHE B CA  1 
ATOM   3065 C C   . PHE B 1 150 ? -6.755  -20.181 -24.355 1.00 101.55 ? 233 PHE B C   1 
ATOM   3066 O O   . PHE B 1 150 ? -7.611  -19.712 -23.601 1.00 108.86 ? 233 PHE B O   1 
ATOM   3067 C CB  . PHE B 1 150 ? -8.425  -19.718 -26.192 1.00 97.30  ? 233 PHE B CB  1 
ATOM   3068 C CG  . PHE B 1 150 ? -8.866  -19.911 -27.634 1.00 100.13 ? 233 PHE B CG  1 
ATOM   3069 C CD1 . PHE B 1 150 ? -8.376  -19.090 -28.654 1.00 100.60 ? 233 PHE B CD1 1 
ATOM   3070 C CD2 . PHE B 1 150 ? -9.772  -20.929 -27.981 1.00 100.70 ? 233 PHE B CD2 1 
ATOM   3071 C CE1 . PHE B 1 150 ? -8.770  -19.281 -29.984 1.00 102.18 ? 233 PHE B CE1 1 
ATOM   3072 C CE2 . PHE B 1 150 ? -10.170 -21.118 -29.310 1.00 101.21 ? 233 PHE B CE2 1 
ATOM   3073 C CZ  . PHE B 1 150 ? -9.667  -20.292 -30.316 1.00 98.76  ? 233 PHE B CZ  1 
ATOM   3074 N N   . SER B 1 151 ? -5.559  -20.591 -23.939 1.00 102.82 ? 234 SER B N   1 
ATOM   3075 C CA  . SER B 1 151 ? -5.065  -20.423 -22.571 1.00 106.17 ? 234 SER B CA  1 
ATOM   3076 C C   . SER B 1 151 ? -4.399  -19.057 -22.449 1.00 115.18 ? 234 SER B C   1 
ATOM   3077 O O   . SER B 1 151 ? -4.048  -18.463 -23.463 1.00 122.83 ? 234 SER B O   1 
ATOM   3078 C CB  . SER B 1 151 ? -4.001  -21.462 -22.305 1.00 103.14 ? 234 SER B CB  1 
ATOM   3079 O OG  . SER B 1 151 ? -2.795  -21.005 -22.888 1.00 103.01 ? 234 SER B OG  1 
ATOM   3080 N N   . GLY B 1 152 ? -4.162  -18.586 -21.223 1.00 124.61 ? 235 GLY B N   1 
ATOM   3081 C CA  . GLY B 1 152 ? -3.725  -17.197 -21.002 1.00 126.60 ? 235 GLY B CA  1 
ATOM   3082 C C   . GLY B 1 152 ? -4.898  -16.276 -21.302 1.00 129.83 ? 235 GLY B C   1 
ATOM   3083 O O   . GLY B 1 152 ? -5.979  -16.747 -21.668 1.00 134.95 ? 235 GLY B O   1 
ATOM   3084 N N   . ARG B 1 153 ? -4.713  -14.963 -21.175 1.00 141.94 ? 236 ARG B N   1 
ATOM   3085 C CA  . ARG B 1 153 ? -5.877  -14.059 -21.294 1.00 139.08 ? 236 ARG B CA  1 
ATOM   3086 C C   . ARG B 1 153 ? -5.799  -12.871 -22.276 1.00 137.56 ? 236 ARG B C   1 
ATOM   3087 O O   . ARG B 1 153 ? -6.622  -11.959 -22.211 1.00 136.40 ? 236 ARG B O   1 
ATOM   3088 C CB  . ARG B 1 153 ? -6.362  -13.621 -19.909 1.00 140.32 ? 236 ARG B CB  1 
ATOM   3089 C CG  . ARG B 1 153 ? -5.241  -13.275 -18.956 1.00 139.60 ? 236 ARG B CG  1 
ATOM   3090 C CD  . ARG B 1 153 ? -5.395  -14.022 -17.644 1.00 137.79 ? 236 ARG B CD  1 
ATOM   3091 N NE  . ARG B 1 153 ? -5.274  -13.086 -16.532 1.00 146.95 ? 236 ARG B NE  1 
ATOM   3092 C CZ  . ARG B 1 153 ? -4.137  -12.529 -16.117 1.00 145.43 ? 236 ARG B CZ  1 
ATOM   3093 N NH1 . ARG B 1 153 ? -2.978  -12.814 -16.705 1.00 148.77 ? 236 ARG B NH1 1 
ATOM   3094 N NH2 . ARG B 1 153 ? -4.163  -11.687 -15.098 1.00 146.48 ? 236 ARG B NH2 1 
ATOM   3095 N N   . GLY B 1 154 ? -4.831  -12.900 -23.189 1.00 136.49 ? 237 GLY B N   1 
ATOM   3096 C CA  . GLY B 1 154 ? -4.871  -12.041 -24.377 1.00 136.92 ? 237 GLY B CA  1 
ATOM   3097 C C   . GLY B 1 154 ? -5.709  -12.707 -25.460 1.00 135.25 ? 237 GLY B C   1 
ATOM   3098 O O   . GLY B 1 154 ? -6.096  -12.073 -26.446 1.00 136.05 ? 237 GLY B O   1 
ATOM   3099 N N   . GLU B 1 155 ? -5.994  -13.994 -25.235 1.00 131.67 ? 238 GLU B N   1 
ATOM   3100 C CA  . GLU B 1 155 ? -6.721  -14.893 -26.143 1.00 119.71 ? 238 GLU B CA  1 
ATOM   3101 C C   . GLU B 1 155 ? -8.226  -14.890 -25.939 1.00 110.95 ? 238 GLU B C   1 
ATOM   3102 O O   . GLU B 1 155 ? -8.966  -15.392 -26.786 1.00 107.55 ? 238 GLU B O   1 
ATOM   3103 C CB  . GLU B 1 155 ? -6.268  -16.339 -25.894 1.00 118.28 ? 238 GLU B CB  1 
ATOM   3104 C CG  . GLU B 1 155 ? -4.769  -16.561 -25.900 1.00 122.01 ? 238 GLU B CG  1 
ATOM   3105 C CD  . GLU B 1 155 ? -4.151  -16.140 -27.205 1.00 124.56 ? 238 GLU B CD  1 
ATOM   3106 O OE1 . GLU B 1 155 ? -4.596  -16.671 -28.250 1.00 118.20 ? 238 GLU B OE1 1 
ATOM   3107 O OE2 . GLU B 1 155 ? -3.248  -15.270 -27.173 1.00 126.30 ? 238 GLU B OE2 1 
ATOM   3108 N N   . LEU B 1 156 ? -8.663  -14.359 -24.801 1.00 108.09 ? 239 LEU B N   1 
ATOM   3109 C CA  . LEU B 1 156 ? -10.025 -14.557 -24.320 1.00 102.41 ? 239 LEU B CA  1 
ATOM   3110 C C   . LEU B 1 156 ? -11.119 -14.054 -25.249 1.00 99.25  ? 239 LEU B C   1 
ATOM   3111 O O   . LEU B 1 156 ? -12.129 -14.734 -25.403 1.00 96.30  ? 239 LEU B O   1 
ATOM   3112 C CB  . LEU B 1 156 ? -10.218 -14.013 -22.895 1.00 103.89 ? 239 LEU B CB  1 
ATOM   3113 C CG  . LEU B 1 156 ? -10.327 -15.056 -21.771 1.00 104.28 ? 239 LEU B CG  1 
ATOM   3114 C CD1 . LEU B 1 156 ? -11.660 -15.803 -21.858 1.00 100.27 ? 239 LEU B CD1 1 
ATOM   3115 C CD2 . LEU B 1 156 ? -9.150  -16.038 -21.739 1.00 103.61 ? 239 LEU B CD2 1 
ATOM   3116 N N   . ALA B 1 157 ? -10.923 -12.895 -25.879 1.00 98.86  ? 240 ALA B N   1 
ATOM   3117 C CA  . ALA B 1 157 ? -11.924 -12.389 -26.828 1.00 95.17  ? 240 ALA B CA  1 
ATOM   3118 C C   . ALA B 1 157 ? -12.260 -13.511 -27.807 1.00 91.99  ? 240 ALA B C   1 
ATOM   3119 O O   . ALA B 1 157 ? -13.439 -13.862 -27.986 1.00 89.91  ? 240 ALA B O   1 
ATOM   3120 C CB  . ALA B 1 157 ? -11.436 -11.141 -27.564 1.00 90.18  ? 240 ALA B CB  1 
ATOM   3121 N N   . GLU B 1 158 ? -11.210 -14.101 -28.382 1.00 89.57  ? 241 GLU B N   1 
ATOM   3122 C CA  . GLU B 1 158 ? -11.339 -15.143 -29.391 1.00 88.81  ? 241 GLU B CA  1 
ATOM   3123 C C   . GLU B 1 158 ? -12.030 -16.396 -28.891 1.00 80.61  ? 241 GLU B C   1 
ATOM   3124 O O   . GLU B 1 158 ? -12.939 -16.907 -29.535 1.00 77.74  ? 241 GLU B O   1 
ATOM   3125 C CB  . GLU B 1 158 ? -9.984  -15.497 -30.018 1.00 99.47  ? 241 GLU B CB  1 
ATOM   3126 C CG  . GLU B 1 158 ? -10.083 -15.722 -31.523 1.00 107.39 ? 241 GLU B CG  1 
ATOM   3127 C CD  . GLU B 1 158 ? -11.159 -14.840 -32.176 1.00 119.18 ? 241 GLU B CD  1 
ATOM   3128 O OE1 . GLU B 1 158 ? -11.114 -13.591 -32.021 1.00 122.51 ? 241 GLU B OE1 1 
ATOM   3129 O OE2 . GLU B 1 158 ? -12.064 -15.397 -32.845 1.00 119.11 ? 241 GLU B OE2 1 
ATOM   3130 N N   . ARG B 1 159 ? -11.612 -16.888 -27.740 1.00 76.98  ? 242 ARG B N   1 
ATOM   3131 C CA  . ARG B 1 159 ? -12.256 -18.044 -27.169 1.00 73.58  ? 242 ARG B CA  1 
ATOM   3132 C C   . ARG B 1 159 ? -13.751 -17.766 -27.061 1.00 70.34  ? 242 ARG B C   1 
ATOM   3133 O O   . ARG B 1 159 ? -14.565 -18.530 -27.574 1.00 69.68  ? 242 ARG B O   1 
ATOM   3134 C CB  . ARG B 1 159 ? -11.664 -18.334 -25.804 1.00 79.67  ? 242 ARG B CB  1 
ATOM   3135 C CG  . ARG B 1 159 ? -11.845 -19.748 -25.319 1.00 74.01  ? 242 ARG B CG  1 
ATOM   3136 C CD  . ARG B 1 159 ? -11.427 -19.815 -23.871 1.00 81.50  ? 242 ARG B CD  1 
ATOM   3137 N NE  . ARG B 1 159 ? -12.535 -19.445 -22.993 1.00 86.95  ? 242 ARG B NE  1 
ATOM   3138 C CZ  . ARG B 1 159 ? -12.500 -19.559 -21.669 1.00 90.74  ? 242 ARG B CZ  1 
ATOM   3139 N NH1 . ARG B 1 159 ? -11.408 -20.043 -21.075 1.00 91.35  ? 242 ARG B NH1 1 
ATOM   3140 N NH2 . ARG B 1 159 ? -13.559 -19.202 -20.942 1.00 91.71  ? 242 ARG B NH2 1 
ATOM   3141 N N   . GLN B 1 160 ? -14.101 -16.654 -26.429 1.00 72.08  ? 243 GLN B N   1 
ATOM   3142 C CA  . GLN B 1 160 ? -15.483 -16.218 -26.311 1.00 67.83  ? 243 GLN B CA  1 
ATOM   3143 C C   . GLN B 1 160 ? -16.219 -16.241 -27.639 1.00 63.85  ? 243 GLN B C   1 
ATOM   3144 O O   . GLN B 1 160 ? -17.221 -16.941 -27.746 1.00 62.46  ? 243 GLN B O   1 
ATOM   3145 C CB  . GLN B 1 160 ? -15.574 -14.844 -25.663 1.00 82.10  ? 243 GLN B CB  1 
ATOM   3146 C CG  . GLN B 1 160 ? -14.750 -14.654 -24.394 1.00 95.03  ? 243 GLN B CG  1 
ATOM   3147 C CD  . GLN B 1 160 ? -15.045 -15.667 -23.288 1.00 98.80  ? 243 GLN B CD  1 
ATOM   3148 O OE1 . GLN B 1 160 ? -15.184 -16.878 -23.522 1.00 91.21  ? 243 GLN B OE1 1 
ATOM   3149 N NE2 . GLN B 1 160 ? -15.115 -15.165 -22.058 1.00 109.09 ? 243 GLN B NE2 1 
ATOM   3150 N N   . GLN B 1 161 ? -15.754 -15.530 -28.663 1.00 61.59  ? 244 GLN B N   1 
ATOM   3151 C CA  . GLN B 1 161 ? -16.438 -15.657 -29.961 1.00 62.27  ? 244 GLN B CA  1 
ATOM   3152 C C   . GLN B 1 161 ? -16.672 -17.124 -30.378 1.00 61.12  ? 244 GLN B C   1 
ATOM   3153 O O   . GLN B 1 161 ? -17.828 -17.537 -30.566 1.00 59.96  ? 244 GLN B O   1 
ATOM   3154 C CB  . GLN B 1 161 ? -15.723 -14.893 -31.061 1.00 71.05  ? 244 GLN B CB  1 
ATOM   3155 C CG  . GLN B 1 161 ? -16.092 -13.413 -31.057 1.00 86.19  ? 244 GLN B CG  1 
ATOM   3156 C CD  . GLN B 1 161 ? -15.061 -12.528 -31.729 1.00 94.47  ? 244 GLN B CD  1 
ATOM   3157 O OE1 . GLN B 1 161 ? -14.122 -13.008 -32.384 1.00 102.49 ? 244 GLN B OE1 1 
ATOM   3158 N NE2 . GLN B 1 161 ? -15.232 -11.226 -31.573 1.00 95.82  ? 244 GLN B NE2 1 
ATOM   3159 N N   . LYS B 1 162 ? -15.589 -17.917 -30.471 1.00 58.74  ? 245 LYS B N   1 
ATOM   3160 C CA  . LYS B 1 162 ? -15.683 -19.323 -30.896 1.00 54.60  ? 245 LYS B CA  1 
ATOM   3161 C C   . LYS B 1 162 ? -16.664 -20.159 -30.034 1.00 52.32  ? 245 LYS B C   1 
ATOM   3162 O O   . LYS B 1 162 ? -17.588 -20.799 -30.543 1.00 46.58  ? 245 LYS B O   1 
ATOM   3163 C CB  . LYS B 1 162 ? -14.296 -19.971 -30.987 1.00 51.08  ? 245 LYS B CB  1 
ATOM   3164 C CG  . LYS B 1 162 ? -13.421 -19.370 -32.075 1.00 55.36  ? 245 LYS B CG  1 
ATOM   3165 C CD  . LYS B 1 162 ? -13.725 -19.870 -33.486 1.00 55.20  ? 245 LYS B CD  1 
ATOM   3166 C CE  . LYS B 1 162 ? -13.275 -18.848 -34.530 1.00 65.18  ? 245 LYS B CE  1 
ATOM   3167 N NZ  . LYS B 1 162 ? -14.263 -17.708 -34.720 1.00 72.55  ? 245 LYS B NZ  1 
ATOM   3168 N N   . LEU B 1 163 ? -16.458 -20.116 -28.729 1.00 53.83  ? 246 LEU B N   1 
ATOM   3169 C CA  . LEU B 1 163 ? -17.274 -20.843 -27.812 1.00 50.37  ? 246 LEU B CA  1 
ATOM   3170 C C   . LEU B 1 163 ? -18.731 -20.495 -28.018 1.00 51.62  ? 246 LEU B C   1 
ATOM   3171 O O   . LEU B 1 163 ? -19.606 -21.383 -27.961 1.00 51.20  ? 246 LEU B O   1 
ATOM   3172 C CB  . LEU B 1 163 ? -16.853 -20.521 -26.389 1.00 53.72  ? 246 LEU B CB  1 
ATOM   3173 C CG  . LEU B 1 163 ? -17.604 -21.325 -25.329 1.00 56.15  ? 246 LEU B CG  1 
ATOM   3174 C CD1 . LEU B 1 163 ? -17.159 -22.782 -25.378 1.00 56.65  ? 246 LEU B CD1 1 
ATOM   3175 C CD2 . LEU B 1 163 ? -17.354 -20.707 -23.957 1.00 58.01  ? 246 LEU B CD2 1 
ATOM   3176 N N   . ALA B 1 164 ? -19.008 -19.224 -28.304 1.00 53.10  ? 247 ALA B N   1 
ATOM   3177 C CA  . ALA B 1 164 ? -20.403 -18.782 -28.364 1.00 53.47  ? 247 ALA B CA  1 
ATOM   3178 C C   . ALA B 1 164 ? -20.978 -19.121 -29.711 1.00 53.65  ? 247 ALA B C   1 
ATOM   3179 O O   . ALA B 1 164 ? -22.170 -19.493 -29.810 1.00 51.06  ? 247 ALA B O   1 
ATOM   3180 C CB  . ALA B 1 164 ? -20.532 -17.286 -28.059 1.00 53.28  ? 247 ALA B CB  1 
ATOM   3181 N N   . GLN B 1 165 ? -20.130 -18.997 -30.744 1.00 55.14  ? 248 GLN B N   1 
ATOM   3182 C CA  . GLN B 1 165 ? -20.475 -19.459 -32.088 1.00 55.10  ? 248 GLN B CA  1 
ATOM   3183 C C   . GLN B 1 165 ? -20.976 -20.904 -31.981 1.00 53.03  ? 248 GLN B C   1 
ATOM   3184 O O   . GLN B 1 165 ? -22.011 -21.286 -32.562 1.00 53.09  ? 248 GLN B O   1 
ATOM   3185 C CB  . GLN B 1 165 ? -19.271 -19.385 -32.991 1.00 57.66  ? 248 GLN B CB  1 
ATOM   3186 C CG  . GLN B 1 165 ? -19.520 -18.759 -34.353 1.00 67.07  ? 248 GLN B CG  1 
ATOM   3187 C CD  . GLN B 1 165 ? -18.522 -17.626 -34.647 1.00 77.89  ? 248 GLN B CD  1 
ATOM   3188 O OE1 . GLN B 1 165 ? -17.320 -17.863 -34.861 1.00 80.55  ? 248 GLN B OE1 1 
ATOM   3189 N NE2 . GLN B 1 165 ? -19.020 -16.376 -34.646 1.00 77.91  ? 248 GLN B NE2 1 
ATOM   3190 N N   . MET B 1 166 ? -20.284 -21.680 -31.168 1.00 46.75  ? 249 MET B N   1 
ATOM   3191 C CA  . MET B 1 166 ? -20.576 -23.081 -31.064 1.00 45.99  ? 249 MET B CA  1 
ATOM   3192 C C   . MET B 1 166 ? -21.807 -23.447 -30.208 1.00 46.47  ? 249 MET B C   1 
ATOM   3193 O O   . MET B 1 166 ? -22.572 -24.344 -30.578 1.00 43.77  ? 249 MET B O   1 
ATOM   3194 C CB  . MET B 1 166 ? -19.347 -23.830 -30.578 1.00 45.55  ? 249 MET B CB  1 
ATOM   3195 C CG  . MET B 1 166 ? -19.645 -25.297 -30.493 1.00 49.21  ? 249 MET B CG  1 
ATOM   3196 S SD  . MET B 1 166 ? -18.765 -26.232 -29.281 1.00 63.50  ? 249 MET B SD  1 
ATOM   3197 C CE  . MET B 1 166 ? -19.116 -25.444 -27.697 1.00 57.51  ? 249 MET B CE  1 
ATOM   3198 N N   . LEU B 1 167 ? -21.978 -22.818 -29.050 1.00 46.17  ? 250 LEU B N   1 
ATOM   3199 C CA  . LEU B 1 167 ? -23.167 -23.091 -28.263 1.00 46.41  ? 250 LEU B CA  1 
ATOM   3200 C C   . LEU B 1 167 ? -24.444 -22.548 -28.951 1.00 50.57  ? 250 LEU B C   1 
ATOM   3201 O O   . LEU B 1 167 ? -25.524 -23.143 -28.814 1.00 51.23  ? 250 LEU B O   1 
ATOM   3202 C CB  . LEU B 1 167 ? -23.021 -22.540 -26.850 1.00 46.52  ? 250 LEU B CB  1 
ATOM   3203 C CG  . LEU B 1 167 ? -21.839 -23.149 -26.079 1.00 46.56  ? 250 LEU B CG  1 
ATOM   3204 C CD1 . LEU B 1 167 ? -21.784 -22.348 -24.812 1.00 51.17  ? 250 LEU B CD1 1 
ATOM   3205 C CD2 . LEU B 1 167 ? -21.979 -24.613 -25.709 1.00 41.55  ? 250 LEU B CD2 1 
ATOM   3206 N N   . SER B 1 168 ? -24.343 -21.459 -29.723 1.00 52.50  ? 251 SER B N   1 
ATOM   3207 C CA  . SER B 1 168 ? -25.522 -21.075 -30.522 1.00 51.54  ? 251 SER B CA  1 
ATOM   3208 C C   . SER B 1 168 ? -25.909 -22.131 -31.551 1.00 46.42  ? 251 SER B C   1 
ATOM   3209 O O   . SER B 1 168 ? -27.099 -22.370 -31.664 1.00 48.96  ? 251 SER B O   1 
ATOM   3210 C CB  . SER B 1 168 ? -25.543 -19.627 -31.069 1.00 51.18  ? 251 SER B CB  1 
ATOM   3211 O OG  . SER B 1 168 ? -24.367 -19.295 -31.765 1.00 60.22  ? 251 SER B OG  1 
ATOM   3212 N N   . ARG B 1 169 ? -24.947 -22.773 -32.238 1.00 42.62  ? 252 ARG B N   1 
ATOM   3213 C CA  . ARG B 1 169 ? -25.243 -23.974 -33.079 1.00 46.59  ? 252 ARG B CA  1 
ATOM   3214 C C   . ARG B 1 169 ? -25.861 -25.156 -32.319 1.00 44.80  ? 252 ARG B C   1 
ATOM   3215 O O   . ARG B 1 169 ? -26.801 -25.815 -32.802 1.00 37.27  ? 252 ARG B O   1 
ATOM   3216 C CB  . ARG B 1 169 ? -24.009 -24.509 -33.843 1.00 51.62  ? 252 ARG B CB  1 
ATOM   3217 C CG  . ARG B 1 169 ? -23.425 -23.464 -34.772 1.00 73.19  ? 252 ARG B CG  1 
ATOM   3218 C CD  . ARG B 1 169 ? -24.067 -23.427 -36.153 1.00 85.29  ? 252 ARG B CD  1 
ATOM   3219 N NE  . ARG B 1 169 ? -23.424 -24.454 -36.970 1.00 96.11  ? 252 ARG B NE  1 
ATOM   3220 C CZ  . ARG B 1 169 ? -23.916 -25.673 -37.163 1.00 91.82  ? 252 ARG B CZ  1 
ATOM   3221 N NH1 . ARG B 1 169 ? -25.096 -26.007 -36.634 1.00 86.24  ? 252 ARG B NH1 1 
ATOM   3222 N NH2 . ARG B 1 169 ? -23.232 -26.543 -37.898 1.00 80.55  ? 252 ARG B NH2 1 
ATOM   3223 N N   . LEU B 1 170 ? -25.303 -25.435 -31.136 1.00 43.90  ? 253 LEU B N   1 
ATOM   3224 C CA  . LEU B 1 170 ? -25.847 -26.427 -30.247 1.00 37.80  ? 253 LEU B CA  1 
ATOM   3225 C C   . LEU B 1 170 ? -27.287 -26.172 -29.930 1.00 37.50  ? 253 LEU B C   1 
ATOM   3226 O O   . LEU B 1 170 ? -28.111 -27.109 -30.003 1.00 36.89  ? 253 LEU B O   1 
ATOM   3227 C CB  . LEU B 1 170 ? -25.073 -26.476 -28.986 1.00 43.88  ? 253 LEU B CB  1 
ATOM   3228 C CG  . LEU B 1 170 ? -24.098 -27.629 -28.927 1.00 48.59  ? 253 LEU B CG  1 
ATOM   3229 C CD1 . LEU B 1 170 ? -23.903 -27.883 -27.433 1.00 49.29  ? 253 LEU B CD1 1 
ATOM   3230 C CD2 . LEU B 1 170 ? -24.619 -28.876 -29.664 1.00 42.65  ? 253 LEU B CD2 1 
ATOM   3231 N N   . GLN B 1 171 ? -27.628 -24.913 -29.649 1.00 37.11  ? 254 GLN B N   1 
ATOM   3232 C CA  . GLN B 1 171 ? -29.000 -24.616 -29.221 1.00 37.33  ? 254 GLN B CA  1 
ATOM   3233 C C   . GLN B 1 171 ? -29.922 -24.905 -30.364 1.00 38.37  ? 254 GLN B C   1 
ATOM   3234 O O   . GLN B 1 171 ? -30.924 -25.618 -30.195 1.00 38.44  ? 254 GLN B O   1 
ATOM   3235 C CB  . GLN B 1 171 ? -29.151 -23.171 -28.836 1.00 40.36  ? 254 GLN B CB  1 
ATOM   3236 C CG  . GLN B 1 171 ? -28.542 -22.817 -27.484 1.00 41.03  ? 254 GLN B CG  1 
ATOM   3237 C CD  . GLN B 1 171 ? -29.149 -21.543 -26.929 1.00 40.59  ? 254 GLN B CD  1 
ATOM   3238 O OE1 . GLN B 1 171 ? -29.468 -21.469 -25.772 1.00 42.91  ? 254 GLN B OE1 1 
ATOM   3239 N NE2 . GLN B 1 171 ? -29.368 -20.574 -27.768 1.00 39.54  ? 254 GLN B NE2 1 
ATOM   3240 N N   . LYS B 1 172 ? -29.519 -24.410 -31.542 1.00 40.10  ? 255 LYS B N   1 
ATOM   3241 C CA  . LYS B 1 172 ? -30.254 -24.542 -32.806 1.00 37.94  ? 255 LYS B CA  1 
ATOM   3242 C C   . LYS B 1 172 ? -30.508 -25.985 -33.153 1.00 38.53  ? 255 LYS B C   1 
ATOM   3243 O O   . LYS B 1 172 ? -31.639 -26.369 -33.355 1.00 43.04  ? 255 LYS B O   1 
ATOM   3244 C CB  . LYS B 1 172 ? -29.475 -23.895 -33.917 1.00 38.19  ? 255 LYS B CB  1 
ATOM   3245 C CG  . LYS B 1 172 ? -30.330 -23.093 -34.847 1.00 41.84  ? 255 LYS B CG  1 
ATOM   3246 C CD  . LYS B 1 172 ? -29.811 -21.695 -34.996 1.00 43.43  ? 255 LYS B CD  1 
ATOM   3247 C CE  . LYS B 1 172 ? -28.330 -21.661 -35.282 1.00 49.83  ? 255 LYS B CE  1 
ATOM   3248 N NZ  . LYS B 1 172 ? -27.884 -20.245 -35.146 1.00 56.72  ? 255 LYS B NZ  1 
ATOM   3249 N N   . ILE B 1 173 ? -29.467 -26.799 -33.128 1.00 41.72  ? 256 ILE B N   1 
ATOM   3250 C CA  . ILE B 1 173 ? -29.560 -28.229 -33.435 1.00 44.07  ? 256 ILE B CA  1 
ATOM   3251 C C   . ILE B 1 173 ? -30.649 -28.906 -32.598 1.00 42.77  ? 256 ILE B C   1 
ATOM   3252 O O   . ILE B 1 173 ? -31.564 -29.517 -33.122 1.00 50.03  ? 256 ILE B O   1 
ATOM   3253 C CB  . ILE B 1 173 ? -28.164 -28.894 -33.215 1.00 45.88  ? 256 ILE B CB  1 
ATOM   3254 C CG1 . ILE B 1 173 ? -27.302 -28.668 -34.465 1.00 44.38  ? 256 ILE B CG1 1 
ATOM   3255 C CG2 . ILE B 1 173 ? -28.257 -30.398 -32.931 1.00 36.75  ? 256 ILE B CG2 1 
ATOM   3256 C CD1 . ILE B 1 173 ? -25.812 -28.889 -34.186 1.00 48.58  ? 256 ILE B CD1 1 
ATOM   3257 N N   . SER B 1 174 ? -30.466 -28.802 -31.290 1.00 44.15  ? 257 SER B N   1 
ATOM   3258 C CA  . SER B 1 174 ? -31.378 -29.097 -30.218 1.00 39.29  ? 257 SER B CA  1 
ATOM   3259 C C   . SER B 1 174 ? -32.846 -28.819 -30.509 1.00 45.20  ? 257 SER B C   1 
ATOM   3260 O O   . SER B 1 174 ? -33.752 -29.664 -30.281 1.00 42.66  ? 257 SER B O   1 
ATOM   3261 C CB  . SER B 1 174 ? -31.013 -28.078 -29.174 1.00 37.62  ? 257 SER B CB  1 
ATOM   3262 O OG  . SER B 1 174 ? -31.325 -28.555 -27.924 1.00 44.58  ? 257 SER B OG  1 
ATOM   3263 N N   . GLU B 1 175 ? -33.072 -27.572 -30.923 1.00 44.04  ? 258 GLU B N   1 
ATOM   3264 C CA  . GLU B 1 175 ? -34.423 -27.040 -31.089 1.00 39.90  ? 258 GLU B CA  1 
ATOM   3265 C C   . GLU B 1 175 ? -34.870 -27.412 -32.475 1.00 40.75  ? 258 GLU B C   1 
ATOM   3266 O O   . GLU B 1 175 ? -36.015 -27.896 -32.634 1.00 42.45  ? 258 GLU B O   1 
ATOM   3267 C CB  . GLU B 1 175 ? -34.483 -25.539 -30.795 1.00 34.04  ? 258 GLU B CB  1 
ATOM   3268 C CG  . GLU B 1 175 ? -34.295 -25.329 -29.292 1.00 36.54  ? 258 GLU B CG  1 
ATOM   3269 C CD  . GLU B 1 175 ? -33.988 -23.906 -28.876 1.00 40.64  ? 258 GLU B CD  1 
ATOM   3270 O OE1 . GLU B 1 175 ? -33.135 -23.682 -27.985 1.00 43.29  ? 258 GLU B OE1 1 
ATOM   3271 O OE2 . GLU B 1 175 ? -34.606 -22.988 -29.425 1.00 48.26  ? 258 GLU B OE2 1 
ATOM   3272 N N   . GLU B 1 176 ? -33.969 -27.269 -33.459 1.00 36.68  ? 259 GLU B N   1 
ATOM   3273 C CA  . GLU B 1 176 ? -34.368 -27.480 -34.816 1.00 38.67  ? 259 GLU B CA  1 
ATOM   3274 C C   . GLU B 1 176 ? -34.667 -28.938 -35.034 1.00 40.99  ? 259 GLU B C   1 
ATOM   3275 O O   . GLU B 1 176 ? -35.581 -29.241 -35.744 1.00 42.81  ? 259 GLU B O   1 
ATOM   3276 C CB  . GLU B 1 176 ? -33.316 -27.009 -35.781 1.00 47.01  ? 259 GLU B CB  1 
ATOM   3277 C CG  . GLU B 1 176 ? -33.800 -26.620 -37.177 1.00 58.06  ? 259 GLU B CG  1 
ATOM   3278 C CD  . GLU B 1 176 ? -32.603 -26.339 -38.090 1.00 76.69  ? 259 GLU B CD  1 
ATOM   3279 O OE1 . GLU B 1 176 ? -31.643 -25.620 -37.633 1.00 68.03  ? 259 GLU B OE1 1 
ATOM   3280 O OE2 . GLU B 1 176 ? -32.608 -26.845 -39.259 1.00 85.40  ? 259 GLU B OE2 1 
ATOM   3281 N N   . TYR B 1 177 ? -33.949 -29.846 -34.380 1.00 41.34  ? 260 TYR B N   1 
ATOM   3282 C CA  . TYR B 1 177 ? -34.102 -31.256 -34.703 1.00 42.33  ? 260 TYR B CA  1 
ATOM   3283 C C   . TYR B 1 177 ? -34.776 -32.048 -33.567 1.00 43.87  ? 260 TYR B C   1 
ATOM   3284 O O   . TYR B 1 177 ? -34.932 -33.231 -33.661 1.00 38.40  ? 260 TYR B O   1 
ATOM   3285 C CB  . TYR B 1 177 ? -32.738 -31.860 -35.105 1.00 40.67  ? 260 TYR B CB  1 
ATOM   3286 C CG  . TYR B 1 177 ? -32.225 -31.290 -36.396 1.00 46.11  ? 260 TYR B CG  1 
ATOM   3287 C CD1 . TYR B 1 177 ? -31.159 -30.367 -36.407 1.00 44.27  ? 260 TYR B CD1 1 
ATOM   3288 C CD2 . TYR B 1 177 ? -32.866 -31.575 -37.609 1.00 46.38  ? 260 TYR B CD2 1 
ATOM   3289 C CE1 . TYR B 1 177 ? -30.698 -29.809 -37.591 1.00 46.13  ? 260 TYR B CE1 1 
ATOM   3290 C CE2 . TYR B 1 177 ? -32.416 -31.021 -38.808 1.00 52.14  ? 260 TYR B CE2 1 
ATOM   3291 C CZ  . TYR B 1 177 ? -31.333 -30.131 -38.796 1.00 55.28  ? 260 TYR B CZ  1 
ATOM   3292 O OH  . TYR B 1 177 ? -30.877 -29.564 -39.982 1.00 57.01  ? 260 TYR B OH  1 
ATOM   3293 N N   . ASN B 1 178 ? -35.186 -31.388 -32.492 1.00 44.56  ? 261 ASN B N   1 
ATOM   3294 C CA  . ASN B 1 178 ? -35.831 -32.109 -31.393 1.00 42.36  ? 261 ASN B CA  1 
ATOM   3295 C C   . ASN B 1 178 ? -34.957 -33.261 -30.834 1.00 43.96  ? 261 ASN B C   1 
ATOM   3296 O O   . ASN B 1 178 ? -35.386 -34.427 -30.742 1.00 46.17  ? 261 ASN B O   1 
ATOM   3297 C CB  . ASN B 1 178 ? -37.238 -32.582 -31.791 1.00 37.04  ? 261 ASN B CB  1 
ATOM   3298 C CG  . ASN B 1 178 ? -38.026 -33.139 -30.606 1.00 40.56  ? 261 ASN B CG  1 
ATOM   3299 O OD1 . ASN B 1 178 ? -37.836 -32.716 -29.455 1.00 42.22  ? 261 ASN B OD1 1 
ATOM   3300 N ND2 . ASN B 1 178 ? -38.898 -34.117 -30.874 1.00 38.77  ? 261 ASN B ND2 1 
ATOM   3301 N N   . VAL B 1 179 ? -33.731 -32.935 -30.461 1.00 43.47  ? 262 VAL B N   1 
ATOM   3302 C CA  . VAL B 1 179 ? -32.890 -33.899 -29.764 1.00 42.04  ? 262 VAL B CA  1 
ATOM   3303 C C   . VAL B 1 179 ? -32.623 -33.351 -28.383 1.00 42.07  ? 262 VAL B C   1 
ATOM   3304 O O   . VAL B 1 179 ? -32.754 -32.170 -28.137 1.00 42.24  ? 262 VAL B O   1 
ATOM   3305 C CB  . VAL B 1 179 ? -31.560 -34.152 -30.457 1.00 40.79  ? 262 VAL B CB  1 
ATOM   3306 C CG1 . VAL B 1 179 ? -31.749 -34.217 -31.945 1.00 42.68  ? 262 VAL B CG1 1 
ATOM   3307 C CG2 . VAL B 1 179 ? -30.618 -33.018 -30.180 1.00 40.36  ? 262 VAL B CG2 1 
ATOM   3308 N N   . ALA B 1 180 ? -32.299 -34.232 -27.455 1.00 43.16  ? 263 ALA B N   1 
ATOM   3309 C CA  . ALA B 1 180 ? -31.843 -33.771 -26.173 1.00 41.99  ? 263 ALA B CA  1 
ATOM   3310 C C   . ALA B 1 180 ? -30.333 -33.628 -26.360 1.00 44.58  ? 263 ALA B C   1 
ATOM   3311 O O   . ALA B 1 180 ? -29.730 -34.454 -27.043 1.00 42.55  ? 263 ALA B O   1 
ATOM   3312 C CB  . ALA B 1 180 ? -32.172 -34.798 -25.121 1.00 39.14  ? 263 ALA B CB  1 
ATOM   3313 N N   . VAL B 1 181 ? -29.741 -32.538 -25.866 1.00 46.20  ? 264 VAL B N   1 
ATOM   3314 C CA  . VAL B 1 181 ? -28.301 -32.493 -25.774 1.00 43.37  ? 264 VAL B CA  1 
ATOM   3315 C C   . VAL B 1 181 ? -27.790 -32.353 -24.372 1.00 47.32  ? 264 VAL B C   1 
ATOM   3316 O O   . VAL B 1 181 ? -28.250 -31.487 -23.621 1.00 52.23  ? 264 VAL B O   1 
ATOM   3317 C CB  . VAL B 1 181 ? -27.594 -31.601 -26.805 1.00 38.82  ? 264 VAL B CB  1 
ATOM   3318 C CG1 . VAL B 1 181 ? -28.583 -30.820 -27.605 1.00 41.87  ? 264 VAL B CG1 1 
ATOM   3319 C CG2 . VAL B 1 181 ? -26.494 -30.761 -26.179 1.00 38.68  ? 264 VAL B CG2 1 
ATOM   3320 N N   . PHE B 1 182 ? -26.861 -33.264 -24.039 1.00 45.05  ? 265 PHE B N   1 
ATOM   3321 C CA  . PHE B 1 182 ? -26.305 -33.395 -22.722 1.00 41.78  ? 265 PHE B CA  1 
ATOM   3322 C C   . PHE B 1 182 ? -24.818 -33.144 -22.789 1.00 40.18  ? 265 PHE B C   1 
ATOM   3323 O O   . PHE B 1 182 ? -24.116 -33.791 -23.529 1.00 46.91  ? 265 PHE B O   1 
ATOM   3324 C CB  . PHE B 1 182 ? -26.576 -34.803 -22.191 1.00 42.64  ? 265 PHE B CB  1 
ATOM   3325 C CG  . PHE B 1 182 ? -25.915 -35.082 -20.849 1.00 43.99  ? 265 PHE B CG  1 
ATOM   3326 C CD1 . PHE B 1 182 ? -26.426 -34.534 -19.684 1.00 47.76  ? 265 PHE B CD1 1 
ATOM   3327 C CD2 . PHE B 1 182 ? -24.775 -35.864 -20.775 1.00 43.36  ? 265 PHE B CD2 1 
ATOM   3328 C CE1 . PHE B 1 182 ? -25.809 -34.756 -18.450 1.00 56.66  ? 265 PHE B CE1 1 
ATOM   3329 C CE2 . PHE B 1 182 ? -24.144 -36.102 -19.571 1.00 50.10  ? 265 PHE B CE2 1 
ATOM   3330 C CZ  . PHE B 1 182 ? -24.669 -35.558 -18.392 1.00 56.50  ? 265 PHE B CZ  1 
ATOM   3331 N N   . VAL B 1 183 ? -24.323 -32.202 -22.020 1.00 41.44  ? 266 VAL B N   1 
ATOM   3332 C CA  . VAL B 1 183 ? -22.879 -31.946 -21.997 1.00 41.44  ? 266 VAL B CA  1 
ATOM   3333 C C   . VAL B 1 183 ? -22.276 -31.929 -20.595 1.00 43.30  ? 266 VAL B C   1 
ATOM   3334 O O   . VAL B 1 183 ? -22.952 -31.610 -19.585 1.00 46.83  ? 266 VAL B O   1 
ATOM   3335 C CB  . VAL B 1 183 ? -22.562 -30.632 -22.684 1.00 43.15  ? 266 VAL B CB  1 
ATOM   3336 C CG1 . VAL B 1 183 ? -23.272 -30.592 -24.030 1.00 38.57  ? 266 VAL B CG1 1 
ATOM   3337 C CG2 . VAL B 1 183 ? -22.982 -29.445 -21.815 1.00 43.35  ? 266 VAL B CG2 1 
ATOM   3338 N N   . THR B 1 184 ? -21.012 -32.306 -20.529 1.00 42.36  ? 267 THR B N   1 
ATOM   3339 C CA  . THR B 1 184 ? -20.313 -32.251 -19.266 1.00 49.44  ? 267 THR B CA  1 
ATOM   3340 C C   . THR B 1 184 ? -19.384 -31.065 -19.287 1.00 51.43  ? 267 THR B C   1 
ATOM   3341 O O   . THR B 1 184 ? -19.036 -30.567 -20.358 1.00 53.92  ? 267 THR B O   1 
ATOM   3342 C CB  . THR B 1 184 ? -19.489 -33.516 -18.996 1.00 48.64  ? 267 THR B CB  1 
ATOM   3343 O OG1 . THR B 1 184 ? -18.420 -33.569 -19.932 1.00 45.31  ? 267 THR B OG1 1 
ATOM   3344 C CG2 . THR B 1 184 ? -20.383 -34.778 -19.088 1.00 48.17  ? 267 THR B CG2 1 
ATOM   3345 N N   . ASN B 1 185 ? -18.977 -30.627 -18.106 1.00 53.38  ? 268 ASN B N   1 
ATOM   3346 C CA  . ASN B 1 185 ? -18.124 -29.474 -17.957 1.00 56.37  ? 268 ASN B CA  1 
ATOM   3347 C C   . ASN B 1 185 ? -17.390 -29.634 -16.628 1.00 62.78  ? 268 ASN B C   1 
ATOM   3348 O O   . ASN B 1 185 ? -17.867 -30.327 -15.731 1.00 65.14  ? 268 ASN B O   1 
ATOM   3349 C CB  . ASN B 1 185 ? -19.016 -28.230 -17.968 1.00 56.67  ? 268 ASN B CB  1 
ATOM   3350 C CG  . ASN B 1 185 ? -18.238 -26.935 -18.064 1.00 59.97  ? 268 ASN B CG  1 
ATOM   3351 O OD1 . ASN B 1 185 ? -18.713 -25.890 -17.633 1.00 61.40  ? 268 ASN B OD1 1 
ATOM   3352 N ND2 . ASN B 1 185 ? -17.061 -26.986 -18.655 1.00 62.42  ? 268 ASN B ND2 1 
ATOM   3353 N N   . GLN B 1 186 ? -16.213 -29.037 -16.506 1.00 69.62  ? 269 GLN B N   1 
ATOM   3354 C CA  . GLN B 1 186 ? -15.438 -29.122 -15.265 1.00 72.99  ? 269 GLN B CA  1 
ATOM   3355 C C   . GLN B 1 186 ? -15.520 -27.757 -14.583 1.00 80.45  ? 269 GLN B C   1 
ATOM   3356 O O   . GLN B 1 186 ? -16.234 -26.849 -15.069 1.00 78.00  ? 269 GLN B O   1 
ATOM   3357 C CB  . GLN B 1 186 ? -13.971 -29.530 -15.513 1.00 72.04  ? 269 GLN B CB  1 
ATOM   3358 C CG  . GLN B 1 186 ? -13.731 -30.582 -16.606 1.00 72.12  ? 269 GLN B CG  1 
ATOM   3359 C CD  . GLN B 1 186 ? -13.693 -29.992 -18.015 1.00 68.17  ? 269 GLN B CD  1 
ATOM   3360 O OE1 . GLN B 1 186 ? -12.986 -29.023 -18.273 1.00 74.04  ? 269 GLN B OE1 1 
ATOM   3361 N NE2 . GLN B 1 186 ? -14.466 -30.571 -18.923 1.00 59.02  ? 269 GLN B NE2 1 
ATOM   3362 N N   . MET B 1 187 ? -14.786 -27.624 -13.472 1.00 85.15  ? 270 MET B N   1 
ATOM   3363 C CA  . MET B 1 187 ? -14.798 -26.432 -12.617 1.00 88.14  ? 270 MET B CA  1 
ATOM   3364 C C   . MET B 1 187 ? -13.389 -25.828 -12.463 1.00 90.85  ? 270 MET B C   1 
ATOM   3365 O O   . MET B 1 187 ? -12.391 -26.504 -12.728 1.00 92.85  ? 270 MET B O   1 
ATOM   3366 C CB  . MET B 1 187 ? -15.379 -26.789 -11.247 1.00 93.74  ? 270 MET B CB  1 
ATOM   3367 C CG  . MET B 1 187 ? -16.069 -28.148 -11.180 1.00 92.89  ? 270 MET B CG  1 
ATOM   3368 S SD  . MET B 1 187 ? -17.750 -28.121 -10.514 1.00 102.14 ? 270 MET B SD  1 
ATOM   3369 C CE  . MET B 1 187 ? -17.529 -28.013 -8.731  1.00 107.19 ? 270 MET B CE  1 
ATOM   3370 N N   . THR B 1 188 ? -13.310 -24.556 -12.066 1.00 92.57  ? 271 THR B N   1 
ATOM   3371 C CA  . THR B 1 188 ? -12.023 -23.882 -11.823 1.00 95.21  ? 271 THR B CA  1 
ATOM   3372 C C   . THR B 1 188 ? -11.469 -24.290 -10.465 1.00 102.84 ? 271 THR B C   1 
ATOM   3373 O O   . THR B 1 188 ? -11.780 -23.672 -9.439  1.00 110.97 ? 271 THR B O   1 
ATOM   3374 C CB  . THR B 1 188 ? -12.143 -22.339 -11.869 1.00 95.43  ? 271 THR B CB  1 
ATOM   3375 O OG1 . THR B 1 188 ? -13.389 -21.947 -11.280 1.00 94.21  ? 271 THR B OG1 1 
ATOM   3376 C CG2 . THR B 1 188 ? -12.071 -21.807 -13.312 1.00 92.90  ? 271 THR B CG2 1 
ATOM   3377 N N   . LYS B 1 203 ? -17.789 -23.224 -8.742  1.00 98.76  ? 286 LYS B N   1 
ATOM   3378 C CA  . LYS B 1 203 ? -18.053 -22.458 -9.960  1.00 98.42  ? 286 LYS B CA  1 
ATOM   3379 C C   . LYS B 1 203 ? -17.656 -23.234 -11.227 1.00 95.23  ? 286 LYS B C   1 
ATOM   3380 O O   . LYS B 1 203 ? -16.503 -23.650 -11.376 1.00 97.75  ? 286 LYS B O   1 
ATOM   3381 C CB  . LYS B 1 203 ? -17.292 -21.134 -9.922  1.00 105.96 ? 286 LYS B CB  1 
ATOM   3382 C CG  . LYS B 1 203 ? -17.931 -20.011 -10.727 1.00 106.98 ? 286 LYS B CG  1 
ATOM   3383 C CD  . LYS B 1 203 ? -16.954 -18.858 -10.966 1.00 112.00 ? 286 LYS B CD  1 
ATOM   3384 C CE  . LYS B 1 203 ? -17.694 -17.567 -11.302 1.00 114.70 ? 286 LYS B CE  1 
ATOM   3385 N NZ  . LYS B 1 203 ? -18.620 -17.713 -12.470 1.00 113.38 ? 286 LYS B NZ  1 
ATOM   3386 N N   . PRO B 1 204 ? -18.610 -23.421 -12.158 1.00 90.31  ? 287 PRO B N   1 
ATOM   3387 C CA  . PRO B 1 204 ? -18.308 -24.087 -13.426 1.00 83.88  ? 287 PRO B CA  1 
ATOM   3388 C C   . PRO B 1 204 ? -17.577 -23.147 -14.399 1.00 82.68  ? 287 PRO B C   1 
ATOM   3389 O O   . PRO B 1 204 ? -17.626 -21.910 -14.227 1.00 84.05  ? 287 PRO B O   1 
ATOM   3390 C CB  . PRO B 1 204 ? -19.694 -24.448 -13.965 1.00 78.00  ? 287 PRO B CB  1 
ATOM   3391 C CG  . PRO B 1 204 ? -20.594 -23.406 -13.408 1.00 82.95  ? 287 PRO B CG  1 
ATOM   3392 C CD  . PRO B 1 204 ? -20.000 -22.926 -12.107 1.00 89.16  ? 287 PRO B CD  1 
ATOM   3393 N N   . ILE B 1 205 ? -16.901 -23.716 -15.402 1.00 76.87  ? 288 ILE B N   1 
ATOM   3394 C CA  . ILE B 1 205 ? -16.153 -22.882 -16.349 1.00 73.51  ? 288 ILE B CA  1 
ATOM   3395 C C   . ILE B 1 205 ? -17.102 -22.371 -17.430 1.00 70.18  ? 288 ILE B C   1 
ATOM   3396 O O   . ILE B 1 205 ? -18.191 -22.897 -17.583 1.00 69.80  ? 288 ILE B O   1 
ATOM   3397 C CB  . ILE B 1 205 ? -14.848 -23.540 -16.906 1.00 71.48  ? 288 ILE B CB  1 
ATOM   3398 C CG1 . ILE B 1 205 ? -15.122 -24.755 -17.768 1.00 65.24  ? 288 ILE B CG1 1 
ATOM   3399 C CG2 . ILE B 1 205 ? -13.890 -23.974 -15.790 1.00 74.25  ? 288 ILE B CG2 1 
ATOM   3400 C CD1 . ILE B 1 205 ? -13.876 -25.216 -18.500 1.00 61.39  ? 288 ILE B CD1 1 
ATOM   3401 N N   . GLY B 1 206 ? -16.719 -21.312 -18.128 1.00 71.42  ? 289 GLY B N   1 
ATOM   3402 C CA  . GLY B 1 206 ? -17.462 -20.877 -19.294 1.00 66.12  ? 289 GLY B CA  1 
ATOM   3403 C C   . GLY B 1 206 ? -18.313 -19.644 -19.120 1.00 69.83  ? 289 GLY B C   1 
ATOM   3404 O O   . GLY B 1 206 ? -18.975 -19.208 -20.089 1.00 69.04  ? 289 GLY B O   1 
ATOM   3405 N N   . GLY B 1 207 ? -18.311 -19.102 -17.896 1.00 69.33  ? 290 GLY B N   1 
ATOM   3406 C CA  . GLY B 1 207 ? -19.029 -17.862 -17.548 1.00 69.73  ? 290 GLY B CA  1 
ATOM   3407 C C   . GLY B 1 207 ? -20.437 -17.706 -18.085 1.00 68.56  ? 290 GLY B C   1 
ATOM   3408 O O   . GLY B 1 207 ? -21.164 -18.691 -18.251 1.00 70.29  ? 290 GLY B O   1 
ATOM   3409 N N   . HIS B 1 208 ? -20.807 -16.465 -18.393 1.00 72.09  ? 291 HIS B N   1 
ATOM   3410 C CA  . HIS B 1 208 ? -22.137 -16.123 -18.935 1.00 72.00  ? 291 HIS B CA  1 
ATOM   3411 C C   . HIS B 1 208 ? -22.471 -16.865 -20.213 1.00 68.41  ? 291 HIS B C   1 
ATOM   3412 O O   . HIS B 1 208 ? -23.636 -17.180 -20.463 1.00 67.25  ? 291 HIS B O   1 
ATOM   3413 C CB  . HIS B 1 208 ? -22.268 -14.617 -19.212 1.00 74.17  ? 291 HIS B CB  1 
ATOM   3414 C CG  . HIS B 1 208 ? -22.081 -13.726 -17.999 1.00 87.30  ? 291 HIS B CG  1 
ATOM   3415 N ND1 . HIS B 1 208 ? -21.115 -12.764 -17.940 1.00 93.74  ? 291 HIS B ND1 1 
ATOM   3416 C CD2 . HIS B 1 208 ? -22.802 -13.630 -16.798 1.00 93.98  ? 291 HIS B CD2 1 
ATOM   3417 C CE1 . HIS B 1 208 ? -21.201 -12.104 -16.757 1.00 93.54  ? 291 HIS B CE1 1 
ATOM   3418 N NE2 . HIS B 1 208 ? -22.228 -12.634 -16.057 1.00 95.68  ? 291 HIS B NE2 1 
ATOM   3419 N N   . ILE B 1 209 ? -21.466 -17.130 -21.045 1.00 65.38  ? 292 ILE B N   1 
ATOM   3420 C CA  . ILE B 1 209 ? -21.693 -17.713 -22.356 1.00 66.26  ? 292 ILE B CA  1 
ATOM   3421 C C   . ILE B 1 209 ? -22.304 -19.104 -22.188 1.00 72.05  ? 292 ILE B C   1 
ATOM   3422 O O   . ILE B 1 209 ? -23.351 -19.421 -22.775 1.00 76.86  ? 292 ILE B O   1 
ATOM   3423 C CB  . ILE B 1 209 ? -20.395 -17.810 -23.175 1.00 65.31  ? 292 ILE B CB  1 
ATOM   3424 C CG1 . ILE B 1 209 ? -19.754 -16.440 -23.336 1.00 73.20  ? 292 ILE B CG1 1 
ATOM   3425 C CG2 . ILE B 1 209 ? -20.622 -18.429 -24.543 1.00 59.15  ? 292 ILE B CG2 1 
ATOM   3426 C CD1 . ILE B 1 209 ? -18.457 -16.308 -22.554 1.00 84.50  ? 292 ILE B CD1 1 
ATOM   3427 N N   . LEU B 1 210 ? -21.673 -19.933 -21.368 1.00 72.21  ? 293 LEU B N   1 
ATOM   3428 C CA  . LEU B 1 210 ? -22.186 -21.277 -21.211 1.00 65.73  ? 293 LEU B CA  1 
ATOM   3429 C C   . LEU B 1 210 ? -23.432 -21.288 -20.312 1.00 66.64  ? 293 LEU B C   1 
ATOM   3430 O O   . LEU B 1 210 ? -24.303 -22.140 -20.478 1.00 63.54  ? 293 LEU B O   1 
ATOM   3431 C CB  . LEU B 1 210 ? -21.114 -22.185 -20.653 1.00 64.84  ? 293 LEU B CB  1 
ATOM   3432 C CG  . LEU B 1 210 ? -21.060 -23.588 -21.223 1.00 62.58  ? 293 LEU B CG  1 
ATOM   3433 C CD1 . LEU B 1 210 ? -19.987 -24.353 -20.474 1.00 63.75  ? 293 LEU B CD1 1 
ATOM   3434 C CD2 . LEU B 1 210 ? -22.384 -24.315 -21.132 1.00 61.88  ? 293 LEU B CD2 1 
ATOM   3435 N N   . ALA B 1 211 ? -23.530 -20.355 -19.361 1.00 62.12  ? 294 ALA B N   1 
ATOM   3436 C CA  . ALA B 1 211 ? -24.684 -20.382 -18.465 1.00 58.82  ? 294 ALA B CA  1 
ATOM   3437 C C   . ALA B 1 211 ? -25.930 -20.141 -19.290 1.00 56.07  ? 294 ALA B C   1 
ATOM   3438 O O   . ALA B 1 211 ? -26.945 -20.793 -19.095 1.00 58.65  ? 294 ALA B O   1 
ATOM   3439 C CB  . ALA B 1 211 ? -24.564 -19.359 -17.349 1.00 54.32  ? 294 ALA B CB  1 
ATOM   3440 N N   . HIS B 1 212 ? -25.831 -19.228 -20.249 1.00 55.43  ? 295 HIS B N   1 
ATOM   3441 C CA  . HIS B 1 212 ? -26.976 -18.863 -21.033 1.00 53.93  ? 295 HIS B CA  1 
ATOM   3442 C C   . HIS B 1 212 ? -27.432 -19.968 -21.962 1.00 51.62  ? 295 HIS B C   1 
ATOM   3443 O O   . HIS B 1 212 ? -28.620 -20.111 -22.203 1.00 53.05  ? 295 HIS B O   1 
ATOM   3444 C CB  . HIS B 1 212 ? -26.686 -17.614 -21.825 1.00 56.71  ? 295 HIS B CB  1 
ATOM   3445 C CG  . HIS B 1 212 ? -27.747 -17.302 -22.847 1.00 62.20  ? 295 HIS B CG  1 
ATOM   3446 N ND1 . HIS B 1 212 ? -27.653 -17.707 -24.153 1.00 60.58  ? 295 HIS B ND1 1 
ATOM   3447 C CD2 . HIS B 1 212 ? -28.964 -16.630 -22.723 1.00 62.45  ? 295 HIS B CD2 1 
ATOM   3448 C CE1 . HIS B 1 212 ? -28.746 -17.297 -24.823 1.00 63.85  ? 295 HIS B CE1 1 
ATOM   3449 N NE2 . HIS B 1 212 ? -29.550 -16.635 -23.953 1.00 67.01  ? 295 HIS B NE2 1 
ATOM   3450 N N   . ALA B 1 213 ? -26.493 -20.750 -22.487 1.00 47.95  ? 296 ALA B N   1 
ATOM   3451 C CA  . ALA B 1 213 ? -26.782 -21.711 -23.534 1.00 49.15  ? 296 ALA B CA  1 
ATOM   3452 C C   . ALA B 1 213 ? -27.494 -22.910 -22.986 1.00 51.56  ? 296 ALA B C   1 
ATOM   3453 O O   . ALA B 1 213 ? -28.266 -23.567 -23.711 1.00 54.04  ? 296 ALA B O   1 
ATOM   3454 C CB  . ALA B 1 213 ? -25.514 -22.136 -24.288 1.00 47.32  ? 296 ALA B CB  1 
ATOM   3455 N N   . SER B 1 214 ? -27.244 -23.228 -21.725 1.00 53.28  ? 297 SER B N   1 
ATOM   3456 C CA  . SER B 1 214 ? -27.804 -24.473 -21.209 1.00 57.75  ? 297 SER B CA  1 
ATOM   3457 C C   . SER B 1 214 ? -29.032 -24.111 -20.464 1.00 55.43  ? 297 SER B C   1 
ATOM   3458 O O   . SER B 1 214 ? -28.973 -23.182 -19.661 1.00 61.31  ? 297 SER B O   1 
ATOM   3459 C CB  . SER B 1 214 ? -26.809 -25.304 -20.371 1.00 61.02  ? 297 SER B CB  1 
ATOM   3460 O OG  . SER B 1 214 ? -25.900 -24.518 -19.636 1.00 72.94  ? 297 SER B OG  1 
ATOM   3461 N N   . THR B 1 215 ? -30.147 -24.792 -20.767 1.00 52.21  ? 298 THR B N   1 
ATOM   3462 C CA  . THR B 1 215 ? -31.403 -24.505 -20.077 1.00 58.32  ? 298 THR B CA  1 
ATOM   3463 C C   . THR B 1 215 ? -31.399 -25.103 -18.667 1.00 56.93  ? 298 THR B C   1 
ATOM   3464 O O   . THR B 1 215 ? -31.924 -24.509 -17.751 1.00 62.60  ? 298 THR B O   1 
ATOM   3465 C CB  . THR B 1 215 ? -32.664 -24.930 -20.878 1.00 62.74  ? 298 THR B CB  1 
ATOM   3466 O OG1 . THR B 1 215 ? -32.783 -26.360 -20.833 1.00 83.03  ? 298 THR B OG1 1 
ATOM   3467 C CG2 . THR B 1 215 ? -32.577 -24.445 -22.352 1.00 57.58  ? 298 THR B CG2 1 
ATOM   3468 N N   . THR B 1 216 ? -30.784 -26.266 -18.507 1.00 56.33  ? 299 THR B N   1 
ATOM   3469 C CA  . THR B 1 216 ? -30.720 -26.948 -17.230 1.00 56.75  ? 299 THR B CA  1 
ATOM   3470 C C   . THR B 1 216 ? -29.265 -27.252 -16.872 1.00 57.21  ? 299 THR B C   1 
ATOM   3471 O O   . THR B 1 216 ? -28.519 -27.807 -17.679 1.00 55.12  ? 299 THR B O   1 
ATOM   3472 C CB  . THR B 1 216 ? -31.569 -28.234 -17.259 1.00 56.03  ? 299 THR B CB  1 
ATOM   3473 O OG1 . THR B 1 216 ? -32.950 -27.869 -17.383 1.00 58.70  ? 299 THR B OG1 1 
ATOM   3474 C CG2 . THR B 1 216 ? -31.393 -29.022 -15.996 1.00 53.86  ? 299 THR B CG2 1 
ATOM   3475 N N   . ARG B 1 217 ? -28.881 -26.869 -15.655 1.00 59.89  ? 300 ARG B N   1 
ATOM   3476 C CA  . ARG B 1 217 ? -27.526 -27.054 -15.132 1.00 59.25  ? 300 ARG B CA  1 
ATOM   3477 C C   . ARG B 1 217 ? -27.621 -27.851 -13.858 1.00 64.36  ? 300 ARG B C   1 
ATOM   3478 O O   . ARG B 1 217 ? -28.410 -27.531 -12.945 1.00 67.23  ? 300 ARG B O   1 
ATOM   3479 C CB  . ARG B 1 217 ? -26.846 -25.727 -14.804 1.00 58.87  ? 300 ARG B CB  1 
ATOM   3480 C CG  . ARG B 1 217 ? -26.884 -24.704 -15.916 1.00 57.82  ? 300 ARG B CG  1 
ATOM   3481 C CD  . ARG B 1 217 ? -25.508 -24.506 -16.487 1.00 59.10  ? 300 ARG B CD  1 
ATOM   3482 N NE  . ARG B 1 217 ? -24.943 -23.181 -16.229 1.00 60.74  ? 300 ARG B NE  1 
ATOM   3483 C CZ  . ARG B 1 217 ? -23.645 -22.945 -16.065 1.00 61.50  ? 300 ARG B CZ  1 
ATOM   3484 N NH1 . ARG B 1 217 ? -22.774 -23.949 -16.065 1.00 64.38  ? 300 ARG B NH1 1 
ATOM   3485 N NH2 . ARG B 1 217 ? -23.216 -21.723 -15.860 1.00 60.67  ? 300 ARG B NH2 1 
ATOM   3486 N N   . ILE B 1 218 ? -26.781 -28.868 -13.788 1.00 63.03  ? 301 ILE B N   1 
ATOM   3487 C CA  . ILE B 1 218 ? -26.806 -29.789 -12.706 1.00 64.55  ? 301 ILE B CA  1 
ATOM   3488 C C   . ILE B 1 218 ? -25.421 -29.845 -12.153 1.00 68.26  ? 301 ILE B C   1 
ATOM   3489 O O   . ILE B 1 218 ? -24.439 -30.016 -12.890 1.00 66.24  ? 301 ILE B O   1 
ATOM   3490 C CB  . ILE B 1 218 ? -27.173 -31.157 -13.243 1.00 64.36  ? 301 ILE B CB  1 
ATOM   3491 C CG1 . ILE B 1 218 ? -28.619 -31.142 -13.685 1.00 68.60  ? 301 ILE B CG1 1 
ATOM   3492 C CG2 . ILE B 1 218 ? -26.978 -32.215 -12.196 1.00 66.54  ? 301 ILE B CG2 1 
ATOM   3493 C CD1 . ILE B 1 218 ? -28.806 -31.869 -14.996 1.00 69.01  ? 301 ILE B CD1 1 
ATOM   3494 N N   . SER B 1 219 ? -25.331 -29.705 -10.839 1.00 76.33  ? 302 SER B N   1 
ATOM   3495 C CA  . SER B 1 219 ? -24.064 -29.917 -10.159 1.00 77.26  ? 302 SER B CA  1 
ATOM   3496 C C   . SER B 1 219 ? -24.026 -31.341 -9.591  1.00 79.11  ? 302 SER B C   1 
ATOM   3497 O O   . SER B 1 219 ? -25.075 -31.950 -9.387  1.00 75.98  ? 302 SER B O   1 
ATOM   3498 C CB  . SER B 1 219 ? -23.850 -28.885 -9.077  1.00 80.12  ? 302 SER B CB  1 
ATOM   3499 O OG  . SER B 1 219 ? -24.312 -29.399 -7.848  1.00 92.78  ? 302 SER B OG  1 
ATOM   3500 N N   . LEU B 1 220 ? -22.814 -31.857 -9.357  1.00 80.32  ? 303 LEU B N   1 
ATOM   3501 C CA  . LEU B 1 220 ? -22.603 -33.233 -8.964  1.00 80.69  ? 303 LEU B CA  1 
ATOM   3502 C C   . LEU B 1 220 ? -21.525 -33.314 -7.893  1.00 90.14  ? 303 LEU B C   1 
ATOM   3503 O O   . LEU B 1 220 ? -20.416 -32.801 -8.082  1.00 96.26  ? 303 LEU B O   1 
ATOM   3504 C CB  . LEU B 1 220 ? -22.167 -34.041 -10.174 1.00 77.81  ? 303 LEU B CB  1 
ATOM   3505 C CG  . LEU B 1 220 ? -23.122 -34.238 -11.357 1.00 76.18  ? 303 LEU B CG  1 
ATOM   3506 C CD1 . LEU B 1 220 ? -22.527 -35.210 -12.375 1.00 68.66  ? 303 LEU B CD1 1 
ATOM   3507 C CD2 . LEU B 1 220 ? -24.465 -34.759 -10.866 1.00 75.42  ? 303 LEU B CD2 1 
ATOM   3508 N N   . ARG B 1 221 ? -21.843 -33.968 -6.777  1.00 92.28  ? 304 ARG B N   1 
ATOM   3509 C CA  . ARG B 1 221 ? -20.886 -34.161 -5.681  1.00 95.77  ? 304 ARG B CA  1 
ATOM   3510 C C   . ARG B 1 221 ? -20.956 -35.570 -5.090  1.00 96.05  ? 304 ARG B C   1 
ATOM   3511 O O   . ARG B 1 221 ? -21.887 -36.343 -5.387  1.00 90.35  ? 304 ARG B O   1 
ATOM   3512 C CB  . ARG B 1 221 ? -21.046 -33.086 -4.602  1.00 96.62  ? 304 ARG B CB  1 
ATOM   3513 C CG  . ARG B 1 221 ? -22.482 -32.739 -4.317  1.00 102.12 ? 304 ARG B CG  1 
ATOM   3514 C CD  . ARG B 1 221 ? -22.589 -31.350 -3.721  1.00 111.31 ? 304 ARG B CD  1 
ATOM   3515 N NE  . ARG B 1 221 ? -22.043 -31.321 -2.367  1.00 121.37 ? 304 ARG B NE  1 
ATOM   3516 C CZ  . ARG B 1 221 ? -22.714 -31.680 -1.273  1.00 126.87 ? 304 ARG B CZ  1 
ATOM   3517 N NH1 . ARG B 1 221 ? -23.977 -32.095 -1.367  1.00 124.00 ? 304 ARG B NH1 1 
ATOM   3518 N NH2 . ARG B 1 221 ? -22.119 -31.630 -0.083  1.00 130.21 ? 304 ARG B NH2 1 
ATOM   3519 N N   . LYS B 1 222 ? -19.957 -35.896 -4.271  1.00 94.94  ? 305 LYS B N   1 
ATOM   3520 C CA  . LYS B 1 222 ? -19.759 -37.255 -3.788  1.00 98.22  ? 305 LYS B CA  1 
ATOM   3521 C C   . LYS B 1 222 ? -20.654 -37.545 -2.588  1.00 107.22 ? 305 LYS B C   1 
ATOM   3522 O O   . LYS B 1 222 ? -21.381 -36.673 -2.108  1.00 106.63 ? 305 LYS B O   1 
ATOM   3523 C CB  . LYS B 1 222 ? -18.283 -37.473 -3.433  1.00 99.11  ? 305 LYS B CB  1 
ATOM   3524 C CG  . LYS B 1 222 ? -17.328 -36.739 -4.371  1.00 93.26  ? 305 LYS B CG  1 
ATOM   3525 C CD  . LYS B 1 222 ? -15.870 -36.963 -4.014  1.00 93.55  ? 305 LYS B CD  1 
ATOM   3526 C CE  . LYS B 1 222 ? -15.392 -38.370 -4.349  1.00 90.54  ? 305 LYS B CE  1 
ATOM   3527 N NZ  . LYS B 1 222 ? -15.488 -38.596 -5.811  1.00 91.58  ? 305 LYS B NZ  1 
ATOM   3528 N N   . GLY B 1 223 ? -20.597 -38.777 -2.095  1.00 113.35 ? 306 GLY B N   1 
ATOM   3529 C CA  . GLY B 1 223 ? -21.497 -39.201 -1.031  1.00 113.59 ? 306 GLY B CA  1 
ATOM   3530 C C   . GLY B 1 223 ? -21.026 -40.452 -0.323  1.00 114.90 ? 306 GLY B C   1 
ATOM   3531 O O   . GLY B 1 223 ? -19.915 -40.920 -0.543  1.00 105.89 ? 306 GLY B O   1 
ATOM   3532 N N   . ARG B 1 224 ? -21.902 -40.980 0.532   1.00 127.16 ? 307 ARG B N   1 
ATOM   3533 C CA  . ARG B 1 224 ? -21.630 -42.132 1.395   1.00 133.18 ? 307 ARG B CA  1 
ATOM   3534 C C   . ARG B 1 224 ? -21.060 -43.307 0.579   1.00 132.05 ? 307 ARG B C   1 
ATOM   3535 O O   . ARG B 1 224 ? -21.722 -44.327 0.398   1.00 136.09 ? 307 ARG B O   1 
ATOM   3536 C CB  . ARG B 1 224 ? -22.918 -42.515 2.154   1.00 136.78 ? 307 ARG B CB  1 
ATOM   3537 C CG  . ARG B 1 224 ? -22.733 -43.338 3.418   1.00 141.48 ? 307 ARG B CG  1 
ATOM   3538 C CD  . ARG B 1 224 ? -22.008 -42.547 4.501   1.00 147.47 ? 307 ARG B CD  1 
ATOM   3539 N NE  . ARG B 1 224 ? -21.056 -43.359 5.277   1.00 147.35 ? 307 ARG B NE  1 
ATOM   3540 C CZ  . ARG B 1 224 ? -19.881 -43.811 4.823   1.00 144.69 ? 307 ARG B CZ  1 
ATOM   3541 N NH1 . ARG B 1 224 ? -19.482 -43.565 3.572   1.00 140.09 ? 307 ARG B NH1 1 
ATOM   3542 N NH2 . ARG B 1 224 ? -19.102 -44.528 5.618   1.00 145.01 ? 307 ARG B NH2 1 
ATOM   3543 N N   . GLY B 1 225 ? -19.828 -43.136 0.089   1.00 125.20 ? 308 GLY B N   1 
ATOM   3544 C CA  . GLY B 1 225 ? -19.140 -44.135 -0.720  1.00 119.15 ? 308 GLY B CA  1 
ATOM   3545 C C   . GLY B 1 225 ? -19.411 -43.903 -2.191  1.00 116.03 ? 308 GLY B C   1 
ATOM   3546 O O   . GLY B 1 225 ? -18.675 -43.174 -2.864  1.00 111.58 ? 308 GLY B O   1 
ATOM   3547 N N   . GLU B 1 226 ? -20.488 -44.508 -2.687  1.00 116.02 ? 309 GLU B N   1 
ATOM   3548 C CA  . GLU B 1 226 ? -20.819 -44.476 -4.117  1.00 111.66 ? 309 GLU B CA  1 
ATOM   3549 C C   . GLU B 1 226 ? -22.148 -43.739 -4.387  1.00 111.39 ? 309 GLU B C   1 
ATOM   3550 O O   . GLU B 1 226 ? -22.531 -43.550 -5.543  1.00 102.63 ? 309 GLU B O   1 
ATOM   3551 C CB  . GLU B 1 226 ? -20.787 -45.905 -4.707  1.00 111.14 ? 309 GLU B CB  1 
ATOM   3552 C CG  . GLU B 1 226 ? -22.124 -46.518 -5.123  1.00 113.46 ? 309 GLU B CG  1 
ATOM   3553 C CD  . GLU B 1 226 ? -23.002 -47.003 -3.974  1.00 122.61 ? 309 GLU B CD  1 
ATOM   3554 O OE1 . GLU B 1 226 ? -24.024 -47.668 -4.271  1.00 124.78 ? 309 GLU B OE1 1 
ATOM   3555 O OE2 . GLU B 1 226 ? -22.699 -46.728 -2.786  1.00 122.57 ? 309 GLU B OE2 1 
ATOM   3556 N N   . LEU B 1 227 ? -22.836 -43.336 -3.307  1.00 115.68 ? 310 LEU B N   1 
ATOM   3557 C CA  . LEU B 1 227 ? -23.951 -42.391 -3.385  1.00 114.27 ? 310 LEU B CA  1 
ATOM   3558 C C   . LEU B 1 227 ? -23.451 -41.105 -4.013  1.00 111.32 ? 310 LEU B C   1 
ATOM   3559 O O   . LEU B 1 227 ? -22.294 -40.720 -3.821  1.00 111.40 ? 310 LEU B O   1 
ATOM   3560 C CB  . LEU B 1 227 ? -24.474 -42.040 -2.008  1.00 119.97 ? 310 LEU B CB  1 
ATOM   3561 C CG  . LEU B 1 227 ? -25.365 -43.010 -1.246  1.00 134.00 ? 310 LEU B CG  1 
ATOM   3562 C CD1 . LEU B 1 227 ? -24.595 -44.210 -0.707  1.00 134.54 ? 310 LEU B CD1 1 
ATOM   3563 C CD2 . LEU B 1 227 ? -26.013 -42.255 -0.093  1.00 139.31 ? 310 LEU B CD2 1 
ATOM   3564 N N   . ARG B 1 228 ? -24.327 -40.426 -4.743  1.00 104.06 ? 311 ARG B N   1 
ATOM   3565 C CA  . ARG B 1 228 ? -23.939 -39.209 -5.446  1.00 98.01  ? 311 ARG B CA  1 
ATOM   3566 C C   . ARG B 1 228 ? -25.080 -38.173 -5.457  1.00 94.68  ? 311 ARG B C   1 
ATOM   3567 O O   . ARG B 1 228 ? -26.268 -38.532 -5.330  1.00 96.64  ? 311 ARG B O   1 
ATOM   3568 C CB  . ARG B 1 228 ? -23.418 -39.563 -6.851  1.00 94.03  ? 311 ARG B CB  1 
ATOM   3569 C CG  . ARG B 1 228 ? -21.908 -39.420 -7.046  1.00 91.85  ? 311 ARG B CG  1 
ATOM   3570 C CD  . ARG B 1 228 ? -21.061 -40.622 -6.644  1.00 95.31  ? 311 ARG B CD  1 
ATOM   3571 N NE  . ARG B 1 228 ? -19.787 -40.699 -7.380  1.00 102.76 ? 311 ARG B NE  1 
ATOM   3572 C CZ  . ARG B 1 228 ? -19.467 -39.999 -8.489  1.00 107.04 ? 311 ARG B CZ  1 
ATOM   3573 N NH1 . ARG B 1 228 ? -20.311 -39.102 -9.028  1.00 103.79 ? 311 ARG B NH1 1 
ATOM   3574 N NH2 . ARG B 1 228 ? -18.278 -40.188 -9.070  1.00 96.26  ? 311 ARG B NH2 1 
ATOM   3575 N N   . ILE B 1 229 ? -24.719 -36.892 -5.562  1.00 88.64  ? 312 ILE B N   1 
ATOM   3576 C CA  . ILE B 1 229 ? -25.696 -35.813 -5.325  1.00 90.95  ? 312 ILE B CA  1 
ATOM   3577 C C   . ILE B 1 229 ? -25.819 -34.803 -6.460  1.00 86.37  ? 312 ILE B C   1 
ATOM   3578 O O   . ILE B 1 229 ? -24.885 -34.044 -6.744  1.00 81.21  ? 312 ILE B O   1 
ATOM   3579 C CB  . ILE B 1 229 ? -25.442 -35.039 -3.999  1.00 95.27  ? 312 ILE B CB  1 
ATOM   3580 C CG1 . ILE B 1 229 ? -25.469 -35.972 -2.778  1.00 101.71 ? 312 ILE B CG1 1 
ATOM   3581 C CG2 . ILE B 1 229 ? -26.456 -33.917 -3.820  1.00 94.59  ? 312 ILE B CG2 1 
ATOM   3582 C CD1 . ILE B 1 229 ? -26.794 -36.657 -2.519  1.00 103.19 ? 312 ILE B CD1 1 
ATOM   3583 N N   . ALA B 1 230 ? -27.005 -34.788 -7.068  1.00 85.03  ? 313 ALA B N   1 
ATOM   3584 C CA  . ALA B 1 230 ? -27.336 -33.816 -8.097  1.00 81.18  ? 313 ALA B CA  1 
ATOM   3585 C C   . ALA B 1 230 ? -28.177 -32.723 -7.508  1.00 84.05  ? 313 ALA B C   1 
ATOM   3586 O O   . ALA B 1 230 ? -29.207 -32.994 -6.891  1.00 86.12  ? 313 ALA B O   1 
ATOM   3587 C CB  . ALA B 1 230 ? -28.086 -34.462 -9.250  1.00 77.01  ? 313 ALA B CB  1 
ATOM   3588 N N   . LYS B 1 231 ? -27.719 -31.491 -7.706  1.00 82.49  ? 314 LYS B N   1 
ATOM   3589 C CA  . LYS B 1 231 ? -28.509 -30.307 -7.426  1.00 82.94  ? 314 LYS B CA  1 
ATOM   3590 C C   . LYS B 1 231 ? -28.626 -29.486 -8.721  1.00 77.49  ? 314 LYS B C   1 
ATOM   3591 O O   . LYS B 1 231 ? -27.629 -29.315 -9.433  1.00 71.44  ? 314 LYS B O   1 
ATOM   3592 C CB  . LYS B 1 231 ? -27.883 -29.479 -6.269  1.00 87.07  ? 314 LYS B CB  1 
ATOM   3593 C CG  . LYS B 1 231 ? -28.596 -28.159 -5.970  1.00 88.96  ? 314 LYS B CG  1 
ATOM   3594 C CD  . LYS B 1 231 ? -28.086 -27.478 -4.705  1.00 95.81  ? 314 LYS B CD  1 
ATOM   3595 C CE  . LYS B 1 231 ? -29.123 -26.505 -4.166  1.00 97.56  ? 314 LYS B CE  1 
ATOM   3596 N NZ  . LYS B 1 231 ? -28.625 -25.650 -3.051  1.00 106.46 ? 314 LYS B NZ  1 
ATOM   3597 N N   . ILE B 1 232 ? -29.845 -29.009 -9.021  1.00 75.63  ? 315 ILE B N   1 
ATOM   3598 C CA  . ILE B 1 232 ? -30.057 -27.954 -10.005 1.00 73.55  ? 315 ILE B CA  1 
ATOM   3599 C C   . ILE B 1 232 ? -29.216 -26.783 -9.574  1.00 77.77  ? 315 ILE B C   1 
ATOM   3600 O O   . ILE B 1 232 ? -29.483 -26.191 -8.534  1.00 81.97  ? 315 ILE B O   1 
ATOM   3601 C CB  . ILE B 1 232 ? -31.498 -27.421 -9.982  1.00 72.69  ? 315 ILE B CB  1 
ATOM   3602 C CG1 . ILE B 1 232 ? -32.544 -28.552 -10.028 1.00 74.08  ? 315 ILE B CG1 1 
ATOM   3603 C CG2 . ILE B 1 232 ? -31.679 -26.352 -11.045 1.00 66.46  ? 315 ILE B CG2 1 
ATOM   3604 C CD1 . ILE B 1 232 ? -32.600 -29.374 -11.302 1.00 75.61  ? 315 ILE B CD1 1 
ATOM   3605 N N   . TYR B 1 233 ? -28.192 -26.458 -10.350 1.00 84.67  ? 316 TYR B N   1 
ATOM   3606 C CA  . TYR B 1 233 ? -27.265 -25.388 -9.955  1.00 93.06  ? 316 TYR B CA  1 
ATOM   3607 C C   . TYR B 1 233 ? -28.012 -24.077 -9.803  1.00 96.98  ? 316 TYR B C   1 
ATOM   3608 O O   . TYR B 1 233 ? -28.989 -23.822 -10.514 1.00 94.96  ? 316 TYR B O   1 
ATOM   3609 C CB  . TYR B 1 233 ? -26.096 -25.263 -10.940 1.00 94.17  ? 316 TYR B CB  1 
ATOM   3610 C CG  . TYR B 1 233 ? -25.206 -24.035 -10.767 1.00 97.74  ? 316 TYR B CG  1 
ATOM   3611 C CD1 . TYR B 1 233 ? -24.408 -23.864 -9.617  1.00 97.75  ? 316 TYR B CD1 1 
ATOM   3612 C CD2 . TYR B 1 233 ? -25.135 -23.056 -11.781 1.00 95.18  ? 316 TYR B CD2 1 
ATOM   3613 C CE1 . TYR B 1 233 ? -23.589 -22.743 -9.473  1.00 98.40  ? 316 TYR B CE1 1 
ATOM   3614 C CE2 . TYR B 1 233 ? -24.324 -21.933 -11.642 1.00 96.58  ? 316 TYR B CE2 1 
ATOM   3615 C CZ  . TYR B 1 233 ? -23.555 -21.777 -10.489 1.00 97.89  ? 316 TYR B CZ  1 
ATOM   3616 O OH  . TYR B 1 233 ? -22.751 -20.666 -10.375 1.00 91.09  ? 316 TYR B OH  1 
ATOM   3617 N N   . ASP B 1 234 ? -27.522 -23.266 -8.867  1.00 111.70 ? 317 ASP B N   1 
ATOM   3618 C CA  . ASP B 1 234 ? -28.208 -22.076 -8.324  1.00 121.10 ? 317 ASP B CA  1 
ATOM   3619 C C   . ASP B 1 234 ? -29.491 -22.459 -7.547  1.00 120.79 ? 317 ASP B C   1 
ATOM   3620 O O   . ASP B 1 234 ? -30.605 -22.430 -8.082  1.00 113.55 ? 317 ASP B O   1 
ATOM   3621 C CB  . ASP B 1 234 ? -28.424 -20.963 -9.385  1.00 119.81 ? 317 ASP B CB  1 
ATOM   3622 C CG  . ASP B 1 234 ? -27.865 -19.592 -8.934  1.00 125.47 ? 317 ASP B CG  1 
ATOM   3623 O OD1 . ASP B 1 234 ? -28.556 -18.849 -8.179  1.00 129.81 ? 317 ASP B OD1 1 
ATOM   3624 O OD2 . ASP B 1 234 ? -26.730 -19.258 -9.351  1.00 116.46 ? 317 ASP B OD2 1 
ATOM   3625 N N   . SER B 1 235 ? -29.270 -22.881 -6.298  1.00 128.21 ? 318 SER B N   1 
ATOM   3626 C CA  . SER B 1 235 ? -30.288 -23.076 -5.240  1.00 135.42 ? 318 SER B CA  1 
ATOM   3627 C C   . SER B 1 235 ? -31.768 -23.210 -5.716  1.00 137.29 ? 318 SER B C   1 
ATOM   3628 O O   . SER B 1 235 ? -32.003 -23.823 -6.771  1.00 135.15 ? 318 SER B O   1 
ATOM   3629 C CB  . SER B 1 235 ? -30.088 -21.999 -4.151  1.00 137.68 ? 318 SER B CB  1 
ATOM   3630 O OG  . SER B 1 235 ? -29.034 -22.345 -3.263  1.00 131.29 ? 318 SER B OG  1 
ATOM   3631 N N   . PRO B 1 236 ? -32.767 -22.737 -4.914  1.00 138.71 ? 319 PRO B N   1 
ATOM   3632 C CA  . PRO B 1 236 ? -32.727 -22.396 -3.478  1.00 145.16 ? 319 PRO B CA  1 
ATOM   3633 C C   . PRO B 1 236 ? -32.336 -23.608 -2.617  1.00 145.71 ? 319 PRO B C   1 
ATOM   3634 O O   . PRO B 1 236 ? -32.515 -24.757 -3.051  1.00 138.34 ? 319 PRO B O   1 
ATOM   3635 C CB  . PRO B 1 236 ? -34.165 -21.944 -3.180  1.00 141.16 ? 319 PRO B CB  1 
ATOM   3636 C CG  . PRO B 1 236 ? -34.649 -21.396 -4.480  1.00 134.37 ? 319 PRO B CG  1 
ATOM   3637 C CD  . PRO B 1 236 ? -34.042 -22.298 -5.525  1.00 135.30 ? 319 PRO B CD  1 
ATOM   3638 N N   . GLU B 1 237 ? -31.792 -23.335 -1.426  1.00 148.10 ? 320 GLU B N   1 
ATOM   3639 C CA  . GLU B 1 237 ? -31.279 -24.362 -0.495  1.00 149.26 ? 320 GLU B CA  1 
ATOM   3640 C C   . GLU B 1 237 ? -32.308 -25.432 -0.081  1.00 147.07 ? 320 GLU B C   1 
ATOM   3641 O O   . GLU B 1 237 ? -32.025 -26.273 0.780   1.00 141.75 ? 320 GLU B O   1 
ATOM   3642 C CB  . GLU B 1 237 ? -30.710 -23.696 0.763   1.00 156.98 ? 320 GLU B CB  1 
ATOM   3643 C CG  . GLU B 1 237 ? -29.411 -22.932 0.566   1.00 159.98 ? 320 GLU B CG  1 
ATOM   3644 C CD  . GLU B 1 237 ? -28.888 -22.330 1.861   1.00 169.96 ? 320 GLU B CD  1 
ATOM   3645 O OE1 . GLU B 1 237 ? -27.906 -21.563 1.804   1.00 173.73 ? 320 GLU B OE1 1 
ATOM   3646 O OE2 . GLU B 1 237 ? -29.446 -22.620 2.943   1.00 173.11 ? 320 GLU B OE2 1 
ATOM   3647 N N   . MET B 1 238 ? -33.492 -25.376 -0.699  1.00 147.65 ? 321 MET B N   1 
ATOM   3648 C CA  . MET B 1 238 ? -34.579 -26.346 -0.526  1.00 144.28 ? 321 MET B CA  1 
ATOM   3649 C C   . MET B 1 238 ? -34.179 -27.750 -1.062  1.00 139.86 ? 321 MET B C   1 
ATOM   3650 O O   . MET B 1 238 ? -33.477 -27.860 -2.083  1.00 131.82 ? 321 MET B O   1 
ATOM   3651 C CB  . MET B 1 238 ? -35.840 -25.805 -1.228  1.00 139.62 ? 321 MET B CB  1 
ATOM   3652 C CG  . MET B 1 238 ? -37.180 -26.333 -0.725  1.00 142.53 ? 321 MET B CG  1 
ATOM   3653 S SD  . MET B 1 238 ? -37.765 -25.748 0.885   1.00 148.70 ? 321 MET B SD  1 
ATOM   3654 C CE  . MET B 1 238 ? -39.540 -25.845 0.652   1.00 141.31 ? 321 MET B CE  1 
ATOM   3655 N N   . PRO B 1 239 ? -34.590 -28.825 -0.346  1.00 140.81 ? 322 PRO B N   1 
ATOM   3656 C CA  . PRO B 1 239 ? -34.283 -30.214 -0.734  1.00 132.76 ? 322 PRO B CA  1 
ATOM   3657 C C   . PRO B 1 239 ? -34.764 -30.657 -2.130  1.00 129.42 ? 322 PRO B C   1 
ATOM   3658 O O   . PRO B 1 239 ? -33.955 -31.157 -2.918  1.00 121.58 ? 322 PRO B O   1 
ATOM   3659 C CB  . PRO B 1 239 ? -34.964 -31.037 0.367   1.00 136.93 ? 322 PRO B CB  1 
ATOM   3660 C CG  . PRO B 1 239 ? -34.932 -30.143 1.565   1.00 139.70 ? 322 PRO B CG  1 
ATOM   3661 C CD  . PRO B 1 239 ? -35.154 -28.758 1.023   1.00 141.39 ? 322 PRO B CD  1 
ATOM   3662 N N   . GLU B 1 240 ? -36.053 -30.478 -2.434  1.00 127.94 ? 323 GLU B N   1 
ATOM   3663 C CA  . GLU B 1 240 ? -36.646 -30.964 -3.696  1.00 117.19 ? 323 GLU B CA  1 
ATOM   3664 C C   . GLU B 1 240 ? -35.969 -30.360 -4.925  1.00 114.32 ? 323 GLU B C   1 
ATOM   3665 O O   . GLU B 1 240 ? -36.346 -30.678 -6.070  1.00 111.06 ? 323 GLU B O   1 
ATOM   3666 C CB  . GLU B 1 240 ? -38.162 -30.717 -3.769  1.00 116.73 ? 323 GLU B CB  1 
ATOM   3667 C CG  . GLU B 1 240 ? -38.920 -30.828 -2.453  1.00 126.07 ? 323 GLU B CG  1 
ATOM   3668 C CD  . GLU B 1 240 ? -38.858 -29.550 -1.626  1.00 128.24 ? 323 GLU B CD  1 
ATOM   3669 O OE1 . GLU B 1 240 ? -38.782 -28.443 -2.225  1.00 122.23 ? 323 GLU B OE1 1 
ATOM   3670 O OE2 . GLU B 1 240 ? -38.888 -29.656 -0.375  1.00 128.30 ? 323 GLU B OE2 1 
ATOM   3671 N N   . ASN B 1 241 ? -34.987 -29.483 -4.686  1.00 111.56 ? 324 ASN B N   1 
ATOM   3672 C CA  . ASN B 1 241 ? -34.058 -29.033 -5.740  1.00 109.51 ? 324 ASN B CA  1 
ATOM   3673 C C   . ASN B 1 241 ? -32.799 -29.914 -5.852  1.00 107.35 ? 324 ASN B C   1 
ATOM   3674 O O   . ASN B 1 241 ? -31.894 -29.594 -6.632  1.00 96.13  ? 324 ASN B O   1 
ATOM   3675 C CB  . ASN B 1 241 ? -33.655 -27.566 -5.551  1.00 107.31 ? 324 ASN B CB  1 
ATOM   3676 C CG  . ASN B 1 241 ? -34.811 -26.607 -5.755  1.00 104.13 ? 324 ASN B CG  1 
ATOM   3677 O OD1 . ASN B 1 241 ? -35.586 -26.733 -6.706  1.00 96.92  ? 324 ASN B OD1 1 
ATOM   3678 N ND2 . ASN B 1 241 ? -34.923 -25.629 -4.861  1.00 107.25 ? 324 ASN B ND2 1 
ATOM   3679 N N   . GLU B 1 242 ? -32.772 -31.005 -5.066  1.00 111.80 ? 325 GLU B N   1 
ATOM   3680 C CA  . GLU B 1 242 ? -31.688 -32.011 -5.025  1.00 110.67 ? 325 GLU B CA  1 
ATOM   3681 C C   . GLU B 1 242 ? -32.173 -33.451 -5.244  1.00 110.03 ? 325 GLU B C   1 
ATOM   3682 O O   . GLU B 1 242 ? -33.374 -33.701 -5.376  1.00 116.54 ? 325 GLU B O   1 
ATOM   3683 C CB  . GLU B 1 242 ? -30.957 -31.963 -3.688  1.00 116.42 ? 325 GLU B CB  1 
ATOM   3684 C CG  . GLU B 1 242 ? -29.977 -30.813 -3.544  1.00 117.70 ? 325 GLU B CG  1 
ATOM   3685 C CD  . GLU B 1 242 ? -29.017 -31.004 -2.380  1.00 118.68 ? 325 GLU B CD  1 
ATOM   3686 O OE1 . GLU B 1 242 ? -28.720 -32.164 -2.028  1.00 115.97 ? 325 GLU B OE1 1 
ATOM   3687 O OE2 . GLU B 1 242 ? -28.550 -29.989 -1.823  1.00 116.81 ? 325 GLU B OE2 1 
ATOM   3688 N N   . ALA B 1 243 ? -31.226 -34.391 -5.262  1.00 107.14 ? 326 ALA B N   1 
ATOM   3689 C CA  . ALA B 1 243 ? -31.496 -35.801 -5.593  1.00 102.37 ? 326 ALA B CA  1 
ATOM   3690 C C   . ALA B 1 243 ? -30.278 -36.716 -5.428  1.00 99.67  ? 326 ALA B C   1 
ATOM   3691 O O   . ALA B 1 243 ? -29.134 -36.363 -5.764  1.00 98.17  ? 326 ALA B O   1 
ATOM   3692 C CB  . ALA B 1 243 ? -32.060 -35.935 -6.999  1.00 95.71  ? 326 ALA B CB  1 
ATOM   3693 N N   . THR B 1 244 ? -30.565 -37.909 -4.924  1.00 96.76  ? 327 THR B N   1 
ATOM   3694 C CA  . THR B 1 244 ? -29.560 -38.899 -4.595  1.00 94.93  ? 327 THR B CA  1 
ATOM   3695 C C   . THR B 1 244 ? -29.697 -40.050 -5.544  1.00 89.16  ? 327 THR B C   1 
ATOM   3696 O O   . THR B 1 244 ? -30.804 -40.574 -5.751  1.00 87.68  ? 327 THR B O   1 
ATOM   3697 C CB  . THR B 1 244 ? -29.770 -39.431 -3.162  1.00 99.13  ? 327 THR B CB  1 
ATOM   3698 O OG1 . THR B 1 244 ? -29.375 -38.426 -2.232  1.00 104.15 ? 327 THR B OG1 1 
ATOM   3699 C CG2 . THR B 1 244 ? -28.949 -40.687 -2.892  1.00 101.44 ? 327 THR B CG2 1 
ATOM   3700 N N   . PHE B 1 245 ? -28.557 -40.452 -6.088  1.00 85.68  ? 328 PHE B N   1 
ATOM   3701 C CA  . PHE B 1 245 ? -28.469 -41.612 -6.972  1.00 88.09  ? 328 PHE B CA  1 
ATOM   3702 C C   . PHE B 1 245 ? -27.155 -42.351 -6.709  1.00 90.19  ? 328 PHE B C   1 
ATOM   3703 O O   . PHE B 1 245 ? -26.230 -41.779 -6.126  1.00 94.38  ? 328 PHE B O   1 
ATOM   3704 C CB  . PHE B 1 245 ? -28.547 -41.160 -8.446  1.00 82.08  ? 328 PHE B CB  1 
ATOM   3705 C CG  . PHE B 1 245 ? -27.336 -40.392 -8.917  1.00 77.06  ? 328 PHE B CG  1 
ATOM   3706 C CD1 . PHE B 1 245 ? -26.307 -41.040 -9.610  1.00 73.30  ? 328 PHE B CD1 1 
ATOM   3707 C CD2 . PHE B 1 245 ? -27.214 -39.017 -8.660  1.00 76.90  ? 328 PHE B CD2 1 
ATOM   3708 C CE1 . PHE B 1 245 ? -25.177 -40.332 -10.044 1.00 70.12  ? 328 PHE B CE1 1 
ATOM   3709 C CE2 . PHE B 1 245 ? -26.093 -38.302 -9.090  1.00 75.12  ? 328 PHE B CE2 1 
ATOM   3710 C CZ  . PHE B 1 245 ? -25.072 -38.961 -9.794  1.00 72.77  ? 328 PHE B CZ  1 
ATOM   3711 N N   . ALA B 1 246 ? -27.056 -43.606 -7.140  1.00 88.72  ? 329 ALA B N   1 
ATOM   3712 C CA  . ALA B 1 246 ? -25.768 -44.301 -7.047  1.00 88.53  ? 329 ALA B CA  1 
ATOM   3713 C C   . ALA B 1 246 ? -25.131 -44.644 -8.415  1.00 79.79  ? 329 ALA B C   1 
ATOM   3714 O O   . ALA B 1 246 ? -25.792 -44.649 -9.440  1.00 73.83  ? 329 ALA B O   1 
ATOM   3715 C CB  . ALA B 1 246 ? -25.853 -45.519 -6.124  1.00 88.02  ? 329 ALA B CB  1 
ATOM   3716 N N   . ILE B 1 247 ? -23.826 -44.863 -8.387  1.00 80.06  ? 330 ILE B N   1 
ATOM   3717 C CA  . ILE B 1 247 ? -23.060 -45.382 -9.497  1.00 84.16  ? 330 ILE B CA  1 
ATOM   3718 C C   . ILE B 1 247 ? -22.964 -46.891 -9.265  1.00 88.86  ? 330 ILE B C   1 
ATOM   3719 O O   . ILE B 1 247 ? -22.869 -47.324 -8.125  1.00 96.89  ? 330 ILE B O   1 
ATOM   3720 C CB  . ILE B 1 247 ? -21.661 -44.711 -9.553  1.00 84.78  ? 330 ILE B CB  1 
ATOM   3721 C CG1 . ILE B 1 247 ? -20.938 -44.778 -8.180  1.00 92.58  ? 330 ILE B CG1 1 
ATOM   3722 C CG2 . ILE B 1 247 ? -21.803 -43.246 -9.968  1.00 78.67  ? 330 ILE B CG2 1 
ATOM   3723 C CD1 . ILE B 1 247 ? -19.838 -45.837 -7.983  1.00 93.55  ? 330 ILE B CD1 1 
ATOM   3724 N N   . THR B 1 248 ? -23.018 -47.702 -10.317 1.00 86.38  ? 331 THR B N   1 
ATOM   3725 C CA  . THR B 1 248 ? -22.999 -49.160 -10.141 1.00 87.16  ? 331 THR B CA  1 
ATOM   3726 C C   . THR B 1 248 ? -22.448 -49.808 -11.378 1.00 86.70  ? 331 THR B C   1 
ATOM   3727 O O   . THR B 1 248 ? -22.204 -49.147 -12.399 1.00 83.16  ? 331 THR B O   1 
ATOM   3728 C CB  . THR B 1 248 ? -24.411 -49.745 -10.029 1.00 87.40  ? 331 THR B CB  1 
ATOM   3729 O OG1 . THR B 1 248 ? -25.147 -49.344 -11.184 1.00 85.10  ? 331 THR B OG1 1 
ATOM   3730 C CG2 . THR B 1 248 ? -25.128 -49.233 -8.824  1.00 89.55  ? 331 THR B CG2 1 
ATOM   3731 N N   . ALA B 1 249 ? -22.316 -51.124 -11.316 1.00 87.87  ? 332 ALA B N   1 
ATOM   3732 C CA  . ALA B 1 249 ? -21.971 -51.879 -12.507 1.00 86.94  ? 332 ALA B CA  1 
ATOM   3733 C C   . ALA B 1 249 ? -22.894 -51.449 -13.664 1.00 81.89  ? 332 ALA B C   1 
ATOM   3734 O O   . ALA B 1 249 ? -22.434 -51.170 -14.752 1.00 81.10  ? 332 ALA B O   1 
ATOM   3735 C CB  . ALA B 1 249 ? -22.083 -53.373 -12.230 1.00 87.94  ? 332 ALA B CB  1 
ATOM   3736 N N   . GLY B 1 250 ? -24.193 -51.350 -13.397 1.00 82.61  ? 333 GLY B N   1 
ATOM   3737 C CA  . GLY B 1 250 ? -25.166 -51.030 -14.418 1.00 73.86  ? 333 GLY B CA  1 
ATOM   3738 C C   . GLY B 1 250 ? -25.405 -49.548 -14.583 1.00 74.03  ? 333 GLY B C   1 
ATOM   3739 O O   . GLY B 1 250 ? -26.437 -49.162 -15.112 1.00 75.14  ? 333 GLY B O   1 
ATOM   3740 N N   . GLY B 1 251 ? -24.467 -48.709 -14.137 1.00 74.80  ? 334 GLY B N   1 
ATOM   3741 C CA  . GLY B 1 251 ? -24.523 -47.250 -14.422 1.00 70.76  ? 334 GLY B CA  1 
ATOM   3742 C C   . GLY B 1 251 ? -25.292 -46.435 -13.401 1.00 73.37  ? 334 GLY B C   1 
ATOM   3743 O O   . GLY B 1 251 ? -25.372 -46.816 -12.230 1.00 78.59  ? 334 GLY B O   1 
ATOM   3744 N N   . ILE B 1 252 ? -25.862 -45.314 -13.835 1.00 68.41  ? 335 ILE B N   1 
ATOM   3745 C CA  . ILE B 1 252 ? -26.663 -44.473 -12.936 1.00 68.86  ? 335 ILE B CA  1 
ATOM   3746 C C   . ILE B 1 252 ? -27.937 -45.201 -12.441 1.00 71.48  ? 335 ILE B C   1 
ATOM   3747 O O   . ILE B 1 252 ? -28.792 -45.593 -13.257 1.00 68.16  ? 335 ILE B O   1 
ATOM   3748 C CB  . ILE B 1 252 ? -27.073 -43.126 -13.598 1.00 65.80  ? 335 ILE B CB  1 
ATOM   3749 C CG1 . ILE B 1 252 ? -26.089 -41.989 -13.321 1.00 61.66  ? 335 ILE B CG1 1 
ATOM   3750 C CG2 . ILE B 1 252 ? -28.362 -42.606 -12.963 1.00 69.58  ? 335 ILE B CG2 1 
ATOM   3751 C CD1 . ILE B 1 252 ? -24.630 -42.332 -13.334 1.00 60.55  ? 335 ILE B CD1 1 
ATOM   3752 N N   . GLY B 1 253 ? -28.055 -45.364 -11.118 1.00 72.84  ? 336 GLY B N   1 
ATOM   3753 C CA  . GLY B 1 253 ? -29.256 -45.935 -10.486 1.00 76.42  ? 336 GLY B CA  1 
ATOM   3754 C C   . GLY B 1 253 ? -29.665 -45.231 -9.193  1.00 82.46  ? 336 GLY B C   1 
ATOM   3755 O O   . GLY B 1 253 ? -29.102 -44.194 -8.844  1.00 80.77  ? 336 GLY B O   1 
ATOM   3756 N N   . ASP B 1 254 ? -30.641 -45.797 -8.480  1.00 88.78  ? 337 ASP B N   1 
ATOM   3757 C CA  . ASP B 1 254 ? -31.129 -45.220 -7.209  1.00 95.66  ? 337 ASP B CA  1 
ATOM   3758 C C   . ASP B 1 254 ? -30.384 -45.760 -5.996  1.00 98.54  ? 337 ASP B C   1 
ATOM   3759 O O   . ASP B 1 254 ? -29.630 -46.718 -6.096  1.00 102.13 ? 337 ASP B O   1 
ATOM   3760 C CB  . ASP B 1 254 ? -32.639 -45.481 -6.998  1.00 97.82  ? 337 ASP B CB  1 
ATOM   3761 C CG  . ASP B 1 254 ? -33.495 -45.049 -8.187  1.00 99.02  ? 337 ASP B CG  1 
ATOM   3762 O OD1 . ASP B 1 254 ? -33.649 -43.817 -8.454  1.00 94.51  ? 337 ASP B OD1 1 
ATOM   3763 O OD2 . ASP B 1 254 ? -34.033 -45.970 -8.839  1.00 99.64  ? 337 ASP B OD2 1 
ATOM   3764 N N   . ALA B 1 255 ? -30.597 -45.106 -4.857  1.00 103.24 ? 338 ALA B N   1 
ATOM   3765 C CA  . ALA B 1 255 ? -30.401 -45.691 -3.525  1.00 104.35 ? 338 ALA B CA  1 
ATOM   3766 C C   . ALA B 1 255 ? -29.873 -47.124 -3.594  1.00 105.00 ? 338 ALA B C   1 
ATOM   3767 O O   . ALA B 1 255 ? -30.263 -47.984 -2.808  1.00 110.21 ? 338 ALA B O   1 
ATOM   3768 C CB  . ALA B 1 255 ? -31.718 -45.640 -2.753  1.00 103.75 ? 338 ALA B CB  1 
ATOM   3769 N N   . GLY C 1 1   ? 31.182  -27.780 -46.740 1.00 75.16  ? 84  GLY C N   1 
ATOM   3770 C CA  . GLY C 1 1   ? 30.593  -28.233 -48.076 1.00 66.09  ? 84  GLY C CA  1 
ATOM   3771 C C   . GLY C 1 1   ? 31.683  -28.892 -48.911 1.00 64.34  ? 84  GLY C C   1 
ATOM   3772 O O   . GLY C 1 1   ? 31.398  -29.739 -49.738 1.00 63.99  ? 84  GLY C O   1 
ATOM   3773 N N   . PHE C 1 2   ? 32.940  -28.543 -48.627 1.00 61.61  ? 85  PHE C N   1 
ATOM   3774 C CA  . PHE C 1 2   ? 34.079  -28.909 -49.441 1.00 59.31  ? 85  PHE C CA  1 
ATOM   3775 C C   . PHE C 1 2   ? 34.668  -30.201 -49.042 1.00 58.21  ? 85  PHE C C   1 
ATOM   3776 O O   . PHE C 1 2   ? 34.795  -30.464 -47.873 1.00 62.49  ? 85  PHE C O   1 
ATOM   3777 C CB  . PHE C 1 2   ? 35.186  -27.857 -49.314 1.00 60.15  ? 85  PHE C CB  1 
ATOM   3778 C CG  . PHE C 1 2   ? 34.809  -26.557 -49.916 1.00 61.86  ? 85  PHE C CG  1 
ATOM   3779 C CD1 . PHE C 1 2   ? 33.989  -25.680 -49.223 1.00 61.48  ? 85  PHE C CD1 1 
ATOM   3780 C CD2 . PHE C 1 2   ? 35.183  -26.248 -51.218 1.00 59.88  ? 85  PHE C CD2 1 
ATOM   3781 C CE1 . PHE C 1 2   ? 33.594  -24.486 -49.797 1.00 61.06  ? 85  PHE C CE1 1 
ATOM   3782 C CE2 . PHE C 1 2   ? 34.790  -25.066 -51.789 1.00 59.43  ? 85  PHE C CE2 1 
ATOM   3783 C CZ  . PHE C 1 2   ? 34.001  -24.171 -51.072 1.00 58.84  ? 85  PHE C CZ  1 
ATOM   3784 N N   . LEU C 1 3   ? 35.048  -30.981 -50.042 1.00 56.57  ? 86  LEU C N   1 
ATOM   3785 C CA  . LEU C 1 3   ? 35.921  -32.132 -49.879 1.00 55.10  ? 86  LEU C CA  1 
ATOM   3786 C C   . LEU C 1 3   ? 37.047  -32.079 -50.919 1.00 54.04  ? 86  LEU C C   1 
ATOM   3787 O O   . LEU C 1 3   ? 37.023  -31.245 -51.822 1.00 56.34  ? 86  LEU C O   1 
ATOM   3788 C CB  . LEU C 1 3   ? 35.123  -33.439 -49.933 1.00 50.99  ? 86  LEU C CB  1 
ATOM   3789 C CG  . LEU C 1 3   ? 34.320  -33.911 -51.124 1.00 48.43  ? 86  LEU C CG  1 
ATOM   3790 C CD1 . LEU C 1 3   ? 33.516  -35.102 -50.638 1.00 44.60  ? 86  LEU C CD1 1 
ATOM   3791 C CD2 . LEU C 1 3   ? 33.362  -32.871 -51.710 1.00 49.09  ? 86  LEU C CD2 1 
ATOM   3792 N N   . THR C 1 4   ? 38.066  -32.917 -50.777 1.00 52.65  ? 87  THR C N   1 
ATOM   3793 C CA  . THR C 1 4   ? 39.137  -32.897 -51.759 1.00 49.92  ? 87  THR C CA  1 
ATOM   3794 C C   . THR C 1 4   ? 38.633  -33.641 -52.962 1.00 46.25  ? 87  THR C C   1 
ATOM   3795 O O   . THR C 1 4   ? 37.685  -34.396 -52.847 1.00 44.30  ? 87  THR C O   1 
ATOM   3796 C CB  . THR C 1 4   ? 40.442  -33.510 -51.231 1.00 51.98  ? 87  THR C CB  1 
ATOM   3797 O OG1 . THR C 1 4   ? 40.225  -34.860 -50.857 1.00 54.70  ? 87  THR C OG1 1 
ATOM   3798 C CG2 . THR C 1 4   ? 40.913  -32.767 -50.025 1.00 53.29  ? 87  THR C CG2 1 
ATOM   3799 N N   . ALA C 1 5   ? 39.211  -33.388 -54.127 1.00 45.92  ? 88  ALA C N   1 
ATOM   3800 C CA  . ALA C 1 5   ? 38.753  -34.061 -55.329 1.00 45.56  ? 88  ALA C CA  1 
ATOM   3801 C C   . ALA C 1 5   ? 39.030  -35.547 -55.153 1.00 48.07  ? 88  ALA C C   1 
ATOM   3802 O O   . ALA C 1 5   ? 38.240  -36.351 -55.582 1.00 50.62  ? 88  ALA C O   1 
ATOM   3803 C CB  . ALA C 1 5   ? 39.406  -33.496 -56.581 1.00 45.55  ? 88  ALA C CB  1 
ATOM   3804 N N   . PHE C 1 6   ? 40.093  -35.906 -54.435 1.00 51.27  ? 89  PHE C N   1 
ATOM   3805 C CA  . PHE C 1 6   ? 40.335  -37.296 -54.100 1.00 54.40  ? 89  PHE C CA  1 
ATOM   3806 C C   . PHE C 1 6   ? 39.135  -37.921 -53.390 1.00 54.88  ? 89  PHE C C   1 
ATOM   3807 O O   . PHE C 1 6   ? 38.675  -39.017 -53.773 1.00 53.86  ? 89  PHE C O   1 
ATOM   3808 C CB  . PHE C 1 6   ? 41.597  -37.468 -53.239 1.00 58.50  ? 89  PHE C CB  1 
ATOM   3809 C CG  . PHE C 1 6   ? 41.851  -38.894 -52.831 1.00 59.52  ? 89  PHE C CG  1 
ATOM   3810 C CD1 . PHE C 1 6   ? 42.782  -39.673 -53.516 1.00 65.11  ? 89  PHE C CD1 1 
ATOM   3811 C CD2 . PHE C 1 6   ? 41.132  -39.475 -51.792 1.00 60.87  ? 89  PHE C CD2 1 
ATOM   3812 C CE1 . PHE C 1 6   ? 42.981  -41.016 -53.173 1.00 68.31  ? 89  PHE C CE1 1 
ATOM   3813 C CE2 . PHE C 1 6   ? 41.328  -40.809 -51.441 1.00 63.64  ? 89  PHE C CE2 1 
ATOM   3814 C CZ  . PHE C 1 6   ? 42.261  -41.578 -52.133 1.00 65.13  ? 89  PHE C CZ  1 
ATOM   3815 N N   . GLU C 1 7   ? 38.653  -37.245 -52.343 1.00 55.05  ? 90  GLU C N   1 
ATOM   3816 C CA  . GLU C 1 7   ? 37.456  -37.714 -51.633 1.00 55.54  ? 90  GLU C CA  1 
ATOM   3817 C C   . GLU C 1 7   ? 36.259  -37.750 -52.558 1.00 51.27  ? 90  GLU C C   1 
ATOM   3818 O O   . GLU C 1 7   ? 35.410  -38.623 -52.451 1.00 52.45  ? 90  GLU C O   1 
ATOM   3819 C CB  . GLU C 1 7   ? 37.142  -36.859 -50.424 1.00 55.25  ? 90  GLU C CB  1 
ATOM   3820 C CG  . GLU C 1 7   ? 38.173  -36.985 -49.330 1.00 63.34  ? 90  GLU C CG  1 
ATOM   3821 C CD  . GLU C 1 7   ? 38.084  -35.862 -48.313 1.00 68.52  ? 90  GLU C CD  1 
ATOM   3822 O OE1 . GLU C 1 7   ? 38.144  -36.187 -47.109 1.00 73.72  ? 90  GLU C OE1 1 
ATOM   3823 O OE2 . GLU C 1 7   ? 37.958  -34.665 -48.704 1.00 66.93  ? 90  GLU C OE2 1 
ATOM   3824 N N   . TYR C 1 8   ? 36.212  -36.823 -53.492 1.00 49.39  ? 91  TYR C N   1 
ATOM   3825 C CA  . TYR C 1 8   ? 35.066  -36.764 -54.372 1.00 50.12  ? 91  TYR C CA  1 
ATOM   3826 C C   . TYR C 1 8   ? 35.140  -37.854 -55.461 1.00 51.07  ? 91  TYR C C   1 
ATOM   3827 O O   . TYR C 1 8   ? 34.129  -38.419 -55.860 1.00 51.99  ? 91  TYR C O   1 
ATOM   3828 C CB  . TYR C 1 8   ? 34.897  -35.358 -54.943 1.00 45.42  ? 91  TYR C CB  1 
ATOM   3829 C CG  . TYR C 1 8   ? 33.687  -35.222 -55.812 1.00 42.56  ? 91  TYR C CG  1 
ATOM   3830 C CD1 . TYR C 1 8   ? 32.397  -35.425 -55.293 1.00 42.33  ? 91  TYR C CD1 1 
ATOM   3831 C CD2 . TYR C 1 8   ? 33.819  -34.847 -57.157 1.00 42.25  ? 91  TYR C CD2 1 
ATOM   3832 C CE1 . TYR C 1 8   ? 31.265  -35.279 -56.094 1.00 40.39  ? 91  TYR C CE1 1 
ATOM   3833 C CE2 . TYR C 1 8   ? 32.713  -34.724 -57.976 1.00 42.82  ? 91  TYR C CE2 1 
ATOM   3834 C CZ  . TYR C 1 8   ? 31.434  -34.952 -57.441 1.00 44.32  ? 91  TYR C CZ  1 
ATOM   3835 O OH  . TYR C 1 8   ? 30.334  -34.820 -58.278 1.00 46.43  ? 91  TYR C OH  1 
ATOM   3836 N N   . SER C 1 9   ? 36.344  -38.147 -55.931 1.00 51.79  ? 92  SER C N   1 
ATOM   3837 C CA  . SER C 1 9   ? 36.582  -39.280 -56.801 1.00 52.38  ? 92  SER C CA  1 
ATOM   3838 C C   . SER C 1 9   ? 36.138  -40.594 -56.174 1.00 54.18  ? 92  SER C C   1 
ATOM   3839 O O   . SER C 1 9   ? 35.636  -41.468 -56.873 1.00 55.76  ? 92  SER C O   1 
ATOM   3840 C CB  . SER C 1 9   ? 38.069  -39.374 -57.124 1.00 51.29  ? 92  SER C CB  1 
ATOM   3841 O OG  . SER C 1 9   ? 38.425  -40.726 -57.327 1.00 54.42  ? 92  SER C OG  1 
ATOM   3842 N N   . GLU C 1 10  ? 36.382  -40.753 -54.874 1.00 55.57  ? 93  GLU C N   1 
ATOM   3843 C CA  . GLU C 1 10  ? 35.860  -41.897 -54.103 1.00 58.79  ? 93  GLU C CA  1 
ATOM   3844 C C   . GLU C 1 10  ? 34.336  -41.975 -54.163 1.00 58.42  ? 93  GLU C C   1 
ATOM   3845 O O   . GLU C 1 10  ? 33.742  -43.050 -54.354 1.00 63.36  ? 93  GLU C O   1 
ATOM   3846 C CB  . GLU C 1 10  ? 36.271  -41.777 -52.635 1.00 61.69  ? 93  GLU C CB  1 
ATOM   3847 C CG  . GLU C 1 10  ? 37.759  -41.874 -52.383 1.00 70.32  ? 93  GLU C CG  1 
ATOM   3848 C CD  . GLU C 1 10  ? 38.285  -43.271 -52.659 1.00 77.48  ? 93  GLU C CD  1 
ATOM   3849 O OE1 . GLU C 1 10  ? 38.530  -44.004 -51.676 1.00 80.85  ? 93  GLU C OE1 1 
ATOM   3850 O OE2 . GLU C 1 10  ? 38.420  -43.651 -53.850 1.00 79.44  ? 93  GLU C OE2 1 
ATOM   3851 N N   . LYS C 1 11  ? 33.697  -40.824 -53.981 1.00 56.40  ? 94  LYS C N   1 
ATOM   3852 C CA  . LYS C 1 11  ? 32.255  -40.766 -54.019 1.00 54.69  ? 94  LYS C CA  1 
ATOM   3853 C C   . LYS C 1 11  ? 31.839  -41.117 -55.436 1.00 52.29  ? 94  LYS C C   1 
ATOM   3854 O O   . LYS C 1 11  ? 30.999  -41.948 -55.618 1.00 56.40  ? 94  LYS C O   1 
ATOM   3855 C CB  . LYS C 1 11  ? 31.757  -39.396 -53.549 1.00 54.15  ? 94  LYS C CB  1 
ATOM   3856 C CG  . LYS C 1 11  ? 30.294  -39.280 -53.134 1.00 54.06  ? 94  LYS C CG  1 
ATOM   3857 C CD  . LYS C 1 11  ? 30.190  -38.096 -52.174 1.00 57.80  ? 94  LYS C CD  1 
ATOM   3858 C CE  . LYS C 1 11  ? 29.192  -37.018 -52.616 1.00 56.65  ? 94  LYS C CE  1 
ATOM   3859 N NZ  . LYS C 1 11  ? 27.802  -37.443 -52.398 1.00 57.84  ? 94  LYS C NZ  1 
ATOM   3860 N N   . ARG C 1 12  ? 32.480  -40.559 -56.444 1.00 52.22  ? 95  ARG C N   1 
ATOM   3861 C CA  . ARG C 1 12  ? 32.141  -40.965 -57.811 1.00 53.55  ? 95  ARG C CA  1 
ATOM   3862 C C   . ARG C 1 12  ? 32.461  -42.403 -58.203 1.00 52.15  ? 95  ARG C C   1 
ATOM   3863 O O   . ARG C 1 12  ? 31.837  -42.870 -59.097 1.00 54.48  ? 95  ARG C O   1 
ATOM   3864 C CB  . ARG C 1 12  ? 32.725  -40.036 -58.868 1.00 51.62  ? 95  ARG C CB  1 
ATOM   3865 C CG  . ARG C 1 12  ? 32.260  -38.611 -58.747 1.00 49.62  ? 95  ARG C CG  1 
ATOM   3866 C CD  . ARG C 1 12  ? 32.157  -38.017 -60.139 1.00 53.20  ? 95  ARG C CD  1 
ATOM   3867 N NE  . ARG C 1 12  ? 30.857  -37.360 -60.244 1.00 55.94  ? 95  ARG C NE  1 
ATOM   3868 C CZ  . ARG C 1 12  ? 29.855  -37.791 -60.996 1.00 48.71  ? 95  ARG C CZ  1 
ATOM   3869 N NH1 . ARG C 1 12  ? 29.971  -38.848 -61.773 1.00 50.63  ? 95  ARG C NH1 1 
ATOM   3870 N NH2 . ARG C 1 12  ? 28.735  -37.149 -60.965 1.00 49.32  ? 95  ARG C NH2 1 
ATOM   3871 N N   . LYS C 1 13  ? 33.415  -43.101 -57.589 1.00 55.16  ? 96  LYS C N   1 
ATOM   3872 C CA  . LYS C 1 13  ? 33.648  -44.508 -57.965 1.00 59.83  ? 96  LYS C CA  1 
ATOM   3873 C C   . LYS C 1 13  ? 32.320  -45.265 -57.895 1.00 59.01  ? 96  LYS C C   1 
ATOM   3874 O O   . LYS C 1 13  ? 32.080  -46.190 -58.649 1.00 64.31  ? 96  LYS C O   1 
ATOM   3875 C CB  . LYS C 1 13  ? 34.656  -45.242 -57.055 1.00 66.73  ? 96  LYS C CB  1 
ATOM   3876 C CG  . LYS C 1 13  ? 36.138  -44.921 -57.224 1.00 75.00  ? 96  LYS C CG  1 
ATOM   3877 C CD  . LYS C 1 13  ? 36.737  -45.383 -58.553 1.00 82.19  ? 96  LYS C CD  1 
ATOM   3878 C CE  . LYS C 1 13  ? 38.188  -44.917 -58.699 1.00 83.51  ? 96  LYS C CE  1 
ATOM   3879 N NZ  . LYS C 1 13  ? 38.660  -44.838 -60.110 1.00 79.61  ? 96  LYS C NZ  1 
ATOM   3880 N N   . MET C 1 14  ? 31.455  -44.854 -56.990 1.00 57.41  ? 97  MET C N   1 
ATOM   3881 C CA  . MET C 1 14  ? 30.223  -45.559 -56.749 1.00 54.72  ? 97  MET C CA  1 
ATOM   3882 C C   . MET C 1 14  ? 29.060  -45.194 -57.649 1.00 49.91  ? 97  MET C C   1 
ATOM   3883 O O   . MET C 1 14  ? 28.031  -45.806 -57.538 1.00 50.81  ? 97  MET C O   1 
ATOM   3884 C CB  . MET C 1 14  ? 29.833  -45.380 -55.305 1.00 55.68  ? 97  MET C CB  1 
ATOM   3885 C CG  . MET C 1 14  ? 30.852  -46.032 -54.403 1.00 66.80  ? 97  MET C CG  1 
ATOM   3886 S SD  . MET C 1 14  ? 30.651  -45.608 -52.653 1.00 91.14  ? 97  MET C SD  1 
ATOM   3887 C CE  . MET C 1 14  ? 29.809  -44.020 -52.613 1.00 79.97  ? 97  MET C CE  1 
ATOM   3888 N N   . VAL C 1 15  ? 29.213  -44.208 -58.524 1.00 49.97  ? 98  VAL C N   1 
ATOM   3889 C CA  . VAL C 1 15  ? 28.177  -43.845 -59.515 1.00 50.59  ? 98  VAL C CA  1 
ATOM   3890 C C   . VAL C 1 15  ? 27.816  -45.025 -60.404 1.00 52.05  ? 98  VAL C C   1 
ATOM   3891 O O   . VAL C 1 15  ? 28.686  -45.664 -60.950 1.00 60.02  ? 98  VAL C O   1 
ATOM   3892 C CB  . VAL C 1 15  ? 28.645  -42.662 -60.402 1.00 48.39  ? 98  VAL C CB  1 
ATOM   3893 C CG1 . VAL C 1 15  ? 27.841  -42.492 -61.700 1.00 42.13  ? 98  VAL C CG1 1 
ATOM   3894 C CG2 . VAL C 1 15  ? 28.599  -41.405 -59.571 1.00 50.39  ? 98  VAL C CG2 1 
ATOM   3895 N N   . PHE C 1 16  ? 26.533  -45.285 -60.578 1.00 51.75  ? 99  PHE C N   1 
ATOM   3896 C CA  . PHE C 1 16  ? 26.098  -46.409 -61.396 1.00 51.81  ? 99  PHE C CA  1 
ATOM   3897 C C   . PHE C 1 16  ? 25.089  -45.973 -62.468 1.00 51.65  ? 99  PHE C C   1 
ATOM   3898 O O   . PHE C 1 16  ? 24.646  -44.827 -62.460 1.00 54.09  ? 99  PHE C O   1 
ATOM   3899 C CB  . PHE C 1 16  ? 25.489  -47.442 -60.468 1.00 48.33  ? 99  PHE C CB  1 
ATOM   3900 C CG  . PHE C 1 16  ? 24.346  -46.922 -59.658 1.00 44.54  ? 99  PHE C CG  1 
ATOM   3901 C CD1 . PHE C 1 16  ? 23.071  -46.770 -60.232 1.00 44.24  ? 99  PHE C CD1 1 
ATOM   3902 C CD2 . PHE C 1 16  ? 24.521  -46.589 -58.314 1.00 41.78  ? 99  PHE C CD2 1 
ATOM   3903 C CE1 . PHE C 1 16  ? 21.991  -46.283 -59.467 1.00 44.95  ? 99  PHE C CE1 1 
ATOM   3904 C CE2 . PHE C 1 16  ? 23.449  -46.135 -57.537 1.00 40.48  ? 99  PHE C CE2 1 
ATOM   3905 C CZ  . PHE C 1 16  ? 22.182  -45.963 -58.103 1.00 41.40  ? 99  PHE C CZ  1 
ATOM   3906 N N   . HIS C 1 17  ? 24.709  -46.884 -63.362 1.00 51.03  ? 100 HIS C N   1 
ATOM   3907 C CA  . HIS C 1 17  ? 23.717  -46.596 -64.421 1.00 51.51  ? 100 HIS C CA  1 
ATOM   3908 C C   . HIS C 1 17  ? 22.669  -47.630 -64.427 1.00 51.44  ? 100 HIS C C   1 
ATOM   3909 O O   . HIS C 1 17  ? 22.970  -48.785 -64.207 1.00 53.00  ? 100 HIS C O   1 
ATOM   3910 C CB  . HIS C 1 17  ? 24.327  -46.640 -65.796 1.00 50.68  ? 100 HIS C CB  1 
ATOM   3911 C CG  . HIS C 1 17  ? 25.385  -45.631 -66.008 1.00 51.72  ? 100 HIS C CG  1 
ATOM   3912 N ND1 . HIS C 1 17  ? 25.104  -44.349 -66.366 1.00 52.91  ? 100 HIS C ND1 1 
ATOM   3913 C CD2 . HIS C 1 17  ? 26.770  -45.735 -65.922 1.00 50.04  ? 100 HIS C CD2 1 
ATOM   3914 C CE1 . HIS C 1 17  ? 26.254  -43.674 -66.502 1.00 51.79  ? 100 HIS C CE1 1 
ATOM   3915 N NE2 . HIS C 1 17  ? 27.275  -44.530 -66.233 1.00 52.93  ? 100 HIS C NE2 1 
ATOM   3916 N N   . ILE C 1 18  ? 21.434  -47.224 -64.697 1.00 52.94  ? 101 ILE C N   1 
ATOM   3917 C CA  . ILE C 1 18  ? 20.295  -48.140 -64.707 1.00 54.35  ? 101 ILE C CA  1 
ATOM   3918 C C   . ILE C 1 18  ? 19.771  -48.248 -66.123 1.00 56.35  ? 101 ILE C C   1 
ATOM   3919 O O   . ILE C 1 18  ? 19.354  -47.246 -66.692 1.00 62.34  ? 101 ILE C O   1 
ATOM   3920 C CB  . ILE C 1 18  ? 19.136  -47.644 -63.811 1.00 54.63  ? 101 ILE C CB  1 
ATOM   3921 C CG1 . ILE C 1 18  ? 19.543  -47.645 -62.311 1.00 51.18  ? 101 ILE C CG1 1 
ATOM   3922 C CG2 . ILE C 1 18  ? 17.876  -48.487 -64.079 1.00 52.58  ? 101 ILE C CG2 1 
ATOM   3923 C CD1 . ILE C 1 18  ? 18.602  -46.896 -61.387 1.00 44.99  ? 101 ILE C CD1 1 
ATOM   3924 N N   . THR C 1 19  ? 19.784  -49.448 -66.680 1.00 53.22  ? 102 THR C N   1 
ATOM   3925 C CA  . THR C 1 19  ? 19.384  -49.642 -68.046 1.00 54.94  ? 102 THR C CA  1 
ATOM   3926 C C   . THR C 1 19  ? 17.935  -49.188 -68.337 1.00 55.03  ? 102 THR C C   1 
ATOM   3927 O O   . THR C 1 19  ? 17.061  -49.244 -67.473 1.00 48.49  ? 102 THR C O   1 
ATOM   3928 C CB  . THR C 1 19  ? 19.647  -51.107 -68.491 1.00 59.24  ? 102 THR C CB  1 
ATOM   3929 O OG1 . THR C 1 19  ? 19.175  -51.309 -69.820 1.00 57.47  ? 102 THR C OG1 1 
ATOM   3930 C CG2 . THR C 1 19  ? 18.985  -52.103 -67.548 1.00 59.09  ? 102 THR C CG2 1 
ATOM   3931 N N   . THR C 1 20  ? 17.689  -48.727 -69.567 1.00 57.54  ? 103 THR C N   1 
ATOM   3932 C CA  . THR C 1 20  ? 16.346  -48.291 -69.941 1.00 55.48  ? 103 THR C CA  1 
ATOM   3933 C C   . THR C 1 20  ? 15.548  -49.461 -70.514 1.00 57.83  ? 103 THR C C   1 
ATOM   3934 O O   . THR C 1 20  ? 14.354  -49.316 -70.802 1.00 57.00  ? 103 THR C O   1 
ATOM   3935 C CB  . THR C 1 20  ? 16.374  -47.215 -71.027 1.00 53.64  ? 103 THR C CB  1 
ATOM   3936 O OG1 . THR C 1 20  ? 17.114  -47.711 -72.146 1.00 59.35  ? 103 THR C OG1 1 
ATOM   3937 C CG2 . THR C 1 20  ? 17.011  -45.961 -70.532 1.00 49.05  ? 103 THR C CG2 1 
ATOM   3938 N N   . GLY C 1 21  ? 16.208  -50.604 -70.683 1.00 57.27  ? 104 GLY C N   1 
ATOM   3939 C CA  . GLY C 1 21  ? 15.651  -51.704 -71.458 1.00 60.52  ? 104 GLY C CA  1 
ATOM   3940 C C   . GLY C 1 21  ? 15.881  -51.565 -72.963 1.00 63.02  ? 104 GLY C C   1 
ATOM   3941 O O   . GLY C 1 21  ? 15.474  -52.447 -73.729 1.00 61.37  ? 104 GLY C O   1 
ATOM   3942 N N   . SER C 1 22  ? 16.515  -50.465 -73.381 1.00 62.79  ? 105 SER C N   1 
ATOM   3943 C CA  . SER C 1 22  ? 16.925  -50.276 -74.775 1.00 72.60  ? 105 SER C CA  1 
ATOM   3944 C C   . SER C 1 22  ? 18.416  -50.021 -74.890 1.00 75.55  ? 105 SER C C   1 
ATOM   3945 O O   . SER C 1 22  ? 18.927  -49.075 -74.305 1.00 72.38  ? 105 SER C O   1 
ATOM   3946 C CB  . SER C 1 22  ? 16.181  -49.114 -75.441 1.00 73.65  ? 105 SER C CB  1 
ATOM   3947 O OG  . SER C 1 22  ? 16.730  -48.840 -76.727 1.00 74.88  ? 105 SER C OG  1 
ATOM   3948 N N   . GLN C 1 23  ? 19.111  -50.836 -75.677 1.00 80.61  ? 106 GLN C N   1 
ATOM   3949 C CA  . GLN C 1 23  ? 20.562  -50.708 -75.757 1.00 84.27  ? 106 GLN C CA  1 
ATOM   3950 C C   . GLN C 1 23  ? 20.946  -49.461 -76.539 1.00 83.56  ? 106 GLN C C   1 
ATOM   3951 O O   . GLN C 1 23  ? 21.900  -48.766 -76.172 1.00 77.78  ? 106 GLN C O   1 
ATOM   3952 C CB  . GLN C 1 23  ? 21.190  -51.947 -76.370 1.00 89.26  ? 106 GLN C CB  1 
ATOM   3953 C CG  . GLN C 1 23  ? 20.902  -53.225 -75.611 1.00 91.61  ? 106 GLN C CG  1 
ATOM   3954 C CD  . GLN C 1 23  ? 21.191  -54.439 -76.468 1.00 102.91 ? 106 GLN C CD  1 
ATOM   3955 O OE1 . GLN C 1 23  ? 22.236  -54.520 -77.136 1.00 101.87 ? 106 GLN C OE1 1 
ATOM   3956 N NE2 . GLN C 1 23  ? 20.255  -55.389 -76.476 1.00 106.33 ? 106 GLN C NE2 1 
ATOM   3957 N N   . GLU C 1 24  ? 20.191  -49.196 -77.608 1.00 85.10  ? 107 GLU C N   1 
ATOM   3958 C CA  . GLU C 1 24  ? 20.274  -47.938 -78.332 1.00 84.29  ? 107 GLU C CA  1 
ATOM   3959 C C   . GLU C 1 24  ? 20.144  -46.751 -77.385 1.00 77.03  ? 107 GLU C C   1 
ATOM   3960 O O   . GLU C 1 24  ? 21.002  -45.884 -77.380 1.00 74.89  ? 107 GLU C O   1 
ATOM   3961 C CB  . GLU C 1 24  ? 19.215  -47.878 -79.425 1.00 87.96  ? 107 GLU C CB  1 
ATOM   3962 C CG  . GLU C 1 24  ? 19.596  -48.668 -80.665 1.00 96.23  ? 107 GLU C CG  1 
ATOM   3963 C CD  . GLU C 1 24  ? 20.855  -48.151 -81.343 1.00 103.31 ? 107 GLU C CD  1 
ATOM   3964 O OE1 . GLU C 1 24  ? 20.851  -46.995 -81.821 1.00 109.18 ? 107 GLU C OE1 1 
ATOM   3965 O OE2 . GLU C 1 24  ? 21.853  -48.905 -81.410 1.00 105.57 ? 107 GLU C OE2 1 
ATOM   3966 N N   . PHE C 1 25  ? 19.086  -46.733 -76.577 1.00 74.27  ? 108 PHE C N   1 
ATOM   3967 C CA  . PHE C 1 25  ? 18.885  -45.702 -75.539 1.00 73.00  ? 108 PHE C CA  1 
ATOM   3968 C C   . PHE C 1 25  ? 20.061  -45.631 -74.547 1.00 70.25  ? 108 PHE C C   1 
ATOM   3969 O O   . PHE C 1 25  ? 20.534  -44.539 -74.208 1.00 70.73  ? 108 PHE C O   1 
ATOM   3970 C CB  . PHE C 1 25  ? 17.605  -45.987 -74.750 1.00 73.89  ? 108 PHE C CB  1 
ATOM   3971 C CG  . PHE C 1 25  ? 16.856  -44.756 -74.303 1.00 71.96  ? 108 PHE C CG  1 
ATOM   3972 C CD1 . PHE C 1 25  ? 15.485  -44.822 -74.071 1.00 67.08  ? 108 PHE C CD1 1 
ATOM   3973 C CD2 . PHE C 1 25  ? 17.500  -43.535 -74.122 1.00 70.99  ? 108 PHE C CD2 1 
ATOM   3974 C CE1 . PHE C 1 25  ? 14.776  -43.696 -73.678 1.00 62.36  ? 108 PHE C CE1 1 
ATOM   3975 C CE2 . PHE C 1 25  ? 16.794  -42.412 -73.713 1.00 65.89  ? 108 PHE C CE2 1 
ATOM   3976 C CZ  . PHE C 1 25  ? 15.430  -42.493 -73.492 1.00 60.90  ? 108 PHE C CZ  1 
ATOM   3977 N N   . ASP C 1 26  ? 20.541  -46.787 -74.090 1.00 67.54  ? 109 ASP C N   1 
ATOM   3978 C CA  . ASP C 1 26  ? 21.665  -46.801 -73.166 1.00 64.56  ? 109 ASP C CA  1 
ATOM   3979 C C   . ASP C 1 26  ? 22.887  -46.166 -73.803 1.00 66.00  ? 109 ASP C C   1 
ATOM   3980 O O   . ASP C 1 26  ? 23.609  -45.428 -73.131 1.00 63.59  ? 109 ASP C O   1 
ATOM   3981 C CB  . ASP C 1 26  ? 21.994  -48.202 -72.663 1.00 64.27  ? 109 ASP C CB  1 
ATOM   3982 C CG  . ASP C 1 26  ? 20.853  -48.849 -71.887 1.00 66.27  ? 109 ASP C CG  1 
ATOM   3983 O OD1 . ASP C 1 26  ? 19.899  -48.189 -71.423 1.00 66.27  ? 109 ASP C OD1 1 
ATOM   3984 O OD2 . ASP C 1 26  ? 20.909  -50.073 -71.736 1.00 72.53  ? 109 ASP C OD2 1 
ATOM   3985 N N   . LYS C 1 27  ? 23.113  -46.455 -75.086 1.00 71.82  ? 110 LYS C N   1 
ATOM   3986 C CA  . LYS C 1 27  ? 24.197  -45.828 -75.842 1.00 76.26  ? 110 LYS C CA  1 
ATOM   3987 C C   . LYS C 1 27  ? 24.059  -44.303 -75.704 1.00 75.86  ? 110 LYS C C   1 
ATOM   3988 O O   . LYS C 1 27  ? 24.978  -43.625 -75.235 1.00 72.30  ? 110 LYS C O   1 
ATOM   3989 C CB  . LYS C 1 27  ? 24.204  -46.298 -77.316 1.00 82.76  ? 110 LYS C CB  1 
ATOM   3990 C CG  . LYS C 1 27  ? 25.131  -45.537 -78.260 1.00 88.00  ? 110 LYS C CG  1 
ATOM   3991 C CD  . LYS C 1 27  ? 24.792  -45.785 -79.739 1.00 95.06  ? 110 LYS C CD  1 
ATOM   3992 C CE  . LYS C 1 27  ? 25.565  -44.833 -80.667 1.00 96.97  ? 110 LYS C CE  1 
ATOM   3993 N NZ  . LYS C 1 27  ? 25.533  -45.154 -82.130 1.00 97.05  ? 110 LYS C NZ  1 
ATOM   3994 N N   . LEU C 1 28  ? 22.884  -43.785 -76.041 1.00 73.65  ? 111 LEU C N   1 
ATOM   3995 C CA  . LEU C 1 28  ? 22.634  -42.348 -76.019 1.00 74.95  ? 111 LEU C CA  1 
ATOM   3996 C C   . LEU C 1 28  ? 23.027  -41.714 -74.684 1.00 70.13  ? 111 LEU C C   1 
ATOM   3997 O O   . LEU C 1 28  ? 23.361  -40.546 -74.609 1.00 69.25  ? 111 LEU C O   1 
ATOM   3998 C CB  . LEU C 1 28  ? 21.136  -42.097 -76.255 1.00 76.29  ? 111 LEU C CB  1 
ATOM   3999 C CG  . LEU C 1 28  ? 20.579  -41.026 -77.203 1.00 77.27  ? 111 LEU C CG  1 
ATOM   4000 C CD1 . LEU C 1 28  ? 19.428  -40.293 -76.526 1.00 73.32  ? 111 LEU C CD1 1 
ATOM   4001 C CD2 . LEU C 1 28  ? 21.631  -40.041 -77.669 1.00 75.81  ? 111 LEU C CD2 1 
ATOM   4002 N N   . LEU C 1 29  ? 22.986  -42.510 -73.630 1.00 70.38  ? 112 LEU C N   1 
ATOM   4003 C CA  . LEU C 1 29  ? 22.990  -42.025 -72.271 1.00 62.93  ? 112 LEU C CA  1 
ATOM   4004 C C   . LEU C 1 29  ? 24.222  -42.500 -71.523 1.00 64.66  ? 112 LEU C C   1 
ATOM   4005 O O   . LEU C 1 29  ? 24.304  -42.359 -70.310 1.00 74.78  ? 112 LEU C O   1 
ATOM   4006 C CB  . LEU C 1 29  ? 21.766  -42.615 -71.610 1.00 61.52  ? 112 LEU C CB  1 
ATOM   4007 C CG  . LEU C 1 29  ? 20.614  -41.789 -71.049 1.00 63.38  ? 112 LEU C CG  1 
ATOM   4008 C CD1 . LEU C 1 29  ? 20.481  -40.385 -71.582 1.00 63.80  ? 112 LEU C CD1 1 
ATOM   4009 C CD2 . LEU C 1 29  ? 19.333  -42.549 -71.283 1.00 65.81  ? 112 LEU C CD2 1 
ATOM   4010 N N   . GLY C 1 30  ? 25.168  -43.097 -72.234 1.00 67.11  ? 113 GLY C N   1 
ATOM   4011 C CA  . GLY C 1 30  ? 26.385  -43.656 -71.640 1.00 63.35  ? 113 GLY C CA  1 
ATOM   4012 C C   . GLY C 1 30  ? 26.190  -44.792 -70.647 1.00 65.79  ? 113 GLY C C   1 
ATOM   4013 O O   . GLY C 1 30  ? 27.026  -44.986 -69.757 1.00 63.63  ? 113 GLY C O   1 
ATOM   4014 N N   . GLY C 1 31  ? 25.094  -45.547 -70.787 1.00 64.20  ? 114 GLY C N   1 
ATOM   4015 C CA  . GLY C 1 31  ? 24.903  -46.749 -69.975 1.00 62.99  ? 114 GLY C CA  1 
ATOM   4016 C C   . GLY C 1 31  ? 23.518  -46.865 -69.375 1.00 61.22  ? 114 GLY C C   1 
ATOM   4017 O O   . GLY C 1 31  ? 23.068  -47.955 -68.996 1.00 56.01  ? 114 GLY C O   1 
ATOM   4018 N N   . GLY C 1 32  ? 22.841  -45.728 -69.309 1.00 60.91  ? 115 GLY C N   1 
ATOM   4019 C CA  . GLY C 1 32  ? 21.473  -45.660 -68.849 1.00 57.95  ? 115 GLY C CA  1 
ATOM   4020 C C   . GLY C 1 32  ? 21.268  -44.368 -68.106 1.00 59.27  ? 115 GLY C C   1 
ATOM   4021 O O   . GLY C 1 32  ? 21.989  -43.376 -68.323 1.00 59.44  ? 115 GLY C O   1 
ATOM   4022 N N   . ILE C 1 33  ? 20.271  -44.399 -67.226 1.00 59.87  ? 116 ILE C N   1 
ATOM   4023 C CA  . ILE C 1 33  ? 19.908  -43.304 -66.335 1.00 55.69  ? 116 ILE C CA  1 
ATOM   4024 C C   . ILE C 1 33  ? 20.985  -43.314 -65.280 1.00 56.09  ? 116 ILE C C   1 
ATOM   4025 O O   . ILE C 1 33  ? 21.228  -44.351 -64.648 1.00 62.89  ? 116 ILE C O   1 
ATOM   4026 C CB  . ILE C 1 33  ? 18.507  -43.619 -65.743 1.00 57.52  ? 116 ILE C CB  1 
ATOM   4027 C CG1 . ILE C 1 33  ? 17.460  -43.560 -66.850 1.00 60.62  ? 116 ILE C CG1 1 
ATOM   4028 C CG2 . ILE C 1 33  ? 18.107  -42.708 -64.607 1.00 47.64  ? 116 ILE C CG2 1 
ATOM   4029 C CD1 . ILE C 1 33  ? 17.425  -42.210 -67.538 1.00 61.97  ? 116 ILE C CD1 1 
ATOM   4030 N N   . GLU C 1 34  ? 21.644  -42.177 -65.094 1.00 57.77  ? 117 GLU C N   1 
ATOM   4031 C CA  . GLU C 1 34  ? 22.827  -42.106 -64.225 1.00 55.00  ? 117 GLU C CA  1 
ATOM   4032 C C   . GLU C 1 34  ? 22.549  -41.545 -62.812 1.00 51.08  ? 117 GLU C C   1 
ATOM   4033 O O   . GLU C 1 34  ? 21.921  -40.489 -62.663 1.00 53.54  ? 117 GLU C O   1 
ATOM   4034 C CB  . GLU C 1 34  ? 23.899  -41.308 -64.938 1.00 53.81  ? 117 GLU C CB  1 
ATOM   4035 C CG  . GLU C 1 34  ? 25.120  -41.141 -64.089 1.00 63.70  ? 117 GLU C CG  1 
ATOM   4036 C CD  . GLU C 1 34  ? 26.234  -40.418 -64.812 1.00 70.16  ? 117 GLU C CD  1 
ATOM   4037 O OE1 . GLU C 1 34  ? 27.257  -41.068 -65.105 1.00 73.89  ? 117 GLU C OE1 1 
ATOM   4038 O OE2 . GLU C 1 34  ? 26.091  -39.209 -65.079 1.00 70.63  ? 117 GLU C OE2 1 
ATOM   4039 N N   . SER C 1 35  ? 23.008  -42.248 -61.774 1.00 48.13  ? 118 SER C N   1 
ATOM   4040 C CA  . SER C 1 35  ? 22.879  -41.774 -60.362 1.00 41.32  ? 118 SER C CA  1 
ATOM   4041 C C   . SER C 1 35  ? 23.716  -40.500 -60.112 1.00 40.83  ? 118 SER C C   1 
ATOM   4042 O O   . SER C 1 35  ? 24.521  -40.126 -60.953 1.00 40.97  ? 118 SER C O   1 
ATOM   4043 C CB  . SER C 1 35  ? 23.329  -42.848 -59.384 1.00 39.56  ? 118 SER C CB  1 
ATOM   4044 O OG  . SER C 1 35  ? 24.739  -43.021 -59.463 1.00 42.49  ? 118 SER C OG  1 
ATOM   4045 N N   . MET C 1 36  ? 23.516  -39.854 -58.962 1.00 39.14  ? 119 MET C N   1 
ATOM   4046 C CA  . MET C 1 36  ? 24.081  -38.540 -58.654 1.00 40.04  ? 119 MET C CA  1 
ATOM   4047 C C   . MET C 1 36  ? 23.665  -37.454 -59.647 1.00 40.19  ? 119 MET C C   1 
ATOM   4048 O O   . MET C 1 36  ? 24.324  -36.439 -59.787 1.00 41.64  ? 119 MET C O   1 
ATOM   4049 C CB  . MET C 1 36  ? 25.602  -38.614 -58.488 1.00 41.19  ? 119 MET C CB  1 
ATOM   4050 C CG  . MET C 1 36  ? 26.032  -39.297 -57.205 1.00 45.03  ? 119 MET C CG  1 
ATOM   4051 S SD  . MET C 1 36  ? 27.803  -39.229 -56.909 1.00 49.36  ? 119 MET C SD  1 
ATOM   4052 C CE  . MET C 1 36  ? 28.040  -37.577 -56.252 1.00 41.09  ? 119 MET C CE  1 
ATOM   4053 N N   . ALA C 1 37  ? 22.552  -37.685 -60.328 1.00 41.23  ? 120 ALA C N   1 
ATOM   4054 C CA  . ALA C 1 37  ? 22.067  -36.809 -61.364 1.00 39.39  ? 120 ALA C CA  1 
ATOM   4055 C C   . ALA C 1 37  ? 20.520  -36.885 -61.515 1.00 42.67  ? 120 ALA C C   1 
ATOM   4056 O O   . ALA C 1 37  ? 19.879  -37.873 -61.190 1.00 42.86  ? 120 ALA C O   1 
ATOM   4057 C CB  . ALA C 1 37  ? 22.726  -37.188 -62.650 1.00 36.40  ? 120 ALA C CB  1 
ATOM   4058 N N   . ILE C 1 38  ? 19.930  -35.834 -62.056 1.00 46.54  ? 121 ILE C N   1 
ATOM   4059 C CA  . ILE C 1 38  ? 18.544  -35.865 -62.483 1.00 45.04  ? 121 ILE C CA  1 
ATOM   4060 C C   . ILE C 1 38  ? 18.449  -36.015 -64.010 1.00 45.97  ? 121 ILE C C   1 
ATOM   4061 O O   . ILE C 1 38  ? 19.012  -35.203 -64.748 1.00 49.22  ? 121 ILE C O   1 
ATOM   4062 C CB  . ILE C 1 38  ? 17.867  -34.573 -62.019 1.00 46.74  ? 121 ILE C CB  1 
ATOM   4063 C CG1 . ILE C 1 38  ? 18.060  -34.423 -60.503 1.00 47.73  ? 121 ILE C CG1 1 
ATOM   4064 C CG2 . ILE C 1 38  ? 16.409  -34.586 -62.403 1.00 44.72  ? 121 ILE C CG2 1 
ATOM   4065 C CD1 . ILE C 1 38  ? 17.760  -33.035 -60.003 1.00 50.70  ? 121 ILE C CD1 1 
ATOM   4066 N N   . THR C 1 39  ? 17.779  -37.066 -64.484 1.00 43.40  ? 122 THR C N   1 
ATOM   4067 C CA  . THR C 1 39  ? 17.454  -37.198 -65.888 1.00 45.70  ? 122 THR C CA  1 
ATOM   4068 C C   . THR C 1 39  ? 15.991  -36.836 -66.158 1.00 47.97  ? 122 THR C C   1 
ATOM   4069 O O   . THR C 1 39  ? 15.055  -37.377 -65.564 1.00 52.18  ? 122 THR C O   1 
ATOM   4070 C CB  . THR C 1 39  ? 17.699  -38.620 -66.388 1.00 48.48  ? 122 THR C CB  1 
ATOM   4071 O OG1 . THR C 1 39  ? 19.024  -38.990 -66.036 1.00 55.35  ? 122 THR C OG1 1 
ATOM   4072 C CG2 . THR C 1 39  ? 17.536  -38.706 -67.933 1.00 46.18  ? 122 THR C CG2 1 
ATOM   4073 N N   . GLU C 1 40  ? 15.790  -35.940 -67.086 1.00 46.44  ? 123 GLU C N   1 
ATOM   4074 C CA  . GLU C 1 40  ? 14.460  -35.575 -67.446 1.00 50.73  ? 123 GLU C CA  1 
ATOM   4075 C C   . GLU C 1 40  ? 14.155  -36.046 -68.857 1.00 53.76  ? 123 GLU C C   1 
ATOM   4076 O O   . GLU C 1 40  ? 14.940  -35.841 -69.811 1.00 53.97  ? 123 GLU C O   1 
ATOM   4077 C CB  . GLU C 1 40  ? 14.322  -34.071 -67.393 1.00 54.30  ? 123 GLU C CB  1 
ATOM   4078 C CG  . GLU C 1 40  ? 13.032  -33.578 -67.989 1.00 63.02  ? 123 GLU C CG  1 
ATOM   4079 C CD  . GLU C 1 40  ? 13.082  -32.110 -68.373 1.00 75.27  ? 123 GLU C CD  1 
ATOM   4080 O OE1 . GLU C 1 40  ? 13.989  -31.386 -67.886 1.00 78.02  ? 123 GLU C OE1 1 
ATOM   4081 O OE2 . GLU C 1 40  ? 12.200  -31.680 -69.164 1.00 87.20  ? 123 GLU C OE2 1 
ATOM   4082 N N   . ALA C 1 41  ? 13.000  -36.679 -68.984 1.00 54.18  ? 124 ALA C N   1 
ATOM   4083 C CA  . ALA C 1 41  ? 12.418  -36.966 -70.292 1.00 53.46  ? 124 ALA C CA  1 
ATOM   4084 C C   . ALA C 1 41  ? 11.173  -36.120 -70.404 1.00 56.60  ? 124 ALA C C   1 
ATOM   4085 O O   . ALA C 1 41  ? 10.289  -36.196 -69.544 1.00 54.39  ? 124 ALA C O   1 
ATOM   4086 C CB  . ALA C 1 41  ? 12.072  -38.437 -70.424 1.00 47.77  ? 124 ALA C CB  1 
ATOM   4087 N N   . PHE C 1 42  ? 11.102  -35.297 -71.445 1.00 62.38  ? 125 PHE C N   1 
ATOM   4088 C CA  . PHE C 1 42  ? 9.873   -34.569 -71.747 1.00 68.90  ? 125 PHE C CA  1 
ATOM   4089 C C   . PHE C 1 42  ? 9.525   -34.895 -73.162 1.00 73.87  ? 125 PHE C C   1 
ATOM   4090 O O   . PHE C 1 42  ? 10.385  -35.327 -73.910 1.00 83.10  ? 125 PHE C O   1 
ATOM   4091 C CB  . PHE C 1 42  ? 10.082  -33.066 -71.624 1.00 71.43  ? 125 PHE C CB  1 
ATOM   4092 C CG  . PHE C 1 42  ? 11.167  -32.536 -72.514 1.00 70.46  ? 125 PHE C CG  1 
ATOM   4093 C CD1 . PHE C 1 42  ? 12.467  -32.430 -72.049 1.00 67.76  ? 125 PHE C CD1 1 
ATOM   4094 C CD2 . PHE C 1 42  ? 10.888  -32.157 -73.821 1.00 72.37  ? 125 PHE C CD2 1 
ATOM   4095 C CE1 . PHE C 1 42  ? 13.463  -31.941 -72.873 1.00 74.52  ? 125 PHE C CE1 1 
ATOM   4096 C CE2 . PHE C 1 42  ? 11.879  -31.664 -74.657 1.00 75.03  ? 125 PHE C CE2 1 
ATOM   4097 C CZ  . PHE C 1 42  ? 13.174  -31.555 -74.186 1.00 75.46  ? 125 PHE C CZ  1 
ATOM   4098 N N   . GLY C 1 43  ? 8.278   -34.650 -73.534 1.00 77.18  ? 126 GLY C N   1 
ATOM   4099 C CA  . GLY C 1 43  ? 7.773   -35.020 -74.834 1.00 75.26  ? 126 GLY C CA  1 
ATOM   4100 C C   . GLY C 1 43  ? 6.273   -34.801 -74.824 1.00 81.43  ? 126 GLY C C   1 
ATOM   4101 O O   . GLY C 1 43  ? 5.687   -34.503 -73.767 1.00 72.31  ? 126 GLY C O   1 
ATOM   4102 N N   . GLU C 1 44  ? 5.661   -34.938 -76.005 1.00 85.87  ? 127 GLU C N   1 
ATOM   4103 C CA  . GLU C 1 44  ? 4.217   -34.798 -76.175 1.00 91.51  ? 127 GLU C CA  1 
ATOM   4104 C C   . GLU C 1 44  ? 3.518   -36.082 -75.777 1.00 90.74  ? 127 GLU C C   1 
ATOM   4105 O O   . GLU C 1 44  ? 4.168   -37.026 -75.331 1.00 92.71  ? 127 GLU C O   1 
ATOM   4106 C CB  . GLU C 1 44  ? 3.858   -34.433 -77.616 1.00 98.42  ? 127 GLU C CB  1 
ATOM   4107 C CG  . GLU C 1 44  ? 3.926   -32.957 -77.950 1.00 102.50 ? 127 GLU C CG  1 
ATOM   4108 C CD  . GLU C 1 44  ? 3.256   -32.664 -79.281 1.00 121.33 ? 127 GLU C CD  1 
ATOM   4109 O OE1 . GLU C 1 44  ? 2.011   -32.811 -79.381 1.00 127.39 ? 127 GLU C OE1 1 
ATOM   4110 O OE2 . GLU C 1 44  ? 3.970   -32.292 -80.239 1.00 126.00 ? 127 GLU C OE2 1 
ATOM   4111 N N   . PHE C 1 45  ? 2.203   -36.116 -75.991 1.00 97.09  ? 128 PHE C N   1 
ATOM   4112 C CA  . PHE C 1 45  ? 1.295   -37.051 -75.304 1.00 100.54 ? 128 PHE C CA  1 
ATOM   4113 C C   . PHE C 1 45  ? 1.623   -38.557 -75.288 1.00 96.60  ? 128 PHE C C   1 
ATOM   4114 O O   . PHE C 1 45  ? 1.741   -39.152 -74.215 1.00 99.33  ? 128 PHE C O   1 
ATOM   4115 C CB  . PHE C 1 45  ? -0.220  -36.730 -75.542 1.00 112.46 ? 128 PHE C CB  1 
ATOM   4116 C CG  . PHE C 1 45  ? -0.629  -36.448 -77.002 1.00 136.49 ? 128 PHE C CG  1 
ATOM   4117 C CD1 . PHE C 1 45  ? -0.207  -35.281 -77.681 1.00 144.12 ? 128 PHE C CD1 1 
ATOM   4118 C CD2 . PHE C 1 45  ? -1.521  -37.309 -77.676 1.00 136.32 ? 128 PHE C CD2 1 
ATOM   4119 C CE1 . PHE C 1 45  ? -0.614  -35.017 -78.998 1.00 140.41 ? 128 PHE C CE1 1 
ATOM   4120 C CE2 . PHE C 1 45  ? -1.925  -37.043 -78.987 1.00 140.31 ? 128 PHE C CE2 1 
ATOM   4121 C CZ  . PHE C 1 45  ? -1.473  -35.897 -79.647 1.00 141.21 ? 128 PHE C CZ  1 
ATOM   4122 N N   . ARG C 1 46  ? 1.789   -39.196 -76.434 1.00 103.61 ? 129 ARG C N   1 
ATOM   4123 C CA  . ARG C 1 46  ? 1.890   -40.664 -76.389 1.00 106.89 ? 129 ARG C CA  1 
ATOM   4124 C C   . ARG C 1 46  ? 3.328   -41.177 -76.527 1.00 100.09 ? 129 ARG C C   1 
ATOM   4125 O O   . ARG C 1 46  ? 3.558   -42.331 -76.886 1.00 101.39 ? 129 ARG C O   1 
ATOM   4126 C CB  . ARG C 1 46  ? 0.913   -41.357 -77.375 1.00 118.69 ? 129 ARG C CB  1 
ATOM   4127 C CG  . ARG C 1 46  ? -0.573  -40.980 -77.252 1.00 127.34 ? 129 ARG C CG  1 
ATOM   4128 C CD  . ARG C 1 46  ? -1.273  -41.544 -76.008 1.00 135.19 ? 129 ARG C CD  1 
ATOM   4129 N NE  . ARG C 1 46  ? -0.915  -40.861 -74.751 1.00 138.08 ? 129 ARG C NE  1 
ATOM   4130 C CZ  . ARG C 1 46  ? -1.584  -39.844 -74.192 1.00 134.76 ? 129 ARG C CZ  1 
ATOM   4131 N NH1 . ARG C 1 46  ? -2.677  -39.344 -74.760 1.00 138.29 ? 129 ARG C NH1 1 
ATOM   4132 N NH2 . ARG C 1 46  ? -1.149  -39.317 -73.050 1.00 134.77 ? 129 ARG C NH2 1 
ATOM   4133 N N   . THR C 1 47  ? 4.296   -40.320 -76.236 1.00 91.35  ? 130 THR C N   1 
ATOM   4134 C CA  . THR C 1 47  ? 5.666   -40.778 -76.158 1.00 88.10  ? 130 THR C CA  1 
ATOM   4135 C C   . THR C 1 47  ? 5.926   -41.527 -74.870 1.00 94.28  ? 130 THR C C   1 
ATOM   4136 O O   . THR C 1 47  ? 5.270   -41.292 -73.833 1.00 117.87 ? 130 THR C O   1 
ATOM   4137 C CB  . THR C 1 47  ? 6.660   -39.649 -76.175 1.00 84.16  ? 130 THR C CB  1 
ATOM   4138 O OG1 . THR C 1 47  ? 6.237   -38.649 -77.115 1.00 86.05  ? 130 THR C OG1 1 
ATOM   4139 C CG2 . THR C 1 47  ? 7.977   -40.244 -76.566 1.00 81.45  ? 130 THR C CG2 1 
ATOM   4140 N N   . GLY C 1 48  ? 6.917   -42.399 -74.916 1.00 84.97  ? 131 GLY C N   1 
ATOM   4141 C CA  . GLY C 1 48  ? 7.103   -43.346 -73.838 1.00 78.11  ? 131 GLY C CA  1 
ATOM   4142 C C   . GLY C 1 48  ? 7.484   -42.854 -72.456 1.00 71.78  ? 131 GLY C C   1 
ATOM   4143 O O   . GLY C 1 48  ? 8.012   -43.645 -71.658 1.00 71.57  ? 131 GLY C O   1 
ATOM   4144 N N   . LYS C 1 49  ? 7.228   -41.579 -72.149 1.00 64.40  ? 132 LYS C N   1 
ATOM   4145 C CA  . LYS C 1 49  ? 7.541   -41.063 -70.807 1.00 60.38  ? 132 LYS C CA  1 
ATOM   4146 C C   . LYS C 1 49  ? 7.115   -42.037 -69.698 1.00 60.04  ? 132 LYS C C   1 
ATOM   4147 O O   . LYS C 1 49  ? 7.930   -42.478 -68.873 1.00 61.12  ? 132 LYS C O   1 
ATOM   4148 C CB  . LYS C 1 49  ? 6.870   -39.727 -70.553 1.00 56.09  ? 132 LYS C CB  1 
ATOM   4149 C CG  . LYS C 1 49  ? 7.513   -38.542 -71.222 1.00 56.75  ? 132 LYS C CG  1 
ATOM   4150 C CD  . LYS C 1 49  ? 6.773   -37.270 -70.828 1.00 60.32  ? 132 LYS C CD  1 
ATOM   4151 C CE  . LYS C 1 49  ? 5.284   -37.360 -71.145 1.00 62.37  ? 132 LYS C CE  1 
ATOM   4152 N NZ  . LYS C 1 49  ? 4.697   -36.028 -71.404 1.00 66.54  ? 132 LYS C NZ  1 
ATOM   4153 N N   . THR C 1 50  ? 5.830   -42.371 -69.691 1.00 59.26  ? 133 THR C N   1 
ATOM   4154 C CA  . THR C 1 50  ? 5.247   -43.210 -68.667 1.00 59.74  ? 133 THR C CA  1 
ATOM   4155 C C   . THR C 1 50  ? 5.712   -44.677 -68.851 1.00 59.70  ? 133 THR C C   1 
ATOM   4156 O O   . THR C 1 50  ? 6.022   -45.396 -67.882 1.00 55.85  ? 133 THR C O   1 
ATOM   4157 C CB  . THR C 1 50  ? 3.704   -43.041 -68.675 1.00 62.32  ? 133 THR C CB  1 
ATOM   4158 O OG1 . THR C 1 50  ? 3.356   -41.739 -68.154 1.00 62.82  ? 133 THR C OG1 1 
ATOM   4159 C CG2 . THR C 1 50  ? 3.018   -44.141 -67.866 1.00 59.56  ? 133 THR C CG2 1 
ATOM   4160 N N   . GLN C 1 51  ? 5.794   -45.105 -70.097 1.00 57.22  ? 134 GLN C N   1 
ATOM   4161 C CA  . GLN C 1 51  ? 6.319   -46.412 -70.354 1.00 58.75  ? 134 GLN C CA  1 
ATOM   4162 C C   . GLN C 1 51  ? 7.730   -46.590 -69.806 1.00 56.79  ? 134 GLN C C   1 
ATOM   4163 O O   . GLN C 1 51  ? 8.125   -47.679 -69.382 1.00 58.44  ? 134 GLN C O   1 
ATOM   4164 C CB  . GLN C 1 51  ? 6.271   -46.664 -71.842 1.00 64.47  ? 134 GLN C CB  1 
ATOM   4165 C CG  . GLN C 1 51  ? 4.846   -46.713 -72.370 1.00 71.30  ? 134 GLN C CG  1 
ATOM   4166 C CD  . GLN C 1 51  ? 4.040   -47.823 -71.696 1.00 81.32  ? 134 GLN C CD  1 
ATOM   4167 O OE1 . GLN C 1 51  ? 2.871   -47.627 -71.316 1.00 85.84  ? 134 GLN C OE1 1 
ATOM   4168 N NE2 . GLN C 1 51  ? 4.676   -48.994 -71.507 1.00 79.63  ? 134 GLN C NE2 1 
ATOM   4169 N N   . LEU C 1 52  ? 8.495   -45.513 -69.804 1.00 54.33  ? 135 LEU C N   1 
ATOM   4170 C CA  . LEU C 1 52  ? 9.862   -45.582 -69.372 1.00 51.49  ? 135 LEU C CA  1 
ATOM   4171 C C   . LEU C 1 52  ? 9.895   -45.578 -67.842 1.00 50.67  ? 135 LEU C C   1 
ATOM   4172 O O   . LEU C 1 52  ? 10.691  -46.264 -67.191 1.00 53.79  ? 135 LEU C O   1 
ATOM   4173 C CB  . LEU C 1 52  ? 10.592  -44.399 -69.956 1.00 52.73  ? 135 LEU C CB  1 
ATOM   4174 C CG  . LEU C 1 52  ? 12.067  -44.474 -70.330 1.00 58.35  ? 135 LEU C CG  1 
ATOM   4175 C CD1 . LEU C 1 52  ? 12.598  -43.052 -70.450 1.00 61.00  ? 135 LEU C CD1 1 
ATOM   4176 C CD2 . LEU C 1 52  ? 12.913  -45.249 -69.334 1.00 55.91  ? 135 LEU C CD2 1 
ATOM   4177 N N   . SER C 1 53  ? 9.004   -44.813 -67.246 1.00 49.44  ? 136 SER C N   1 
ATOM   4178 C CA  . SER C 1 53  ? 8.814   -44.895 -65.805 1.00 49.12  ? 136 SER C CA  1 
ATOM   4179 C C   . SER C 1 53  ? 8.586   -46.319 -65.320 1.00 46.96  ? 136 SER C C   1 
ATOM   4180 O O   . SER C 1 53  ? 9.271   -46.782 -64.429 1.00 51.86  ? 136 SER C O   1 
ATOM   4181 C CB  . SER C 1 53  ? 7.663   -43.988 -65.381 1.00 50.21  ? 136 SER C CB  1 
ATOM   4182 O OG  . SER C 1 53  ? 8.024   -42.644 -65.667 1.00 49.82  ? 136 SER C OG  1 
ATOM   4183 N N   . HIS C 1 54  ? 7.630   -47.022 -65.904 1.00 45.32  ? 137 HIS C N   1 
ATOM   4184 C CA  . HIS C 1 54  ? 7.354   -48.362 -65.431 1.00 46.59  ? 137 HIS C CA  1 
ATOM   4185 C C   . HIS C 1 54  ? 8.537   -49.277 -65.697 1.00 46.50  ? 137 HIS C C   1 
ATOM   4186 O O   . HIS C 1 54  ? 8.892   -50.111 -64.874 1.00 46.31  ? 137 HIS C O   1 
ATOM   4187 C CB  . HIS C 1 54  ? 6.068   -48.918 -66.045 1.00 45.95  ? 137 HIS C CB  1 
ATOM   4188 C CG  . HIS C 1 54  ? 4.807   -48.257 -65.564 1.00 43.69  ? 137 HIS C CG  1 
ATOM   4189 N ND1 . HIS C 1 54  ? 4.447   -47.030 -65.954 1.00 46.83  ? 137 HIS C ND1 1 
ATOM   4190 C CD2 . HIS C 1 54  ? 3.763   -48.735 -64.763 1.00 45.24  ? 137 HIS C CD2 1 
ATOM   4191 C CE1 . HIS C 1 54  ? 3.248   -46.701 -65.387 1.00 45.68  ? 137 HIS C CE1 1 
ATOM   4192 N NE2 . HIS C 1 54  ? 2.833   -47.747 -64.667 1.00 45.67  ? 137 HIS C NE2 1 
ATOM   4193 N N   . THR C 1 55  ? 9.152   -49.137 -66.853 1.00 45.23  ? 138 THR C N   1 
ATOM   4194 C CA  . THR C 1 55  ? 10.203  -50.061 -67.225 1.00 48.40  ? 138 THR C CA  1 
ATOM   4195 C C   . THR C 1 55  ? 11.283  -49.957 -66.167 1.00 47.28  ? 138 THR C C   1 
ATOM   4196 O O   . THR C 1 55  ? 11.828  -50.961 -65.700 1.00 48.49  ? 138 THR C O   1 
ATOM   4197 C CB  . THR C 1 55  ? 10.787  -49.739 -68.632 1.00 48.73  ? 138 THR C CB  1 
ATOM   4198 O OG1 . THR C 1 55  ? 9.828   -50.067 -69.661 1.00 46.60  ? 138 THR C OG1 1 
ATOM   4199 C CG2 . THR C 1 55  ? 12.022  -50.539 -68.859 1.00 48.44  ? 138 THR C CG2 1 
ATOM   4200 N N   . LEU C 1 56  ? 11.577  -48.722 -65.783 1.00 47.47  ? 139 LEU C N   1 
ATOM   4201 C CA  . LEU C 1 56  ? 12.638  -48.451 -64.841 1.00 45.19  ? 139 LEU C CA  1 
ATOM   4202 C C   . LEU C 1 56  ? 12.363  -49.014 -63.456 1.00 45.63  ? 139 LEU C C   1 
ATOM   4203 O O   . LEU C 1 56  ? 13.323  -49.293 -62.741 1.00 48.04  ? 139 LEU C O   1 
ATOM   4204 C CB  . LEU C 1 56  ? 12.872  -46.953 -64.733 1.00 43.97  ? 139 LEU C CB  1 
ATOM   4205 C CG  . LEU C 1 56  ? 13.629  -46.245 -65.854 1.00 41.33  ? 139 LEU C CG  1 
ATOM   4206 C CD1 . LEU C 1 56  ? 13.536  -44.761 -65.616 1.00 41.40  ? 139 LEU C CD1 1 
ATOM   4207 C CD2 . LEU C 1 56  ? 15.087  -46.633 -65.933 1.00 39.24  ? 139 LEU C CD2 1 
ATOM   4208 N N   . CYS C 1 57  ? 11.086  -49.168 -63.061 1.00 43.75  ? 140 CYS C N   1 
ATOM   4209 C CA  . CYS C 1 57  ? 10.731  -49.869 -61.789 1.00 43.04  ? 140 CYS C CA  1 
ATOM   4210 C C   . CYS C 1 57  ? 11.249  -51.300 -61.687 1.00 47.64  ? 140 CYS C C   1 
ATOM   4211 O O   . CYS C 1 57  ? 11.383  -51.863 -60.572 1.00 50.34  ? 140 CYS C O   1 
ATOM   4212 C CB  . CYS C 1 57  ? 9.240   -49.966 -61.621 1.00 41.78  ? 140 CYS C CB  1 
ATOM   4213 S SG  . CYS C 1 57  ? 8.512   -48.361 -61.385 1.00 48.31  ? 140 CYS C SG  1 
ATOM   4214 N N   . VAL C 1 58  ? 11.516  -51.890 -62.850 1.00 45.11  ? 141 VAL C N   1 
ATOM   4215 C CA  . VAL C 1 58  ? 11.960  -53.253 -62.902 1.00 47.39  ? 141 VAL C CA  1 
ATOM   4216 C C   . VAL C 1 58  ? 13.423  -53.320 -63.149 1.00 47.73  ? 141 VAL C C   1 
ATOM   4217 O O   . VAL C 1 58  ? 14.134  -53.958 -62.374 1.00 49.84  ? 141 VAL C O   1 
ATOM   4218 C CB  . VAL C 1 58  ? 11.246  -54.046 -63.990 1.00 47.95  ? 141 VAL C CB  1 
ATOM   4219 C CG1 . VAL C 1 58  ? 11.748  -55.464 -64.016 1.00 46.77  ? 141 VAL C CG1 1 
ATOM   4220 C CG2 . VAL C 1 58  ? 9.757   -54.041 -63.726 1.00 49.20  ? 141 VAL C CG2 1 
ATOM   4221 N N   . THR C 1 59  ? 13.875  -52.663 -64.215 1.00 48.79  ? 142 THR C N   1 
ATOM   4222 C CA  . THR C 1 59  ? 15.311  -52.700 -64.567 1.00 50.65  ? 142 THR C CA  1 
ATOM   4223 C C   . THR C 1 59  ? 16.186  -52.256 -63.427 1.00 47.27  ? 142 THR C C   1 
ATOM   4224 O O   . THR C 1 59  ? 17.253  -52.818 -63.239 1.00 51.85  ? 142 THR C O   1 
ATOM   4225 C CB  . THR C 1 59  ? 15.687  -51.899 -65.835 1.00 48.66  ? 142 THR C CB  1 
ATOM   4226 O OG1 . THR C 1 59  ? 15.343  -50.520 -65.649 1.00 49.03  ? 142 THR C OG1 1 
ATOM   4227 C CG2 . THR C 1 59  ? 14.939  -52.450 -67.048 1.00 50.85  ? 142 THR C CG2 1 
ATOM   4228 N N   . ALA C 1 60  ? 15.739  -51.253 -62.675 1.00 45.59  ? 143 ALA C N   1 
ATOM   4229 C CA  . ALA C 1 60  ? 16.446  -50.814 -61.444 1.00 47.45  ? 143 ALA C CA  1 
ATOM   4230 C C   . ALA C 1 60  ? 16.693  -51.962 -60.446 1.00 46.08  ? 143 ALA C C   1 
ATOM   4231 O O   . ALA C 1 60  ? 17.654  -51.961 -59.692 1.00 51.89  ? 143 ALA C O   1 
ATOM   4232 C CB  . ALA C 1 60  ? 15.716  -49.654 -60.762 1.00 43.40  ? 143 ALA C CB  1 
ATOM   4233 N N   . GLN C 1 61  ? 15.859  -52.965 -60.484 1.00 45.39  ? 144 GLN C N   1 
ATOM   4234 C CA  . GLN C 1 61  ? 16.010  -54.062 -59.576 1.00 48.02  ? 144 GLN C CA  1 
ATOM   4235 C C   . GLN C 1 61  ? 16.953  -55.142 -60.073 1.00 50.89  ? 144 GLN C C   1 
ATOM   4236 O O   . GLN C 1 61  ? 17.152  -56.142 -59.362 1.00 52.96  ? 144 GLN C O   1 
ATOM   4237 C CB  . GLN C 1 61  ? 14.620  -54.642 -59.262 1.00 47.34  ? 144 GLN C CB  1 
ATOM   4238 C CG  . GLN C 1 61  ? 13.768  -53.619 -58.558 1.00 44.92  ? 144 GLN C CG  1 
ATOM   4239 C CD  . GLN C 1 61  ? 12.479  -54.162 -58.054 1.00 45.80  ? 144 GLN C CD  1 
ATOM   4240 O OE1 . GLN C 1 61  ? 12.457  -55.164 -57.354 1.00 47.66  ? 144 GLN C OE1 1 
ATOM   4241 N NE2 . GLN C 1 61  ? 11.386  -53.494 -58.396 1.00 44.91  ? 144 GLN C NE2 1 
ATOM   4242 N N   . LEU C 1 62  ? 17.507  -54.984 -61.277 1.00 50.41  ? 145 LEU C N   1 
ATOM   4243 C CA  . LEU C 1 62  ? 18.361  -56.049 -61.859 1.00 57.54  ? 145 LEU C CA  1 
ATOM   4244 C C   . LEU C 1 62  ? 19.843  -55.763 -61.714 1.00 60.28  ? 145 LEU C C   1 
ATOM   4245 O O   . LEU C 1 62  ? 20.292  -54.667 -62.054 1.00 63.73  ? 145 LEU C O   1 
ATOM   4246 C CB  . LEU C 1 62  ? 18.077  -56.280 -63.347 1.00 55.74  ? 145 LEU C CB  1 
ATOM   4247 C CG  . LEU C 1 62  ? 16.607  -56.328 -63.745 1.00 55.08  ? 145 LEU C CG  1 
ATOM   4248 C CD1 . LEU C 1 62  ? 16.497  -56.133 -65.243 1.00 57.25  ? 145 LEU C CD1 1 
ATOM   4249 C CD2 . LEU C 1 62  ? 15.920  -57.598 -63.270 1.00 52.12  ? 145 LEU C CD2 1 
ATOM   4250 N N   . PRO C 1 63  ? 20.609  -56.752 -61.226 1.00 63.78  ? 146 PRO C N   1 
ATOM   4251 C CA  . PRO C 1 63  ? 22.066  -56.662 -61.349 1.00 67.13  ? 146 PRO C CA  1 
ATOM   4252 C C   . PRO C 1 63  ? 22.406  -56.245 -62.776 1.00 69.35  ? 146 PRO C C   1 
ATOM   4253 O O   . PRO C 1 63  ? 21.843  -56.792 -63.725 1.00 69.56  ? 146 PRO C O   1 
ATOM   4254 C CB  . PRO C 1 63  ? 22.539  -58.107 -61.098 1.00 65.55  ? 146 PRO C CB  1 
ATOM   4255 C CG  . PRO C 1 63  ? 21.319  -58.947 -61.237 1.00 65.51  ? 146 PRO C CG  1 
ATOM   4256 C CD  . PRO C 1 63  ? 20.181  -58.090 -60.784 1.00 63.38  ? 146 PRO C CD  1 
ATOM   4257 N N   . GLY C 1 64  ? 23.274  -55.257 -62.925 1.00 68.41  ? 147 GLY C N   1 
ATOM   4258 C CA  . GLY C 1 64  ? 23.614  -54.757 -64.247 1.00 72.52  ? 147 GLY C CA  1 
ATOM   4259 C C   . GLY C 1 64  ? 25.116  -54.692 -64.445 1.00 79.90  ? 147 GLY C C   1 
ATOM   4260 O O   . GLY C 1 64  ? 25.880  -55.309 -63.677 1.00 86.13  ? 147 GLY C O   1 
ATOM   4261 N N   . ALA C 1 65  ? 25.535  -53.958 -65.482 1.00 79.15  ? 148 ALA C N   1 
ATOM   4262 C CA  . ALA C 1 65  ? 26.957  -53.740 -65.791 1.00 80.03  ? 148 ALA C CA  1 
ATOM   4263 C C   . ALA C 1 65  ? 27.642  -52.952 -64.660 1.00 80.66  ? 148 ALA C C   1 
ATOM   4264 O O   . ALA C 1 65  ? 26.970  -52.355 -63.792 1.00 75.23  ? 148 ALA C O   1 
ATOM   4265 C CB  . ALA C 1 65  ? 27.120  -53.022 -67.133 1.00 75.30  ? 148 ALA C CB  1 
ATOM   4266 N N   . GLY C 1 66  ? 28.973  -52.974 -64.668 1.00 77.98  ? 149 GLY C N   1 
ATOM   4267 C CA  . GLY C 1 66  ? 29.771  -52.269 -63.679 1.00 79.86  ? 149 GLY C CA  1 
ATOM   4268 C C   . GLY C 1 66  ? 29.681  -52.843 -62.272 1.00 83.56  ? 149 GLY C C   1 
ATOM   4269 O O   . GLY C 1 66  ? 30.126  -52.206 -61.319 1.00 86.32  ? 149 GLY C O   1 
ATOM   4270 N N   . GLY C 1 67  ? 29.134  -54.050 -62.131 1.00 83.94  ? 150 GLY C N   1 
ATOM   4271 C CA  . GLY C 1 67  ? 28.892  -54.615 -60.806 1.00 78.78  ? 150 GLY C CA  1 
ATOM   4272 C C   . GLY C 1 67  ? 27.726  -53.954 -60.075 1.00 72.91  ? 150 GLY C C   1 
ATOM   4273 O O   . GLY C 1 67  ? 27.698  -53.912 -58.836 1.00 66.98  ? 150 GLY C O   1 
ATOM   4274 N N   . TYR C 1 68  ? 26.758  -53.440 -60.833 1.00 67.76  ? 151 TYR C N   1 
ATOM   4275 C CA  . TYR C 1 68  ? 25.571  -52.828 -60.224 1.00 65.10  ? 151 TYR C CA  1 
ATOM   4276 C C   . TYR C 1 68  ? 24.625  -53.904 -59.657 1.00 61.60  ? 151 TYR C C   1 
ATOM   4277 O O   . TYR C 1 68  ? 24.149  -54.785 -60.393 1.00 58.69  ? 151 TYR C O   1 
ATOM   4278 C CB  . TYR C 1 68  ? 24.874  -51.891 -61.223 1.00 65.86  ? 151 TYR C CB  1 
ATOM   4279 C CG  . TYR C 1 68  ? 23.517  -51.388 -60.789 1.00 65.53  ? 151 TYR C CG  1 
ATOM   4280 C CD1 . TYR C 1 68  ? 23.396  -50.326 -59.900 1.00 61.75  ? 151 TYR C CD1 1 
ATOM   4281 C CD2 . TYR C 1 68  ? 22.343  -51.975 -61.277 1.00 64.97  ? 151 TYR C CD2 1 
ATOM   4282 C CE1 . TYR C 1 68  ? 22.150  -49.866 -59.503 1.00 55.40  ? 151 TYR C CE1 1 
ATOM   4283 C CE2 . TYR C 1 68  ? 21.104  -51.522 -60.880 1.00 56.90  ? 151 TYR C CE2 1 
ATOM   4284 C CZ  . TYR C 1 68  ? 21.011  -50.468 -59.997 1.00 55.92  ? 151 TYR C CZ  1 
ATOM   4285 O OH  . TYR C 1 68  ? 19.764  -50.018 -59.571 1.00 59.24  ? 151 TYR C OH  1 
ATOM   4286 N N   . PRO C 1 69  ? 24.361  -53.835 -58.344 1.00 60.28  ? 152 PRO C N   1 
ATOM   4287 C CA  . PRO C 1 69  ? 23.677  -54.931 -57.643 1.00 61.68  ? 152 PRO C CA  1 
ATOM   4288 C C   . PRO C 1 69  ? 22.160  -54.903 -57.845 1.00 61.66  ? 152 PRO C C   1 
ATOM   4289 O O   . PRO C 1 69  ? 21.514  -55.935 -57.745 1.00 60.63  ? 152 PRO C O   1 
ATOM   4290 C CB  . PRO C 1 69  ? 24.024  -54.684 -56.173 1.00 59.76  ? 152 PRO C CB  1 
ATOM   4291 C CG  . PRO C 1 69  ? 24.273  -53.202 -56.077 1.00 57.83  ? 152 PRO C CG  1 
ATOM   4292 C CD  . PRO C 1 69  ? 24.568  -52.664 -57.466 1.00 60.91  ? 152 PRO C CD  1 
ATOM   4293 N N   . GLY C 1 70  ? 21.611  -53.735 -58.177 1.00 59.27  ? 153 GLY C N   1 
ATOM   4294 C CA  . GLY C 1 70  ? 20.157  -53.557 -58.229 1.00 55.72  ? 153 GLY C CA  1 
ATOM   4295 C C   . GLY C 1 70  ? 19.658  -53.151 -56.859 1.00 54.81  ? 153 GLY C C   1 
ATOM   4296 O O   . GLY C 1 70  ? 20.287  -53.442 -55.835 1.00 61.47  ? 153 GLY C O   1 
ATOM   4297 N N   . GLY C 1 71  ? 18.531  -52.473 -56.820 1.00 52.43  ? 154 GLY C N   1 
ATOM   4298 C CA  . GLY C 1 71  ? 17.929  -52.152 -55.549 1.00 49.28  ? 154 GLY C CA  1 
ATOM   4299 C C   . GLY C 1 71  ? 16.524  -51.631 -55.722 1.00 51.25  ? 154 GLY C C   1 
ATOM   4300 O O   . GLY C 1 71  ? 15.851  -51.917 -56.737 1.00 49.34  ? 154 GLY C O   1 
ATOM   4301 N N   . LYS C 1 72  ? 16.117  -50.827 -54.730 1.00 48.29  ? 155 LYS C N   1 
ATOM   4302 C CA  . LYS C 1 72  ? 14.761  -50.339 -54.540 1.00 41.25  ? 155 LYS C CA  1 
ATOM   4303 C C   . LYS C 1 72  ? 14.526  -49.000 -55.220 1.00 40.03  ? 155 LYS C C   1 
ATOM   4304 O O   . LYS C 1 72  ? 15.499  -48.306 -55.617 1.00 36.55  ? 155 LYS C O   1 
ATOM   4305 C CB  . LYS C 1 72  ? 14.544  -50.170 -53.071 1.00 40.56  ? 155 LYS C CB  1 
ATOM   4306 C CG  . LYS C 1 72  ? 14.560  -51.494 -52.374 1.00 44.30  ? 155 LYS C CG  1 
ATOM   4307 C CD  . LYS C 1 72  ? 13.645  -51.540 -51.165 1.00 47.26  ? 155 LYS C CD  1 
ATOM   4308 C CE  . LYS C 1 72  ? 13.827  -52.889 -50.492 1.00 51.00  ? 155 LYS C CE  1 
ATOM   4309 N NZ  . LYS C 1 72  ? 13.328  -52.712 -49.111 1.00 56.49  ? 155 LYS C NZ  1 
ATOM   4310 N N   . ILE C 1 73  ? 13.239  -48.644 -55.347 1.00 37.21  ? 156 ILE C N   1 
ATOM   4311 C CA  . ILE C 1 73  ? 12.797  -47.485 -56.109 1.00 36.98  ? 156 ILE C CA  1 
ATOM   4312 C C   . ILE C 1 73  ? 11.722  -46.790 -55.348 1.00 38.10  ? 156 ILE C C   1 
ATOM   4313 O O   . ILE C 1 73  ? 10.823  -47.455 -54.801 1.00 35.47  ? 156 ILE C O   1 
ATOM   4314 C CB  . ILE C 1 73  ? 12.075  -47.932 -57.401 1.00 39.31  ? 156 ILE C CB  1 
ATOM   4315 C CG1 . ILE C 1 73  ? 13.024  -48.695 -58.310 1.00 40.25  ? 156 ILE C CG1 1 
ATOM   4316 C CG2 . ILE C 1 73  ? 11.394  -46.755 -58.105 1.00 34.52  ? 156 ILE C CG2 1 
ATOM   4317 C CD1 . ILE C 1 73  ? 13.008  -50.165 -57.982 1.00 42.58  ? 156 ILE C CD1 1 
ATOM   4318 N N   . ILE C 1 74  ? 11.767  -45.460 -55.366 1.00 40.03  ? 157 ILE C N   1 
ATOM   4319 C CA  . ILE C 1 74  ? 10.631  -44.655 -54.889 1.00 40.35  ? 157 ILE C CA  1 
ATOM   4320 C C   . ILE C 1 74  ? 9.995   -43.986 -56.072 1.00 40.91  ? 157 ILE C C   1 
ATOM   4321 O O   . ILE C 1 74  ? 10.680  -43.498 -56.990 1.00 42.35  ? 157 ILE C O   1 
ATOM   4322 C CB  . ILE C 1 74  ? 11.020  -43.531 -53.904 1.00 45.64  ? 157 ILE C CB  1 
ATOM   4323 C CG1 . ILE C 1 74  ? 12.004  -44.028 -52.851 1.00 44.14  ? 157 ILE C CG1 1 
ATOM   4324 C CG2 . ILE C 1 74  ? 9.775   -42.981 -53.223 1.00 44.03  ? 157 ILE C CG2 1 
ATOM   4325 C CD1 . ILE C 1 74  ? 11.558  -43.766 -51.437 1.00 50.18  ? 157 ILE C CD1 1 
ATOM   4326 N N   . PHE C 1 75  ? 8.670   -43.959 -56.048 1.00 41.90  ? 158 PHE C N   1 
ATOM   4327 C CA  . PHE C 1 75  ? 7.892   -43.526 -57.191 1.00 36.48  ? 158 PHE C CA  1 
ATOM   4328 C C   . PHE C 1 75  ? 6.833   -42.596 -56.675 1.00 39.58  ? 158 PHE C C   1 
ATOM   4329 O O   . PHE C 1 75  ? 6.048   -42.939 -55.783 1.00 40.38  ? 158 PHE C O   1 
ATOM   4330 C CB  . PHE C 1 75  ? 7.221   -44.713 -57.877 1.00 35.84  ? 158 PHE C CB  1 
ATOM   4331 C CG  . PHE C 1 75  ? 6.709   -44.392 -59.274 1.00 40.16  ? 158 PHE C CG  1 
ATOM   4332 C CD1 . PHE C 1 75  ? 7.162   -45.087 -60.366 1.00 36.73  ? 158 PHE C CD1 1 
ATOM   4333 C CD2 . PHE C 1 75  ? 5.803   -43.334 -59.491 1.00 38.69  ? 158 PHE C CD2 1 
ATOM   4334 C CE1 . PHE C 1 75  ? 6.698   -44.781 -61.628 1.00 40.47  ? 158 PHE C CE1 1 
ATOM   4335 C CE2 . PHE C 1 75  ? 5.330   -43.056 -60.744 1.00 35.71  ? 158 PHE C CE2 1 
ATOM   4336 C CZ  . PHE C 1 75  ? 5.782   -43.774 -61.818 1.00 38.20  ? 158 PHE C CZ  1 
ATOM   4337 N N   . ILE C 1 76  ? 6.836   -41.399 -57.238 1.00 41.42  ? 159 ILE C N   1 
ATOM   4338 C CA  . ILE C 1 76  ? 5.862   -40.378 -56.915 1.00 39.53  ? 159 ILE C CA  1 
ATOM   4339 C C   . ILE C 1 76  ? 5.080   -40.060 -58.177 1.00 40.47  ? 159 ILE C C   1 
ATOM   4340 O O   . ILE C 1 76  ? 5.665   -39.769 -59.222 1.00 43.67  ? 159 ILE C O   1 
ATOM   4341 C CB  . ILE C 1 76  ? 6.568   -39.151 -56.395 1.00 39.85  ? 159 ILE C CB  1 
ATOM   4342 C CG1 . ILE C 1 76  ? 7.342   -39.539 -55.140 1.00 41.68  ? 159 ILE C CG1 1 
ATOM   4343 C CG2 . ILE C 1 76  ? 5.584   -38.008 -56.164 1.00 40.13  ? 159 ILE C CG2 1 
ATOM   4344 C CD1 . ILE C 1 76  ? 8.082   -38.403 -54.482 1.00 42.76  ? 159 ILE C CD1 1 
ATOM   4345 N N   . ASP C 1 77  ? 3.760   -40.113 -58.075 1.00 38.38  ? 160 ASP C N   1 
ATOM   4346 C CA  . ASP C 1 77  ? 2.893   -40.097 -59.234 1.00 38.71  ? 160 ASP C CA  1 
ATOM   4347 C C   . ASP C 1 77  ? 1.915   -38.910 -59.075 1.00 40.76  ? 160 ASP C C   1 
ATOM   4348 O O   . ASP C 1 77  ? 1.101   -38.826 -58.134 1.00 41.71  ? 160 ASP C O   1 
ATOM   4349 C CB  . ASP C 1 77  ? 2.225   -41.450 -59.265 1.00 38.84  ? 160 ASP C CB  1 
ATOM   4350 C CG  . ASP C 1 77  ? 1.180   -41.593 -60.329 1.00 43.58  ? 160 ASP C CG  1 
ATOM   4351 O OD1 . ASP C 1 77  ? 1.024   -40.714 -61.210 1.00 45.05  ? 160 ASP C OD1 1 
ATOM   4352 O OD2 . ASP C 1 77  ? 0.478   -42.637 -60.255 1.00 44.37  ? 160 ASP C OD2 1 
ATOM   4353 N N   . THR C 1 78  ? 2.052   -37.947 -59.952 1.00 40.41  ? 161 THR C N   1 
ATOM   4354 C CA  . THR C 1 78  ? 1.248   -36.755 -59.831 1.00 44.32  ? 161 THR C CA  1 
ATOM   4355 C C   . THR C 1 78  ? 0.201   -36.850 -60.886 1.00 47.61  ? 161 THR C C   1 
ATOM   4356 O O   . THR C 1 78  ? -0.523  -35.896 -61.120 1.00 50.56  ? 161 THR C O   1 
ATOM   4357 C CB  . THR C 1 78  ? 2.084   -35.506 -60.166 1.00 44.32  ? 161 THR C CB  1 
ATOM   4358 O OG1 . THR C 1 78  ? 2.489   -35.591 -61.534 1.00 44.22  ? 161 THR C OG1 1 
ATOM   4359 C CG2 . THR C 1 78  ? 3.321   -35.399 -59.289 1.00 39.98  ? 161 THR C CG2 1 
ATOM   4360 N N   . GLU C 1 79  ? 0.159   -38.004 -61.553 1.00 52.31  ? 162 GLU C N   1 
ATOM   4361 C CA  . GLU C 1 79  ? -0.518  -38.156 -62.842 1.00 51.02  ? 162 GLU C CA  1 
ATOM   4362 C C   . GLU C 1 79  ? -1.671  -39.143 -62.804 1.00 52.38  ? 162 GLU C C   1 
ATOM   4363 O O   . GLU C 1 79  ? -2.461  -39.244 -63.775 1.00 49.38  ? 162 GLU C O   1 
ATOM   4364 C CB  . GLU C 1 79  ? 0.481   -38.617 -63.883 1.00 55.33  ? 162 GLU C CB  1 
ATOM   4365 C CG  . GLU C 1 79  ? 1.570   -37.613 -64.174 1.00 66.54  ? 162 GLU C CG  1 
ATOM   4366 C CD  . GLU C 1 79  ? 1.023   -36.318 -64.733 1.00 72.48  ? 162 GLU C CD  1 
ATOM   4367 O OE1 . GLU C 1 79  ? 1.096   -35.298 -64.034 1.00 71.13  ? 162 GLU C OE1 1 
ATOM   4368 O OE2 . GLU C 1 79  ? 0.491   -36.331 -65.860 1.00 87.26  ? 162 GLU C OE2 1 
ATOM   4369 N N   . ASN C 1 80  ? -1.727  -39.890 -61.696 1.00 51.02  ? 163 ASN C N   1 
ATOM   4370 C CA  . ASN C 1 80  ? -2.631  -40.993 -61.515 1.00 48.11  ? 163 ASN C CA  1 
ATOM   4371 C C   . ASN C 1 80  ? -2.387  -42.026 -62.590 1.00 48.77  ? 163 ASN C C   1 
ATOM   4372 O O   . ASN C 1 80  ? -3.315  -42.671 -63.008 1.00 52.97  ? 163 ASN C O   1 
ATOM   4373 C CB  . ASN C 1 80  ? -4.088  -40.508 -61.571 1.00 50.63  ? 163 ASN C CB  1 
ATOM   4374 C CG  . ASN C 1 80  ? -5.068  -41.421 -60.817 1.00 51.36  ? 163 ASN C CG  1 
ATOM   4375 O OD1 . ASN C 1 80  ? -4.677  -42.312 -60.062 1.00 45.73  ? 163 ASN C OD1 1 
ATOM   4376 N ND2 . ASN C 1 80  ? -6.362  -41.177 -61.021 1.00 53.09  ? 163 ASN C ND2 1 
ATOM   4377 N N   . THR C 1 81  ? -1.150  -42.225 -63.037 1.00 49.39  ? 164 THR C N   1 
ATOM   4378 C CA  . THR C 1 81  ? -0.966  -43.211 -64.128 1.00 51.29  ? 164 THR C CA  1 
ATOM   4379 C C   . THR C 1 81  ? -0.117  -44.463 -63.848 1.00 50.55  ? 164 THR C C   1 
ATOM   4380 O O   . THR C 1 81  ? 0.007   -45.324 -64.705 1.00 58.56  ? 164 THR C O   1 
ATOM   4381 C CB  . THR C 1 81  ? -0.552  -42.568 -65.472 1.00 50.22  ? 164 THR C CB  1 
ATOM   4382 O OG1 . THR C 1 81  ? 0.650   -41.821 -65.292 1.00 49.51  ? 164 THR C OG1 1 
ATOM   4383 C CG2 . THR C 1 81  ? -1.676  -41.655 -66.004 1.00 50.07  ? 164 THR C CG2 1 
ATOM   4384 N N   . PHE C 1 82  ? 0.429   -44.586 -62.649 1.00 47.68  ? 165 PHE C N   1 
ATOM   4385 C CA  . PHE C 1 82  ? 1.168   -45.769 -62.274 1.00 45.26  ? 165 PHE C CA  1 
ATOM   4386 C C   . PHE C 1 82  ? 0.227   -46.930 -62.112 1.00 45.68  ? 165 PHE C C   1 
ATOM   4387 O O   . PHE C 1 82  ? -0.851  -46.788 -61.551 1.00 51.53  ? 165 PHE C O   1 
ATOM   4388 C CB  . PHE C 1 82  ? 1.894   -45.507 -60.986 1.00 47.41  ? 165 PHE C CB  1 
ATOM   4389 C CG  . PHE C 1 82  ? 2.685   -46.671 -60.510 1.00 49.17  ? 165 PHE C CG  1 
ATOM   4390 C CD1 . PHE C 1 82  ? 2.399   -47.265 -59.270 1.00 43.74  ? 165 PHE C CD1 1 
ATOM   4391 C CD2 . PHE C 1 82  ? 3.687   -47.203 -61.300 1.00 48.30  ? 165 PHE C CD2 1 
ATOM   4392 C CE1 . PHE C 1 82  ? 3.127   -48.346 -58.823 1.00 42.56  ? 165 PHE C CE1 1 
ATOM   4393 C CE2 . PHE C 1 82  ? 4.412   -48.300 -60.848 1.00 49.76  ? 165 PHE C CE2 1 
ATOM   4394 C CZ  . PHE C 1 82  ? 4.133   -48.866 -59.608 1.00 44.23  ? 165 PHE C CZ  1 
ATOM   4395 N N   . ARG C 1 83  ? 0.617   -48.085 -62.629 1.00 47.07  ? 166 ARG C N   1 
ATOM   4396 C CA  . ARG C 1 83  ? -0.282  -49.246 -62.723 1.00 46.72  ? 166 ARG C CA  1 
ATOM   4397 C C   . ARG C 1 83  ? 0.598   -50.444 -62.447 1.00 48.49  ? 166 ARG C C   1 
ATOM   4398 O O   . ARG C 1 83  ? 1.386   -50.862 -63.332 1.00 46.12  ? 166 ARG C O   1 
ATOM   4399 C CB  . ARG C 1 83  ? -0.879  -49.394 -64.150 1.00 45.98  ? 166 ARG C CB  1 
ATOM   4400 C CG  . ARG C 1 83  ? -1.991  -48.445 -64.611 1.00 44.73  ? 166 ARG C CG  1 
ATOM   4401 C CD  . ARG C 1 83  ? -3.261  -48.409 -63.738 1.00 46.89  ? 166 ARG C CD  1 
ATOM   4402 N NE  . ARG C 1 83  ? -3.255  -47.095 -63.105 1.00 51.28  ? 166 ARG C NE  1 
ATOM   4403 C CZ  . ARG C 1 83  ? -4.156  -46.154 -63.333 1.00 50.88  ? 166 ARG C CZ  1 
ATOM   4404 N NH1 . ARG C 1 83  ? -5.185  -46.412 -64.108 1.00 59.39  ? 166 ARG C NH1 1 
ATOM   4405 N NH2 . ARG C 1 83  ? -4.038  -44.967 -62.782 1.00 46.72  ? 166 ARG C NH2 1 
ATOM   4406 N N   . PRO C 1 84  ? 0.509   -50.995 -61.219 1.00 47.96  ? 167 PRO C N   1 
ATOM   4407 C CA  . PRO C 1 84  ? 1.317   -52.159 -60.830 1.00 49.40  ? 167 PRO C CA  1 
ATOM   4408 C C   . PRO C 1 84  ? 1.210   -53.345 -61.812 1.00 53.03  ? 167 PRO C C   1 
ATOM   4409 O O   . PRO C 1 84  ? 2.203   -53.987 -62.122 1.00 56.39  ? 167 PRO C O   1 
ATOM   4410 C CB  . PRO C 1 84  ? 0.753   -52.510 -59.471 1.00 49.39  ? 167 PRO C CB  1 
ATOM   4411 C CG  . PRO C 1 84  ? 0.351   -51.179 -58.897 1.00 48.02  ? 167 PRO C CG  1 
ATOM   4412 C CD  . PRO C 1 84  ? -0.225  -50.439 -60.074 1.00 47.98  ? 167 PRO C CD  1 
ATOM   4413 N N   . ASP C 1 85  ? 0.017   -53.605 -62.315 1.00 58.08  ? 168 ASP C N   1 
ATOM   4414 C CA  . ASP C 1 85  ? -0.191  -54.591 -63.371 1.00 62.98  ? 168 ASP C CA  1 
ATOM   4415 C C   . ASP C 1 85  ? 0.719   -54.488 -64.591 1.00 62.83  ? 168 ASP C C   1 
ATOM   4416 O O   . ASP C 1 85  ? 1.239   -55.510 -65.033 1.00 62.63  ? 168 ASP C O   1 
ATOM   4417 C CB  . ASP C 1 85  ? -1.615  -54.506 -63.863 1.00 68.79  ? 168 ASP C CB  1 
ATOM   4418 C CG  . ASP C 1 85  ? -2.437  -55.669 -63.442 1.00 76.68  ? 168 ASP C CG  1 
ATOM   4419 O OD1 . ASP C 1 85  ? -3.642  -55.421 -63.192 1.00 85.52  ? 168 ASP C OD1 1 
ATOM   4420 O OD2 . ASP C 1 85  ? -1.906  -56.815 -63.396 1.00 80.24  ? 168 ASP C OD2 1 
ATOM   4421 N N   . ARG C 1 86  ? 0.870   -53.270 -65.139 1.00 59.53  ? 169 ARG C N   1 
ATOM   4422 C CA  . ARG C 1 86  ? 1.760   -53.004 -66.268 1.00 59.08  ? 169 ARG C CA  1 
ATOM   4423 C C   . ARG C 1 86  ? 3.118   -53.570 -66.027 1.00 57.33  ? 169 ARG C C   1 
ATOM   4424 O O   . ARG C 1 86  ? 3.826   -53.876 -66.978 1.00 64.18  ? 169 ARG C O   1 
ATOM   4425 C CB  . ARG C 1 86  ? 1.985   -51.496 -66.506 1.00 61.60  ? 169 ARG C CB  1 
ATOM   4426 C CG  . ARG C 1 86  ? 1.327   -50.867 -67.729 1.00 66.88  ? 169 ARG C CG  1 
ATOM   4427 C CD  . ARG C 1 86  ? 0.983   -51.870 -68.833 1.00 84.55  ? 169 ARG C CD  1 
ATOM   4428 N NE  . ARG C 1 86  ? 2.116   -52.438 -69.595 1.00 85.28  ? 169 ARG C NE  1 
ATOM   4429 C CZ  . ARG C 1 86  ? 3.272   -51.830 -69.861 1.00 75.91  ? 169 ARG C CZ  1 
ATOM   4430 N NH1 . ARG C 1 86  ? 3.499   -50.583 -69.441 1.00 64.59  ? 169 ARG C NH1 1 
ATOM   4431 N NH2 . ARG C 1 86  ? 4.183   -52.482 -70.579 1.00 68.62  ? 169 ARG C NH2 1 
ATOM   4432 N N   . LEU C 1 87  ? 3.513   -53.649 -64.760 1.00 57.46  ? 170 LEU C N   1 
ATOM   4433 C CA  . LEU C 1 87  ? 4.878   -54.063 -64.417 1.00 60.55  ? 170 LEU C CA  1 
ATOM   4434 C C   . LEU C 1 87  ? 5.027   -55.550 -64.572 1.00 62.80  ? 170 LEU C C   1 
ATOM   4435 O O   . LEU C 1 87  ? 6.111   -56.099 -64.406 1.00 65.77  ? 170 LEU C O   1 
ATOM   4436 C CB  . LEU C 1 87  ? 5.274   -53.669 -62.993 1.00 55.22  ? 170 LEU C CB  1 
ATOM   4437 C CG  . LEU C 1 87  ? 5.413   -52.190 -62.769 1.00 54.18  ? 170 LEU C CG  1 
ATOM   4438 C CD1 . LEU C 1 87  ? 6.112   -51.921 -61.437 1.00 50.85  ? 170 LEU C CD1 1 
ATOM   4439 C CD2 . LEU C 1 87  ? 6.172   -51.602 -63.960 1.00 55.43  ? 170 LEU C CD2 1 
ATOM   4440 N N   . ARG C 1 88  ? 3.951   -56.232 -64.887 1.00 64.07  ? 171 ARG C N   1 
ATOM   4441 C CA  . ARG C 1 88  ? 4.114   -57.632 -64.724 1.00 68.73  ? 171 ARG C CA  1 
ATOM   4442 C C   . ARG C 1 88  ? 4.511   -58.373 -65.964 1.00 69.19  ? 171 ARG C C   1 
ATOM   4443 O O   . ARG C 1 88  ? 5.233   -59.359 -65.879 1.00 67.13  ? 171 ARG C O   1 
ATOM   4444 C CB  . ARG C 1 88  ? 3.146   -58.208 -63.709 1.00 71.42  ? 171 ARG C CB  1 
ATOM   4445 C CG  . ARG C 1 88  ? 3.560   -57.557 -62.355 1.00 71.66  ? 171 ARG C CG  1 
ATOM   4446 C CD  . ARG C 1 88  ? 2.553   -57.636 -61.244 1.00 67.23  ? 171 ARG C CD  1 
ATOM   4447 N NE  . ARG C 1 88  ? 2.239   -59.028 -60.993 1.00 82.30  ? 171 ARG C NE  1 
ATOM   4448 C CZ  . ARG C 1 88  ? 1.046   -59.607 -61.192 1.00 90.73  ? 171 ARG C CZ  1 
ATOM   4449 N NH1 . ARG C 1 88  ? -0.011  -58.903 -61.622 1.00 83.10  ? 171 ARG C NH1 1 
ATOM   4450 N NH2 . ARG C 1 88  ? 0.914   -60.911 -60.939 1.00 88.48  ? 171 ARG C NH2 1 
ATOM   4451 N N   . ASP C 1 89  ? 4.212   -57.773 -67.112 1.00 69.16  ? 172 ASP C N   1 
ATOM   4452 C CA  . ASP C 1 89  ? 4.816   -58.226 -68.366 1.00 71.53  ? 172 ASP C CA  1 
ATOM   4453 C C   . ASP C 1 89  ? 6.218   -57.719 -68.481 1.00 70.01  ? 172 ASP C C   1 
ATOM   4454 O O   . ASP C 1 89  ? 7.038   -58.290 -69.232 1.00 69.84  ? 172 ASP C O   1 
ATOM   4455 C CB  . ASP C 1 89  ? 4.062   -57.738 -69.588 1.00 78.24  ? 172 ASP C CB  1 
ATOM   4456 C CG  . ASP C 1 89  ? 2.601   -57.992 -69.488 1.00 85.96  ? 172 ASP C CG  1 
ATOM   4457 O OD1 . ASP C 1 89  ? 1.928   -57.196 -68.752 1.00 87.62  ? 172 ASP C OD1 1 
ATOM   4458 O OD2 . ASP C 1 89  ? 2.157   -58.990 -70.124 1.00 79.36  ? 172 ASP C OD2 1 
ATOM   4459 N N   . ILE C 1 90  ? 6.524   -56.641 -67.765 1.00 62.25  ? 173 ILE C N   1 
ATOM   4460 C CA  . ILE C 1 90  ? 7.915   -56.197 -67.839 1.00 58.14  ? 173 ILE C CA  1 
ATOM   4461 C C   . ILE C 1 90  ? 8.749   -57.173 -67.003 1.00 60.54  ? 173 ILE C C   1 
ATOM   4462 O O   . ILE C 1 90  ? 9.884   -57.548 -67.411 1.00 61.82  ? 173 ILE C O   1 
ATOM   4463 C CB  . ILE C 1 90  ? 8.093   -54.713 -67.504 1.00 51.36  ? 173 ILE C CB  1 
ATOM   4464 C CG1 . ILE C 1 90  ? 7.237   -53.889 -68.460 1.00 48.51  ? 173 ILE C CG1 1 
ATOM   4465 C CG2 . ILE C 1 90  ? 9.552   -54.322 -67.607 1.00 49.42  ? 173 ILE C CG2 1 
ATOM   4466 C CD1 . ILE C 1 90  ? 6.941   -52.490 -68.026 1.00 44.32  ? 173 ILE C CD1 1 
ATOM   4467 N N   . ALA C 1 91  ? 8.150   -57.641 -65.897 1.00 56.90  ? 174 ALA C N   1 
ATOM   4468 C CA  . ALA C 1 91  ? 8.757   -58.685 -65.089 1.00 59.77  ? 174 ALA C CA  1 
ATOM   4469 C C   . ALA C 1 91  ? 8.998   -59.985 -65.882 1.00 64.01  ? 174 ALA C C   1 
ATOM   4470 O O   . ALA C 1 91  ? 10.061  -60.580 -65.752 1.00 66.32  ? 174 ALA C O   1 
ATOM   4471 C CB  . ALA C 1 91  ? 7.944   -58.959 -63.836 1.00 56.88  ? 174 ALA C CB  1 
ATOM   4472 N N   . ASP C 1 92  ? 8.041   -60.422 -66.697 1.00 66.55  ? 175 ASP C N   1 
ATOM   4473 C CA  . ASP C 1 92  ? 8.251   -61.652 -67.491 1.00 73.17  ? 175 ASP C CA  1 
ATOM   4474 C C   . ASP C 1 92  ? 9.405   -61.462 -68.455 1.00 70.57  ? 175 ASP C C   1 
ATOM   4475 O O   . ASP C 1 92  ? 10.347  -62.258 -68.490 1.00 68.42  ? 175 ASP C O   1 
ATOM   4476 C CB  . ASP C 1 92  ? 6.992   -62.085 -68.257 1.00 81.63  ? 175 ASP C CB  1 
ATOM   4477 C CG  . ASP C 1 92  ? 5.830   -62.417 -67.327 1.00 92.12  ? 175 ASP C CG  1 
ATOM   4478 O OD1 . ASP C 1 92  ? 6.096   -62.672 -66.133 1.00 97.56  ? 175 ASP C OD1 1 
ATOM   4479 O OD2 . ASP C 1 92  ? 4.653   -62.407 -67.770 1.00 97.72  ? 175 ASP C OD2 1 
ATOM   4480 N N   . ARG C 1 93  ? 9.346   -60.372 -69.210 1.00 67.25  ? 176 ARG C N   1 
ATOM   4481 C CA  . ARG C 1 93  ? 10.380  -60.085 -70.161 1.00 64.24  ? 176 ARG C CA  1 
ATOM   4482 C C   . ARG C 1 93  ? 11.728  -60.178 -69.475 1.00 65.89  ? 176 ARG C C   1 
ATOM   4483 O O   . ARG C 1 93  ? 12.663  -60.666 -70.059 1.00 68.38  ? 176 ARG C O   1 
ATOM   4484 C CB  . ARG C 1 93  ? 10.197  -58.708 -70.748 1.00 60.85  ? 176 ARG C CB  1 
ATOM   4485 C CG  . ARG C 1 93  ? 11.519  -58.161 -71.248 1.00 63.22  ? 176 ARG C CG  1 
ATOM   4486 C CD  . ARG C 1 93  ? 11.419  -56.729 -71.698 1.00 59.96  ? 176 ARG C CD  1 
ATOM   4487 N NE  . ARG C 1 93  ? 12.632  -56.319 -72.405 1.00 59.29  ? 176 ARG C NE  1 
ATOM   4488 C CZ  . ARG C 1 93  ? 12.910  -55.056 -72.672 1.00 57.66  ? 176 ARG C CZ  1 
ATOM   4489 N NH1 . ARG C 1 93  ? 12.063  -54.112 -72.282 1.00 57.77  ? 176 ARG C NH1 1 
ATOM   4490 N NH2 . ARG C 1 93  ? 14.033  -54.723 -73.276 1.00 57.87  ? 176 ARG C NH2 1 
ATOM   4491 N N   . PHE C 1 94  ? 11.840  -59.703 -68.235 1.00 65.64  ? 177 PHE C N   1 
ATOM   4492 C CA  . PHE C 1 94  ? 13.137  -59.733 -67.565 1.00 63.84  ? 177 PHE C CA  1 
ATOM   4493 C C   . PHE C 1 94  ? 13.371  -60.926 -66.700 1.00 62.96  ? 177 PHE C C   1 
ATOM   4494 O O   . PHE C 1 94  ? 14.413  -61.020 -66.084 1.00 63.13  ? 177 PHE C O   1 
ATOM   4495 C CB  . PHE C 1 94  ? 13.381  -58.457 -66.765 1.00 62.86  ? 177 PHE C CB  1 
ATOM   4496 C CG  . PHE C 1 94  ? 13.805  -57.326 -67.623 1.00 65.62  ? 177 PHE C CG  1 
ATOM   4497 C CD1 . PHE C 1 94  ? 12.925  -56.291 -67.920 1.00 62.73  ? 177 PHE C CD1 1 
ATOM   4498 C CD2 . PHE C 1 94  ? 15.066  -57.345 -68.223 1.00 64.63  ? 177 PHE C CD2 1 
ATOM   4499 C CE1 . PHE C 1 94  ? 13.332  -55.270 -68.766 1.00 61.67  ? 177 PHE C CE1 1 
ATOM   4500 C CE2 . PHE C 1 94  ? 15.476  -56.324 -69.057 1.00 63.18  ? 177 PHE C CE2 1 
ATOM   4501 C CZ  . PHE C 1 94  ? 14.613  -55.285 -69.328 1.00 61.92  ? 177 PHE C CZ  1 
ATOM   4502 N N   . ASN C 1 95  ? 12.394  -61.816 -66.624 1.00 65.38  ? 178 ASN C N   1 
ATOM   4503 C CA  . ASN C 1 95  ? 12.571  -63.082 -65.909 1.00 71.09  ? 178 ASN C CA  1 
ATOM   4504 C C   . ASN C 1 95  ? 12.642  -63.024 -64.368 1.00 71.64  ? 178 ASN C C   1 
ATOM   4505 O O   . ASN C 1 95  ? 13.319  -63.833 -63.728 1.00 74.67  ? 178 ASN C O   1 
ATOM   4506 C CB  . ASN C 1 95  ? 13.831  -63.764 -66.428 1.00 71.02  ? 178 ASN C CB  1 
ATOM   4507 C CG  . ASN C 1 95  ? 13.618  -65.214 -66.696 1.00 73.27  ? 178 ASN C CG  1 
ATOM   4508 O OD1 . ASN C 1 95  ? 12.480  -65.707 -66.642 1.00 70.29  ? 178 ASN C OD1 1 
ATOM   4509 N ND2 . ASN C 1 95  ? 14.717  -65.925 -66.976 1.00 77.77  ? 178 ASN C ND2 1 
ATOM   4510 N N   . VAL C 1 96  ? 11.923  -62.088 -63.775 1.00 69.53  ? 179 VAL C N   1 
ATOM   4511 C CA  . VAL C 1 96  ? 12.064  -61.815 -62.356 1.00 69.25  ? 179 VAL C CA  1 
ATOM   4512 C C   . VAL C 1 96  ? 10.682  -62.012 -61.707 1.00 68.08  ? 179 VAL C C   1 
ATOM   4513 O O   . VAL C 1 96  ? 9.686   -61.833 -62.406 1.00 66.44  ? 179 VAL C O   1 
ATOM   4514 C CB  . VAL C 1 96  ? 12.657  -60.402 -62.263 1.00 66.49  ? 179 VAL C CB  1 
ATOM   4515 C CG1 . VAL C 1 96  ? 12.025  -59.559 -61.180 1.00 66.83  ? 179 VAL C CG1 1 
ATOM   4516 C CG2 . VAL C 1 96  ? 14.167  -60.492 -62.129 1.00 65.30  ? 179 VAL C CG2 1 
ATOM   4517 N N   . ASP C 1 97  ? 10.581  -62.428 -60.437 1.00 66.94  ? 180 ASP C N   1 
ATOM   4518 C CA  . ASP C 1 97  ? 9.230   -62.566 -59.829 1.00 68.52  ? 180 ASP C CA  1 
ATOM   4519 C C   . ASP C 1 97  ? 8.444   -61.209 -59.772 1.00 68.93  ? 180 ASP C C   1 
ATOM   4520 O O   . ASP C 1 97  ? 8.994   -60.169 -59.421 1.00 63.57  ? 180 ASP C O   1 
ATOM   4521 C CB  . ASP C 1 97  ? 9.291   -63.258 -58.462 1.00 70.52  ? 180 ASP C CB  1 
ATOM   4522 C CG  . ASP C 1 97  ? 7.986   -63.097 -57.642 1.00 78.90  ? 180 ASP C CG  1 
ATOM   4523 O OD1 . ASP C 1 97  ? 8.067   -62.540 -56.523 1.00 80.96  ? 180 ASP C OD1 1 
ATOM   4524 O OD2 . ASP C 1 97  ? 6.880   -63.502 -58.100 1.00 79.66  ? 180 ASP C OD2 1 
ATOM   4525 N N   . HIS C 1 98  ? 7.168   -61.224 -60.152 1.00 73.58  ? 181 HIS C N   1 
ATOM   4526 C CA  . HIS C 1 98  ? 6.342   -60.007 -60.202 1.00 73.02  ? 181 HIS C CA  1 
ATOM   4527 C C   . HIS C 1 98  ? 6.103   -59.403 -58.845 1.00 68.03  ? 181 HIS C C   1 
ATOM   4528 O O   . HIS C 1 98  ? 6.151   -58.165 -58.676 1.00 66.35  ? 181 HIS C O   1 
ATOM   4529 C CB  . HIS C 1 98  ? 5.022   -60.236 -60.969 1.00 83.00  ? 181 HIS C CB  1 
ATOM   4530 C CG  . HIS C 1 98  ? 4.477   -61.673 -60.892 1.00 110.69 ? 181 HIS C CG  1 
ATOM   4531 N ND1 . HIS C 1 98  ? 4.330   -62.457 -61.987 1.00 116.58 ? 181 HIS C ND1 1 
ATOM   4532 C CD2 . HIS C 1 98  ? 4.029   -62.444 -59.799 1.00 116.14 ? 181 HIS C CD2 1 
ATOM   4533 C CE1 . HIS C 1 98  ? 3.821   -63.662 -61.619 1.00 127.46 ? 181 HIS C CE1 1 
ATOM   4534 N NE2 . HIS C 1 98  ? 3.632   -63.649 -60.284 1.00 124.26 ? 181 HIS C NE2 1 
ATOM   4535 N N   . ASP C 1 99  ? 5.869   -60.267 -57.859 1.00 65.09  ? 182 ASP C N   1 
ATOM   4536 C CA  . ASP C 1 99  ? 5.562   -59.819 -56.511 1.00 59.87  ? 182 ASP C CA  1 
ATOM   4537 C C   . ASP C 1 99  ? 6.785   -59.258 -55.859 1.00 59.02  ? 182 ASP C C   1 
ATOM   4538 O O   . ASP C 1 99  ? 6.695   -58.256 -55.144 1.00 54.91  ? 182 ASP C O   1 
ATOM   4539 C CB  . ASP C 1 99  ? 4.965   -60.928 -55.673 1.00 64.89  ? 182 ASP C CB  1 
ATOM   4540 C CG  . ASP C 1 99  ? 3.562   -61.336 -56.155 1.00 71.42  ? 182 ASP C CG  1 
ATOM   4541 O OD1 . ASP C 1 99  ? 3.153   -62.526 -55.958 1.00 80.61  ? 182 ASP C OD1 1 
ATOM   4542 O OD2 . ASP C 1 99  ? 2.879   -60.469 -56.750 1.00 65.02  ? 182 ASP C OD2 1 
ATOM   4543 N N   . ALA C 1 100 ? 7.946   -59.862 -56.131 1.00 56.32  ? 183 ALA C N   1 
ATOM   4544 C CA  . ALA C 1 100 ? 9.189   -59.275 -55.653 1.00 51.91  ? 183 ALA C CA  1 
ATOM   4545 C C   . ALA C 1 100 ? 9.397   -57.882 -56.236 1.00 49.98  ? 183 ALA C C   1 
ATOM   4546 O O   . ALA C 1 100 ? 9.847   -56.982 -55.537 1.00 53.03  ? 183 ALA C O   1 
ATOM   4547 C CB  . ALA C 1 100 ? 10.385  -60.162 -55.956 1.00 52.95  ? 183 ALA C CB  1 
ATOM   4548 N N   . VAL C 1 101 ? 9.077   -57.696 -57.511 1.00 49.35  ? 184 VAL C N   1 
ATOM   4549 C CA  . VAL C 1 101 ? 9.358   -56.437 -58.185 1.00 47.86  ? 184 VAL C CA  1 
ATOM   4550 C C   . VAL C 1 101 ? 8.519   -55.416 -57.519 1.00 46.66  ? 184 VAL C C   1 
ATOM   4551 O O   . VAL C 1 101 ? 8.992   -54.353 -57.219 1.00 50.53  ? 184 VAL C O   1 
ATOM   4552 C CB  . VAL C 1 101 ? 9.041   -56.521 -59.686 1.00 51.49  ? 184 VAL C CB  1 
ATOM   4553 C CG1 . VAL C 1 101 ? 8.550   -55.193 -60.279 1.00 52.02  ? 184 VAL C CG1 1 
ATOM   4554 C CG2 . VAL C 1 101 ? 10.264  -57.031 -60.422 1.00 52.48  ? 184 VAL C CG2 1 
ATOM   4555 N N   . LEU C 1 102 ? 7.287   -55.782 -57.214 1.00 48.51  ? 185 LEU C N   1 
ATOM   4556 C CA  . LEU C 1 102 ? 6.352   -54.883 -56.563 1.00 47.56  ? 185 LEU C CA  1 
ATOM   4557 C C   . LEU C 1 102 ? 6.664   -54.523 -55.110 1.00 48.67  ? 185 LEU C C   1 
ATOM   4558 O O   . LEU C 1 102 ? 6.381   -53.406 -54.684 1.00 49.31  ? 185 LEU C O   1 
ATOM   4559 C CB  . LEU C 1 102 ? 4.964   -55.485 -56.665 1.00 48.57  ? 185 LEU C CB  1 
ATOM   4560 C CG  . LEU C 1 102 ? 4.011   -54.972 -57.742 1.00 45.85  ? 185 LEU C CG  1 
ATOM   4561 C CD1 . LEU C 1 102 ? 4.703   -54.433 -58.971 1.00 46.60  ? 185 LEU C CD1 1 
ATOM   4562 C CD2 . LEU C 1 102 ? 3.084   -56.118 -58.081 1.00 46.41  ? 185 LEU C CD2 1 
ATOM   4563 N N   . ASP C 1 103 ? 7.250   -55.450 -54.356 1.00 50.41  ? 186 ASP C N   1 
ATOM   4564 C CA  . ASP C 1 103 ? 7.618   -55.180 -52.964 1.00 50.32  ? 186 ASP C CA  1 
ATOM   4565 C C   . ASP C 1 103 ? 8.709   -54.160 -52.864 1.00 48.91  ? 186 ASP C C   1 
ATOM   4566 O O   . ASP C 1 103 ? 8.949   -53.624 -51.786 1.00 48.40  ? 186 ASP C O   1 
ATOM   4567 C CB  . ASP C 1 103 ? 8.125   -56.429 -52.282 1.00 55.05  ? 186 ASP C CB  1 
ATOM   4568 C CG  . ASP C 1 103 ? 7.052   -57.477 -52.143 1.00 69.62  ? 186 ASP C CG  1 
ATOM   4569 O OD1 . ASP C 1 103 ? 7.407   -58.695 -52.180 1.00 73.70  ? 186 ASP C OD1 1 
ATOM   4570 O OD2 . ASP C 1 103 ? 5.846   -57.081 -52.023 1.00 68.71  ? 186 ASP C OD2 1 
ATOM   4571 N N   . ASN C 1 104 ? 9.409   -53.936 -53.967 1.00 44.90  ? 187 ASN C N   1 
ATOM   4572 C CA  . ASN C 1 104 ? 10.576  -53.099 -53.908 1.00 48.03  ? 187 ASN C CA  1 
ATOM   4573 C C   . ASN C 1 104 ? 10.397  -51.692 -54.464 1.00 47.69  ? 187 ASN C C   1 
ATOM   4574 O O   . ASN C 1 104 ? 11.363  -50.963 -54.559 1.00 49.78  ? 187 ASN C O   1 
ATOM   4575 C CB  . ASN C 1 104 ? 11.723  -53.776 -54.620 1.00 50.72  ? 187 ASN C CB  1 
ATOM   4576 C CG  . ASN C 1 104 ? 12.245  -54.967 -53.857 1.00 54.83  ? 187 ASN C CG  1 
ATOM   4577 O OD1 . ASN C 1 104 ? 12.645  -54.888 -52.674 1.00 56.88  ? 187 ASN C OD1 1 
ATOM   4578 N ND2 . ASN C 1 104 ? 12.221  -56.089 -54.519 1.00 59.31  ? 187 ASN C ND2 1 
ATOM   4579 N N   . VAL C 1 105 ? 9.179   -51.332 -54.841 1.00 43.74  ? 188 VAL C N   1 
ATOM   4580 C CA  . VAL C 1 105 ? 8.853   -50.002 -55.272 1.00 42.60  ? 188 VAL C CA  1 
ATOM   4581 C C   . VAL C 1 105 ? 7.978   -49.371 -54.186 1.00 45.59  ? 188 VAL C C   1 
ATOM   4582 O O   . VAL C 1 105 ? 6.930   -49.935 -53.811 1.00 45.93  ? 188 VAL C O   1 
ATOM   4583 C CB  . VAL C 1 105 ? 8.033   -50.057 -56.571 1.00 42.02  ? 188 VAL C CB  1 
ATOM   4584 C CG1 . VAL C 1 105 ? 7.622   -48.678 -57.028 1.00 41.10  ? 188 VAL C CG1 1 
ATOM   4585 C CG2 . VAL C 1 105 ? 8.830   -50.733 -57.642 1.00 42.87  ? 188 VAL C CG2 1 
ATOM   4586 N N   . LEU C 1 106 ? 8.409   -48.220 -53.674 1.00 41.71  ? 189 LEU C N   1 
ATOM   4587 C CA  . LEU C 1 106 ? 7.598   -47.440 -52.777 1.00 37.14  ? 189 LEU C CA  1 
ATOM   4588 C C   . LEU C 1 106 ? 6.923   -46.370 -53.573 1.00 39.52  ? 189 LEU C C   1 
ATOM   4589 O O   . LEU C 1 106 ? 7.587   -45.657 -54.398 1.00 37.51  ? 189 LEU C O   1 
ATOM   4590 C CB  . LEU C 1 106 ? 8.438   -46.800 -51.711 1.00 39.47  ? 189 LEU C CB  1 
ATOM   4591 C CG  . LEU C 1 106 ? 8.288   -47.230 -50.252 1.00 42.30  ? 189 LEU C CG  1 
ATOM   4592 C CD1 . LEU C 1 106 ? 7.762   -48.679 -50.126 1.00 40.04  ? 189 LEU C CD1 1 
ATOM   4593 C CD2 . LEU C 1 106 ? 9.643   -46.974 -49.596 1.00 36.73  ? 189 LEU C CD2 1 
ATOM   4594 N N   . TYR C 1 107 ? 5.614   -46.228 -53.308 1.00 37.61  ? 190 TYR C N   1 
ATOM   4595 C CA  . TYR C 1 107 ? 4.748   -45.408 -54.137 1.00 35.28  ? 190 TYR C CA  1 
ATOM   4596 C C   . TYR C 1 107 ? 3.916   -44.495 -53.255 1.00 36.19  ? 190 TYR C C   1 
ATOM   4597 O O   . TYR C 1 107 ? 3.391   -44.885 -52.185 1.00 36.92  ? 190 TYR C O   1 
ATOM   4598 C CB  . TYR C 1 107 ? 3.871   -46.324 -55.011 1.00 36.95  ? 190 TYR C CB  1 
ATOM   4599 C CG  . TYR C 1 107 ? 2.805   -45.634 -55.803 1.00 37.43  ? 190 TYR C CG  1 
ATOM   4600 C CD1 . TYR C 1 107 ? 3.120   -45.047 -57.012 1.00 38.31  ? 190 TYR C CD1 1 
ATOM   4601 C CD2 . TYR C 1 107 ? 1.473   -45.575 -55.370 1.00 39.06  ? 190 TYR C CD2 1 
ATOM   4602 C CE1 . TYR C 1 107 ? 2.171   -44.443 -57.795 1.00 37.20  ? 190 TYR C CE1 1 
ATOM   4603 C CE2 . TYR C 1 107 ? 0.497   -44.917 -56.137 1.00 37.72  ? 190 TYR C CE2 1 
ATOM   4604 C CZ  . TYR C 1 107 ? 0.866   -44.355 -57.360 1.00 38.98  ? 190 TYR C CZ  1 
ATOM   4605 O OH  . TYR C 1 107 ? -0.003  -43.664 -58.183 1.00 40.54  ? 190 TYR C OH  1 
ATOM   4606 N N   . ALA C 1 108 ? 3.847   -43.261 -53.708 1.00 34.14  ? 191 ALA C N   1 
ATOM   4607 C CA  . ALA C 1 108 ? 2.907   -42.274 -53.215 1.00 34.45  ? 191 ALA C CA  1 
ATOM   4608 C C   . ALA C 1 108 ? 2.430   -41.409 -54.377 1.00 31.90  ? 191 ALA C C   1 
ATOM   4609 O O   . ALA C 1 108 ? 3.204   -41.079 -55.253 1.00 30.46  ? 191 ALA C O   1 
ATOM   4610 C CB  . ALA C 1 108 ? 3.529   -41.397 -52.131 1.00 28.47  ? 191 ALA C CB  1 
ATOM   4611 N N   . ARG C 1 109 ? 1.154   -41.066 -54.344 1.00 34.44  ? 192 ARG C N   1 
ATOM   4612 C CA  . ARG C 1 109 ? 0.524   -40.063 -55.199 1.00 38.13  ? 192 ARG C CA  1 
ATOM   4613 C C   . ARG C 1 109 ? 0.812   -38.740 -54.563 1.00 41.65  ? 192 ARG C C   1 
ATOM   4614 O O   . ARG C 1 109 ? 0.715   -38.630 -53.348 1.00 45.89  ? 192 ARG C O   1 
ATOM   4615 C CB  . ARG C 1 109 ? -1.027  -40.228 -55.176 1.00 36.85  ? 192 ARG C CB  1 
ATOM   4616 C CG  . ARG C 1 109 ? -1.583  -41.391 -55.949 1.00 33.74  ? 192 ARG C CG  1 
ATOM   4617 C CD  . ARG C 1 109 ? -1.629  -41.028 -57.429 1.00 35.45  ? 192 ARG C CD  1 
ATOM   4618 N NE  . ARG C 1 109 ? -2.796  -40.208 -57.720 1.00 38.13  ? 192 ARG C NE  1 
ATOM   4619 C CZ  . ARG C 1 109 ? -2.742  -38.944 -58.160 1.00 39.42  ? 192 ARG C CZ  1 
ATOM   4620 N NH1 . ARG C 1 109 ? -1.587  -38.356 -58.386 1.00 41.82  ? 192 ARG C NH1 1 
ATOM   4621 N NH2 . ARG C 1 109 ? -3.851  -38.273 -58.413 1.00 40.43  ? 192 ARG C NH2 1 
ATOM   4622 N N   . ALA C 1 110 ? 1.087   -37.724 -55.369 1.00 46.16  ? 193 ALA C N   1 
ATOM   4623 C CA  . ALA C 1 110 ? 1.081   -36.340 -54.889 1.00 47.48  ? 193 ALA C CA  1 
ATOM   4624 C C   . ALA C 1 110 ? -0.140  -35.587 -55.444 1.00 49.16  ? 193 ALA C C   1 
ATOM   4625 O O   . ALA C 1 110 ? -0.377  -35.586 -56.644 1.00 54.04  ? 193 ALA C O   1 
ATOM   4626 C CB  . ALA C 1 110 ? 2.345   -35.650 -55.350 1.00 49.64  ? 193 ALA C CB  1 
ATOM   4627 N N   . TYR C 1 111 ? -0.882  -34.916 -54.587 1.00 47.26  ? 194 TYR C N   1 
ATOM   4628 C CA  . TYR C 1 111 ? -2.093  -34.188 -54.992 1.00 48.16  ? 194 TYR C CA  1 
ATOM   4629 C C   . TYR C 1 111 ? -1.966  -32.663 -55.129 1.00 49.42  ? 194 TYR C C   1 
ATOM   4630 O O   . TYR C 1 111 ? -2.871  -32.027 -55.696 1.00 50.96  ? 194 TYR C O   1 
ATOM   4631 C CB  . TYR C 1 111 ? -3.237  -34.505 -54.031 1.00 46.28  ? 194 TYR C CB  1 
ATOM   4632 C CG  . TYR C 1 111 ? -3.545  -35.953 -54.025 1.00 46.21  ? 194 TYR C CG  1 
ATOM   4633 C CD1 . TYR C 1 111 ? -3.148  -36.763 -52.963 1.00 45.55  ? 194 TYR C CD1 1 
ATOM   4634 C CD2 . TYR C 1 111 ? -4.232  -36.546 -55.093 1.00 46.28  ? 194 TYR C CD2 1 
ATOM   4635 C CE1 . TYR C 1 111 ? -3.406  -38.133 -52.963 1.00 42.75  ? 194 TYR C CE1 1 
ATOM   4636 C CE2 . TYR C 1 111 ? -4.520  -37.915 -55.083 1.00 44.03  ? 194 TYR C CE2 1 
ATOM   4637 C CZ  . TYR C 1 111 ? -4.084  -38.709 -54.027 1.00 44.58  ? 194 TYR C CZ  1 
ATOM   4638 O OH  . TYR C 1 111 ? -4.345  -40.092 -54.030 1.00 45.20  ? 194 TYR C OH  1 
ATOM   4639 N N   . THR C 1 112 ? -0.880  -32.098 -54.586 1.00 48.09  ? 195 THR C N   1 
ATOM   4640 C CA  . THR C 1 112 ? -0.553  -30.664 -54.679 1.00 48.05  ? 195 THR C CA  1 
ATOM   4641 C C   . THR C 1 112 ? 0.958   -30.477 -54.755 1.00 49.98  ? 195 THR C C   1 
ATOM   4642 O O   . THR C 1 112 ? 1.735   -31.385 -54.390 1.00 46.60  ? 195 THR C O   1 
ATOM   4643 C CB  . THR C 1 112 ? -1.101  -29.808 -53.479 1.00 48.54  ? 195 THR C CB  1 
ATOM   4644 O OG1 . THR C 1 112 ? -0.351  -30.079 -52.296 1.00 50.06  ? 195 THR C OG1 1 
ATOM   4645 C CG2 . THR C 1 112 ? -2.580  -30.051 -53.180 1.00 44.26  ? 195 THR C CG2 1 
ATOM   4646 N N   . SER C 1 113 ? 1.365   -29.307 -55.265 1.00 53.22  ? 196 SER C N   1 
ATOM   4647 C CA  . SER C 1 113 ? 2.735   -28.797 -55.161 1.00 50.37  ? 196 SER C CA  1 
ATOM   4648 C C   . SER C 1 113 ? 3.304   -28.980 -53.778 1.00 49.37  ? 196 SER C C   1 
ATOM   4649 O O   . SER C 1 113 ? 4.392   -29.504 -53.613 1.00 46.51  ? 196 SER C O   1 
ATOM   4650 C CB  . SER C 1 113 ? 2.715   -27.272 -55.354 1.00 57.06  ? 196 SER C CB  1 
ATOM   4651 O OG  . SER C 1 113 ? 2.671   -26.966 -56.712 1.00 63.15  ? 196 SER C OG  1 
ATOM   4652 N N   . GLU C 1 114 ? 2.578   -28.428 -52.802 1.00 51.10  ? 197 GLU C N   1 
ATOM   4653 C CA  . GLU C 1 114 ? 2.954   -28.468 -51.432 1.00 52.92  ? 197 GLU C CA  1 
ATOM   4654 C C   . GLU C 1 114 ? 3.198   -29.928 -51.079 1.00 51.16  ? 197 GLU C C   1 
ATOM   4655 O O   . GLU C 1 114 ? 4.278   -30.284 -50.600 1.00 52.99  ? 197 GLU C O   1 
ATOM   4656 C CB  . GLU C 1 114 ? 1.818   -27.920 -50.608 1.00 60.62  ? 197 GLU C CB  1 
ATOM   4657 C CG  . GLU C 1 114 ? 2.222   -26.976 -49.498 1.00 71.46  ? 197 GLU C CG  1 
ATOM   4658 C CD  . GLU C 1 114 ? 1.016   -26.182 -48.995 1.00 84.45  ? 197 GLU C CD  1 
ATOM   4659 O OE1 . GLU C 1 114 ? 0.138   -26.793 -48.343 1.00 87.47  ? 197 GLU C OE1 1 
ATOM   4660 O OE2 . GLU C 1 114 ? 0.921   -24.952 -49.256 1.00 90.23  ? 197 GLU C OE2 1 
ATOM   4661 N N   . HIS C 1 115 ? 2.201   -30.765 -51.361 1.00 45.83  ? 198 HIS C N   1 
ATOM   4662 C CA  . HIS C 1 115 ? 2.244   -32.170 -51.090 1.00 44.22  ? 198 HIS C CA  1 
ATOM   4663 C C   . HIS C 1 115 ? 3.456   -32.791 -51.716 1.00 45.61  ? 198 HIS C C   1 
ATOM   4664 O O   . HIS C 1 115 ? 4.169   -33.567 -51.074 1.00 46.33  ? 198 HIS C O   1 
ATOM   4665 C CB  . HIS C 1 115 ? 0.963   -32.804 -51.602 1.00 43.41  ? 198 HIS C CB  1 
ATOM   4666 C CG  . HIS C 1 115 ? 0.744   -34.240 -51.156 1.00 45.87  ? 198 HIS C CG  1 
ATOM   4667 N ND1 . HIS C 1 115 ? 1.233   -34.736 -50.003 1.00 48.28  ? 198 HIS C ND1 1 
ATOM   4668 C CD2 . HIS C 1 115 ? 0.014   -35.285 -51.748 1.00 44.96  ? 198 HIS C CD2 1 
ATOM   4669 C CE1 . HIS C 1 115 ? 0.840   -36.027 -49.857 1.00 47.61  ? 198 HIS C CE1 1 
ATOM   4670 N NE2 . HIS C 1 115 ? 0.098   -36.354 -50.930 1.00 46.03  ? 198 HIS C NE2 1 
ATOM   4671 N N   . GLN C 1 116 ? 3.725   -32.442 -52.972 1.00 45.58  ? 199 GLN C N   1 
ATOM   4672 C CA  . GLN C 1 116 ? 4.832   -33.036 -53.672 1.00 46.14  ? 199 GLN C CA  1 
ATOM   4673 C C   . GLN C 1 116 ? 6.126   -32.726 -52.920 1.00 48.40  ? 199 GLN C C   1 
ATOM   4674 O O   . GLN C 1 116 ? 6.920   -33.616 -52.690 1.00 52.46  ? 199 GLN C O   1 
ATOM   4675 C CB  . GLN C 1 116 ? 4.878   -32.559 -55.109 1.00 45.01  ? 199 GLN C CB  1 
ATOM   4676 C CG  . GLN C 1 116 ? 5.945   -33.220 -55.965 1.00 43.75  ? 199 GLN C CG  1 
ATOM   4677 C CD  . GLN C 1 116 ? 5.944   -32.679 -57.392 1.00 47.41  ? 199 GLN C CD  1 
ATOM   4678 O OE1 . GLN C 1 116 ? 7.002   -32.451 -57.985 1.00 48.28  ? 199 GLN C OE1 1 
ATOM   4679 N NE2 . GLN C 1 116 ? 4.756   -32.415 -57.932 1.00 46.58  ? 199 GLN C NE2 1 
ATOM   4680 N N   . MET C 1 117 ? 6.325   -31.484 -52.512 1.00 50.42  ? 200 MET C N   1 
ATOM   4681 C CA  . MET C 1 117 ? 7.512   -31.110 -51.722 1.00 53.00  ? 200 MET C CA  1 
ATOM   4682 C C   . MET C 1 117 ? 7.567   -31.909 -50.417 1.00 50.26  ? 200 MET C C   1 
ATOM   4683 O O   . MET C 1 117 ? 8.613   -32.405 -50.056 1.00 53.38  ? 200 MET C O   1 
ATOM   4684 C CB  . MET C 1 117 ? 7.509   -29.601 -51.395 1.00 58.95  ? 200 MET C CB  1 
ATOM   4685 C CG  . MET C 1 117 ? 8.804   -28.804 -51.577 1.00 59.03  ? 200 MET C CG  1 
ATOM   4686 S SD  . MET C 1 117 ? 10.430  -29.621 -51.466 1.00 71.45  ? 200 MET C SD  1 
ATOM   4687 C CE  . MET C 1 117 ? 11.471  -28.181 -51.131 1.00 69.18  ? 200 MET C CE  1 
ATOM   4688 N N   . GLU C 1 118 ? 6.452   -32.079 -49.723 1.00 49.88  ? 201 GLU C N   1 
ATOM   4689 C CA  . GLU C 1 118 ? 6.496   -32.830 -48.457 1.00 52.66  ? 201 GLU C CA  1 
ATOM   4690 C C   . GLU C 1 118 ? 6.929   -34.258 -48.601 1.00 53.23  ? 201 GLU C C   1 
ATOM   4691 O O   . GLU C 1 118 ? 7.469   -34.837 -47.649 1.00 59.30  ? 201 GLU C O   1 
ATOM   4692 C CB  . GLU C 1 118 ? 5.173   -32.842 -47.742 1.00 52.72  ? 201 GLU C CB  1 
ATOM   4693 C CG  . GLU C 1 118 ? 4.786   -31.498 -47.193 1.00 61.28  ? 201 GLU C CG  1 
ATOM   4694 C CD  . GLU C 1 118 ? 3.336   -31.500 -46.742 1.00 73.18  ? 201 GLU C CD  1 
ATOM   4695 O OE1 . GLU C 1 118 ? 2.889   -30.460 -46.194 1.00 72.13  ? 201 GLU C OE1 1 
ATOM   4696 O OE2 . GLU C 1 118 ? 2.659   -32.561 -46.944 1.00 74.69  ? 201 GLU C OE2 1 
ATOM   4697 N N   . LEU C 1 119 ? 6.677   -34.853 -49.761 1.00 47.89  ? 202 LEU C N   1 
ATOM   4698 C CA  . LEU C 1 119 ? 7.014   -36.240 -49.906 1.00 46.55  ? 202 LEU C CA  1 
ATOM   4699 C C   . LEU C 1 119 ? 8.504   -36.361 -50.125 1.00 43.61  ? 202 LEU C C   1 
ATOM   4700 O O   . LEU C 1 119 ? 9.088   -37.379 -49.777 1.00 41.24  ? 202 LEU C O   1 
ATOM   4701 C CB  . LEU C 1 119 ? 6.217   -36.905 -51.038 1.00 49.36  ? 202 LEU C CB  1 
ATOM   4702 C CG  . LEU C 1 119 ? 4.698   -37.090 -50.862 1.00 49.20  ? 202 LEU C CG  1 
ATOM   4703 C CD1 . LEU C 1 119 ? 4.115   -37.535 -52.191 1.00 40.49  ? 202 LEU C CD1 1 
ATOM   4704 C CD2 . LEU C 1 119 ? 4.342   -38.026 -49.702 1.00 44.07  ? 202 LEU C CD2 1 
ATOM   4705 N N   . LEU C 1 120 ? 9.122   -35.333 -50.691 1.00 44.09  ? 203 LEU C N   1 
ATOM   4706 C CA  . LEU C 1 120 ? 10.558  -35.372 -50.872 1.00 48.48  ? 203 LEU C CA  1 
ATOM   4707 C C   . LEU C 1 120 ? 11.223  -35.454 -49.518 1.00 53.07  ? 203 LEU C C   1 
ATOM   4708 O O   . LEU C 1 120 ? 12.236  -36.158 -49.375 1.00 54.71  ? 203 LEU C O   1 
ATOM   4709 C CB  . LEU C 1 120 ? 11.094  -34.183 -51.649 1.00 51.56  ? 203 LEU C CB  1 
ATOM   4710 C CG  . LEU C 1 120 ? 11.138  -34.370 -53.173 1.00 56.17  ? 203 LEU C CG  1 
ATOM   4711 C CD1 . LEU C 1 120 ? 11.440  -35.821 -53.484 1.00 60.09  ? 203 LEU C CD1 1 
ATOM   4712 C CD2 . LEU C 1 120 ? 9.835   -34.059 -53.860 1.00 55.61  ? 203 LEU C CD2 1 
ATOM   4713 N N   . ASP C 1 121 ? 10.639  -34.784 -48.519 1.00 53.54  ? 204 ASP C N   1 
ATOM   4714 C CA  . ASP C 1 121 ? 11.187  -34.808 -47.148 1.00 55.74  ? 204 ASP C CA  1 
ATOM   4715 C C   . ASP C 1 121 ? 11.156  -36.212 -46.603 1.00 51.90  ? 204 ASP C C   1 
ATOM   4716 O O   . ASP C 1 121 ? 12.125  -36.743 -46.078 1.00 49.33  ? 204 ASP C O   1 
ATOM   4717 C CB  . ASP C 1 121 ? 10.419  -33.860 -46.218 1.00 64.14  ? 204 ASP C CB  1 
ATOM   4718 C CG  . ASP C 1 121 ? 10.627  -32.380 -46.582 1.00 70.95  ? 204 ASP C CG  1 
ATOM   4719 O OD1 . ASP C 1 121 ? 11.519  -32.051 -47.445 1.00 70.25  ? 204 ASP C OD1 1 
ATOM   4720 O OD2 . ASP C 1 121 ? 9.870   -31.558 -46.002 1.00 70.70  ? 204 ASP C OD2 1 
ATOM   4721 N N   . TYR C 1 122 ? 10.036  -36.850 -46.782 1.00 51.84  ? 205 TYR C N   1 
ATOM   4722 C CA  . TYR C 1 122 ? 9.985   -38.214 -46.414 1.00 55.45  ? 205 TYR C CA  1 
ATOM   4723 C C   . TYR C 1 122 ? 10.970  -39.131 -47.219 1.00 52.33  ? 205 TYR C C   1 
ATOM   4724 O O   . TYR C 1 122 ? 11.611  -40.009 -46.651 1.00 58.55  ? 205 TYR C O   1 
ATOM   4725 C CB  . TYR C 1 122 ? 8.538   -38.684 -46.505 1.00 61.05  ? 205 TYR C CB  1 
ATOM   4726 C CG  . TYR C 1 122 ? 8.417   -40.015 -45.861 1.00 76.88  ? 205 TYR C CG  1 
ATOM   4727 C CD1 . TYR C 1 122 ? 8.468   -41.199 -46.628 1.00 69.93  ? 205 TYR C CD1 1 
ATOM   4728 C CD2 . TYR C 1 122 ? 8.354   -40.113 -44.460 1.00 81.21  ? 205 TYR C CD2 1 
ATOM   4729 C CE1 . TYR C 1 122 ? 8.399   -42.438 -46.016 1.00 76.68  ? 205 TYR C CE1 1 
ATOM   4730 C CE2 . TYR C 1 122 ? 8.283   -41.353 -43.841 1.00 84.32  ? 205 TYR C CE2 1 
ATOM   4731 C CZ  . TYR C 1 122 ? 8.302   -42.500 -44.616 1.00 81.29  ? 205 TYR C CZ  1 
ATOM   4732 O OH  . TYR C 1 122 ? 8.225   -43.707 -43.974 1.00 89.31  ? 205 TYR C OH  1 
ATOM   4733 N N   . VAL C 1 123 ? 11.072  -38.944 -48.529 1.00 44.80  ? 206 VAL C N   1 
ATOM   4734 C CA  . VAL C 1 123 ? 12.034  -39.693 -49.328 1.00 42.32  ? 206 VAL C CA  1 
ATOM   4735 C C   . VAL C 1 123 ? 13.472  -39.464 -48.880 1.00 43.63  ? 206 VAL C C   1 
ATOM   4736 O O   . VAL C 1 123 ? 14.235  -40.398 -48.844 1.00 45.08  ? 206 VAL C O   1 
ATOM   4737 C CB  . VAL C 1 123 ? 11.895  -39.299 -50.802 1.00 39.92  ? 206 VAL C CB  1 
ATOM   4738 C CG1 . VAL C 1 123 ? 13.085  -39.742 -51.683 1.00 33.87  ? 206 VAL C CG1 1 
ATOM   4739 C CG2 . VAL C 1 123 ? 10.566  -39.827 -51.277 1.00 40.45  ? 206 VAL C CG2 1 
ATOM   4740 N N   . ALA C 1 124 ? 13.848  -38.229 -48.571 1.00 44.59  ? 207 ALA C N   1 
ATOM   4741 C CA  . ALA C 1 124 ? 15.218  -37.959 -48.123 1.00 49.93  ? 207 ALA C CA  1 
ATOM   4742 C C   . ALA C 1 124 ? 15.551  -38.766 -46.874 1.00 52.85  ? 207 ALA C C   1 
ATOM   4743 O O   . ALA C 1 124 ? 16.548  -39.495 -46.845 1.00 54.73  ? 207 ALA C O   1 
ATOM   4744 C CB  . ALA C 1 124 ? 15.465  -36.465 -47.903 1.00 46.19  ? 207 ALA C CB  1 
ATOM   4745 N N   . ALA C 1 125 ? 14.703  -38.662 -45.858 1.00 55.23  ? 208 ALA C N   1 
ATOM   4746 C CA  . ALA C 1 125 ? 14.865  -39.457 -44.635 1.00 56.05  ? 208 ALA C CA  1 
ATOM   4747 C C   . ALA C 1 125 ? 14.905  -40.952 -44.976 1.00 59.49  ? 208 ALA C C   1 
ATOM   4748 O O   . ALA C 1 125 ? 15.734  -41.728 -44.465 1.00 58.00  ? 208 ALA C O   1 
ATOM   4749 C CB  . ALA C 1 125 ? 13.723  -39.181 -43.695 1.00 52.61  ? 208 ALA C CB  1 
ATOM   4750 N N   . LYS C 1 126 ? 14.015  -41.379 -45.857 1.00 55.10  ? 209 LYS C N   1 
ATOM   4751 C CA  . LYS C 1 126 ? 13.929  -42.790 -46.044 1.00 56.96  ? 209 LYS C CA  1 
ATOM   4752 C C   . LYS C 1 126 ? 15.322  -43.190 -46.536 1.00 64.23  ? 209 LYS C C   1 
ATOM   4753 O O   . LYS C 1 126 ? 15.831  -44.234 -46.144 1.00 71.15  ? 209 LYS C O   1 
ATOM   4754 C CB  . LYS C 1 126 ? 12.754  -43.141 -46.953 1.00 57.39  ? 209 LYS C CB  1 
ATOM   4755 C CG  . LYS C 1 126 ? 12.854  -44.409 -47.782 1.00 61.89  ? 209 LYS C CG  1 
ATOM   4756 C CD  . LYS C 1 126 ? 12.743  -45.673 -46.964 1.00 61.25  ? 209 LYS C CD  1 
ATOM   4757 C CE  . LYS C 1 126 ? 11.381  -45.831 -46.316 1.00 62.39  ? 209 LYS C CE  1 
ATOM   4758 N NZ  . LYS C 1 126 ? 11.496  -46.930 -45.297 1.00 64.42  ? 209 LYS C NZ  1 
ATOM   4759 N N   . PHE C 1 127 ? 15.984  -42.315 -47.302 1.00 62.24  ? 210 PHE C N   1 
ATOM   4760 C CA  . PHE C 1 127 ? 17.333  -42.640 -47.789 1.00 59.60  ? 210 PHE C CA  1 
ATOM   4761 C C   . PHE C 1 127 ? 18.365  -42.658 -46.689 1.00 60.47  ? 210 PHE C C   1 
ATOM   4762 O O   . PHE C 1 127 ? 19.239  -43.527 -46.667 1.00 63.40  ? 210 PHE C O   1 
ATOM   4763 C CB  . PHE C 1 127 ? 17.798  -41.707 -48.890 1.00 52.82  ? 210 PHE C CB  1 
ATOM   4764 C CG  . PHE C 1 127 ? 17.052  -41.854 -50.161 1.00 43.68  ? 210 PHE C CG  1 
ATOM   4765 C CD1 . PHE C 1 127 ? 16.218  -42.935 -50.367 1.00 43.27  ? 210 PHE C CD1 1 
ATOM   4766 C CD2 . PHE C 1 127 ? 17.187  -40.899 -51.155 1.00 40.03  ? 210 PHE C CD2 1 
ATOM   4767 C CE1 . PHE C 1 127 ? 15.538  -43.067 -51.570 1.00 42.83  ? 210 PHE C CE1 1 
ATOM   4768 C CE2 . PHE C 1 127 ? 16.520  -41.031 -52.374 1.00 39.82  ? 210 PHE C CE2 1 
ATOM   4769 C CZ  . PHE C 1 127 ? 15.683  -42.107 -52.575 1.00 40.44  ? 210 PHE C CZ  1 
ATOM   4770 N N   . HIS C 1 128 ? 18.260  -41.701 -45.779 1.00 64.03  ? 211 HIS C N   1 
ATOM   4771 C CA  . HIS C 1 128 ? 19.147  -41.650 -44.622 1.00 66.05  ? 211 HIS C CA  1 
ATOM   4772 C C   . HIS C 1 128 ? 19.150  -42.971 -43.879 1.00 69.24  ? 211 HIS C C   1 
ATOM   4773 O O   . HIS C 1 128 ? 20.205  -43.462 -43.499 1.00 66.24  ? 211 HIS C O   1 
ATOM   4774 C CB  . HIS C 1 128 ? 18.734  -40.530 -43.687 1.00 66.47  ? 211 HIS C CB  1 
ATOM   4775 C CG  . HIS C 1 128 ? 19.889  -39.736 -43.151 1.00 75.25  ? 211 HIS C CG  1 
ATOM   4776 N ND1 . HIS C 1 128 ? 19.905  -38.380 -43.157 1.00 80.71  ? 211 HIS C ND1 1 
ATOM   4777 C CD2 . HIS C 1 128 ? 21.102  -40.141 -42.600 1.00 73.93  ? 211 HIS C CD2 1 
ATOM   4778 C CE1 . HIS C 1 128 ? 21.064  -37.941 -42.638 1.00 77.22  ? 211 HIS C CE1 1 
ATOM   4779 N NE2 . HIS C 1 128 ? 21.803  -39.021 -42.312 1.00 78.30  ? 211 HIS C NE2 1 
ATOM   4780 N N   . GLU C 1 129 ? 17.968  -43.568 -43.708 1.00 76.48  ? 212 GLU C N   1 
ATOM   4781 C CA  . GLU C 1 129 ? 17.774  -44.698 -42.795 1.00 78.02  ? 212 GLU C CA  1 
ATOM   4782 C C   . GLU C 1 129 ? 18.714  -45.809 -43.135 1.00 79.08  ? 212 GLU C C   1 
ATOM   4783 O O   . GLU C 1 129 ? 19.269  -46.438 -42.245 1.00 79.71  ? 212 GLU C O   1 
ATOM   4784 C CB  . GLU C 1 129 ? 16.321  -45.197 -42.796 1.00 81.26  ? 212 GLU C CB  1 
ATOM   4785 C CG  . GLU C 1 129 ? 15.384  -44.242 -42.042 1.00 91.89  ? 212 GLU C CG  1 
ATOM   4786 C CD  . GLU C 1 129 ? 14.288  -44.906 -41.191 1.00 94.89  ? 212 GLU C CD  1 
ATOM   4787 O OE1 . GLU C 1 129 ? 14.335  -44.804 -39.923 1.00 79.39  ? 212 GLU C OE1 1 
ATOM   4788 O OE2 . GLU C 1 129 ? 13.359  -45.494 -41.805 1.00 92.07  ? 212 GLU C OE2 1 
ATOM   4789 N N   . GLU C 1 130 ? 18.905  -46.043 -44.428 1.00 77.45  ? 213 GLU C N   1 
ATOM   4790 C CA  . GLU C 1 130 ? 19.930  -46.978 -44.852 1.00 78.89  ? 213 GLU C CA  1 
ATOM   4791 C C   . GLU C 1 130 ? 20.471  -46.609 -46.202 1.00 74.06  ? 213 GLU C C   1 
ATOM   4792 O O   . GLU C 1 130 ? 19.727  -46.305 -47.128 1.00 67.84  ? 213 GLU C O   1 
ATOM   4793 C CB  . GLU C 1 130 ? 19.449  -48.436 -44.833 1.00 85.82  ? 213 GLU C CB  1 
ATOM   4794 C CG  . GLU C 1 130 ? 20.568  -49.462 -45.002 1.00 88.05  ? 213 GLU C CG  1 
ATOM   4795 C CD  . GLU C 1 130 ? 20.179  -50.854 -44.515 1.00 95.75  ? 213 GLU C CD  1 
ATOM   4796 O OE1 . GLU C 1 130 ? 18.965  -51.166 -44.438 1.00 94.30  ? 213 GLU C OE1 1 
ATOM   4797 O OE2 . GLU C 1 130 ? 21.097  -51.644 -44.199 1.00 100.72 ? 213 GLU C OE2 1 
ATOM   4798 N N   . ALA C 1 131 ? 21.793  -46.666 -46.273 1.00 75.22  ? 214 ALA C N   1 
ATOM   4799 C CA  . ALA C 1 131 ? 22.548  -46.345 -47.453 1.00 75.26  ? 214 ALA C CA  1 
ATOM   4800 C C   . ALA C 1 131 ? 22.489  -47.486 -48.456 1.00 77.98  ? 214 ALA C C   1 
ATOM   4801 O O   . ALA C 1 131 ? 22.664  -48.680 -48.109 1.00 74.50  ? 214 ALA C O   1 
ATOM   4802 C CB  . ALA C 1 131 ? 24.002  -46.059 -47.079 1.00 77.71  ? 214 ALA C CB  1 
ATOM   4803 N N   . GLY C 1 132 ? 22.254  -47.102 -49.708 1.00 73.69  ? 215 GLY C N   1 
ATOM   4804 C CA  . GLY C 1 132 ? 22.414  -48.018 -50.818 1.00 68.61  ? 215 GLY C CA  1 
ATOM   4805 C C   . GLY C 1 132 ? 21.375  -49.111 -50.854 1.00 67.73  ? 215 GLY C C   1 
ATOM   4806 O O   . GLY C 1 132 ? 21.607  -50.128 -51.484 1.00 74.01  ? 215 GLY C O   1 
ATOM   4807 N N   . ILE C 1 133 ? 20.240  -48.947 -50.174 1.00 65.09  ? 216 ILE C N   1 
ATOM   4808 C CA  . ILE C 1 133 ? 19.127  -49.857 -50.487 1.00 63.76  ? 216 ILE C CA  1 
ATOM   4809 C C   . ILE C 1 133 ? 18.264  -49.299 -51.633 1.00 56.98  ? 216 ILE C C   1 
ATOM   4810 O O   . ILE C 1 133 ? 17.828  -50.063 -52.474 1.00 58.80  ? 216 ILE C O   1 
ATOM   4811 C CB  . ILE C 1 133 ? 18.342  -50.455 -49.263 1.00 66.34  ? 216 ILE C CB  1 
ATOM   4812 C CG1 . ILE C 1 133 ? 17.312  -49.485 -48.733 1.00 66.39  ? 216 ILE C CG1 1 
ATOM   4813 C CG2 . ILE C 1 133 ? 19.295  -50.974 -48.153 1.00 59.77  ? 216 ILE C CG2 1 
ATOM   4814 C CD1 . ILE C 1 133 ? 17.965  -48.356 -47.968 1.00 71.23  ? 216 ILE C CD1 1 
ATOM   4815 N N   . PHE C 1 134 ? 18.093  -47.978 -51.705 1.00 52.97  ? 217 PHE C N   1 
ATOM   4816 C CA  . PHE C 1 134 ? 17.373  -47.344 -52.809 1.00 48.91  ? 217 PHE C CA  1 
ATOM   4817 C C   . PHE C 1 134 ? 18.276  -46.875 -53.909 1.00 47.61  ? 217 PHE C C   1 
ATOM   4818 O O   . PHE C 1 134 ? 19.322  -46.324 -53.635 1.00 49.50  ? 217 PHE C O   1 
ATOM   4819 C CB  . PHE C 1 134 ? 16.573  -46.174 -52.310 1.00 48.96  ? 217 PHE C CB  1 
ATOM   4820 C CG  . PHE C 1 134 ? 15.378  -46.592 -51.578 1.00 50.21  ? 217 PHE C CG  1 
ATOM   4821 C CD1 . PHE C 1 134 ? 15.442  -46.800 -50.215 1.00 46.67  ? 217 PHE C CD1 1 
ATOM   4822 C CD2 . PHE C 1 134 ? 14.201  -46.893 -52.276 1.00 47.03  ? 217 PHE C CD2 1 
ATOM   4823 C CE1 . PHE C 1 134 ? 14.337  -47.258 -49.525 1.00 47.70  ? 217 PHE C CE1 1 
ATOM   4824 C CE2 . PHE C 1 134 ? 13.096  -47.362 -51.591 1.00 48.40  ? 217 PHE C CE2 1 
ATOM   4825 C CZ  . PHE C 1 134 ? 13.166  -47.546 -50.205 1.00 47.67  ? 217 PHE C CZ  1 
ATOM   4826 N N   . LYS C 1 135 ? 17.863  -47.073 -55.153 1.00 45.32  ? 218 LYS C N   1 
ATOM   4827 C CA  . LYS C 1 135 ? 18.738  -46.766 -56.270 1.00 43.91  ? 218 LYS C CA  1 
ATOM   4828 C C   . LYS C 1 135 ? 18.149  -45.730 -57.188 1.00 39.33  ? 218 LYS C C   1 
ATOM   4829 O O   . LYS C 1 135 ? 18.906  -45.040 -57.857 1.00 39.63  ? 218 LYS C O   1 
ATOM   4830 C CB  . LYS C 1 135 ? 19.165  -48.030 -57.043 1.00 45.80  ? 218 LYS C CB  1 
ATOM   4831 C CG  . LYS C 1 135 ? 19.910  -49.064 -56.203 1.00 49.62  ? 218 LYS C CG  1 
ATOM   4832 C CD  . LYS C 1 135 ? 21.129  -48.449 -55.545 1.00 52.04  ? 218 LYS C CD  1 
ATOM   4833 C CE  . LYS C 1 135 ? 22.009  -49.454 -54.781 1.00 55.23  ? 218 LYS C CE  1 
ATOM   4834 N NZ  . LYS C 1 135 ? 23.330  -48.866 -54.334 1.00 54.93  ? 218 LYS C NZ  1 
ATOM   4835 N N   . LEU C 1 136 ? 16.819  -45.590 -57.177 1.00 38.87  ? 219 LEU C N   1 
ATOM   4836 C CA  . LEU C 1 136 ? 16.084  -44.745 -58.135 1.00 38.83  ? 219 LEU C CA  1 
ATOM   4837 C C   . LEU C 1 136 ? 14.969  -44.040 -57.465 1.00 39.42  ? 219 LEU C C   1 
ATOM   4838 O O   . LEU C 1 136 ? 14.244  -44.625 -56.608 1.00 41.16  ? 219 LEU C O   1 
ATOM   4839 C CB  . LEU C 1 136 ? 15.378  -45.608 -59.178 1.00 44.97  ? 219 LEU C CB  1 
ATOM   4840 C CG  . LEU C 1 136 ? 15.314  -45.206 -60.649 1.00 47.84  ? 219 LEU C CG  1 
ATOM   4841 C CD1 . LEU C 1 136 ? 14.367  -46.154 -61.382 1.00 48.33  ? 219 LEU C CD1 1 
ATOM   4842 C CD2 . LEU C 1 136 ? 14.957  -43.763 -60.919 1.00 44.70  ? 219 LEU C CD2 1 
ATOM   4843 N N   . LEU C 1 137 ? 14.790  -42.797 -57.895 1.00 40.06  ? 220 LEU C N   1 
ATOM   4844 C CA  . LEU C 1 137 ? 13.689  -41.945 -57.458 1.00 39.60  ? 220 LEU C CA  1 
ATOM   4845 C C   . LEU C 1 137 ? 12.979  -41.571 -58.747 1.00 40.62  ? 220 LEU C C   1 
ATOM   4846 O O   . LEU C 1 137 ? 13.596  -40.961 -59.623 1.00 38.53  ? 220 LEU C O   1 
ATOM   4847 C CB  . LEU C 1 137 ? 14.207  -40.678 -56.814 1.00 36.80  ? 220 LEU C CB  1 
ATOM   4848 C CG  . LEU C 1 137 ? 13.293  -40.054 -55.765 1.00 38.35  ? 220 LEU C CG  1 
ATOM   4849 C CD1 . LEU C 1 137 ? 13.517  -38.590 -55.518 1.00 34.58  ? 220 LEU C CD1 1 
ATOM   4850 C CD2 . LEU C 1 137 ? 11.833  -40.225 -56.083 1.00 44.78  ? 220 LEU C CD2 1 
ATOM   4851 N N   . ILE C 1 138 ? 11.706  -41.929 -58.887 1.00 38.55  ? 221 ILE C N   1 
ATOM   4852 C CA  . ILE C 1 138 ? 10.968  -41.505 -60.084 1.00 40.64  ? 221 ILE C CA  1 
ATOM   4853 C C   . ILE C 1 138 ? 9.924   -40.503 -59.696 1.00 40.46  ? 221 ILE C C   1 
ATOM   4854 O O   . ILE C 1 138 ? 9.298   -40.640 -58.627 1.00 42.02  ? 221 ILE C O   1 
ATOM   4855 C CB  . ILE C 1 138 ? 10.247  -42.654 -60.793 1.00 39.51  ? 221 ILE C CB  1 
ATOM   4856 C CG1 . ILE C 1 138 ? 11.263  -43.691 -61.264 1.00 36.98  ? 221 ILE C CG1 1 
ATOM   4857 C CG2 . ILE C 1 138 ? 9.490   -42.082 -61.978 1.00 40.42  ? 221 ILE C CG2 1 
ATOM   4858 C CD1 . ILE C 1 138 ? 10.699  -45.092 -61.469 1.00 35.68  ? 221 ILE C CD1 1 
ATOM   4859 N N   . ILE C 1 139 ? 9.771   -39.463 -60.515 1.00 40.93  ? 222 ILE C N   1 
ATOM   4860 C CA  . ILE C 1 139 ? 8.707   -38.485 -60.285 1.00 39.83  ? 222 ILE C CA  1 
ATOM   4861 C C   . ILE C 1 139 ? 8.087   -38.268 -61.631 1.00 42.96  ? 222 ILE C C   1 
ATOM   4862 O O   . ILE C 1 139 ? 8.675   -37.589 -62.454 1.00 44.68  ? 222 ILE C O   1 
ATOM   4863 C CB  . ILE C 1 139 ? 9.212   -37.130 -59.781 1.00 39.97  ? 222 ILE C CB  1 
ATOM   4864 C CG1 . ILE C 1 139 ? 10.039  -37.269 -58.516 1.00 40.12  ? 222 ILE C CG1 1 
ATOM   4865 C CG2 . ILE C 1 139 ? 8.040   -36.194 -59.509 1.00 40.96  ? 222 ILE C CG2 1 
ATOM   4866 C CD1 . ILE C 1 139 ? 10.684  -35.962 -58.132 1.00 44.29  ? 222 ILE C CD1 1 
ATOM   4867 N N   . ASP C 1 140 ? 6.902   -38.873 -61.825 1.00 47.98  ? 223 ASP C N   1 
ATOM   4868 C CA  . ASP C 1 140 ? 6.032   -38.748 -62.986 1.00 45.53  ? 223 ASP C CA  1 
ATOM   4869 C C   . ASP C 1 140 ? 4.819   -37.930 -62.579 1.00 51.07  ? 223 ASP C C   1 
ATOM   4870 O O   . ASP C 1 140 ? 3.819   -38.512 -62.090 1.00 57.06  ? 223 ASP C O   1 
ATOM   4871 C CB  . ASP C 1 140 ? 5.529   -40.148 -63.407 1.00 44.45  ? 223 ASP C CB  1 
ATOM   4872 C CG  . ASP C 1 140 ? 4.932   -40.167 -64.856 1.00 48.33  ? 223 ASP C CG  1 
ATOM   4873 O OD1 . ASP C 1 140 ? 4.445   -41.239 -65.326 1.00 48.34  ? 223 ASP C OD1 1 
ATOM   4874 O OD2 . ASP C 1 140 ? 4.942   -39.101 -65.528 1.00 49.05  ? 223 ASP C OD2 1 
ATOM   4875 N N   . SER C 1 141 ? 4.829   -36.612 -62.806 1.00 48.86  ? 224 SER C N   1 
ATOM   4876 C CA  . SER C 1 141 ? 5.829   -35.897 -63.560 1.00 51.29  ? 224 SER C CA  1 
ATOM   4877 C C   . SER C 1 141 ? 6.255   -34.740 -62.688 1.00 52.34  ? 224 SER C C   1 
ATOM   4878 O O   . SER C 1 141 ? 5.580   -34.436 -61.703 1.00 55.81  ? 224 SER C O   1 
ATOM   4879 C CB  . SER C 1 141 ? 5.216   -35.342 -64.834 1.00 51.34  ? 224 SER C CB  1 
ATOM   4880 O OG  . SER C 1 141 ? 4.326   -34.310 -64.479 1.00 53.23  ? 224 SER C OG  1 
ATOM   4881 N N   . ILE C 1 142 ? 7.325   -34.063 -63.088 1.00 51.22  ? 225 ILE C N   1 
ATOM   4882 C CA  . ILE C 1 142 ? 8.073   -33.164 -62.192 1.00 51.21  ? 225 ILE C CA  1 
ATOM   4883 C C   . ILE C 1 142 ? 7.368   -31.893 -61.717 1.00 52.49  ? 225 ILE C C   1 
ATOM   4884 O O   . ILE C 1 142 ? 7.589   -31.503 -60.538 1.00 50.45  ? 225 ILE C O   1 
ATOM   4885 C CB  . ILE C 1 142 ? 9.461   -32.756 -62.786 1.00 47.23  ? 225 ILE C CB  1 
ATOM   4886 C CG1 . ILE C 1 142 ? 10.340  -32.156 -61.704 1.00 42.23  ? 225 ILE C CG1 1 
ATOM   4887 C CG2 . ILE C 1 142 ? 9.273   -31.795 -63.932 1.00 47.16  ? 225 ILE C CG2 1 
ATOM   4888 C CD1 . ILE C 1 142 ? 10.400  -33.028 -60.478 1.00 39.53  ? 225 ILE C CD1 1 
ATOM   4889 N N   . MET C 1 143 ? 6.560   -31.294 -62.620 1.00 49.03  ? 226 MET C N   1 
ATOM   4890 C CA  . MET C 1 143 ? 6.003   -29.914 -62.537 1.00 50.40  ? 226 MET C CA  1 
ATOM   4891 C C   . MET C 1 143 ? 4.519   -29.792 -62.855 1.00 51.95  ? 226 MET C C   1 
ATOM   4892 O O   . MET C 1 143 ? 3.949   -28.713 -62.710 1.00 52.21  ? 226 MET C O   1 
ATOM   4893 C CB  . MET C 1 143 ? 6.534   -29.076 -63.678 1.00 56.06  ? 226 MET C CB  1 
ATOM   4894 C CG  . MET C 1 143 ? 7.885   -28.478 -63.539 1.00 61.37  ? 226 MET C CG  1 
ATOM   4895 S SD  . MET C 1 143 ? 7.751   -26.932 -64.391 1.00 66.40  ? 226 MET C SD  1 
ATOM   4896 C CE  . MET C 1 143 ? 6.183   -27.103 -65.219 1.00 74.94  ? 226 MET C CE  1 
ATOM   4897 N N   . ALA C 1 144 ? 3.875   -30.820 -63.388 1.00 49.68  ? 227 ALA C N   1 
ATOM   4898 C CA  . ALA C 1 144 ? 2.444   -30.652 -63.607 1.00 47.29  ? 227 ALA C CA  1 
ATOM   4899 C C   . ALA C 1 144 ? 1.784   -29.926 -62.414 1.00 48.52  ? 227 ALA C C   1 
ATOM   4900 O O   . ALA C 1 144 ? 1.072   -28.950 -62.643 1.00 52.14  ? 227 ALA C O   1 
ATOM   4901 C CB  . ALA C 1 144 ? 1.776   -31.964 -63.884 1.00 43.92  ? 227 ALA C CB  1 
ATOM   4902 N N   . LEU C 1 145 ? 2.048   -30.354 -61.163 1.00 44.84  ? 228 LEU C N   1 
ATOM   4903 C CA  . LEU C 1 145 ? 1.372   -29.771 -60.008 1.00 44.98  ? 228 LEU C CA  1 
ATOM   4904 C C   . LEU C 1 145 ? 1.683   -28.303 -59.757 1.00 50.26  ? 228 LEU C C   1 
ATOM   4905 O O   . LEU C 1 145 ? 0.877   -27.577 -59.187 1.00 55.06  ? 228 LEU C O   1 
ATOM   4906 C CB  . LEU C 1 145 ? 1.591   -30.604 -58.762 1.00 44.70  ? 228 LEU C CB  1 
ATOM   4907 C CG  . LEU C 1 145 ? 0.753   -31.885 -58.742 1.00 44.74  ? 228 LEU C CG  1 
ATOM   4908 C CD1 . LEU C 1 145 ? 1.150   -32.761 -57.577 1.00 42.34  ? 228 LEU C CD1 1 
ATOM   4909 C CD2 . LEU C 1 145 ? -0.743  -31.578 -58.718 1.00 43.80  ? 228 LEU C CD2 1 
ATOM   4910 N N   . PHE C 1 146 ? 2.837   -27.845 -60.193 1.00 53.06  ? 229 PHE C N   1 
ATOM   4911 C CA  . PHE C 1 146 ? 3.166   -26.422 -60.110 1.00 57.85  ? 229 PHE C CA  1 
ATOM   4912 C C   . PHE C 1 146 ? 2.476   -25.536 -61.159 1.00 65.40  ? 229 PHE C C   1 
ATOM   4913 O O   . PHE C 1 146 ? 2.189   -24.363 -60.866 1.00 67.37  ? 229 PHE C O   1 
ATOM   4914 C CB  . PHE C 1 146 ? 4.685   -26.221 -60.140 1.00 55.63  ? 229 PHE C CB  1 
ATOM   4915 C CG  . PHE C 1 146 ? 5.389   -26.820 -58.950 1.00 56.40  ? 229 PHE C CG  1 
ATOM   4916 C CD1 . PHE C 1 146 ? 5.581   -28.215 -58.852 1.00 57.48  ? 229 PHE C CD1 1 
ATOM   4917 C CD2 . PHE C 1 146 ? 5.845   -26.011 -57.914 1.00 54.98  ? 229 PHE C CD2 1 
ATOM   4918 C CE1 . PHE C 1 146 ? 6.219   -28.768 -57.749 1.00 53.69  ? 229 PHE C CE1 1 
ATOM   4919 C CE2 . PHE C 1 146 ? 6.474   -26.566 -56.801 1.00 54.95  ? 229 PHE C CE2 1 
ATOM   4920 C CZ  . PHE C 1 146 ? 6.662   -27.939 -56.720 1.00 54.65  ? 229 PHE C CZ  1 
ATOM   4921 N N   . ARG C 1 147 ? 2.220   -26.071 -62.365 1.00 68.67  ? 230 ARG C N   1 
ATOM   4922 C CA  . ARG C 1 147 ? 1.341   -25.379 -63.332 1.00 77.37  ? 230 ARG C CA  1 
ATOM   4923 C C   . ARG C 1 147 ? -0.073  -25.265 -62.774 1.00 82.87  ? 230 ARG C C   1 
ATOM   4924 O O   . ARG C 1 147 ? -0.771  -24.303 -63.067 1.00 91.94  ? 230 ARG C O   1 
ATOM   4925 C CB  . ARG C 1 147 ? 1.279   -26.079 -64.698 1.00 76.21  ? 230 ARG C CB  1 
ATOM   4926 C CG  . ARG C 1 147 ? 2.517   -25.868 -65.534 1.00 81.59  ? 230 ARG C CG  1 
ATOM   4927 C CD  . ARG C 1 147 ? 2.209   -25.742 -67.017 1.00 88.56  ? 230 ARG C CD  1 
ATOM   4928 N NE  . ARG C 1 147 ? 1.747   -27.004 -67.589 1.00 88.88  ? 230 ARG C NE  1 
ATOM   4929 C CZ  . ARG C 1 147 ? 1.601   -27.236 -68.893 1.00 90.09  ? 230 ARG C CZ  1 
ATOM   4930 N NH1 . ARG C 1 147 ? 1.889   -26.289 -69.796 1.00 89.74  ? 230 ARG C NH1 1 
ATOM   4931 N NH2 . ARG C 1 147 ? 1.162   -28.429 -69.294 1.00 88.00  ? 230 ARG C NH2 1 
ATOM   4932 N N   . VAL C 1 148 ? -0.486  -26.255 -61.976 1.00 79.42  ? 231 VAL C N   1 
ATOM   4933 C CA  . VAL C 1 148 ? -1.807  -26.265 -61.353 1.00 82.61  ? 231 VAL C CA  1 
ATOM   4934 C C   . VAL C 1 148 ? -1.949  -25.238 -60.204 1.00 86.71  ? 231 VAL C C   1 
ATOM   4935 O O   . VAL C 1 148 ? -2.859  -24.394 -60.247 1.00 92.07  ? 231 VAL C O   1 
ATOM   4936 C CB  . VAL C 1 148 ? -2.238  -27.714 -60.950 1.00 82.60  ? 231 VAL C CB  1 
ATOM   4937 C CG1 . VAL C 1 148 ? -3.429  -27.730 -59.992 1.00 78.58  ? 231 VAL C CG1 1 
ATOM   4938 C CG2 . VAL C 1 148 ? -2.537  -28.550 -62.187 1.00 74.03  ? 231 VAL C CG2 1 
ATOM   4939 N N   . ASP C 1 149 ? -1.056  -25.282 -59.210 1.00 84.41  ? 232 ASP C N   1 
ATOM   4940 C CA  . ASP C 1 149 ? -1.146  -24.384 -58.037 1.00 87.69  ? 232 ASP C CA  1 
ATOM   4941 C C   . ASP C 1 149 ? -0.790  -22.926 -58.376 1.00 94.05  ? 232 ASP C C   1 
ATOM   4942 O O   . ASP C 1 149 ? -0.960  -22.039 -57.538 1.00 98.45  ? 232 ASP C O   1 
ATOM   4943 C CB  . ASP C 1 149 ? -0.272  -24.897 -56.861 1.00 87.86  ? 232 ASP C CB  1 
ATOM   4944 C CG  . ASP C 1 149 ? -0.788  -26.232 -56.244 1.00 87.77  ? 232 ASP C CG  1 
ATOM   4945 O OD1 . ASP C 1 149 ? -1.783  -26.783 -56.760 1.00 80.39  ? 232 ASP C OD1 1 
ATOM   4946 O OD2 . ASP C 1 149 ? -0.191  -26.733 -55.249 1.00 81.64  ? 232 ASP C OD2 1 
ATOM   4947 N N   . PHE C 1 150 ? -0.304  -22.691 -59.604 1.00 100.92 ? 233 PHE C N   1 
ATOM   4948 C CA  . PHE C 1 150 ? 0.191   -21.374 -60.081 1.00 100.21 ? 233 PHE C CA  1 
ATOM   4949 C C   . PHE C 1 150 ? 0.030   -21.218 -61.620 1.00 103.69 ? 233 PHE C C   1 
ATOM   4950 O O   . PHE C 1 150 ? 1.039   -21.180 -62.349 1.00 102.68 ? 233 PHE C O   1 
ATOM   4951 C CB  . PHE C 1 150 ? 1.689   -21.162 -59.697 1.00 94.46  ? 233 PHE C CB  1 
ATOM   4952 C CG  . PHE C 1 150 ? 2.016   -21.412 -58.229 1.00 98.58  ? 233 PHE C CG  1 
ATOM   4953 C CD1 . PHE C 1 150 ? 1.790   -20.424 -57.257 1.00 96.84  ? 233 PHE C CD1 1 
ATOM   4954 C CD2 . PHE C 1 150 ? 2.564   -22.646 -57.809 1.00 98.08  ? 233 PHE C CD2 1 
ATOM   4955 C CE1 . PHE C 1 150 ? 2.085   -20.657 -55.910 1.00 92.24  ? 233 PHE C CE1 1 
ATOM   4956 C CE2 . PHE C 1 150 ? 2.864   -22.876 -56.459 1.00 91.81  ? 233 PHE C CE2 1 
ATOM   4957 C CZ  . PHE C 1 150 ? 2.620   -21.879 -55.511 1.00 91.24  ? 233 PHE C CZ  1 
ATOM   4958 N N   . SER C 1 151 ? -1.212  -21.157 -62.119 1.00 103.74 ? 234 SER C N   1 
ATOM   4959 C CA  . SER C 1 151 ? -1.465  -20.910 -63.559 1.00 110.12 ? 234 SER C CA  1 
ATOM   4960 C C   . SER C 1 151 ? -2.124  -19.548 -63.802 1.00 118.80 ? 234 SER C C   1 
ATOM   4961 O O   . SER C 1 151 ? -3.220  -19.276 -63.306 1.00 128.15 ? 234 SER C O   1 
ATOM   4962 C CB  . SER C 1 151 ? -2.279  -22.038 -64.215 1.00 109.86 ? 234 SER C CB  1 
ATOM   4963 O OG  . SER C 1 151 ? -3.677  -21.910 -63.991 1.00 109.55 ? 234 SER C OG  1 
ATOM   4964 N N   . GLY C 1 152 ? -1.452  -18.718 -64.593 1.00 120.36 ? 235 GLY C N   1 
ATOM   4965 C CA  . GLY C 1 152 ? -1.743  -17.294 -64.686 1.00 123.82 ? 235 GLY C CA  1 
ATOM   4966 C C   . GLY C 1 152 ? -0.451  -16.604 -64.297 1.00 125.78 ? 235 GLY C C   1 
ATOM   4967 O O   . GLY C 1 152 ? 0.085   -16.848 -63.208 1.00 119.56 ? 235 GLY C O   1 
ATOM   4968 N N   . ARG C 1 153 ? 0.056   -15.750 -65.187 1.00 134.33 ? 236 ARG C N   1 
ATOM   4969 C CA  . ARG C 1 153 ? 1.394   -15.131 -65.031 1.00 136.22 ? 236 ARG C CA  1 
ATOM   4970 C C   . ARG C 1 153 ? 1.528   -14.149 -63.856 1.00 135.56 ? 236 ARG C C   1 
ATOM   4971 O O   . ARG C 1 153 ? 2.644   -13.753 -63.494 1.00 130.39 ? 236 ARG C O   1 
ATOM   4972 C CB  . ARG C 1 153 ? 1.870   -14.477 -66.344 1.00 137.84 ? 236 ARG C CB  1 
ATOM   4973 C CG  . ARG C 1 153 ? 1.296   -13.097 -66.643 1.00 135.37 ? 236 ARG C CG  1 
ATOM   4974 C CD  . ARG C 1 153 ? 1.255   -12.860 -68.144 1.00 136.87 ? 236 ARG C CD  1 
ATOM   4975 N NE  . ARG C 1 153 ? -0.101  -12.522 -68.577 1.00 142.31 ? 236 ARG C NE  1 
ATOM   4976 C CZ  . ARG C 1 153 ? -1.110  -13.392 -68.675 1.00 139.48 ? 236 ARG C CZ  1 
ATOM   4977 N NH1 . ARG C 1 153 ? -0.938  -14.675 -68.373 1.00 138.88 ? 236 ARG C NH1 1 
ATOM   4978 N NH2 . ARG C 1 153 ? -2.306  -12.978 -69.074 1.00 138.69 ? 236 ARG C NH2 1 
ATOM   4979 N N   . GLY C 1 154 ? 0.394   -13.767 -63.272 1.00 135.36 ? 237 GLY C N   1 
ATOM   4980 C CA  . GLY C 1 154 ? 0.383   -12.975 -62.048 1.00 135.56 ? 237 GLY C CA  1 
ATOM   4981 C C   . GLY C 1 154 ? 1.127   -13.634 -60.892 1.00 134.81 ? 237 GLY C C   1 
ATOM   4982 O O   . GLY C 1 154 ? 1.656   -12.934 -60.022 1.00 130.41 ? 237 GLY C O   1 
ATOM   4983 N N   . GLU C 1 155 ? 1.166   -14.974 -60.874 1.00 136.56 ? 238 GLU C N   1 
ATOM   4984 C CA  . GLU C 1 155 ? 1.904   -15.708 -59.827 1.00 128.93 ? 238 GLU C CA  1 
ATOM   4985 C C   . GLU C 1 155 ? 3.113   -16.563 -60.292 1.00 118.75 ? 238 GLU C C   1 
ATOM   4986 O O   . GLU C 1 155 ? 3.344   -17.661 -59.780 1.00 105.91 ? 238 GLU C O   1 
ATOM   4987 C CB  . GLU C 1 155 ? 0.952   -16.477 -58.884 1.00 125.13 ? 238 GLU C CB  1 
ATOM   4988 C CG  . GLU C 1 155 ? 1.446   -16.555 -57.432 1.00 127.86 ? 238 GLU C CG  1 
ATOM   4989 C CD  . GLU C 1 155 ? 2.267   -15.333 -56.948 1.00 132.06 ? 238 GLU C CD  1 
ATOM   4990 O OE1 . GLU C 1 155 ? 3.209   -14.880 -57.645 1.00 134.59 ? 238 GLU C OE1 1 
ATOM   4991 O OE2 . GLU C 1 155 ? 2.005   -14.830 -55.830 1.00 128.71 ? 238 GLU C OE2 1 
ATOM   4992 N N   . LEU C 1 156 ? 3.902   -16.024 -61.226 1.00 111.88 ? 239 LEU C N   1 
ATOM   4993 C CA  . LEU C 1 156 ? 5.118   -16.691 -61.675 1.00 103.74 ? 239 LEU C CA  1 
ATOM   4994 C C   . LEU C 1 156 ? 6.196   -16.662 -60.607 1.00 97.96  ? 239 LEU C C   1 
ATOM   4995 O O   . LEU C 1 156 ? 6.911   -17.638 -60.437 1.00 93.78  ? 239 LEU C O   1 
ATOM   4996 C CB  . LEU C 1 156 ? 5.662   -16.089 -62.975 1.00 108.26 ? 239 LEU C CB  1 
ATOM   4997 C CG  . LEU C 1 156 ? 5.199   -16.671 -64.315 1.00 108.67 ? 239 LEU C CG  1 
ATOM   4998 C CD1 . LEU C 1 156 ? 5.785   -15.854 -65.461 1.00 110.66 ? 239 LEU C CD1 1 
ATOM   4999 C CD2 . LEU C 1 156 ? 5.566   -18.143 -64.454 1.00 100.34 ? 239 LEU C CD2 1 
ATOM   5000 N N   . ALA C 1 157 ? 6.299   -15.557 -59.877 1.00 96.74  ? 240 ALA C N   1 
ATOM   5001 C CA  . ALA C 1 157 ? 7.373   -15.396 -58.900 1.00 90.96  ? 240 ALA C CA  1 
ATOM   5002 C C   . ALA C 1 157 ? 7.313   -16.460 -57.821 1.00 85.17  ? 240 ALA C C   1 
ATOM   5003 O O   . ALA C 1 157 ? 8.309   -17.124 -57.552 1.00 80.47  ? 240 ALA C O   1 
ATOM   5004 C CB  . ALA C 1 157 ? 7.345   -14.015 -58.284 1.00 93.30  ? 240 ALA C CB  1 
ATOM   5005 N N   . GLU C 1 158 ? 6.140   -16.630 -57.228 1.00 84.73  ? 241 GLU C N   1 
ATOM   5006 C CA  . GLU C 1 158 ? 5.910   -17.690 -56.253 1.00 85.72  ? 241 GLU C CA  1 
ATOM   5007 C C   . GLU C 1 158 ? 6.166   -19.075 -56.760 1.00 80.32  ? 241 GLU C C   1 
ATOM   5008 O O   . GLU C 1 158 ? 6.774   -19.883 -56.055 1.00 74.19  ? 241 GLU C O   1 
ATOM   5009 C CB  . GLU C 1 158 ? 4.488   -17.655 -55.710 1.00 94.97  ? 241 GLU C CB  1 
ATOM   5010 C CG  . GLU C 1 158 ? 4.426   -16.965 -54.365 1.00 107.84 ? 241 GLU C CG  1 
ATOM   5011 C CD  . GLU C 1 158 ? 5.658   -17.275 -53.541 1.00 110.48 ? 241 GLU C CD  1 
ATOM   5012 O OE1 . GLU C 1 158 ? 6.522   -16.365 -53.373 1.00 109.39 ? 241 GLU C OE1 1 
ATOM   5013 O OE2 . GLU C 1 158 ? 5.760   -18.448 -53.107 1.00 104.34 ? 241 GLU C OE2 1 
ATOM   5014 N N   . ARG C 1 159 ? 5.682   -19.355 -57.968 1.00 80.31  ? 242 ARG C N   1 
ATOM   5015 C CA  . ARG C 1 159 ? 5.865   -20.665 -58.567 1.00 78.63  ? 242 ARG C CA  1 
ATOM   5016 C C   . ARG C 1 159 ? 7.342   -21.029 -58.663 1.00 76.34  ? 242 ARG C C   1 
ATOM   5017 O O   . ARG C 1 159 ? 7.711   -22.157 -58.348 1.00 74.47  ? 242 ARG C O   1 
ATOM   5018 C CB  . ARG C 1 159 ? 5.196   -20.761 -59.939 1.00 82.46  ? 242 ARG C CB  1 
ATOM   5019 C CG  . ARG C 1 159 ? 5.248   -22.164 -60.540 1.00 79.15  ? 242 ARG C CG  1 
ATOM   5020 C CD  . ARG C 1 159 ? 4.582   -22.234 -61.904 1.00 85.19  ? 242 ARG C CD  1 
ATOM   5021 N NE  . ARG C 1 159 ? 5.544   -22.110 -63.002 1.00 88.17  ? 242 ARG C NE  1 
ATOM   5022 C CZ  . ARG C 1 159 ? 5.222   -22.211 -64.289 1.00 87.98  ? 242 ARG C CZ  1 
ATOM   5023 N NH1 . ARG C 1 159 ? 3.961   -22.441 -64.646 1.00 85.62  ? 242 ARG C NH1 1 
ATOM   5024 N NH2 . ARG C 1 159 ? 6.164   -22.087 -65.217 1.00 86.97  ? 242 ARG C NH2 1 
ATOM   5025 N N   . GLN C 1 160 ? 8.185   -20.075 -59.068 1.00 80.71  ? 243 GLN C N   1 
ATOM   5026 C CA  . GLN C 1 160 ? 9.629   -20.333 -59.218 1.00 79.98  ? 243 GLN C CA  1 
ATOM   5027 C C   . GLN C 1 160 ? 10.327  -20.595 -57.886 1.00 71.07  ? 243 GLN C C   1 
ATOM   5028 O O   . GLN C 1 160 ? 11.022  -21.593 -57.745 1.00 65.74  ? 243 GLN C O   1 
ATOM   5029 C CB  . GLN C 1 160 ? 10.330  -19.215 -59.985 1.00 92.27  ? 243 GLN C CB  1 
ATOM   5030 C CG  . GLN C 1 160 ? 9.487   -18.513 -61.047 1.00 108.95 ? 243 GLN C CG  1 
ATOM   5031 C CD  . GLN C 1 160 ? 9.027   -19.394 -62.216 1.00 114.40 ? 243 GLN C CD  1 
ATOM   5032 O OE1 . GLN C 1 160 ? 8.835   -20.616 -62.089 1.00 111.74 ? 243 GLN C OE1 1 
ATOM   5033 N NE2 . GLN C 1 160 ? 8.821   -18.753 -63.370 1.00 120.05 ? 243 GLN C NE2 1 
ATOM   5034 N N   . GLN C 1 161 ? 10.107  -19.716 -56.914 1.00 69.92  ? 244 GLN C N   1 
ATOM   5035 C CA  . GLN C 1 161 ? 10.618  -19.901 -55.558 1.00 72.61  ? 244 GLN C CA  1 
ATOM   5036 C C   . GLN C 1 161 ? 10.447  -21.348 -55.131 1.00 69.60  ? 244 GLN C C   1 
ATOM   5037 O O   . GLN C 1 161 ? 11.416  -22.032 -54.803 1.00 71.29  ? 244 GLN C O   1 
ATOM   5038 C CB  . GLN C 1 161 ? 9.898   -18.979 -54.581 1.00 79.19  ? 244 GLN C CB  1 
ATOM   5039 C CG  . GLN C 1 161 ? 10.726  -18.552 -53.374 1.00 89.15  ? 244 GLN C CG  1 
ATOM   5040 C CD  . GLN C 1 161 ? 10.069  -17.408 -52.606 1.00 101.80 ? 244 GLN C CD  1 
ATOM   5041 O OE1 . GLN C 1 161 ? 8.918   -17.521 -52.163 1.00 101.01 ? 244 GLN C OE1 1 
ATOM   5042 N NE2 . GLN C 1 161 ? 10.798  -16.294 -52.447 1.00 103.43 ? 244 GLN C NE2 1 
ATOM   5043 N N   . LYS C 1 162 ? 9.203   -21.809 -55.188 1.00 68.31  ? 245 LYS C N   1 
ATOM   5044 C CA  . LYS C 1 162 ? 8.819   -23.155 -54.817 1.00 61.81  ? 245 LYS C CA  1 
ATOM   5045 C C   . LYS C 1 162 ? 9.480   -24.233 -55.648 1.00 56.96  ? 245 LYS C C   1 
ATOM   5046 O O   . LYS C 1 162 ? 10.050  -25.161 -55.102 1.00 53.74  ? 245 LYS C O   1 
ATOM   5047 C CB  . LYS C 1 162 ? 7.311   -23.276 -54.919 1.00 62.14  ? 245 LYS C CB  1 
ATOM   5048 C CG  . LYS C 1 162 ? 6.601   -22.457 -53.866 1.00 68.41  ? 245 LYS C CG  1 
ATOM   5049 C CD  . LYS C 1 162 ? 6.927   -22.962 -52.471 1.00 70.17  ? 245 LYS C CD  1 
ATOM   5050 C CE  . LYS C 1 162 ? 5.853   -22.560 -51.473 1.00 77.36  ? 245 LYS C CE  1 
ATOM   5051 N NZ  . LYS C 1 162 ? 5.983   -21.150 -51.016 1.00 83.96  ? 245 LYS C NZ  1 
ATOM   5052 N N   . LEU C 1 163 ? 9.371   -24.105 -56.967 1.00 56.80  ? 246 LEU C N   1 
ATOM   5053 C CA  . LEU C 1 163 ? 9.900   -25.061 -57.915 1.00 52.66  ? 246 LEU C CA  1 
ATOM   5054 C C   . LEU C 1 163 ? 11.418  -25.196 -57.696 1.00 54.26  ? 246 LEU C C   1 
ATOM   5055 O O   . LEU C 1 163 ? 11.962  -26.295 -57.462 1.00 56.74  ? 246 LEU C O   1 
ATOM   5056 C CB  . LEU C 1 163 ? 9.585   -24.579 -59.333 1.00 53.50  ? 246 LEU C CB  1 
ATOM   5057 C CG  . LEU C 1 163 ? 10.131  -25.415 -60.504 1.00 55.05  ? 246 LEU C CG  1 
ATOM   5058 C CD1 . LEU C 1 163 ? 9.443   -26.754 -60.621 1.00 53.78  ? 246 LEU C CD1 1 
ATOM   5059 C CD2 . LEU C 1 163 ? 9.921   -24.708 -61.822 1.00 57.37  ? 246 LEU C CD2 1 
ATOM   5060 N N   . ALA C 1 164 ? 12.096  -24.065 -57.701 1.00 53.71  ? 247 ALA C N   1 
ATOM   5061 C CA  . ALA C 1 164 ? 13.528  -24.092 -57.593 1.00 55.84  ? 247 ALA C CA  1 
ATOM   5062 C C   . ALA C 1 164 ? 13.943  -24.724 -56.292 1.00 56.59  ? 247 ALA C C   1 
ATOM   5063 O O   . ALA C 1 164 ? 14.897  -25.494 -56.317 1.00 58.44  ? 247 ALA C O   1 
ATOM   5064 C CB  . ALA C 1 164 ? 14.130  -22.699 -57.769 1.00 55.39  ? 247 ALA C CB  1 
ATOM   5065 N N   . GLN C 1 165 ? 13.217  -24.422 -55.193 1.00 59.20  ? 248 GLN C N   1 
ATOM   5066 C CA  . GLN C 1 165 ? 13.446  -25.020 -53.850 1.00 60.71  ? 248 GLN C CA  1 
ATOM   5067 C C   . GLN C 1 165 ? 13.399  -26.529 -53.931 1.00 59.98  ? 248 GLN C C   1 
ATOM   5068 O O   . GLN C 1 165 ? 14.262  -27.251 -53.397 1.00 62.39  ? 248 GLN C O   1 
ATOM   5069 C CB  . GLN C 1 165 ? 12.420  -24.552 -52.814 1.00 60.48  ? 248 GLN C CB  1 
ATOM   5070 C CG  . GLN C 1 165 ? 13.000  -23.618 -51.768 1.00 74.98  ? 248 GLN C CG  1 
ATOM   5071 C CD  . GLN C 1 165 ? 11.982  -22.634 -51.162 1.00 88.16  ? 248 GLN C CD  1 
ATOM   5072 O OE1 . GLN C 1 165 ? 10.985  -23.053 -50.566 1.00 92.98  ? 248 GLN C OE1 1 
ATOM   5073 N NE2 . GLN C 1 165 ? 12.245  -21.312 -51.299 1.00 84.11  ? 248 GLN C NE2 1 
ATOM   5074 N N   . MET C 1 166 ? 12.404  -27.014 -54.651 1.00 56.78  ? 249 MET C N   1 
ATOM   5075 C CA  . MET C 1 166 ? 12.233  -28.424 -54.728 1.00 53.18  ? 249 MET C CA  1 
ATOM   5076 C C   . MET C 1 166 ? 13.326  -29.021 -55.583 1.00 50.31  ? 249 MET C C   1 
ATOM   5077 O O   . MET C 1 166 ? 13.832  -30.084 -55.268 1.00 44.09  ? 249 MET C O   1 
ATOM   5078 C CB  . MET C 1 166 ? 10.887  -28.753 -55.295 1.00 52.93  ? 249 MET C CB  1 
ATOM   5079 C CG  . MET C 1 166 ? 10.756  -30.233 -55.536 1.00 57.18  ? 249 MET C CG  1 
ATOM   5080 S SD  . MET C 1 166 ? 9.411   -30.510 -56.658 1.00 65.27  ? 249 MET C SD  1 
ATOM   5081 C CE  . MET C 1 166 ? 10.129  -30.123 -58.259 1.00 56.01  ? 249 MET C CE  1 
ATOM   5082 N N   . LEU C 1 167 ? 13.682  -28.366 -56.684 1.00 51.67  ? 250 LEU C N   1 
ATOM   5083 C CA  . LEU C 1 167 ? 14.661  -29.001 -57.570 1.00 52.79  ? 250 LEU C CA  1 
ATOM   5084 C C   . LEU C 1 167 ? 16.080  -29.032 -56.949 1.00 54.62  ? 250 LEU C C   1 
ATOM   5085 O O   . LEU C 1 167 ? 16.853  -29.995 -57.085 1.00 50.95  ? 250 LEU C O   1 
ATOM   5086 C CB  . LEU C 1 167 ? 14.634  -28.367 -58.940 1.00 50.06  ? 250 LEU C CB  1 
ATOM   5087 C CG  . LEU C 1 167 ? 13.314  -28.617 -59.666 1.00 51.09  ? 250 LEU C CG  1 
ATOM   5088 C CD1 . LEU C 1 167 ? 13.215  -27.627 -60.801 1.00 55.38  ? 250 LEU C CD1 1 
ATOM   5089 C CD2 . LEU C 1 167 ? 13.129  -30.027 -60.216 1.00 49.92  ? 250 LEU C CD2 1 
ATOM   5090 N N   . SER C 1 168 ? 16.403  -27.993 -56.203 1.00 59.22  ? 251 SER C N   1 
ATOM   5091 C CA  . SER C 1 168 ? 17.644  -28.051 -55.478 1.00 57.04  ? 251 SER C CA  1 
ATOM   5092 C C   . SER C 1 168 ? 17.611  -29.087 -54.346 1.00 51.70  ? 251 SER C C   1 
ATOM   5093 O O   . SER C 1 168 ? 18.629  -29.731 -54.131 1.00 52.88  ? 251 SER C O   1 
ATOM   5094 C CB  . SER C 1 168 ? 18.120  -26.669 -55.049 1.00 55.40  ? 251 SER C CB  1 
ATOM   5095 O OG  . SER C 1 168 ? 17.378  -26.241 -53.960 1.00 56.87  ? 251 SER C OG  1 
ATOM   5096 N N   . ARG C 1 169 ? 16.477  -29.294 -53.668 1.00 48.67  ? 252 ARG C N   1 
ATOM   5097 C CA  . ARG C 1 169 ? 16.324  -30.523 -52.812 1.00 50.94  ? 252 ARG C CA  1 
ATOM   5098 C C   . ARG C 1 169 ? 16.573  -31.837 -53.566 1.00 48.64  ? 252 ARG C C   1 
ATOM   5099 O O   . ARG C 1 169 ? 17.244  -32.780 -53.072 1.00 45.61  ? 252 ARG C O   1 
ATOM   5100 C CB  . ARG C 1 169 ? 14.960  -30.603 -52.102 1.00 56.78  ? 252 ARG C CB  1 
ATOM   5101 C CG  . ARG C 1 169 ? 14.815  -29.597 -50.943 1.00 76.96  ? 252 ARG C CG  1 
ATOM   5102 C CD  . ARG C 1 169 ? 15.903  -29.715 -49.861 1.00 89.25  ? 252 ARG C CD  1 
ATOM   5103 N NE  . ARG C 1 169 ? 15.659  -30.815 -48.904 1.00 102.37 ? 252 ARG C NE  1 
ATOM   5104 C CZ  . ARG C 1 169 ? 16.469  -31.857 -48.654 1.00 97.11  ? 252 ARG C CZ  1 
ATOM   5105 N NH1 . ARG C 1 169 ? 17.647  -32.020 -49.264 1.00 90.75  ? 252 ARG C NH1 1 
ATOM   5106 N NH2 . ARG C 1 169 ? 16.094  -32.749 -47.756 1.00 90.24  ? 252 ARG C NH2 1 
ATOM   5107 N N   . LEU C 1 170 ? 16.047  -31.899 -54.781 1.00 47.70  ? 253 LEU C N   1 
ATOM   5108 C CA  . LEU C 1 170 ? 16.211  -33.074 -55.574 1.00 44.52  ? 253 LEU C CA  1 
ATOM   5109 C C   . LEU C 1 170 ? 17.673  -33.285 -55.948 1.00 43.83  ? 253 LEU C C   1 
ATOM   5110 O O   . LEU C 1 170 ? 18.223  -34.383 -55.766 1.00 42.52  ? 253 LEU C O   1 
ATOM   5111 C CB  . LEU C 1 170 ? 15.382  -32.930 -56.786 1.00 48.96  ? 253 LEU C CB  1 
ATOM   5112 C CG  . LEU C 1 170 ? 14.111  -33.738 -56.780 1.00 48.05  ? 253 LEU C CG  1 
ATOM   5113 C CD1 . LEU C 1 170 ? 13.648  -33.735 -58.249 1.00 44.28  ? 253 LEU C CD1 1 
ATOM   5114 C CD2 . LEU C 1 170 ? 14.504  -35.129 -56.323 1.00 42.66  ? 253 LEU C CD2 1 
ATOM   5115 N N   . GLN C 1 171 ? 18.327  -32.230 -56.414 1.00 43.06  ? 254 GLN C N   1 
ATOM   5116 C CA  . GLN C 1 171 ? 19.741  -32.322 -56.738 1.00 41.37  ? 254 GLN C CA  1 
ATOM   5117 C C   . GLN C 1 171 ? 20.533  -32.842 -55.563 1.00 42.16  ? 254 GLN C C   1 
ATOM   5118 O O   . GLN C 1 171 ? 21.313  -33.781 -55.721 1.00 41.57  ? 254 GLN C O   1 
ATOM   5119 C CB  . GLN C 1 171 ? 20.267  -30.973 -57.098 1.00 41.47  ? 254 GLN C CB  1 
ATOM   5120 C CG  . GLN C 1 171 ? 19.790  -30.521 -58.434 1.00 47.89  ? 254 GLN C CG  1 
ATOM   5121 C CD  . GLN C 1 171 ? 20.747  -29.524 -59.034 1.00 50.91  ? 254 GLN C CD  1 
ATOM   5122 O OE1 . GLN C 1 171 ? 21.002  -29.553 -60.220 1.00 52.93  ? 254 GLN C OE1 1 
ATOM   5123 N NE2 . GLN C 1 171 ? 21.302  -28.659 -58.209 1.00 52.74  ? 254 GLN C NE2 1 
ATOM   5124 N N   . LYS C 1 172 ? 20.332  -32.243 -54.379 1.00 43.43  ? 255 LYS C N   1 
ATOM   5125 C CA  . LYS C 1 172 ? 21.019  -32.712 -53.163 1.00 45.34  ? 255 LYS C CA  1 
ATOM   5126 C C   . LYS C 1 172 ? 20.774  -34.165 -52.819 1.00 44.62  ? 255 LYS C C   1 
ATOM   5127 O O   . LYS C 1 172 ? 21.703  -34.843 -52.406 1.00 47.95  ? 255 LYS C O   1 
ATOM   5128 C CB  . LYS C 1 172 ? 20.643  -31.899 -51.965 1.00 48.63  ? 255 LYS C CB  1 
ATOM   5129 C CG  . LYS C 1 172 ? 21.631  -30.811 -51.694 1.00 55.25  ? 255 LYS C CG  1 
ATOM   5130 C CD  . LYS C 1 172 ? 20.856  -29.562 -51.308 1.00 64.85  ? 255 LYS C CD  1 
ATOM   5131 C CE  . LYS C 1 172 ? 20.558  -29.455 -49.827 1.00 68.06  ? 255 LYS C CE  1 
ATOM   5132 N NZ  . LYS C 1 172 ? 20.254  -28.018 -49.635 1.00 70.00  ? 255 LYS C NZ  1 
ATOM   5133 N N   . ILE C 1 173 ? 19.532  -34.627 -52.964 1.00 39.89  ? 256 ILE C N   1 
ATOM   5134 C CA  . ILE C 1 173 ? 19.181  -35.992 -52.680 1.00 39.69  ? 256 ILE C CA  1 
ATOM   5135 C C   . ILE C 1 173 ? 20.002  -36.923 -53.572 1.00 40.74  ? 256 ILE C C   1 
ATOM   5136 O O   . ILE C 1 173 ? 20.772  -37.778 -53.102 1.00 41.52  ? 256 ILE C O   1 
ATOM   5137 C CB  . ILE C 1 173 ? 17.677  -36.164 -52.935 1.00 42.93  ? 256 ILE C CB  1 
ATOM   5138 C CG1 . ILE C 1 173 ? 16.896  -35.400 -51.893 1.00 44.61  ? 256 ILE C CG1 1 
ATOM   5139 C CG2 . ILE C 1 173 ? 17.227  -37.635 -52.967 1.00 37.97  ? 256 ILE C CG2 1 
ATOM   5140 C CD1 . ILE C 1 173 ? 15.414  -35.733 -51.942 1.00 49.53  ? 256 ILE C CD1 1 
ATOM   5141 N N   . SER C 1 174 ? 19.784  -36.747 -54.875 1.00 46.53  ? 257 SER C N   1 
ATOM   5142 C CA  . SER C 1 174 ? 20.541  -37.294 -55.987 1.00 41.90  ? 257 SER C CA  1 
ATOM   5143 C C   . SER C 1 174 ? 22.002  -37.582 -55.644 1.00 43.82  ? 257 SER C C   1 
ATOM   5144 O O   . SER C 1 174 ? 22.497  -38.732 -55.759 1.00 40.13  ? 257 SER C O   1 
ATOM   5145 C CB  . SER C 1 174 ? 20.548  -36.174 -56.986 1.00 42.73  ? 257 SER C CB  1 
ATOM   5146 O OG  . SER C 1 174 ? 20.992  -36.590 -58.246 1.00 59.20  ? 257 SER C OG  1 
ATOM   5147 N N   . GLU C 1 175 ? 22.668  -36.499 -55.223 1.00 44.20  ? 258 GLU C N   1 
ATOM   5148 C CA  . GLU C 1 175 ? 24.097  -36.442 -55.008 1.00 44.65  ? 258 GLU C CA  1 
ATOM   5149 C C   . GLU C 1 175 ? 24.495  -36.888 -53.607 1.00 46.29  ? 258 GLU C C   1 
ATOM   5150 O O   . GLU C 1 175 ? 25.527  -37.508 -53.436 1.00 47.70  ? 258 GLU C O   1 
ATOM   5151 C CB  . GLU C 1 175 ? 24.587  -35.033 -55.271 1.00 44.67  ? 258 GLU C CB  1 
ATOM   5152 C CG  . GLU C 1 175 ? 24.582  -34.676 -56.730 1.00 43.18  ? 258 GLU C CG  1 
ATOM   5153 C CD  . GLU C 1 175 ? 24.691  -33.185 -57.032 1.00 49.72  ? 258 GLU C CD  1 
ATOM   5154 O OE1 . GLU C 1 175 ? 24.014  -32.701 -57.986 1.00 51.63  ? 258 GLU C OE1 1 
ATOM   5155 O OE2 . GLU C 1 175 ? 25.480  -32.491 -56.357 1.00 57.08  ? 258 GLU C OE2 1 
ATOM   5156 N N   . GLU C 1 176 ? 23.674  -36.619 -52.599 1.00 48.78  ? 259 GLU C N   1 
ATOM   5157 C CA  . GLU C 1 176 ? 24.047  -37.016 -51.249 1.00 48.58  ? 259 GLU C CA  1 
ATOM   5158 C C   . GLU C 1 176 ? 23.913  -38.523 -51.060 1.00 49.86  ? 259 GLU C C   1 
ATOM   5159 O O   . GLU C 1 176 ? 24.720  -39.134 -50.385 1.00 48.78  ? 259 GLU C O   1 
ATOM   5160 C CB  . GLU C 1 176 ? 23.177  -36.323 -50.258 1.00 53.41  ? 259 GLU C CB  1 
ATOM   5161 C CG  . GLU C 1 176 ? 23.796  -36.280 -48.873 1.00 65.49  ? 259 GLU C CG  1 
ATOM   5162 C CD  . GLU C 1 176 ? 22.887  -35.612 -47.839 1.00 77.85  ? 259 GLU C CD  1 
ATOM   5163 O OE1 . GLU C 1 176 ? 21.998  -34.779 -48.222 1.00 70.78  ? 259 GLU C OE1 1 
ATOM   5164 O OE2 . GLU C 1 176 ? 23.079  -35.913 -46.625 1.00 89.35  ? 259 GLU C OE2 1 
ATOM   5165 N N   . TYR C 1 177 ? 22.914  -39.114 -51.708 1.00 47.27  ? 260 TYR C N   1 
ATOM   5166 C CA  . TYR C 1 177 ? 22.511  -40.483 -51.428 1.00 48.37  ? 260 TYR C CA  1 
ATOM   5167 C C   . TYR C 1 177 ? 22.870  -41.456 -52.526 1.00 45.59  ? 260 TYR C C   1 
ATOM   5168 O O   . TYR C 1 177 ? 22.514  -42.613 -52.469 1.00 45.54  ? 260 TYR C O   1 
ATOM   5169 C CB  . TYR C 1 177 ? 20.991  -40.523 -51.150 1.00 48.87  ? 260 TYR C CB  1 
ATOM   5170 C CG  . TYR C 1 177 ? 20.727  -39.916 -49.803 1.00 53.35  ? 260 TYR C CG  1 
ATOM   5171 C CD1 . TYR C 1 177 ? 20.045  -38.677 -49.659 1.00 52.35  ? 260 TYR C CD1 1 
ATOM   5172 C CD2 . TYR C 1 177 ? 21.272  -40.496 -48.673 1.00 50.63  ? 260 TYR C CD2 1 
ATOM   5173 C CE1 . TYR C 1 177 ? 19.857  -38.103 -48.399 1.00 50.29  ? 260 TYR C CE1 1 
ATOM   5174 C CE2 . TYR C 1 177 ? 21.089  -39.927 -47.430 1.00 57.18  ? 260 TYR C CE2 1 
ATOM   5175 C CZ  . TYR C 1 177 ? 20.381  -38.742 -47.298 1.00 56.86  ? 260 TYR C CZ  1 
ATOM   5176 O OH  . TYR C 1 177 ? 20.228  -38.238 -46.023 1.00 68.85  ? 260 TYR C OH  1 
ATOM   5177 N N   . ASN C 1 178 ? 23.566  -40.957 -53.528 1.00 42.66  ? 261 ASN C N   1 
ATOM   5178 C CA  . ASN C 1 178 ? 23.929  -41.719 -54.677 1.00 38.32  ? 261 ASN C CA  1 
ATOM   5179 C C   . ASN C 1 178 ? 22.746  -42.421 -55.235 1.00 38.97  ? 261 ASN C C   1 
ATOM   5180 O O   . ASN C 1 178 ? 22.758  -43.639 -55.361 1.00 39.60  ? 261 ASN C O   1 
ATOM   5181 C CB  . ASN C 1 178 ? 25.023  -42.715 -54.358 1.00 35.31  ? 261 ASN C CB  1 
ATOM   5182 C CG  . ASN C 1 178 ? 25.544  -43.398 -55.597 1.00 38.19  ? 261 ASN C CG  1 
ATOM   5183 O OD1 . ASN C 1 178 ? 25.501  -42.840 -56.714 1.00 37.69  ? 261 ASN C OD1 1 
ATOM   5184 N ND2 . ASN C 1 178 ? 26.070  -44.619 -55.417 1.00 40.46  ? 261 ASN C ND2 1 
ATOM   5185 N N   . VAL C 1 179 ? 21.690  -41.688 -55.544 1.00 39.71  ? 262 VAL C N   1 
ATOM   5186 C CA  . VAL C 1 179 ? 20.636  -42.328 -56.306 1.00 38.73  ? 262 VAL C CA  1 
ATOM   5187 C C   . VAL C 1 179 ? 20.414  -41.669 -57.651 1.00 37.15  ? 262 VAL C C   1 
ATOM   5188 O O   . VAL C 1 179 ? 20.843  -40.532 -57.868 1.00 39.45  ? 262 VAL C O   1 
ATOM   5189 C CB  . VAL C 1 179 ? 19.316  -42.428 -55.541 1.00 39.80  ? 262 VAL C CB  1 
ATOM   5190 C CG1 . VAL C 1 179 ? 19.545  -43.066 -54.192 1.00 45.20  ? 262 VAL C CG1 1 
ATOM   5191 C CG2 . VAL C 1 179 ? 18.663  -41.089 -55.409 1.00 37.38  ? 262 VAL C CG2 1 
ATOM   5192 N N   . ALA C 1 180 ? 19.760  -42.392 -58.546 1.00 35.43  ? 263 ALA C N   1 
ATOM   5193 C CA  . ALA C 1 180 ? 19.376  -41.842 -59.832 1.00 39.38  ? 263 ALA C CA  1 
ATOM   5194 C C   . ALA C 1 180 ? 17.989  -41.194 -59.666 1.00 39.56  ? 263 ALA C C   1 
ATOM   5195 O O   . ALA C 1 180 ? 17.111  -41.764 -59.033 1.00 44.49  ? 263 ALA C O   1 
ATOM   5196 C CB  . ALA C 1 180 ? 19.349  -42.953 -60.864 1.00 38.37  ? 263 ALA C CB  1 
ATOM   5197 N N   . VAL C 1 181 ? 17.813  -39.972 -60.139 1.00 40.08  ? 264 VAL C N   1 
ATOM   5198 C CA  . VAL C 1 181 ? 16.473  -39.425 -60.248 1.00 39.39  ? 264 VAL C CA  1 
ATOM   5199 C C   . VAL C 1 181 ? 16.052  -39.250 -61.700 1.00 44.18  ? 264 VAL C C   1 
ATOM   5200 O O   . VAL C 1 181 ? 16.783  -38.686 -62.503 1.00 47.26  ? 264 VAL C O   1 
ATOM   5201 C CB  . VAL C 1 181 ? 16.136  -38.245 -59.293 1.00 37.84  ? 264 VAL C CB  1 
ATOM   5202 C CG1 . VAL C 1 181 ? 17.302  -37.809 -58.435 1.00 41.09  ? 264 VAL C CG1 1 
ATOM   5203 C CG2 . VAL C 1 181 ? 15.414  -37.104 -59.976 1.00 39.19  ? 264 VAL C CG2 1 
ATOM   5204 N N   . PHE C 1 182 ? 14.883  -39.810 -62.020 1.00 44.23  ? 265 PHE C N   1 
ATOM   5205 C CA  . PHE C 1 182 ? 14.306  -39.746 -63.333 1.00 42.52  ? 265 PHE C CA  1 
ATOM   5206 C C   . PHE C 1 182 ? 12.973  -39.024 -63.319 1.00 41.75  ? 265 PHE C C   1 
ATOM   5207 O O   . PHE C 1 182 ? 12.067  -39.459 -62.648 1.00 47.33  ? 265 PHE C O   1 
ATOM   5208 C CB  . PHE C 1 182 ? 14.051  -41.139 -63.843 1.00 40.97  ? 265 PHE C CB  1 
ATOM   5209 C CG  . PHE C 1 182 ? 13.326  -41.141 -65.144 1.00 41.97  ? 265 PHE C CG  1 
ATOM   5210 C CD1 . PHE C 1 182 ? 13.976  -40.695 -66.301 1.00 40.67  ? 265 PHE C CD1 1 
ATOM   5211 C CD2 . PHE C 1 182 ? 11.971  -41.497 -65.208 1.00 38.99  ? 265 PHE C CD2 1 
ATOM   5212 C CE1 . PHE C 1 182 ? 13.297  -40.651 -67.528 1.00 42.29  ? 265 PHE C CE1 1 
ATOM   5213 C CE2 . PHE C 1 182 ? 11.290  -41.449 -66.422 1.00 40.95  ? 265 PHE C CE2 1 
ATOM   5214 C CZ  . PHE C 1 182 ? 11.961  -41.042 -67.586 1.00 44.09  ? 265 PHE C CZ  1 
ATOM   5215 N N   . VAL C 1 183 ? 12.838  -37.929 -64.052 1.00 42.21  ? 266 VAL C N   1 
ATOM   5216 C CA  . VAL C 1 183 ? 11.550  -37.264 -64.080 1.00 41.41  ? 266 VAL C CA  1 
ATOM   5217 C C   . VAL C 1 183 ? 11.033  -37.070 -65.483 1.00 46.92  ? 266 VAL C C   1 
ATOM   5218 O O   . VAL C 1 183 ? 11.816  -36.954 -66.453 1.00 44.83  ? 266 VAL C O   1 
ATOM   5219 C CB  . VAL C 1 183 ? 11.567  -35.922 -63.335 1.00 42.33  ? 266 VAL C CB  1 
ATOM   5220 C CG1 . VAL C 1 183 ? 12.226  -36.088 -61.946 1.00 42.92  ? 266 VAL C CG1 1 
ATOM   5221 C CG2 . VAL C 1 183 ? 12.282  -34.855 -64.141 1.00 40.38  ? 266 VAL C CG2 1 
ATOM   5222 N N   . THR C 1 184 ? 9.704   -37.036 -65.572 1.00 46.57  ? 267 THR C N   1 
ATOM   5223 C CA  . THR C 1 184 ? 9.030   -36.758 -66.810 1.00 49.94  ? 267 THR C CA  1 
ATOM   5224 C C   . THR C 1 184 ? 8.511   -35.324 -66.766 1.00 57.75  ? 267 THR C C   1 
ATOM   5225 O O   . THR C 1 184 ? 8.372   -34.741 -65.668 1.00 55.40  ? 267 THR C O   1 
ATOM   5226 C CB  . THR C 1 184 ? 7.898   -37.762 -67.129 1.00 49.27  ? 267 THR C CB  1 
ATOM   5227 O OG1 . THR C 1 184 ? 6.869   -37.680 -66.137 1.00 51.15  ? 267 THR C OG1 1 
ATOM   5228 C CG2 . THR C 1 184 ? 8.434   -39.185 -67.178 1.00 46.09  ? 267 THR C CG2 1 
ATOM   5229 N N   . ASN C 1 185 ? 8.229   -34.782 -67.965 1.00 59.67  ? 268 ASN C N   1 
ATOM   5230 C CA  . ASN C 1 185 ? 7.815   -33.412 -68.156 1.00 58.42  ? 268 ASN C CA  1 
ATOM   5231 C C   . ASN C 1 185 ? 6.982   -33.168 -69.414 1.00 63.69  ? 268 ASN C C   1 
ATOM   5232 O O   . ASN C 1 185 ? 7.018   -33.948 -70.369 1.00 66.10  ? 268 ASN C O   1 
ATOM   5233 C CB  . ASN C 1 185 ? 9.057   -32.550 -68.222 1.00 59.77  ? 268 ASN C CB  1 
ATOM   5234 C CG  . ASN C 1 185 ? 8.760   -31.092 -67.976 1.00 63.91  ? 268 ASN C CG  1 
ATOM   5235 O OD1 . ASN C 1 185 ? 9.494   -30.238 -68.437 1.00 69.22  ? 268 ASN C OD1 1 
ATOM   5236 N ND2 . ASN C 1 185 ? 7.698   -30.798 -67.235 1.00 65.65  ? 268 ASN C ND2 1 
ATOM   5237 N N   . GLN C 1 186 ? 6.275   -32.042 -69.418 1.00 67.05  ? 269 GLN C N   1 
ATOM   5238 C CA  . GLN C 1 186 ? 5.350   -31.664 -70.491 1.00 74.72  ? 269 GLN C CA  1 
ATOM   5239 C C   . GLN C 1 186 ? 5.902   -30.545 -71.378 1.00 77.87  ? 269 GLN C C   1 
ATOM   5240 O O   . GLN C 1 186 ? 7.023   -30.033 -71.168 1.00 74.77  ? 269 GLN C O   1 
ATOM   5241 C CB  . GLN C 1 186 ? 4.009   -31.184 -69.908 1.00 80.72  ? 269 GLN C CB  1 
ATOM   5242 C CG  . GLN C 1 186 ? 3.137   -32.246 -69.245 1.00 83.88  ? 269 GLN C CG  1 
ATOM   5243 C CD  . GLN C 1 186 ? 3.527   -32.559 -67.801 1.00 81.97  ? 269 GLN C CD  1 
ATOM   5244 O OE1 . GLN C 1 186 ? 3.778   -31.662 -66.982 1.00 77.67  ? 269 GLN C OE1 1 
ATOM   5245 N NE2 . GLN C 1 186 ? 3.578   -33.851 -67.486 1.00 82.70  ? 269 GLN C NE2 1 
ATOM   5246 N N   . MET C 1 187 ? 5.083   -30.154 -72.350 1.00 77.08  ? 270 MET C N   1 
ATOM   5247 C CA  . MET C 1 187 ? 5.474   -29.180 -73.354 1.00 84.15  ? 270 MET C CA  1 
ATOM   5248 C C   . MET C 1 187 ? 4.438   -28.059 -73.410 1.00 88.74  ? 270 MET C C   1 
ATOM   5249 O O   . MET C 1 187 ? 3.358   -28.182 -72.820 1.00 93.92  ? 270 MET C O   1 
ATOM   5250 C CB  . MET C 1 187 ? 5.559   -29.863 -74.715 1.00 85.66  ? 270 MET C CB  1 
ATOM   5251 C CG  . MET C 1 187 ? 6.204   -31.242 -74.711 1.00 84.96  ? 270 MET C CG  1 
ATOM   5252 S SD  . MET C 1 187 ? 7.972   -31.234 -75.068 1.00 88.67  ? 270 MET C SD  1 
ATOM   5253 C CE  . MET C 1 187 ? 8.018   -31.092 -76.870 1.00 94.90  ? 270 MET C CE  1 
ATOM   5254 N N   . THR C 1 188 ? 4.767   -26.974 -74.107 1.00 91.00  ? 271 THR C N   1 
ATOM   5255 C CA  . THR C 1 188 ? 3.810   -25.897 -74.370 1.00 97.72  ? 271 THR C CA  1 
ATOM   5256 C C   . THR C 1 188 ? 3.746   -25.583 -75.859 1.00 105.74 ? 271 THR C C   1 
ATOM   5257 O O   . THR C 1 188 ? 4.744   -25.166 -76.442 1.00 119.77 ? 271 THR C O   1 
ATOM   5258 C CB  . THR C 1 188 ? 4.144   -24.609 -73.585 1.00 96.84  ? 271 THR C CB  1 
ATOM   5259 O OG1 . THR C 1 188 ? 5.488   -24.680 -73.076 1.00 88.05  ? 271 THR C OG1 1 
ATOM   5260 C CG2 . THR C 1 188 ? 3.153   -24.413 -72.425 1.00 95.88  ? 271 THR C CG2 1 
ATOM   5261 N N   . LYS C 1 203 ? 8.631   -26.483 -76.921 1.00 99.95  ? 286 LYS C N   1 
ATOM   5262 C CA  . LYS C 1 203 ? 9.580   -26.371 -75.827 1.00 99.12  ? 286 LYS C CA  1 
ATOM   5263 C C   . LYS C 1 203 ? 9.043   -27.049 -74.544 1.00 99.53  ? 286 LYS C C   1 
ATOM   5264 O O   . LYS C 1 203 ? 7.821   -27.070 -74.312 1.00 103.01 ? 286 LYS C O   1 
ATOM   5265 C CB  . LYS C 1 203 ? 9.892   -24.894 -75.542 1.00 104.43 ? 286 LYS C CB  1 
ATOM   5266 C CG  . LYS C 1 203 ? 11.362  -24.612 -75.210 1.00 119.28 ? 286 LYS C CG  1 
ATOM   5267 C CD  . LYS C 1 203 ? 11.568  -23.662 -74.022 1.00 119.16 ? 286 LYS C CD  1 
ATOM   5268 C CE  . LYS C 1 203 ? 13.014  -23.686 -73.509 1.00 113.53 ? 286 LYS C CE  1 
ATOM   5269 N NZ  . LYS C 1 203 ? 13.193  -23.045 -72.169 1.00 106.29 ? 286 LYS C NZ  1 
ATOM   5270 N N   . PRO C 1 204 ? 9.948   -27.606 -73.705 1.00 92.41  ? 287 PRO C N   1 
ATOM   5271 C CA  . PRO C 1 204 ? 9.561   -28.003 -72.343 1.00 88.51  ? 287 PRO C CA  1 
ATOM   5272 C C   . PRO C 1 204 ? 9.273   -26.790 -71.455 1.00 89.13  ? 287 PRO C C   1 
ATOM   5273 O O   . PRO C 1 204 ? 9.891   -25.721 -71.621 1.00 90.45  ? 287 PRO C O   1 
ATOM   5274 C CB  . PRO C 1 204 ? 10.814  -28.717 -71.815 1.00 84.05  ? 287 PRO C CB  1 
ATOM   5275 C CG  . PRO C 1 204 ? 11.939  -28.140 -72.612 1.00 87.40  ? 287 PRO C CG  1 
ATOM   5276 C CD  . PRO C 1 204 ? 11.346  -27.982 -73.990 1.00 91.52  ? 287 PRO C CD  1 
ATOM   5277 N N   . ILE C 1 205 ? 8.350   -26.963 -70.514 1.00 86.51  ? 288 ILE C N   1 
ATOM   5278 C CA  . ILE C 1 205 ? 8.058   -25.922 -69.520 1.00 87.20  ? 288 ILE C CA  1 
ATOM   5279 C C   . ILE C 1 205 ? 9.037   -26.037 -68.342 1.00 78.55  ? 288 ILE C C   1 
ATOM   5280 O O   . ILE C 1 205 ? 9.558   -27.116 -68.083 1.00 75.63  ? 288 ILE C O   1 
ATOM   5281 C CB  . ILE C 1 205 ? 6.560   -25.909 -69.056 1.00 91.34  ? 288 ILE C CB  1 
ATOM   5282 C CG1 . ILE C 1 205 ? 5.845   -27.234 -69.369 1.00 93.68  ? 288 ILE C CG1 1 
ATOM   5283 C CG2 . ILE C 1 205 ? 5.793   -24.743 -69.682 1.00 98.49  ? 288 ILE C CG2 1 
ATOM   5284 C CD1 . ILE C 1 205 ? 6.014   -28.307 -68.302 1.00 85.57  ? 288 ILE C CD1 1 
ATOM   5285 N N   . GLY C 1 206 ? 9.302   -24.929 -67.654 1.00 72.32  ? 289 GLY C N   1 
ATOM   5286 C CA  . GLY C 1 206 ? 10.211  -24.930 -66.522 1.00 68.53  ? 289 GLY C CA  1 
ATOM   5287 C C   . GLY C 1 206 ? 11.193  -23.780 -66.542 1.00 71.82  ? 289 GLY C C   1 
ATOM   5288 O O   . GLY C 1 206 ? 11.739  -23.397 -65.486 1.00 70.37  ? 289 GLY C O   1 
ATOM   5289 N N   . GLY C 1 207 ? 11.401  -23.214 -67.735 1.00 71.09  ? 290 GLY C N   1 
ATOM   5290 C CA  . GLY C 1 207 ? 12.378  -22.133 -67.938 1.00 74.92  ? 290 GLY C CA  1 
ATOM   5291 C C   . GLY C 1 207 ? 13.786  -22.604 -67.601 1.00 71.61  ? 290 GLY C C   1 
ATOM   5292 O O   . GLY C 1 207 ? 14.064  -23.819 -67.633 1.00 68.09  ? 290 GLY C O   1 
ATOM   5293 N N   . HIS C 1 208 ? 14.667  -21.661 -67.260 1.00 72.95  ? 291 HIS C N   1 
ATOM   5294 C CA  . HIS C 1 208 ? 16.017  -22.021 -66.807 1.00 77.09  ? 291 HIS C CA  1 
ATOM   5295 C C   . HIS C 1 208 ? 16.023  -22.821 -65.532 1.00 74.48  ? 291 HIS C C   1 
ATOM   5296 O O   . HIS C 1 208 ? 16.991  -23.521 -65.272 1.00 69.85  ? 291 HIS C O   1 
ATOM   5297 C CB  . HIS C 1 208 ? 16.882  -20.807 -66.606 1.00 76.59  ? 291 HIS C CB  1 
ATOM   5298 C CG  . HIS C 1 208 ? 16.693  -19.790 -67.641 1.00 82.69  ? 291 HIS C CG  1 
ATOM   5299 N ND1 . HIS C 1 208 ? 15.723  -18.860 -67.560 1.00 95.49  ? 291 HIS C ND1 1 
ATOM   5300 C CD2 . HIS C 1 208 ? 17.364  -19.565 -68.830 1.00 86.38  ? 291 HIS C CD2 1 
ATOM   5301 C CE1 . HIS C 1 208 ? 15.781  -18.055 -68.640 1.00 96.45  ? 291 HIS C CE1 1 
ATOM   5302 N NE2 . HIS C 1 208 ? 16.787  -18.488 -69.418 1.00 94.02  ? 291 HIS C NE2 1 
ATOM   5303 N N   . ILE C 1 209 ? 14.955  -22.731 -64.737 1.00 69.51  ? 292 ILE C N   1 
ATOM   5304 C CA  . ILE C 1 209 ? 14.906  -23.438 -63.466 1.00 70.79  ? 292 ILE C CA  1 
ATOM   5305 C C   . ILE C 1 209 ? 14.951  -24.948 -63.631 1.00 66.43  ? 292 ILE C C   1 
ATOM   5306 O O   . ILE C 1 209 ? 15.632  -25.623 -62.883 1.00 66.68  ? 292 ILE C O   1 
ATOM   5307 C CB  . ILE C 1 209 ? 13.652  -23.101 -62.631 1.00 73.62  ? 292 ILE C CB  1 
ATOM   5308 C CG1 . ILE C 1 209 ? 13.460  -21.603 -62.496 1.00 79.66  ? 292 ILE C CG1 1 
ATOM   5309 C CG2 . ILE C 1 209 ? 13.735  -23.735 -61.247 1.00 70.46  ? 292 ILE C CG2 1 
ATOM   5310 C CD1 . ILE C 1 209 ? 12.002  -21.220 -62.589 1.00 89.13  ? 292 ILE C CD1 1 
ATOM   5311 N N   . LEU C 1 210 ? 14.203  -25.493 -64.574 1.00 67.12  ? 293 LEU C N   1 
ATOM   5312 C CA  . LEU C 1 210 ? 14.222  -26.930 -64.716 1.00 62.00  ? 293 LEU C CA  1 
ATOM   5313 C C   . LEU C 1 210 ? 15.483  -27.298 -65.462 1.00 64.21  ? 293 LEU C C   1 
ATOM   5314 O O   . LEU C 1 210 ? 16.156  -28.259 -65.096 1.00 65.53  ? 293 LEU C O   1 
ATOM   5315 C CB  . LEU C 1 210 ? 13.015  -27.428 -65.470 1.00 58.19  ? 293 LEU C CB  1 
ATOM   5316 C CG  . LEU C 1 210 ? 12.258  -28.647 -64.936 1.00 61.85  ? 293 LEU C CG  1 
ATOM   5317 C CD1 . LEU C 1 210 ? 11.785  -29.440 -66.138 1.00 64.71  ? 293 LEU C CD1 1 
ATOM   5318 C CD2 . LEU C 1 210 ? 13.004  -29.580 -63.992 1.00 56.93  ? 293 LEU C CD2 1 
ATOM   5319 N N   . ALA C 1 211 ? 15.828  -26.503 -66.481 1.00 68.00  ? 294 ALA C N   1 
ATOM   5320 C CA  . ALA C 1 211 ? 16.956  -26.810 -67.379 1.00 65.90  ? 294 ALA C CA  1 
ATOM   5321 C C   . ALA C 1 211 ? 18.255  -26.950 -66.592 1.00 63.45  ? 294 ALA C C   1 
ATOM   5322 O O   . ALA C 1 211 ? 19.137  -27.764 -66.914 1.00 65.54  ? 294 ALA C O   1 
ATOM   5323 C CB  . ALA C 1 211 ? 17.078  -25.749 -68.460 1.00 65.73  ? 294 ALA C CB  1 
ATOM   5324 N N   . HIS C 1 212 ? 18.353  -26.192 -65.510 1.00 61.11  ? 295 HIS C N   1 
ATOM   5325 C CA  . HIS C 1 212 ? 19.586  -26.182 -64.767 1.00 59.55  ? 295 HIS C CA  1 
ATOM   5326 C C   . HIS C 1 212 ? 19.694  -27.396 -63.865 1.00 59.41  ? 295 HIS C C   1 
ATOM   5327 O O   . HIS C 1 212 ? 20.774  -27.969 -63.670 1.00 56.14  ? 295 HIS C O   1 
ATOM   5328 C CB  . HIS C 1 212 ? 19.762  -24.868 -64.020 1.00 57.35  ? 295 HIS C CB  1 
ATOM   5329 C CG  . HIS C 1 212 ? 20.865  -24.914 -63.031 1.00 63.74  ? 295 HIS C CG  1 
ATOM   5330 N ND1 . HIS C 1 212 ? 20.681  -25.374 -61.738 1.00 63.76  ? 295 HIS C ND1 1 
ATOM   5331 C CD2 . HIS C 1 212 ? 22.221  -24.645 -63.175 1.00 65.80  ? 295 HIS C CD2 1 
ATOM   5332 C CE1 . HIS C 1 212 ? 21.861  -25.383 -61.104 1.00 67.97  ? 295 HIS C CE1 1 
ATOM   5333 N NE2 . HIS C 1 212 ? 22.813  -24.931 -61.981 1.00 75.83  ? 295 HIS C NE2 1 
ATOM   5334 N N   . ALA C 1 213 ? 18.561  -27.803 -63.307 1.00 58.94  ? 296 ALA C N   1 
ATOM   5335 C CA  . ALA C 1 213 ? 18.556  -28.842 -62.297 1.00 55.13  ? 296 ALA C CA  1 
ATOM   5336 C C   . ALA C 1 213 ? 18.825  -30.207 -62.952 1.00 55.41  ? 296 ALA C C   1 
ATOM   5337 O O   . ALA C 1 213 ? 19.485  -31.079 -62.362 1.00 57.46  ? 296 ALA C O   1 
ATOM   5338 C CB  . ALA C 1 213 ? 17.231  -28.819 -61.531 1.00 47.33  ? 296 ALA C CB  1 
ATOM   5339 N N   . SER C 1 214 ? 18.273  -30.391 -64.153 1.00 55.82  ? 297 SER C N   1 
ATOM   5340 C CA  . SER C 1 214 ? 18.476  -31.611 -64.907 1.00 54.12  ? 297 SER C CA  1 
ATOM   5341 C C   . SER C 1 214 ? 19.831  -31.524 -65.532 1.00 57.33  ? 297 SER C C   1 
ATOM   5342 O O   . SER C 1 214 ? 20.269  -30.480 -66.076 1.00 60.51  ? 297 SER C O   1 
ATOM   5343 C CB  . SER C 1 214 ? 17.439  -31.837 -65.994 1.00 54.26  ? 297 SER C CB  1 
ATOM   5344 O OG  . SER C 1 214 ? 16.112  -31.632 -65.517 1.00 55.53  ? 297 SER C OG  1 
ATOM   5345 N N   . THR C 1 215 ? 20.502  -32.655 -65.432 1.00 56.82  ? 298 THR C N   1 
ATOM   5346 C CA  . THR C 1 215 ? 21.843  -32.733 -65.880 1.00 55.63  ? 298 THR C CA  1 
ATOM   5347 C C   . THR C 1 215 ? 21.850  -33.557 -67.169 1.00 56.92  ? 298 THR C C   1 
ATOM   5348 O O   . THR C 1 215 ? 22.768  -33.467 -67.963 1.00 65.36  ? 298 THR C O   1 
ATOM   5349 C CB  . THR C 1 215 ? 22.806  -33.042 -64.683 1.00 56.18  ? 298 THR C CB  1 
ATOM   5350 O OG1 . THR C 1 215 ? 23.782  -34.013 -65.037 1.00 55.50  ? 298 THR C OG1 1 
ATOM   5351 C CG2 . THR C 1 215 ? 22.035  -33.472 -63.444 1.00 48.06  ? 298 THR C CG2 1 
ATOM   5352 N N   . THR C 1 216 ? 20.753  -34.267 -67.428 1.00 55.18  ? 299 THR C N   1 
ATOM   5353 C CA  . THR C 1 216 ? 20.456  -34.806 -68.763 1.00 52.92  ? 299 THR C CA  1 
ATOM   5354 C C   . THR C 1 216 ? 18.976  -34.630 -69.077 1.00 59.68  ? 299 THR C C   1 
ATOM   5355 O O   . THR C 1 216 ? 18.091  -34.993 -68.264 1.00 65.10  ? 299 THR C O   1 
ATOM   5356 C CB  . THR C 1 216 ? 20.771  -36.293 -68.859 1.00 52.22  ? 299 THR C CB  1 
ATOM   5357 O OG1 . THR C 1 216 ? 22.075  -36.550 -68.296 1.00 50.42  ? 299 THR C OG1 1 
ATOM   5358 C CG2 . THR C 1 216 ? 20.673  -36.776 -70.298 1.00 47.98  ? 299 THR C CG2 1 
ATOM   5359 N N   . ARG C 1 217 ? 18.709  -34.059 -70.245 1.00 56.36  ? 300 ARG C N   1 
ATOM   5360 C CA  . ARG C 1 217 ? 17.372  -33.760 -70.653 1.00 57.27  ? 300 ARG C CA  1 
ATOM   5361 C C   . ARG C 1 217 ? 17.203  -34.442 -71.992 1.00 59.68  ? 300 ARG C C   1 
ATOM   5362 O O   . ARG C 1 217 ? 17.974  -34.224 -72.910 1.00 59.87  ? 300 ARG C O   1 
ATOM   5363 C CB  . ARG C 1 217 ? 17.140  -32.245 -70.772 1.00 59.58  ? 300 ARG C CB  1 
ATOM   5364 C CG  . ARG C 1 217 ? 17.550  -31.428 -69.554 1.00 57.12  ? 300 ARG C CG  1 
ATOM   5365 C CD  . ARG C 1 217 ? 16.489  -30.440 -69.082 1.00 59.82  ? 300 ARG C CD  1 
ATOM   5366 N NE  . ARG C 1 217 ? 16.203  -29.361 -70.024 1.00 64.88  ? 300 ARG C NE  1 
ATOM   5367 C CZ  . ARG C 1 217 ? 15.114  -28.587 -70.025 1.00 64.23  ? 300 ARG C CZ  1 
ATOM   5368 N NH1 . ARG C 1 217 ? 14.158  -28.740 -69.135 1.00 60.76  ? 300 ARG C NH1 1 
ATOM   5369 N NH2 . ARG C 1 217 ? 14.971  -27.656 -70.958 1.00 74.61  ? 300 ARG C NH2 1 
ATOM   5370 N N   . ILE C 1 218 ? 16.201  -35.303 -72.080 1.00 61.73  ? 301 ILE C N   1 
ATOM   5371 C CA  . ILE C 1 218 ? 15.976  -36.073 -73.272 1.00 61.65  ? 301 ILE C CA  1 
ATOM   5372 C C   . ILE C 1 218 ? 14.645  -35.708 -73.820 1.00 63.82  ? 301 ILE C C   1 
ATOM   5373 O O   . ILE C 1 218 ? 13.645  -35.782 -73.130 1.00 65.99  ? 301 ILE C O   1 
ATOM   5374 C CB  . ILE C 1 218 ? 15.944  -37.546 -72.943 1.00 59.08  ? 301 ILE C CB  1 
ATOM   5375 C CG1 . ILE C 1 218 ? 17.334  -37.956 -72.551 1.00 59.30  ? 301 ILE C CG1 1 
ATOM   5376 C CG2 . ILE C 1 218 ? 15.441  -38.380 -74.118 1.00 62.86  ? 301 ILE C CG2 1 
ATOM   5377 C CD1 . ILE C 1 218 ? 17.291  -39.065 -71.531 1.00 62.53  ? 301 ILE C CD1 1 
ATOM   5378 N N   . SER C 1 219 ? 14.636  -35.305 -75.080 1.00 71.44  ? 302 SER C N   1 
ATOM   5379 C CA  . SER C 1 219 ? 13.388  -35.110 -75.809 1.00 69.81  ? 302 SER C CA  1 
ATOM   5380 C C   . SER C 1 219 ? 12.931  -36.437 -76.416 1.00 67.57  ? 302 SER C C   1 
ATOM   5381 O O   . SER C 1 219 ? 13.761  -37.242 -76.865 1.00 66.14  ? 302 SER C O   1 
ATOM   5382 C CB  . SER C 1 219 ? 13.585  -34.057 -76.885 1.00 72.52  ? 302 SER C CB  1 
ATOM   5383 O OG  . SER C 1 219 ? 13.120  -34.558 -78.115 1.00 80.35  ? 302 SER C OG  1 
ATOM   5384 N N   . LEU C 1 220 ? 11.612  -36.649 -76.392 1.00 68.26  ? 303 LEU C N   1 
ATOM   5385 C CA  . LEU C 1 220 ? 10.946  -37.823 -76.968 1.00 70.82  ? 303 LEU C CA  1 
ATOM   5386 C C   . LEU C 1 220 ? 9.919   -37.454 -78.056 1.00 80.41  ? 303 LEU C C   1 
ATOM   5387 O O   . LEU C 1 220 ? 9.059   -36.591 -77.853 1.00 89.93  ? 303 LEU C O   1 
ATOM   5388 C CB  . LEU C 1 220 ? 10.264  -38.619 -75.872 1.00 64.80  ? 303 LEU C CB  1 
ATOM   5389 C CG  . LEU C 1 220 ? 11.171  -39.194 -74.765 1.00 64.55  ? 303 LEU C CG  1 
ATOM   5390 C CD1 . LEU C 1 220 ? 10.407  -40.068 -73.787 1.00 55.06  ? 303 LEU C CD1 1 
ATOM   5391 C CD2 . LEU C 1 220 ? 12.351  -39.952 -75.364 1.00 66.33  ? 303 LEU C CD2 1 
ATOM   5392 N N   . ARG C 1 221 ? 9.997   -38.090 -79.215 1.00 80.92  ? 304 ARG C N   1 
ATOM   5393 C CA  . ARG C 1 221 ? 8.934   -37.897 -80.189 1.00 83.10  ? 304 ARG C CA  1 
ATOM   5394 C C   . ARG C 1 221 ? 8.402   -39.212 -80.746 1.00 83.10  ? 304 ARG C C   1 
ATOM   5395 O O   . ARG C 1 221 ? 9.082   -40.251 -80.740 1.00 81.48  ? 304 ARG C O   1 
ATOM   5396 C CB  . ARG C 1 221 ? 9.348   -36.933 -81.292 1.00 82.76  ? 304 ARG C CB  1 
ATOM   5397 C CG  . ARG C 1 221 ? 10.566  -37.387 -82.041 1.00 87.41  ? 304 ARG C CG  1 
ATOM   5398 C CD  . ARG C 1 221 ? 11.088  -36.298 -82.953 1.00 91.16  ? 304 ARG C CD  1 
ATOM   5399 N NE  . ARG C 1 221 ? 11.721  -36.931 -84.110 1.00 100.63 ? 304 ARG C NE  1 
ATOM   5400 C CZ  . ARG C 1 221 ? 13.035  -37.064 -84.295 1.00 100.00 ? 304 ARG C CZ  1 
ATOM   5401 N NH1 . ARG C 1 221 ? 13.901  -36.574 -83.408 1.00 95.18  ? 304 ARG C NH1 1 
ATOM   5402 N NH2 . ARG C 1 221 ? 13.483  -37.681 -85.384 1.00 98.77  ? 304 ARG C NH2 1 
ATOM   5403 N N   . LYS C 1 222 ? 7.149   -39.143 -81.170 1.00 82.59  ? 305 LYS C N   1 
ATOM   5404 C CA  . LYS C 1 222 ? 6.486   -40.214 -81.884 1.00 86.48  ? 305 LYS C CA  1 
ATOM   5405 C C   . LYS C 1 222 ? 7.303   -40.577 -83.128 1.00 86.86  ? 305 LYS C C   1 
ATOM   5406 O O   . LYS C 1 222 ? 7.697   -39.709 -83.872 1.00 89.17  ? 305 LYS C O   1 
ATOM   5407 C CB  . LYS C 1 222 ? 5.097   -39.725 -82.321 1.00 88.44  ? 305 LYS C CB  1 
ATOM   5408 C CG  . LYS C 1 222 ? 3.971   -39.997 -81.347 1.00 88.68  ? 305 LYS C CG  1 
ATOM   5409 C CD  . LYS C 1 222 ? 3.229   -41.274 -81.724 1.00 98.76  ? 305 LYS C CD  1 
ATOM   5410 C CE  . LYS C 1 222 ? 4.070   -42.163 -82.656 1.00 103.03 ? 305 LYS C CE  1 
ATOM   5411 N NZ  . LYS C 1 222 ? 3.315   -43.213 -83.403 1.00 106.70 ? 305 LYS C NZ  1 
ATOM   5412 N N   . GLY C 1 223 ? 7.582   -41.858 -83.326 1.00 86.97  ? 306 GLY C N   1 
ATOM   5413 C CA  . GLY C 1 223 ? 8.212   -42.330 -84.547 1.00 89.61  ? 306 GLY C CA  1 
ATOM   5414 C C   . GLY C 1 223 ? 7.118   -42.868 -85.454 1.00 94.57  ? 306 GLY C C   1 
ATOM   5415 O O   . GLY C 1 223 ? 5.971   -42.445 -85.352 1.00 94.06  ? 306 GLY C O   1 
ATOM   5416 N N   . ARG C 1 224 ? 7.458   -43.805 -86.336 1.00 98.04  ? 307 ARG C N   1 
ATOM   5417 C CA  . ARG C 1 224 ? 6.435   -44.449 -87.153 1.00 103.61 ? 307 ARG C CA  1 
ATOM   5418 C C   . ARG C 1 224 ? 5.684   -45.576 -86.417 1.00 104.64 ? 307 ARG C C   1 
ATOM   5419 O O   . ARG C 1 224 ? 6.282   -46.569 -85.988 1.00 102.92 ? 307 ARG C O   1 
ATOM   5420 C CB  . ARG C 1 224 ? 6.990   -44.919 -88.501 1.00 105.25 ? 307 ARG C CB  1 
ATOM   5421 C CG  . ARG C 1 224 ? 5.931   -45.550 -89.380 1.00 105.81 ? 307 ARG C CG  1 
ATOM   5422 C CD  . ARG C 1 224 ? 5.955   -44.964 -90.774 1.00 110.52 ? 307 ARG C CD  1 
ATOM   5423 N NE  . ARG C 1 224 ? 5.028   -45.682 -91.655 1.00 115.12 ? 307 ARG C NE  1 
ATOM   5424 C CZ  . ARG C 1 224 ? 3.796   -45.271 -91.968 1.00 116.67 ? 307 ARG C CZ  1 
ATOM   5425 N NH1 . ARG C 1 224 ? 3.325   -44.124 -91.492 1.00 116.44 ? 307 ARG C NH1 1 
ATOM   5426 N NH2 . ARG C 1 224 ? 3.027   -46.006 -92.766 1.00 120.79 ? 307 ARG C NH2 1 
ATOM   5427 N N   . GLY C 1 225 ? 4.366   -45.412 -86.303 1.00 106.84 ? 308 GLY C N   1 
ATOM   5428 C CA  . GLY C 1 225 ? 3.528   -46.353 -85.581 1.00 107.74 ? 308 GLY C CA  1 
ATOM   5429 C C   . GLY C 1 225 ? 4.070   -46.604 -84.193 1.00 109.37 ? 308 GLY C C   1 
ATOM   5430 O O   . GLY C 1 225 ? 3.880   -45.798 -83.279 1.00 110.65 ? 308 GLY C O   1 
ATOM   5431 N N   . GLU C 1 226 ? 4.793   -47.703 -84.041 1.00 111.58 ? 309 GLU C N   1 
ATOM   5432 C CA  . GLU C 1 226 ? 5.192   -48.158 -82.712 1.00 109.49 ? 309 GLU C CA  1 
ATOM   5433 C C   . GLU C 1 226 ? 6.481   -47.548 -82.134 1.00 102.56 ? 309 GLU C C   1 
ATOM   5434 O O   . GLU C 1 226 ? 6.634   -47.429 -80.913 1.00 96.14  ? 309 GLU C O   1 
ATOM   5435 C CB  . GLU C 1 226 ? 5.324   -49.669 -82.756 1.00 121.14 ? 309 GLU C CB  1 
ATOM   5436 C CG  . GLU C 1 226 ? 5.335   -50.339 -81.396 1.00 125.98 ? 309 GLU C CG  1 
ATOM   5437 C CD  . GLU C 1 226 ? 5.756   -51.791 -81.504 1.00 135.75 ? 309 GLU C CD  1 
ATOM   5438 O OE1 . GLU C 1 226 ? 4.868   -52.674 -81.432 1.00 135.60 ? 309 GLU C OE1 1 
ATOM   5439 O OE2 . GLU C 1 226 ? 6.972   -52.042 -81.694 1.00 138.18 ? 309 GLU C OE2 1 
ATOM   5440 N N   . LEU C 1 227 ? 7.408   -47.182 -83.012 1.00 100.89 ? 310 LEU C N   1 
ATOM   5441 C CA  . LEU C 1 227 ? 8.752   -46.757 -82.608 1.00 95.59  ? 310 LEU C CA  1 
ATOM   5442 C C   . LEU C 1 227 ? 8.783   -45.328 -82.015 1.00 92.26  ? 310 LEU C C   1 
ATOM   5443 O O   . LEU C 1 227 ? 7.825   -44.564 -82.173 1.00 93.30  ? 310 LEU C O   1 
ATOM   5444 C CB  . LEU C 1 227 ? 9.732   -46.899 -83.776 1.00 99.34  ? 310 LEU C CB  1 
ATOM   5445 C CG  . LEU C 1 227 ? 9.803   -48.193 -84.599 1.00 104.97 ? 310 LEU C CG  1 
ATOM   5446 C CD1 . LEU C 1 227 ? 9.257   -48.057 -86.027 1.00 105.63 ? 310 LEU C CD1 1 
ATOM   5447 C CD2 . LEU C 1 227 ? 11.257  -48.603 -84.657 1.00 107.42 ? 310 LEU C CD2 1 
ATOM   5448 N N   . ARG C 1 228 ? 9.868   -44.984 -81.309 1.00 86.65  ? 311 ARG C N   1 
ATOM   5449 C CA  . ARG C 1 228 ? 9.983   -43.693 -80.619 1.00 78.54  ? 311 ARG C CA  1 
ATOM   5450 C C   . ARG C 1 228 ? 11.388  -43.126 -80.723 1.00 77.89  ? 311 ARG C C   1 
ATOM   5451 O O   . ARG C 1 228 ? 12.373  -43.881 -80.781 1.00 78.18  ? 311 ARG C O   1 
ATOM   5452 C CB  . ARG C 1 228 ? 9.625   -43.853 -79.153 1.00 77.38  ? 311 ARG C CB  1 
ATOM   5453 C CG  . ARG C 1 228 ? 8.221   -44.345 -78.852 1.00 73.72  ? 311 ARG C CG  1 
ATOM   5454 C CD  . ARG C 1 228 ? 7.246   -43.189 -78.763 1.00 74.59  ? 311 ARG C CD  1 
ATOM   5455 N NE  . ARG C 1 228 ? 5.924   -43.669 -78.386 1.00 75.25  ? 311 ARG C NE  1 
ATOM   5456 C CZ  . ARG C 1 228 ? 5.082   -44.277 -79.216 1.00 77.09  ? 311 ARG C CZ  1 
ATOM   5457 N NH1 . ARG C 1 228 ? 5.421   -44.469 -80.486 1.00 82.84  ? 311 ARG C NH1 1 
ATOM   5458 N NH2 . ARG C 1 228 ? 3.904   -44.694 -78.776 1.00 71.74  ? 311 ARG C NH2 1 
ATOM   5459 N N   . ILE C 1 229 ? 11.499  -41.801 -80.776 1.00 76.56  ? 312 ILE C N   1 
ATOM   5460 C CA  . ILE C 1 229 ? 12.827  -41.218 -80.901 1.00 79.49  ? 312 ILE C CA  1 
ATOM   5461 C C   . ILE C 1 229 ? 13.227  -40.450 -79.655 1.00 78.81  ? 312 ILE C C   1 
ATOM   5462 O O   . ILE C 1 229 ? 12.406  -39.739 -79.081 1.00 81.60  ? 312 ILE C O   1 
ATOM   5463 C CB  . ILE C 1 229 ? 12.960  -40.260 -82.092 1.00 84.15  ? 312 ILE C CB  1 
ATOM   5464 C CG1 . ILE C 1 229 ? 12.104  -40.703 -83.299 1.00 89.32  ? 312 ILE C CG1 1 
ATOM   5465 C CG2 . ILE C 1 229 ? 14.440  -40.080 -82.442 1.00 83.97  ? 312 ILE C CG2 1 
ATOM   5466 C CD1 . ILE C 1 229 ? 12.545  -41.985 -83.982 1.00 90.08  ? 312 ILE C CD1 1 
ATOM   5467 N N   . ALA C 1 230 ? 14.487  -40.598 -79.242 1.00 76.81  ? 313 ALA C N   1 
ATOM   5468 C CA  . ALA C 1 230 ? 15.052  -39.756 -78.200 1.00 73.16  ? 313 ALA C CA  1 
ATOM   5469 C C   . ALA C 1 230 ? 16.200  -38.939 -78.748 1.00 74.61  ? 313 ALA C C   1 
ATOM   5470 O O   . ALA C 1 230 ? 17.074  -39.469 -79.407 1.00 74.97  ? 313 ALA C O   1 
ATOM   5471 C CB  . ALA C 1 230 ? 15.522  -40.590 -77.041 1.00 67.44  ? 313 ALA C CB  1 
ATOM   5472 N N   . LYS C 1 231 ? 16.167  -37.638 -78.484 1.00 76.36  ? 314 LYS C N   1 
ATOM   5473 C CA  . LYS C 1 231 ? 17.315  -36.768 -78.686 1.00 77.56  ? 314 LYS C CA  1 
ATOM   5474 C C   . LYS C 1 231 ? 17.773  -36.283 -77.312 1.00 76.77  ? 314 LYS C C   1 
ATOM   5475 O O   . LYS C 1 231 ? 16.955  -36.146 -76.392 1.00 77.43  ? 314 LYS C O   1 
ATOM   5476 C CB  . LYS C 1 231 ? 16.954  -35.579 -79.575 1.00 80.70  ? 314 LYS C CB  1 
ATOM   5477 C CG  . LYS C 1 231 ? 18.148  -34.801 -80.121 1.00 84.17  ? 314 LYS C CG  1 
ATOM   5478 C CD  . LYS C 1 231 ? 17.833  -34.194 -81.492 1.00 91.77  ? 314 LYS C CD  1 
ATOM   5479 C CE  . LYS C 1 231 ? 19.044  -33.558 -82.176 1.00 92.44  ? 314 LYS C CE  1 
ATOM   5480 N NZ  . LYS C 1 231 ? 18.904  -33.577 -83.667 1.00 100.08 ? 314 LYS C NZ  1 
ATOM   5481 N N   . ILE C 1 232 ? 19.081  -36.087 -77.151 1.00 74.24  ? 315 ILE C N   1 
ATOM   5482 C CA  . ILE C 1 232 ? 19.559  -35.259 -76.079 1.00 72.29  ? 315 ILE C CA  1 
ATOM   5483 C C   . ILE C 1 232 ? 19.081  -33.869 -76.413 1.00 76.94  ? 315 ILE C C   1 
ATOM   5484 O O   . ILE C 1 232 ? 19.414  -33.324 -77.489 1.00 85.86  ? 315 ILE C O   1 
ATOM   5485 C CB  . ILE C 1 232 ? 21.084  -35.230 -75.981 1.00 72.39  ? 315 ILE C CB  1 
ATOM   5486 C CG1 . ILE C 1 232 ? 21.601  -36.359 -75.094 1.00 69.21  ? 315 ILE C CG1 1 
ATOM   5487 C CG2 . ILE C 1 232 ? 21.530  -33.947 -75.306 1.00 74.24  ? 315 ILE C CG2 1 
ATOM   5488 C CD1 . ILE C 1 232 ? 21.504  -37.716 -75.729 1.00 73.01  ? 315 ILE C CD1 1 
ATOM   5489 N N   . TYR C 1 233 ? 18.285  -33.297 -75.519 1.00 76.21  ? 316 TYR C N   1 
ATOM   5490 C CA  . TYR C 1 233 ? 17.781  -31.958 -75.759 1.00 84.94  ? 316 TYR C CA  1 
ATOM   5491 C C   . TYR C 1 233 ? 18.889  -30.951 -75.971 1.00 93.54  ? 316 TYR C C   1 
ATOM   5492 O O   . TYR C 1 233 ? 19.850  -30.852 -75.175 1.00 86.59  ? 316 TYR C O   1 
ATOM   5493 C CB  . TYR C 1 233 ? 16.903  -31.466 -74.636 1.00 85.22  ? 316 TYR C CB  1 
ATOM   5494 C CG  . TYR C 1 233 ? 16.350  -30.075 -74.883 1.00 85.22  ? 316 TYR C CG  1 
ATOM   5495 C CD1 . TYR C 1 233 ? 15.566  -29.803 -76.011 1.00 86.14  ? 316 TYR C CD1 1 
ATOM   5496 C CD2 . TYR C 1 233 ? 16.600  -29.040 -73.982 1.00 81.38  ? 316 TYR C CD2 1 
ATOM   5497 C CE1 . TYR C 1 233 ? 15.028  -28.548 -76.226 1.00 86.44  ? 316 TYR C CE1 1 
ATOM   5498 C CE2 . TYR C 1 233 ? 16.080  -27.778 -74.195 1.00 87.23  ? 316 TYR C CE2 1 
ATOM   5499 C CZ  . TYR C 1 233 ? 15.289  -27.535 -75.316 1.00 88.24  ? 316 TYR C CZ  1 
ATOM   5500 O OH  . TYR C 1 233 ? 14.755  -26.278 -75.514 1.00 92.80  ? 316 TYR C OH  1 
ATOM   5501 N N   . ASP C 1 234 ? 18.682  -30.191 -77.044 1.00 106.30 ? 317 ASP C N   1 
ATOM   5502 C CA  . ASP C 1 234 ? 19.619  -29.229 -77.611 1.00 111.82 ? 317 ASP C CA  1 
ATOM   5503 C C   . ASP C 1 234 ? 20.725  -29.939 -78.383 1.00 111.56 ? 317 ASP C C   1 
ATOM   5504 O O   . ASP C 1 234 ? 21.777  -30.258 -77.847 1.00 111.05 ? 317 ASP C O   1 
ATOM   5505 C CB  . ASP C 1 234 ? 20.153  -28.239 -76.563 1.00 110.77 ? 317 ASP C CB  1 
ATOM   5506 C CG  . ASP C 1 234 ? 19.959  -26.793 -76.982 1.00 114.35 ? 317 ASP C CG  1 
ATOM   5507 O OD1 . ASP C 1 234 ? 18.908  -26.479 -77.581 1.00 114.61 ? 317 ASP C OD1 1 
ATOM   5508 O OD2 . ASP C 1 234 ? 20.850  -25.966 -76.705 1.00 116.15 ? 317 ASP C OD2 1 
ATOM   5509 N N   . SER C 1 235 ? 20.410  -30.254 -79.634 1.00 120.05 ? 318 SER C N   1 
ATOM   5510 C CA  . SER C 1 235 ? 21.395  -30.467 -80.697 1.00 125.96 ? 318 SER C CA  1 
ATOM   5511 C C   . SER C 1 235 ? 22.557  -31.454 -80.412 1.00 122.91 ? 318 SER C C   1 
ATOM   5512 O O   . SER C 1 235 ? 22.503  -32.215 -79.422 1.00 112.44 ? 318 SER C O   1 
ATOM   5513 C CB  . SER C 1 235 ? 21.929  -29.094 -81.157 1.00 132.84 ? 318 SER C CB  1 
ATOM   5514 O OG  . SER C 1 235 ? 20.870  -28.217 -81.514 1.00 131.38 ? 318 SER C OG  1 
ATOM   5515 N N   . PRO C 1 236 ? 23.559  -31.501 -81.338 1.00 125.67 ? 319 PRO C N   1 
ATOM   5516 C CA  . PRO C 1 236 ? 23.410  -30.896 -82.673 1.00 126.60 ? 319 PRO C CA  1 
ATOM   5517 C C   . PRO C 1 236 ? 22.675  -31.877 -83.576 1.00 129.13 ? 319 PRO C C   1 
ATOM   5518 O O   . PRO C 1 236 ? 22.165  -32.882 -83.082 1.00 120.63 ? 319 PRO C O   1 
ATOM   5519 C CB  . PRO C 1 236 ? 24.852  -30.664 -83.131 1.00 123.53 ? 319 PRO C CB  1 
ATOM   5520 C CG  . PRO C 1 236 ? 25.672  -31.648 -82.373 1.00 121.79 ? 319 PRO C CG  1 
ATOM   5521 C CD  . PRO C 1 236 ? 24.893  -32.113 -81.167 1.00 122.90 ? 319 PRO C CD  1 
ATOM   5522 N N   . GLU C 1 237 ? 22.604  -31.594 -84.872 1.00 144.46 ? 320 GLU C N   1 
ATOM   5523 C CA  . GLU C 1 237 ? 21.894  -32.485 -85.803 1.00 154.61 ? 320 GLU C CA  1 
ATOM   5524 C C   . GLU C 1 237 ? 22.791  -33.650 -86.263 1.00 160.60 ? 320 GLU C C   1 
ATOM   5525 O O   . GLU C 1 237 ? 23.306  -33.668 -87.391 1.00 169.02 ? 320 GLU C O   1 
ATOM   5526 C CB  . GLU C 1 237 ? 21.268  -31.699 -86.979 1.00 157.50 ? 320 GLU C CB  1 
ATOM   5527 C CG  . GLU C 1 237 ? 20.345  -32.484 -87.920 1.00 155.85 ? 320 GLU C CG  1 
ATOM   5528 C CD  . GLU C 1 237 ? 19.539  -33.577 -87.228 1.00 153.47 ? 320 GLU C CD  1 
ATOM   5529 O OE1 . GLU C 1 237 ? 19.854  -34.763 -87.466 1.00 150.58 ? 320 GLU C OE1 1 
ATOM   5530 O OE2 . GLU C 1 237 ? 18.612  -33.264 -86.442 1.00 147.44 ? 320 GLU C OE2 1 
ATOM   5531 N N   . MET C 1 238 ? 22.964  -34.613 -85.357 1.00 153.66 ? 321 MET C N   1 
ATOM   5532 C CA  . MET C 1 238 ? 23.770  -35.811 -85.590 1.00 152.67 ? 321 MET C CA  1 
ATOM   5533 C C   . MET C 1 238 ? 23.143  -37.082 -84.980 1.00 150.00 ? 321 MET C C   1 
ATOM   5534 O O   . MET C 1 238 ? 22.543  -37.027 -83.891 1.00 142.57 ? 321 MET C O   1 
ATOM   5535 C CB  . MET C 1 238 ? 25.189  -35.610 -85.050 1.00 149.86 ? 321 MET C CB  1 
ATOM   5536 C CG  . MET C 1 238 ? 26.246  -35.475 -86.129 1.00 159.45 ? 321 MET C CG  1 
ATOM   5537 S SD  . MET C 1 238 ? 27.798  -36.257 -85.653 1.00 160.83 ? 321 MET C SD  1 
ATOM   5538 C CE  . MET C 1 238 ? 27.318  -37.982 -85.519 1.00 155.90 ? 321 MET C CE  1 
ATOM   5539 N N   . PRO C 1 239 ? 23.283  -38.234 -85.676 1.00 147.36 ? 322 PRO C N   1 
ATOM   5540 C CA  . PRO C 1 239 ? 22.790  -39.525 -85.171 1.00 139.41 ? 322 PRO C CA  1 
ATOM   5541 C C   . PRO C 1 239 ? 23.351  -39.935 -83.797 1.00 125.26 ? 322 PRO C C   1 
ATOM   5542 O O   . PRO C 1 239 ? 22.719  -40.726 -83.103 1.00 125.47 ? 322 PRO C O   1 
ATOM   5543 C CB  . PRO C 1 239 ? 23.229  -40.520 -86.258 1.00 143.96 ? 322 PRO C CB  1 
ATOM   5544 C CG  . PRO C 1 239 ? 24.305  -39.814 -87.021 1.00 147.77 ? 322 PRO C CG  1 
ATOM   5545 C CD  . PRO C 1 239 ? 23.879  -38.380 -87.015 1.00 148.44 ? 322 PRO C CD  1 
ATOM   5546 N N   . GLU C 1 240 ? 24.518  -39.402 -83.426 1.00 120.70 ? 323 GLU C N   1 
ATOM   5547 C CA  . GLU C 1 240 ? 25.118  -39.578 -82.087 1.00 116.02 ? 323 GLU C CA  1 
ATOM   5548 C C   . GLU C 1 240 ? 24.164  -39.179 -80.955 1.00 107.98 ? 323 GLU C C   1 
ATOM   5549 O O   . GLU C 1 240 ? 24.082  -39.867 -79.944 1.00 102.52 ? 323 GLU C O   1 
ATOM   5550 C CB  . GLU C 1 240 ? 26.461  -38.822 -81.952 1.00 117.56 ? 323 GLU C CB  1 
ATOM   5551 C CG  . GLU C 1 240 ? 26.345  -37.295 -81.912 1.00 123.25 ? 323 GLU C CG  1 
ATOM   5552 C CD  . GLU C 1 240 ? 27.669  -36.537 -82.028 1.00 126.47 ? 323 GLU C CD  1 
ATOM   5553 O OE1 . GLU C 1 240 ? 28.745  -37.173 -82.051 1.00 128.89 ? 323 GLU C OE1 1 
ATOM   5554 O OE2 . GLU C 1 240 ? 27.629  -35.284 -82.091 1.00 120.75 ? 323 GLU C OE2 1 
ATOM   5555 N N   . ASN C 1 241 ? 23.439  -38.080 -81.145 1.00 104.03 ? 324 ASN C N   1 
ATOM   5556 C CA  . ASN C 1 241 ? 22.480  -37.602 -80.157 1.00 102.96 ? 324 ASN C CA  1 
ATOM   5557 C C   . ASN C 1 241 ? 21.065  -38.130 -80.434 1.00 101.31 ? 324 ASN C C   1 
ATOM   5558 O O   . ASN C 1 241 ? 20.070  -37.490 -80.091 1.00 97.91  ? 324 ASN C O   1 
ATOM   5559 C CB  . ASN C 1 241 ? 22.505  -36.069 -80.081 1.00 106.86 ? 324 ASN C CB  1 
ATOM   5560 C CG  . ASN C 1 241 ? 23.876  -35.499 -80.400 1.00 111.77 ? 324 ASN C CG  1 
ATOM   5561 O OD1 . ASN C 1 241 ? 24.816  -35.653 -79.620 1.00 106.71 ? 324 ASN C OD1 1 
ATOM   5562 N ND2 . ASN C 1 241 ? 24.004  -34.863 -81.571 1.00 111.56 ? 324 ASN C ND2 1 
ATOM   5563 N N   . GLU C 1 242 ? 20.982  -39.307 -81.045 1.00 97.75  ? 325 GLU C N   1 
ATOM   5564 C CA  . GLU C 1 242 ? 19.694  -39.924 -81.272 1.00 97.67  ? 325 GLU C CA  1 
ATOM   5565 C C   . GLU C 1 242 ? 19.654  -41.423 -81.058 1.00 97.74  ? 325 GLU C C   1 
ATOM   5566 O O   . GLU C 1 242 ? 20.593  -42.144 -81.392 1.00 102.67 ? 325 GLU C O   1 
ATOM   5567 C CB  . GLU C 1 242 ? 19.159  -39.574 -82.652 1.00 103.27 ? 325 GLU C CB  1 
ATOM   5568 C CG  . GLU C 1 242 ? 18.228  -38.380 -82.620 1.00 102.39 ? 325 GLU C CG  1 
ATOM   5569 C CD  . GLU C 1 242 ? 17.568  -38.133 -83.953 1.00 104.71 ? 325 GLU C CD  1 
ATOM   5570 O OE1 . GLU C 1 242 ? 17.491  -39.087 -84.749 1.00 105.40 ? 325 GLU C OE1 1 
ATOM   5571 O OE2 . GLU C 1 242 ? 17.131  -36.990 -84.200 1.00 104.61 ? 325 GLU C OE2 1 
ATOM   5572 N N   . ALA C 1 243 ? 18.545  -41.872 -80.481 1.00 96.31  ? 326 ALA C N   1 
ATOM   5573 C CA  . ALA C 1 243 ? 18.261  -43.286 -80.326 1.00 93.70  ? 326 ALA C CA  1 
ATOM   5574 C C   . ALA C 1 243 ? 16.819  -43.603 -80.679 1.00 92.48  ? 326 ALA C C   1 
ATOM   5575 O O   . ALA C 1 243 ? 15.873  -42.850 -80.406 1.00 91.97  ? 326 ALA C O   1 
ATOM   5576 C CB  . ALA C 1 243 ? 18.583  -43.763 -78.928 1.00 88.21  ? 326 ALA C CB  1 
ATOM   5577 N N   . THR C 1 244 ? 16.671  -44.741 -81.312 1.00 87.23  ? 327 THR C N   1 
ATOM   5578 C CA  . THR C 1 244 ? 15.377  -45.188 -81.688 1.00 86.36  ? 327 THR C CA  1 
ATOM   5579 C C   . THR C 1 244 ? 15.076  -46.390 -80.832 1.00 83.34  ? 327 THR C C   1 
ATOM   5580 O O   . THR C 1 244 ? 15.907  -47.291 -80.710 1.00 84.11  ? 327 THR C O   1 
ATOM   5581 C CB  . THR C 1 244 ? 15.391  -45.546 -83.187 1.00 88.78  ? 327 THR C CB  1 
ATOM   5582 O OG1 . THR C 1 244 ? 15.656  -44.355 -83.922 1.00 86.74  ? 327 THR C OG1 1 
ATOM   5583 C CG2 . THR C 1 244 ? 14.063  -46.135 -83.643 1.00 87.35  ? 327 THR C CG2 1 
ATOM   5584 N N   . PHE C 1 245 ? 13.888  -46.393 -80.236 1.00 82.54  ? 328 PHE C N   1 
ATOM   5585 C CA  . PHE C 1 245 ? 13.446  -47.499 -79.374 1.00 82.81  ? 328 PHE C CA  1 
ATOM   5586 C C   . PHE C 1 245 ? 11.952  -47.808 -79.593 1.00 85.44  ? 328 PHE C C   1 
ATOM   5587 O O   . PHE C 1 245 ? 11.284  -47.096 -80.356 1.00 88.33  ? 328 PHE C O   1 
ATOM   5588 C CB  . PHE C 1 245 ? 13.735  -47.178 -77.899 1.00 75.24  ? 328 PHE C CB  1 
ATOM   5589 C CG  . PHE C 1 245 ? 12.906  -46.064 -77.363 1.00 72.17  ? 328 PHE C CG  1 
ATOM   5590 C CD1 . PHE C 1 245 ? 11.727  -46.333 -76.672 1.00 69.12  ? 328 PHE C CD1 1 
ATOM   5591 C CD2 . PHE C 1 245 ? 13.291  -44.738 -77.561 1.00 72.25  ? 328 PHE C CD2 1 
ATOM   5592 C CE1 . PHE C 1 245 ? 10.936  -45.299 -76.179 1.00 65.81  ? 328 PHE C CE1 1 
ATOM   5593 C CE2 . PHE C 1 245 ? 12.516  -43.697 -77.062 1.00 72.82  ? 328 PHE C CE2 1 
ATOM   5594 C CZ  . PHE C 1 245 ? 11.335  -43.981 -76.362 1.00 68.99  ? 328 PHE C CZ  1 
ATOM   5595 N N   . ALA C 1 246 ? 11.443  -48.852 -78.919 1.00 80.44  ? 329 ALA C N   1 
ATOM   5596 C CA  . ALA C 1 246 ? 10.062  -49.286 -79.075 1.00 77.69  ? 329 ALA C CA  1 
ATOM   5597 C C   . ALA C 1 246 ? 9.392   -49.607 -77.751 1.00 75.82  ? 329 ALA C C   1 
ATOM   5598 O O   . ALA C 1 246 ? 10.052  -49.949 -76.767 1.00 76.66  ? 329 ALA C O   1 
ATOM   5599 C CB  . ALA C 1 246 ? 9.980   -50.485 -80.010 1.00 81.80  ? 329 ALA C CB  1 
ATOM   5600 N N   . ILE C 1 247 ? 8.068   -49.476 -77.755 1.00 76.03  ? 330 ILE C N   1 
ATOM   5601 C CA  . ILE C 1 247 ? 7.181   -49.830 -76.661 1.00 76.28  ? 330 ILE C CA  1 
ATOM   5602 C C   . ILE C 1 247 ? 6.582   -51.249 -76.890 1.00 79.39  ? 330 ILE C C   1 
ATOM   5603 O O   . ILE C 1 247 ? 5.991   -51.511 -77.943 1.00 83.52  ? 330 ILE C O   1 
ATOM   5604 C CB  . ILE C 1 247 ? 6.095   -48.716 -76.463 1.00 78.46  ? 330 ILE C CB  1 
ATOM   5605 C CG1 . ILE C 1 247 ? 5.271   -48.456 -77.760 1.00 89.44  ? 330 ILE C CG1 1 
ATOM   5606 C CG2 . ILE C 1 247 ? 6.752   -47.397 -76.027 1.00 73.91  ? 330 ILE C CG2 1 
ATOM   5607 C CD1 . ILE C 1 247 ? 3.990   -49.283 -78.000 1.00 87.63  ? 330 ILE C CD1 1 
ATOM   5608 N N   . THR C 1 248 ? 6.775   -52.160 -75.929 1.00 76.17  ? 331 THR C N   1 
ATOM   5609 C CA  . THR C 1 248 ? 6.280   -53.552 -75.998 1.00 76.16  ? 331 THR C CA  1 
ATOM   5610 C C   . THR C 1 248 ? 5.498   -53.809 -74.750 1.00 74.14  ? 331 THR C C   1 
ATOM   5611 O O   . THR C 1 248 ? 5.646   -53.063 -73.778 1.00 71.70  ? 331 THR C O   1 
ATOM   5612 C CB  . THR C 1 248 ? 7.427   -54.564 -75.869 1.00 76.44  ? 331 THR C CB  1 
ATOM   5613 O OG1 . THR C 1 248 ? 8.603   -54.027 -76.475 1.00 76.45  ? 331 THR C OG1 1 
ATOM   5614 C CG2 . THR C 1 248 ? 7.044   -55.973 -76.454 1.00 77.05  ? 331 THR C CG2 1 
ATOM   5615 N N   . ALA C 1 249 ? 4.741   -54.901 -74.722 1.00 72.82  ? 332 ALA C N   1 
ATOM   5616 C CA  . ALA C 1 249 ? 4.156   -55.329 -73.460 1.00 71.22  ? 332 ALA C CA  1 
ATOM   5617 C C   . ALA C 1 249 ? 5.235   -55.441 -72.387 1.00 70.23  ? 332 ALA C C   1 
ATOM   5618 O O   . ALA C 1 249 ? 4.978   -55.160 -71.222 1.00 73.45  ? 332 ALA C O   1 
ATOM   5619 C CB  . ALA C 1 249 ? 3.439   -56.652 -73.614 1.00 76.21  ? 332 ALA C CB  1 
ATOM   5620 N N   . GLY C 1 250 ? 6.449   -55.820 -72.791 1.00 71.52  ? 333 GLY C N   1 
ATOM   5621 C CA  . GLY C 1 250 ? 7.601   -55.913 -71.886 1.00 65.86  ? 333 GLY C CA  1 
ATOM   5622 C C   . GLY C 1 250 ? 8.360   -54.614 -71.663 1.00 62.16  ? 333 GLY C C   1 
ATOM   5623 O O   . GLY C 1 250 ? 9.549   -54.637 -71.334 1.00 58.79  ? 333 GLY C O   1 
ATOM   5624 N N   . GLY C 1 251 ? 7.686   -53.479 -71.837 1.00 59.94  ? 334 GLY C N   1 
ATOM   5625 C CA  . GLY C 1 251 ? 8.313   -52.171 -71.581 1.00 63.19  ? 334 GLY C CA  1 
ATOM   5626 C C   . GLY C 1 251 ? 9.113   -51.535 -72.724 1.00 68.04  ? 334 GLY C C   1 
ATOM   5627 O O   . GLY C 1 251 ? 8.875   -51.823 -73.910 1.00 73.93  ? 334 GLY C O   1 
ATOM   5628 N N   . ILE C 1 252 ? 10.060  -50.663 -72.363 1.00 64.08  ? 335 ILE C N   1 
ATOM   5629 C CA  . ILE C 1 252 ? 10.912  -50.003 -73.340 1.00 63.07  ? 335 ILE C CA  1 
ATOM   5630 C C   . ILE C 1 252 ? 11.917  -51.031 -73.855 1.00 67.63  ? 335 ILE C C   1 
ATOM   5631 O O   . ILE C 1 252 ? 12.610  -51.668 -73.049 1.00 68.54  ? 335 ILE C O   1 
ATOM   5632 C CB  . ILE C 1 252 ? 11.715  -48.839 -72.720 1.00 58.32  ? 335 ILE C CB  1 
ATOM   5633 C CG1 . ILE C 1 252 ? 10.820  -47.693 -72.231 1.00 55.12  ? 335 ILE C CG1 1 
ATOM   5634 C CG2 . ILE C 1 252 ? 12.774  -48.333 -73.694 1.00 62.05  ? 335 ILE C CG2 1 
ATOM   5635 C CD1 . ILE C 1 252 ? 9.845   -47.116 -73.223 1.00 56.32  ? 335 ILE C CD1 1 
ATOM   5636 N N   . GLY C 1 253 ? 12.009  -51.181 -75.176 1.00 66.24  ? 336 GLY C N   1 
ATOM   5637 C CA  . GLY C 1 253 ? 13.020  -52.058 -75.771 1.00 70.40  ? 336 GLY C CA  1 
ATOM   5638 C C   . GLY C 1 253 ? 13.574  -51.651 -77.130 1.00 73.63  ? 336 GLY C C   1 
ATOM   5639 O O   . GLY C 1 253 ? 13.452  -50.499 -77.549 1.00 70.76  ? 336 GLY C O   1 
ATOM   5640 N N   . ASP C 1 254 ? 14.178  -52.601 -77.834 1.00 77.92  ? 337 ASP C N   1 
ATOM   5641 C CA  . ASP C 1 254 ? 14.776  -52.266 -79.124 1.00 84.63  ? 337 ASP C CA  1 
ATOM   5642 C C   . ASP C 1 254 ? 13.780  -52.407 -80.277 1.00 86.68  ? 337 ASP C C   1 
ATOM   5643 O O   . ASP C 1 254 ? 12.607  -52.675 -80.050 1.00 88.24  ? 337 ASP C O   1 
ATOM   5644 C CB  . ASP C 1 254 ? 16.065  -53.067 -79.330 1.00 90.75  ? 337 ASP C CB  1 
ATOM   5645 C CG  . ASP C 1 254 ? 17.073  -52.833 -78.208 1.00 93.29  ? 337 ASP C CG  1 
ATOM   5646 O OD1 . ASP C 1 254 ? 17.502  -51.663 -77.998 1.00 92.36  ? 337 ASP C OD1 1 
ATOM   5647 O OD2 . ASP C 1 254 ? 17.417  -53.826 -77.526 1.00 96.47  ? 337 ASP C OD2 1 
ATOM   5648 N N   . ALA C 1 255 ? 14.226  -52.191 -81.506 1.00 89.54  ? 338 ALA C N   1 
ATOM   5649 C CA  . ALA C 1 255 ? 13.402  -52.491 -82.663 1.00 91.62  ? 338 ALA C CA  1 
ATOM   5650 C C   . ALA C 1 255 ? 14.112  -53.541 -83.481 1.00 96.19  ? 338 ALA C C   1 
ATOM   5651 O O   . ALA C 1 255 ? 15.234  -53.912 -83.140 1.00 92.75  ? 338 ALA C O   1 
ATOM   5652 C CB  . ALA C 1 255 ? 13.179  -51.242 -83.477 1.00 93.20  ? 338 ALA C CB  1 
ATOM   5653 N N   . GLY D 1 1   ? 3.516   -41.912 -46.145 1.00 78.58  ? 84  GLY D N   1 
ATOM   5654 C CA  . GLY D 1 1   ? 2.437   -41.605 -47.204 1.00 84.40  ? 84  GLY D CA  1 
ATOM   5655 C C   . GLY D 1 1   ? 2.490   -42.597 -48.366 1.00 75.05  ? 84  GLY D C   1 
ATOM   5656 O O   . GLY D 1 1   ? 1.659   -42.631 -49.287 1.00 70.11  ? 84  GLY D O   1 
ATOM   5657 N N   . PHE D 1 2   ? 3.498   -43.439 -48.265 1.00 69.01  ? 85  PHE D N   1 
ATOM   5658 C CA  . PHE D 1 2   ? 3.820   -44.378 -49.262 1.00 59.34  ? 85  PHE D CA  1 
ATOM   5659 C C   . PHE D 1 2   ? 3.264   -45.681 -48.821 1.00 57.87  ? 85  PHE D C   1 
ATOM   5660 O O   . PHE D 1 2   ? 3.188   -45.978 -47.628 1.00 59.11  ? 85  PHE D O   1 
ATOM   5661 C CB  . PHE D 1 2   ? 5.323   -44.477 -49.332 1.00 53.36  ? 85  PHE D CB  1 
ATOM   5662 C CG  . PHE D 1 2   ? 5.952   -43.270 -49.915 1.00 54.21  ? 85  PHE D CG  1 
ATOM   5663 C CD1 . PHE D 1 2   ? 6.147   -42.132 -49.145 1.00 55.57  ? 85  PHE D CD1 1 
ATOM   5664 C CD2 . PHE D 1 2   ? 6.329   -43.246 -51.253 1.00 53.00  ? 85  PHE D CD2 1 
ATOM   5665 C CE1 . PHE D 1 2   ? 6.714   -40.996 -49.680 1.00 54.17  ? 85  PHE D CE1 1 
ATOM   5666 C CE2 . PHE D 1 2   ? 6.901   -42.109 -51.790 1.00 53.22  ? 85  PHE D CE2 1 
ATOM   5667 C CZ  . PHE D 1 2   ? 7.097   -40.984 -51.002 1.00 53.36  ? 85  PHE D CZ  1 
ATOM   5668 N N   . LEU D 1 3   ? 2.889   -46.461 -49.810 1.00 51.93  ? 86  LEU D N   1 
ATOM   5669 C CA  . LEU D 1 3   ? 2.694   -47.854 -49.616 1.00 49.21  ? 86  LEU D CA  1 
ATOM   5670 C C   . LEU D 1 3   ? 3.587   -48.484 -50.669 1.00 51.00  ? 86  LEU D C   1 
ATOM   5671 O O   . LEU D 1 3   ? 4.068   -47.786 -51.584 1.00 56.08  ? 86  LEU D O   1 
ATOM   5672 C CB  . LEU D 1 3   ? 1.198   -48.212 -49.720 1.00 47.53  ? 86  LEU D CB  1 
ATOM   5673 C CG  . LEU D 1 3   ? 0.344   -47.920 -50.959 1.00 48.59  ? 86  LEU D CG  1 
ATOM   5674 C CD1 . LEU D 1 3   ? -1.120  -48.312 -50.731 1.00 45.65  ? 86  LEU D CD1 1 
ATOM   5675 C CD2 . LEU D 1 3   ? 0.436   -46.500 -51.511 1.00 47.11  ? 86  LEU D CD2 1 
ATOM   5676 N N   . THR D 1 4   ? 3.873   -49.774 -50.531 1.00 48.68  ? 87  THR D N   1 
ATOM   5677 C CA  . THR D 1 4   ? 4.605   -50.453 -51.566 1.00 46.61  ? 87  THR D CA  1 
ATOM   5678 C C   . THR D 1 4   ? 3.656   -50.692 -52.720 1.00 46.96  ? 87  THR D C   1 
ATOM   5679 O O   . THR D 1 4   ? 2.429   -50.586 -52.563 1.00 47.86  ? 87  THR D O   1 
ATOM   5680 C CB  . THR D 1 4   ? 5.063   -51.838 -51.144 1.00 46.33  ? 87  THR D CB  1 
ATOM   5681 O OG1 . THR D 1 4   ? 3.922   -52.688 -51.122 1.00 45.05  ? 87  THR D OG1 1 
ATOM   5682 C CG2 . THR D 1 4   ? 5.799   -51.820 -49.801 1.00 46.66  ? 87  THR D CG2 1 
ATOM   5683 N N   . ALA D 1 5   ? 4.228   -51.027 -53.876 1.00 46.57  ? 88  ALA D N   1 
ATOM   5684 C CA  . ALA D 1 5   ? 3.483   -51.167 -55.105 1.00 46.12  ? 88  ALA D CA  1 
ATOM   5685 C C   . ALA D 1 5   ? 2.681   -52.482 -55.041 1.00 48.77  ? 88  ALA D C   1 
ATOM   5686 O O   . ALA D 1 5   ? 1.599   -52.611 -55.665 1.00 49.31  ? 88  ALA D O   1 
ATOM   5687 C CB  . ALA D 1 5   ? 4.434   -51.133 -56.294 1.00 46.54  ? 88  ALA D CB  1 
ATOM   5688 N N   . PHE D 1 6   ? 3.189   -53.433 -54.252 1.00 46.66  ? 89  PHE D N   1 
ATOM   5689 C CA  . PHE D 1 6   ? 2.423   -54.612 -53.919 1.00 46.12  ? 89  PHE D CA  1 
ATOM   5690 C C   . PHE D 1 6   ? 1.138   -54.188 -53.212 1.00 44.88  ? 89  PHE D C   1 
ATOM   5691 O O   . PHE D 1 6   ? 0.038   -54.615 -53.616 1.00 45.01  ? 89  PHE D O   1 
ATOM   5692 C CB  . PHE D 1 6   ? 3.230   -55.601 -53.061 1.00 47.57  ? 89  PHE D CB  1 
ATOM   5693 C CG  . PHE D 1 6   ? 2.450   -56.829 -52.678 1.00 48.44  ? 89  PHE D CG  1 
ATOM   5694 C CD1 . PHE D 1 6   ? 2.614   -58.024 -53.385 1.00 52.13  ? 89  PHE D CD1 1 
ATOM   5695 C CD2 . PHE D 1 6   ? 1.532   -56.794 -51.635 1.00 46.68  ? 89  PHE D CD2 1 
ATOM   5696 C CE1 . PHE D 1 6   ? 1.879   -59.163 -53.030 1.00 55.26  ? 89  PHE D CE1 1 
ATOM   5697 C CE2 . PHE D 1 6   ? 0.802   -57.913 -51.278 1.00 48.71  ? 89  PHE D CE2 1 
ATOM   5698 C CZ  . PHE D 1 6   ? 0.969   -59.097 -51.972 1.00 52.05  ? 89  PHE D CZ  1 
ATOM   5699 N N   . GLU D 1 7   ? 1.255   -53.360 -52.174 1.00 43.14  ? 90  GLU D N   1 
ATOM   5700 C CA  . GLU D 1 7   ? 0.055   -52.950 -51.443 1.00 45.76  ? 90  GLU D CA  1 
ATOM   5701 C C   . GLU D 1 7   ? -0.849  -52.058 -52.295 1.00 44.04  ? 90  GLU D C   1 
ATOM   5702 O O   . GLU D 1 7   ? -2.083  -52.043 -52.157 1.00 42.76  ? 90  GLU D O   1 
ATOM   5703 C CB  . GLU D 1 7   ? 0.400   -52.237 -50.167 1.00 48.77  ? 90  GLU D CB  1 
ATOM   5704 C CG  . GLU D 1 7   ? 1.274   -53.043 -49.267 1.00 54.91  ? 90  GLU D CG  1 
ATOM   5705 C CD  . GLU D 1 7   ? 1.843   -52.189 -48.163 1.00 63.00  ? 90  GLU D CD  1 
ATOM   5706 O OE1 . GLU D 1 7   ? 1.333   -52.397 -47.047 1.00 77.43  ? 90  GLU D OE1 1 
ATOM   5707 O OE2 . GLU D 1 7   ? 2.756   -51.321 -48.386 1.00 58.52  ? 90  GLU D OE2 1 
ATOM   5708 N N   . TYR D 1 8   ? -0.229  -51.331 -53.205 1.00 44.25  ? 91  TYR D N   1 
ATOM   5709 C CA  . TYR D 1 8   ? -1.005  -50.540 -54.132 1.00 44.91  ? 91  TYR D CA  1 
ATOM   5710 C C   . TYR D 1 8   ? -1.752  -51.430 -55.130 1.00 45.71  ? 91  TYR D C   1 
ATOM   5711 O O   . TYR D 1 8   ? -2.908  -51.173 -55.461 1.00 45.59  ? 91  TYR D O   1 
ATOM   5712 C CB  . TYR D 1 8   ? -0.131  -49.500 -54.830 1.00 42.60  ? 91  TYR D CB  1 
ATOM   5713 C CG  . TYR D 1 8   ? -0.933  -48.558 -55.624 1.00 38.44  ? 91  TYR D CG  1 
ATOM   5714 C CD1 . TYR D 1 8   ? -2.043  -47.936 -55.055 1.00 40.04  ? 91  TYR D CD1 1 
ATOM   5715 C CD2 . TYR D 1 8   ? -0.623  -48.304 -56.959 1.00 39.08  ? 91  TYR D CD2 1 
ATOM   5716 C CE1 . TYR D 1 8   ? -2.830  -47.049 -55.789 1.00 38.14  ? 91  TYR D CE1 1 
ATOM   5717 C CE2 . TYR D 1 8   ? -1.376  -47.427 -57.716 1.00 38.10  ? 91  TYR D CE2 1 
ATOM   5718 C CZ  . TYR D 1 8   ? -2.467  -46.795 -57.107 1.00 39.42  ? 91  TYR D CZ  1 
ATOM   5719 O OH  . TYR D 1 8   ? -3.235  -45.932 -57.806 1.00 44.25  ? 91  TYR D OH  1 
ATOM   5720 N N   . SER D 1 9   ? -1.100  -52.491 -55.596 1.00 45.92  ? 92  SER D N   1 
ATOM   5721 C CA  . SER D 1 9   ? -1.767  -53.428 -56.440 1.00 44.23  ? 92  SER D CA  1 
ATOM   5722 C C   . SER D 1 9   ? -2.941  -54.030 -55.687 1.00 47.64  ? 92  SER D C   1 
ATOM   5723 O O   . SER D 1 9   ? -3.963  -54.303 -56.285 1.00 53.50  ? 92  SER D O   1 
ATOM   5724 C CB  . SER D 1 9   ? -0.786  -54.486 -56.871 1.00 46.38  ? 92  SER D CB  1 
ATOM   5725 O OG  . SER D 1 9   ? -1.451  -55.672 -57.227 1.00 53.24  ? 92  SER D OG  1 
ATOM   5726 N N   . GLU D 1 10  ? -2.822  -54.253 -54.375 1.00 49.81  ? 93  GLU D N   1 
ATOM   5727 C CA  . GLU D 1 10  ? -3.943  -54.820 -53.615 1.00 50.41  ? 93  GLU D CA  1 
ATOM   5728 C C   . GLU D 1 10  ? -5.088  -53.827 -53.628 1.00 51.00  ? 93  GLU D C   1 
ATOM   5729 O O   . GLU D 1 10  ? -6.226  -54.164 -53.880 1.00 50.83  ? 93  GLU D O   1 
ATOM   5730 C CB  . GLU D 1 10  ? -3.541  -55.127 -52.179 1.00 54.63  ? 93  GLU D CB  1 
ATOM   5731 C CG  . GLU D 1 10  ? -2.567  -56.285 -52.030 1.00 66.09  ? 93  GLU D CG  1 
ATOM   5732 C CD  . GLU D 1 10  ? -3.169  -57.629 -52.446 1.00 74.98  ? 93  GLU D CD  1 
ATOM   5733 O OE1 . GLU D 1 10  ? -3.866  -58.279 -51.608 1.00 79.20  ? 93  GLU D OE1 1 
ATOM   5734 O OE2 . GLU D 1 10  ? -2.947  -58.034 -53.623 1.00 79.22  ? 93  GLU D OE2 1 
ATOM   5735 N N   . LYS D 1 11  ? -4.770  -52.569 -53.398 1.00 51.55  ? 94  LYS D N   1 
ATOM   5736 C CA  . LYS D 1 11  ? -5.776  -51.537 -53.460 1.00 53.40  ? 94  LYS D CA  1 
ATOM   5737 C C   . LYS D 1 11  ? -6.505  -51.497 -54.827 1.00 54.77  ? 94  LYS D C   1 
ATOM   5738 O O   . LYS D 1 11  ? -7.729  -51.394 -54.850 1.00 61.40  ? 94  LYS D O   1 
ATOM   5739 C CB  . LYS D 1 11  ? -5.145  -50.194 -53.101 1.00 49.22  ? 94  LYS D CB  1 
ATOM   5740 C CG  . LYS D 1 11  ? -6.119  -49.139 -52.698 1.00 50.71  ? 94  LYS D CG  1 
ATOM   5741 C CD  . LYS D 1 11  ? -5.354  -47.853 -52.418 1.00 57.15  ? 94  LYS D CD  1 
ATOM   5742 C CE  . LYS D 1 11  ? -6.265  -46.663 -52.139 1.00 56.75  ? 94  LYS D CE  1 
ATOM   5743 N NZ  . LYS D 1 11  ? -5.495  -45.733 -51.280 1.00 65.70  ? 94  LYS D NZ  1 
ATOM   5744 N N   . ARG D 1 12  ? -5.783  -51.612 -55.944 1.00 50.55  ? 95  ARG D N   1 
ATOM   5745 C CA  . ARG D 1 12  ? -6.415  -51.480 -57.262 1.00 51.87  ? 95  ARG D CA  1 
ATOM   5746 C C   . ARG D 1 12  ? -7.151  -52.728 -57.736 1.00 60.16  ? 95  ARG D C   1 
ATOM   5747 O O   . ARG D 1 12  ? -7.737  -52.693 -58.827 1.00 60.70  ? 95  ARG D O   1 
ATOM   5748 C CB  . ARG D 1 12  ? -5.387  -51.243 -58.329 1.00 51.61  ? 95  ARG D CB  1 
ATOM   5749 C CG  . ARG D 1 12  ? -4.760  -49.886 -58.307 1.00 50.65  ? 95  ARG D CG  1 
ATOM   5750 C CD  . ARG D 1 12  ? -4.338  -49.517 -59.701 1.00 47.85  ? 95  ARG D CD  1 
ATOM   5751 N NE  . ARG D 1 12  ? -4.751  -48.146 -59.829 1.00 53.77  ? 95  ARG D NE  1 
ATOM   5752 C CZ  . ARG D 1 12  ? -5.723  -47.692 -60.610 1.00 49.35  ? 95  ARG D CZ  1 
ATOM   5753 N NH1 . ARG D 1 12  ? -6.392  -48.487 -61.416 1.00 48.34  ? 95  ARG D NH1 1 
ATOM   5754 N NH2 . ARG D 1 12  ? -5.971  -46.395 -60.606 1.00 48.44  ? 95  ARG D NH2 1 
ATOM   5755 N N   . LYS D 1 13  ? -7.049  -53.843 -56.996 1.00 60.41  ? 96  LYS D N   1 
ATOM   5756 C CA  . LYS D 1 13  ? -7.806  -55.048 -57.325 1.00 61.51  ? 96  LYS D CA  1 
ATOM   5757 C C   . LYS D 1 13  ? -9.259  -54.615 -57.389 1.00 58.58  ? 96  LYS D C   1 
ATOM   5758 O O   . LYS D 1 13  ? -10.013 -55.066 -58.228 1.00 59.31  ? 96  LYS D O   1 
ATOM   5759 C CB  . LYS D 1 13  ? -7.690  -56.149 -56.241 1.00 66.20  ? 96  LYS D CB  1 
ATOM   5760 C CG  . LYS D 1 13  ? -6.311  -56.739 -55.984 1.00 71.23  ? 96  LYS D CG  1 
ATOM   5761 C CD  . LYS D 1 13  ? -5.877  -57.806 -56.969 1.00 74.21  ? 96  LYS D CD  1 
ATOM   5762 C CE  . LYS D 1 13  ? -4.346  -57.892 -57.022 1.00 78.90  ? 96  LYS D CE  1 
ATOM   5763 N NZ  . LYS D 1 13  ? -3.854  -59.234 -57.464 1.00 83.81  ? 96  LYS D NZ  1 
ATOM   5764 N N   . MET D 1 14  ? -9.632  -53.696 -56.512 1.00 58.03  ? 97  MET D N   1 
ATOM   5765 C CA  . MET D 1 14  ? -11.022 -53.371 -56.286 1.00 54.78  ? 97  MET D CA  1 
ATOM   5766 C C   . MET D 1 14  ? -11.544 -52.323 -57.219 1.00 49.48  ? 97  MET D C   1 
ATOM   5767 O O   . MET D 1 14  ? -12.689 -51.945 -57.123 1.00 56.26  ? 97  MET D O   1 
ATOM   5768 C CB  . MET D 1 14  ? -11.204 -52.915 -54.860 1.00 58.72  ? 97  MET D CB  1 
ATOM   5769 C CG  . MET D 1 14  ? -10.557 -53.881 -53.884 1.00 66.16  ? 97  MET D CG  1 
ATOM   5770 S SD  . MET D 1 14  ? -10.730 -53.339 -52.179 1.00 85.10  ? 97  MET D SD  1 
ATOM   5771 C CE  . MET D 1 14  ? -10.541 -51.535 -52.221 1.00 74.54  ? 97  MET D CE  1 
ATOM   5772 N N   . VAL D 1 15  ? -10.718 -51.876 -58.140 1.00 47.51  ? 98  VAL D N   1 
ATOM   5773 C CA  . VAL D 1 15  ? -11.132 -50.922 -59.155 1.00 47.56  ? 98  VAL D CA  1 
ATOM   5774 C C   . VAL D 1 15  ? -12.202 -51.530 -60.002 1.00 48.36  ? 98  VAL D C   1 
ATOM   5775 O O   . VAL D 1 15  ? -12.018 -52.588 -60.533 1.00 53.08  ? 98  VAL D O   1 
ATOM   5776 C CB  . VAL D 1 15  ? -9.927  -50.475 -60.007 1.00 45.08  ? 98  VAL D CB  1 
ATOM   5777 C CG1 . VAL D 1 15  ? -10.342 -49.858 -61.333 1.00 46.55  ? 98  VAL D CG1 1 
ATOM   5778 C CG2 . VAL D 1 15  ? -9.162  -49.460 -59.206 1.00 46.57  ? 98  VAL D CG2 1 
ATOM   5779 N N   . PHE D 1 16  ? -13.322 -50.842 -60.134 1.00 51.61  ? 99  PHE D N   1 
ATOM   5780 C CA  . PHE D 1 16  ? -14.434 -51.320 -60.953 1.00 50.34  ? 99  PHE D CA  1 
ATOM   5781 C C   . PHE D 1 16  ? -14.861 -50.289 -61.969 1.00 50.33  ? 99  PHE D C   1 
ATOM   5782 O O   . PHE D 1 16  ? -14.445 -49.127 -61.891 1.00 46.16  ? 99  PHE D O   1 
ATOM   5783 C CB  . PHE D 1 16  ? -15.627 -51.588 -60.067 1.00 49.97  ? 99  PHE D CB  1 
ATOM   5784 C CG  . PHE D 1 16  ? -16.018 -50.427 -59.242 1.00 45.64  ? 99  PHE D CG  1 
ATOM   5785 C CD1 . PHE D 1 16  ? -16.790 -49.392 -59.785 1.00 45.71  ? 99  PHE D CD1 1 
ATOM   5786 C CD2 . PHE D 1 16  ? -15.625 -50.357 -57.896 1.00 43.58  ? 99  PHE D CD2 1 
ATOM   5787 C CE1 . PHE D 1 16  ? -17.158 -48.287 -58.989 1.00 43.05  ? 99  PHE D CE1 1 
ATOM   5788 C CE2 . PHE D 1 16  ? -16.011 -49.275 -57.104 1.00 42.06  ? 99  PHE D CE2 1 
ATOM   5789 C CZ  . PHE D 1 16  ? -16.755 -48.230 -57.653 1.00 40.15  ? 99  PHE D CZ  1 
ATOM   5790 N N   . HIS D 1 17  ? -15.722 -50.729 -62.895 1.00 52.78  ? 100 HIS D N   1 
ATOM   5791 C CA  . HIS D 1 17  ? -16.201 -49.898 -63.981 1.00 53.41  ? 100 HIS D CA  1 
ATOM   5792 C C   . HIS D 1 17  ? -17.691 -49.896 -63.987 1.00 55.58  ? 100 HIS D C   1 
ATOM   5793 O O   . HIS D 1 17  ? -18.314 -50.950 -63.803 1.00 59.42  ? 100 HIS D O   1 
ATOM   5794 C CB  . HIS D 1 17  ? -15.747 -50.459 -65.303 1.00 56.81  ? 100 HIS D CB  1 
ATOM   5795 C CG  . HIS D 1 17  ? -14.271 -50.326 -65.555 1.00 61.47  ? 100 HIS D CG  1 
ATOM   5796 N ND1 . HIS D 1 17  ? -13.725 -49.221 -66.129 1.00 64.89  ? 100 HIS D ND1 1 
ATOM   5797 C CD2 . HIS D 1 17  ? -13.216 -51.220 -65.338 1.00 58.17  ? 100 HIS D CD2 1 
ATOM   5798 C CE1 . HIS D 1 17  ? -12.382 -49.405 -66.267 1.00 59.21  ? 100 HIS D CE1 1 
ATOM   5799 N NE2 . HIS D 1 17  ? -12.082 -50.626 -65.790 1.00 57.63  ? 100 HIS D NE2 1 
ATOM   5800 N N   . ILE D 1 18  ? -18.281 -48.724 -64.227 1.00 53.39  ? 101 ILE D N   1 
ATOM   5801 C CA  . ILE D 1 18  ? -19.726 -48.597 -64.327 1.00 53.32  ? 101 ILE D CA  1 
ATOM   5802 C C   . ILE D 1 18  ? -20.122 -48.348 -65.783 1.00 55.72  ? 101 ILE D C   1 
ATOM   5803 O O   . ILE D 1 18  ? -19.727 -47.332 -66.359 1.00 55.28  ? 101 ILE D O   1 
ATOM   5804 C CB  . ILE D 1 18  ? -20.264 -47.454 -63.424 1.00 51.30  ? 101 ILE D CB  1 
ATOM   5805 C CG1 . ILE D 1 18  ? -19.775 -47.623 -61.980 1.00 46.74  ? 101 ILE D CG1 1 
ATOM   5806 C CG2 . ILE D 1 18  ? -21.792 -47.400 -63.499 1.00 51.48  ? 101 ILE D CG2 1 
ATOM   5807 C CD1 . ILE D 1 18  ? -20.008 -46.423 -61.090 1.00 45.56  ? 101 ILE D CD1 1 
ATOM   5808 N N   . THR D 1 19  ? -20.902 -49.279 -66.351 1.00 56.49  ? 102 THR D N   1 
ATOM   5809 C CA  . THR D 1 19  ? -21.397 -49.191 -67.712 1.00 59.76  ? 102 THR D CA  1 
ATOM   5810 C C   . THR D 1 19  ? -22.126 -47.877 -68.016 1.00 63.68  ? 102 THR D C   1 
ATOM   5811 O O   . THR D 1 19  ? -22.873 -47.339 -67.179 1.00 63.53  ? 102 THR D O   1 
ATOM   5812 C CB  . THR D 1 19  ? -22.326 -50.391 -68.066 1.00 64.98  ? 102 THR D CB  1 
ATOM   5813 O OG1 . THR D 1 19  ? -22.848 -50.255 -69.411 1.00 65.36  ? 102 THR D OG1 1 
ATOM   5814 C CG2 . THR D 1 19  ? -23.480 -50.553 -67.043 1.00 60.83  ? 102 THR D CG2 1 
ATOM   5815 N N   . THR D 1 20  ? -21.913 -47.359 -69.222 1.00 64.82  ? 103 THR D N   1 
ATOM   5816 C CA  . THR D 1 20  ? -22.570 -46.135 -69.602 1.00 61.87  ? 103 THR D CA  1 
ATOM   5817 C C   . THR D 1 20  ? -23.939 -46.490 -70.061 1.00 63.78  ? 103 THR D C   1 
ATOM   5818 O O   . THR D 1 20  ? -24.751 -45.614 -70.243 1.00 63.76  ? 103 THR D O   1 
ATOM   5819 C CB  . THR D 1 20  ? -21.915 -45.471 -70.807 1.00 65.54  ? 103 THR D CB  1 
ATOM   5820 O OG1 . THR D 1 20  ? -21.763 -46.449 -71.845 1.00 69.96  ? 103 THR D OG1 1 
ATOM   5821 C CG2 . THR D 1 20  ? -20.571 -44.911 -70.439 1.00 65.83  ? 103 THR D CG2 1 
ATOM   5822 N N   . GLY D 1 21  ? -24.191 -47.769 -70.281 1.00 65.96  ? 104 GLY D N   1 
ATOM   5823 C CA  . GLY D 1 21  ? -25.397 -48.172 -70.974 1.00 69.55  ? 104 GLY D CA  1 
ATOM   5824 C C   . GLY D 1 21  ? -25.221 -48.278 -72.481 1.00 74.98  ? 104 GLY D C   1 
ATOM   5825 O O   . GLY D 1 21  ? -26.181 -48.596 -73.200 1.00 79.60  ? 104 GLY D O   1 
ATOM   5826 N N   . SER D 1 22  ? -24.004 -48.019 -72.963 1.00 74.51  ? 105 SER D N   1 
ATOM   5827 C CA  . SER D 1 22  ? -23.653 -48.258 -74.361 1.00 78.80  ? 105 SER D CA  1 
ATOM   5828 C C   . SER D 1 22  ? -22.427 -49.151 -74.485 1.00 81.10  ? 105 SER D C   1 
ATOM   5829 O O   . SER D 1 22  ? -21.342 -48.833 -73.968 1.00 73.73  ? 105 SER D O   1 
ATOM   5830 C CB  . SER D 1 22  ? -23.420 -46.939 -75.110 1.00 79.58  ? 105 SER D CB  1 
ATOM   5831 O OG  . SER D 1 22  ? -22.585 -47.123 -76.243 1.00 83.52  ? 105 SER D OG  1 
ATOM   5832 N N   . GLN D 1 23  ? -22.584 -50.255 -75.216 1.00 87.28  ? 106 GLN D N   1 
ATOM   5833 C CA  . GLN D 1 23  ? -21.464 -51.171 -75.397 1.00 88.32  ? 106 GLN D CA  1 
ATOM   5834 C C   . GLN D 1 23  ? -20.308 -50.483 -76.111 1.00 86.67  ? 106 GLN D C   1 
ATOM   5835 O O   . GLN D 1 23  ? -19.149 -50.792 -75.844 1.00 82.65  ? 106 GLN D O   1 
ATOM   5836 C CB  . GLN D 1 23  ? -21.881 -52.393 -76.182 1.00 95.53  ? 106 GLN D CB  1 
ATOM   5837 C CG  . GLN D 1 23  ? -22.254 -53.625 -75.383 1.00 97.68  ? 106 GLN D CG  1 
ATOM   5838 C CD  . GLN D 1 23  ? -22.892 -54.654 -76.308 1.00 108.10 ? 106 GLN D CD  1 
ATOM   5839 O OE1 . GLN D 1 23  ? -22.269 -55.124 -77.276 1.00 109.70 ? 106 GLN D OE1 1 
ATOM   5840 N NE2 . GLN D 1 23  ? -24.161 -54.975 -76.048 1.00 110.97 ? 106 GLN D NE2 1 
ATOM   5841 N N   . GLU D 1 24  ? -20.629 -49.553 -77.011 1.00 87.92  ? 107 GLU D N   1 
ATOM   5842 C CA  . GLU D 1 24  ? -19.598 -48.798 -77.705 1.00 90.50  ? 107 GLU D CA  1 
ATOM   5843 C C   . GLU D 1 24  ? -18.938 -47.819 -76.762 1.00 86.80  ? 107 GLU D C   1 
ATOM   5844 O O   . GLU D 1 24  ? -17.722 -47.746 -76.693 1.00 90.95  ? 107 GLU D O   1 
ATOM   5845 C CB  . GLU D 1 24  ? -20.145 -48.082 -78.939 1.00 99.44  ? 107 GLU D CB  1 
ATOM   5846 C CG  . GLU D 1 24  ? -20.264 -48.963 -80.197 1.00 108.93 ? 107 GLU D CG  1 
ATOM   5847 C CD  . GLU D 1 24  ? -18.914 -49.381 -80.790 1.00 113.52 ? 107 GLU D CD  1 
ATOM   5848 O OE1 . GLU D 1 24  ? -18.678 -50.600 -80.987 1.00 113.60 ? 107 GLU D OE1 1 
ATOM   5849 O OE2 . GLU D 1 24  ? -18.078 -48.489 -81.054 1.00 116.45 ? 107 GLU D OE2 1 
ATOM   5850 N N   . PHE D 1 25  ? -19.724 -47.087 -75.992 1.00 85.45  ? 108 PHE D N   1 
ATOM   5851 C CA  . PHE D 1 25  ? -19.133 -46.156 -75.038 1.00 79.26  ? 108 PHE D CA  1 
ATOM   5852 C C   . PHE D 1 25  ? -18.190 -46.901 -74.079 1.00 75.55  ? 108 PHE D C   1 
ATOM   5853 O O   . PHE D 1 25  ? -17.046 -46.516 -73.867 1.00 73.12  ? 108 PHE D O   1 
ATOM   5854 C CB  . PHE D 1 25  ? -20.232 -45.410 -74.289 1.00 75.55  ? 108 PHE D CB  1 
ATOM   5855 C CG  . PHE D 1 25  ? -19.862 -44.008 -73.904 1.00 69.78  ? 108 PHE D CG  1 
ATOM   5856 C CD1 . PHE D 1 25  ? -20.836 -43.028 -73.828 1.00 65.62  ? 108 PHE D CD1 1 
ATOM   5857 C CD2 . PHE D 1 25  ? -18.535 -43.666 -73.623 1.00 67.18  ? 108 PHE D CD2 1 
ATOM   5858 C CE1 . PHE D 1 25  ? -20.504 -41.722 -73.479 1.00 63.80  ? 108 PHE D CE1 1 
ATOM   5859 C CE2 . PHE D 1 25  ? -18.192 -42.370 -73.250 1.00 64.20  ? 108 PHE D CE2 1 
ATOM   5860 C CZ  . PHE D 1 25  ? -19.182 -41.392 -73.184 1.00 63.12  ? 108 PHE D CZ  1 
ATOM   5861 N N   . ASP D 1 26  ? -18.661 -48.015 -73.555 1.00 75.87  ? 109 ASP D N   1 
ATOM   5862 C CA  . ASP D 1 26  ? -17.878 -48.793 -72.639 1.00 72.74  ? 109 ASP D CA  1 
ATOM   5863 C C   . ASP D 1 26  ? -16.572 -49.257 -73.250 1.00 75.15  ? 109 ASP D C   1 
ATOM   5864 O O   . ASP D 1 26  ? -15.540 -49.215 -72.595 1.00 71.70  ? 109 ASP D O   1 
ATOM   5865 C CB  . ASP D 1 26  ? -18.725 -49.946 -72.132 1.00 75.05  ? 109 ASP D CB  1 
ATOM   5866 C CG  . ASP D 1 26  ? -19.955 -49.458 -71.368 1.00 76.07  ? 109 ASP D CG  1 
ATOM   5867 O OD1 . ASP D 1 26  ? -20.073 -48.236 -71.107 1.00 75.27  ? 109 ASP D OD1 1 
ATOM   5868 O OD2 . ASP D 1 26  ? -20.814 -50.285 -71.025 1.00 77.17  ? 109 ASP D OD2 1 
ATOM   5869 N N   . LYS D 1 27  ? -16.604 -49.667 -74.517 1.00 84.81  ? 110 LYS D N   1 
ATOM   5870 C CA  . LYS D 1 27  ? -15.373 -50.080 -75.230 1.00 87.99  ? 110 LYS D CA  1 
ATOM   5871 C C   . LYS D 1 27  ? -14.311 -48.975 -75.129 1.00 85.41  ? 110 LYS D C   1 
ATOM   5872 O O   . LYS D 1 27  ? -13.194 -49.220 -74.683 1.00 81.63  ? 110 LYS D O   1 
ATOM   5873 C CB  . LYS D 1 27  ? -15.696 -50.552 -76.676 1.00 97.07  ? 110 LYS D CB  1 
ATOM   5874 C CG  . LYS D 1 27  ? -14.780 -50.144 -77.841 1.00 102.80 ? 110 LYS D CG  1 
ATOM   5875 C CD  . LYS D 1 27  ? -15.505 -49.178 -78.786 1.00 105.02 ? 110 LYS D CD  1 
ATOM   5876 C CE  . LYS D 1 27  ? -15.066 -49.350 -80.237 1.00 113.76 ? 110 LYS D CE  1 
ATOM   5877 N NZ  . LYS D 1 27  ? -13.812 -48.626 -80.563 1.00 112.72 ? 110 LYS D NZ  1 
ATOM   5878 N N   . LEU D 1 28  ? -14.716 -47.753 -75.465 1.00 85.09  ? 111 LEU D N   1 
ATOM   5879 C CA  . LEU D 1 28  ? -13.884 -46.559 -75.387 1.00 81.96  ? 111 LEU D CA  1 
ATOM   5880 C C   . LEU D 1 28  ? -13.353 -46.318 -73.978 1.00 77.86  ? 111 LEU D C   1 
ATOM   5881 O O   . LEU D 1 28  ? -12.292 -45.727 -73.775 1.00 74.00  ? 111 LEU D O   1 
ATOM   5882 C CB  . LEU D 1 28  ? -14.757 -45.365 -75.755 1.00 83.64  ? 111 LEU D CB  1 
ATOM   5883 C CG  . LEU D 1 28  ? -14.251 -44.252 -76.667 1.00 88.76  ? 111 LEU D CG  1 
ATOM   5884 C CD1 . LEU D 1 28  ? -14.851 -42.904 -76.275 1.00 82.12  ? 111 LEU D CD1 1 
ATOM   5885 C CD2 . LEU D 1 28  ? -12.734 -44.199 -76.676 1.00 90.20  ? 111 LEU D CD2 1 
ATOM   5886 N N   . LEU D 1 29  ? -14.124 -46.752 -72.997 1.00 74.42  ? 112 LEU D N   1 
ATOM   5887 C CA  . LEU D 1 29  ? -13.821 -46.439 -71.629 1.00 70.16  ? 112 LEU D CA  1 
ATOM   5888 C C   . LEU D 1 29  ? -13.027 -47.534 -70.975 1.00 69.26  ? 112 LEU D C   1 
ATOM   5889 O O   . LEU D 1 29  ? -12.645 -47.424 -69.811 1.00 69.76  ? 112 LEU D O   1 
ATOM   5890 C CB  . LEU D 1 29  ? -15.121 -46.209 -70.879 1.00 67.97  ? 112 LEU D CB  1 
ATOM   5891 C CG  . LEU D 1 29  ? -15.428 -44.763 -70.515 1.00 67.00  ? 112 LEU D CG  1 
ATOM   5892 C CD1 . LEU D 1 29  ? -14.712 -43.756 -71.399 1.00 67.87  ? 112 LEU D CD1 1 
ATOM   5893 C CD2 . LEU D 1 29  ? -16.938 -44.563 -70.528 1.00 65.41  ? 112 LEU D CD2 1 
ATOM   5894 N N   . GLY D 1 30  ? -12.794 -48.599 -71.721 1.00 70.52  ? 113 GLY D N   1 
ATOM   5895 C CA  . GLY D 1 30  ? -12.138 -49.766 -71.169 1.00 71.97  ? 113 GLY D CA  1 
ATOM   5896 C C   . GLY D 1 30  ? -12.993 -50.437 -70.121 1.00 70.96  ? 113 GLY D C   1 
ATOM   5897 O O   . GLY D 1 30  ? -12.462 -51.078 -69.217 1.00 70.35  ? 113 GLY D O   1 
ATOM   5898 N N   . GLY D 1 31  ? -14.316 -50.250 -70.238 1.00 72.73  ? 114 GLY D N   1 
ATOM   5899 C CA  . GLY D 1 31  ? -15.333 -50.931 -69.414 1.00 67.52  ? 114 GLY D CA  1 
ATOM   5900 C C   . GLY D 1 31  ? -16.520 -50.056 -69.041 1.00 65.16  ? 114 GLY D C   1 
ATOM   5901 O O   . GLY D 1 31  ? -17.650 -50.531 -68.936 1.00 63.72  ? 114 GLY D O   1 
ATOM   5902 N N   . GLY D 1 32  ? -16.254 -48.771 -68.841 1.00 63.25  ? 115 GLY D N   1 
ATOM   5903 C CA  . GLY D 1 32  ? -17.218 -47.844 -68.238 1.00 62.27  ? 115 GLY D CA  1 
ATOM   5904 C C   . GLY D 1 32  ? -16.543 -46.678 -67.519 1.00 59.68  ? 115 GLY D C   1 
ATOM   5905 O O   . GLY D 1 32  ? -15.342 -46.420 -67.687 1.00 58.09  ? 115 GLY D O   1 
ATOM   5906 N N   . ILE D 1 33  ? -17.316 -45.946 -66.727 1.00 59.88  ? 116 ILE D N   1 
ATOM   5907 C CA  . ILE D 1 33  ? -16.718 -44.932 -65.865 1.00 57.96  ? 116 ILE D CA  1 
ATOM   5908 C C   . ILE D 1 33  ? -15.865 -45.700 -64.872 1.00 55.14  ? 116 ILE D C   1 
ATOM   5909 O O   . ILE D 1 33  ? -16.378 -46.586 -64.159 1.00 52.04  ? 116 ILE D O   1 
ATOM   5910 C CB  . ILE D 1 33  ? -17.771 -44.060 -65.123 1.00 56.26  ? 116 ILE D CB  1 
ATOM   5911 C CG1 . ILE D 1 33  ? -18.709 -43.372 -66.118 1.00 58.13  ? 116 ILE D CG1 1 
ATOM   5912 C CG2 . ILE D 1 33  ? -17.102 -43.013 -64.263 1.00 55.51  ? 116 ILE D CG2 1 
ATOM   5913 C CD1 . ILE D 1 33  ? -18.079 -42.967 -67.431 1.00 57.83  ? 116 ILE D CD1 1 
ATOM   5914 N N   . GLU D 1 34  ? -14.573 -45.373 -64.852 1.00 50.74  ? 117 GLU D N   1 
ATOM   5915 C CA  . GLU D 1 34  ? -13.660 -46.052 -63.963 1.00 49.73  ? 117 GLU D CA  1 
ATOM   5916 C C   . GLU D 1 34  ? -13.632 -45.515 -62.519 1.00 46.18  ? 117 GLU D C   1 
ATOM   5917 O O   . GLU D 1 34  ? -13.539 -44.328 -62.278 1.00 46.42  ? 117 GLU D O   1 
ATOM   5918 C CB  . GLU D 1 34  ? -12.282 -46.008 -64.544 1.00 50.35  ? 117 GLU D CB  1 
ATOM   5919 C CG  . GLU D 1 34  ? -11.333 -47.004 -63.945 1.00 52.28  ? 117 GLU D CG  1 
ATOM   5920 C CD  . GLU D 1 34  ? -9.982  -46.863 -64.584 1.00 57.67  ? 117 GLU D CD  1 
ATOM   5921 O OE1 . GLU D 1 34  ? -9.390  -47.879 -64.996 1.00 59.35  ? 117 GLU D OE1 1 
ATOM   5922 O OE2 . GLU D 1 34  ? -9.530  -45.699 -64.686 1.00 64.71  ? 117 GLU D OE2 1 
ATOM   5923 N N   . SER D 1 35  ? -13.685 -46.423 -61.569 1.00 43.67  ? 118 SER D N   1 
ATOM   5924 C CA  . SER D 1 35  ? -13.504 -46.098 -60.159 1.00 42.58  ? 118 SER D CA  1 
ATOM   5925 C C   . SER D 1 35  ? -12.057 -45.628 -59.915 1.00 42.03  ? 118 SER D C   1 
ATOM   5926 O O   . SER D 1 35  ? -11.181 -45.912 -60.708 1.00 44.27  ? 118 SER D O   1 
ATOM   5927 C CB  . SER D 1 35  ? -13.882 -47.367 -59.404 1.00 46.19  ? 118 SER D CB  1 
ATOM   5928 O OG  . SER D 1 35  ? -13.096 -47.635 -58.299 1.00 53.13  ? 118 SER D OG  1 
ATOM   5929 N N   . MET D 1 36  ? -11.820 -44.839 -58.878 1.00 39.46  ? 119 MET D N   1 
ATOM   5930 C CA  . MET D 1 36  ? -10.481 -44.304 -58.581 1.00 38.99  ? 119 MET D CA  1 
ATOM   5931 C C   . MET D 1 36  ? -9.987  -43.197 -59.505 1.00 39.92  ? 119 MET D C   1 
ATOM   5932 O O   . MET D 1 36  ? -8.799  -42.918 -59.627 1.00 45.64  ? 119 MET D O   1 
ATOM   5933 C CB  . MET D 1 36  ? -9.454  -45.448 -58.432 1.00 39.07  ? 119 MET D CB  1 
ATOM   5934 C CG  . MET D 1 36  ? -9.290  -45.760 -56.947 1.00 45.28  ? 119 MET D CG  1 
ATOM   5935 S SD  . MET D 1 36  ? -8.315  -47.173 -56.439 1.00 49.84  ? 119 MET D SD  1 
ATOM   5936 C CE  . MET D 1 36  ? -6.788  -46.366 -55.927 1.00 43.02  ? 119 MET D CE  1 
ATOM   5937 N N   . ALA D 1 37  ? -10.895 -42.532 -60.161 1.00 39.57  ? 120 ALA D N   1 
ATOM   5938 C CA  . ALA D 1 37  ? -10.496 -41.618 -61.191 1.00 43.82  ? 120 ALA D CA  1 
ATOM   5939 C C   . ALA D 1 37  ? -11.564 -40.544 -61.334 1.00 44.85  ? 120 ALA D C   1 
ATOM   5940 O O   . ALA D 1 37  ? -12.710 -40.742 -60.938 1.00 44.82  ? 120 ALA D O   1 
ATOM   5941 C CB  . ALA D 1 37  ? -10.365 -42.378 -62.485 1.00 42.55  ? 120 ALA D CB  1 
ATOM   5942 N N   . ILE D 1 38  ? -11.203 -39.417 -61.924 1.00 46.18  ? 121 ILE D N   1 
ATOM   5943 C CA  . ILE D 1 38  ? -12.227 -38.494 -62.370 1.00 43.73  ? 121 ILE D CA  1 
ATOM   5944 C C   . ILE D 1 38  ? -12.429 -38.587 -63.870 1.00 46.98  ? 121 ILE D C   1 
ATOM   5945 O O   . ILE D 1 38  ? -11.483 -38.404 -64.704 1.00 48.85  ? 121 ILE D O   1 
ATOM   5946 C CB  . ILE D 1 38  ? -11.910 -37.077 -61.902 1.00 43.65  ? 121 ILE D CB  1 
ATOM   5947 C CG1 . ILE D 1 38  ? -11.760 -37.089 -60.359 1.00 40.30  ? 121 ILE D CG1 1 
ATOM   5948 C CG2 . ILE D 1 38  ? -13.008 -36.140 -62.388 1.00 43.75  ? 121 ILE D CG2 1 
ATOM   5949 C CD1 . ILE D 1 38  ? -11.105 -35.865 -59.763 1.00 39.30  ? 121 ILE D CD1 1 
ATOM   5950 N N   . THR D 1 39  ? -13.653 -38.920 -64.236 1.00 46.80  ? 122 THR D N   1 
ATOM   5951 C CA  . THR D 1 39  ? -13.982 -38.987 -65.674 1.00 50.59  ? 122 THR D CA  1 
ATOM   5952 C C   . THR D 1 39  ? -14.771 -37.740 -65.981 1.00 51.63  ? 122 THR D C   1 
ATOM   5953 O O   . THR D 1 39  ? -15.861 -37.528 -65.406 1.00 49.04  ? 122 THR D O   1 
ATOM   5954 C CB  . THR D 1 39  ? -14.828 -40.220 -66.044 1.00 51.43  ? 122 THR D CB  1 
ATOM   5955 O OG1 . THR D 1 39  ? -14.062 -41.398 -65.818 1.00 57.18  ? 122 THR D OG1 1 
ATOM   5956 C CG2 . THR D 1 39  ? -15.156 -40.194 -67.486 1.00 53.16  ? 122 THR D CG2 1 
ATOM   5957 N N   . GLU D 1 40  ? -14.213 -36.902 -66.850 1.00 51.19  ? 123 GLU D N   1 
ATOM   5958 C CA  . GLU D 1 40  ? -14.860 -35.649 -67.256 1.00 52.85  ? 123 GLU D CA  1 
ATOM   5959 C C   . GLU D 1 40  ? -15.458 -35.731 -68.645 1.00 58.47  ? 123 GLU D C   1 
ATOM   5960 O O   . GLU D 1 40  ? -14.781 -36.139 -69.603 1.00 60.37  ? 123 GLU D O   1 
ATOM   5961 C CB  . GLU D 1 40  ? -13.832 -34.557 -67.287 1.00 53.38  ? 123 GLU D CB  1 
ATOM   5962 C CG  . GLU D 1 40  ? -14.377 -33.218 -67.696 1.00 60.73  ? 123 GLU D CG  1 
ATOM   5963 C CD  . GLU D 1 40  ? -13.261 -32.242 -68.058 1.00 68.50  ? 123 GLU D CD  1 
ATOM   5964 O OE1 . GLU D 1 40  ? -12.134 -32.340 -67.492 1.00 67.14  ? 123 GLU D OE1 1 
ATOM   5965 O OE2 . GLU D 1 40  ? -13.501 -31.380 -68.935 1.00 74.26  ? 123 GLU D OE2 1 
ATOM   5966 N N   . ALA D 1 41  ? -16.719 -35.331 -68.771 1.00 59.49  ? 124 ALA D N   1 
ATOM   5967 C CA  . ALA D 1 41  ? -17.354 -35.222 -70.099 1.00 60.20  ? 124 ALA D CA  1 
ATOM   5968 C C   . ALA D 1 41  ? -17.820 -33.797 -70.365 1.00 63.62  ? 124 ALA D C   1 
ATOM   5969 O O   . ALA D 1 41  ? -18.422 -33.157 -69.508 1.00 64.91  ? 124 ALA D O   1 
ATOM   5970 C CB  . ALA D 1 41  ? -18.509 -36.195 -70.246 1.00 55.85  ? 124 ALA D CB  1 
ATOM   5971 N N   . PHE D 1 42  ? -17.525 -33.301 -71.559 1.00 73.57  ? 125 PHE D N   1 
ATOM   5972 C CA  . PHE D 1 42  ? -17.852 -31.936 -71.939 1.00 75.42  ? 125 PHE D CA  1 
ATOM   5973 C C   . PHE D 1 42  ? -18.254 -31.825 -73.405 1.00 81.98  ? 125 PHE D C   1 
ATOM   5974 O O   . PHE D 1 42  ? -17.977 -32.723 -74.212 1.00 78.90  ? 125 PHE D O   1 
ATOM   5975 C CB  . PHE D 1 42  ? -16.680 -30.995 -71.628 1.00 75.33  ? 125 PHE D CB  1 
ATOM   5976 C CG  . PHE D 1 42  ? -15.417 -31.282 -72.412 1.00 73.53  ? 125 PHE D CG  1 
ATOM   5977 C CD1 . PHE D 1 42  ? -14.360 -31.946 -71.818 1.00 72.01  ? 125 PHE D CD1 1 
ATOM   5978 C CD2 . PHE D 1 42  ? -15.265 -30.826 -73.705 1.00 78.81  ? 125 PHE D CD2 1 
ATOM   5979 C CE1 . PHE D 1 42  ? -13.185 -32.182 -72.501 1.00 77.45  ? 125 PHE D CE1 1 
ATOM   5980 C CE2 . PHE D 1 42  ? -14.091 -31.064 -74.412 1.00 85.09  ? 125 PHE D CE2 1 
ATOM   5981 C CZ  . PHE D 1 42  ? -13.045 -31.751 -73.807 1.00 82.94  ? 125 PHE D CZ  1 
ATOM   5982 N N   . GLY D 1 43  ? -18.902 -30.701 -73.709 1.00 86.52  ? 126 GLY D N   1 
ATOM   5983 C CA  . GLY D 1 43  ? -19.401 -30.356 -75.031 1.00 92.90  ? 126 GLY D CA  1 
ATOM   5984 C C   . GLY D 1 43  ? -20.283 -29.130 -74.875 1.00 99.01  ? 126 GLY D C   1 
ATOM   5985 O O   . GLY D 1 43  ? -20.456 -28.629 -73.753 1.00 94.05  ? 126 GLY D O   1 
ATOM   5986 N N   . GLU D 1 44  ? -20.801 -28.629 -76.003 1.00 109.45 ? 127 GLU D N   1 
ATOM   5987 C CA  . GLU D 1 44  ? -21.901 -27.661 -76.037 1.00 113.21 ? 127 GLU D CA  1 
ATOM   5988 C C   . GLU D 1 44  ? -23.111 -28.362 -75.407 1.00 116.60 ? 127 GLU D C   1 
ATOM   5989 O O   . GLU D 1 44  ? -23.047 -29.579 -75.160 1.00 114.85 ? 127 GLU D O   1 
ATOM   5990 C CB  . GLU D 1 44  ? -22.215 -27.293 -77.483 1.00 114.45 ? 127 GLU D CB  1 
ATOM   5991 C CG  . GLU D 1 44  ? -23.055 -28.356 -78.184 1.00 120.26 ? 127 GLU D CG  1 
ATOM   5992 C CD  . GLU D 1 44  ? -22.950 -28.319 -79.699 1.00 127.37 ? 127 GLU D CD  1 
ATOM   5993 O OE1 . GLU D 1 44  ? -23.971 -28.598 -80.374 1.00 124.28 ? 127 GLU D OE1 1 
ATOM   5994 O OE2 . GLU D 1 44  ? -21.851 -28.019 -80.220 1.00 130.86 ? 127 GLU D OE2 1 
ATOM   5995 N N   . PHE D 1 45  ? -24.210 -27.649 -75.136 1.00 119.06 ? 128 PHE D N   1 
ATOM   5996 C CA  . PHE D 1 45  ? -25.350 -28.373 -74.538 1.00 114.36 ? 128 PHE D CA  1 
ATOM   5997 C C   . PHE D 1 45  ? -26.431 -28.798 -75.506 1.00 106.62 ? 128 PHE D C   1 
ATOM   5998 O O   . PHE D 1 45  ? -27.610 -28.657 -75.230 1.00 106.45 ? 128 PHE D O   1 
ATOM   5999 C CB  . PHE D 1 45  ? -25.943 -27.756 -73.237 1.00 111.60 ? 128 PHE D CB  1 
ATOM   6000 C CG  . PHE D 1 45  ? -26.283 -28.798 -72.178 1.00 94.21  ? 128 PHE D CG  1 
ATOM   6001 C CD1 . PHE D 1 45  ? -26.419 -30.174 -72.525 1.00 90.45  ? 128 PHE D CD1 1 
ATOM   6002 C CD2 . PHE D 1 45  ? -26.459 -28.417 -70.864 1.00 90.10  ? 128 PHE D CD2 1 
ATOM   6003 C CE1 . PHE D 1 45  ? -26.711 -31.131 -71.592 1.00 83.23  ? 128 PHE D CE1 1 
ATOM   6004 C CE2 . PHE D 1 45  ? -26.757 -29.375 -69.898 1.00 95.05  ? 128 PHE D CE2 1 
ATOM   6005 C CZ  . PHE D 1 45  ? -26.877 -30.719 -70.268 1.00 93.14  ? 128 PHE D CZ  1 
ATOM   6006 N N   . ARG D 1 46  ? -26.024 -29.365 -76.626 1.00 104.17 ? 129 ARG D N   1 
ATOM   6007 C CA  . ARG D 1 46  ? -26.945 -30.223 -77.333 1.00 107.18 ? 129 ARG D CA  1 
ATOM   6008 C C   . ARG D 1 46  ? -26.872 -31.547 -76.591 1.00 96.07  ? 129 ARG D C   1 
ATOM   6009 O O   . ARG D 1 46  ? -27.859 -32.245 -76.398 1.00 92.47  ? 129 ARG D O   1 
ATOM   6010 C CB  . ARG D 1 46  ? -26.516 -30.414 -78.804 1.00 119.87 ? 129 ARG D CB  1 
ATOM   6011 C CG  . ARG D 1 46  ? -26.763 -29.232 -79.751 1.00 123.76 ? 129 ARG D CG  1 
ATOM   6012 C CD  . ARG D 1 46  ? -28.247 -28.947 -79.965 1.00 130.55 ? 129 ARG D CD  1 
ATOM   6013 N NE  . ARG D 1 46  ? -28.552 -27.516 -79.871 1.00 133.50 ? 129 ARG D NE  1 
ATOM   6014 C CZ  . ARG D 1 46  ? -29.678 -27.005 -79.368 1.00 134.21 ? 129 ARG D CZ  1 
ATOM   6015 N NH1 . ARG D 1 46  ? -30.635 -27.793 -78.889 1.00 135.33 ? 129 ARG D NH1 1 
ATOM   6016 N NH2 . ARG D 1 46  ? -29.842 -25.691 -79.329 1.00 135.89 ? 129 ARG D NH2 1 
ATOM   6017 N N   . THR D 1 47  ? -25.672 -31.820 -76.111 1.00 90.43  ? 130 THR D N   1 
ATOM   6018 C CA  . THR D 1 47  ? -25.159 -33.175 -75.930 1.00 89.14  ? 130 THR D CA  1 
ATOM   6019 C C   . THR D 1 47  ? -25.494 -34.022 -74.670 1.00 94.93  ? 130 THR D C   1 
ATOM   6020 O O   . THR D 1 47  ? -25.965 -33.523 -73.566 1.00 104.97 ? 130 THR D O   1 
ATOM   6021 C CB  . THR D 1 47  ? -23.634 -33.166 -76.055 1.00 80.72  ? 130 THR D CB  1 
ATOM   6022 O OG1 . THR D 1 47  ? -23.254 -32.323 -77.150 1.00 84.32  ? 130 THR D OG1 1 
ATOM   6023 C CG2 . THR D 1 47  ? -23.177 -34.539 -76.293 1.00 80.57  ? 130 THR D CG2 1 
ATOM   6024 N N   . GLY D 1 48  ? -25.183 -35.309 -74.854 1.00 81.22  ? 131 GLY D N   1 
ATOM   6025 C CA  . GLY D 1 48  ? -25.439 -36.321 -73.857 1.00 75.43  ? 131 GLY D CA  1 
ATOM   6026 C C   . GLY D 1 48  ? -24.922 -36.092 -72.448 1.00 66.42  ? 131 GLY D C   1 
ATOM   6027 O O   . GLY D 1 48  ? -25.009 -37.012 -71.626 1.00 61.61  ? 131 GLY D O   1 
ATOM   6028 N N   . LYS D 1 49  ? -24.380 -34.906 -72.151 1.00 63.19  ? 132 LYS D N   1 
ATOM   6029 C CA  . LYS D 1 49  ? -23.751 -34.723 -70.821 1.00 63.93  ? 132 LYS D CA  1 
ATOM   6030 C C   . LYS D 1 49  ? -24.761 -35.038 -69.724 1.00 59.71  ? 132 LYS D C   1 
ATOM   6031 O O   . LYS D 1 49  ? -24.532 -35.881 -68.861 1.00 55.80  ? 132 LYS D O   1 
ATOM   6032 C CB  . LYS D 1 49  ? -23.236 -33.304 -70.581 1.00 63.01  ? 132 LYS D CB  1 
ATOM   6033 C CG  . LYS D 1 49  ? -21.968 -32.887 -71.296 1.00 61.75  ? 132 LYS D CG  1 
ATOM   6034 C CD  . LYS D 1 49  ? -21.835 -31.370 -71.149 1.00 64.63  ? 132 LYS D CD  1 
ATOM   6035 C CE  . LYS D 1 49  ? -23.069 -30.636 -71.686 1.00 69.40  ? 132 LYS D CE  1 
ATOM   6036 N NZ  . LYS D 1 49  ? -22.956 -29.146 -71.709 1.00 70.39  ? 132 LYS D NZ  1 
ATOM   6037 N N   . THR D 1 50  ? -25.900 -34.364 -69.793 1.00 65.51  ? 133 THR D N   1 
ATOM   6038 C CA  . THR D 1 50  ? -26.913 -34.482 -68.761 1.00 68.25  ? 133 THR D CA  1 
ATOM   6039 C C   . THR D 1 50  ? -27.602 -35.843 -68.805 1.00 62.92  ? 133 THR D C   1 
ATOM   6040 O O   . THR D 1 50  ? -27.818 -36.472 -67.777 1.00 64.27  ? 133 THR D O   1 
ATOM   6041 C CB  . THR D 1 50  ? -27.868 -33.260 -68.782 1.00 72.56  ? 133 THR D CB  1 
ATOM   6042 O OG1 . THR D 1 50  ? -27.177 -32.123 -68.205 1.00 72.21  ? 133 THR D OG1 1 
ATOM   6043 C CG2 . THR D 1 50  ? -29.178 -33.541 -68.006 1.00 70.71  ? 133 THR D CG2 1 
ATOM   6044 N N   . GLN D 1 51  ? -27.888 -36.297 -69.999 1.00 63.07  ? 134 GLN D N   1 
ATOM   6045 C CA  . GLN D 1 51  ? -28.374 -37.643 -70.243 1.00 67.13  ? 134 GLN D CA  1 
ATOM   6046 C C   . GLN D 1 51  ? -27.524 -38.787 -69.647 1.00 65.98  ? 134 GLN D C   1 
ATOM   6047 O O   . GLN D 1 51  ? -28.054 -39.836 -69.238 1.00 63.55  ? 134 GLN D O   1 
ATOM   6048 C CB  . GLN D 1 51  ? -28.474 -37.804 -71.761 1.00 72.05  ? 134 GLN D CB  1 
ATOM   6049 C CG  . GLN D 1 51  ? -29.577 -36.957 -72.369 1.00 77.58  ? 134 GLN D CG  1 
ATOM   6050 C CD  . GLN D 1 51  ? -30.942 -37.449 -71.899 1.00 83.87  ? 134 GLN D CD  1 
ATOM   6051 O OE1 . GLN D 1 51  ? -31.557 -36.857 -70.998 1.00 84.75  ? 134 GLN D OE1 1 
ATOM   6052 N NE2 . GLN D 1 51  ? -31.387 -38.586 -72.454 1.00 86.87  ? 134 GLN D NE2 1 
ATOM   6053 N N   . LEU D 1 52  ? -26.209 -38.579 -69.641 1.00 61.92  ? 135 LEU D N   1 
ATOM   6054 C CA  . LEU D 1 52  ? -25.269 -39.571 -69.220 1.00 61.58  ? 135 LEU D CA  1 
ATOM   6055 C C   . LEU D 1 52  ? -25.317 -39.673 -67.699 1.00 62.32  ? 135 LEU D C   1 
ATOM   6056 O O   . LEU D 1 52  ? -25.364 -40.769 -67.128 1.00 62.85  ? 135 LEU D O   1 
ATOM   6057 C CB  . LEU D 1 52  ? -23.888 -39.133 -69.660 1.00 63.98  ? 135 LEU D CB  1 
ATOM   6058 C CG  . LEU D 1 52  ? -22.880 -40.165 -70.179 1.00 69.20  ? 135 LEU D CG  1 
ATOM   6059 C CD1 . LEU D 1 52  ? -21.508 -39.517 -70.303 1.00 64.87  ? 135 LEU D CD1 1 
ATOM   6060 C CD2 . LEU D 1 52  ? -22.799 -41.396 -69.289 1.00 68.15  ? 135 LEU D CD2 1 
ATOM   6061 N N   . SER D 1 53  ? -25.283 -38.512 -67.053 1.00 58.81  ? 136 SER D N   1 
ATOM   6062 C CA  . SER D 1 53  ? -25.553 -38.390 -65.633 1.00 57.00  ? 136 SER D CA  1 
ATOM   6063 C C   . SER D 1 53  ? -26.763 -39.202 -65.224 1.00 56.31  ? 136 SER D C   1 
ATOM   6064 O O   . SER D 1 53  ? -26.695 -39.968 -64.277 1.00 55.19  ? 136 SER D O   1 
ATOM   6065 C CB  . SER D 1 53  ? -25.794 -36.930 -65.249 1.00 60.38  ? 136 SER D CB  1 
ATOM   6066 O OG  . SER D 1 53  ? -24.769 -36.098 -65.758 1.00 65.24  ? 136 SER D OG  1 
ATOM   6067 N N   . HIS D 1 54  ? -27.870 -39.067 -65.942 1.00 57.79  ? 137 HIS D N   1 
ATOM   6068 C CA  . HIS D 1 54  ? -29.066 -39.754 -65.500 1.00 56.50  ? 137 HIS D CA  1 
ATOM   6069 C C   . HIS D 1 54  ? -28.913 -41.244 -65.655 1.00 58.05  ? 137 HIS D C   1 
ATOM   6070 O O   . HIS D 1 54  ? -29.282 -41.999 -64.759 1.00 56.01  ? 137 HIS D O   1 
ATOM   6071 C CB  . HIS D 1 54  ? -30.306 -39.218 -66.199 1.00 58.10  ? 137 HIS D CB  1 
ATOM   6072 C CG  . HIS D 1 54  ? -30.757 -37.862 -65.690 1.00 60.64  ? 137 HIS D CG  1 
ATOM   6073 N ND1 . HIS D 1 54  ? -30.211 -36.711 -66.114 1.00 62.19  ? 137 HIS D ND1 1 
ATOM   6074 C CD2 . HIS D 1 54  ? -31.725 -37.511 -64.756 1.00 61.50  ? 137 HIS D CD2 1 
ATOM   6075 C CE1 . HIS D 1 54  ? -30.813 -35.677 -65.507 1.00 64.72  ? 137 HIS D CE1 1 
ATOM   6076 N NE2 . HIS D 1 54  ? -31.729 -36.168 -64.662 1.00 63.60  ? 137 HIS D NE2 1 
ATOM   6077 N N   . THR D 1 55  ? -28.323 -41.679 -66.768 1.00 55.53  ? 138 THR D N   1 
ATOM   6078 C CA  . THR D 1 55  ? -28.227 -43.085 -67.044 1.00 54.89  ? 138 THR D CA  1 
ATOM   6079 C C   . THR D 1 55  ? -27.381 -43.751 -65.989 1.00 54.62  ? 138 THR D C   1 
ATOM   6080 O O   . THR D 1 55  ? -27.767 -44.765 -65.408 1.00 57.76  ? 138 THR D O   1 
ATOM   6081 C CB  . THR D 1 55  ? -27.650 -43.325 -68.440 1.00 58.36  ? 138 THR D CB  1 
ATOM   6082 O OG1 . THR D 1 55  ? -28.521 -42.739 -69.431 1.00 59.49  ? 138 THR D OG1 1 
ATOM   6083 C CG2 . THR D 1 55  ? -27.519 -44.801 -68.700 1.00 58.51  ? 138 THR D CG2 1 
ATOM   6084 N N   . LEU D 1 56  ? -26.243 -43.142 -65.704 1.00 54.29  ? 139 LEU D N   1 
ATOM   6085 C CA  . LEU D 1 56  ? -25.341 -43.605 -64.653 1.00 49.97  ? 139 LEU D CA  1 
ATOM   6086 C C   . LEU D 1 56  ? -25.998 -43.729 -63.261 1.00 51.28  ? 139 LEU D C   1 
ATOM   6087 O O   . LEU D 1 56  ? -25.620 -44.603 -62.470 1.00 51.72  ? 139 LEU D O   1 
ATOM   6088 C CB  . LEU D 1 56  ? -24.136 -42.692 -64.589 1.00 46.17  ? 139 LEU D CB  1 
ATOM   6089 C CG  . LEU D 1 56  ? -23.118 -42.649 -65.727 1.00 46.68  ? 139 LEU D CG  1 
ATOM   6090 C CD1 . LEU D 1 56  ? -22.182 -41.458 -65.543 1.00 44.02  ? 139 LEU D CD1 1 
ATOM   6091 C CD2 . LEU D 1 56  ? -22.324 -43.934 -65.761 1.00 46.96  ? 139 LEU D CD2 1 
ATOM   6092 N N   . CYS D 1 57  ? -26.979 -42.878 -62.956 1.00 47.54  ? 140 CYS D N   1 
ATOM   6093 C CA  . CYS D 1 57  ? -27.702 -43.022 -61.699 1.00 45.71  ? 140 CYS D CA  1 
ATOM   6094 C C   . CYS D 1 57  ? -28.355 -44.387 -61.610 1.00 49.81  ? 140 CYS D C   1 
ATOM   6095 O O   . CYS D 1 57  ? -28.583 -44.902 -60.501 1.00 49.32  ? 140 CYS D O   1 
ATOM   6096 C CB  . CYS D 1 57  ? -28.788 -41.969 -61.544 1.00 45.58  ? 140 CYS D CB  1 
ATOM   6097 S SG  . CYS D 1 57  ? -28.201 -40.291 -61.249 1.00 49.92  ? 140 CYS D SG  1 
ATOM   6098 N N   . VAL D 1 58  ? -28.665 -44.980 -62.762 1.00 51.15  ? 141 VAL D N   1 
ATOM   6099 C CA  . VAL D 1 58  ? -29.273 -46.310 -62.748 1.00 55.81  ? 141 VAL D CA  1 
ATOM   6100 C C   . VAL D 1 58  ? -28.257 -47.472 -62.898 1.00 57.74  ? 141 VAL D C   1 
ATOM   6101 O O   . VAL D 1 58  ? -28.211 -48.401 -62.078 1.00 56.77  ? 141 VAL D O   1 
ATOM   6102 C CB  . VAL D 1 58  ? -30.396 -46.400 -63.790 1.00 57.58  ? 141 VAL D CB  1 
ATOM   6103 C CG1 . VAL D 1 58  ? -31.117 -47.731 -63.702 1.00 58.24  ? 141 VAL D CG1 1 
ATOM   6104 C CG2 . VAL D 1 58  ? -31.370 -45.259 -63.590 1.00 56.89  ? 141 VAL D CG2 1 
ATOM   6105 N N   . THR D 1 59  ? -27.455 -47.418 -63.952 1.00 60.31  ? 142 THR D N   1 
ATOM   6106 C CA  . THR D 1 59  ? -26.478 -48.479 -64.246 1.00 61.99  ? 142 THR D CA  1 
ATOM   6107 C C   . THR D 1 59  ? -25.524 -48.757 -63.095 1.00 60.77  ? 142 THR D C   1 
ATOM   6108 O O   . THR D 1 59  ? -25.054 -49.870 -62.927 1.00 65.15  ? 142 THR D O   1 
ATOM   6109 C CB  . THR D 1 59  ? -25.631 -48.122 -65.475 1.00 62.07  ? 142 THR D CB  1 
ATOM   6110 O OG1 . THR D 1 59  ? -24.934 -46.891 -65.232 1.00 57.94  ? 142 THR D OG1 1 
ATOM   6111 C CG2 . THR D 1 59  ? -26.530 -48.019 -66.743 1.00 64.13  ? 142 THR D CG2 1 
ATOM   6112 N N   . ALA D 1 60  ? -25.252 -47.734 -62.296 1.00 59.03  ? 143 ALA D N   1 
ATOM   6113 C CA  . ALA D 1 60  ? -24.406 -47.864 -61.130 1.00 52.56  ? 143 ALA D CA  1 
ATOM   6114 C C   . ALA D 1 60  ? -25.051 -48.748 -60.085 1.00 52.77  ? 143 ALA D C   1 
ATOM   6115 O O   . ALA D 1 60  ? -24.378 -49.251 -59.213 1.00 54.10  ? 143 ALA D O   1 
ATOM   6116 C CB  . ALA D 1 60  ? -24.111 -46.489 -60.558 1.00 47.55  ? 143 ALA D CB  1 
ATOM   6117 N N   . GLN D 1 61  ? -26.355 -48.938 -60.169 1.00 55.02  ? 144 GLN D N   1 
ATOM   6118 C CA  . GLN D 1 61  ? -27.064 -49.773 -59.198 1.00 57.03  ? 144 GLN D CA  1 
ATOM   6119 C C   . GLN D 1 61  ? -27.133 -51.215 -59.639 1.00 61.29  ? 144 GLN D C   1 
ATOM   6120 O O   . GLN D 1 61  ? -27.516 -52.080 -58.844 1.00 63.22  ? 144 GLN D O   1 
ATOM   6121 C CB  . GLN D 1 61  ? -28.482 -49.242 -58.949 1.00 55.11  ? 144 GLN D CB  1 
ATOM   6122 C CG  . GLN D 1 61  ? -28.493 -47.849 -58.345 1.00 56.12  ? 144 GLN D CG  1 
ATOM   6123 C CD  . GLN D 1 61  ? -29.870 -47.393 -57.887 1.00 58.64  ? 144 GLN D CD  1 
ATOM   6124 O OE1 . GLN D 1 61  ? -30.634 -48.164 -57.307 1.00 62.34  ? 144 GLN D OE1 1 
ATOM   6125 N NE2 . GLN D 1 61  ? -30.192 -46.136 -58.151 1.00 55.97  ? 144 GLN D NE2 1 
ATOM   6126 N N   . LEU D 1 62  ? -26.788 -51.473 -60.909 1.00 62.98  ? 145 LEU D N   1 
ATOM   6127 C CA  . LEU D 1 62  ? -26.911 -52.826 -61.513 1.00 64.48  ? 145 LEU D CA  1 
ATOM   6128 C C   . LEU D 1 62  ? -25.632 -53.654 -61.375 1.00 65.59  ? 145 LEU D C   1 
ATOM   6129 O O   . LEU D 1 62  ? -24.519 -53.152 -61.579 1.00 64.28  ? 145 LEU D O   1 
ATOM   6130 C CB  . LEU D 1 62  ? -27.257 -52.762 -63.000 1.00 62.53  ? 145 LEU D CB  1 
ATOM   6131 C CG  . LEU D 1 62  ? -28.407 -51.874 -63.474 1.00 63.71  ? 145 LEU D CG  1 
ATOM   6132 C CD1 . LEU D 1 62  ? -28.343 -51.678 -64.979 1.00 63.01  ? 145 LEU D CD1 1 
ATOM   6133 C CD2 . LEU D 1 62  ? -29.774 -52.370 -63.038 1.00 62.81  ? 145 LEU D CD2 1 
ATOM   6134 N N   . PRO D 1 63  ? -25.790 -54.938 -61.057 1.00 69.20  ? 146 PRO D N   1 
ATOM   6135 C CA  . PRO D 1 63  ? -24.609 -55.807 -61.154 1.00 71.20  ? 146 PRO D CA  1 
ATOM   6136 C C   . PRO D 1 63  ? -24.106 -55.749 -62.594 1.00 73.06  ? 146 PRO D C   1 
ATOM   6137 O O   . PRO D 1 63  ? -24.925 -55.747 -63.531 1.00 80.50  ? 146 PRO D O   1 
ATOM   6138 C CB  . PRO D 1 63  ? -25.179 -57.205 -60.856 1.00 73.92  ? 146 PRO D CB  1 
ATOM   6139 C CG  . PRO D 1 63  ? -26.649 -57.094 -61.203 1.00 73.62  ? 146 PRO D CG  1 
ATOM   6140 C CD  . PRO D 1 63  ? -27.047 -55.696 -60.853 1.00 70.03  ? 146 PRO D CD  1 
ATOM   6141 N N   . GLY D 1 64  ? -22.797 -55.700 -62.785 1.00 70.54  ? 147 GLY D N   1 
ATOM   6142 C CA  . GLY D 1 64  ? -22.232 -55.673 -64.138 1.00 76.20  ? 147 GLY D CA  1 
ATOM   6143 C C   . GLY D 1 64  ? -20.936 -56.459 -64.224 1.00 81.09  ? 147 GLY D C   1 
ATOM   6144 O O   . GLY D 1 64  ? -20.556 -57.120 -63.257 1.00 82.47  ? 147 GLY D O   1 
ATOM   6145 N N   . ALA D 1 65  ? -20.255 -56.378 -65.373 1.00 82.76  ? 148 ALA D N   1 
ATOM   6146 C CA  . ALA D 1 65  ? -18.978 -57.065 -65.593 1.00 79.22  ? 148 ALA D CA  1 
ATOM   6147 C C   . ALA D 1 65  ? -18.042 -56.855 -64.420 1.00 78.71  ? 148 ALA D C   1 
ATOM   6148 O O   . ALA D 1 65  ? -18.177 -55.870 -63.670 1.00 76.86  ? 148 ALA D O   1 
ATOM   6149 C CB  . ALA D 1 65  ? -18.319 -56.597 -66.885 1.00 76.92  ? 148 ALA D CB  1 
ATOM   6150 N N   . GLY D 1 66  ? -17.108 -57.792 -64.266 1.00 79.70  ? 149 GLY D N   1 
ATOM   6151 C CA  . GLY D 1 66  ? -16.090 -57.752 -63.211 1.00 78.06  ? 149 GLY D CA  1 
ATOM   6152 C C   . GLY D 1 66  ? -16.557 -58.076 -61.799 1.00 80.02  ? 149 GLY D C   1 
ATOM   6153 O O   . GLY D 1 66  ? -15.874 -57.761 -60.814 1.00 77.93  ? 149 GLY D O   1 
ATOM   6154 N N   . GLY D 1 67  ? -17.714 -58.725 -61.694 1.00 83.11  ? 150 GLY D N   1 
ATOM   6155 C CA  . GLY D 1 67  ? -18.336 -58.950 -60.390 1.00 84.17  ? 150 GLY D CA  1 
ATOM   6156 C C   . GLY D 1 67  ? -18.814 -57.652 -59.724 1.00 79.05  ? 150 GLY D C   1 
ATOM   6157 O O   . GLY D 1 67  ? -18.980 -57.596 -58.505 1.00 80.47  ? 150 GLY D O   1 
ATOM   6158 N N   . TYR D 1 68  ? -19.034 -56.605 -60.517 1.00 72.93  ? 151 TYR D N   1 
ATOM   6159 C CA  . TYR D 1 68  ? -19.501 -55.345 -59.974 1.00 66.58  ? 151 TYR D CA  1 
ATOM   6160 C C   . TYR D 1 68  ? -20.931 -55.509 -59.498 1.00 66.68  ? 151 TYR D C   1 
ATOM   6161 O O   . TYR D 1 68  ? -21.824 -55.863 -60.293 1.00 65.48  ? 151 TYR D O   1 
ATOM   6162 C CB  . TYR D 1 68  ? -19.384 -54.232 -60.994 1.00 63.82  ? 151 TYR D CB  1 
ATOM   6163 C CG  . TYR D 1 68  ? -20.019 -52.974 -60.517 1.00 62.00  ? 151 TYR D CG  1 
ATOM   6164 C CD1 . TYR D 1 68  ? -19.312 -52.065 -59.770 1.00 60.09  ? 151 TYR D CD1 1 
ATOM   6165 C CD2 . TYR D 1 68  ? -21.341 -52.703 -60.803 1.00 64.14  ? 151 TYR D CD2 1 
ATOM   6166 C CE1 . TYR D 1 68  ? -19.898 -50.886 -59.323 1.00 60.99  ? 151 TYR D CE1 1 
ATOM   6167 C CE2 . TYR D 1 68  ? -21.947 -51.547 -60.358 1.00 66.11  ? 151 TYR D CE2 1 
ATOM   6168 C CZ  . TYR D 1 68  ? -21.223 -50.625 -59.623 1.00 61.83  ? 151 TYR D CZ  1 
ATOM   6169 O OH  . TYR D 1 68  ? -21.833 -49.458 -59.194 1.00 56.28  ? 151 TYR D OH  1 
ATOM   6170 N N   . PRO D 1 69  ? -21.143 -55.289 -58.188 1.00 64.50  ? 152 PRO D N   1 
ATOM   6171 C CA  . PRO D 1 69  ? -22.374 -55.648 -57.461 1.00 67.20  ? 152 PRO D CA  1 
ATOM   6172 C C   . PRO D 1 69  ? -23.537 -54.658 -57.584 1.00 70.64  ? 152 PRO D C   1 
ATOM   6173 O O   . PRO D 1 69  ? -24.699 -55.031 -57.406 1.00 74.79  ? 152 PRO D O   1 
ATOM   6174 C CB  . PRO D 1 69  ? -21.908 -55.742 -56.008 1.00 64.38  ? 152 PRO D CB  1 
ATOM   6175 C CG  . PRO D 1 69  ? -20.663 -54.934 -55.922 1.00 60.88  ? 152 PRO D CG  1 
ATOM   6176 C CD  . PRO D 1 69  ? -20.112 -54.726 -57.306 1.00 61.19  ? 152 PRO D CD  1 
ATOM   6177 N N   . GLY D 1 70  ? -23.224 -53.413 -57.928 1.00 68.47  ? 153 GLY D N   1 
ATOM   6178 C CA  . GLY D 1 70  ? -24.202 -52.347 -57.875 1.00 64.60  ? 153 GLY D CA  1 
ATOM   6179 C C   . GLY D 1 70  ? -23.941 -51.605 -56.593 1.00 60.20  ? 153 GLY D C   1 
ATOM   6180 O O   . GLY D 1 70  ? -23.288 -52.123 -55.692 1.00 64.77  ? 153 GLY D O   1 
ATOM   6181 N N   . GLY D 1 71  ? -24.418 -50.381 -56.509 1.00 58.72  ? 154 GLY D N   1 
ATOM   6182 C CA  . GLY D 1 71  ? -24.244 -49.613 -55.283 1.00 57.71  ? 154 GLY D CA  1 
ATOM   6183 C C   . GLY D 1 71  ? -24.974 -48.298 -55.383 1.00 55.87  ? 154 GLY D C   1 
ATOM   6184 O O   . GLY D 1 71  ? -25.672 -48.056 -56.382 1.00 54.91  ? 154 GLY D O   1 
ATOM   6185 N N   . LYS D 1 72  ? -24.798 -47.458 -54.354 1.00 52.33  ? 155 LYS D N   1 
ATOM   6186 C CA  . LYS D 1 72  ? -25.415 -46.126 -54.282 1.00 50.95  ? 155 LYS D CA  1 
ATOM   6187 C C   . LYS D 1 72  ? -24.649 -44.989 -55.002 1.00 48.90  ? 155 LYS D C   1 
ATOM   6188 O O   . LYS D 1 72  ? -23.440 -45.082 -55.308 1.00 46.61  ? 155 LYS D O   1 
ATOM   6189 C CB  . LYS D 1 72  ? -25.625 -45.737 -52.819 1.00 50.75  ? 155 LYS D CB  1 
ATOM   6190 C CG  . LYS D 1 72  ? -26.368 -46.790 -52.018 1.00 54.47  ? 155 LYS D CG  1 
ATOM   6191 C CD  . LYS D 1 72  ? -27.026 -46.231 -50.773 1.00 55.93  ? 155 LYS D CD  1 
ATOM   6192 C CE  . LYS D 1 72  ? -28.033 -47.213 -50.234 1.00 59.61  ? 155 LYS D CE  1 
ATOM   6193 N NZ  . LYS D 1 72  ? -28.201 -46.933 -48.790 1.00 64.63  ? 155 LYS D NZ  1 
ATOM   6194 N N   . ILE D 1 73  ? -25.361 -43.897 -55.230 1.00 43.95  ? 156 ILE D N   1 
ATOM   6195 C CA  . ILE D 1 73  ? -24.833 -42.789 -55.963 1.00 41.94  ? 156 ILE D CA  1 
ATOM   6196 C C   . ILE D 1 73  ? -25.078 -41.512 -55.195 1.00 43.52  ? 156 ILE D C   1 
ATOM   6197 O O   . ILE D 1 73  ? -26.133 -41.349 -54.533 1.00 40.24  ? 156 ILE D O   1 
ATOM   6198 C CB  . ILE D 1 73  ? -25.576 -42.638 -57.323 1.00 43.32  ? 156 ILE D CB  1 
ATOM   6199 C CG1 . ILE D 1 73  ? -25.367 -43.854 -58.204 1.00 42.26  ? 156 ILE D CG1 1 
ATOM   6200 C CG2 . ILE D 1 73  ? -25.190 -41.365 -58.050 1.00 41.01  ? 156 ILE D CG2 1 
ATOM   6201 C CD1 . ILE D 1 73  ? -26.427 -44.910 -57.968 1.00 45.51  ? 156 ILE D CD1 1 
ATOM   6202 N N   . ILE D 1 74  ? -24.099 -40.608 -55.318 1.00 42.43  ? 157 ILE D N   1 
ATOM   6203 C CA  . ILE D 1 74  ? -24.263 -39.219 -54.950 1.00 39.49  ? 157 ILE D CA  1 
ATOM   6204 C C   . ILE D 1 74  ? -24.267 -38.275 -56.151 1.00 40.81  ? 157 ILE D C   1 
ATOM   6205 O O   . ILE D 1 74  ? -23.436 -38.351 -57.070 1.00 38.15  ? 157 ILE D O   1 
ATOM   6206 C CB  . ILE D 1 74  ? -23.159 -38.749 -54.037 1.00 41.65  ? 157 ILE D CB  1 
ATOM   6207 C CG1 . ILE D 1 74  ? -23.121 -39.636 -52.804 1.00 41.39  ? 157 ILE D CG1 1 
ATOM   6208 C CG2 . ILE D 1 74  ? -23.333 -37.251 -53.732 1.00 40.13  ? 157 ILE D CG2 1 
ATOM   6209 C CD1 . ILE D 1 74  ? -23.225 -38.849 -51.521 1.00 44.57  ? 157 ILE D CD1 1 
ATOM   6210 N N   . PHE D 1 75  ? -25.205 -37.338 -56.095 1.00 40.88  ? 158 PHE D N   1 
ATOM   6211 C CA  . PHE D 1 75  ? -25.424 -36.460 -57.171 1.00 37.13  ? 158 PHE D CA  1 
ATOM   6212 C C   . PHE D 1 75  ? -25.463 -35.032 -56.656 1.00 37.41  ? 158 PHE D C   1 
ATOM   6213 O O   . PHE D 1 75  ? -26.326 -34.663 -55.869 1.00 38.90  ? 158 PHE D O   1 
ATOM   6214 C CB  . PHE D 1 75  ? -26.706 -36.863 -57.887 1.00 36.36  ? 158 PHE D CB  1 
ATOM   6215 C CG  . PHE D 1 75  ? -26.866 -36.232 -59.241 1.00 37.35  ? 158 PHE D CG  1 
ATOM   6216 C CD1 . PHE D 1 75  ? -27.056 -37.029 -60.378 1.00 38.82  ? 158 PHE D CD1 1 
ATOM   6217 C CD2 . PHE D 1 75  ? -26.807 -34.840 -59.397 1.00 37.04  ? 158 PHE D CD2 1 
ATOM   6218 C CE1 . PHE D 1 75  ? -27.205 -36.472 -61.644 1.00 37.43  ? 158 PHE D CE1 1 
ATOM   6219 C CE2 . PHE D 1 75  ? -26.949 -34.287 -60.681 1.00 40.61  ? 158 PHE D CE2 1 
ATOM   6220 C CZ  . PHE D 1 75  ? -27.143 -35.108 -61.797 1.00 37.48  ? 158 PHE D CZ  1 
ATOM   6221 N N   . ILE D 1 76  ? -24.514 -34.232 -57.130 1.00 39.70  ? 159 ILE D N   1 
ATOM   6222 C CA  . ILE D 1 76  ? -24.459 -32.791 -56.844 1.00 39.17  ? 159 ILE D CA  1 
ATOM   6223 C C   . ILE D 1 76  ? -24.712 -31.998 -58.126 1.00 40.53  ? 159 ILE D C   1 
ATOM   6224 O O   . ILE D 1 76  ? -23.960 -32.090 -59.088 1.00 38.40  ? 159 ILE D O   1 
ATOM   6225 C CB  . ILE D 1 76  ? -23.096 -32.413 -56.281 1.00 38.58  ? 159 ILE D CB  1 
ATOM   6226 C CG1 . ILE D 1 76  ? -22.869 -33.206 -54.982 1.00 36.86  ? 159 ILE D CG1 1 
ATOM   6227 C CG2 . ILE D 1 76  ? -22.967 -30.878 -56.159 1.00 35.86  ? 159 ILE D CG2 1 
ATOM   6228 C CD1 . ILE D 1 76  ? -21.535 -32.896 -54.344 1.00 39.37  ? 159 ILE D CD1 1 
ATOM   6229 N N   . ASP D 1 77  ? -25.774 -31.207 -58.087 1.00 41.94  ? 160 ASP D N   1 
ATOM   6230 C CA  . ASP D 1 77  ? -26.376 -30.568 -59.235 1.00 40.45  ? 160 ASP D CA  1 
ATOM   6231 C C   . ASP D 1 77  ? -26.110 -29.056 -59.129 1.00 42.84  ? 160 ASP D C   1 
ATOM   6232 O O   . ASP D 1 77  ? -26.507 -28.385 -58.119 1.00 37.70  ? 160 ASP D O   1 
ATOM   6233 C CB  . ASP D 1 77  ? -27.866 -30.863 -59.191 1.00 40.94  ? 160 ASP D CB  1 
ATOM   6234 C CG  . ASP D 1 77  ? -28.602 -30.363 -60.412 1.00 48.27  ? 160 ASP D CG  1 
ATOM   6235 O OD1 . ASP D 1 77  ? -27.939 -29.711 -61.269 1.00 49.15  ? 160 ASP D OD1 1 
ATOM   6236 O OD2 . ASP D 1 77  ? -29.855 -30.625 -60.515 1.00 47.28  ? 160 ASP D OD2 1 
ATOM   6237 N N   . THR D 1 78  ? -25.407 -28.525 -60.142 1.00 42.24  ? 161 THR D N   1 
ATOM   6238 C CA  . THR D 1 78  ? -25.161 -27.087 -60.199 1.00 43.80  ? 161 THR D CA  1 
ATOM   6239 C C   . THR D 1 78  ? -26.045 -26.454 -61.202 1.00 44.44  ? 161 THR D C   1 
ATOM   6240 O O   . THR D 1 78  ? -25.977 -25.254 -61.389 1.00 49.60  ? 161 THR D O   1 
ATOM   6241 C CB  . THR D 1 78  ? -23.712 -26.721 -60.578 1.00 42.91  ? 161 THR D CB  1 
ATOM   6242 O OG1 . THR D 1 78  ? -23.457 -27.095 -61.933 1.00 47.10  ? 161 THR D OG1 1 
ATOM   6243 C CG2 . THR D 1 78  ? -22.775 -27.420 -59.726 1.00 40.27  ? 161 THR D CG2 1 
ATOM   6244 N N   . GLU D 1 79  ? -26.843 -27.258 -61.884 1.00 45.85  ? 162 GLU D N   1 
ATOM   6245 C CA  . GLU D 1 79  ? -27.472 -26.807 -63.135 1.00 51.68  ? 162 GLU D CA  1 
ATOM   6246 C C   . GLU D 1 79  ? -28.989 -26.856 -63.065 1.00 52.73  ? 162 GLU D C   1 
ATOM   6247 O O   . GLU D 1 79  ? -29.654 -26.451 -64.013 1.00 50.69  ? 162 GLU D O   1 
ATOM   6248 C CB  . GLU D 1 79  ? -27.024 -27.690 -64.308 1.00 56.37  ? 162 GLU D CB  1 
ATOM   6249 C CG  . GLU D 1 79  ? -25.535 -27.779 -64.530 1.00 61.70  ? 162 GLU D CG  1 
ATOM   6250 C CD  . GLU D 1 79  ? -25.032 -26.495 -65.124 1.00 73.37  ? 162 GLU D CD  1 
ATOM   6251 O OE1 . GLU D 1 79  ? -24.603 -25.630 -64.323 1.00 74.17  ? 162 GLU D OE1 1 
ATOM   6252 O OE2 . GLU D 1 79  ? -25.129 -26.326 -66.372 1.00 80.37  ? 162 GLU D OE2 1 
ATOM   6253 N N   . ASN D 1 80  ? -29.528 -27.404 -61.968 1.00 51.72  ? 163 ASN D N   1 
ATOM   6254 C CA  . ASN D 1 80  ? -30.964 -27.448 -61.743 1.00 52.77  ? 163 ASN D CA  1 
ATOM   6255 C C   . ASN D 1 80  ? -31.590 -28.286 -62.843 1.00 54.64  ? 163 ASN D C   1 
ATOM   6256 O O   . ASN D 1 80  ? -32.703 -28.024 -63.234 1.00 53.95  ? 163 ASN D O   1 
ATOM   6257 C CB  . ASN D 1 80  ? -31.534 -26.018 -61.771 1.00 52.13  ? 163 ASN D CB  1 
ATOM   6258 C CG  . ASN D 1 80  ? -32.874 -25.864 -61.046 1.00 53.60  ? 163 ASN D CG  1 
ATOM   6259 O OD1 . ASN D 1 80  ? -33.214 -26.616 -60.115 1.00 54.35  ? 163 ASN D OD1 1 
ATOM   6260 N ND2 . ASN D 1 80  ? -33.632 -24.838 -61.455 1.00 51.00  ? 163 ASN D ND2 1 
ATOM   6261 N N   . THR D 1 81  ? -30.854 -29.268 -63.372 1.00 53.35  ? 164 THR D N   1 
ATOM   6262 C CA  . THR D 1 81  ? -31.417 -30.131 -64.404 1.00 53.11  ? 164 THR D CA  1 
ATOM   6263 C C   . THR D 1 81  ? -31.715 -31.573 -63.977 1.00 51.44  ? 164 THR D C   1 
ATOM   6264 O O   . THR D 1 81  ? -32.214 -32.364 -64.791 1.00 54.27  ? 164 THR D O   1 
ATOM   6265 C CB  . THR D 1 81  ? -30.588 -30.109 -65.724 1.00 56.28  ? 164 THR D CB  1 
ATOM   6266 O OG1 . THR D 1 81  ? -29.196 -30.187 -65.409 1.00 55.42  ? 164 THR D OG1 1 
ATOM   6267 C CG2 . THR D 1 81  ? -30.878 -28.819 -66.577 1.00 52.07  ? 164 THR D CG2 1 
ATOM   6268 N N   . PHE D 1 82  ? -31.438 -31.929 -62.723 1.00 49.18  ? 165 PHE D N   1 
ATOM   6269 C CA  . PHE D 1 82  ? -31.658 -33.310 -62.290 1.00 48.90  ? 165 PHE D CA  1 
ATOM   6270 C C   . PHE D 1 82  ? -33.146 -33.655 -62.220 1.00 51.20  ? 165 PHE D C   1 
ATOM   6271 O O   . PHE D 1 82  ? -33.902 -32.997 -61.509 1.00 53.21  ? 165 PHE D O   1 
ATOM   6272 C CB  . PHE D 1 82  ? -30.980 -33.598 -60.963 1.00 47.66  ? 165 PHE D CB  1 
ATOM   6273 C CG  . PHE D 1 82  ? -31.233 -34.992 -60.463 1.00 49.85  ? 165 PHE D CG  1 
ATOM   6274 C CD1 . PHE D 1 82  ? -32.021 -35.212 -59.346 1.00 50.33  ? 165 PHE D CD1 1 
ATOM   6275 C CD2 . PHE D 1 82  ? -30.724 -36.095 -61.142 1.00 52.71  ? 165 PHE D CD2 1 
ATOM   6276 C CE1 . PHE D 1 82  ? -32.270 -36.500 -58.884 1.00 49.32  ? 165 PHE D CE1 1 
ATOM   6277 C CE2 . PHE D 1 82  ? -30.980 -37.388 -60.694 1.00 53.05  ? 165 PHE D CE2 1 
ATOM   6278 C CZ  . PHE D 1 82  ? -31.758 -37.591 -59.566 1.00 51.05  ? 165 PHE D CZ  1 
ATOM   6279 N N   . ARG D 1 83  ? -33.605 -34.645 -62.979 1.00 51.63  ? 166 ARG D N   1 
ATOM   6280 C CA  . ARG D 1 83  ? -35.044 -34.950 -62.925 1.00 50.41  ? 166 ARG D CA  1 
ATOM   6281 C C   . ARG D 1 83  ? -35.291 -36.401 -62.578 1.00 51.17  ? 166 ARG D C   1 
ATOM   6282 O O   . ARG D 1 83  ? -35.259 -37.261 -63.496 1.00 50.64  ? 166 ARG D O   1 
ATOM   6283 C CB  . ARG D 1 83  ? -35.732 -34.735 -64.271 1.00 49.41  ? 166 ARG D CB  1 
ATOM   6284 C CG  . ARG D 1 83  ? -35.757 -33.370 -64.905 1.00 50.07  ? 166 ARG D CG  1 
ATOM   6285 C CD  . ARG D 1 83  ? -36.690 -32.374 -64.247 1.00 49.72  ? 166 ARG D CD  1 
ATOM   6286 N NE  . ARG D 1 83  ? -35.754 -31.546 -63.542 1.00 54.65  ? 166 ARG D NE  1 
ATOM   6287 C CZ  . ARG D 1 83  ? -35.640 -30.242 -63.666 1.00 51.40  ? 166 ARG D CZ  1 
ATOM   6288 N NH1 . ARG D 1 83  ? -36.490 -29.538 -64.385 1.00 49.14  ? 166 ARG D NH1 1 
ATOM   6289 N NH2 . ARG D 1 83  ? -34.681 -29.660 -63.002 1.00 51.87  ? 166 ARG D NH2 1 
ATOM   6290 N N   . PRO D 1 84  ? -35.622 -36.684 -61.304 1.00 49.71  ? 167 PRO D N   1 
ATOM   6291 C CA  . PRO D 1 84  ? -35.988 -38.063 -60.863 1.00 56.48  ? 167 PRO D CA  1 
ATOM   6292 C C   . PRO D 1 84  ? -36.932 -38.837 -61.817 1.00 59.26  ? 167 PRO D C   1 
ATOM   6293 O O   . PRO D 1 84  ? -36.913 -40.059 -61.833 1.00 63.78  ? 167 PRO D O   1 
ATOM   6294 C CB  . PRO D 1 84  ? -36.691 -37.840 -59.494 1.00 53.32  ? 167 PRO D CB  1 
ATOM   6295 C CG  . PRO D 1 84  ? -36.197 -36.518 -59.013 1.00 47.19  ? 167 PRO D CG  1 
ATOM   6296 C CD  . PRO D 1 84  ? -35.929 -35.689 -60.264 1.00 48.95  ? 167 PRO D CD  1 
ATOM   6297 N N   . ASP D 1 85  ? -37.739 -38.130 -62.596 1.00 62.72  ? 168 ASP D N   1 
ATOM   6298 C CA  . ASP D 1 85  ? -38.613 -38.773 -63.563 1.00 68.45  ? 168 ASP D CA  1 
ATOM   6299 C C   . ASP D 1 85  ? -37.837 -39.508 -64.671 1.00 67.72  ? 168 ASP D C   1 
ATOM   6300 O O   . ASP D 1 85  ? -38.205 -40.612 -65.056 1.00 67.61  ? 168 ASP D O   1 
ATOM   6301 C CB  . ASP D 1 85  ? -39.612 -37.761 -64.154 1.00 76.11  ? 168 ASP D CB  1 
ATOM   6302 C CG  . ASP D 1 85  ? -41.060 -38.026 -63.709 1.00 85.71  ? 168 ASP D CG  1 
ATOM   6303 O OD1 . ASP D 1 85  ? -41.800 -37.044 -63.412 1.00 88.11  ? 168 ASP D OD1 1 
ATOM   6304 O OD2 . ASP D 1 85  ? -41.460 -39.218 -63.673 1.00 88.24  ? 168 ASP D OD2 1 
ATOM   6305 N N   . ARG D 1 86  ? -36.763 -38.909 -65.175 1.00 63.99  ? 169 ARG D N   1 
ATOM   6306 C CA  . ARG D 1 86  ? -35.969 -39.578 -66.177 1.00 65.00  ? 169 ARG D CA  1 
ATOM   6307 C C   . ARG D 1 86  ? -35.458 -40.914 -65.641 1.00 66.89  ? 169 ARG D C   1 
ATOM   6308 O O   . ARG D 1 86  ? -35.339 -41.887 -66.390 1.00 73.06  ? 169 ARG D O   1 
ATOM   6309 C CB  . ARG D 1 86  ? -34.792 -38.722 -66.656 1.00 66.26  ? 169 ARG D CB  1 
ATOM   6310 C CG  . ARG D 1 86  ? -35.088 -37.547 -67.583 1.00 65.37  ? 169 ARG D CG  1 
ATOM   6311 C CD  . ARG D 1 86  ? -35.833 -37.925 -68.859 1.00 78.99  ? 169 ARG D CD  1 
ATOM   6312 N NE  . ARG D 1 86  ? -35.400 -39.110 -69.633 1.00 82.38  ? 169 ARG D NE  1 
ATOM   6313 C CZ  . ARG D 1 86  ? -34.149 -39.448 -69.948 1.00 81.62  ? 169 ARG D CZ  1 
ATOM   6314 N NH1 . ARG D 1 86  ? -33.099 -38.700 -69.564 1.00 76.41  ? 169 ARG D NH1 1 
ATOM   6315 N NH2 . ARG D 1 86  ? -33.959 -40.548 -70.672 1.00 80.57  ? 169 ARG D NH2 1 
ATOM   6316 N N   . LEU D 1 87  ? -35.179 -40.993 -64.345 1.00 65.80  ? 170 LEU D N   1 
ATOM   6317 C CA  . LEU D 1 87  ? -34.671 -42.254 -63.812 1.00 66.31  ? 170 LEU D CA  1 
ATOM   6318 C C   . LEU D 1 87  ? -35.699 -43.376 -63.891 1.00 69.99  ? 170 LEU D C   1 
ATOM   6319 O O   . LEU D 1 87  ? -35.330 -44.540 -63.869 1.00 73.26  ? 170 LEU D O   1 
ATOM   6320 C CB  . LEU D 1 87  ? -34.078 -42.111 -62.403 1.00 63.10  ? 170 LEU D CB  1 
ATOM   6321 C CG  . LEU D 1 87  ? -33.053 -40.977 -62.247 1.00 60.02  ? 170 LEU D CG  1 
ATOM   6322 C CD1 . LEU D 1 87  ? -32.235 -41.085 -60.971 1.00 53.97  ? 170 LEU D CD1 1 
ATOM   6323 C CD2 . LEU D 1 87  ? -32.127 -40.956 -63.441 1.00 60.54  ? 170 LEU D CD2 1 
ATOM   6324 N N   . ARG D 1 88  ? -36.974 -43.033 -64.033 1.00 72.93  ? 171 ARG D N   1 
ATOM   6325 C CA  . ARG D 1 88  ? -38.024 -44.044 -64.025 1.00 75.93  ? 171 ARG D CA  1 
ATOM   6326 C C   . ARG D 1 88  ? -38.096 -44.688 -65.374 1.00 81.90  ? 171 ARG D C   1 
ATOM   6327 O O   . ARG D 1 88  ? -38.320 -45.913 -65.502 1.00 80.75  ? 171 ARG D O   1 
ATOM   6328 C CB  . ARG D 1 88  ? -39.358 -43.419 -63.720 1.00 80.17  ? 171 ARG D CB  1 
ATOM   6329 C CG  . ARG D 1 88  ? -39.619 -43.137 -62.254 1.00 77.83  ? 171 ARG D CG  1 
ATOM   6330 C CD  . ARG D 1 88  ? -40.923 -42.371 -62.204 1.00 77.66  ? 171 ARG D CD  1 
ATOM   6331 N NE  . ARG D 1 88  ? -40.913 -41.459 -61.082 1.00 79.68  ? 171 ARG D NE  1 
ATOM   6332 C CZ  . ARG D 1 88  ? -41.433 -41.761 -59.902 1.00 84.65  ? 171 ARG D CZ  1 
ATOM   6333 N NH1 . ARG D 1 88  ? -42.012 -42.959 -59.718 1.00 85.07  ? 171 ARG D NH1 1 
ATOM   6334 N NH2 . ARG D 1 88  ? -41.378 -40.869 -58.916 1.00 79.61  ? 171 ARG D NH2 1 
ATOM   6335 N N   . ASP D 1 89  ? -37.900 -43.845 -66.386 1.00 83.96  ? 172 ASP D N   1 
ATOM   6336 C CA  . ASP D 1 89  ? -37.810 -44.296 -67.775 1.00 85.03  ? 172 ASP D CA  1 
ATOM   6337 C C   . ASP D 1 89  ? -36.627 -45.225 -67.986 1.00 81.49  ? 172 ASP D C   1 
ATOM   6338 O O   . ASP D 1 89  ? -36.740 -46.236 -68.667 1.00 86.78  ? 172 ASP D O   1 
ATOM   6339 C CB  . ASP D 1 89  ? -37.660 -43.093 -68.692 1.00 85.77  ? 172 ASP D CB  1 
ATOM   6340 C CG  . ASP D 1 89  ? -38.931 -42.316 -68.827 1.00 87.15  ? 172 ASP D CG  1 
ATOM   6341 O OD1 . ASP D 1 89  ? -39.031 -41.280 -68.131 1.00 78.91  ? 172 ASP D OD1 1 
ATOM   6342 O OD2 . ASP D 1 89  ? -39.804 -42.754 -69.630 1.00 88.59  ? 172 ASP D OD2 1 
ATOM   6343 N N   . ILE D 1 90  ? -35.489 -44.866 -67.403 1.00 73.94  ? 173 ILE D N   1 
ATOM   6344 C CA  . ILE D 1 90  ? -34.285 -45.630 -67.586 1.00 72.14  ? 173 ILE D CA  1 
ATOM   6345 C C   . ILE D 1 90  ? -34.418 -46.935 -66.810 1.00 76.26  ? 173 ILE D C   1 
ATOM   6346 O O   . ILE D 1 90  ? -33.987 -47.996 -67.290 1.00 78.41  ? 173 ILE D O   1 
ATOM   6347 C CB  . ILE D 1 90  ? -33.066 -44.812 -67.171 1.00 67.56  ? 173 ILE D CB  1 
ATOM   6348 C CG1 . ILE D 1 90  ? -33.017 -43.538 -68.014 1.00 67.79  ? 173 ILE D CG1 1 
ATOM   6349 C CG2 . ILE D 1 90  ? -31.792 -45.618 -67.324 1.00 65.96  ? 173 ILE D CG2 1 
ATOM   6350 C CD1 . ILE D 1 90  ? -32.066 -42.459 -67.529 1.00 63.58  ? 173 ILE D CD1 1 
ATOM   6351 N N   . ALA D 1 91  ? -35.069 -46.858 -65.646 1.00 74.38  ? 174 ALA D N   1 
ATOM   6352 C CA  . ALA D 1 91  ? -35.329 -48.036 -64.808 1.00 76.14  ? 174 ALA D CA  1 
ATOM   6353 C C   . ALA D 1 91  ? -36.287 -49.011 -65.478 1.00 80.32  ? 174 ALA D C   1 
ATOM   6354 O O   . ALA D 1 91  ? -36.242 -50.225 -65.228 1.00 83.66  ? 174 ALA D O   1 
ATOM   6355 C CB  . ALA D 1 91  ? -35.873 -47.623 -63.447 1.00 73.56  ? 174 ALA D CB  1 
ATOM   6356 N N   . ASP D 1 92  ? -37.174 -48.476 -66.306 1.00 82.25  ? 175 ASP D N   1 
ATOM   6357 C CA  . ASP D 1 92  ? -38.028 -49.332 -67.122 1.00 88.82  ? 175 ASP D CA  1 
ATOM   6358 C C   . ASP D 1 92  ? -37.145 -50.075 -68.103 1.00 88.84  ? 175 ASP D C   1 
ATOM   6359 O O   . ASP D 1 92  ? -37.223 -51.291 -68.196 1.00 95.21  ? 175 ASP D O   1 
ATOM   6360 C CB  . ASP D 1 92  ? -39.118 -48.525 -67.853 1.00 93.12  ? 175 ASP D CB  1 
ATOM   6361 C CG  . ASP D 1 92  ? -40.259 -48.079 -66.918 1.00 96.26  ? 175 ASP D CG  1 
ATOM   6362 O OD1 . ASP D 1 92  ? -40.303 -48.542 -65.754 1.00 98.98  ? 175 ASP D OD1 1 
ATOM   6363 O OD2 . ASP D 1 92  ? -41.118 -47.265 -67.338 1.00 98.26  ? 175 ASP D OD2 1 
ATOM   6364 N N   . ARG D 1 93  ? -36.266 -49.349 -68.790 1.00 84.50  ? 176 ARG D N   1 
ATOM   6365 C CA  . ARG D 1 93  ? -35.404 -49.955 -69.796 1.00 86.16  ? 176 ARG D CA  1 
ATOM   6366 C C   . ARG D 1 93  ? -34.581 -51.089 -69.197 1.00 86.10  ? 176 ARG D C   1 
ATOM   6367 O O   . ARG D 1 93  ? -34.366 -52.095 -69.842 1.00 85.56  ? 176 ARG D O   1 
ATOM   6368 C CB  . ARG D 1 93  ? -34.499 -48.905 -70.459 1.00 83.86  ? 176 ARG D CB  1 
ATOM   6369 C CG  . ARG D 1 93  ? -33.424 -49.487 -71.366 1.00 84.56  ? 176 ARG D CG  1 
ATOM   6370 C CD  . ARG D 1 93  ? -32.166 -48.630 -71.250 1.00 82.47  ? 176 ARG D CD  1 
ATOM   6371 N NE  . ARG D 1 93  ? -30.926 -49.286 -71.687 1.00 80.80  ? 176 ARG D NE  1 
ATOM   6372 C CZ  . ARG D 1 93  ? -29.890 -48.651 -72.231 1.00 78.48  ? 176 ARG D CZ  1 
ATOM   6373 N NH1 . ARG D 1 93  ? -29.922 -47.345 -72.412 1.00 80.18  ? 176 ARG D NH1 1 
ATOM   6374 N NH2 . ARG D 1 93  ? -28.811 -49.312 -72.589 1.00 79.37  ? 176 ARG D NH2 1 
ATOM   6375 N N   . PHE D 1 94  ? -34.135 -50.920 -67.956 1.00 84.44  ? 177 PHE D N   1 
ATOM   6376 C CA  . PHE D 1 94  ? -33.301 -51.934 -67.307 1.00 85.51  ? 177 PHE D CA  1 
ATOM   6377 C C   . PHE D 1 94  ? -34.155 -52.839 -66.422 1.00 87.40  ? 177 PHE D C   1 
ATOM   6378 O O   . PHE D 1 94  ? -33.625 -53.630 -65.658 1.00 88.50  ? 177 PHE D O   1 
ATOM   6379 C CB  . PHE D 1 94  ? -32.109 -51.305 -66.516 1.00 79.30  ? 177 PHE D CB  1 
ATOM   6380 C CG  . PHE D 1 94  ? -31.003 -50.754 -67.398 1.00 78.43  ? 177 PHE D CG  1 
ATOM   6381 C CD1 . PHE D 1 94  ? -30.855 -49.375 -67.590 1.00 76.33  ? 177 PHE D CD1 1 
ATOM   6382 C CD2 . PHE D 1 94  ? -30.113 -51.611 -68.055 1.00 79.96  ? 177 PHE D CD2 1 
ATOM   6383 C CE1 . PHE D 1 94  ? -29.859 -48.867 -68.418 1.00 75.12  ? 177 PHE D CE1 1 
ATOM   6384 C CE2 . PHE D 1 94  ? -29.110 -51.110 -68.883 1.00 77.72  ? 177 PHE D CE2 1 
ATOM   6385 C CZ  . PHE D 1 94  ? -28.984 -49.740 -69.069 1.00 77.89  ? 177 PHE D CZ  1 
ATOM   6386 N N   . ASN D 1 95  ? -35.474 -52.716 -66.530 1.00 90.35  ? 178 ASN D N   1 
ATOM   6387 C CA  . ASN D 1 95  ? -36.409 -53.573 -65.781 1.00 96.89  ? 178 ASN D CA  1 
ATOM   6388 C C   . ASN D 1 95  ? -36.215 -53.689 -64.253 1.00 95.95  ? 178 ASN D C   1 
ATOM   6389 O O   . ASN D 1 95  ? -36.230 -54.801 -63.716 1.00 98.65  ? 178 ASN D O   1 
ATOM   6390 C CB  . ASN D 1 95  ? -36.478 -54.980 -66.401 1.00 101.51 ? 178 ASN D CB  1 
ATOM   6391 C CG  . ASN D 1 95  ? -37.473 -55.068 -67.543 1.00 109.01 ? 178 ASN D CG  1 
ATOM   6392 O OD1 . ASN D 1 95  ? -38.595 -54.540 -67.471 1.00 112.40 ? 178 ASN D OD1 1 
ATOM   6393 N ND2 . ASN D 1 95  ? -37.069 -55.741 -68.607 1.00 110.68 ? 178 ASN D ND2 1 
ATOM   6394 N N   . VAL D 1 96  ? -36.049 -52.566 -63.553 1.00 90.02  ? 179 VAL D N   1 
ATOM   6395 C CA  . VAL D 1 96  ? -35.965 -52.621 -62.086 1.00 90.76  ? 179 VAL D CA  1 
ATOM   6396 C C   . VAL D 1 96  ? -37.011 -51.705 -61.454 1.00 89.03  ? 179 VAL D C   1 
ATOM   6397 O O   . VAL D 1 96  ? -37.654 -50.907 -62.149 1.00 86.87  ? 179 VAL D O   1 
ATOM   6398 C CB  . VAL D 1 96  ? -34.535 -52.328 -61.519 1.00 90.82  ? 179 VAL D CB  1 
ATOM   6399 C CG1 . VAL D 1 96  ? -34.309 -53.122 -60.229 1.00 91.94  ? 179 VAL D CG1 1 
ATOM   6400 C CG2 . VAL D 1 96  ? -33.429 -52.676 -62.518 1.00 83.27  ? 179 VAL D CG2 1 
ATOM   6401 N N   . ASP D 1 97  ? -37.187 -51.830 -60.142 1.00 89.04  ? 180 ASP D N   1 
ATOM   6402 C CA  . ASP D 1 97  ? -38.171 -51.034 -59.409 1.00 93.71  ? 180 ASP D CA  1 
ATOM   6403 C C   . ASP D 1 97  ? -37.769 -49.532 -59.298 1.00 90.88  ? 180 ASP D C   1 
ATOM   6404 O O   . ASP D 1 97  ? -36.684 -49.200 -58.776 1.00 88.50  ? 180 ASP D O   1 
ATOM   6405 C CB  . ASP D 1 97  ? -38.451 -51.697 -58.043 1.00 99.30  ? 180 ASP D CB  1 
ATOM   6406 C CG  . ASP D 1 97  ? -39.413 -50.891 -57.157 1.00 108.58 ? 180 ASP D CG  1 
ATOM   6407 O OD1 . ASP D 1 97  ? -39.113 -50.758 -55.949 1.00 113.30 ? 180 ASP D OD1 1 
ATOM   6408 O OD2 . ASP D 1 97  ? -40.460 -50.391 -57.637 1.00 113.29 ? 180 ASP D OD2 1 
ATOM   6409 N N   . HIS D 1 98  ? -38.650 -48.656 -59.817 1.00 90.66  ? 181 HIS D N   1 
ATOM   6410 C CA  . HIS D 1 98  ? -38.515 -47.176 -59.801 1.00 83.02  ? 181 HIS D CA  1 
ATOM   6411 C C   . HIS D 1 98  ? -38.167 -46.697 -58.439 1.00 79.99  ? 181 HIS D C   1 
ATOM   6412 O O   . HIS D 1 98  ? -37.342 -45.802 -58.263 1.00 81.09  ? 181 HIS D O   1 
ATOM   6413 C CB  . HIS D 1 98  ? -39.833 -46.482 -60.130 1.00 87.63  ? 181 HIS D CB  1 
ATOM   6414 C CG  . HIS D 1 98  ? -40.455 -46.850 -61.464 1.00 96.98  ? 181 HIS D CG  1 
ATOM   6415 N ND1 . HIS D 1 98  ? -41.555 -46.211 -61.940 1.00 102.70 ? 181 HIS D ND1 1 
ATOM   6416 C CD2 . HIS D 1 98  ? -40.119 -47.812 -62.414 1.00 102.82 ? 181 HIS D CD2 1 
ATOM   6417 C CE1 . HIS D 1 98  ? -41.899 -46.737 -63.125 1.00 110.70 ? 181 HIS D CE1 1 
ATOM   6418 N NE2 . HIS D 1 98  ? -41.020 -47.720 -63.415 1.00 110.71 ? 181 HIS D NE2 1 
ATOM   6419 N N   . ASP D 1 99  ? -38.831 -47.293 -57.458 1.00 82.06  ? 182 ASP D N   1 
ATOM   6420 C CA  . ASP D 1 99  ? -38.740 -46.891 -56.067 1.00 80.22  ? 182 ASP D CA  1 
ATOM   6421 C C   . ASP D 1 99  ? -37.370 -47.143 -55.406 1.00 75.77  ? 182 ASP D C   1 
ATOM   6422 O O   . ASP D 1 99  ? -36.805 -46.226 -54.813 1.00 71.64  ? 182 ASP D O   1 
ATOM   6423 C CB  . ASP D 1 99  ? -39.901 -47.512 -55.278 1.00 90.01  ? 182 ASP D CB  1 
ATOM   6424 C CG  . ASP D 1 99  ? -41.288 -47.021 -55.769 1.00 97.78  ? 182 ASP D CG  1 
ATOM   6425 O OD1 . ASP D 1 99  ? -42.069 -47.861 -56.295 1.00 107.16 ? 182 ASP D OD1 1 
ATOM   6426 O OD2 . ASP D 1 99  ? -41.588 -45.808 -55.633 1.00 83.65  ? 182 ASP D OD2 1 
ATOM   6427 N N   . ALA D 1 100 ? -36.832 -48.360 -55.527 1.00 72.58  ? 183 ALA D N   1 
ATOM   6428 C CA  . ALA D 1 100 ? -35.557 -48.680 -54.906 1.00 69.69  ? 183 ALA D CA  1 
ATOM   6429 C C   . ALA D 1 100 ? -34.410 -47.939 -55.605 1.00 67.67  ? 183 ALA D C   1 
ATOM   6430 O O   . ALA D 1 100 ? -33.360 -47.667 -54.988 1.00 63.01  ? 183 ALA D O   1 
ATOM   6431 C CB  . ALA D 1 100 ? -35.309 -50.187 -54.873 1.00 66.82  ? 183 ALA D CB  1 
ATOM   6432 N N   . VAL D 1 101 ? -34.617 -47.616 -56.883 1.00 66.80  ? 184 VAL D N   1 
ATOM   6433 C CA  . VAL D 1 101 ? -33.617 -46.886 -57.656 1.00 64.47  ? 184 VAL D CA  1 
ATOM   6434 C C   . VAL D 1 101 ? -33.541 -45.443 -57.209 1.00 60.97  ? 184 VAL D C   1 
ATOM   6435 O O   . VAL D 1 101 ? -32.463 -44.903 -57.093 1.00 58.59  ? 184 VAL D O   1 
ATOM   6436 C CB  . VAL D 1 101 ? -33.922 -46.890 -59.163 1.00 67.32  ? 184 VAL D CB  1 
ATOM   6437 C CG1 . VAL D 1 101 ? -33.380 -45.605 -59.813 1.00 65.01  ? 184 VAL D CG1 1 
ATOM   6438 C CG2 . VAL D 1 101 ? -33.319 -48.124 -59.813 1.00 66.95  ? 184 VAL D CG2 1 
ATOM   6439 N N   . LEU D 1 102 ? -34.701 -44.824 -56.982 1.00 61.59  ? 185 LEU D N   1 
ATOM   6440 C CA  . LEU D 1 102 ? -34.780 -43.426 -56.542 1.00 58.11  ? 185 LEU D CA  1 
ATOM   6441 C C   . LEU D 1 102 ? -34.253 -43.316 -55.127 1.00 58.65  ? 185 LEU D C   1 
ATOM   6442 O O   . LEU D 1 102 ? -33.721 -42.293 -54.707 1.00 59.18  ? 185 LEU D O   1 
ATOM   6443 C CB  . LEU D 1 102 ? -36.239 -42.961 -56.582 1.00 55.58  ? 185 LEU D CB  1 
ATOM   6444 C CG  . LEU D 1 102 ? -36.774 -42.098 -57.720 1.00 51.59  ? 185 LEU D CG  1 
ATOM   6445 C CD1 . LEU D 1 102 ? -35.924 -42.169 -58.966 1.00 50.28  ? 185 LEU D CD1 1 
ATOM   6446 C CD2 . LEU D 1 102 ? -38.183 -42.554 -58.023 1.00 55.91  ? 185 LEU D CD2 1 
ATOM   6447 N N   . ASP D 1 103 ? -34.407 -44.411 -54.405 1.00 61.39  ? 186 ASP D N   1 
ATOM   6448 C CA  . ASP D 1 103 ? -34.013 -44.503 -53.044 1.00 62.24  ? 186 ASP D CA  1 
ATOM   6449 C C   . ASP D 1 103 ? -32.504 -44.600 -52.860 1.00 60.67  ? 186 ASP D C   1 
ATOM   6450 O O   . ASP D 1 103 ? -32.013 -44.293 -51.801 1.00 61.18  ? 186 ASP D O   1 
ATOM   6451 C CB  . ASP D 1 103 ? -34.666 -45.737 -52.471 1.00 73.52  ? 186 ASP D CB  1 
ATOM   6452 C CG  . ASP D 1 103 ? -35.384 -45.443 -51.222 1.00 83.68  ? 186 ASP D CG  1 
ATOM   6453 O OD1 . ASP D 1 103 ? -34.677 -45.133 -50.234 1.00 91.93  ? 186 ASP D OD1 1 
ATOM   6454 O OD2 . ASP D 1 103 ? -36.636 -45.490 -51.237 1.00 84.09  ? 186 ASP D OD2 1 
ATOM   6455 N N   . ASN D 1 104 ? -31.772 -45.040 -53.880 1.00 57.26  ? 187 ASN D N   1 
ATOM   6456 C CA  . ASN D 1 104 ? -30.332 -45.243 -53.754 1.00 55.91  ? 187 ASN D CA  1 
ATOM   6457 C C   . ASN D 1 104 ? -29.442 -44.135 -54.352 1.00 54.26  ? 187 ASN D C   1 
ATOM   6458 O O   . ASN D 1 104 ? -28.236 -44.346 -54.555 1.00 51.16  ? 187 ASN D O   1 
ATOM   6459 C CB  . ASN D 1 104 ? -29.940 -46.554 -54.408 1.00 56.73  ? 187 ASN D CB  1 
ATOM   6460 C CG  . ASN D 1 104 ? -30.403 -47.743 -53.632 1.00 58.84  ? 187 ASN D CG  1 
ATOM   6461 O OD1 . ASN D 1 104 ? -30.383 -47.753 -52.396 1.00 62.19  ? 187 ASN D OD1 1 
ATOM   6462 N ND2 . ASN D 1 104 ? -30.828 -48.761 -54.348 1.00 60.32  ? 187 ASN D ND2 1 
ATOM   6463 N N   . VAL D 1 105 ? -30.041 -42.982 -54.641 1.00 48.36  ? 188 VAL D N   1 
ATOM   6464 C CA  . VAL D 1 105 ? -29.329 -41.866 -55.176 1.00 45.27  ? 188 VAL D CA  1 
ATOM   6465 C C   . VAL D 1 105 ? -29.537 -40.763 -54.164 1.00 47.59  ? 188 VAL D C   1 
ATOM   6466 O O   . VAL D 1 105 ? -30.698 -40.470 -53.840 1.00 46.83  ? 188 VAL D O   1 
ATOM   6467 C CB  . VAL D 1 105 ? -29.984 -41.355 -56.478 1.00 44.22  ? 188 VAL D CB  1 
ATOM   6468 C CG1 . VAL D 1 105 ? -29.254 -40.110 -56.949 1.00 41.44  ? 188 VAL D CG1 1 
ATOM   6469 C CG2 . VAL D 1 105 ? -30.011 -42.424 -57.578 1.00 43.09  ? 188 VAL D CG2 1 
ATOM   6470 N N   . LEU D 1 106 ? -28.436 -40.162 -53.679 1.00 45.67  ? 189 LEU D N   1 
ATOM   6471 C CA  . LEU D 1 106 ? -28.460 -39.002 -52.771 1.00 43.41  ? 189 LEU D CA  1 
ATOM   6472 C C   . LEU D 1 106 ? -28.208 -37.767 -53.585 1.00 44.18  ? 189 LEU D C   1 
ATOM   6473 O O   . LEU D 1 106 ? -27.287 -37.779 -54.439 1.00 40.46  ? 189 LEU D O   1 
ATOM   6474 C CB  . LEU D 1 106 ? -27.381 -39.137 -51.702 1.00 46.92  ? 189 LEU D CB  1 
ATOM   6475 C CG  . LEU D 1 106 ? -27.830 -39.384 -50.252 1.00 51.77  ? 189 LEU D CG  1 
ATOM   6476 C CD1 . LEU D 1 106 ? -29.146 -40.146 -50.207 1.00 50.47  ? 189 LEU D CD1 1 
ATOM   6477 C CD2 . LEU D 1 106 ? -26.741 -40.020 -49.391 1.00 47.90  ? 189 LEU D CD2 1 
ATOM   6478 N N   . TYR D 1 107 ? -29.024 -36.718 -53.352 1.00 42.79  ? 190 TYR D N   1 
ATOM   6479 C CA  . TYR D 1 107 ? -29.108 -35.552 -54.270 1.00 39.74  ? 190 TYR D CA  1 
ATOM   6480 C C   . TYR D 1 107 ? -28.979 -34.232 -53.521 1.00 41.12  ? 190 TYR D C   1 
ATOM   6481 O O   . TYR D 1 107 ? -29.510 -34.084 -52.402 1.00 39.51  ? 190 TYR D O   1 
ATOM   6482 C CB  . TYR D 1 107 ? -30.433 -35.548 -55.041 1.00 43.08  ? 190 TYR D CB  1 
ATOM   6483 C CG  . TYR D 1 107 ? -30.650 -34.300 -55.884 1.00 42.74  ? 190 TYR D CG  1 
ATOM   6484 C CD1 . TYR D 1 107 ? -29.992 -34.142 -57.075 1.00 41.67  ? 190 TYR D CD1 1 
ATOM   6485 C CD2 . TYR D 1 107 ? -31.497 -33.283 -55.472 1.00 43.19  ? 190 TYR D CD2 1 
ATOM   6486 C CE1 . TYR D 1 107 ? -30.160 -33.015 -57.845 1.00 43.04  ? 190 TYR D CE1 1 
ATOM   6487 C CE2 . TYR D 1 107 ? -31.669 -32.126 -56.239 1.00 44.55  ? 190 TYR D CE2 1 
ATOM   6488 C CZ  . TYR D 1 107 ? -30.988 -32.007 -57.441 1.00 46.56  ? 190 TYR D CZ  1 
ATOM   6489 O OH  . TYR D 1 107 ? -31.106 -30.875 -58.250 1.00 46.83  ? 190 TYR D OH  1 
ATOM   6490 N N   . ALA D 1 108 ? -28.273 -33.277 -54.121 1.00 37.46  ? 191 ALA D N   1 
ATOM   6491 C CA  . ALA D 1 108 ? -28.156 -31.966 -53.508 1.00 38.54  ? 191 ALA D CA  1 
ATOM   6492 C C   . ALA D 1 108 ? -27.810 -30.987 -54.570 1.00 40.62  ? 191 ALA D C   1 
ATOM   6493 O O   . ALA D 1 108 ? -27.025 -31.304 -55.506 1.00 41.06  ? 191 ALA D O   1 
ATOM   6494 C CB  . ALA D 1 108 ? -27.095 -31.924 -52.422 1.00 35.31  ? 191 ALA D CB  1 
ATOM   6495 N N   . ARG D 1 109 ? -28.418 -29.813 -54.424 1.00 37.98  ? 192 ARG D N   1 
ATOM   6496 C CA  . ARG D 1 109 ? -28.116 -28.689 -55.267 1.00 39.02  ? 192 ARG D CA  1 
ATOM   6497 C C   . ARG D 1 109 ? -27.008 -27.971 -54.536 1.00 39.50  ? 192 ARG D C   1 
ATOM   6498 O O   . ARG D 1 109 ? -27.035 -27.881 -53.300 1.00 42.69  ? 192 ARG D O   1 
ATOM   6499 C CB  . ARG D 1 109 ? -29.339 -27.743 -55.396 1.00 38.16  ? 192 ARG D CB  1 
ATOM   6500 C CG  . ARG D 1 109 ? -30.482 -28.230 -56.278 1.00 37.25  ? 192 ARG D CG  1 
ATOM   6501 C CD  . ARG D 1 109 ? -30.286 -27.952 -57.787 1.00 38.06  ? 192 ARG D CD  1 
ATOM   6502 N NE  . ARG D 1 109 ? -30.444 -26.522 -58.037 1.00 37.58  ? 192 ARG D NE  1 
ATOM   6503 C CZ  . ARG D 1 109 ? -29.485 -25.710 -58.462 1.00 36.05  ? 192 ARG D CZ  1 
ATOM   6504 N NH1 . ARG D 1 109 ? -28.282 -26.174 -58.794 1.00 34.25  ? 192 ARG D NH1 1 
ATOM   6505 N NH2 . ARG D 1 109 ? -29.757 -24.431 -58.606 1.00 37.29  ? 192 ARG D NH2 1 
ATOM   6506 N N   . ALA D 1 110 ? -26.075 -27.449 -55.313 1.00 40.62  ? 193 ALA D N   1 
ATOM   6507 C CA  . ALA D 1 110 ? -25.080 -26.458 -54.905 1.00 42.85  ? 193 ALA D CA  1 
ATOM   6508 C C   . ALA D 1 110 ? -25.399 -25.067 -55.536 1.00 44.09  ? 193 ALA D C   1 
ATOM   6509 O O   . ALA D 1 110 ? -25.607 -24.960 -56.739 1.00 49.69  ? 193 ALA D O   1 
ATOM   6510 C CB  . ALA D 1 110 ? -23.699 -26.936 -55.355 1.00 44.44  ? 193 ALA D CB  1 
ATOM   6511 N N   . TYR D 1 111 ? -25.395 -24.010 -54.742 1.00 45.53  ? 194 TYR D N   1 
ATOM   6512 C CA  . TYR D 1 111 ? -25.822 -22.669 -55.181 1.00 45.09  ? 194 TYR D CA  1 
ATOM   6513 C C   . TYR D 1 111 ? -24.652 -21.743 -55.337 1.00 47.52  ? 194 TYR D C   1 
ATOM   6514 O O   . TYR D 1 111 ? -24.767 -20.701 -56.004 1.00 52.15  ? 194 TYR D O   1 
ATOM   6515 C CB  . TYR D 1 111 ? -26.827 -22.055 -54.219 1.00 42.24  ? 194 TYR D CB  1 
ATOM   6516 C CG  . TYR D 1 111 ? -28.045 -22.901 -54.118 1.00 43.61  ? 194 TYR D CG  1 
ATOM   6517 C CD1 . TYR D 1 111 ? -28.225 -23.762 -53.047 1.00 44.90  ? 194 TYR D CD1 1 
ATOM   6518 C CD2 . TYR D 1 111 ? -29.007 -22.910 -55.143 1.00 43.28  ? 194 TYR D CD2 1 
ATOM   6519 C CE1 . TYR D 1 111 ? -29.358 -24.586 -52.983 1.00 46.07  ? 194 TYR D CE1 1 
ATOM   6520 C CE2 . TYR D 1 111 ? -30.140 -23.720 -55.088 1.00 41.45  ? 194 TYR D CE2 1 
ATOM   6521 C CZ  . TYR D 1 111 ? -30.314 -24.564 -54.010 1.00 43.82  ? 194 TYR D CZ  1 
ATOM   6522 O OH  . TYR D 1 111 ? -31.443 -25.381 -53.925 1.00 41.92  ? 194 TYR D OH  1 
ATOM   6523 N N   . THR D 1 112 ? -23.529 -22.118 -54.739 1.00 46.43  ? 195 THR D N   1 
ATOM   6524 C CA  . THR D 1 112 ? -22.277 -21.347 -54.895 1.00 49.06  ? 195 THR D CA  1 
ATOM   6525 C C   . THR D 1 112 ? -21.079 -22.276 -54.905 1.00 49.32  ? 195 THR D C   1 
ATOM   6526 O O   . THR D 1 112 ? -21.178 -23.452 -54.499 1.00 49.33  ? 195 THR D O   1 
ATOM   6527 C CB  . THR D 1 112 ? -22.038 -20.347 -53.754 1.00 46.54  ? 195 THR D CB  1 
ATOM   6528 O OG1 . THR D 1 112 ? -21.556 -21.079 -52.625 1.00 47.56  ? 195 THR D OG1 1 
ATOM   6529 C CG2 . THR D 1 112 ? -23.303 -19.574 -53.405 1.00 42.92  ? 195 THR D CG2 1 
ATOM   6530 N N   . SER D 1 113 ? -19.980 -21.742 -55.420 1.00 50.77  ? 196 SER D N   1 
ATOM   6531 C CA  . SER D 1 113 ? -18.663 -22.350 -55.347 1.00 50.50  ? 196 SER D CA  1 
ATOM   6532 C C   . SER D 1 113 ? -18.374 -22.898 -53.986 1.00 50.39  ? 196 SER D C   1 
ATOM   6533 O O   . SER D 1 113 ? -17.974 -24.035 -53.840 1.00 46.37  ? 196 SER D O   1 
ATOM   6534 C CB  . SER D 1 113 ? -17.598 -21.278 -55.588 1.00 55.52  ? 196 SER D CB  1 
ATOM   6535 O OG  . SER D 1 113 ? -17.292 -21.227 -56.948 1.00 60.33  ? 196 SER D OG  1 
ATOM   6536 N N   . GLU D 1 114 ? -18.500 -22.032 -52.984 1.00 56.97  ? 197 GLU D N   1 
ATOM   6537 C CA  . GLU D 1 114 ? -18.109 -22.397 -51.638 1.00 57.24  ? 197 GLU D CA  1 
ATOM   6538 C C   . GLU D 1 114 ? -19.020 -23.488 -51.138 1.00 52.50  ? 197 GLU D C   1 
ATOM   6539 O O   . GLU D 1 114 ? -18.537 -24.467 -50.566 1.00 50.60  ? 197 GLU D O   1 
ATOM   6540 C CB  . GLU D 1 114 ? -18.070 -21.180 -50.736 1.00 65.35  ? 197 GLU D CB  1 
ATOM   6541 C CG  . GLU D 1 114 ? -16.877 -20.285 -51.073 1.00 82.21  ? 197 GLU D CG  1 
ATOM   6542 C CD  . GLU D 1 114 ? -16.375 -19.471 -49.890 1.00 92.52  ? 197 GLU D CD  1 
ATOM   6543 O OE1 . GLU D 1 114 ? -17.221 -18.772 -49.249 1.00 92.76  ? 197 GLU D OE1 1 
ATOM   6544 O OE2 . GLU D 1 114 ? -15.138 -19.529 -49.624 1.00 87.65  ? 197 GLU D OE2 1 
ATOM   6545 N N   . HIS D 1 115 ? -20.312 -23.349 -51.456 1.00 46.83  ? 198 HIS D N   1 
ATOM   6546 C CA  . HIS D 1 115 ? -21.286 -24.363 -51.185 1.00 45.16  ? 198 HIS D CA  1 
ATOM   6547 C C   . HIS D 1 115 ? -20.866 -25.700 -51.789 1.00 45.29  ? 198 HIS D C   1 
ATOM   6548 O O   . HIS D 1 115 ? -20.873 -26.714 -51.110 1.00 46.73  ? 198 HIS D O   1 
ATOM   6549 C CB  . HIS D 1 115 ? -22.644 -23.886 -51.691 1.00 44.07  ? 198 HIS D CB  1 
ATOM   6550 C CG  . HIS D 1 115 ? -23.816 -24.774 -51.284 1.00 43.16  ? 198 HIS D CG  1 
ATOM   6551 N ND1 . HIS D 1 115 ? -23.805 -25.544 -50.180 1.00 45.63  ? 198 HIS D ND1 1 
ATOM   6552 C CD2 . HIS D 1 115 ? -25.056 -24.951 -51.861 1.00 40.71  ? 198 HIS D CD2 1 
ATOM   6553 C CE1 . HIS D 1 115 ? -24.982 -26.179 -50.057 1.00 43.26  ? 198 HIS D CE1 1 
ATOM   6554 N NE2 . HIS D 1 115 ? -25.741 -25.819 -51.096 1.00 43.62  ? 198 HIS D NE2 1 
ATOM   6555 N N   . GLN D 1 116 ? -20.456 -25.701 -53.055 1.00 46.49  ? 199 GLN D N   1 
ATOM   6556 C CA  . GLN D 1 116 ? -20.002 -26.907 -53.758 1.00 45.70  ? 199 GLN D CA  1 
ATOM   6557 C C   . GLN D 1 116 ? -18.890 -27.628 -52.979 1.00 46.38  ? 199 GLN D C   1 
ATOM   6558 O O   . GLN D 1 116 ? -18.912 -28.829 -52.856 1.00 46.61  ? 199 GLN D O   1 
ATOM   6559 C CB  . GLN D 1 116 ? -19.496 -26.533 -55.167 1.00 43.63  ? 199 GLN D CB  1 
ATOM   6560 C CG  . GLN D 1 116 ? -19.364 -27.720 -56.095 1.00 44.23  ? 199 GLN D CG  1 
ATOM   6561 C CD  . GLN D 1 116 ? -18.959 -27.369 -57.514 1.00 49.09  ? 199 GLN D CD  1 
ATOM   6562 O OE1 . GLN D 1 116 ? -18.149 -28.089 -58.125 1.00 54.25  ? 199 GLN D OE1 1 
ATOM   6563 N NE2 . GLN D 1 116 ? -19.490 -26.267 -58.052 1.00 46.56  ? 199 GLN D NE2 1 
ATOM   6564 N N   . MET D 1 117 ? -17.920 -26.875 -52.468 1.00 48.62  ? 200 MET D N   1 
ATOM   6565 C CA  . MET D 1 117 ? -16.815 -27.423 -51.724 1.00 49.77  ? 200 MET D CA  1 
ATOM   6566 C C   . MET D 1 117 ? -17.308 -27.929 -50.359 1.00 53.04  ? 200 MET D C   1 
ATOM   6567 O O   . MET D 1 117 ? -16.902 -29.005 -49.924 1.00 55.84  ? 200 MET D O   1 
ATOM   6568 C CB  . MET D 1 117 ? -15.693 -26.378 -51.589 1.00 51.61  ? 200 MET D CB  1 
ATOM   6569 C CG  . MET D 1 117 ? -14.362 -26.836 -50.962 1.00 54.52  ? 200 MET D CG  1 
ATOM   6570 S SD  . MET D 1 117 ? -13.538 -28.418 -51.423 1.00 64.93  ? 200 MET D SD  1 
ATOM   6571 C CE  . MET D 1 117 ? -11.823 -27.930 -51.133 1.00 63.59  ? 200 MET D CE  1 
ATOM   6572 N N   . GLU D 1 118 ? -18.194 -27.204 -49.680 1.00 52.16  ? 201 GLU D N   1 
ATOM   6573 C CA  . GLU D 1 118 ? -18.764 -27.768 -48.447 1.00 53.19  ? 201 GLU D CA  1 
ATOM   6574 C C   . GLU D 1 118 ? -19.458 -29.128 -48.649 1.00 54.21  ? 201 GLU D C   1 
ATOM   6575 O O   . GLU D 1 118 ? -19.426 -29.982 -47.740 1.00 54.79  ? 201 GLU D O   1 
ATOM   6576 C CB  . GLU D 1 118 ? -19.795 -26.855 -47.864 1.00 54.74  ? 201 GLU D CB  1 
ATOM   6577 C CG  . GLU D 1 118 ? -19.254 -25.687 -47.080 1.00 68.66  ? 201 GLU D CG  1 
ATOM   6578 C CD  . GLU D 1 118 ? -20.296 -24.571 -46.933 1.00 75.62  ? 201 GLU D CD  1 
ATOM   6579 O OE1 . GLU D 1 118 ? -19.869 -23.388 -46.956 1.00 74.89  ? 201 GLU D OE1 1 
ATOM   6580 O OE2 . GLU D 1 118 ? -21.530 -24.878 -46.834 1.00 71.14  ? 201 GLU D OE2 1 
ATOM   6581 N N   . LEU D 1 119 ? -20.118 -29.325 -49.801 1.00 46.03  ? 202 LEU D N   1 
ATOM   6582 C CA  . LEU D 1 119 ? -20.888 -30.529 -49.971 1.00 43.98  ? 202 LEU D CA  1 
ATOM   6583 C C   . LEU D 1 119 ? -19.928 -31.705 -50.142 1.00 45.27  ? 202 LEU D C   1 
ATOM   6584 O O   . LEU D 1 119 ? -20.163 -32.818 -49.609 1.00 42.55  ? 202 LEU D O   1 
ATOM   6585 C CB  . LEU D 1 119 ? -21.816 -30.411 -51.157 1.00 42.68  ? 202 LEU D CB  1 
ATOM   6586 C CG  . LEU D 1 119 ? -23.107 -29.606 -51.020 1.00 43.36  ? 202 LEU D CG  1 
ATOM   6587 C CD1 . LEU D 1 119 ? -23.664 -29.500 -52.427 1.00 38.73  ? 202 LEU D CD1 1 
ATOM   6588 C CD2 . LEU D 1 119 ? -24.112 -30.216 -50.056 1.00 40.01  ? 202 LEU D CD2 1 
ATOM   6589 N N   . LEU D 1 120 ? -18.828 -31.459 -50.859 1.00 45.83  ? 203 LEU D N   1 
ATOM   6590 C CA  . LEU D 1 120 ? -17.755 -32.452 -50.958 1.00 45.70  ? 203 LEU D CA  1 
ATOM   6591 C C   . LEU D 1 120 ? -17.310 -32.927 -49.596 1.00 47.90  ? 203 LEU D C   1 
ATOM   6592 O O   . LEU D 1 120 ? -17.116 -34.136 -49.397 1.00 49.70  ? 203 LEU D O   1 
ATOM   6593 C CB  . LEU D 1 120 ? -16.578 -31.893 -51.680 1.00 45.80  ? 203 LEU D CB  1 
ATOM   6594 C CG  . LEU D 1 120 ? -16.466 -32.374 -53.121 1.00 50.87  ? 203 LEU D CG  1 
ATOM   6595 C CD1 . LEU D 1 120 ? -17.702 -33.088 -53.676 1.00 50.11  ? 203 LEU D CD1 1 
ATOM   6596 C CD2 . LEU D 1 120 ? -16.108 -31.206 -53.994 1.00 47.95  ? 203 LEU D CD2 1 
ATOM   6597 N N   . ASP D 1 121 ? -17.212 -32.013 -48.633 1.00 46.09  ? 204 ASP D N   1 
ATOM   6598 C CA  . ASP D 1 121 ? -16.676 -32.428 -47.347 1.00 54.27  ? 204 ASP D CA  1 
ATOM   6599 C C   . ASP D 1 121 ? -17.691 -33.291 -46.621 1.00 51.64  ? 204 ASP D C   1 
ATOM   6600 O O   . ASP D 1 121 ? -17.365 -34.326 -46.074 1.00 57.02  ? 204 ASP D O   1 
ATOM   6601 C CB  . ASP D 1 121 ? -16.032 -31.261 -46.549 1.00 64.00  ? 204 ASP D CB  1 
ATOM   6602 C CG  . ASP D 1 121 ? -14.760 -30.662 -47.286 1.00 71.35  ? 204 ASP D CG  1 
ATOM   6603 O OD1 . ASP D 1 121 ? -14.012 -31.378 -48.035 1.00 67.22  ? 204 ASP D OD1 1 
ATOM   6604 O OD2 . ASP D 1 121 ? -14.518 -29.445 -47.135 1.00 77.15  ? 204 ASP D OD2 1 
ATOM   6605 N N   . TYR D 1 122 ? -18.947 -32.943 -46.740 1.00 50.64  ? 205 TYR D N   1 
ATOM   6606 C CA  . TYR D 1 122 ? -19.975 -33.855 -46.334 1.00 49.24  ? 205 TYR D CA  1 
ATOM   6607 C C   . TYR D 1 122 ? -19.973 -35.262 -47.003 1.00 49.80  ? 205 TYR D C   1 
ATOM   6608 O O   . TYR D 1 122 ? -20.058 -36.248 -46.308 1.00 56.90  ? 205 TYR D O   1 
ATOM   6609 C CB  . TYR D 1 122 ? -21.318 -33.203 -46.562 1.00 51.64  ? 205 TYR D CB  1 
ATOM   6610 C CG  . TYR D 1 122 ? -22.360 -34.032 -45.937 1.00 57.72  ? 205 TYR D CG  1 
ATOM   6611 C CD1 . TYR D 1 122 ? -23.172 -34.875 -46.714 1.00 54.12  ? 205 TYR D CD1 1 
ATOM   6612 C CD2 . TYR D 1 122 ? -22.489 -34.053 -44.521 1.00 64.68  ? 205 TYR D CD2 1 
ATOM   6613 C CE1 . TYR D 1 122 ? -24.140 -35.685 -46.104 1.00 63.32  ? 205 TYR D CE1 1 
ATOM   6614 C CE2 . TYR D 1 122 ? -23.443 -34.853 -43.908 1.00 70.48  ? 205 TYR D CE2 1 
ATOM   6615 C CZ  . TYR D 1 122 ? -24.279 -35.652 -44.697 1.00 68.10  ? 205 TYR D CZ  1 
ATOM   6616 O OH  . TYR D 1 122 ? -25.204 -36.444 -44.063 1.00 71.70  ? 205 TYR D OH  1 
ATOM   6617 N N   . VAL D 1 123 ? -19.985 -35.352 -48.330 1.00 43.27  ? 206 VAL D N   1 
ATOM   6618 C CA  . VAL D 1 123 ? -19.700 -36.608 -49.058 1.00 44.84  ? 206 VAL D CA  1 
ATOM   6619 C C   . VAL D 1 123 ? -18.446 -37.408 -48.571 1.00 46.17  ? 206 VAL D C   1 
ATOM   6620 O O   . VAL D 1 123 ? -18.545 -38.583 -48.215 1.00 46.06  ? 206 VAL D O   1 
ATOM   6621 C CB  . VAL D 1 123 ? -19.476 -36.283 -50.553 1.00 40.23  ? 206 VAL D CB  1 
ATOM   6622 C CG1 . VAL D 1 123 ? -18.976 -37.463 -51.308 1.00 36.46  ? 206 VAL D CG1 1 
ATOM   6623 C CG2 . VAL D 1 123 ? -20.739 -35.740 -51.155 1.00 40.88  ? 206 VAL D CG2 1 
ATOM   6624 N N   . ALA D 1 124 ? -17.262 -36.799 -48.538 1.00 45.93  ? 207 ALA D N   1 
ATOM   6625 C CA  . ALA D 1 124 ? -16.115 -37.581 -48.044 1.00 48.73  ? 207 ALA D CA  1 
ATOM   6626 C C   . ALA D 1 124 ? -16.462 -38.302 -46.734 1.00 54.67  ? 207 ALA D C   1 
ATOM   6627 O O   . ALA D 1 124 ? -16.262 -39.525 -46.614 1.00 55.69  ? 207 ALA D O   1 
ATOM   6628 C CB  . ALA D 1 124 ? -14.854 -36.749 -47.924 1.00 44.79  ? 207 ALA D CB  1 
ATOM   6629 N N   . ALA D 1 125 ? -17.034 -37.561 -45.779 1.00 57.30  ? 208 ALA D N   1 
ATOM   6630 C CA  . ALA D 1 125 ? -17.448 -38.135 -44.498 1.00 61.19  ? 208 ALA D CA  1 
ATOM   6631 C C   . ALA D 1 125 ? -18.592 -39.173 -44.645 1.00 59.86  ? 208 ALA D C   1 
ATOM   6632 O O   . ALA D 1 125 ? -18.642 -40.204 -43.975 1.00 59.88  ? 208 ALA D O   1 
ATOM   6633 C CB  . ALA D 1 125 ? -17.799 -37.017 -43.521 1.00 65.72  ? 208 ALA D CB  1 
ATOM   6634 N N   . LYS D 1 126 ? -19.482 -38.949 -45.584 1.00 60.30  ? 209 LYS D N   1 
ATOM   6635 C CA  . LYS D 1 126 ? -20.480 -39.967 -45.884 1.00 58.37  ? 209 LYS D CA  1 
ATOM   6636 C C   . LYS D 1 126 ? -19.829 -41.251 -46.422 1.00 60.59  ? 209 LYS D C   1 
ATOM   6637 O O   . LYS D 1 126 ? -20.335 -42.364 -46.196 1.00 61.12  ? 209 LYS D O   1 
ATOM   6638 C CB  . LYS D 1 126 ? -21.538 -39.402 -46.821 1.00 52.70  ? 209 LYS D CB  1 
ATOM   6639 C CG  . LYS D 1 126 ? -22.503 -40.398 -47.434 1.00 57.46  ? 209 LYS D CG  1 
ATOM   6640 C CD  . LYS D 1 126 ? -23.483 -41.037 -46.470 1.00 56.28  ? 209 LYS D CD  1 
ATOM   6641 C CE  . LYS D 1 126 ? -24.686 -40.146 -46.237 1.00 58.42  ? 209 LYS D CE  1 
ATOM   6642 N NZ  . LYS D 1 126 ? -25.733 -40.998 -45.602 1.00 59.41  ? 209 LYS D NZ  1 
ATOM   6643 N N   . PHE D 1 127 ? -18.691 -41.119 -47.097 1.00 59.53  ? 210 PHE D N   1 
ATOM   6644 C CA  . PHE D 1 127 ? -18.056 -42.320 -47.650 1.00 62.06  ? 210 PHE D CA  1 
ATOM   6645 C C   . PHE D 1 127 ? -17.282 -43.018 -46.555 1.00 66.98  ? 210 PHE D C   1 
ATOM   6646 O O   . PHE D 1 127 ? -17.354 -44.245 -46.412 1.00 72.94  ? 210 PHE D O   1 
ATOM   6647 C CB  . PHE D 1 127 ? -17.139 -42.012 -48.829 1.00 54.76  ? 210 PHE D CB  1 
ATOM   6648 C CG  . PHE D 1 127 ? -17.861 -41.596 -50.053 1.00 50.05  ? 210 PHE D CG  1 
ATOM   6649 C CD1 . PHE D 1 127 ? -19.223 -41.756 -50.147 1.00 48.31  ? 210 PHE D CD1 1 
ATOM   6650 C CD2 . PHE D 1 127 ? -17.162 -41.061 -51.127 1.00 48.18  ? 210 PHE D CD2 1 
ATOM   6651 C CE1 . PHE D 1 127 ? -19.886 -41.367 -51.298 1.00 51.96  ? 210 PHE D CE1 1 
ATOM   6652 C CE2 . PHE D 1 127 ? -17.810 -40.706 -52.296 1.00 47.94  ? 210 PHE D CE2 1 
ATOM   6653 C CZ  . PHE D 1 127 ? -19.183 -40.850 -52.381 1.00 47.41  ? 210 PHE D CZ  1 
ATOM   6654 N N   . HIS D 1 128 ? -16.553 -42.217 -45.789 1.00 67.85  ? 211 HIS D N   1 
ATOM   6655 C CA  . HIS D 1 128 ? -15.921 -42.661 -44.560 1.00 75.14  ? 211 HIS D CA  1 
ATOM   6656 C C   . HIS D 1 128 ? -16.814 -43.548 -43.705 1.00 72.51  ? 211 HIS D C   1 
ATOM   6657 O O   . HIS D 1 128 ? -16.333 -44.493 -43.116 1.00 77.54  ? 211 HIS D O   1 
ATOM   6658 C CB  . HIS D 1 128 ? -15.445 -41.438 -43.790 1.00 80.84  ? 211 HIS D CB  1 
ATOM   6659 C CG  . HIS D 1 128 ? -14.384 -41.727 -42.763 1.00 86.79  ? 211 HIS D CG  1 
ATOM   6660 N ND1 . HIS D 1 128 ? -13.070 -41.790 -43.075 1.00 84.78  ? 211 HIS D ND1 1 
ATOM   6661 C CD2 . HIS D 1 128 ? -14.479 -41.929 -41.377 1.00 90.58  ? 211 HIS D CD2 1 
ATOM   6662 C CE1 . HIS D 1 128 ? -12.361 -42.038 -41.954 1.00 90.31  ? 211 HIS D CE1 1 
ATOM   6663 N NE2 . HIS D 1 128 ? -13.228 -42.125 -40.916 1.00 94.44  ? 211 HIS D NE2 1 
ATOM   6664 N N   . GLU D 1 129 ? -18.118 -43.302 -43.681 1.00 72.02  ? 212 GLU D N   1 
ATOM   6665 C CA  . GLU D 1 129 ? -18.991 -43.990 -42.730 1.00 80.09  ? 212 GLU D CA  1 
ATOM   6666 C C   . GLU D 1 129 ? -19.144 -45.460 -42.941 1.00 81.97  ? 212 GLU D C   1 
ATOM   6667 O O   . GLU D 1 129 ? -19.195 -46.231 -41.976 1.00 89.17  ? 212 GLU D O   1 
ATOM   6668 C CB  . GLU D 1 129 ? -20.357 -43.317 -42.613 1.00 84.02  ? 212 GLU D CB  1 
ATOM   6669 C CG  . GLU D 1 129 ? -20.410 -42.424 -41.375 1.00 84.25  ? 212 GLU D CG  1 
ATOM   6670 C CD  . GLU D 1 129 ? -21.768 -41.825 -41.115 1.00 85.55  ? 212 GLU D CD  1 
ATOM   6671 O OE1 . GLU D 1 129 ? -21.893 -41.147 -40.074 1.00 85.23  ? 212 GLU D OE1 1 
ATOM   6672 O OE2 . GLU D 1 129 ? -22.688 -42.021 -41.954 1.00 85.24  ? 212 GLU D OE2 1 
ATOM   6673 N N   . GLU D 1 130 ? -19.221 -45.860 -44.195 1.00 80.54  ? 213 GLU D N   1 
ATOM   6674 C CA  . GLU D 1 130 ? -19.099 -47.274 -44.496 1.00 86.17  ? 213 GLU D CA  1 
ATOM   6675 C C   . GLU D 1 130 ? -18.620 -47.491 -45.909 1.00 78.33  ? 213 GLU D C   1 
ATOM   6676 O O   . GLU D 1 130 ? -19.175 -46.936 -46.845 1.00 76.26  ? 213 GLU D O   1 
ATOM   6677 C CB  . GLU D 1 130 ? -20.409 -48.014 -44.257 1.00 92.57  ? 213 GLU D CB  1 
ATOM   6678 C CG  . GLU D 1 130 ? -20.283 -49.511 -44.461 1.00 98.62  ? 213 GLU D CG  1 
ATOM   6679 C CD  . GLU D 1 130 ? -21.572 -50.225 -44.165 1.00 105.50 ? 213 GLU D CD  1 
ATOM   6680 O OE1 . GLU D 1 130 ? -22.638 -49.585 -44.287 1.00 108.29 ? 213 GLU D OE1 1 
ATOM   6681 O OE2 . GLU D 1 130 ? -21.517 -51.420 -43.811 1.00 114.78 ? 213 GLU D OE2 1 
ATOM   6682 N N   . ALA D 1 131 ? -17.585 -48.313 -46.019 1.00 76.68  ? 214 ALA D N   1 
ATOM   6683 C CA  . ALA D 1 131 ? -16.901 -48.640 -47.259 1.00 75.52  ? 214 ALA D CA  1 
ATOM   6684 C C   . ALA D 1 131 ? -17.841 -49.304 -48.228 1.00 75.44  ? 214 ALA D C   1 
ATOM   6685 O O   . ALA D 1 131 ? -18.796 -49.980 -47.827 1.00 84.79  ? 214 ALA D O   1 
ATOM   6686 C CB  . ALA D 1 131 ? -15.735 -49.593 -46.973 1.00 75.62  ? 214 ALA D CB  1 
ATOM   6687 N N   . GLY D 1 132 ? -17.564 -49.111 -49.506 1.00 69.99  ? 215 GLY D N   1 
ATOM   6688 C CA  . GLY D 1 132 ? -18.185 -49.919 -50.531 1.00 70.69  ? 215 GLY D CA  1 
ATOM   6689 C C   . GLY D 1 132 ? -19.699 -49.892 -50.538 1.00 71.44  ? 215 GLY D C   1 
ATOM   6690 O O   . GLY D 1 132 ? -20.315 -50.740 -51.178 1.00 76.76  ? 215 GLY D O   1 
ATOM   6691 N N   . ILE D 1 133 ? -20.317 -48.946 -49.831 1.00 68.47  ? 216 ILE D N   1 
ATOM   6692 C CA  . ILE D 1 133 ? -21.757 -48.744 -50.042 1.00 67.73  ? 216 ILE D CA  1 
ATOM   6693 C C   . ILE D 1 133 ? -21.985 -47.779 -51.201 1.00 60.20  ? 216 ILE D C   1 
ATOM   6694 O O   . ILE D 1 133 ? -22.805 -48.082 -52.074 1.00 61.17  ? 216 ILE D O   1 
ATOM   6695 C CB  . ILE D 1 133 ? -22.602 -48.455 -48.765 1.00 72.73  ? 216 ILE D CB  1 
ATOM   6696 C CG1 . ILE D 1 133 ? -22.087 -47.223 -48.018 1.00 76.48  ? 216 ILE D CG1 1 
ATOM   6697 C CG2 . ILE D 1 133 ? -22.654 -49.701 -47.863 1.00 68.07  ? 216 ILE D CG2 1 
ATOM   6698 C CD1 . ILE D 1 133 ? -23.062 -46.686 -46.980 1.00 92.69  ? 216 ILE D CD1 1 
ATOM   6699 N N   . PHE D 1 134 ? -21.211 -46.684 -51.262 1.00 54.15  ? 217 PHE D N   1 
ATOM   6700 C CA  . PHE D 1 134 ? -21.270 -45.758 -52.398 1.00 48.29  ? 217 PHE D CA  1 
ATOM   6701 C C   . PHE D 1 134 ? -20.276 -46.052 -53.526 1.00 50.39  ? 217 PHE D C   1 
ATOM   6702 O O   . PHE D 1 134 ? -19.096 -46.265 -53.241 1.00 52.63  ? 217 PHE D O   1 
ATOM   6703 C CB  . PHE D 1 134 ? -21.146 -44.351 -51.917 1.00 43.61  ? 217 PHE D CB  1 
ATOM   6704 C CG  . PHE D 1 134 ? -22.414 -43.830 -51.318 1.00 47.14  ? 217 PHE D CG  1 
ATOM   6705 C CD1 . PHE D 1 134 ? -22.693 -44.002 -49.946 1.00 50.69  ? 217 PHE D CD1 1 
ATOM   6706 C CD2 . PHE D 1 134 ? -23.369 -43.210 -52.115 1.00 47.52  ? 217 PHE D CD2 1 
ATOM   6707 C CE1 . PHE D 1 134 ? -23.886 -43.536 -49.385 1.00 49.55  ? 217 PHE D CE1 1 
ATOM   6708 C CE2 . PHE D 1 134 ? -24.558 -42.720 -51.572 1.00 50.80  ? 217 PHE D CE2 1 
ATOM   6709 C CZ  . PHE D 1 134 ? -24.823 -42.898 -50.199 1.00 52.83  ? 217 PHE D CZ  1 
ATOM   6710 N N   . LYS D 1 135 ? -20.762 -46.098 -54.784 1.00 48.76  ? 218 LYS D N   1 
ATOM   6711 C CA  . LYS D 1 135 ? -19.938 -46.381 -55.999 1.00 46.70  ? 218 LYS D CA  1 
ATOM   6712 C C   . LYS D 1 135 ? -19.720 -45.202 -56.981 1.00 46.95  ? 218 LYS D C   1 
ATOM   6713 O O   . LYS D 1 135 ? -18.695 -45.170 -57.683 1.00 45.49  ? 218 LYS D O   1 
ATOM   6714 C CB  . LYS D 1 135 ? -20.482 -47.568 -56.779 1.00 49.76  ? 218 LYS D CB  1 
ATOM   6715 C CG  . LYS D 1 135 ? -20.773 -48.780 -55.906 1.00 56.80  ? 218 LYS D CG  1 
ATOM   6716 C CD  . LYS D 1 135 ? -19.501 -49.462 -55.468 1.00 56.43  ? 218 LYS D CD  1 
ATOM   6717 C CE  . LYS D 1 135 ? -19.775 -50.630 -54.550 1.00 60.03  ? 218 LYS D CE  1 
ATOM   6718 N NZ  . LYS D 1 135 ? -18.544 -50.821 -53.723 1.00 64.05  ? 218 LYS D NZ  1 
ATOM   6719 N N   . LEU D 1 136 ? -20.641 -44.225 -57.003 1.00 44.42  ? 219 LEU D N   1 
ATOM   6720 C CA  . LEU D 1 136 ? -20.582 -43.143 -57.969 1.00 43.12  ? 219 LEU D CA  1 
ATOM   6721 C C   . LEU D 1 136 ? -20.753 -41.852 -57.287 1.00 44.01  ? 219 LEU D C   1 
ATOM   6722 O O   . LEU D 1 136 ? -21.606 -41.730 -56.400 1.00 45.90  ? 219 LEU D O   1 
ATOM   6723 C CB  . LEU D 1 136 ? -21.744 -43.221 -58.949 1.00 42.95  ? 219 LEU D CB  1 
ATOM   6724 C CG  . LEU D 1 136 ? -21.456 -42.888 -60.403 1.00 42.80  ? 219 LEU D CG  1 
ATOM   6725 C CD1 . LEU D 1 136 ? -22.761 -42.756 -61.189 1.00 42.80  ? 219 LEU D CD1 1 
ATOM   6726 C CD2 . LEU D 1 136 ? -20.538 -41.699 -60.643 1.00 41.78  ? 219 LEU D CD2 1 
ATOM   6727 N N   . LEU D 1 137 ? -19.969 -40.878 -57.732 1.00 44.46  ? 220 LEU D N   1 
ATOM   6728 C CA  . LEU D 1 137 ? -20.138 -39.497 -57.321 1.00 42.28  ? 220 LEU D CA  1 
ATOM   6729 C C   . LEU D 1 137 ? -20.241 -38.689 -58.608 1.00 42.90  ? 220 LEU D C   1 
ATOM   6730 O O   . LEU D 1 137 ? -19.274 -38.603 -59.355 1.00 43.33  ? 220 LEU D O   1 
ATOM   6731 C CB  . LEU D 1 137 ? -18.946 -38.999 -56.543 1.00 36.74  ? 220 LEU D CB  1 
ATOM   6732 C CG  . LEU D 1 137 ? -19.050 -37.632 -55.806 1.00 40.55  ? 220 LEU D CG  1 
ATOM   6733 C CD1 . LEU D 1 137 ? -17.708 -37.069 -55.287 1.00 35.67  ? 220 LEU D CD1 1 
ATOM   6734 C CD2 . LEU D 1 137 ? -19.824 -36.538 -56.505 1.00 35.50  ? 220 LEU D CD2 1 
ATOM   6735 N N   . ILE D 1 138 ? -21.399 -38.079 -58.851 1.00 42.06  ? 221 ILE D N   1 
ATOM   6736 C CA  . ILE D 1 138 ? -21.580 -37.192 -59.999 1.00 43.71  ? 221 ILE D CA  1 
ATOM   6737 C C   . ILE D 1 138 ? -21.612 -35.749 -59.556 1.00 41.01  ? 221 ILE D C   1 
ATOM   6738 O O   . ILE D 1 138 ? -22.247 -35.425 -58.564 1.00 49.58  ? 221 ILE D O   1 
ATOM   6739 C CB  . ILE D 1 138 ? -22.897 -37.522 -60.714 1.00 45.34  ? 221 ILE D CB  1 
ATOM   6740 C CG1 . ILE D 1 138 ? -22.849 -38.969 -61.210 1.00 45.92  ? 221 ILE D CG1 1 
ATOM   6741 C CG2 . ILE D 1 138 ? -23.199 -36.526 -61.822 1.00 42.46  ? 221 ILE D CG2 1 
ATOM   6742 C CD1 . ILE D 1 138 ? -24.231 -39.544 -61.492 1.00 49.20  ? 221 ILE D CD1 1 
ATOM   6743 N N   . ILE D 1 139 ? -20.886 -34.899 -60.253 1.00 41.37  ? 222 ILE D N   1 
ATOM   6744 C CA  . ILE D 1 139 ? -21.035 -33.477 -60.134 1.00 39.95  ? 222 ILE D CA  1 
ATOM   6745 C C   . ILE D 1 139 ? -21.376 -32.975 -61.507 1.00 44.19  ? 222 ILE D C   1 
ATOM   6746 O O   . ILE D 1 139 ? -20.535 -32.983 -62.410 1.00 42.52  ? 222 ILE D O   1 
ATOM   6747 C CB  . ILE D 1 139 ? -19.737 -32.840 -59.692 1.00 41.83  ? 222 ILE D CB  1 
ATOM   6748 C CG1 . ILE D 1 139 ? -19.386 -33.397 -58.306 1.00 45.17  ? 222 ILE D CG1 1 
ATOM   6749 C CG2 . ILE D 1 139 ? -19.890 -31.316 -59.661 1.00 39.65  ? 222 ILE D CG2 1 
ATOM   6750 C CD1 . ILE D 1 139 ? -17.933 -33.310 -57.919 1.00 46.67  ? 222 ILE D CD1 1 
ATOM   6751 N N   . ASP D 1 140 ? -22.631 -32.564 -61.664 1.00 47.86  ? 223 ASP D N   1 
ATOM   6752 C CA  . ASP D 1 140 ? -23.097 -31.903 -62.868 1.00 51.48  ? 223 ASP D CA  1 
ATOM   6753 C C   . ASP D 1 140 ? -23.503 -30.493 -62.532 1.00 53.16  ? 223 ASP D C   1 
ATOM   6754 O O   . ASP D 1 140 ? -24.617 -30.293 -62.039 1.00 61.12  ? 223 ASP D O   1 
ATOM   6755 C CB  . ASP D 1 140 ? -24.332 -32.617 -63.418 1.00 55.48  ? 223 ASP D CB  1 
ATOM   6756 C CG  . ASP D 1 140 ? -24.874 -31.966 -64.704 1.00 59.42  ? 223 ASP D CG  1 
ATOM   6757 O OD1 . ASP D 1 140 ? -26.084 -32.092 -64.988 1.00 62.68  ? 223 ASP D OD1 1 
ATOM   6758 O OD2 . ASP D 1 140 ? -24.088 -31.332 -65.432 1.00 62.11  ? 223 ASP D OD2 1 
ATOM   6759 N N   . SER D 1 141 ? -22.663 -29.498 -62.811 1.00 53.57  ? 224 SER D N   1 
ATOM   6760 C CA  . SER D 1 141 ? -21.367 -29.638 -63.464 1.00 53.39  ? 224 SER D CA  1 
ATOM   6761 C C   . SER D 1 141 ? -20.244 -29.107 -62.582 1.00 51.52  ? 224 SER D C   1 
ATOM   6762 O O   . SER D 1 141 ? -20.469 -28.337 -61.654 1.00 53.17  ? 224 SER D O   1 
ATOM   6763 C CB  . SER D 1 141 ? -21.364 -28.895 -64.801 1.00 52.51  ? 224 SER D CB  1 
ATOM   6764 O OG  . SER D 1 141 ? -21.456 -27.497 -64.613 1.00 56.24  ? 224 SER D OG  1 
ATOM   6765 N N   . ILE D 1 142 ? -19.033 -29.516 -62.911 1.00 50.54  ? 225 ILE D N   1 
ATOM   6766 C CA  . ILE D 1 142 ? -17.855 -29.269 -62.105 1.00 48.85  ? 225 ILE D CA  1 
ATOM   6767 C C   . ILE D 1 142 ? -17.456 -27.814 -61.866 1.00 51.33  ? 225 ILE D C   1 
ATOM   6768 O O   . ILE D 1 142 ? -17.051 -27.504 -60.765 1.00 56.57  ? 225 ILE D O   1 
ATOM   6769 C CB  . ILE D 1 142 ? -16.645 -30.036 -62.691 1.00 48.29  ? 225 ILE D CB  1 
ATOM   6770 C CG1 . ILE D 1 142 ? -15.528 -30.152 -61.651 1.00 44.76  ? 225 ILE D CG1 1 
ATOM   6771 C CG2 . ILE D 1 142 ? -16.206 -29.404 -64.022 1.00 50.02  ? 225 ILE D CG2 1 
ATOM   6772 C CD1 . ILE D 1 142 ? -16.018 -30.628 -60.292 1.00 41.22  ? 225 ILE D CD1 1 
ATOM   6773 N N   . MET D 1 143 ? -17.589 -26.938 -62.862 1.00 53.52  ? 226 MET D N   1 
ATOM   6774 C CA  . MET D 1 143 ? -16.973 -25.599 -62.833 1.00 58.54  ? 226 MET D CA  1 
ATOM   6775 C C   . MET D 1 143 ? -17.932 -24.453 -63.051 1.00 58.85  ? 226 MET D C   1 
ATOM   6776 O O   . MET D 1 143 ? -17.510 -23.290 -63.043 1.00 61.88  ? 226 MET D O   1 
ATOM   6777 C CB  . MET D 1 143 ? -16.056 -25.413 -64.044 1.00 62.09  ? 226 MET D CB  1 
ATOM   6778 C CG  . MET D 1 143 ? -14.759 -26.124 -64.081 1.00 62.25  ? 226 MET D CG  1 
ATOM   6779 S SD  . MET D 1 143 ? -13.566 -24.889 -64.539 1.00 73.07  ? 226 MET D SD  1 
ATOM   6780 C CE  . MET D 1 143 ? -14.542 -23.432 -64.918 1.00 78.52  ? 226 MET D CE  1 
ATOM   6781 N N   . ALA D 1 144 ? -19.170 -24.744 -63.411 1.00 54.70  ? 227 ALA D N   1 
ATOM   6782 C CA  . ALA D 1 144 ? -20.108 -23.651 -63.700 1.00 53.57  ? 227 ALA D CA  1 
ATOM   6783 C C   . ALA D 1 144 ? -20.140 -22.564 -62.598 1.00 52.94  ? 227 ALA D C   1 
ATOM   6784 O O   . ALA D 1 144 ? -20.186 -21.378 -62.908 1.00 55.58  ? 227 ALA D O   1 
ATOM   6785 C CB  . ALA D 1 144 ? -21.497 -24.195 -63.970 1.00 50.40  ? 227 ALA D CB  1 
ATOM   6786 N N   . LEU D 1 145 ? -20.082 -22.971 -61.325 1.00 50.43  ? 228 LEU D N   1 
ATOM   6787 C CA  . LEU D 1 145 ? -20.093 -22.033 -60.194 1.00 49.44  ? 228 LEU D CA  1 
ATOM   6788 C C   . LEU D 1 145 ? -18.818 -21.249 -60.004 1.00 52.29  ? 228 LEU D C   1 
ATOM   6789 O O   . LEU D 1 145 ? -18.849 -20.150 -59.474 1.00 56.60  ? 228 LEU D O   1 
ATOM   6790 C CB  . LEU D 1 145 ? -20.453 -22.750 -58.892 1.00 46.15  ? 228 LEU D CB  1 
ATOM   6791 C CG  . LEU D 1 145 ? -21.912 -23.239 -58.889 1.00 44.79  ? 228 LEU D CG  1 
ATOM   6792 C CD1 . LEU D 1 145 ? -22.216 -24.030 -57.619 1.00 42.30  ? 228 LEU D CD1 1 
ATOM   6793 C CD2 . LEU D 1 145 ? -22.914 -22.103 -59.090 1.00 41.49  ? 228 LEU D CD2 1 
ATOM   6794 N N   . PHE D 1 146 ? -17.690 -21.801 -60.417 1.00 53.04  ? 229 PHE D N   1 
ATOM   6795 C CA  . PHE D 1 146 ? -16.445 -21.040 -60.370 1.00 59.57  ? 229 PHE D CA  1 
ATOM   6796 C C   . PHE D 1 146 ? -16.362 -19.950 -61.438 1.00 68.38  ? 229 PHE D C   1 
ATOM   6797 O O   . PHE D 1 146 ? -15.831 -18.876 -61.155 1.00 74.76  ? 229 PHE D O   1 
ATOM   6798 C CB  . PHE D 1 146 ? -15.227 -21.974 -60.369 1.00 58.56  ? 229 PHE D CB  1 
ATOM   6799 C CG  . PHE D 1 146 ? -15.173 -22.835 -59.149 1.00 55.50  ? 229 PHE D CG  1 
ATOM   6800 C CD1 . PHE D 1 146 ? -16.064 -23.899 -59.003 1.00 54.87  ? 229 PHE D CD1 1 
ATOM   6801 C CD2 . PHE D 1 146 ? -14.303 -22.535 -58.112 1.00 56.21  ? 229 PHE D CD2 1 
ATOM   6802 C CE1 . PHE D 1 146 ? -16.057 -24.673 -57.856 1.00 55.63  ? 229 PHE D CE1 1 
ATOM   6803 C CE2 . PHE D 1 146 ? -14.296 -23.297 -56.954 1.00 56.88  ? 229 PHE D CE2 1 
ATOM   6804 C CZ  . PHE D 1 146 ? -15.178 -24.361 -56.822 1.00 55.75  ? 229 PHE D CZ  1 
ATOM   6805 N N   . ARG D 1 147 ? -16.903 -20.207 -62.637 1.00 72.31  ? 230 ARG D N   1 
ATOM   6806 C CA  . ARG D 1 147 ? -17.062 -19.167 -63.661 1.00 81.51  ? 230 ARG D CA  1 
ATOM   6807 C C   . ARG D 1 147 ? -17.815 -17.997 -63.033 1.00 89.64  ? 230 ARG D C   1 
ATOM   6808 O O   . ARG D 1 147 ? -17.459 -16.823 -63.221 1.00 92.94  ? 230 ARG D O   1 
ATOM   6809 C CB  . ARG D 1 147 ? -17.849 -19.682 -64.877 1.00 81.70  ? 230 ARG D CB  1 
ATOM   6810 C CG  . ARG D 1 147 ? -17.096 -20.684 -65.726 1.00 86.49  ? 230 ARG D CG  1 
ATOM   6811 C CD  . ARG D 1 147 ? -16.983 -20.220 -67.159 1.00 92.73  ? 230 ARG D CD  1 
ATOM   6812 N NE  . ARG D 1 147 ? -18.015 -20.771 -68.045 1.00 97.52  ? 230 ARG D NE  1 
ATOM   6813 C CZ  . ARG D 1 147 ? -18.048 -20.568 -69.371 1.00 100.97 ? 230 ARG D CZ  1 
ATOM   6814 N NH1 . ARG D 1 147 ? -17.110 -19.836 -69.977 1.00 98.55  ? 230 ARG D NH1 1 
ATOM   6815 N NH2 . ARG D 1 147 ? -19.015 -21.102 -70.106 1.00 99.54  ? 230 ARG D NH2 1 
ATOM   6816 N N   . VAL D 1 148 ? -18.831 -18.366 -62.254 1.00 88.31  ? 231 VAL D N   1 
ATOM   6817 C CA  . VAL D 1 148 ? -19.785 -17.466 -61.610 1.00 94.31  ? 231 VAL D CA  1 
ATOM   6818 C C   . VAL D 1 148 ? -19.231 -16.701 -60.383 1.00 101.45 ? 231 VAL D C   1 
ATOM   6819 O O   . VAL D 1 148 ? -19.247 -15.475 -60.364 1.00 107.38 ? 231 VAL D O   1 
ATOM   6820 C CB  . VAL D 1 148 ? -21.083 -18.258 -61.263 1.00 89.93  ? 231 VAL D CB  1 
ATOM   6821 C CG1 . VAL D 1 148 ? -22.005 -17.497 -60.314 1.00 84.12  ? 231 VAL D CG1 1 
ATOM   6822 C CG2 . VAL D 1 148 ? -21.802 -18.677 -62.544 1.00 83.17  ? 231 VAL D CG2 1 
ATOM   6823 N N   . ASP D 1 149 ? -18.754 -17.409 -59.365 1.00 107.77 ? 232 ASP D N   1 
ATOM   6824 C CA  . ASP D 1 149 ? -18.278 -16.763 -58.134 1.00 113.06 ? 232 ASP D CA  1 
ATOM   6825 C C   . ASP D 1 149 ? -17.054 -15.841 -58.325 1.00 121.26 ? 232 ASP D C   1 
ATOM   6826 O O   . ASP D 1 149 ? -17.014 -14.741 -57.758 1.00 125.50 ? 232 ASP D O   1 
ATOM   6827 C CB  . ASP D 1 149 ? -18.012 -17.820 -57.051 1.00 106.72 ? 232 ASP D CB  1 
ATOM   6828 C CG  . ASP D 1 149 ? -19.278 -18.215 -56.304 1.00 104.98 ? 232 ASP D CG  1 
ATOM   6829 O OD1 . ASP D 1 149 ? -19.751 -17.385 -55.497 1.00 109.99 ? 232 ASP D OD1 1 
ATOM   6830 O OD2 . ASP D 1 149 ? -19.799 -19.340 -56.521 1.00 90.95  ? 232 ASP D OD2 1 
ATOM   6831 N N   . PHE D 1 150 ? -16.077 -16.292 -59.121 1.00 126.15 ? 233 PHE D N   1 
ATOM   6832 C CA  . PHE D 1 150 ? -14.813 -15.562 -59.356 1.00 129.72 ? 233 PHE D CA  1 
ATOM   6833 C C   . PHE D 1 150 ? -14.617 -15.230 -60.849 1.00 132.78 ? 233 PHE D C   1 
ATOM   6834 O O   . PHE D 1 150 ? -13.832 -15.897 -61.548 1.00 128.46 ? 233 PHE D O   1 
ATOM   6835 C CB  . PHE D 1 150 ? -13.580 -16.355 -58.854 1.00 122.20 ? 233 PHE D CB  1 
ATOM   6836 C CG  . PHE D 1 150 ? -13.725 -16.973 -57.469 1.00 120.46 ? 233 PHE D CG  1 
ATOM   6837 C CD1 . PHE D 1 150 ? -13.226 -16.314 -56.331 1.00 115.70 ? 233 PHE D CD1 1 
ATOM   6838 C CD2 . PHE D 1 150 ? -14.314 -18.243 -57.299 1.00 111.64 ? 233 PHE D CD2 1 
ATOM   6839 C CE1 . PHE D 1 150 ? -13.339 -16.886 -55.061 1.00 106.01 ? 233 PHE D CE1 1 
ATOM   6840 C CE2 . PHE D 1 150 ? -14.431 -18.813 -56.030 1.00 109.17 ? 233 PHE D CE2 1 
ATOM   6841 C CZ  . PHE D 1 150 ? -13.943 -18.134 -54.912 1.00 109.80 ? 233 PHE D CZ  1 
ATOM   6842 N N   . SER D 1 151 ? -15.353 -14.225 -61.332 1.00 129.39 ? 234 SER D N   1 
ATOM   6843 C CA  . SER D 1 151 ? -15.137 -13.648 -62.667 1.00 136.60 ? 234 SER D CA  1 
ATOM   6844 C C   . SER D 1 151 ? -15.425 -12.139 -62.700 1.00 142.83 ? 234 SER D C   1 
ATOM   6845 O O   . SER D 1 151 ? -16.314 -11.637 -62.001 1.00 141.79 ? 234 SER D O   1 
ATOM   6846 C CB  . SER D 1 151 ? -15.923 -14.389 -63.752 1.00 134.47 ? 234 SER D CB  1 
ATOM   6847 O OG  . SER D 1 151 ? -17.315 -14.229 -63.573 1.00 136.47 ? 234 SER D OG  1 
ATOM   6848 N N   . GLY D 1 152 ? -14.684 -11.442 -63.554 1.00 143.24 ? 235 GLY D N   1 
ATOM   6849 C CA  . GLY D 1 152 ? -14.452 -10.005 -63.429 1.00 148.59 ? 235 GLY D CA  1 
ATOM   6850 C C   . GLY D 1 152 ? -12.965 -9.995  -63.167 1.00 151.69 ? 235 GLY D C   1 
ATOM   6851 O O   . GLY D 1 152 ? -12.492 -9.423  -62.183 1.00 149.34 ? 235 GLY D O   1 
ATOM   6852 N N   . ARG D 1 153 ? -12.246 -10.632 -64.094 1.00 155.09 ? 236 ARG D N   1 
ATOM   6853 C CA  . ARG D 1 153 ? -10.947 -11.277 -63.842 1.00 153.87 ? 236 ARG D CA  1 
ATOM   6854 C C   . ARG D 1 153 ? -9.694  -10.410 -63.535 1.00 152.29 ? 236 ARG D C   1 
ATOM   6855 O O   . ARG D 1 153 ? -9.171  -9.678  -64.386 1.00 143.54 ? 236 ARG D O   1 
ATOM   6856 C CB  . ARG D 1 153 ? -10.662 -12.344 -64.920 1.00 153.20 ? 236 ARG D CB  1 
ATOM   6857 C CG  . ARG D 1 153 ? -10.496 -11.836 -66.349 1.00 159.30 ? 236 ARG D CG  1 
ATOM   6858 C CD  . ARG D 1 153 ? -10.205 -12.990 -67.300 1.00 155.69 ? 236 ARG D CD  1 
ATOM   6859 N NE  . ARG D 1 153 ? -9.612  -12.539 -68.561 1.00 157.52 ? 236 ARG D NE  1 
ATOM   6860 C CZ  . ARG D 1 153 ? -8.351  -12.759 -68.935 1.00 154.71 ? 236 ARG D CZ  1 
ATOM   6861 N NH1 . ARG D 1 153 ? -7.514  -13.435 -68.155 1.00 147.79 ? 236 ARG D NH1 1 
ATOM   6862 N NH2 . ARG D 1 153 ? -7.923  -12.304 -70.104 1.00 153.87 ? 236 ARG D NH2 1 
ATOM   6863 N N   . GLY D 1 154 ? -9.255  -10.537 -62.283 1.00 146.77 ? 237 GLY D N   1 
ATOM   6864 C CA  . GLY D 1 154 ? -8.011  -9.999  -61.738 1.00 143.11 ? 237 GLY D CA  1 
ATOM   6865 C C   . GLY D 1 154 ? -7.586  -10.955 -60.626 1.00 139.77 ? 237 GLY D C   1 
ATOM   6866 O O   . GLY D 1 154 ? -6.445  -11.411 -60.590 1.00 134.83 ? 237 GLY D O   1 
ATOM   6867 N N   . GLU D 1 155 ? -8.526  -11.261 -59.726 1.00 137.17 ? 238 GLU D N   1 
ATOM   6868 C CA  . GLU D 1 155 ? -8.404  -12.356 -58.748 1.00 127.27 ? 238 GLU D CA  1 
ATOM   6869 C C   . GLU D 1 155 ? -8.766  -13.710 -59.405 1.00 118.50 ? 238 GLU D C   1 
ATOM   6870 O O   . GLU D 1 155 ? -9.672  -14.436 -58.970 1.00 107.98 ? 238 GLU D O   1 
ATOM   6871 C CB  . GLU D 1 155 ? -9.270  -12.067 -57.499 1.00 125.67 ? 238 GLU D CB  1 
ATOM   6872 C CG  . GLU D 1 155 ? -10.762 -12.430 -57.576 1.00 121.88 ? 238 GLU D CG  1 
ATOM   6873 C CD  . GLU D 1 155 ? -11.520 -11.778 -58.734 1.00 123.01 ? 238 GLU D CD  1 
ATOM   6874 O OE1 . GLU D 1 155 ? -12.309 -10.846 -58.473 1.00 120.63 ? 238 GLU D OE1 1 
ATOM   6875 O OE2 . GLU D 1 155 ? -11.343 -12.194 -59.905 1.00 121.38 ? 238 GLU D OE2 1 
ATOM   6876 N N   . LEU D 1 156 ? -8.080  -14.030 -60.493 1.00 113.80 ? 239 LEU D N   1 
ATOM   6877 C CA  . LEU D 1 156 ? -8.193  -15.365 -61.031 1.00 107.68 ? 239 LEU D CA  1 
ATOM   6878 C C   . LEU D 1 156 ? -7.314  -16.264 -60.189 1.00 100.92 ? 239 LEU D C   1 
ATOM   6879 O O   . LEU D 1 156 ? -7.572  -17.440 -60.084 1.00 96.50  ? 239 LEU D O   1 
ATOM   6880 C CB  . LEU D 1 156 ? -7.793  -15.434 -62.503 1.00 110.47 ? 239 LEU D CB  1 
ATOM   6881 C CG  . LEU D 1 156 ? -8.812  -14.999 -63.563 1.00 113.70 ? 239 LEU D CG  1 
ATOM   6882 C CD1 . LEU D 1 156 ? -8.219  -15.298 -64.938 1.00 113.59 ? 239 LEU D CD1 1 
ATOM   6883 C CD2 . LEU D 1 156 ? -10.202 -15.628 -63.391 1.00 106.21 ? 239 LEU D CD2 1 
ATOM   6884 N N   . ALA D 1 157 ? -6.278  -15.698 -59.579 1.00 102.54 ? 240 ALA D N   1 
ATOM   6885 C CA  . ALA D 1 157 ? -5.485  -16.424 -58.600 1.00 98.08  ? 240 ALA D CA  1 
ATOM   6886 C C   . ALA D 1 157 ? -6.402  -16.908 -57.484 1.00 95.28  ? 240 ALA D C   1 
ATOM   6887 O O   . ALA D 1 157 ? -6.139  -17.928 -56.856 1.00 93.14  ? 240 ALA D O   1 
ATOM   6888 C CB  . ALA D 1 157 ? -4.382  -15.552 -58.041 1.00 96.26  ? 240 ALA D CB  1 
ATOM   6889 N N   . GLU D 1 158 ? -7.489  -16.187 -57.245 1.00 92.55  ? 241 GLU D N   1 
ATOM   6890 C CA  . GLU D 1 158 ? -8.453  -16.632 -56.254 1.00 93.53  ? 241 GLU D CA  1 
ATOM   6891 C C   . GLU D 1 158 ? -9.271  -17.843 -56.709 1.00 84.84  ? 241 GLU D C   1 
ATOM   6892 O O   . GLU D 1 158 ? -9.215  -18.916 -56.073 1.00 77.19  ? 241 GLU D O   1 
ATOM   6893 C CB  . GLU D 1 158 ? -9.377  -15.486 -55.843 1.00 107.96 ? 241 GLU D CB  1 
ATOM   6894 C CG  . GLU D 1 158 ? -9.065  -14.918 -54.470 1.00 120.76 ? 241 GLU D CG  1 
ATOM   6895 C CD  . GLU D 1 158 ? -9.094  -15.989 -53.392 1.00 121.83 ? 241 GLU D CD  1 
ATOM   6896 O OE1 . GLU D 1 158 ? -8.034  -16.650 -53.176 1.00 121.17 ? 241 GLU D OE1 1 
ATOM   6897 O OE2 . GLU D 1 158 ? -10.182 -16.154 -52.776 1.00 111.44 ? 241 GLU D OE2 1 
ATOM   6898 N N   . ARG D 1 159 ? -10.016 -17.663 -57.804 1.00 78.43  ? 242 ARG D N   1 
ATOM   6899 C CA  . ARG D 1 159 ? -10.754 -18.743 -58.442 1.00 75.37  ? 242 ARG D CA  1 
ATOM   6900 C C   . ARG D 1 159 ? -9.895  -19.997 -58.583 1.00 70.30  ? 242 ARG D C   1 
ATOM   6901 O O   . ARG D 1 159 ? -10.340 -21.098 -58.315 1.00 65.02  ? 242 ARG D O   1 
ATOM   6902 C CB  . ARG D 1 159 ? -11.239 -18.321 -59.833 1.00 80.57  ? 242 ARG D CB  1 
ATOM   6903 C CG  . ARG D 1 159 ? -12.042 -19.406 -60.552 1.00 82.34  ? 242 ARG D CG  1 
ATOM   6904 C CD  . ARG D 1 159 ? -12.472 -19.030 -61.960 1.00 87.64  ? 242 ARG D CD  1 
ATOM   6905 N NE  . ARG D 1 159 ? -11.688 -19.747 -62.969 1.00 93.79  ? 242 ARG D NE  1 
ATOM   6906 C CZ  . ARG D 1 159 ? -11.876 -19.635 -64.283 1.00 96.94  ? 242 ARG D CZ  1 
ATOM   6907 N NH1 . ARG D 1 159 ? -12.832 -18.825 -64.751 1.00 93.62  ? 242 ARG D NH1 1 
ATOM   6908 N NH2 . ARG D 1 159 ? -11.120 -20.339 -65.128 1.00 92.26  ? 242 ARG D NH2 1 
ATOM   6909 N N   . GLN D 1 160 ? -8.655  -19.804 -59.001 1.00 72.68  ? 243 GLN D N   1 
ATOM   6910 C CA  . GLN D 1 160 ? -7.773  -20.895 -59.285 1.00 72.23  ? 243 GLN D CA  1 
ATOM   6911 C C   . GLN D 1 160 ? -7.415  -21.625 -58.011 1.00 67.88  ? 243 GLN D C   1 
ATOM   6912 O O   . GLN D 1 160 ? -7.579  -22.851 -57.965 1.00 66.03  ? 243 GLN D O   1 
ATOM   6913 C CB  . GLN D 1 160 ? -6.539  -20.416 -60.043 1.00 85.22  ? 243 GLN D CB  1 
ATOM   6914 C CG  . GLN D 1 160 ? -6.826  -19.626 -61.322 1.00 95.56  ? 243 GLN D CG  1 
ATOM   6915 C CD  . GLN D 1 160 ? -7.509  -20.442 -62.416 1.00 101.92 ? 243 GLN D CD  1 
ATOM   6916 O OE1 . GLN D 1 160 ? -8.675  -20.881 -62.279 1.00 97.92  ? 243 GLN D OE1 1 
ATOM   6917 N NE2 . GLN D 1 160 ? -6.791  -20.630 -63.535 1.00 107.06 ? 243 GLN D NE2 1 
ATOM   6918 N N   . GLN D 1 161 ? -6.979  -20.897 -56.974 1.00 66.60  ? 244 GLN D N   1 
ATOM   6919 C CA  . GLN D 1 161 ? -6.688  -21.528 -55.664 1.00 66.49  ? 244 GLN D CA  1 
ATOM   6920 C C   . GLN D 1 161 ? -7.875  -22.365 -55.231 1.00 62.60  ? 244 GLN D C   1 
ATOM   6921 O O   . GLN D 1 161 ? -7.724  -23.536 -54.927 1.00 61.21  ? 244 GLN D O   1 
ATOM   6922 C CB  . GLN D 1 161 ? -6.313  -20.524 -54.560 1.00 72.87  ? 244 GLN D CB  1 
ATOM   6923 C CG  . GLN D 1 161 ? -4.859  -20.549 -54.079 1.00 80.97  ? 244 GLN D CG  1 
ATOM   6924 C CD  . GLN D 1 161 ? -4.373  -19.214 -53.470 1.00 93.10  ? 244 GLN D CD  1 
ATOM   6925 O OE1 . GLN D 1 161 ? -5.175  -18.307 -53.182 1.00 98.59  ? 244 GLN D OE1 1 
ATOM   6926 N NE2 . GLN D 1 161 ? -3.045  -19.090 -53.277 1.00 92.10  ? 244 GLN D NE2 1 
ATOM   6927 N N   . LYS D 1 162 ? -9.062  -21.764 -55.266 1.00 63.02  ? 245 LYS D N   1 
ATOM   6928 C CA  . LYS D 1 162 ? -10.295 -22.449 -54.924 1.00 58.33  ? 245 LYS D CA  1 
ATOM   6929 C C   . LYS D 1 162 ? -10.620 -23.684 -55.812 1.00 55.44  ? 245 LYS D C   1 
ATOM   6930 O O   . LYS D 1 162 ? -10.899 -24.774 -55.284 1.00 49.45  ? 245 LYS D O   1 
ATOM   6931 C CB  . LYS D 1 162 ? -11.459 -21.439 -54.858 1.00 58.91  ? 245 LYS D CB  1 
ATOM   6932 C CG  . LYS D 1 162 ? -11.530 -20.644 -53.550 1.00 63.54  ? 245 LYS D CG  1 
ATOM   6933 C CD  . LYS D 1 162 ? -11.342 -21.539 -52.319 1.00 67.88  ? 245 LYS D CD  1 
ATOM   6934 C CE  . LYS D 1 162 ? -11.675 -20.847 -51.008 1.00 72.45  ? 245 LYS D CE  1 
ATOM   6935 N NZ  . LYS D 1 162 ? -10.803 -19.655 -50.799 1.00 88.42  ? 245 LYS D NZ  1 
ATOM   6936 N N   . LEU D 1 163 ? -10.567 -23.516 -57.138 1.00 54.45  ? 246 LEU D N   1 
ATOM   6937 C CA  . LEU D 1 163 ? -10.852 -24.592 -58.049 1.00 52.54  ? 246 LEU D CA  1 
ATOM   6938 C C   . LEU D 1 163 ? -9.843  -25.723 -57.829 1.00 53.91  ? 246 LEU D C   1 
ATOM   6939 O O   . LEU D 1 163 ? -10.203 -26.895 -57.775 1.00 54.08  ? 246 LEU D O   1 
ATOM   6940 C CB  . LEU D 1 163 ? -10.795 -24.096 -59.497 1.00 56.88  ? 246 LEU D CB  1 
ATOM   6941 C CG  . LEU D 1 163 ? -11.171 -25.175 -60.513 1.00 56.97  ? 246 LEU D CG  1 
ATOM   6942 C CD1 . LEU D 1 163 ? -12.668 -25.253 -60.613 1.00 56.22  ? 246 LEU D CD1 1 
ATOM   6943 C CD2 . LEU D 1 163 ? -10.629 -24.833 -61.868 1.00 61.93  ? 246 LEU D CD2 1 
ATOM   6944 N N   . ALA D 1 164 ? -8.573  -25.376 -57.655 1.00 54.73  ? 247 ALA D N   1 
ATOM   6945 C CA  . ALA D 1 164 ? -7.573  -26.406 -57.542 1.00 52.81  ? 247 ALA D CA  1 
ATOM   6946 C C   . ALA D 1 164 ? -7.780  -27.136 -56.256 1.00 52.22  ? 247 ALA D C   1 
ATOM   6947 O O   . ALA D 1 164 ? -7.661  -28.348 -56.243 1.00 51.10  ? 247 ALA D O   1 
ATOM   6948 C CB  . ALA D 1 164 ? -6.193  -25.809 -57.584 1.00 56.44  ? 247 ALA D CB  1 
ATOM   6949 N N   . GLN D 1 165 ? -8.089  -26.383 -55.185 1.00 54.52  ? 248 GLN D N   1 
ATOM   6950 C CA  . GLN D 1 165 ? -8.371  -26.916 -53.852 1.00 54.53  ? 248 GLN D CA  1 
ATOM   6951 C C   . GLN D 1 165 ? -9.455  -27.989 -53.981 1.00 52.39  ? 248 GLN D C   1 
ATOM   6952 O O   . GLN D 1 165 ? -9.287  -29.129 -53.542 1.00 52.12  ? 248 GLN D O   1 
ATOM   6953 C CB  . GLN D 1 165 ? -8.871  -25.803 -52.952 1.00 57.30  ? 248 GLN D CB  1 
ATOM   6954 C CG  . GLN D 1 165 ? -8.356  -25.754 -51.518 1.00 61.80  ? 248 GLN D CG  1 
ATOM   6955 C CD  . GLN D 1 165 ? -7.795  -24.361 -51.198 1.00 69.80  ? 248 GLN D CD  1 
ATOM   6956 O OE1 . GLN D 1 165 ? -8.497  -23.331 -51.288 1.00 70.22  ? 248 GLN D OE1 1 
ATOM   6957 N NE2 . GLN D 1 165 ? -6.503  -24.315 -50.888 1.00 72.29  ? 248 GLN D NE2 1 
ATOM   6958 N N   . MET D 1 166 ? -10.538 -27.645 -54.654 1.00 49.27  ? 249 MET D N   1 
ATOM   6959 C CA  . MET D 1 166 ? -11.638 -28.572 -54.716 1.00 48.74  ? 249 MET D CA  1 
ATOM   6960 C C   . MET D 1 166 ? -11.294 -29.784 -55.517 1.00 46.65  ? 249 MET D C   1 
ATOM   6961 O O   . MET D 1 166 ? -11.666 -30.894 -55.129 1.00 45.18  ? 249 MET D O   1 
ATOM   6962 C CB  . MET D 1 166 ? -12.911 -27.951 -55.278 1.00 50.93  ? 249 MET D CB  1 
ATOM   6963 C CG  . MET D 1 166 ? -13.811 -29.062 -55.737 1.00 54.03  ? 249 MET D CG  1 
ATOM   6964 S SD  . MET D 1 166 ? -15.002 -28.590 -56.951 1.00 66.17  ? 249 MET D SD  1 
ATOM   6965 C CE  . MET D 1 166 ? -14.055 -28.321 -58.449 1.00 60.14  ? 249 MET D CE  1 
ATOM   6966 N N   . LEU D 1 167 ? -10.617 -29.582 -56.650 1.00 46.68  ? 250 LEU D N   1 
ATOM   6967 C CA  . LEU D 1 167 ? -10.358 -30.682 -57.560 1.00 44.60  ? 250 LEU D CA  1 
ATOM   6968 C C   . LEU D 1 167 ? -9.364  -31.658 -56.949 1.00 46.15  ? 250 LEU D C   1 
ATOM   6969 O O   . LEU D 1 167 ? -9.428  -32.864 -57.186 1.00 43.98  ? 250 LEU D O   1 
ATOM   6970 C CB  . LEU D 1 167 ? -9.852  -30.166 -58.888 1.00 51.04  ? 250 LEU D CB  1 
ATOM   6971 C CG  . LEU D 1 167 ? -11.006 -29.564 -59.695 1.00 53.58  ? 250 LEU D CG  1 
ATOM   6972 C CD1 . LEU D 1 167 ? -10.447 -28.707 -60.822 1.00 61.14  ? 250 LEU D CD1 1 
ATOM   6973 C CD2 . LEU D 1 167 ? -11.926 -30.650 -60.220 1.00 51.12  ? 250 LEU D CD2 1 
ATOM   6974 N N   . SER D 1 168 ? -8.451  -31.156 -56.132 1.00 48.87  ? 251 SER D N   1 
ATOM   6975 C CA  . SER D 1 168 ? -7.540  -32.062 -55.497 1.00 50.05  ? 251 SER D CA  1 
ATOM   6976 C C   . SER D 1 168 ? -8.251  -32.811 -54.385 1.00 48.19  ? 251 SER D C   1 
ATOM   6977 O O   . SER D 1 168 ? -7.966  -33.991 -54.209 1.00 49.64  ? 251 SER D O   1 
ATOM   6978 C CB  . SER D 1 168 ? -6.251  -31.389 -55.045 1.00 52.84  ? 251 SER D CB  1 
ATOM   6979 O OG  . SER D 1 168 ? -6.451  -30.696 -53.849 1.00 58.28  ? 251 SER D OG  1 
ATOM   6980 N N   . ARG D 1 169 ? -9.200  -32.185 -53.692 1.00 46.13  ? 252 ARG D N   1 
ATOM   6981 C CA  . ARG D 1 169 ? -10.108 -32.982 -52.815 1.00 52.72  ? 252 ARG D CA  1 
ATOM   6982 C C   . ARG D 1 169 ? -10.883 -34.088 -53.532 1.00 48.08  ? 252 ARG D C   1 
ATOM   6983 O O   . ARG D 1 169 ? -11.011 -35.199 -53.012 1.00 49.29  ? 252 ARG D O   1 
ATOM   6984 C CB  . ARG D 1 169 ? -11.095 -32.133 -51.991 1.00 57.36  ? 252 ARG D CB  1 
ATOM   6985 C CG  . ARG D 1 169 ? -10.421 -31.378 -50.863 1.00 78.53  ? 252 ARG D CG  1 
ATOM   6986 C CD  . ARG D 1 169 ? -10.059 -32.317 -49.734 1.00 91.81  ? 252 ARG D CD  1 
ATOM   6987 N NE  . ARG D 1 169 ? -11.265 -32.662 -48.978 1.00 105.19 ? 252 ARG D NE  1 
ATOM   6988 C CZ  . ARG D 1 169 ? -11.524 -33.864 -48.462 1.00 100.71 ? 252 ARG D CZ  1 
ATOM   6989 N NH1 . ARG D 1 169 ? -10.678 -34.878 -48.634 1.00 95.23  ? 252 ARG D NH1 1 
ATOM   6990 N NH2 . ARG D 1 169 ? -12.643 -34.053 -47.776 1.00 91.01  ? 252 ARG D NH2 1 
ATOM   6991 N N   . LEU D 1 170 ? -11.417 -33.787 -54.704 1.00 44.91  ? 253 LEU D N   1 
ATOM   6992 C CA  . LEU D 1 170 ? -12.084 -34.807 -55.505 1.00 44.20  ? 253 LEU D CA  1 
ATOM   6993 C C   . LEU D 1 170 ? -11.205 -36.035 -55.782 1.00 43.63  ? 253 LEU D C   1 
ATOM   6994 O O   . LEU D 1 170 ? -11.604 -37.187 -55.555 1.00 43.53  ? 253 LEU D O   1 
ATOM   6995 C CB  . LEU D 1 170 ? -12.507 -34.219 -56.828 1.00 43.91  ? 253 LEU D CB  1 
ATOM   6996 C CG  . LEU D 1 170 ? -13.967 -33.849 -56.925 1.00 45.40  ? 253 LEU D CG  1 
ATOM   6997 C CD1 . LEU D 1 170 ? -14.284 -33.642 -58.379 1.00 46.58  ? 253 LEU D CD1 1 
ATOM   6998 C CD2 . LEU D 1 170 ? -14.827 -34.963 -56.360 1.00 45.40  ? 253 LEU D CD2 1 
ATOM   6999 N N   . GLN D 1 171 ? -9.992  -35.786 -56.241 1.00 42.05  ? 254 GLN D N   1 
ATOM   7000 C CA  . GLN D 1 171 ? -9.098  -36.867 -56.544 1.00 40.47  ? 254 GLN D CA  1 
ATOM   7001 C C   . GLN D 1 171 ? -8.914  -37.689 -55.269 1.00 40.42  ? 254 GLN D C   1 
ATOM   7002 O O   . GLN D 1 171 ? -9.099  -38.890 -55.285 1.00 42.23  ? 254 GLN D O   1 
ATOM   7003 C CB  . GLN D 1 171 ? -7.783  -36.314 -57.022 1.00 41.46  ? 254 GLN D CB  1 
ATOM   7004 C CG  . GLN D 1 171 ? -7.758  -35.592 -58.368 1.00 41.96  ? 254 GLN D CG  1 
ATOM   7005 C CD  . GLN D 1 171 ? -6.342  -35.587 -58.937 1.00 42.80  ? 254 GLN D CD  1 
ATOM   7006 O OE1 . GLN D 1 171 ? -6.137  -35.751 -60.124 1.00 44.64  ? 254 GLN D OE1 1 
ATOM   7007 N NE2 . GLN D 1 171 ? -5.359  -35.475 -58.065 1.00 43.57  ? 254 GLN D NE2 1 
ATOM   7008 N N   . LYS D 1 172 ? -8.592  -37.045 -54.156 1.00 41.24  ? 255 LYS D N   1 
ATOM   7009 C CA  . LYS D 1 172 ? -8.442  -37.761 -52.886 1.00 42.81  ? 255 LYS D CA  1 
ATOM   7010 C C   . LYS D 1 172 ? -9.655  -38.624 -52.533 1.00 43.35  ? 255 LYS D C   1 
ATOM   7011 O O   . LYS D 1 172 ? -9.491  -39.780 -52.140 1.00 44.41  ? 255 LYS D O   1 
ATOM   7012 C CB  . LYS D 1 172 ? -8.100  -36.808 -51.741 1.00 43.88  ? 255 LYS D CB  1 
ATOM   7013 C CG  . LYS D 1 172 ? -6.688  -36.968 -51.206 1.00 49.27  ? 255 LYS D CG  1 
ATOM   7014 C CD  . LYS D 1 172 ? -5.863  -35.681 -51.112 1.00 51.71  ? 255 LYS D CD  1 
ATOM   7015 C CE  . LYS D 1 172 ? -6.522  -34.573 -50.303 1.00 56.70  ? 255 LYS D CE  1 
ATOM   7016 N NZ  . LYS D 1 172 ? -5.477  -33.597 -49.880 1.00 64.25  ? 255 LYS D NZ  1 
ATOM   7017 N N   . ILE D 1 173 ? -10.858 -38.069 -52.672 1.00 42.63  ? 256 ILE D N   1 
ATOM   7018 C CA  . ILE D 1 173 ? -12.077 -38.792 -52.378 1.00 43.81  ? 256 ILE D CA  1 
ATOM   7019 C C   . ILE D 1 173 ? -12.202 -40.028 -53.292 1.00 45.35  ? 256 ILE D C   1 
ATOM   7020 O O   . ILE D 1 173 ? -12.472 -41.131 -52.831 1.00 44.05  ? 256 ILE D O   1 
ATOM   7021 C CB  . ILE D 1 173 ? -13.283 -37.870 -52.606 1.00 46.80  ? 256 ILE D CB  1 
ATOM   7022 C CG1 . ILE D 1 173 ? -13.431 -36.921 -51.417 1.00 47.88  ? 256 ILE D CG1 1 
ATOM   7023 C CG2 . ILE D 1 173 ? -14.570 -38.670 -52.856 1.00 41.71  ? 256 ILE D CG2 1 
ATOM   7024 C CD1 . ILE D 1 173 ? -14.509 -35.879 -51.652 1.00 50.47  ? 256 ILE D CD1 1 
ATOM   7025 N N   . SER D 1 174 ? -12.031 -39.784 -54.587 1.00 44.58  ? 257 SER D N   1 
ATOM   7026 C CA  . SER D 1 174 ? -11.893 -40.769 -55.650 1.00 46.22  ? 257 SER D CA  1 
ATOM   7027 C C   . SER D 1 174 ? -11.080 -41.999 -55.277 1.00 49.01  ? 257 SER D C   1 
ATOM   7028 O O   . SER D 1 174 ? -11.532 -43.159 -55.409 1.00 46.93  ? 257 SER D O   1 
ATOM   7029 C CB  . SER D 1 174 ? -11.069 -40.105 -56.737 1.00 43.71  ? 257 SER D CB  1 
ATOM   7030 O OG  . SER D 1 174 ? -11.514 -40.558 -57.943 1.00 54.55  ? 257 SER D OG  1 
ATOM   7031 N N   . GLU D 1 175 ? -9.845  -41.718 -54.852 1.00 46.20  ? 258 GLU D N   1 
ATOM   7032 C CA  . GLU D 1 175 ? -8.827  -42.743 -54.731 1.00 45.97  ? 258 GLU D CA  1 
ATOM   7033 C C   . GLU D 1 175 ? -8.869  -43.368 -53.366 1.00 45.94  ? 258 GLU D C   1 
ATOM   7034 O O   . GLU D 1 175 ? -8.695  -44.576 -53.237 1.00 54.44  ? 258 GLU D O   1 
ATOM   7035 C CB  . GLU D 1 175 ? -7.444  -42.190 -55.097 1.00 43.53  ? 258 GLU D CB  1 
ATOM   7036 C CG  . GLU D 1 175 ? -7.444  -41.676 -56.516 1.00 43.34  ? 258 GLU D CG  1 
ATOM   7037 C CD  . GLU D 1 175 ? -6.217  -40.881 -56.932 1.00 46.66  ? 258 GLU D CD  1 
ATOM   7038 O OE1 . GLU D 1 175 ? -6.352  -40.056 -57.864 1.00 55.09  ? 258 GLU D OE1 1 
ATOM   7039 O OE2 . GLU D 1 175 ? -5.121  -41.096 -56.400 1.00 49.55  ? 258 GLU D OE2 1 
ATOM   7040 N N   . GLU D 1 176 ? -9.145  -42.562 -52.352 1.00 46.63  ? 259 GLU D N   1 
ATOM   7041 C CA  . GLU D 1 176 ? -9.194  -43.032 -50.974 1.00 46.50  ? 259 GLU D CA  1 
ATOM   7042 C C   . GLU D 1 176 ? -10.398 -43.965 -50.735 1.00 46.47  ? 259 GLU D C   1 
ATOM   7043 O O   . GLU D 1 176 ? -10.272 -44.914 -49.988 1.00 43.13  ? 259 GLU D O   1 
ATOM   7044 C CB  . GLU D 1 176 ? -9.256  -41.820 -50.067 1.00 56.10  ? 259 GLU D CB  1 
ATOM   7045 C CG  . GLU D 1 176 ? -8.688  -41.921 -48.650 1.00 71.74  ? 259 GLU D CG  1 
ATOM   7046 C CD  . GLU D 1 176 ? -8.793  -40.550 -47.929 1.00 85.64  ? 259 GLU D CD  1 
ATOM   7047 O OE1 . GLU D 1 176 ? -8.670  -39.478 -48.605 1.00 79.93  ? 259 GLU D OE1 1 
ATOM   7048 O OE2 . GLU D 1 176 ? -9.017  -40.527 -46.688 1.00 87.35  ? 259 GLU D OE2 1 
ATOM   7049 N N   . TYR D 1 177 ? -11.542 -43.722 -51.393 1.00 45.81  ? 260 TYR D N   1 
ATOM   7050 C CA  . TYR D 1 177 ? -12.803 -44.441 -51.082 1.00 46.27  ? 260 TYR D CA  1 
ATOM   7051 C C   . TYR D 1 177 ? -13.258 -45.285 -52.311 1.00 46.45  ? 260 TYR D C   1 
ATOM   7052 O O   . TYR D 1 177 ? -14.391 -45.750 -52.438 1.00 41.15  ? 260 TYR D O   1 
ATOM   7053 C CB  . TYR D 1 177 ? -13.921 -43.462 -50.667 1.00 43.92  ? 260 TYR D CB  1 
ATOM   7054 C CG  . TYR D 1 177 ? -13.638 -42.698 -49.399 1.00 47.93  ? 260 TYR D CG  1 
ATOM   7055 C CD1 . TYR D 1 177 ? -13.419 -41.288 -49.430 1.00 44.22  ? 260 TYR D CD1 1 
ATOM   7056 C CD2 . TYR D 1 177 ? -13.559 -43.374 -48.149 1.00 51.51  ? 260 TYR D CD2 1 
ATOM   7057 C CE1 . TYR D 1 177 ? -13.114 -40.580 -48.277 1.00 44.51  ? 260 TYR D CE1 1 
ATOM   7058 C CE2 . TYR D 1 177 ? -13.275 -42.678 -46.976 1.00 51.94  ? 260 TYR D CE2 1 
ATOM   7059 C CZ  . TYR D 1 177 ? -13.043 -41.286 -47.053 1.00 52.63  ? 260 TYR D CZ  1 
ATOM   7060 O OH  . TYR D 1 177 ? -12.763 -40.606 -45.902 1.00 57.42  ? 260 TYR D OH  1 
ATOM   7061 N N   . ASN D 1 178 ? -12.365 -45.450 -53.253 1.00 46.38  ? 261 ASN D N   1 
ATOM   7062 C CA  . ASN D 1 178 ? -12.688 -46.310 -54.382 1.00 44.39  ? 261 ASN D CA  1 
ATOM   7063 C C   . ASN D 1 178 ? -14.023 -46.033 -55.043 1.00 42.96  ? 261 ASN D C   1 
ATOM   7064 O O   . ASN D 1 178 ? -14.849 -46.937 -55.194 1.00 46.89  ? 261 ASN D O   1 
ATOM   7065 C CB  . ASN D 1 178 ? -12.661 -47.773 -53.944 1.00 40.51  ? 261 ASN D CB  1 
ATOM   7066 C CG  . ASN D 1 178 ? -12.695 -48.672 -55.135 1.00 39.15  ? 261 ASN D CG  1 
ATOM   7067 O OD1 . ASN D 1 178 ? -12.234 -48.235 -56.175 1.00 39.09  ? 261 ASN D OD1 1 
ATOM   7068 N ND2 . ASN D 1 178 ? -13.273 -49.885 -55.028 1.00 37.57  ? 261 ASN D ND2 1 
ATOM   7069 N N   . VAL D 1 179 ? -14.278 -44.788 -55.395 1.00 41.50  ? 262 VAL D N   1 
ATOM   7070 C CA  . VAL D 1 179 ? -15.503 -44.498 -56.092 1.00 39.62  ? 262 VAL D CA  1 
ATOM   7071 C C   . VAL D 1 179 ? -15.161 -43.893 -57.402 1.00 38.84  ? 262 VAL D C   1 
ATOM   7072 O O   . VAL D 1 179 ? -14.066 -43.345 -57.558 1.00 37.06  ? 262 VAL D O   1 
ATOM   7073 C CB  . VAL D 1 179 ? -16.355 -43.502 -55.355 1.00 40.06  ? 262 VAL D CB  1 
ATOM   7074 C CG1 . VAL D 1 179 ? -16.773 -44.075 -54.015 1.00 42.87  ? 262 VAL D CG1 1 
ATOM   7075 C CG2 . VAL D 1 179 ? -15.592 -42.219 -55.186 1.00 37.09  ? 262 VAL D CG2 1 
ATOM   7076 N N   . ALA D 1 180 ? -16.095 -44.025 -58.346 1.00 39.06  ? 263 ALA D N   1 
ATOM   7077 C CA  . ALA D 1 180 ? -15.966 -43.380 -59.651 1.00 39.38  ? 263 ALA D CA  1 
ATOM   7078 C C   . ALA D 1 180 ? -16.560 -41.992 -59.491 1.00 40.70  ? 263 ALA D C   1 
ATOM   7079 O O   . ALA D 1 180 ? -17.670 -41.799 -58.986 1.00 45.22  ? 263 ALA D O   1 
ATOM   7080 C CB  . ALA D 1 180 ? -16.698 -44.156 -60.712 1.00 36.91  ? 263 ALA D CB  1 
ATOM   7081 N N   . VAL D 1 181 ? -15.793 -40.993 -59.846 1.00 41.39  ? 264 VAL D N   1 
ATOM   7082 C CA  . VAL D 1 181 ? -16.388 -39.695 -59.937 1.00 37.94  ? 264 VAL D CA  1 
ATOM   7083 C C   . VAL D 1 181 ? -16.523 -39.275 -61.383 1.00 40.17  ? 264 VAL D C   1 
ATOM   7084 O O   . VAL D 1 181 ? -15.555 -39.371 -62.146 1.00 42.31  ? 264 VAL D O   1 
ATOM   7085 C CB  . VAL D 1 181 ? -15.754 -38.688 -58.991 1.00 34.89  ? 264 VAL D CB  1 
ATOM   7086 C CG1 . VAL D 1 181 ? -14.558 -39.283 -58.255 1.00 35.57  ? 264 VAL D CG1 1 
ATOM   7087 C CG2 . VAL D 1 181 ? -15.545 -37.341 -59.649 1.00 35.52  ? 264 VAL D CG2 1 
ATOM   7088 N N   . PHE D 1 182 ? -17.755 -38.875 -61.746 1.00 41.50  ? 265 PHE D N   1 
ATOM   7089 C CA  . PHE D 1 182 ? -18.082 -38.419 -63.094 1.00 45.48  ? 265 PHE D CA  1 
ATOM   7090 C C   . PHE D 1 182 ? -18.480 -36.944 -63.074 1.00 47.48  ? 265 PHE D C   1 
ATOM   7091 O O   . PHE D 1 182 ? -19.328 -36.509 -62.274 1.00 48.42  ? 265 PHE D O   1 
ATOM   7092 C CB  . PHE D 1 182 ? -19.154 -39.313 -63.722 1.00 44.06  ? 265 PHE D CB  1 
ATOM   7093 C CG  . PHE D 1 182 ? -19.705 -38.783 -65.007 1.00 48.67  ? 265 PHE D CG  1 
ATOM   7094 C CD1 . PHE D 1 182 ? -19.007 -38.953 -66.210 1.00 51.08  ? 265 PHE D CD1 1 
ATOM   7095 C CD2 . PHE D 1 182 ? -20.937 -38.129 -65.050 1.00 48.56  ? 265 PHE D CD2 1 
ATOM   7096 C CE1 . PHE D 1 182 ? -19.495 -38.473 -67.424 1.00 46.92  ? 265 PHE D CE1 1 
ATOM   7097 C CE2 . PHE D 1 182 ? -21.432 -37.652 -66.279 1.00 52.27  ? 265 PHE D CE2 1 
ATOM   7098 C CZ  . PHE D 1 182 ? -20.700 -37.820 -67.467 1.00 47.42  ? 265 PHE D CZ  1 
ATOM   7099 N N   . VAL D 1 183 ? -17.855 -36.150 -63.937 1.00 46.66  ? 266 VAL D N   1 
ATOM   7100 C CA  . VAL D 1 183 ? -18.255 -34.757 -64.013 1.00 42.93  ? 266 VAL D CA  1 
ATOM   7101 C C   . VAL D 1 183 ? -18.565 -34.241 -65.413 1.00 46.04  ? 266 VAL D C   1 
ATOM   7102 O O   . VAL D 1 183 ? -18.053 -34.785 -66.400 1.00 52.78  ? 266 VAL D O   1 
ATOM   7103 C CB  . VAL D 1 183 ? -17.245 -33.882 -63.338 1.00 39.32  ? 266 VAL D CB  1 
ATOM   7104 C CG1 . VAL D 1 183 ? -16.958 -34.471 -61.973 1.00 40.29  ? 266 VAL D CG1 1 
ATOM   7105 C CG2 . VAL D 1 183 ? -15.985 -33.808 -64.156 1.00 41.05  ? 266 VAL D CG2 1 
ATOM   7106 N N   . THR D 1 184 ? -19.392 -33.196 -65.492 1.00 44.21  ? 267 THR D N   1 
ATOM   7107 C CA  . THR D 1 184 ? -19.731 -32.578 -66.742 1.00 49.79  ? 267 THR D CA  1 
ATOM   7108 C C   . THR D 1 184 ? -19.075 -31.207 -66.786 1.00 52.20  ? 267 THR D C   1 
ATOM   7109 O O   . THR D 1 184 ? -18.775 -30.637 -65.731 1.00 48.75  ? 267 THR D O   1 
ATOM   7110 C CB  . THR D 1 184 ? -21.247 -32.446 -66.916 1.00 52.42  ? 267 THR D CB  1 
ATOM   7111 O OG1 . THR D 1 184 ? -21.771 -31.694 -65.826 1.00 55.46  ? 267 THR D OG1 1 
ATOM   7112 C CG2 . THR D 1 184 ? -21.924 -33.810 -66.904 1.00 52.42  ? 267 THR D CG2 1 
ATOM   7113 N N   . ASN D 1 185 ? -18.845 -30.692 -68.004 1.00 54.03  ? 268 ASN D N   1 
ATOM   7114 C CA  . ASN D 1 185 ? -18.250 -29.386 -68.195 1.00 54.72  ? 268 ASN D CA  1 
ATOM   7115 C C   . ASN D 1 185 ? -18.710 -28.642 -69.471 1.00 60.52  ? 268 ASN D C   1 
ATOM   7116 O O   . ASN D 1 185 ? -19.358 -29.221 -70.339 1.00 65.04  ? 268 ASN D O   1 
ATOM   7117 C CB  . ASN D 1 185 ? -16.747 -29.534 -68.177 1.00 55.79  ? 268 ASN D CB  1 
ATOM   7118 C CG  . ASN D 1 185 ? -16.069 -28.255 -67.791 1.00 61.29  ? 268 ASN D CG  1 
ATOM   7119 O OD1 . ASN D 1 185 ? -15.012 -27.908 -68.310 1.00 65.13  ? 268 ASN D OD1 1 
ATOM   7120 N ND2 . ASN D 1 185 ? -16.709 -27.511 -66.896 1.00 64.35  ? 268 ASN D ND2 1 
ATOM   7121 N N   . GLN D 1 186 ? -18.383 -27.359 -69.591 1.00 63.60  ? 269 GLN D N   1 
ATOM   7122 C CA  . GLN D 1 186 ? -18.824 -26.561 -70.737 1.00 71.59  ? 269 GLN D CA  1 
ATOM   7123 C C   . GLN D 1 186 ? -17.605 -26.156 -71.570 1.00 76.70  ? 269 GLN D C   1 
ATOM   7124 O O   . GLN D 1 186 ? -16.466 -26.475 -71.178 1.00 75.99  ? 269 GLN D O   1 
ATOM   7125 C CB  . GLN D 1 186 ? -19.614 -25.327 -70.277 1.00 72.32  ? 269 GLN D CB  1 
ATOM   7126 C CG  . GLN D 1 186 ? -20.814 -25.616 -69.369 1.00 74.12  ? 269 GLN D CG  1 
ATOM   7127 C CD  . GLN D 1 186 ? -20.443 -25.884 -67.900 1.00 78.24  ? 269 GLN D CD  1 
ATOM   7128 O OE1 . GLN D 1 186 ? -19.465 -25.348 -67.365 1.00 82.52  ? 269 GLN D OE1 1 
ATOM   7129 N NE2 . GLN D 1 186 ? -21.228 -26.729 -67.245 1.00 75.25  ? 269 GLN D NE2 1 
ATOM   7130 N N   . MET D 1 187 ? -17.838 -25.453 -72.688 1.00 81.20  ? 270 MET D N   1 
ATOM   7131 C CA  . MET D 1 187 ? -16.759 -25.023 -73.606 1.00 88.53  ? 270 MET D CA  1 
ATOM   7132 C C   . MET D 1 187 ? -16.687 -23.524 -73.783 1.00 90.58  ? 270 MET D C   1 
ATOM   7133 O O   . MET D 1 187 ? -17.590 -22.832 -73.359 1.00 91.79  ? 270 MET D O   1 
ATOM   7134 C CB  . MET D 1 187 ? -16.961 -25.609 -74.998 1.00 92.36  ? 270 MET D CB  1 
ATOM   7135 C CG  . MET D 1 187 ? -17.671 -26.935 -75.030 1.00 95.82  ? 270 MET D CG  1 
ATOM   7136 S SD  . MET D 1 187 ? -16.640 -28.199 -75.768 1.00 106.32 ? 270 MET D SD  1 
ATOM   7137 C CE  . MET D 1 187 ? -16.621 -27.762 -77.523 1.00 111.56 ? 270 MET D CE  1 
ATOM   7138 N N   . THR D 1 188 ? -15.613 -23.035 -74.417 1.00 98.39  ? 271 THR D N   1 
ATOM   7139 C CA  . THR D 1 188 ? -15.587 -21.691 -75.061 1.00 103.50 ? 271 THR D CA  1 
ATOM   7140 C C   . THR D 1 188 ? -14.775 -21.683 -76.370 1.00 109.96 ? 271 THR D C   1 
ATOM   7141 O O   . THR D 1 188 ? -13.776 -22.402 -76.518 1.00 108.94 ? 271 THR D O   1 
ATOM   7142 C CB  . THR D 1 188 ? -15.076 -20.545 -74.134 1.00 102.79 ? 271 THR D CB  1 
ATOM   7143 O OG1 . THR D 1 188 ? -14.119 -21.049 -73.188 1.00 95.43  ? 271 THR D OG1 1 
ATOM   7144 C CG2 . THR D 1 188 ? -16.240 -19.847 -73.397 1.00 99.30  ? 271 THR D CG2 1 
ATOM   7145 N N   . LYS D 1 203 ? -13.024 -25.322 -77.003 1.00 106.81 ? 286 LYS D N   1 
ATOM   7146 C CA  . LYS D 1 203 ? -12.133 -25.832 -75.948 1.00 104.21 ? 286 LYS D CA  1 
ATOM   7147 C C   . LYS D 1 203 ? -12.822 -25.833 -74.561 1.00 107.03 ? 286 LYS D C   1 
ATOM   7148 O O   . LYS D 1 203 ? -13.594 -24.906 -74.244 1.00 112.18 ? 286 LYS D O   1 
ATOM   7149 C CB  . LYS D 1 203 ? -10.806 -25.062 -75.932 1.00 104.90 ? 286 LYS D CB  1 
ATOM   7150 C CG  . LYS D 1 203 ? -10.792 -23.827 -76.849 1.00 119.66 ? 286 LYS D CG  1 
ATOM   7151 C CD  . LYS D 1 203 ? -10.193 -24.047 -78.254 1.00 117.79 ? 286 LYS D CD  1 
ATOM   7152 C CE  . LYS D 1 203 ? -11.044 -23.399 -79.339 1.00 121.38 ? 286 LYS D CE  1 
ATOM   7153 N NZ  . LYS D 1 203 ? -11.724 -22.141 -78.897 1.00 118.30 ? 286 LYS D NZ  1 
ATOM   7154 N N   . PRO D 1 204 ? -12.568 -26.881 -73.737 1.00 100.68 ? 287 PRO D N   1 
ATOM   7155 C CA  . PRO D 1 204 ? -13.190 -27.034 -72.422 1.00 92.60  ? 287 PRO D CA  1 
ATOM   7156 C C   . PRO D 1 204 ? -12.705 -25.943 -71.456 1.00 90.89  ? 287 PRO D C   1 
ATOM   7157 O O   . PRO D 1 204 ? -11.556 -25.478 -71.595 1.00 90.08  ? 287 PRO D O   1 
ATOM   7158 C CB  . PRO D 1 204 ? -12.660 -28.394 -71.965 1.00 92.54  ? 287 PRO D CB  1 
ATOM   7159 C CG  . PRO D 1 204 ? -11.306 -28.482 -72.585 1.00 92.51  ? 287 PRO D CG  1 
ATOM   7160 C CD  . PRO D 1 204 ? -11.539 -27.918 -73.961 1.00 102.18 ? 287 PRO D CD  1 
ATOM   7161 N N   . ILE D 1 205 ? -13.540 -25.531 -70.495 1.00 82.34  ? 288 ILE D N   1 
ATOM   7162 C CA  . ILE D 1 205 ? -13.086 -24.487 -69.552 1.00 82.51  ? 288 ILE D CA  1 
ATOM   7163 C C   . ILE D 1 205 ? -12.232 -25.074 -68.438 1.00 78.50  ? 288 ILE D C   1 
ATOM   7164 O O   . ILE D 1 205 ? -12.230 -26.283 -68.249 1.00 79.03  ? 288 ILE D O   1 
ATOM   7165 C CB  . ILE D 1 205 ? -14.210 -23.569 -69.004 1.00 81.27  ? 288 ILE D CB  1 
ATOM   7166 C CG1 . ILE D 1 205 ? -15.583 -24.219 -69.149 1.00 79.53  ? 288 ILE D CG1 1 
ATOM   7167 C CG2 . ILE D 1 205 ? -14.193 -22.222 -69.714 1.00 80.93  ? 288 ILE D CG2 1 
ATOM   7168 C CD1 . ILE D 1 205 ? -16.160 -24.700 -67.854 1.00 69.29  ? 288 ILE D CD1 1 
ATOM   7169 N N   . GLY D 1 206 ? -11.462 -24.239 -67.747 1.00 78.00  ? 289 GLY D N   1 
ATOM   7170 C CA  . GLY D 1 206 ? -10.717 -24.700 -66.579 1.00 74.09  ? 289 GLY D CA  1 
ATOM   7171 C C   . GLY D 1 206 ? -9.217  -24.860 -66.691 1.00 73.72  ? 289 GLY D C   1 
ATOM   7172 O O   . GLY D 1 206 ? -8.564  -25.219 -65.694 1.00 75.71  ? 289 GLY D O   1 
ATOM   7173 N N   . GLY D 1 207 ? -8.681  -24.621 -67.888 1.00 72.52  ? 290 GLY D N   1 
ATOM   7174 C CA  . GLY D 1 207 ? -7.244  -24.592 -68.115 1.00 72.58  ? 290 GLY D CA  1 
ATOM   7175 C C   . GLY D 1 207 ? -6.535  -25.885 -67.753 1.00 70.45  ? 290 GLY D C   1 
ATOM   7176 O O   . GLY D 1 207 ? -7.093  -26.981 -67.863 1.00 65.49  ? 290 GLY D O   1 
ATOM   7177 N N   . HIS D 1 208 ? -5.284  -25.742 -67.332 1.00 72.75  ? 291 HIS D N   1 
ATOM   7178 C CA  . HIS D 1 208 ? -4.470  -26.858 -66.880 1.00 71.38  ? 291 HIS D CA  1 
ATOM   7179 C C   . HIS D 1 208 ? -5.039  -27.484 -65.641 1.00 66.97  ? 291 HIS D C   1 
ATOM   7180 O O   . HIS D 1 208 ? -4.835  -28.669 -65.379 1.00 61.69  ? 291 HIS D O   1 
ATOM   7181 C CB  . HIS D 1 208 ? -3.081  -26.369 -66.528 1.00 74.87  ? 291 HIS D CB  1 
ATOM   7182 C CG  . HIS D 1 208 ? -2.324  -25.791 -67.678 1.00 85.84  ? 291 HIS D CG  1 
ATOM   7183 N ND1 . HIS D 1 208 ? -2.158  -24.453 -67.840 1.00 92.71  ? 291 HIS D ND1 1 
ATOM   7184 C CD2 . HIS D 1 208 ? -1.626  -26.407 -68.721 1.00 88.55  ? 291 HIS D CD2 1 
ATOM   7185 C CE1 . HIS D 1 208 ? -1.404  -24.220 -68.940 1.00 94.01  ? 291 HIS D CE1 1 
ATOM   7186 N NE2 . HIS D 1 208 ? -1.085  -25.416 -69.484 1.00 94.50  ? 291 HIS D NE2 1 
ATOM   7187 N N   . ILE D 1 209 ? -5.738  -26.674 -64.850 1.00 66.35  ? 292 ILE D N   1 
ATOM   7188 C CA  . ILE D 1 209 ? -6.187  -27.098 -63.550 1.00 67.13  ? 292 ILE D CA  1 
ATOM   7189 C C   . ILE D 1 209 ? -7.161  -28.238 -63.751 1.00 64.53  ? 292 ILE D C   1 
ATOM   7190 O O   . ILE D 1 209 ? -6.959  -29.328 -63.229 1.00 65.78  ? 292 ILE D O   1 
ATOM   7191 C CB  . ILE D 1 209 ? -6.765  -25.913 -62.731 1.00 69.66  ? 292 ILE D CB  1 
ATOM   7192 C CG1 . ILE D 1 209 ? -5.754  -24.766 -62.739 1.00 77.22  ? 292 ILE D CG1 1 
ATOM   7193 C CG2 . ILE D 1 209 ? -7.086  -26.318 -61.288 1.00 64.95  ? 292 ILE D CG2 1 
ATOM   7194 C CD1 . ILE D 1 209 ? -6.146  -23.539 -61.943 1.00 84.47  ? 292 ILE D CD1 1 
ATOM   7195 N N   . LEU D 1 210 ? -8.183  -28.010 -64.560 1.00 68.59  ? 293 LEU D N   1 
ATOM   7196 C CA  . LEU D 1 210 ? -9.199  -29.028 -64.737 1.00 67.50  ? 293 LEU D CA  1 
ATOM   7197 C C   . LEU D 1 210 ? -8.645  -30.172 -65.570 1.00 66.54  ? 293 LEU D C   1 
ATOM   7198 O O   . LEU D 1 210 ? -8.992  -31.328 -65.360 1.00 65.23  ? 293 LEU D O   1 
ATOM   7199 C CB  . LEU D 1 210 ? -10.431 -28.446 -65.395 1.00 65.59  ? 293 LEU D CB  1 
ATOM   7200 C CG  . LEU D 1 210 ? -11.771 -28.967 -64.890 1.00 65.11  ? 293 LEU D CG  1 
ATOM   7201 C CD1 . LEU D 1 210 ? -12.644 -29.180 -66.107 1.00 67.45  ? 293 LEU D CD1 1 
ATOM   7202 C CD2 . LEU D 1 210 ? -11.703 -30.262 -64.097 1.00 64.61  ? 293 LEU D CD2 1 
ATOM   7203 N N   . ALA D 1 211 ? -7.769  -29.838 -66.507 1.00 69.23  ? 294 ALA D N   1 
ATOM   7204 C CA  . ALA D 1 211 ? -7.139  -30.836 -67.370 1.00 68.39  ? 294 ALA D CA  1 
ATOM   7205 C C   . ALA D 1 211 ? -6.404  -31.855 -66.505 1.00 67.83  ? 294 ALA D C   1 
ATOM   7206 O O   . ALA D 1 211 ? -6.484  -33.070 -66.737 1.00 71.98  ? 294 ALA D O   1 
ATOM   7207 C CB  . ALA D 1 211 ? -6.179  -30.165 -68.349 1.00 63.96  ? 294 ALA D CB  1 
ATOM   7208 N N   . HIS D 1 212 ? -5.709  -31.355 -65.485 1.00 64.23  ? 295 HIS D N   1 
ATOM   7209 C CA  . HIS D 1 212 ? -4.839  -32.208 -64.703 1.00 59.64  ? 295 HIS D CA  1 
ATOM   7210 C C   . HIS D 1 212 ? -5.604  -33.173 -63.823 1.00 57.47  ? 295 HIS D C   1 
ATOM   7211 O O   . HIS D 1 212 ? -5.255  -34.352 -63.746 1.00 55.22  ? 295 HIS D O   1 
ATOM   7212 C CB  . HIS D 1 212 ? -3.829  -31.400 -63.891 1.00 56.71  ? 295 HIS D CB  1 
ATOM   7213 C CG  . HIS D 1 212 ? -3.095  -32.234 -62.884 1.00 58.02  ? 295 HIS D CG  1 
ATOM   7214 N ND1 . HIS D 1 212 ? -3.522  -32.369 -61.583 1.00 57.00  ? 295 HIS D ND1 1 
ATOM   7215 C CD2 . HIS D 1 212 ? -1.995  -33.083 -63.032 1.00 58.35  ? 295 HIS D CD2 1 
ATOM   7216 C CE1 . HIS D 1 212 ? -2.710  -33.228 -60.937 1.00 56.53  ? 295 HIS D CE1 1 
ATOM   7217 N NE2 . HIS D 1 212 ? -1.784  -33.681 -61.825 1.00 56.60  ? 295 HIS D NE2 1 
ATOM   7218 N N   . ALA D 1 213 ? -6.645  -32.669 -63.158 1.00 58.07  ? 296 ALA D N   1 
ATOM   7219 C CA  . ALA D 1 213 ? -7.422  -33.447 -62.192 1.00 55.61  ? 296 ALA D CA  1 
ATOM   7220 C C   . ALA D 1 213 ? -8.116  -34.614 -62.844 1.00 56.70  ? 296 ALA D C   1 
ATOM   7221 O O   . ALA D 1 213 ? -8.133  -35.720 -62.313 1.00 60.44  ? 296 ALA D O   1 
ATOM   7222 C CB  . ALA D 1 213 ? -8.450  -32.556 -61.514 1.00 55.07  ? 296 ALA D CB  1 
ATOM   7223 N N   . SER D 1 214 ? -8.692  -34.354 -64.009 1.00 59.61  ? 297 SER D N   1 
ATOM   7224 C CA  . SER D 1 214 ? -9.469  -35.344 -64.686 1.00 57.76  ? 297 SER D CA  1 
ATOM   7225 C C   . SER D 1 214 ? -8.498  -36.336 -65.144 1.00 57.68  ? 297 SER D C   1 
ATOM   7226 O O   . SER D 1 214 ? -7.398  -35.988 -65.583 1.00 67.25  ? 297 SER D O   1 
ATOM   7227 C CB  . SER D 1 214 ? -10.215 -34.731 -65.844 1.00 63.42  ? 297 SER D CB  1 
ATOM   7228 O OG  . SER D 1 214 ? -11.127 -33.787 -65.296 1.00 71.58  ? 297 SER D OG  1 
ATOM   7229 N N   . THR D 1 215 ? -8.878  -37.591 -65.014 1.00 55.63  ? 298 THR D N   1 
ATOM   7230 C CA  . THR D 1 215 ? -7.946  -38.610 -65.375 1.00 54.60  ? 298 THR D CA  1 
ATOM   7231 C C   . THR D 1 215 ? -8.328  -39.248 -66.725 1.00 54.99  ? 298 THR D C   1 
ATOM   7232 O O   . THR D 1 215 ? -7.483  -39.717 -67.442 1.00 54.55  ? 298 THR D O   1 
ATOM   7233 C CB  . THR D 1 215 ? -7.415  -39.447 -64.133 1.00 56.67  ? 298 THR D CB  1 
ATOM   7234 O OG1 . THR D 1 215 ? -7.301  -40.842 -64.456 1.00 54.94  ? 298 THR D OG1 1 
ATOM   7235 C CG2 . THR D 1 215 ? -8.209  -39.146 -62.759 1.00 49.37  ? 298 THR D CG2 1 
ATOM   7236 N N   . THR D 1 216 ? -9.603  -39.159 -67.085 1.00 56.04  ? 299 THR D N   1 
ATOM   7237 C CA  . THR D 1 216 ? -10.102 -39.362 -68.458 1.00 54.85  ? 299 THR D CA  1 
ATOM   7238 C C   . THR D 1 216 ? -11.000 -38.170 -68.825 1.00 57.38  ? 299 THR D C   1 
ATOM   7239 O O   . THR D 1 216 ? -11.757 -37.690 -67.962 1.00 58.01  ? 299 THR D O   1 
ATOM   7240 C CB  . THR D 1 216 ? -10.991 -40.613 -68.542 1.00 53.91  ? 299 THR D CB  1 
ATOM   7241 O OG1 . THR D 1 216 ? -10.261 -41.745 -68.084 1.00 53.51  ? 299 THR D OG1 1 
ATOM   7242 C CG2 . THR D 1 216 ? -11.424 -40.867 -69.956 1.00 57.92  ? 299 THR D CG2 1 
ATOM   7243 N N   . ARG D 1 217 ? -10.922 -37.713 -70.087 1.00 61.95  ? 300 ARG D N   1 
ATOM   7244 C CA  . ARG D 1 217 ? -11.663 -36.549 -70.613 1.00 62.57  ? 300 ARG D CA  1 
ATOM   7245 C C   . ARG D 1 217 ? -12.327 -36.934 -71.921 1.00 66.58  ? 300 ARG D C   1 
ATOM   7246 O O   . ARG D 1 217 ? -11.677 -37.433 -72.840 1.00 67.93  ? 300 ARG D O   1 
ATOM   7247 C CB  . ARG D 1 217 ? -10.712 -35.387 -70.927 1.00 65.69  ? 300 ARG D CB  1 
ATOM   7248 C CG  . ARG D 1 217 ? -9.788  -34.944 -69.803 1.00 65.58  ? 300 ARG D CG  1 
ATOM   7249 C CD  . ARG D 1 217 ? -10.181 -33.566 -69.320 1.00 63.76  ? 300 ARG D CD  1 
ATOM   7250 N NE  . ARG D 1 217 ? -9.330  -32.557 -69.911 1.00 61.76  ? 300 ARG D NE  1 
ATOM   7251 C CZ  . ARG D 1 217 ? -9.594  -31.254 -69.985 1.00 63.13  ? 300 ARG D CZ  1 
ATOM   7252 N NH1 . ARG D 1 217 ? -10.725 -30.752 -69.529 1.00 62.18  ? 300 ARG D NH1 1 
ATOM   7253 N NH2 . ARG D 1 217 ? -8.716  -30.437 -70.552 1.00 68.08  ? 300 ARG D NH2 1 
ATOM   7254 N N   . ILE D 1 218 ? -13.620 -36.688 -72.028 1.00 67.69  ? 301 ILE D N   1 
ATOM   7255 C CA  . ILE D 1 218 ? -14.347 -37.129 -73.199 1.00 71.61  ? 301 ILE D CA  1 
ATOM   7256 C C   . ILE D 1 218 ? -15.052 -35.945 -73.803 1.00 75.75  ? 301 ILE D C   1 
ATOM   7257 O O   . ILE D 1 218 ? -15.877 -35.295 -73.136 1.00 72.92  ? 301 ILE D O   1 
ATOM   7258 C CB  . ILE D 1 218 ? -15.397 -38.199 -72.861 1.00 72.93  ? 301 ILE D CB  1 
ATOM   7259 C CG1 . ILE D 1 218 ? -14.727 -39.531 -72.562 1.00 76.31  ? 301 ILE D CG1 1 
ATOM   7260 C CG2 . ILE D 1 218 ? -16.372 -38.420 -74.009 1.00 79.46  ? 301 ILE D CG2 1 
ATOM   7261 C CD1 . ILE D 1 218 ? -15.365 -40.170 -71.342 1.00 73.62  ? 301 ILE D CD1 1 
ATOM   7262 N N   . SER D 1 219 ? -14.716 -35.670 -75.065 1.00 75.67  ? 302 SER D N   1 
ATOM   7263 C CA  . SER D 1 219 ? -15.455 -34.723 -75.867 1.00 78.68  ? 302 SER D CA  1 
ATOM   7264 C C   . SER D 1 219 ? -16.771 -35.378 -76.259 1.00 82.06  ? 302 SER D C   1 
ATOM   7265 O O   . SER D 1 219 ? -16.867 -36.599 -76.437 1.00 81.43  ? 302 SER D O   1 
ATOM   7266 C CB  . SER D 1 219 ? -14.713 -34.403 -77.151 1.00 82.71  ? 302 SER D CB  1 
ATOM   7267 O OG  . SER D 1 219 ? -15.317 -35.130 -78.208 1.00 83.10  ? 302 SER D OG  1 
ATOM   7268 N N   . LEU D 1 220 ? -17.776 -34.539 -76.430 1.00 86.36  ? 303 LEU D N   1 
ATOM   7269 C CA  . LEU D 1 220 ? -19.094 -34.989 -76.787 1.00 87.95  ? 303 LEU D CA  1 
ATOM   7270 C C   . LEU D 1 220 ? -19.602 -34.110 -77.896 1.00 94.03  ? 303 LEU D C   1 
ATOM   7271 O O   . LEU D 1 220 ? -19.405 -32.889 -77.872 1.00 96.96  ? 303 LEU D O   1 
ATOM   7272 C CB  . LEU D 1 220 ? -20.016 -34.957 -75.565 1.00 82.92  ? 303 LEU D CB  1 
ATOM   7273 C CG  . LEU D 1 220 ? -19.940 -36.229 -74.714 1.00 79.95  ? 303 LEU D CG  1 
ATOM   7274 C CD1 . LEU D 1 220 ? -21.098 -36.293 -73.747 1.00 75.46  ? 303 LEU D CD1 1 
ATOM   7275 C CD2 . LEU D 1 220 ? -19.967 -37.475 -75.583 1.00 82.00  ? 303 LEU D CD2 1 
ATOM   7276 N N   . ARG D 1 221 ? -20.198 -34.741 -78.904 1.00 98.65  ? 304 ARG D N   1 
ATOM   7277 C CA  . ARG D 1 221 ? -20.821 -34.006 -79.998 1.00 99.93  ? 304 ARG D CA  1 
ATOM   7278 C C   . ARG D 1 221 ? -21.972 -34.751 -80.663 1.00 102.44 ? 304 ARG D C   1 
ATOM   7279 O O   . ARG D 1 221 ? -21.946 -35.979 -80.843 1.00 98.49  ? 304 ARG D O   1 
ATOM   7280 C CB  . ARG D 1 221 ? -19.795 -33.541 -81.024 1.00 104.45 ? 304 ARG D CB  1 
ATOM   7281 C CG  . ARG D 1 221 ? -18.445 -34.230 -80.966 1.00 104.81 ? 304 ARG D CG  1 
ATOM   7282 C CD  . ARG D 1 221 ? -17.657 -33.819 -82.189 1.00 106.57 ? 304 ARG D CD  1 
ATOM   7283 N NE  . ARG D 1 221 ? -18.128 -34.560 -83.349 1.00 110.93 ? 304 ARG D NE  1 
ATOM   7284 C CZ  . ARG D 1 221 ? -17.394 -35.443 -84.027 1.00 115.37 ? 304 ARG D CZ  1 
ATOM   7285 N NH1 . ARG D 1 221 ? -16.147 -35.687 -83.664 1.00 116.34 ? 304 ARG D NH1 1 
ATOM   7286 N NH2 . ARG D 1 221 ? -17.895 -36.074 -85.081 1.00 119.86 ? 304 ARG D NH2 1 
ATOM   7287 N N   . LYS D 1 222 ? -23.003 -33.978 -80.983 1.00 106.54 ? 305 LYS D N   1 
ATOM   7288 C CA  . LYS D 1 222 ? -24.176 -34.481 -81.680 1.00 110.32 ? 305 LYS D CA  1 
ATOM   7289 C C   . LYS D 1 222 ? -23.773 -34.806 -83.095 1.00 111.06 ? 305 LYS D C   1 
ATOM   7290 O O   . LYS D 1 222 ? -23.267 -33.940 -83.793 1.00 114.54 ? 305 LYS D O   1 
ATOM   7291 C CB  . LYS D 1 222 ? -25.298 -33.428 -81.653 1.00 112.97 ? 305 LYS D CB  1 
ATOM   7292 C CG  . LYS D 1 222 ? -26.452 -33.670 -82.619 1.00 121.74 ? 305 LYS D CG  1 
ATOM   7293 C CD  . LYS D 1 222 ? -27.822 -33.526 -81.956 1.00 120.96 ? 305 LYS D CD  1 
ATOM   7294 C CE  . LYS D 1 222 ? -28.123 -32.117 -81.455 1.00 120.78 ? 305 LYS D CE  1 
ATOM   7295 N NZ  . LYS D 1 222 ? -29.114 -31.343 -82.258 1.00 120.95 ? 305 LYS D NZ  1 
ATOM   7296 N N   . GLY D 1 223 ? -23.957 -36.065 -83.492 1.00 111.33 ? 306 GLY D N   1 
ATOM   7297 C CA  . GLY D 1 223 ? -23.830 -36.475 -84.891 1.00 116.28 ? 306 GLY D CA  1 
ATOM   7298 C C   . GLY D 1 223 ? -25.085 -36.040 -85.621 1.00 120.67 ? 306 GLY D C   1 
ATOM   7299 O O   . GLY D 1 223 ? -25.601 -34.955 -85.367 1.00 119.06 ? 306 GLY D O   1 
ATOM   7300 N N   . ARG D 1 224 ? -25.602 -36.876 -86.515 1.00 128.80 ? 307 ARG D N   1 
ATOM   7301 C CA  . ARG D 1 224 ? -26.863 -36.537 -87.204 1.00 134.16 ? 307 ARG D CA  1 
ATOM   7302 C C   . ARG D 1 224 ? -28.089 -36.996 -86.402 1.00 128.81 ? 307 ARG D C   1 
ATOM   7303 O O   . ARG D 1 224 ? -27.992 -37.919 -85.602 1.00 121.24 ? 307 ARG D O   1 
ATOM   7304 C CB  . ARG D 1 224 ? -26.892 -37.042 -88.657 1.00 139.86 ? 307 ARG D CB  1 
ATOM   7305 C CG  . ARG D 1 224 ? -26.375 -38.458 -88.851 1.00 145.86 ? 307 ARG D CG  1 
ATOM   7306 C CD  . ARG D 1 224 ? -26.402 -38.846 -90.320 1.00 157.27 ? 307 ARG D CD  1 
ATOM   7307 N NE  . ARG D 1 224 ? -27.624 -39.570 -90.707 1.00 163.51 ? 307 ARG D NE  1 
ATOM   7308 C CZ  . ARG D 1 224 ? -28.834 -39.032 -90.908 1.00 162.60 ? 307 ARG D CZ  1 
ATOM   7309 N NH1 . ARG D 1 224 ? -29.050 -37.730 -90.740 1.00 160.58 ? 307 ARG D NH1 1 
ATOM   7310 N NH2 . ARG D 1 224 ? -29.850 -39.812 -91.271 1.00 160.58 ? 307 ARG D NH2 1 
ATOM   7311 N N   . GLY D 1 225 ? -29.230 -36.336 -86.615 1.00 132.06 ? 308 GLY D N   1 
ATOM   7312 C CA  . GLY D 1 225 ? -30.421 -36.561 -85.793 1.00 127.56 ? 308 GLY D CA  1 
ATOM   7313 C C   . GLY D 1 225 ? -30.024 -36.710 -84.341 1.00 121.18 ? 308 GLY D C   1 
ATOM   7314 O O   . GLY D 1 225 ? -29.466 -35.785 -83.746 1.00 117.19 ? 308 GLY D O   1 
ATOM   7315 N N   . GLU D 1 226 ? -30.250 -37.903 -83.796 1.00 120.91 ? 309 GLU D N   1 
ATOM   7316 C CA  . GLU D 1 226 ? -30.042 -38.171 -82.361 1.00 112.90 ? 309 GLU D CA  1 
ATOM   7317 C C   . GLU D 1 226 ? -28.786 -39.022 -81.984 1.00 110.42 ? 309 GLU D C   1 
ATOM   7318 O O   . GLU D 1 226 ? -28.439 -39.133 -80.789 1.00 107.61 ? 309 GLU D O   1 
ATOM   7319 C CB  . GLU D 1 226 ? -31.370 -38.654 -81.725 1.00 111.52 ? 309 GLU D CB  1 
ATOM   7320 C CG  . GLU D 1 226 ? -31.355 -39.991 -80.996 1.00 114.76 ? 309 GLU D CG  1 
ATOM   7321 C CD  . GLU D 1 226 ? -31.571 -41.203 -81.905 1.00 124.59 ? 309 GLU D CD  1 
ATOM   7322 O OE1 . GLU D 1 226 ? -31.665 -42.325 -81.350 1.00 125.91 ? 309 GLU D OE1 1 
ATOM   7323 O OE2 . GLU D 1 226 ? -31.652 -41.056 -83.158 1.00 127.99 ? 309 GLU D OE2 1 
ATOM   7324 N N   . LEU D 1 227 ? -28.119 -39.591 -82.999 1.00 110.92 ? 310 LEU D N   1 
ATOM   7325 C CA  . LEU D 1 227 ? -26.777 -40.201 -82.880 1.00 111.07 ? 310 LEU D CA  1 
ATOM   7326 C C   . LEU D 1 227 ? -25.866 -39.204 -82.187 1.00 110.07 ? 310 LEU D C   1 
ATOM   7327 O O   . LEU D 1 227 ? -26.037 -37.989 -82.340 1.00 110.29 ? 310 LEU D O   1 
ATOM   7328 C CB  . LEU D 1 227 ? -26.125 -40.471 -84.256 1.00 117.19 ? 310 LEU D CB  1 
ATOM   7329 C CG  . LEU D 1 227 ? -26.681 -41.179 -85.507 1.00 123.41 ? 310 LEU D CG  1 
ATOM   7330 C CD1 . LEU D 1 227 ? -28.020 -40.640 -86.015 1.00 123.84 ? 310 LEU D CD1 1 
ATOM   7331 C CD2 . LEU D 1 227 ? -25.642 -41.169 -86.634 1.00 131.38 ? 310 LEU D CD2 1 
ATOM   7332 N N   . ARG D 1 228 ? -24.883 -39.711 -81.447 1.00 109.74 ? 311 ARG D N   1 
ATOM   7333 C CA  . ARG D 1 228 ? -23.906 -38.863 -80.762 1.00 104.14 ? 311 ARG D CA  1 
ATOM   7334 C C   . ARG D 1 228 ? -22.520 -39.507 -80.678 1.00 102.34 ? 311 ARG D C   1 
ATOM   7335 O O   . ARG D 1 228 ? -22.368 -40.752 -80.684 1.00 100.13 ? 311 ARG D O   1 
ATOM   7336 C CB  . ARG D 1 228 ? -24.415 -38.481 -79.381 1.00 102.40 ? 311 ARG D CB  1 
ATOM   7337 C CG  . ARG D 1 228 ? -25.388 -37.319 -79.395 1.00 104.00 ? 311 ARG D CG  1 
ATOM   7338 C CD  . ARG D 1 228 ? -25.436 -36.650 -78.031 1.00 104.07 ? 311 ARG D CD  1 
ATOM   7339 N NE  . ARG D 1 228 ? -26.240 -35.427 -78.006 1.00 106.56 ? 311 ARG D NE  1 
ATOM   7340 C CZ  . ARG D 1 228 ? -27.296 -35.182 -78.782 1.00 111.03 ? 311 ARG D CZ  1 
ATOM   7341 N NH1 . ARG D 1 228 ? -27.717 -36.081 -79.676 1.00 111.03 ? 311 ARG D NH1 1 
ATOM   7342 N NH2 . ARG D 1 228 ? -27.941 -34.026 -78.652 1.00 111.60 ? 311 ARG D NH2 1 
ATOM   7343 N N   . ILE D 1 229 ? -21.509 -38.641 -80.602 1.00 101.36 ? 312 ILE D N   1 
ATOM   7344 C CA  . ILE D 1 229 ? -20.108 -39.068 -80.681 1.00 100.40 ? 312 ILE D CA  1 
ATOM   7345 C C   . ILE D 1 229 ? -19.314 -38.750 -79.415 1.00 98.40  ? 312 ILE D C   1 
ATOM   7346 O O   . ILE D 1 229 ? -19.311 -37.600 -78.943 1.00 99.02  ? 312 ILE D O   1 
ATOM   7347 C CB  . ILE D 1 229 ? -19.393 -38.386 -81.865 1.00 104.17 ? 312 ILE D CB  1 
ATOM   7348 C CG1 . ILE D 1 229 ? -20.047 -38.755 -83.217 1.00 105.88 ? 312 ILE D CG1 1 
ATOM   7349 C CG2 . ILE D 1 229 ? -17.892 -38.651 -81.796 1.00 103.58 ? 312 ILE D CG2 1 
ATOM   7350 C CD1 . ILE D 1 229 ? -20.491 -40.199 -83.349 1.00 104.59 ? 312 ILE D CD1 1 
ATOM   7351 N N   . ALA D 1 230 ? -18.637 -39.768 -78.883 1.00 95.08  ? 313 ALA D N   1 
ATOM   7352 C CA  . ALA D 1 230 ? -17.722 -39.595 -77.768 1.00 90.17  ? 313 ALA D CA  1 
ATOM   7353 C C   . ALA D 1 230 ? -16.300 -39.774 -78.261 1.00 92.59  ? 313 ALA D C   1 
ATOM   7354 O O   . ALA D 1 230 ? -16.029 -40.720 -78.984 1.00 101.02 ? 313 ALA D O   1 
ATOM   7355 C CB  . ALA D 1 230 ? -18.025 -40.611 -76.693 1.00 89.88  ? 313 ALA D CB  1 
ATOM   7356 N N   . LYS D 1 231 ? -15.396 -38.879 -77.868 1.00 90.54  ? 314 LYS D N   1 
ATOM   7357 C CA  . LYS D 1 231 ? -13.986 -38.944 -78.279 1.00 92.49  ? 314 LYS D CA  1 
ATOM   7358 C C   . LYS D 1 231 ? -13.079 -38.577 -77.109 1.00 87.27  ? 314 LYS D C   1 
ATOM   7359 O O   . LYS D 1 231 ? -13.391 -37.649 -76.371 1.00 86.53  ? 314 LYS D O   1 
ATOM   7360 C CB  . LYS D 1 231 ? -13.748 -38.010 -79.485 1.00 94.39  ? 314 LYS D CB  1 
ATOM   7361 C CG  . LYS D 1 231 ? -12.297 -37.716 -79.846 1.00 95.01  ? 314 LYS D CG  1 
ATOM   7362 C CD  . LYS D 1 231 ? -11.733 -38.741 -80.828 1.00 100.14 ? 314 LYS D CD  1 
ATOM   7363 C CE  . LYS D 1 231 ? -11.001 -38.084 -82.000 1.00 102.24 ? 314 LYS D CE  1 
ATOM   7364 N NZ  . LYS D 1 231 ? -10.246 -39.056 -82.851 1.00 107.62 ? 314 LYS D NZ  1 
ATOM   7365 N N   . ILE D 1 232 ? -11.977 -39.301 -76.929 1.00 87.31  ? 315 ILE D N   1 
ATOM   7366 C CA  . ILE D 1 232 ? -10.958 -38.929 -75.933 1.00 86.12  ? 315 ILE D CA  1 
ATOM   7367 C C   . ILE D 1 232 ? -10.306 -37.600 -76.337 1.00 95.32  ? 315 ILE D C   1 
ATOM   7368 O O   . ILE D 1 232 ? -9.823  -37.470 -77.477 1.00 103.85 ? 315 ILE D O   1 
ATOM   7369 C CB  . ILE D 1 232 ? -9.873  -40.027 -75.795 1.00 83.53  ? 315 ILE D CB  1 
ATOM   7370 C CG1 . ILE D 1 232 ? -10.315 -41.134 -74.856 1.00 76.42  ? 315 ILE D CG1 1 
ATOM   7371 C CG2 . ILE D 1 232 ? -8.597  -39.484 -75.183 1.00 88.07  ? 315 ILE D CG2 1 
ATOM   7372 C CD1 . ILE D 1 232 ? -11.350 -42.050 -75.440 1.00 78.44  ? 315 ILE D CD1 1 
ATOM   7373 N N   . TYR D 1 233 ? -10.284 -36.622 -75.423 1.00 98.86  ? 316 TYR D N   1 
ATOM   7374 C CA  . TYR D 1 233 ? -9.680  -35.293 -75.714 1.00 109.40 ? 316 TYR D CA  1 
ATOM   7375 C C   . TYR D 1 233 ? -8.162  -35.340 -75.973 1.00 115.28 ? 316 TYR D C   1 
ATOM   7376 O O   . TYR D 1 233 ? -7.383  -35.795 -75.119 1.00 112.14 ? 316 TYR D O   1 
ATOM   7377 C CB  . TYR D 1 233 ? -10.020 -34.252 -74.631 1.00 108.75 ? 316 TYR D CB  1 
ATOM   7378 C CG  . TYR D 1 233 ? -9.553  -32.823 -74.923 1.00 113.02 ? 316 TYR D CG  1 
ATOM   7379 C CD1 . TYR D 1 233 ? -10.192 -32.035 -75.887 1.00 112.93 ? 316 TYR D CD1 1 
ATOM   7380 C CD2 . TYR D 1 233 ? -8.487  -32.251 -74.212 1.00 113.69 ? 316 TYR D CD2 1 
ATOM   7381 C CE1 . TYR D 1 233 ? -9.779  -30.730 -76.140 1.00 115.67 ? 316 TYR D CE1 1 
ATOM   7382 C CE2 . TYR D 1 233 ? -8.065  -30.946 -74.464 1.00 112.42 ? 316 TYR D CE2 1 
ATOM   7383 C CZ  . TYR D 1 233 ? -8.715  -30.192 -75.425 1.00 116.63 ? 316 TYR D CZ  1 
ATOM   7384 O OH  . TYR D 1 233 ? -8.303  -28.905 -75.683 1.00 121.52 ? 316 TYR D OH  1 
ATOM   7385 N N   . ASP D 1 234 ? -7.791  -34.829 -77.154 1.00 123.04 ? 317 ASP D N   1 
ATOM   7386 C CA  . ASP D 1 234 ? -6.445  -34.884 -77.774 1.00 131.07 ? 317 ASP D CA  1 
ATOM   7387 C C   . ASP D 1 234 ? -6.342  -36.079 -78.718 1.00 132.88 ? 317 ASP D C   1 
ATOM   7388 O O   . ASP D 1 234 ? -5.693  -37.086 -78.423 1.00 132.13 ? 317 ASP D O   1 
ATOM   7389 C CB  . ASP D 1 234 ? -5.285  -34.814 -76.764 1.00 130.81 ? 317 ASP D CB  1 
ATOM   7390 C CG  . ASP D 1 234 ? -4.874  -33.379 -76.433 1.00 128.50 ? 317 ASP D CG  1 
ATOM   7391 O OD1 . ASP D 1 234 ? -3.833  -33.219 -75.761 1.00 122.45 ? 317 ASP D OD1 1 
ATOM   7392 O OD2 . ASP D 1 234 ? -5.575  -32.420 -76.838 1.00 127.11 ? 317 ASP D OD2 1 
ATOM   7393 N N   . SER D 1 235 ? -6.995  -35.915 -79.867 1.00 139.73 ? 318 SER D N   1 
ATOM   7394 C CA  . SER D 1 235 ? -7.295  -36.982 -80.835 1.00 139.50 ? 318 SER D CA  1 
ATOM   7395 C C   . SER D 1 235 ? -7.007  -38.433 -80.318 1.00 136.80 ? 318 SER D C   1 
ATOM   7396 O O   . SER D 1 235 ? -7.751  -38.908 -79.434 1.00 129.60 ? 318 SER D O   1 
ATOM   7397 C CB  . SER D 1 235 ? -6.710  -36.627 -82.216 1.00 143.57 ? 318 SER D CB  1 
ATOM   7398 O OG  . SER D 1 235 ? -7.624  -36.903 -83.267 1.00 139.43 ? 318 SER D OG  1 
ATOM   7399 N N   . PRO D 1 236 ? -5.943  -39.126 -80.822 1.00 135.71 ? 319 PRO D N   1 
ATOM   7400 C CA  . PRO D 1 236 ? -4.953  -38.744 -81.841 1.00 140.76 ? 319 PRO D CA  1 
ATOM   7401 C C   . PRO D 1 236 ? -5.312  -39.076 -83.311 1.00 143.97 ? 319 PRO D C   1 
ATOM   7402 O O   . PRO D 1 236 ? -4.395  -39.253 -84.107 1.00 145.60 ? 319 PRO D O   1 
ATOM   7403 C CB  . PRO D 1 236 ? -3.696  -39.508 -81.400 1.00 134.72 ? 319 PRO D CB  1 
ATOM   7404 C CG  . PRO D 1 236 ? -4.227  -40.751 -80.784 1.00 131.04 ? 319 PRO D CG  1 
ATOM   7405 C CD  . PRO D 1 236 ? -5.559  -40.395 -80.166 1.00 130.42 ? 319 PRO D CD  1 
ATOM   7406 N N   . GLU D 1 237 ? -6.615  -39.167 -83.641 1.00 147.78 ? 320 GLU D N   1 
ATOM   7407 C CA  . GLU D 1 237 ? -7.166  -39.212 -85.042 1.00 154.90 ? 320 GLU D CA  1 
ATOM   7408 C C   . GLU D 1 237 ? -7.846  -40.531 -85.462 1.00 153.25 ? 320 GLU D C   1 
ATOM   7409 O O   . GLU D 1 237 ? -8.776  -40.522 -86.271 1.00 146.88 ? 320 GLU D O   1 
ATOM   7410 C CB  . GLU D 1 237 ? -6.131  -38.793 -86.113 1.00 163.35 ? 320 GLU D CB  1 
ATOM   7411 C CG  . GLU D 1 237 ? -6.653  -37.834 -87.185 1.00 170.76 ? 320 GLU D CG  1 
ATOM   7412 C CD  . GLU D 1 237 ? -7.436  -38.528 -88.301 1.00 175.53 ? 320 GLU D CD  1 
ATOM   7413 O OE1 . GLU D 1 237 ? -8.684  -38.350 -88.338 1.00 168.94 ? 320 GLU D OE1 1 
ATOM   7414 O OE2 . GLU D 1 237 ? -6.808  -39.234 -89.141 1.00 176.09 ? 320 GLU D OE2 1 
ATOM   7415 N N   . MET D 1 238 ? -7.371  -41.651 -84.914 1.00 154.52 ? 321 MET D N   1 
ATOM   7416 C CA  . MET D 1 238 ? -7.895  -42.985 -85.235 1.00 152.44 ? 321 MET D CA  1 
ATOM   7417 C C   . MET D 1 238 ? -9.297  -43.200 -84.645 1.00 152.21 ? 321 MET D C   1 
ATOM   7418 O O   . MET D 1 238 ? -9.559  -42.811 -83.483 1.00 140.35 ? 321 MET D O   1 
ATOM   7419 C CB  . MET D 1 238 ? -6.933  -44.081 -84.744 1.00 149.83 ? 321 MET D CB  1 
ATOM   7420 C CG  . MET D 1 238 ? -5.497  -43.974 -85.250 1.00 151.24 ? 321 MET D CG  1 
ATOM   7421 S SD  . MET D 1 238 ? -5.354  -43.831 -87.045 1.00 162.58 ? 321 MET D SD  1 
ATOM   7422 C CE  . MET D 1 238 ? -4.947  -42.097 -87.262 1.00 160.82 ? 321 MET D CE  1 
ATOM   7423 N N   . PRO D 1 239 ? -10.202 -43.827 -85.438 1.00 151.37 ? 322 PRO D N   1 
ATOM   7424 C CA  . PRO D 1 239 ? -11.617 -44.011 -85.056 1.00 146.77 ? 322 PRO D CA  1 
ATOM   7425 C C   . PRO D 1 239 ? -11.812 -44.972 -83.873 1.00 135.56 ? 322 PRO D C   1 
ATOM   7426 O O   . PRO D 1 239 ? -12.917 -45.108 -83.361 1.00 125.98 ? 322 PRO D O   1 
ATOM   7427 C CB  . PRO D 1 239 ? -12.254 -44.570 -86.331 1.00 148.05 ? 322 PRO D CB  1 
ATOM   7428 C CG  . PRO D 1 239 ? -11.134 -45.264 -87.026 1.00 155.42 ? 322 PRO D CG  1 
ATOM   7429 C CD  . PRO D 1 239 ? -9.893  -44.475 -86.726 1.00 153.54 ? 322 PRO D CD  1 
ATOM   7430 N N   . GLU D 1 240 ? -10.733 -45.639 -83.470 1.00 137.34 ? 323 GLU D N   1 
ATOM   7431 C CA  . GLU D 1 240 ? -10.686 -46.411 -82.235 1.00 131.25 ? 323 GLU D CA  1 
ATOM   7432 C C   . GLU D 1 240 ? -11.075 -45.524 -81.056 1.00 123.65 ? 323 GLU D C   1 
ATOM   7433 O O   . GLU D 1 240 ? -11.681 -46.005 -80.103 1.00 124.10 ? 323 GLU D O   1 
ATOM   7434 C CB  . GLU D 1 240 ? -9.279  -46.992 -82.019 1.00 136.66 ? 323 GLU D CB  1 
ATOM   7435 C CG  . GLU D 1 240 ? -8.197  -45.938 -81.749 1.00 140.25 ? 323 GLU D CG  1 
ATOM   7436 C CD  . GLU D 1 240 ? -6.770  -46.404 -82.023 1.00 143.11 ? 323 GLU D CD  1 
ATOM   7437 O OE1 . GLU D 1 240 ? -5.828  -45.716 -81.560 1.00 140.74 ? 323 GLU D OE1 1 
ATOM   7438 O OE2 . GLU D 1 240 ? -6.583  -47.439 -82.701 1.00 142.57 ? 323 GLU D OE2 1 
ATOM   7439 N N   . ASN D 1 241 ? -10.736 -44.232 -81.140 1.00 119.56 ? 324 ASN D N   1 
ATOM   7440 C CA  . ASN D 1 241 ? -11.005 -43.246 -80.073 1.00 108.22 ? 324 ASN D CA  1 
ATOM   7441 C C   . ASN D 1 241 ? -12.388 -42.543 -80.149 1.00 109.17 ? 324 ASN D C   1 
ATOM   7442 O O   . ASN D 1 241 ? -12.632 -41.571 -79.414 1.00 107.56 ? 324 ASN D O   1 
ATOM   7443 C CB  . ASN D 1 241 ? -9.886  -42.190 -80.007 1.00 103.42 ? 324 ASN D CB  1 
ATOM   7444 C CG  . ASN D 1 241 ? -8.506  -42.780 -80.221 1.00 105.46 ? 324 ASN D CG  1 
ATOM   7445 O OD1 . ASN D 1 241 ? -8.021  -43.574 -79.411 1.00 97.85  ? 324 ASN D OD1 1 
ATOM   7446 N ND2 . ASN D 1 241 ? -7.860  -42.392 -81.331 1.00 110.93 ? 324 ASN D ND2 1 
ATOM   7447 N N   . GLU D 1 242 ? -13.271 -43.031 -81.032 1.00 108.36 ? 325 GLU D N   1 
ATOM   7448 C CA  . GLU D 1 242 ? -14.626 -42.491 -81.203 1.00 104.21 ? 325 GLU D CA  1 
ATOM   7449 C C   . GLU D 1 242 ? -15.670 -43.594 -81.143 1.00 104.72 ? 325 GLU D C   1 
ATOM   7450 O O   . GLU D 1 242 ? -15.622 -44.545 -81.935 1.00 107.52 ? 325 GLU D O   1 
ATOM   7451 C CB  . GLU D 1 242 ? -14.783 -41.788 -82.550 1.00 108.00 ? 325 GLU D CB  1 
ATOM   7452 C CG  . GLU D 1 242 ? -13.802 -40.670 -82.835 1.00 107.31 ? 325 GLU D CG  1 
ATOM   7453 C CD  . GLU D 1 242 ? -14.341 -39.700 -83.852 1.00 108.92 ? 325 GLU D CD  1 
ATOM   7454 O OE1 . GLU D 1 242 ? -15.484 -39.258 -83.690 1.00 107.08 ? 325 GLU D OE1 1 
ATOM   7455 O OE2 . GLU D 1 242 ? -13.631 -39.378 -84.817 1.00 115.04 ? 325 GLU D OE2 1 
ATOM   7456 N N   . ALA D 1 243 ? -16.625 -43.452 -80.228 1.00 99.38  ? 326 ALA D N   1 
ATOM   7457 C CA  . ALA D 1 243 ? -17.753 -44.379 -80.145 1.00 99.83  ? 326 ALA D CA  1 
ATOM   7458 C C   . ALA D 1 243 ? -19.104 -43.735 -80.472 1.00 99.95  ? 326 ALA D C   1 
ATOM   7459 O O   . ALA D 1 243 ? -19.334 -42.536 -80.248 1.00 96.46  ? 326 ALA D O   1 
ATOM   7460 C CB  . ALA D 1 243 ? -17.799 -45.060 -78.787 1.00 96.54  ? 326 ALA D CB  1 
ATOM   7461 N N   . THR D 1 244 ? -19.996 -44.562 -80.998 1.00 103.42 ? 327 THR D N   1 
ATOM   7462 C CA  . THR D 1 244 ? -21.322 -44.113 -81.368 1.00 109.08 ? 327 THR D CA  1 
ATOM   7463 C C   . THR D 1 244 ? -22.381 -44.748 -80.489 1.00 106.14 ? 327 THR D C   1 
ATOM   7464 O O   . THR D 1 244 ? -22.629 -45.978 -80.523 1.00 104.45 ? 327 THR D O   1 
ATOM   7465 C CB  . THR D 1 244 ? -21.635 -44.349 -82.859 1.00 117.08 ? 327 THR D CB  1 
ATOM   7466 O OG1 . THR D 1 244 ? -20.587 -43.791 -83.654 1.00 125.51 ? 327 THR D OG1 1 
ATOM   7467 C CG2 . THR D 1 244 ? -22.947 -43.685 -83.252 1.00 119.27 ? 327 THR D CG2 1 
ATOM   7468 N N   . PHE D 1 245 ? -22.984 -43.862 -79.703 1.00 100.24 ? 328 PHE D N   1 
ATOM   7469 C CA  . PHE D 1 245 ? -24.147 -44.155 -78.892 1.00 98.73  ? 328 PHE D CA  1 
ATOM   7470 C C   . PHE D 1 245 ? -25.335 -43.327 -79.412 1.00 100.70 ? 328 PHE D C   1 
ATOM   7471 O O   . PHE D 1 245 ? -25.144 -42.424 -80.232 1.00 104.04 ? 328 PHE D O   1 
ATOM   7472 C CB  . PHE D 1 245 ? -23.832 -43.858 -77.405 1.00 90.24  ? 328 PHE D CB  1 
ATOM   7473 C CG  . PHE D 1 245 ? -23.678 -42.382 -77.059 1.00 85.78  ? 328 PHE D CG  1 
ATOM   7474 C CD1 . PHE D 1 245 ? -24.695 -41.695 -76.395 1.00 87.39  ? 328 PHE D CD1 1 
ATOM   7475 C CD2 . PHE D 1 245 ? -22.500 -41.692 -77.329 1.00 84.42  ? 328 PHE D CD2 1 
ATOM   7476 C CE1 . PHE D 1 245 ? -24.541 -40.346 -76.026 1.00 86.37  ? 328 PHE D CE1 1 
ATOM   7477 C CE2 . PHE D 1 245 ? -22.343 -40.348 -76.979 1.00 81.78  ? 328 PHE D CE2 1 
ATOM   7478 C CZ  . PHE D 1 245 ? -23.363 -39.673 -76.323 1.00 83.99  ? 328 PHE D CZ  1 
ATOM   7479 N N   . ALA D 1 246 ? -26.550 -43.636 -78.951 1.00 99.71  ? 329 ALA D N   1 
ATOM   7480 C CA  . ALA D 1 246 ? -27.708 -42.745 -79.134 1.00 99.31  ? 329 ALA D CA  1 
ATOM   7481 C C   . ALA D 1 246 ? -28.341 -42.368 -77.776 1.00 96.87  ? 329 ALA D C   1 
ATOM   7482 O O   . ALA D 1 246 ? -28.145 -43.077 -76.786 1.00 98.93  ? 329 ALA D O   1 
ATOM   7483 C CB  . ALA D 1 246 ? -28.735 -43.397 -80.043 1.00 102.54 ? 329 ALA D CB  1 
ATOM   7484 N N   . ILE D 1 247 ? -29.065 -41.252 -77.713 1.00 93.26  ? 330 ILE D N   1 
ATOM   7485 C CA  . ILE D 1 247 ? -29.832 -40.943 -76.516 1.00 91.01  ? 330 ILE D CA  1 
ATOM   7486 C C   . ILE D 1 247 ? -31.313 -41.185 -76.789 1.00 95.77  ? 330 ILE D C   1 
ATOM   7487 O O   . ILE D 1 247 ? -31.804 -40.861 -77.871 1.00 103.13 ? 330 ILE D O   1 
ATOM   7488 C CB  . ILE D 1 247 ? -29.533 -39.524 -75.941 1.00 91.38  ? 330 ILE D CB  1 
ATOM   7489 C CG1 . ILE D 1 247 ? -30.391 -38.421 -76.578 1.00 93.39  ? 330 ILE D CG1 1 
ATOM   7490 C CG2 . ILE D 1 247 ? -28.037 -39.205 -75.991 1.00 88.53  ? 330 ILE D CG2 1 
ATOM   7491 C CD1 . ILE D 1 247 ? -31.495 -37.883 -75.681 1.00 90.16  ? 330 ILE D CD1 1 
ATOM   7492 N N   . THR D 1 248 ? -32.004 -41.801 -75.830 1.00 91.62  ? 331 THR D N   1 
ATOM   7493 C CA  . THR D 1 248 ? -33.405 -42.202 -76.001 1.00 92.74  ? 331 THR D CA  1 
ATOM   7494 C C   . THR D 1 248 ? -34.074 -42.150 -74.675 1.00 86.12  ? 331 THR D C   1 
ATOM   7495 O O   . THR D 1 248 ? -33.411 -42.048 -73.655 1.00 84.29  ? 331 THR D O   1 
ATOM   7496 C CB  . THR D 1 248 ? -33.570 -43.669 -76.442 1.00 96.74  ? 331 THR D CB  1 
ATOM   7497 O OG1 . THR D 1 248 ? -32.643 -44.492 -75.721 1.00 93.31  ? 331 THR D OG1 1 
ATOM   7498 C CG2 . THR D 1 248 ? -33.378 -43.829 -77.950 1.00 105.09 ? 331 THR D CG2 1 
ATOM   7499 N N   . ALA D 1 249 ? -35.391 -42.285 -74.694 1.00 85.75  ? 332 ALA D N   1 
ATOM   7500 C CA  . ALA D 1 249 ? -36.186 -42.242 -73.493 1.00 83.52  ? 332 ALA D CA  1 
ATOM   7501 C C   . ALA D 1 249 ? -35.571 -43.125 -72.413 1.00 82.70  ? 332 ALA D C   1 
ATOM   7502 O O   . ALA D 1 249 ? -35.582 -42.743 -71.240 1.00 81.18  ? 332 ALA D O   1 
ATOM   7503 C CB  . ALA D 1 249 ? -37.617 -42.657 -73.777 1.00 84.51  ? 332 ALA D CB  1 
ATOM   7504 N N   . GLY D 1 250 ? -35.021 -44.276 -72.812 1.00 84.10  ? 333 GLY D N   1 
ATOM   7505 C CA  . GLY D 1 250 ? -34.376 -45.214 -71.875 1.00 82.62  ? 333 GLY D CA  1 
ATOM   7506 C C   . GLY D 1 250 ? -32.933 -44.869 -71.526 1.00 80.22  ? 333 GLY D C   1 
ATOM   7507 O O   . GLY D 1 250 ? -32.142 -45.761 -71.191 1.00 80.35  ? 333 GLY D O   1 
ATOM   7508 N N   . GLY D 1 251 ? -32.589 -43.578 -71.601 1.00 76.83  ? 334 GLY D N   1 
ATOM   7509 C CA  . GLY D 1 251 ? -31.213 -43.104 -71.355 1.00 74.51  ? 334 GLY D CA  1 
ATOM   7510 C C   . GLY D 1 251 ? -30.241 -43.546 -72.427 1.00 77.25  ? 334 GLY D C   1 
ATOM   7511 O O   . GLY D 1 251 ? -30.665 -44.006 -73.489 1.00 84.53  ? 334 GLY D O   1 
ATOM   7512 N N   . ILE D 1 252 ? -28.940 -43.428 -72.151 1.00 77.00  ? 335 ILE D N   1 
ATOM   7513 C CA  . ILE D 1 252 ? -27.875 -43.775 -73.123 1.00 75.39  ? 335 ILE D CA  1 
ATOM   7514 C C   . ILE D 1 252 ? -27.868 -45.252 -73.567 1.00 77.38  ? 335 ILE D C   1 
ATOM   7515 O O   . ILE D 1 252 ? -27.810 -46.165 -72.730 1.00 73.25  ? 335 ILE D O   1 
ATOM   7516 C CB  . ILE D 1 252 ? -26.458 -43.391 -72.617 1.00 70.77  ? 335 ILE D CB  1 
ATOM   7517 C CG1 . ILE D 1 252 ? -26.022 -42.027 -73.133 1.00 69.27  ? 335 ILE D CG1 1 
ATOM   7518 C CG2 . ILE D 1 252 ? -25.407 -44.322 -73.219 1.00 74.21  ? 335 ILE D CG2 1 
ATOM   7519 C CD1 . ILE D 1 252 ? -26.613 -40.837 -72.451 1.00 69.61  ? 335 ILE D CD1 1 
ATOM   7520 N N   . GLY D 1 253 ? -27.906 -45.452 -74.886 1.00 80.29  ? 336 GLY D N   1 
ATOM   7521 C CA  . GLY D 1 253 ? -27.860 -46.782 -75.517 1.00 87.16  ? 336 GLY D CA  1 
ATOM   7522 C C   . GLY D 1 253 ? -27.054 -46.842 -76.820 1.00 91.73  ? 336 GLY D C   1 
ATOM   7523 O O   . GLY D 1 253 ? -26.263 -45.944 -77.112 1.00 93.27  ? 336 GLY D O   1 
ATOM   7524 N N   . ASP D 1 254 ? -27.238 -47.897 -77.611 1.00 95.04  ? 337 ASP D N   1 
ATOM   7525 C CA  . ASP D 1 254 ? -26.453 -48.045 -78.851 1.00 98.74  ? 337 ASP D CA  1 
ATOM   7526 C C   . ASP D 1 254 ? -27.224 -47.530 -80.061 1.00 99.76  ? 337 ASP D C   1 
ATOM   7527 O O   . ASP D 1 254 ? -28.446 -47.529 -80.057 1.00 101.05 ? 337 ASP D O   1 
ATOM   7528 C CB  . ASP D 1 254 ? -26.015 -49.500 -79.073 1.00 102.20 ? 337 ASP D CB  1 
ATOM   7529 C CG  . ASP D 1 254 ? -25.703 -50.214 -77.780 1.00 99.59  ? 337 ASP D CG  1 
ATOM   7530 O OD1 . ASP D 1 254 ? -24.644 -49.939 -77.157 1.00 97.33  ? 337 ASP D OD1 1 
ATOM   7531 O OD2 . ASP D 1 254 ? -26.539 -51.046 -77.384 1.00 101.29 ? 337 ASP D OD2 1 
ATOM   7532 N N   . ALA D 1 255 ? -26.501 -47.090 -81.089 1.00 101.75 ? 338 ALA D N   1 
ATOM   7533 C CA  . ALA D 1 255 ? -27.111 -46.578 -82.333 1.00 104.66 ? 338 ALA D CA  1 
ATOM   7534 C C   . ALA D 1 255 ? -27.840 -47.662 -83.141 1.00 108.10 ? 338 ALA D C   1 
ATOM   7535 O O   . ALA D 1 255 ? -27.508 -48.845 -83.054 1.00 105.98 ? 338 ALA D O   1 
ATOM   7536 C CB  . ALA D 1 255 ? -26.056 -45.890 -83.189 1.00 104.87 ? 338 ALA D CB  1 
HETATM 7537 O O   . HOH E 2 .   ? 10.828  -30.705 -25.342 1.00 45.21  ? 401 HOH A O   1 
HETATM 7538 O O   . HOH E 2 .   ? -4.052  -39.347 -24.763 1.00 44.27  ? 402 HOH A O   1 
HETATM 7539 O O   . HOH E 2 .   ? 5.988   -49.239 -40.815 1.00 76.77  ? 403 HOH A O   1 
HETATM 7540 O O   . HOH E 2 .   ? 11.532  -23.657 -32.999 1.00 54.48  ? 404 HOH A O   1 
HETATM 7541 O O   . HOH E 2 .   ? 5.895   -56.804 -22.405 1.00 37.28  ? 405 HOH A O   1 
HETATM 7542 O O   . HOH E 2 .   ? 8.934   -31.267 -20.677 1.00 52.98  ? 406 HOH A O   1 
HETATM 7543 O O   . HOH E 2 .   ? -0.006  -44.214 -22.785 1.00 36.17  ? 407 HOH A O   1 
HETATM 7544 O O   . HOH E 2 .   ? 3.869   -49.682 -36.335 1.00 57.91  ? 408 HOH A O   1 
HETATM 7545 O O   . HOH E 2 .   ? -6.139  -35.308 -18.989 1.00 43.07  ? 409 HOH A O   1 
HETATM 7546 O O   . HOH E 2 .   ? 16.775  -39.134 -22.130 1.00 64.69  ? 410 HOH A O   1 
HETATM 7547 O O   . HOH E 2 .   ? 2.572   -61.929 -19.435 1.00 56.69  ? 411 HOH A O   1 
HETATM 7548 O O   . HOH E 2 .   ? -8.142  -35.986 -24.478 1.00 51.04  ? 412 HOH A O   1 
HETATM 7549 O O   . HOH E 2 .   ? 24.112  -54.295 -15.627 1.00 69.46  ? 413 HOH A O   1 
HETATM 7550 O O   . HOH E 2 .   ? 11.420  -56.679 -1.067  1.00 71.93  ? 414 HOH A O   1 
HETATM 7551 O O   . HOH E 2 .   ? -8.429  -36.677 -3.843  1.00 71.10  ? 415 HOH A O   1 
HETATM 7552 O O   . HOH E 2 .   ? 20.433  -62.656 -18.454 1.00 70.61  ? 416 HOH A O   1 
HETATM 7553 O O   . HOH E 2 .   ? 0.022   -51.299 -32.581 1.00 51.45  ? 417 HOH A O   1 
HETATM 7554 O O   . HOH E 2 .   ? -4.321  -38.767 -14.054 1.00 56.90  ? 418 HOH A O   1 
HETATM 7555 O O   . HOH E 2 .   ? -13.767 -38.409 -37.882 1.00 55.78  ? 419 HOH A O   1 
HETATM 7556 O O   . HOH E 2 .   ? -4.419  -39.923 -27.143 1.00 47.91  ? 420 HOH A O   1 
HETATM 7557 O O   . HOH E 2 .   ? -11.155 -50.395 -23.334 1.00 50.95  ? 421 HOH A O   1 
HETATM 7558 O O   . HOH E 2 .   ? 3.891   -55.780 -21.276 1.00 39.12  ? 422 HOH A O   1 
HETATM 7559 O O   . HOH E 2 .   ? 3.655   -28.258 -6.460  1.00 76.69  ? 423 HOH A O   1 
HETATM 7560 O O   . HOH E 2 .   ? -9.826  -43.125 -29.752 1.00 56.16  ? 424 HOH A O   1 
HETATM 7561 O O   . HOH E 2 .   ? -3.565  -52.785 -33.547 1.00 58.74  ? 425 HOH A O   1 
HETATM 7562 O O   . HOH E 2 .   ? 7.266   -55.285 -34.752 1.00 50.56  ? 426 HOH A O   1 
HETATM 7563 O O   . HOH E 2 .   ? -6.840  -37.353 -22.504 1.00 64.99  ? 427 HOH A O   1 
HETATM 7564 O O   . HOH E 2 .   ? -18.370 -41.409 -41.027 1.00 69.47  ? 428 HOH A O   1 
HETATM 7565 O O   . HOH E 2 .   ? 6.443   -18.073 -23.391 1.00 103.01 ? 429 HOH A O   1 
HETATM 7566 O O   . HOH F 2 .   ? -14.316 -29.148 -25.349 1.00 46.29  ? 401 HOH B O   1 
HETATM 7567 O O   . HOH F 2 .   ? -8.984  -34.519 -27.296 1.00 44.35  ? 402 HOH B O   1 
HETATM 7568 O O   . HOH F 2 .   ? -15.627 -39.780 -22.487 1.00 69.53  ? 403 HOH B O   1 
HETATM 7569 O O   . HOH F 2 .   ? -16.215 -28.468 -20.691 1.00 52.29  ? 404 HOH B O   1 
HETATM 7570 O O   . HOH F 2 .   ? -30.542 -24.996 -24.125 1.00 51.65  ? 405 HOH B O   1 
HETATM 7571 O O   . HOH F 2 .   ? -16.144 -23.404 -7.771  1.00 62.25  ? 406 HOH B O   1 
HETATM 7572 O O   . HOH F 2 .   ? -30.319 -32.177 -45.552 1.00 63.75  ? 407 HOH B O   1 
HETATM 7573 O O   . HOH F 2 .   ? -8.583  -25.342 -32.927 1.00 74.97  ? 408 HOH B O   1 
HETATM 7574 O O   . HOH F 2 .   ? -31.126 -31.553 -22.821 1.00 45.73  ? 409 HOH B O   1 
HETATM 7575 O O   . HOH F 2 .   ? -17.323 -54.158 -25.893 1.00 58.00  ? 410 HOH B O   1 
HETATM 7576 O O   . HOH F 2 .   ? -27.455 -19.142 -28.228 1.00 45.38  ? 411 HOH B O   1 
HETATM 7577 O O   . HOH F 2 .   ? -27.139 -33.329 -45.730 1.00 57.36  ? 412 HOH B O   1 
HETATM 7578 O O   . HOH F 2 .   ? -27.421 -39.695 -42.890 1.00 59.68  ? 413 HOH B O   1 
HETATM 7579 O O   . HOH F 2 .   ? -21.331 -22.692 -37.507 1.00 54.85  ? 414 HOH B O   1 
HETATM 7580 O O   . HOH F 2 .   ? -22.883 -55.140 -35.911 1.00 58.77  ? 415 HOH B O   1 
HETATM 7581 O O   . HOH F 2 .   ? -41.803 -36.147 -21.209 1.00 79.47  ? 416 HOH B O   1 
HETATM 7582 O O   . HOH F 2 .   ? -30.593 -59.654 -20.696 1.00 68.29  ? 417 HOH B O   1 
HETATM 7583 O O   . HOH F 2 .   ? -30.770 -18.110 -27.177 1.00 58.97  ? 418 HOH B O   1 
HETATM 7584 O O   . HOH F 2 .   ? -31.569 -25.477 -26.679 1.00 48.84  ? 419 HOH B O   1 
HETATM 7585 O O   . HOH F 2 .   ? -31.533 -47.547 -0.639  1.00 73.93  ? 420 HOH B O   1 
HETATM 7586 O O   . HOH F 2 .   ? -18.687 -15.287 -19.881 1.00 63.12  ? 421 HOH B O   1 
HETATM 7587 O O   . HOH F 2 .   ? -15.834 -25.853 -7.426  1.00 74.70  ? 422 HOH B O   1 
HETATM 7588 O O   . HOH G 2 .   ? 6.139   -31.694 -65.172 1.00 53.39  ? 401 HOH C O   1 
HETATM 7589 O O   . HOH G 2 .   ? 21.090  -33.310 -60.881 1.00 53.63  ? 402 HOH C O   1 
HETATM 7590 O O   . HOH G 2 .   ? 7.161   -26.879 -78.168 1.00 50.54  ? 403 HOH C O   1 
HETATM 7591 O O   . HOH G 2 .   ? 3.936   -32.022 -60.608 1.00 52.46  ? 404 HOH C O   1 
HETATM 7592 O O   . HOH G 2 .   ? -2.464  -52.092 -61.633 1.00 46.55  ? 405 HOH C O   1 
HETATM 7593 O O   . HOH G 2 .   ? 27.921  -48.108 -65.254 1.00 54.25  ? 406 HOH C O   1 
HETATM 7594 O O   . HOH G 2 .   ? 28.627  -55.996 -64.937 1.00 68.24  ? 407 HOH C O   1 
HETATM 7595 O O   . HOH G 2 .   ? 16.027  -48.624 -45.740 1.00 59.99  ? 408 HOH C O   1 
HETATM 7596 O O   . HOH G 2 .   ? 2.231   -42.282 -63.705 1.00 57.49  ? 409 HOH C O   1 
HETATM 7597 O O   . HOH G 2 .   ? 0.003   -26.208 -52.510 1.00 61.81  ? 410 HOH C O   1 
HETATM 7598 O O   . HOH G 2 .   ? 14.168  -46.756 -44.068 1.00 61.93  ? 411 HOH C O   1 
HETATM 7599 O O   . HOH G 2 .   ? 19.678  -39.324 -63.532 1.00 48.18  ? 412 HOH C O   1 
HETATM 7600 O O   . HOH G 2 .   ? 22.804  -27.128 -49.328 1.00 68.34  ? 413 HOH C O   1 
HETATM 7601 O O   . HOH G 2 .   ? 6.548   -27.147 -53.039 1.00 58.34  ? 414 HOH C O   1 
HETATM 7602 O O   . HOH G 2 .   ? 20.840  -44.797 -51.638 1.00 51.96  ? 415 HOH C O   1 
HETATM 7603 O O   . HOH G 2 .   ? 32.224  -40.442 -62.919 1.00 55.41  ? 416 HOH C O   1 
HETATM 7604 O O   . HOH G 2 .   ? 26.788  -49.458 -62.853 1.00 55.54  ? 417 HOH C O   1 
HETATM 7605 O O   . HOH G 2 .   ? 22.299  -44.326 -80.061 1.00 71.38  ? 418 HOH C O   1 
HETATM 7606 O O   . HOH G 2 .   ? 8.842   -56.527 -49.444 1.00 68.40  ? 419 HOH C O   1 
HETATM 7607 O O   . HOH G 2 .   ? -1.791  -13.885 -60.188 1.00 71.41  ? 420 HOH C O   1 
HETATM 7608 O O   . HOH G 2 .   ? 39.121  -45.638 -55.712 1.00 77.94  ? 421 HOH C O   1 
HETATM 7609 O O   . HOH G 2 .   ? 13.027  -19.940 -65.377 1.00 58.83  ? 422 HOH C O   1 
HETATM 7610 O O   . HOH G 2 .   ? 26.758  -41.922 -82.113 1.00 71.39  ? 423 HOH C O   1 
HETATM 7611 O O   . HOH G 2 .   ? 17.069  -46.386 -46.589 1.00 79.03  ? 424 HOH C O   1 
HETATM 7612 O O   . HOH G 2 .   ? 16.838  -49.805 -80.201 1.00 68.81  ? 425 HOH C O   1 
HETATM 7613 O O   . HOH G 2 .   ? -4.414  -37.635 -65.763 1.00 66.83  ? 426 HOH C O   1 
HETATM 7614 O O   . HOH G 2 .   ? 19.278  -46.320 -50.272 1.00 81.78  ? 427 HOH C O   1 
HETATM 7615 O O   . HOH G 2 .   ? 13.284  -31.737 -49.480 1.00 68.57  ? 428 HOH C O   1 
HETATM 7616 O O   . HOH G 2 .   ? 16.498  -42.336 -41.167 1.00 62.12  ? 429 HOH C O   1 
HETATM 7617 O O   . HOH H 2 .   ? -26.631 -23.634 -58.653 1.00 47.41  ? 401 HOH D O   1 
HETATM 7618 O O   . HOH H 2 .   ? -14.028 -41.815 -63.381 1.00 47.91  ? 402 HOH D O   1 
HETATM 7619 O O   . HOH H 2 .   ? -28.327 -31.829 -63.753 1.00 64.71  ? 403 HOH D O   1 
HETATM 7620 O O   . HOH H 2 .   ? -19.778 -46.434 -39.393 1.00 64.29  ? 404 HOH D O   1 
HETATM 7621 O O   . HOH H 2 .   ? -18.255 -26.914 -65.247 1.00 72.91  ? 405 HOH D O   1 
HETATM 7622 O O   . HOH H 2 .   ? -20.895 -44.804 -45.799 1.00 71.59  ? 406 HOH D O   1 
HETATM 7623 O O   . HOH H 2 .   ? -16.060 -54.036 -62.456 1.00 46.79  ? 407 HOH D O   1 
HETATM 7624 O O   . HOH H 2 .   ? -14.014 -53.395 -64.876 1.00 69.54  ? 408 HOH D O   1 
HETATM 7625 O O   . HOH H 2 .   ? -6.027  -51.037 -62.447 1.00 52.46  ? 409 HOH D O   1 
HETATM 7626 O O   . HOH H 2 .   ? -10.553 -42.463 -65.536 1.00 59.05  ? 410 HOH D O   1 
HETATM 7627 O O   . HOH H 2 .   ? 4.114   -44.328 -44.854 1.00 98.53  ? 411 HOH D O   1 
HETATM 7628 O O   . HOH H 2 .   ? -19.766 -25.708 -60.859 1.00 43.91  ? 412 HOH D O   1 
HETATM 7629 O O   . HOH H 2 .   ? -22.842 -25.933 -72.101 1.00 67.01  ? 413 HOH D O   1 
HETATM 7630 O O   . HOH H 2 .   ? -8.250  -38.007 -72.129 1.00 67.42  ? 414 HOH D O   1 
HETATM 7631 O O   . HOH H 2 .   ? -11.768 -29.314 -48.371 1.00 64.20  ? 415 HOH D O   1 
HETATM 7632 O O   . HOH H 2 .   ? -28.550 -48.819 -85.427 1.00 78.14  ? 416 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 0.7187 0.8019 0.9861 -0.0010 -0.1858 0.1165  84  GLY A N   
2    C CA  . GLY A 1   ? 0.8531 0.9139 1.0960 -0.0001 -0.1603 0.1031  84  GLY A CA  
3    C C   . GLY A 1   ? 0.8265 0.8608 1.0824 0.0042  -0.1382 0.0758  84  GLY A C   
4    O O   . GLY A 1   ? 0.6625 0.6796 0.9019 0.0048  -0.1182 0.0650  84  GLY A O   
5    N N   . PHE A 2   ? 0.7817 0.8154 1.0686 0.0067  -0.1427 0.0662  85  PHE A N   
6    C CA  . PHE A 2   ? 0.6917 0.7060 0.9942 0.0100  -0.1241 0.0443  85  PHE A CA  
7    C C   . PHE A 2   ? 0.6773 0.7037 0.9508 0.0093  -0.1272 0.0268  85  PHE A C   
8    O O   . PHE A 2   ? 0.6946 0.7449 0.9437 0.0063  -0.1446 0.0299  85  PHE A O   
9    C CB  . PHE A 2   ? 0.6760 0.6838 1.0389 0.0128  -0.1276 0.0466  85  PHE A CB  
10   C CG  . PHE A 2   ? 0.6517 0.6458 1.0535 0.0137  -0.1213 0.0596  85  PHE A CG  
11   C CD1 . PHE A 2   ? 0.6231 0.5966 1.0586 0.0160  -0.0994 0.0460  85  PHE A CD1 
12   C CD2 . PHE A 2   ? 0.6510 0.6547 1.0569 0.0116  -0.1359 0.0848  85  PHE A CD2 
13   C CE1 . PHE A 2   ? 0.6085 0.5710 1.0848 0.0164  -0.0924 0.0530  85  PHE A CE1 
14   C CE2 . PHE A 2   ? 0.6426 0.6333 1.0933 0.0124  -0.1297 0.0954  85  PHE A CE2 
15   C CZ  . PHE A 2   ? 0.6255 0.5954 1.1128 0.0149  -0.1080 0.0774  85  PHE A CZ  
16   N N   . LEU A 3   ? 0.6296 0.6414 0.9062 0.0114  -0.1096 0.0082  86  LEU A N   
17   C CA  . LEU A 3   ? 0.6166 0.6372 0.8894 0.0116  -0.1126 -0.0093 86  LEU A CA  
18   C C   . LEU A 3   ? 0.6144 0.6189 0.9308 0.0150  -0.0995 -0.0187 86  LEU A C   
19   O O   . LEU A 3   ? 0.6108 0.5996 0.9496 0.0163  -0.0869 -0.0129 86  LEU A O   
20   C CB  . LEU A 3   ? 0.5757 0.5983 0.8046 0.0099  -0.1038 -0.0199 86  LEU A CB  
21   C CG  . LEU A 3   ? 0.5913 0.5942 0.8057 0.0106  -0.0809 -0.0234 86  LEU A CG  
22   C CD1 . LEU A 3   ? 0.5475 0.5575 0.7218 0.0085  -0.0785 -0.0312 86  LEU A CD1 
23   C CD2 . LEU A 3   ? 0.6518 0.6418 0.8671 0.0105  -0.0728 -0.0098 86  LEU A CD2 
24   N N   . THR A 4   ? 0.5601 0.5699 0.8933 0.0159  -0.1020 -0.0333 87  THR A N   
25   C CA  . THR A 4   ? 0.5019 0.4973 0.8774 0.0186  -0.0877 -0.0396 87  THR A CA  
26   C C   . THR A 4   ? 0.4963 0.4769 0.8547 0.0186  -0.0631 -0.0444 87  THR A C   
27   O O   . THR A 4   ? 0.4908 0.4736 0.8111 0.0170  -0.0606 -0.0466 87  THR A O   
28   C CB  . THR A 4   ? 0.4878 0.4933 0.8950 0.0196  -0.0980 -0.0526 87  THR A CB  
29   O OG1 . THR A 4   ? 0.4999 0.5095 0.8873 0.0187  -0.0936 -0.0662 87  THR A OG1 
30   C CG2 . THR A 4   ? 0.4493 0.4762 0.8657 0.0185  -0.1262 -0.0494 87  THR A CG2 
31   N N   . ALA A 5   ? 0.5149 0.4823 0.9018 0.0198  -0.0447 -0.0450 88  ALA A N   
32   C CA  . ALA A 5   ? 0.5176 0.4747 0.8860 0.0188  -0.0219 -0.0460 88  ALA A CA  
33   C C   . ALA A 5   ? 0.5491 0.5106 0.9129 0.0187  -0.0211 -0.0535 88  ALA A C   
34   O O   . ALA A 5   ? 0.5184 0.4763 0.8567 0.0174  -0.0092 -0.0522 88  ALA A O   
35   C CB  . ALA A 5   ? 0.5197 0.4670 0.9203 0.0192  -0.0021 -0.0455 88  ALA A CB  
36   N N   . PHE A 6   ? 0.5391 0.5101 0.9305 0.0199  -0.0358 -0.0619 89  PHE A N   
37   C CA  . PHE A 6   ? 0.5468 0.5249 0.9383 0.0196  -0.0392 -0.0724 89  PHE A CA  
38   C C   . PHE A 6   ? 0.5250 0.5122 0.8709 0.0177  -0.0482 -0.0762 89  PHE A C   
39   O O   . PHE A 6   ? 0.5186 0.5042 0.8520 0.0170  -0.0401 -0.0792 89  PHE A O   
40   C CB  . PHE A 6   ? 0.5724 0.5609 1.0086 0.0209  -0.0535 -0.0848 89  PHE A CB  
41   C CG  . PHE A 6   ? 0.6037 0.6008 1.0483 0.0204  -0.0574 -0.0996 89  PHE A CG  
42   C CD1 . PHE A 6   ? 0.6784 0.6669 1.1514 0.0210  -0.0413 -0.0990 89  PHE A CD1 
43   C CD2 . PHE A 6   ? 0.6145 0.6305 1.0405 0.0188  -0.0765 -0.1139 89  PHE A CD2 
44   C CE1 . PHE A 6   ? 0.6883 0.6844 1.1784 0.0207  -0.0448 -0.1132 89  PHE A CE1 
45   C CE2 . PHE A 6   ? 0.6252 0.6504 1.0650 0.0181  -0.0789 -0.1320 89  PHE A CE2 
46   C CZ  . PHE A 6   ? 0.6348 0.6487 1.1097 0.0193  -0.0633 -0.1318 89  PHE A CZ  
47   N N   . GLU A 7   ? 0.5119 0.5104 0.8364 0.0167  -0.0650 -0.0749 90  GLU A N   
48   C CA  . GLU A 7   ? 0.5158 0.5250 0.7960 0.0142  -0.0717 -0.0771 90  GLU A CA  
49   C C   . GLU A 7   ? 0.5292 0.5247 0.7778 0.0136  -0.0552 -0.0674 90  GLU A C   
50   O O   . GLU A 7   ? 0.5128 0.5109 0.7389 0.0123  -0.0516 -0.0727 90  GLU A O   
51   C CB  . GLU A 7   ? 0.5447 0.5709 0.8082 0.0124  -0.0917 -0.0723 90  GLU A CB  
52   C CG  . GLU A 7   ? 0.6022 0.6501 0.8866 0.0116  -0.1112 -0.0864 90  GLU A CG  
53   C CD  . GLU A 7   ? 0.7291 0.7911 1.0179 0.0106  -0.1313 -0.0751 90  GLU A CD  
54   O OE1 . GLU A 7   ? 0.8745 0.9610 1.1682 0.0086  -0.1506 -0.0863 90  GLU A OE1 
55   O OE2 . GLU A 7   ? 0.7232 0.7739 1.0151 0.0115  -0.1289 -0.0555 90  GLU A OE2 
56   N N   . TYR A 8   ? 0.5204 0.5022 0.7724 0.0143  -0.0446 -0.0553 91  TYR A N   
57   C CA  . TYR A 8   ? 0.4920 0.4627 0.7158 0.0131  -0.0295 -0.0478 91  TYR A CA  
58   C C   . TYR A 8   ? 0.5035 0.4687 0.7295 0.0130  -0.0153 -0.0508 91  TYR A C   
59   O O   . TYR A 8   ? 0.4921 0.4570 0.6901 0.0116  -0.0111 -0.0498 91  TYR A O   
60   C CB  . TYR A 8   ? 0.4540 0.4141 0.6877 0.0134  -0.0205 -0.0395 91  TYR A CB  
61   C CG  . TYR A 8   ? 0.4293 0.3815 0.6337 0.0115  -0.0070 -0.0350 91  TYR A CG  
62   C CD1 . TYR A 8   ? 0.4423 0.3981 0.6111 0.0099  -0.0127 -0.0322 91  TYR A CD1 
63   C CD2 . TYR A 8   ? 0.4532 0.3966 0.6660 0.0108  0.0115  -0.0348 91  TYR A CD2 
64   C CE1 . TYR A 8   ? 0.4327 0.3823 0.5774 0.0080  -0.0023 -0.0294 91  TYR A CE1 
65   C CE2 . TYR A 8   ? 0.4629 0.4024 0.6486 0.0084  0.0222  -0.0336 91  TYR A CE2 
66   C CZ  . TYR A 8   ? 0.5068 0.4487 0.6596 0.0073  0.0142  -0.0308 91  TYR A CZ  
67   O OH  . TYR A 8   ? 0.5361 0.4748 0.6639 0.0049  0.0226  -0.0306 91  TYR A OH  
68   N N   . SER A 9   ? 0.4804 0.4427 0.7433 0.0144  -0.0089 -0.0527 92  SER A N   
69   C CA  . SER A 9   ? 0.4770 0.4361 0.7494 0.0140  0.0038  -0.0510 92  SER A CA  
70   C C   . SER A 9   ? 0.4719 0.4383 0.7371 0.0136  -0.0038 -0.0587 92  SER A C   
71   O O   . SER A 9   ? 0.4729 0.4367 0.7277 0.0125  0.0047  -0.0533 92  SER A O   
72   C CB  . SER A 9   ? 0.4653 0.4228 0.7861 0.0153  0.0097  -0.0516 92  SER A CB  
73   O OG  . SER A 9   ? 0.5171 0.4748 0.8542 0.0149  0.0175  -0.0488 92  SER A OG  
74   N N   . GLU A 10  ? 0.5099 0.4875 0.7823 0.0142  -0.0202 -0.0720 93  GLU A N   
75   C CA  . GLU A 10  ? 0.5165 0.5044 0.7858 0.0134  -0.0271 -0.0849 93  GLU A CA  
76   C C   . GLU A 10  ? 0.5281 0.5158 0.7518 0.0115  -0.0252 -0.0798 93  GLU A C   
77   O O   . GLU A 10  ? 0.5910 0.5805 0.8099 0.0107  -0.0222 -0.0836 93  GLU A O   
78   C CB  . GLU A 10  ? 0.5377 0.5434 0.8166 0.0130  -0.0455 -0.1028 93  GLU A CB  
79   C CG  . GLU A 10  ? 0.6486 0.6587 0.9809 0.0145  -0.0498 -0.1155 93  GLU A CG  
80   C CD  . GLU A 10  ? 0.7474 0.7496 1.1173 0.0155  -0.0373 -0.1158 93  GLU A CD  
81   O OE1 . GLU A 10  ? 0.8478 0.8596 1.2360 0.0149  -0.0414 -0.1328 93  GLU A OE1 
82   O OE2 . GLU A 10  ? 0.7613 0.7494 1.1449 0.0164  -0.0227 -0.0985 93  GLU A OE2 
83   N N   . LYS A 11  ? 0.5248 0.5099 0.7199 0.0108  -0.0267 -0.0708 94  LYS A N   
84   C CA  . LYS A 11  ? 0.5296 0.5153 0.6852 0.0089  -0.0257 -0.0666 94  LYS A CA  
85   C C   . LYS A 11  ? 0.5347 0.5078 0.6806 0.0085  -0.0102 -0.0559 94  LYS A C   
86   O O   . LYS A 11  ? 0.5739 0.5478 0.7006 0.0072  -0.0080 -0.0556 94  LYS A O   
87   C CB  . LYS A 11  ? 0.5069 0.4961 0.6420 0.0081  -0.0339 -0.0600 94  LYS A CB  
88   C CG  . LYS A 11  ? 0.5712 0.5605 0.6695 0.0060  -0.0323 -0.0538 94  LYS A CG  
89   C CD  . LYS A 11  ? 0.6292 0.6236 0.7153 0.0049  -0.0416 -0.0445 94  LYS A CD  
90   C CE  . LYS A 11  ? 0.6686 0.6629 0.7219 0.0026  -0.0385 -0.0380 94  LYS A CE  
91   N NZ  . LYS A 11  ? 0.7375 0.7296 0.7901 0.0021  -0.0425 -0.0240 94  LYS A NZ  
92   N N   . ARG A 12  ? 0.5487 0.5126 0.7091 0.0090  0.0005  -0.0476 95  ARG A N   
93   C CA  . ARG A 12  ? 0.5371 0.4946 0.6862 0.0075  0.0142  -0.0373 95  ARG A CA  
94   C C   . ARG A 12  ? 0.6143 0.5735 0.7846 0.0075  0.0182  -0.0350 95  ARG A C   
95   O O   . ARG A 12  ? 0.6036 0.5612 0.7619 0.0057  0.0268  -0.0241 95  ARG A O   
96   C CB  . ARG A 12  ? 0.5563 0.5083 0.7161 0.0071  0.0263  -0.0305 95  ARG A CB  
97   C CG  . ARG A 12  ? 0.5478 0.4962 0.6916 0.0065  0.0271  -0.0308 95  ARG A CG  
98   C CD  . ARG A 12  ? 0.5120 0.4577 0.6497 0.0041  0.0439  -0.0261 95  ARG A CD  
99   N NE  . ARG A 12  ? 0.6287 0.5722 0.7421 0.0029  0.0413  -0.0283 95  ARG A NE  
100  C CZ  . ARG A 12  ? 0.5419 0.4862 0.6256 0.0003  0.0454  -0.0267 95  ARG A CZ  
101  N NH1 . ARG A 12  ? 0.4639 0.4123 0.5351 -0.0019 0.0527  -0.0210 95  ARG A NH1 
102  N NH2 . ARG A 12  ? 0.5223 0.4642 0.5932 -0.0003 0.0415  -0.0295 95  ARG A NH2 
103  N N   . LYS A 13  ? 0.5778 0.5415 0.7835 0.0093  0.0120  -0.0442 96  LYS A N   
104  C CA  . LYS A 13  ? 0.5662 0.5311 0.8000 0.0092  0.0159  -0.0406 96  LYS A CA  
105  C C   . LYS A 13  ? 0.5594 0.5270 0.7715 0.0079  0.0134  -0.0411 96  LYS A C   
106  O O   . LYS A 13  ? 0.5984 0.5666 0.8314 0.0075  0.0168  -0.0343 96  LYS A O   
107  C CB  . LYS A 13  ? 0.5815 0.5518 0.8629 0.0111  0.0090  -0.0547 96  LYS A CB  
108  C CG  . LYS A 13  ? 0.6965 0.6649 1.0093 0.0125  0.0104  -0.0550 96  LYS A CG  
109  C CD  . LYS A 13  ? 0.8497 0.8128 1.1907 0.0120  0.0251  -0.0365 96  LYS A CD  
110  C CE  . LYS A 13  ? 0.8478 0.8107 1.2346 0.0137  0.0257  -0.0408 96  LYS A CE  
111  N NZ  . LYS A 13  ? 0.9109 0.8701 1.3147 0.0123  0.0428  -0.0205 96  LYS A NZ  
112  N N   . MET A 14  ? 0.5041 0.4738 0.6791 0.0072  0.0076  -0.0477 97  MET A N   
113  C CA  . MET A 14  ? 0.5296 0.5035 0.6886 0.0060  0.0047  -0.0519 97  MET A CA  
114  C C   . MET A 14  ? 0.5002 0.4690 0.6233 0.0041  0.0102  -0.0383 97  MET A C   
115  O O   . MET A 14  ? 0.4924 0.4635 0.6033 0.0029  0.0089  -0.0389 97  MET A O   
116  C CB  . MET A 14  ? 0.6205 0.6047 0.7655 0.0057  -0.0057 -0.0696 97  MET A CB  
117  C CG  . MET A 14  ? 0.7632 0.7577 0.9440 0.0068  -0.0129 -0.0882 97  MET A CG  
118  S SD  . MET A 14  ? 1.0554 1.0703 1.2142 0.0048  -0.0258 -0.1096 97  MET A SD  
119  C CE  . MET A 14  ? 0.9346 0.9459 1.0443 0.0037  -0.0279 -0.0932 97  MET A CE  
120  N N   . VAL A 15  ? 0.4265 0.3895 0.5356 0.0034  0.0167  -0.0283 98  VAL A N   
121  C CA  . VAL A 15  ? 0.4508 0.4112 0.5309 0.0010  0.0231  -0.0173 98  VAL A CA  
122  C C   . VAL A 15  ? 0.4538 0.4168 0.5405 -0.0005 0.0258  -0.0059 98  VAL A C   
123  O O   . VAL A 15  ? 0.4986 0.4632 0.6165 0.0000  0.0285  0.0013  98  VAL A O   
124  C CB  . VAL A 15  ? 0.4739 0.4309 0.5472 -0.0001 0.0321  -0.0117 98  VAL A CB  
125  C CG1 . VAL A 15  ? 0.4027 0.3615 0.4484 -0.0037 0.0400  -0.0027 98  VAL A CG1 
126  C CG2 . VAL A 15  ? 0.4552 0.4093 0.5218 0.0012  0.0273  -0.0210 98  VAL A CG2 
127  N N   . PHE A 16  ? 0.4690 0.4331 0.5299 -0.0024 0.0244  -0.0031 99  PHE A N   
128  C CA  . PHE A 16  ? 0.4569 0.4249 0.5232 -0.0042 0.0249  0.0098  99  PHE A CA  
129  C C   . PHE A 16  ? 0.5234 0.4946 0.5553 -0.0080 0.0286  0.0208  99  PHE A C   
130  O O   . PHE A 16  ? 0.5767 0.5459 0.5814 -0.0092 0.0312  0.0143  99  PHE A O   
131  C CB  . PHE A 16  ? 0.3813 0.3510 0.4623 -0.0029 0.0176  0.0006  99  PHE A CB  
132  C CG  . PHE A 16  ? 0.3664 0.3358 0.4189 -0.0032 0.0136  -0.0117 99  PHE A CG  
133  C CD1 . PHE A 16  ? 0.3630 0.3323 0.3875 -0.0055 0.0137  -0.0061 99  PHE A CD1 
134  C CD2 . PHE A 16  ? 0.3478 0.3195 0.4027 -0.0016 0.0093  -0.0285 99  PHE A CD2 
135  C CE1 . PHE A 16  ? 0.3538 0.3232 0.3574 -0.0060 0.0108  -0.0155 99  PHE A CE1 
136  C CE2 . PHE A 16  ? 0.3266 0.3010 0.3561 -0.0026 0.0063  -0.0362 99  PHE A CE2 
137  C CZ  . PHE A 16  ? 0.3733 0.3454 0.3791 -0.0046 0.0076  -0.0291 99  PHE A CZ  
138  N N   . HIS A 17  ? 0.4753 0.4531 0.5120 -0.0103 0.0281  0.0369  100 HIS A N   
139  C CA  . HIS A 17  ? 0.5366 0.5213 0.5404 -0.0146 0.0286  0.0450  100 HIS A CA  
140  C C   . HIS A 17  ? 0.5753 0.5630 0.5845 -0.0152 0.0203  0.0508  100 HIS A C   
141  O O   . HIS A 17  ? 0.5605 0.5496 0.6046 -0.0139 0.0168  0.0600  100 HIS A O   
142  C CB  . HIS A 17  ? 0.5261 0.5223 0.5238 -0.0187 0.0360  0.0631  100 HIS A CB  
143  C CG  . HIS A 17  ? 0.5540 0.5488 0.5518 -0.0186 0.0462  0.0581  100 HIS A CG  
144  N ND1 . HIS A 17  ? 0.6535 0.6506 0.6226 -0.0210 0.0532  0.0477  100 HIS A ND1 
145  C CD2 . HIS A 17  ? 0.5620 0.5536 0.5919 -0.0161 0.0510  0.0608  100 HIS A CD2 
146  C CE1 . HIS A 17  ? 0.6210 0.6163 0.6035 -0.0202 0.0623  0.0445  100 HIS A CE1 
147  N NE2 . HIS A 17  ? 0.5607 0.5523 0.5793 -0.0171 0.0606  0.0531  100 HIS A NE2 
148  N N   . ILE A 18  ? 0.5697 0.5585 0.5503 -0.0171 0.0171  0.0451  101 ILE A N   
149  C CA  . ILE A 18  ? 0.5196 0.5125 0.5052 -0.0182 0.0091  0.0517  101 ILE A CA  
150  C C   . ILE A 18  ? 0.5410 0.5476 0.5066 -0.0235 0.0078  0.0690  101 ILE A C   
151  O O   . ILE A 18  ? 0.5325 0.5441 0.4641 -0.0268 0.0109  0.0632  101 ILE A O   
152  C CB  . ILE A 18  ? 0.5449 0.5317 0.5176 -0.0172 0.0057  0.0348  101 ILE A CB  
153  C CG1 . ILE A 18  ? 0.4910 0.4700 0.4808 -0.0131 0.0070  0.0193  101 ILE A CG1 
154  C CG2 . ILE A 18  ? 0.4929 0.4843 0.4758 -0.0184 -0.0020 0.0413  101 ILE A CG2 
155  C CD1 . ILE A 18  ? 0.4888 0.4637 0.4602 -0.0127 0.0064  0.0042  101 ILE A CD1 
156  N N   . THR A 19  ? 0.5264 0.5413 0.5166 -0.0246 0.0034  0.0906  102 THR A N   
157  C CA  . THR A 19  ? 0.5275 0.5602 0.5018 -0.0302 -0.0002 0.1123  102 THR A CA  
158  C C   . THR A 19  ? 0.5630 0.6005 0.5058 -0.0332 -0.0068 0.1030  102 THR A C   
159  O O   . THR A 19  ? 0.5676 0.5941 0.5162 -0.0303 -0.0106 0.0877  102 THR A O   
160  C CB  . THR A 19  ? 0.5216 0.5613 0.5391 -0.0302 -0.0071 0.1393  102 THR A CB  
161  O OG1 . THR A 19  ? 0.5760 0.6375 0.5764 -0.0367 -0.0118 0.1657  102 THR A OG1 
162  C CG2 . THR A 19  ? 0.4771 0.5088 0.5276 -0.0270 -0.0164 0.1339  102 THR A CG2 
163  N N   . THR A 20  ? 0.5784 0.6340 0.4879 -0.0394 -0.0073 0.1108  103 THR A N   
164  C CA  . THR A 20  ? 0.5837 0.6464 0.4661 -0.0429 -0.0139 0.1011  103 THR A CA  
165  C C   . THR A 20  ? 0.6178 0.6941 0.5131 -0.0456 -0.0277 0.1238  103 THR A C   
166  O O   . THR A 20  ? 0.6198 0.7022 0.5017 -0.0482 -0.0364 0.1183  103 THR A O   
167  C CB  . THR A 20  ? 0.5836 0.6654 0.4254 -0.0496 -0.0086 0.0972  103 THR A CB  
168  O OG1 . THR A 20  ? 0.6300 0.7334 0.4696 -0.0544 -0.0097 0.1255  103 THR A OG1 
169  C CG2 . THR A 20  ? 0.5830 0.6550 0.4141 -0.0480 0.0056  0.0761  103 THR A CG2 
170  N N   . GLY A 21  ? 0.6346 0.7172 0.5594 -0.0455 -0.0304 0.1509  104 GLY A N   
171  C CA  . GLY A 21  ? 0.6184 0.7176 0.5598 -0.0489 -0.0448 0.1791  104 GLY A CA  
172  C C   . GLY A 21  ? 0.6777 0.8077 0.5883 -0.0573 -0.0473 0.2037  104 GLY A C   
173  O O   . GLY A 21  ? 0.6704 0.8193 0.5925 -0.0613 -0.0608 0.2328  104 GLY A O   
174  N N   . SER A 22  ? 0.6845 0.8220 0.5564 -0.0606 -0.0346 0.1919  105 SER A N   
175  C CA  . SER A 22  ? 0.7361 0.9055 0.5773 -0.0691 -0.0324 0.2132  105 SER A CA  
176  C C   . SER A 22  ? 0.7518 0.9195 0.6042 -0.0682 -0.0170 0.2232  105 SER A C   
177  O O   . SER A 22  ? 0.7555 0.9057 0.6044 -0.0644 -0.0036 0.1979  105 SER A O   
178  C CB  . SER A 22  ? 0.7726 0.9591 0.5585 -0.0755 -0.0290 0.1878  105 SER A CB  
179  O OG  . SER A 22  ? 0.8119 1.0303 0.5631 -0.0842 -0.0209 0.1998  105 SER A OG  
180  N N   . GLN A 23  ? 0.8353 1.0229 0.7028 -0.0722 -0.0190 0.2616  106 GLN A N   
181  C CA  . GLN A 23  ? 0.8615 1.0512 0.7383 -0.0725 -0.0033 0.2723  106 GLN A CA  
182  C C   . GLN A 23  ? 0.8260 1.0345 0.6485 -0.0791 0.0116  0.2546  106 GLN A C   
183  O O   . GLN A 23  ? 0.7959 0.9951 0.6217 -0.0771 0.0280  0.2420  106 GLN A O   
184  C CB  . GLN A 23  ? 0.8998 1.1089 0.8084 -0.0761 -0.0083 0.3210  106 GLN A CB  
185  C CG  . GLN A 23  ? 0.9927 1.1825 0.9678 -0.0693 -0.0211 0.3366  106 GLN A CG  
186  C CD  . GLN A 23  ? 1.0858 1.3014 1.0897 -0.0747 -0.0323 0.3889  106 GLN A CD  
187  O OE1 . GLN A 23  ? 1.1454 1.3774 1.1583 -0.0787 -0.0240 0.4181  106 GLN A OE1 
188  N NE2 . GLN A 23  ? 1.0370 1.2580 1.0576 -0.0752 -0.0515 0.4031  106 GLN A NE2 
189  N N   . GLU A 24  ? 0.8305 1.0666 0.6060 -0.0872 0.0060  0.2508  107 GLU A N   
190  C CA  . GLU A 24  ? 0.8499 1.1056 0.5770 -0.0939 0.0212  0.2274  107 GLU A CA  
191  C C   . GLU A 24  ? 0.7831 1.0084 0.5101 -0.0873 0.0297  0.1816  107 GLU A C   
192  O O   . GLU A 24  ? 0.7779 0.9961 0.5050 -0.0861 0.0468  0.1652  107 GLU A O   
193  C CB  . GLU A 24  ? 0.8912 1.1882 0.5680 -0.1051 0.0129  0.2306  107 GLU A CB  
194  C CG  . GLU A 24  ? 0.9829 1.3135 0.6594 -0.1123 0.0024  0.2809  107 GLU A CG  
195  C CD  . GLU A 24  ? 1.0666 1.4262 0.7275 -0.1197 0.0198  0.3030  107 GLU A CD  
196  O OE1 . GLU A 24  ? 1.1888 1.5958 0.8085 -0.1317 0.0173  0.3240  107 GLU A OE1 
197  O OE2 . GLU A 24  ? 1.0061 1.3440 0.6959 -0.1142 0.0356  0.3006  107 GLU A OE2 
198  N N   . PHE A 25  ? 0.7346 0.9423 0.4662 -0.0831 0.0174  0.1634  108 PHE A N   
199  C CA  . PHE A 25  ? 0.7293 0.9093 0.4645 -0.0771 0.0237  0.1246  108 PHE A CA  
200  C C   . PHE A 25  ? 0.7073 0.8578 0.4782 -0.0687 0.0340  0.1209  108 PHE A C   
201  O O   . PHE A 25  ? 0.7114 0.8513 0.4793 -0.0669 0.0469  0.0957  108 PHE A O   
202  C CB  . PHE A 25  ? 0.6929 0.8583 0.4354 -0.0736 0.0083  0.1133  108 PHE A CB  
203  C CG  . PHE A 25  ? 0.6502 0.8013 0.3830 -0.0717 0.0130  0.0747  108 PHE A CG  
204  C CD1 . PHE A 25  ? 0.6363 0.7811 0.3693 -0.0709 0.0009  0.0621  108 PHE A CD1 
205  C CD2 . PHE A 25  ? 0.6263 0.7701 0.3559 -0.0708 0.0293  0.0522  108 PHE A CD2 
206  C CE1 . PHE A 25  ? 0.5903 0.7217 0.3214 -0.0692 0.0050  0.0297  108 PHE A CE1 
207  C CE2 . PHE A 25  ? 0.6065 0.7371 0.3358 -0.0690 0.0327  0.0198  108 PHE A CE2 
208  C CZ  . PHE A 25  ? 0.5918 0.7161 0.3222 -0.0682 0.0206  0.0096  108 PHE A CZ  
209  N N   . ASP A 26  ? 0.7004 0.8395 0.5091 -0.0640 0.0282  0.1454  109 ASP A N   
210  C CA  . ASP A 26  ? 0.6747 0.7887 0.5199 -0.0564 0.0361  0.1410  109 ASP A CA  
211  C C   . ASP A 26  ? 0.6948 0.8168 0.5356 -0.0588 0.0534  0.1412  109 ASP A C   
212  O O   . ASP A 26  ? 0.6556 0.7589 0.5094 -0.0540 0.0622  0.1213  109 ASP A O   
213  C CB  . ASP A 26  ? 0.6522 0.7575 0.5433 -0.0521 0.0273  0.1662  109 ASP A CB  
214  C CG  . ASP A 26  ? 0.6918 0.7815 0.6002 -0.0475 0.0134  0.1584  109 ASP A CG  
215  O OD1 . ASP A 26  ? 0.6244 0.7073 0.5100 -0.0469 0.0104  0.1345  109 ASP A OD1 
216  O OD2 . ASP A 26  ? 0.7107 0.7956 0.6608 -0.0445 0.0061  0.1769  109 ASP A OD2 
217  N N   . LYS A 27  ? 0.7307 0.8823 0.5550 -0.0666 0.0579  0.1657  110 LYS A N   
218  C CA  . LYS A 27  ? 0.7682 0.9326 0.5891 -0.0702 0.0761  0.1700  110 LYS A CA  
219  C C   . LYS A 27  ? 0.7678 0.9311 0.5623 -0.0716 0.0889  0.1326  110 LYS A C   
220  O O   . LYS A 27  ? 0.7287 0.8811 0.5394 -0.0688 0.1023  0.1206  110 LYS A O   
221  C CB  . LYS A 27  ? 0.8308 1.0348 0.6284 -0.0805 0.0783  0.2028  110 LYS A CB  
222  C CG  . LYS A 27  ? 0.8601 1.0688 0.6960 -0.0803 0.0815  0.2418  110 LYS A CG  
223  C CD  . LYS A 27  ? 1.0023 1.2525 0.8073 -0.0916 0.0944  0.2650  110 LYS A CD  
224  C CE  . LYS A 27  ? 1.0403 1.2961 0.8250 -0.0943 0.1175  0.2372  110 LYS A CE  
225  N NZ  . LYS A 27  ? 1.0777 1.3790 0.8284 -0.1066 0.1317  0.2582  110 LYS A NZ  
226  N N   . LEU A 28  ? 0.7886 0.9628 0.5483 -0.0757 0.0838  0.1136  111 LEU A N   
227  C CA  . LEU A 28  ? 0.8105 0.9842 0.5521 -0.0772 0.0945  0.0762  111 LEU A CA  
228  C C   . LEU A 28  ? 0.7916 0.9288 0.5665 -0.0675 0.0959  0.0562  111 LEU A C   
229  O O   . LEU A 28  ? 0.7656 0.8982 0.5442 -0.0672 0.1088  0.0328  111 LEU A O   
230  C CB  . LEU A 28  ? 0.8407 1.0236 0.5545 -0.0808 0.0834  0.0595  111 LEU A CB  
231  C CG  . LEU A 28  ? 0.9385 1.1538 0.6135 -0.0908 0.0933  0.0369  111 LEU A CG  
232  C CD1 . LEU A 28  ? 0.8837 1.0879 0.5557 -0.0895 0.0882  0.0010  111 LEU A CD1 
233  C CD2 . LEU A 28  ? 0.9605 1.1859 0.6365 -0.0937 0.1162  0.0277  111 LEU A CD2 
234  N N   . LEU A 29  ? 0.7549 0.8684 0.5551 -0.0602 0.0822  0.0653  112 LEU A N   
235  C CA  . LEU A 29  ? 0.7481 0.8308 0.5743 -0.0518 0.0800  0.0474  112 LEU A CA  
236  C C   . LEU A 29  ? 0.7568 0.8238 0.6204 -0.0459 0.0835  0.0580  112 LEU A C   
237  O O   . LEU A 29  ? 0.8150 0.8591 0.7011 -0.0391 0.0794  0.0462  112 LEU A O   
238  C CB  . LEU A 29  ? 0.7222 0.7920 0.5512 -0.0482 0.0634  0.0465  112 LEU A CB  
239  C CG  . LEU A 29  ? 0.7495 0.8140 0.5636 -0.0485 0.0581  0.0233  112 LEU A CG  
240  C CD1 . LEU A 29  ? 0.7284 0.8068 0.5204 -0.0542 0.0680  0.0000  112 LEU A CD1 
241  C CD2 . LEU A 29  ? 0.7407 0.8101 0.5474 -0.0496 0.0432  0.0344  112 LEU A CD2 
242  N N   . GLY A 30  ? 0.6726 0.7540 0.5438 -0.0489 0.0903  0.0807  113 GLY A N   
243  C CA  . GLY A 30  ? 0.6521 0.7212 0.5636 -0.0440 0.0932  0.0922  113 GLY A CA  
244  C C   . GLY A 30  ? 0.6812 0.7337 0.6233 -0.0378 0.0784  0.1011  113 GLY A C   
245  O O   . GLY A 30  ? 0.6711 0.7077 0.6491 -0.0321 0.0775  0.0980  113 GLY A O   
246  N N   . GLY A 31  ? 0.6499 0.7078 0.5801 -0.0394 0.0666  0.1099  114 GLY A N   
247  C CA  . GLY A 31  ? 0.5482 0.5949 0.5106 -0.0347 0.0541  0.1191  114 GLY A CA  
248  C C   . GLY A 31  ? 0.5343 0.5759 0.4808 -0.0339 0.0422  0.1084  114 GLY A C   
249  O O   . GLY A 31  ? 0.5327 0.5711 0.5026 -0.0318 0.0321  0.1184  114 GLY A O   
250  N N   . GLY A 32  ? 0.5122 0.5533 0.4250 -0.0355 0.0441  0.0877  115 GLY A N   
251  C CA  . GLY A 32  ? 0.5104 0.5450 0.4107 -0.0344 0.0343  0.0747  115 GLY A CA  
252  C C   . GLY A 32  ? 0.5294 0.5482 0.4243 -0.0310 0.0375  0.0484  115 GLY A C   
253  O O   . GLY A 32  ? 0.5475 0.5626 0.4444 -0.0303 0.0467  0.0395  115 GLY A O   
254  N N   . ILE A 33  ? 0.5300 0.5403 0.4217 -0.0292 0.0297  0.0378  116 ILE A N   
255  C CA  . ILE A 33  ? 0.5470 0.5438 0.4375 -0.0262 0.0308  0.0180  116 ILE A CA  
256  C C   . ILE A 33  ? 0.5420 0.5271 0.4570 -0.0211 0.0327  0.0151  116 ILE A C   
257  O O   . ILE A 33  ? 0.5095 0.4921 0.4460 -0.0184 0.0282  0.0218  116 ILE A O   
258  C CB  . ILE A 33  ? 0.5404 0.5325 0.4278 -0.0255 0.0218  0.0126  116 ILE A CB  
259  C CG1 . ILE A 33  ? 0.5801 0.5853 0.4476 -0.0306 0.0176  0.0161  116 ILE A CG1 
260  C CG2 . ILE A 33  ? 0.4740 0.4557 0.3596 -0.0236 0.0226  -0.0030 116 ILE A CG2 
261  C CD1 . ILE A 33  ? 0.5670 0.5836 0.4116 -0.0357 0.0245  0.0071  116 ILE A CD1 
262  N N   . GLU A 34  ? 0.5875 0.5670 0.5030 -0.0200 0.0388  0.0040  117 GLU A N   
263  C CA  . GLU A 34  ? 0.5815 0.5532 0.5201 -0.0159 0.0399  0.0018  117 GLU A CA  
264  C C   . GLU A 34  ? 0.5885 0.5510 0.5327 -0.0125 0.0335  -0.0083 117 GLU A C   
265  O O   . GLU A 34  ? 0.6213 0.5810 0.5550 -0.0134 0.0331  -0.0155 117 GLU A O   
266  C CB  . GLU A 34  ? 0.5773 0.5511 0.5197 -0.0171 0.0506  -0.0007 117 GLU A CB  
267  C CG  . GLU A 34  ? 0.6473 0.6158 0.6176 -0.0134 0.0518  0.0004  117 GLU A CG  
268  C CD  . GLU A 34  ? 0.7692 0.7388 0.7480 -0.0143 0.0630  -0.0042 117 GLU A CD  
269  O OE1 . GLU A 34  ? 0.9209 0.9010 0.8918 -0.0183 0.0735  0.0011  117 GLU A OE1 
270  O OE2 . GLU A 34  ? 0.9195 0.8812 0.9145 -0.0113 0.0616  -0.0126 117 GLU A OE2 
271  N N   . SER A 35  ? 0.5147 0.4749 0.4772 -0.0093 0.0285  -0.0085 118 SER A N   
272  C CA  . SER A 35  ? 0.5190 0.4757 0.4877 -0.0068 0.0228  -0.0165 118 SER A CA  
273  C C   . SER A 35  ? 0.5173 0.4700 0.4900 -0.0061 0.0251  -0.0202 118 SER A C   
274  O O   . SER A 35  ? 0.4995 0.4515 0.4804 -0.0065 0.0324  -0.0192 118 SER A O   
275  C CB  . SER A 35  ? 0.5658 0.5244 0.5592 -0.0042 0.0195  -0.0182 118 SER A CB  
276  O OG  . SER A 35  ? 0.6195 0.5819 0.6129 -0.0040 0.0141  -0.0216 118 SER A OG  
277  N N   . MET A 36  ? 0.5188 0.4705 0.4903 -0.0052 0.0187  -0.0234 119 MET A N   
278  C CA  . MET A 36  ? 0.4766 0.4252 0.4610 -0.0041 0.0181  -0.0245 119 MET A CA  
279  C C   . MET A 36  ? 0.4493 0.3938 0.4316 -0.0061 0.0266  -0.0265 119 MET A C   
280  O O   . MET A 36  ? 0.4653 0.4068 0.4650 -0.0056 0.0301  -0.0289 119 MET A O   
281  C CB  . MET A 36  ? 0.4267 0.3757 0.4339 -0.0018 0.0182  -0.0256 119 MET A CB  
282  C CG  . MET A 36  ? 0.4570 0.4125 0.4711 -0.0001 0.0083  -0.0284 119 MET A CG  
283  S SD  . MET A 36  ? 0.5358 0.4927 0.5820 0.0026  0.0049  -0.0318 119 MET A SD  
284  C CE  . MET A 36  ? 0.4754 0.4320 0.5293 0.0031  -0.0023 -0.0287 119 MET A CE  
285  N N   . ALA A 37  ? 0.4219 0.3679 0.3862 -0.0088 0.0298  -0.0274 120 ALA A N   
286  C CA  . ALA A 37  ? 0.4604 0.4060 0.4222 -0.0116 0.0379  -0.0337 120 ALA A CA  
287  C C   . ALA A 37  ? 0.4978 0.4447 0.4433 -0.0141 0.0357  -0.0357 120 ALA A C   
288  O O   . ALA A 37  ? 0.5543 0.5031 0.4876 -0.0140 0.0299  -0.0307 120 ALA A O   
289  C CB  . ALA A 37  ? 0.4293 0.3808 0.3869 -0.0137 0.0480  -0.0351 120 ALA A CB  
290  N N   . ILE A 38  ? 0.5306 0.4771 0.4807 -0.0165 0.0407  -0.0446 121 ILE A N   
291  C CA  . ILE A 38  ? 0.5136 0.4631 0.4511 -0.0197 0.0398  -0.0493 121 ILE A CA  
292  C C   . ILE A 38  ? 0.5344 0.4944 0.4562 -0.0240 0.0473  -0.0577 121 ILE A C   
293  O O   . ILE A 38  ? 0.6015 0.5658 0.5300 -0.0260 0.0568  -0.0682 121 ILE A O   
294  C CB  . ILE A 38  ? 0.5728 0.5168 0.5315 -0.0200 0.0395  -0.0550 121 ILE A CB  
295  C CG1 . ILE A 38  ? 0.5820 0.5203 0.5524 -0.0167 0.0309  -0.0419 121 ILE A CG1 
296  C CG2 . ILE A 38  ? 0.5630 0.5103 0.5143 -0.0235 0.0389  -0.0625 121 ILE A CG2 
297  C CD1 . ILE A 38  ? 0.5821 0.5158 0.5789 -0.0170 0.0288  -0.0402 121 ILE A CD1 
298  N N   . THR A 39  ? 0.5715 0.5383 0.4724 -0.0259 0.0433  -0.0529 122 THR A N   
299  C CA  . THR A 39  ? 0.5850 0.5664 0.4674 -0.0312 0.0482  -0.0589 122 THR A CA  
300  C C   . THR A 39  ? 0.6299 0.6143 0.5082 -0.0343 0.0444  -0.0696 122 THR A C   
301  O O   . THR A 39  ? 0.6874 0.6656 0.5674 -0.0327 0.0360  -0.0636 122 THR A O   
302  C CB  . THR A 39  ? 0.6011 0.5908 0.4674 -0.0318 0.0445  -0.0431 122 THR A CB  
303  O OG1 . THR A 39  ? 0.6758 0.6615 0.5534 -0.0286 0.0480  -0.0340 122 THR A OG1 
304  C CG2 . THR A 39  ? 0.5921 0.6022 0.4352 -0.0384 0.0481  -0.0454 122 THR A CG2 
305  N N   . GLU A 40  ? 0.6219 0.6170 0.4979 -0.0391 0.0512  -0.0873 123 GLU A N   
306  C CA  . GLU A 40  ? 0.6229 0.6221 0.5005 -0.0424 0.0479  -0.1012 123 GLU A CA  
307  C C   . GLU A 40  ? 0.6732 0.6957 0.5220 -0.0492 0.0479  -0.1081 123 GLU A C   
308  O O   . GLU A 40  ? 0.6276 0.6656 0.4635 -0.0532 0.0572  -0.1151 123 GLU A O   
309  C CB  . GLU A 40  ? 0.6413 0.6354 0.5491 -0.0429 0.0553  -0.1209 123 GLU A CB  
310  C CG  . GLU A 40  ? 0.7233 0.7295 0.6343 -0.0486 0.0562  -0.1445 123 GLU A CG  
311  C CD  . GLU A 40  ? 0.7470 0.7503 0.6969 -0.0497 0.0653  -0.1683 123 GLU A CD  
312  O OE1 . GLU A 40  ? 0.7401 0.7359 0.7121 -0.0471 0.0732  -0.1690 123 GLU A OE1 
313  O OE2 . GLU A 40  ? 0.7737 0.7826 0.7378 -0.0534 0.0642  -0.1874 123 GLU A OE2 
314  N N   . ALA A 41  ? 0.6457 0.6729 0.4842 -0.0510 0.0375  -0.1049 124 ALA A N   
315  C CA  . ALA A 41  ? 0.6435 0.6957 0.4561 -0.0582 0.0346  -0.1121 124 ALA A CA  
316  C C   . ALA A 41  ? 0.6984 0.7541 0.5234 -0.0616 0.0323  -0.1358 124 ALA A C   
317  O O   . ALA A 41  ? 0.6899 0.7303 0.5356 -0.0584 0.0256  -0.1338 124 ALA A O   
318  C CB  . ALA A 41  ? 0.6074 0.6651 0.4030 -0.0582 0.0225  -0.0891 124 ALA A CB  
319  N N   . PHE A 42  ? 0.7321 0.8099 0.5467 -0.0685 0.0384  -0.1592 125 PHE A N   
320  C CA  . PHE A 42  ? 0.8042 0.8904 0.6317 -0.0730 0.0356  -0.1859 125 PHE A CA  
321  C C   . PHE A 42  ? 0.8955 1.0163 0.6881 -0.0820 0.0322  -0.1970 125 PHE A C   
322  O O   . PHE A 42  ? 0.9959 1.1357 0.7574 -0.0856 0.0367  -0.1884 125 PHE A O   
323  C CB  . PHE A 42  ? 0.7674 0.8465 0.6317 -0.0729 0.0480  -0.2132 125 PHE A CB  
324  C CG  . PHE A 42  ? 0.7601 0.8542 0.6155 -0.0764 0.0629  -0.2276 125 PHE A CG  
325  C CD1 . PHE A 42  ? 0.7624 0.8401 0.6314 -0.0710 0.0719  -0.2155 125 PHE A CD1 
326  C CD2 . PHE A 42  ? 0.7922 0.9194 0.6265 -0.0857 0.0684  -0.2548 125 PHE A CD2 
327  C CE1 . PHE A 42  ? 0.7705 0.8621 0.6353 -0.0743 0.0870  -0.2290 125 PHE A CE1 
328  C CE2 . PHE A 42  ? 0.8030 0.9470 0.6294 -0.0898 0.0846  -0.2695 125 PHE A CE2 
329  C CZ  . PHE A 42  ? 0.8291 0.9541 0.6728 -0.0838 0.0946  -0.2565 125 PHE A CZ  
330  N N   . GLY A 43  ? 0.9170 1.0481 0.7157 -0.0862 0.0239  -0.2157 126 GLY A N   
331  C CA  . GLY A 43  ? 0.9895 1.1550 0.7529 -0.0948 0.0156  -0.2216 126 GLY A CA  
332  C C   . GLY A 43  ? 1.1528 1.3237 0.9361 -0.0982 0.0066  -0.2464 126 GLY A C   
333  O O   . GLY A 43  ? 1.1311 1.2767 0.9565 -0.0932 0.0071  -0.2532 126 GLY A O   
334  N N   . GLU A 44  ? 1.3028 1.5096 1.0561 -0.1073 -0.0017 -0.2591 127 GLU A N   
335  C CA  . GLU A 44  ? 1.3964 1.6148 1.1625 -0.1117 -0.0144 -0.2800 127 GLU A CA  
336  C C   . GLU A 44  ? 1.4432 1.6381 1.2244 -0.1052 -0.0291 -0.2506 127 GLU A C   
337  O O   . GLU A 44  ? 1.4036 1.5771 1.1817 -0.0982 -0.0293 -0.2164 127 GLU A O   
338  C CB  . GLU A 44  ? 1.4451 1.7117 1.1654 -0.1232 -0.0233 -0.2906 127 GLU A CB  
339  C CG  . GLU A 44  ? 1.4763 1.7707 1.2065 -0.1322 -0.0251 -0.3387 127 GLU A CG  
340  C CD  . GLU A 44  ? 1.5368 1.8827 1.2168 -0.1440 -0.0386 -0.3440 127 GLU A CD  
341  O OE1 . GLU A 44  ? 1.5096 1.8694 1.1485 -0.1453 -0.0468 -0.3066 127 GLU A OE1 
342  O OE2 . GLU A 44  ? 1.5165 1.8911 1.2003 -0.1526 -0.0418 -0.3854 127 GLU A OE2 
343  N N   . PHE A 45  ? 1.4519 1.6520 1.2529 -0.1079 -0.0407 -0.2669 128 PHE A N   
344  C CA  . PHE A 45  ? 1.3810 1.5715 1.1899 -0.1049 -0.0570 -0.2434 128 PHE A CA  
345  C C   . PHE A 45  ? 1.2532 1.4643 1.0181 -0.1074 -0.0682 -0.2122 128 PHE A C   
346  O O   . PHE A 45  ? 1.3195 1.5586 1.0473 -0.1136 -0.0652 -0.2146 128 PHE A O   
347  C CB  . PHE A 45  ? 1.5096 1.7139 1.3417 -0.1103 -0.0684 -0.2720 128 PHE A CB  
348  C CG  . PHE A 45  ? 1.7156 1.9381 1.5610 -0.1171 -0.0596 -0.3192 128 PHE A CG  
349  C CD1 . PHE A 45  ? 1.6984 1.8990 1.5811 -0.1132 -0.0418 -0.3368 128 PHE A CD1 
350  C CD2 . PHE A 45  ? 1.8134 2.0776 1.6379 -0.1278 -0.0700 -0.3475 128 PHE A CD2 
351  C CE1 . PHE A 45  ? 1.7753 1.9932 1.6787 -0.1195 -0.0332 -0.3824 128 PHE A CE1 
352  C CE2 . PHE A 45  ? 1.8156 2.0993 1.6559 -0.1346 -0.0612 -0.3959 128 PHE A CE2 
353  C CZ  . PHE A 45  ? 1.8293 2.0888 1.7120 -0.1302 -0.0422 -0.4142 128 PHE A CZ  
354  N N   . ARG A 46  ? 1.1634 1.3620 0.9356 -0.1029 -0.0802 -0.1819 129 ARG A N   
355  C CA  . ARG A 46  ? 1.1422 1.3632 0.8841 -0.1061 -0.0950 -0.1523 129 ARG A CA  
356  C C   . ARG A 46  ? 1.1007 1.3261 0.8137 -0.1052 -0.0866 -0.1275 129 ARG A C   
357  O O   . ARG A 46  ? 1.0110 1.2479 0.7096 -0.1060 -0.0972 -0.0954 129 ARG A O   
358  C CB  . ARG A 46  ? 1.3009 1.5646 1.0197 -0.1170 -0.1114 -0.1677 129 ARG A CB  
359  C CG  . ARG A 46  ? 1.3887 1.6547 1.1367 -0.1197 -0.1202 -0.1989 129 ARG A CG  
360  C CD  . ARG A 46  ? 1.3704 1.6149 1.1544 -0.1142 -0.1326 -0.1814 129 ARG A CD  
361  N NE  . ARG A 46  ? 1.3830 1.5846 1.2028 -0.1042 -0.1180 -0.1754 129 ARG A NE  
362  C CZ  . ARG A 46  ? 1.3868 1.5647 1.2331 -0.0976 -0.1214 -0.1524 129 ARG A CZ  
363  N NH1 . ARG A 46  ? 1.4154 1.6048 1.2634 -0.0989 -0.1392 -0.1327 129 ARG A NH1 
364  N NH2 . ARG A 46  ? 1.2712 1.4160 1.1439 -0.0900 -0.1070 -0.1491 129 ARG A NH2 
365  N N   . THR A 47  ? 1.0768 1.2928 0.7874 -0.1036 -0.0677 -0.1412 130 THR A N   
366  C CA  . THR A 47  ? 1.0833 1.2955 0.7775 -0.1009 -0.0577 -0.1176 130 THR A CA  
367  C C   . THR A 47  ? 1.1679 1.3446 0.8884 -0.0906 -0.0565 -0.0902 130 THR A C   
368  O O   . THR A 47  ? 1.3842 1.5349 1.1365 -0.0848 -0.0577 -0.0943 130 THR A O   
369  C CB  . THR A 47  ? 1.0297 1.2416 0.7183 -0.1018 -0.0375 -0.1401 130 THR A CB  
370  O OG1 . THR A 47  ? 1.0241 1.2688 0.6945 -0.1115 -0.0360 -0.1737 130 THR A OG1 
371  C CG2 . THR A 47  ? 1.0346 1.2524 0.7016 -0.1014 -0.0302 -0.1140 130 THR A CG2 
372  N N   . GLY A 48  ? 1.0021 1.1799 0.7109 -0.0889 -0.0532 -0.0633 131 GLY A N   
373  C CA  . GLY A 48  ? 0.9001 1.0517 0.6330 -0.0805 -0.0543 -0.0375 131 GLY A CA  
374  C C   . GLY A 48  ? 0.7918 0.9084 0.5528 -0.0722 -0.0436 -0.0456 131 GLY A C   
375  O O   . GLY A 48  ? 0.7911 0.8908 0.5682 -0.0662 -0.0430 -0.0267 131 GLY A O   
376  N N   . LYS A 49  ? 0.7639 0.8713 0.5340 -0.0719 -0.0355 -0.0725 132 LYS A N   
377  C CA  . LYS A 49  ? 0.7316 0.8093 0.5264 -0.0646 -0.0255 -0.0754 132 LYS A CA  
378  C C   . LYS A 49  ? 0.7318 0.7930 0.5466 -0.0591 -0.0320 -0.0575 132 LYS A C   
379  O O   . LYS A 49  ? 0.7205 0.7674 0.5436 -0.0537 -0.0274 -0.0437 132 LYS A O   
380  C CB  . LYS A 49  ? 0.6988 0.7685 0.5118 -0.0651 -0.0196 -0.1023 132 LYS A CB  
381  C CG  . LYS A 49  ? 0.6890 0.7736 0.4915 -0.0702 -0.0103 -0.1262 132 LYS A CG  
382  C CD  . LYS A 49  ? 0.7511 0.8304 0.5813 -0.0715 -0.0070 -0.1544 132 LYS A CD  
383  C CE  . LYS A 49  ? 0.7830 0.8781 0.6144 -0.0768 -0.0194 -0.1667 132 LYS A CE  
384  N NZ  . LYS A 49  ? 0.8003 0.8887 0.6673 -0.0778 -0.0153 -0.1941 132 LYS A NZ  
385  N N   . THR A 50  ? 0.7499 0.8156 0.5738 -0.0610 -0.0429 -0.0592 133 THR A N   
386  C CA  . THR A 50  ? 0.7545 0.8060 0.6016 -0.0564 -0.0473 -0.0467 133 THR A CA  
387  C C   . THR A 50  ? 0.6899 0.7466 0.5382 -0.0551 -0.0546 -0.0220 133 THR A C   
388  O O   . THR A 50  ? 0.6803 0.7232 0.5472 -0.0500 -0.0520 -0.0120 133 THR A O   
389  C CB  . THR A 50  ? 0.8131 0.8656 0.6770 -0.0586 -0.0542 -0.0588 133 THR A CB  
390  O OG1 . THR A 50  ? 0.8045 0.8436 0.6824 -0.0574 -0.0445 -0.0760 133 THR A OG1 
391  C CG2 . THR A 50  ? 0.8088 0.8534 0.6955 -0.0555 -0.0600 -0.0449 133 THR A CG2 
392  N N   . GLN A 51  ? 0.6733 0.7519 0.5035 -0.0600 -0.0633 -0.0125 134 GLN A N   
393  C CA  . GLN A 51  ? 0.6750 0.7607 0.5103 -0.0594 -0.0702 0.0138  134 GLN A CA  
394  C C   . GLN A 51  ? 0.6675 0.7413 0.5066 -0.0548 -0.0592 0.0232  134 GLN A C   
395  O O   . GLN A 51  ? 0.6433 0.7104 0.5058 -0.0510 -0.0612 0.0400  134 GLN A O   
396  C CB  . GLN A 51  ? 0.7862 0.9025 0.5954 -0.0670 -0.0804 0.0236  134 GLN A CB  
397  C CG  . GLN A 51  ? 0.9270 1.0590 0.7404 -0.0714 -0.0973 0.0234  134 GLN A CG  
398  C CD  . GLN A 51  ? 1.0904 1.2121 0.9417 -0.0671 -0.1064 0.0416  134 GLN A CD  
399  O OE1 . GLN A 51  ? 1.0723 1.1775 0.9480 -0.0637 -0.1054 0.0298  134 GLN A OE1 
400  N NE2 . GLN A 51  ? 1.1537 1.2854 1.0146 -0.0674 -0.1141 0.0708  134 GLN A NE2 
401  N N   . LEU A 52  ? 0.6641 0.7362 0.4845 -0.0553 -0.0476 0.0110  135 LEU A N   
402  C CA  . LEU A 52  ? 0.6781 0.7387 0.5032 -0.0510 -0.0368 0.0172  135 LEU A CA  
403  C C   . LEU A 52  ? 0.6677 0.7049 0.5176 -0.0444 -0.0322 0.0118  135 LEU A C   
404  O O   . LEU A 52  ? 0.7470 0.7761 0.6143 -0.0403 -0.0301 0.0222  135 LEU A O   
405  C CB  . LEU A 52  ? 0.6667 0.7305 0.4709 -0.0531 -0.0252 0.0030  135 LEU A CB  
406  C CG  . LEU A 52  ? 0.6818 0.7500 0.4794 -0.0529 -0.0166 0.0146  135 LEU A CG  
407  C CD1 . LEU A 52  ? 0.6335 0.6972 0.4222 -0.0531 -0.0032 -0.0058 135 LEU A CD1 
408  C CD2 . LEU A 52  ? 0.6180 0.6722 0.4407 -0.0470 -0.0155 0.0313  135 LEU A CD2 
409  N N   . SER A 53  ? 0.6567 0.6853 0.5097 -0.0439 -0.0306 -0.0046 136 SER A N   
410  C CA  . SER A 53  ? 0.6286 0.6399 0.5009 -0.0390 -0.0260 -0.0085 136 SER A CA  
411  C C   . SER A 53  ? 0.6126 0.6232 0.5068 -0.0368 -0.0318 0.0030  136 SER A C   
412  O O   . SER A 53  ? 0.6873 0.6896 0.5956 -0.0329 -0.0270 0.0053  136 SER A O   
413  C CB  . SER A 53  ? 0.6345 0.6402 0.5103 -0.0399 -0.0244 -0.0235 136 SER A CB  
414  O OG  . SER A 53  ? 0.6737 0.6811 0.5370 -0.0422 -0.0191 -0.0363 136 SER A OG  
415  N N   . HIS A 54  ? 0.5780 0.5987 0.4784 -0.0397 -0.0423 0.0092  137 HIS A N   
416  C CA  . HIS A 54  ? 0.5785 0.5982 0.5083 -0.0376 -0.0474 0.0189  137 HIS A CA  
417  C C   . HIS A 54  ? 0.5841 0.6060 0.5264 -0.0357 -0.0477 0.0341  137 HIS A C   
418  O O   . HIS A 54  ? 0.6326 0.6481 0.6027 -0.0322 -0.0452 0.0355  137 HIS A O   
419  C CB  . HIS A 54  ? 0.5589 0.5892 0.4985 -0.0409 -0.0600 0.0235  137 HIS A CB  
420  C CG  . HIS A 54  ? 0.6021 0.6276 0.5451 -0.0418 -0.0589 0.0083  137 HIS A CG  
421  N ND1 . HIS A 54  ? 0.6705 0.6987 0.5938 -0.0449 -0.0585 -0.0041 137 HIS A ND1 
422  C CD2 . HIS A 54  ? 0.6989 0.7177 0.6677 -0.0401 -0.0569 0.0033  137 HIS A CD2 
423  C CE1 . HIS A 54  ? 0.6742 0.6966 0.6123 -0.0451 -0.0572 -0.0147 137 HIS A CE1 
424  N NE2 . HIS A 54  ? 0.7150 0.7322 0.6787 -0.0423 -0.0558 -0.0093 137 HIS A NE2 
425  N N   . THR A 55  ? 0.6115 0.6437 0.5352 -0.0384 -0.0497 0.0447  138 THR A N   
426  C CA  . THR A 55  ? 0.6223 0.6586 0.5625 -0.0373 -0.0509 0.0636  138 THR A CA  
427  C C   . THR A 55  ? 0.5891 0.6110 0.5418 -0.0322 -0.0397 0.0557  138 THR A C   
428  O O   . THR A 55  ? 0.5841 0.6024 0.5713 -0.0291 -0.0397 0.0618  138 THR A O   
429  C CB  . THR A 55  ? 0.6061 0.6598 0.5193 -0.0422 -0.0533 0.0774  138 THR A CB  
430  O OG1 . THR A 55  ? 0.5744 0.6462 0.4772 -0.0477 -0.0663 0.0855  138 THR A OG1 
431  C CG2 . THR A 55  ? 0.5633 0.6204 0.4979 -0.0410 -0.0529 0.0992  138 THR A CG2 
432  N N   . LEU A 56  ? 0.5822 0.5970 0.5109 -0.0316 -0.0308 0.0408  139 LEU A N   
433  C CA  . LEU A 56  ? 0.5452 0.5490 0.4821 -0.0274 -0.0218 0.0337  139 LEU A CA  
434  C C   . LEU A 56  ? 0.5354 0.5316 0.4968 -0.0241 -0.0205 0.0239  139 LEU A C   
435  O O   . LEU A 56  ? 0.5000 0.4921 0.4800 -0.0210 -0.0164 0.0206  139 LEU A O   
436  C CB  . LEU A 56  ? 0.5310 0.5297 0.4415 -0.0277 -0.0140 0.0211  139 LEU A CB  
437  C CG  . LEU A 56  ? 0.5208 0.5286 0.4077 -0.0313 -0.0114 0.0249  139 LEU A CG  
438  C CD1 . LEU A 56  ? 0.5227 0.5244 0.3932 -0.0315 -0.0040 0.0082  139 LEU A CD1 
439  C CD2 . LEU A 56  ? 0.5174 0.5282 0.4142 -0.0303 -0.0080 0.0382  139 LEU A CD2 
440  N N   . CYS A 57  ? 0.4835 0.4801 0.4465 -0.0252 -0.0236 0.0180  140 CYS A N   
441  C CA  . CYS A 57  ? 0.4899 0.4832 0.4760 -0.0231 -0.0207 0.0083  140 CYS A CA  
442  C C   . CYS A 57  ? 0.5161 0.5124 0.5410 -0.0212 -0.0229 0.0143  140 CYS A C   
443  O O   . CYS A 57  ? 0.5699 0.5652 0.6171 -0.0191 -0.0177 0.0024  140 CYS A O   
444  C CB  . CYS A 57  ? 0.4746 0.4697 0.4622 -0.0252 -0.0237 0.0041  140 CYS A CB  
445  S SG  . CYS A 57  ? 0.5060 0.4960 0.4633 -0.0267 -0.0183 -0.0069 140 CYS A SG  
446  N N   . VAL A 58  ? 0.4941 0.4961 0.5296 -0.0224 -0.0303 0.0327  141 VAL A N   
447  C CA  . VAL A 58  ? 0.4966 0.5012 0.5783 -0.0206 -0.0332 0.0414  141 VAL A CA  
448  C C   . VAL A 58  ? 0.4974 0.5010 0.5862 -0.0191 -0.0301 0.0490  141 VAL A C   
449  O O   . VAL A 58  ? 0.5097 0.5108 0.6342 -0.0163 -0.0264 0.0422  141 VAL A O   
450  C CB  . VAL A 58  ? 0.5369 0.5509 0.6379 -0.0232 -0.0455 0.0622  141 VAL A CB  
451  C CG1 . VAL A 58  ? 0.4785 0.4953 0.6364 -0.0214 -0.0491 0.0752  141 VAL A CG1 
452  C CG2 . VAL A 58  ? 0.5235 0.5383 0.6255 -0.0245 -0.0489 0.0534  141 VAL A CG2 
453  N N   . THR A 59  ? 0.4772 0.4841 0.5345 -0.0213 -0.0307 0.0612  142 THR A N   
454  C CA  . THR A 59  ? 0.4600 0.4672 0.5277 -0.0203 -0.0271 0.0714  142 THR A CA  
455  C C   . THR A 59  ? 0.4469 0.4448 0.5138 -0.0169 -0.0180 0.0518  142 THR A C   
456  O O   . THR A 59  ? 0.4934 0.4900 0.5883 -0.0148 -0.0152 0.0547  142 THR A O   
457  C CB  . THR A 59  ? 0.4432 0.4593 0.4775 -0.0242 -0.0274 0.0880  142 THR A CB  
458  O OG1 . THR A 59  ? 0.4307 0.4441 0.4205 -0.0256 -0.0230 0.0723  142 THR A OG1 
459  C CG2 . THR A 59  ? 0.4419 0.4729 0.4805 -0.0283 -0.0383 0.1124  142 THR A CG2 
460  N N   . ALA A 60  ? 0.4025 0.3952 0.4417 -0.0165 -0.0142 0.0332  143 ALA A N   
461  C CA  . ALA A 60  ? 0.4385 0.4256 0.4790 -0.0137 -0.0077 0.0156  143 ALA A CA  
462  C C   . ALA A 60  ? 0.4434 0.4320 0.5258 -0.0113 -0.0069 0.0033  143 ALA A C   
463  O O   . ALA A 60  ? 0.4240 0.4119 0.5147 -0.0094 -0.0029 -0.0105 143 ALA A O   
464  C CB  . ALA A 60  ? 0.4211 0.4047 0.4267 -0.0143 -0.0045 0.0022  143 ALA A CB  
465  N N   . GLN A 61  ? 0.4289 0.4212 0.5396 -0.0119 -0.0107 0.0063  144 GLN A N   
466  C CA  . GLN A 61  ? 0.4007 0.3963 0.5569 -0.0102 -0.0089 -0.0083 144 GLN A CA  
467  C C   . GLN A 61  ? 0.4045 0.4010 0.6108 -0.0087 -0.0113 0.0033  144 GLN A C   
468  O O   . GLN A 61  ? 0.3900 0.3890 0.6399 -0.0070 -0.0087 -0.0116 144 GLN A O   
469  C CB  . GLN A 61  ? 0.4023 0.4017 0.5730 -0.0114 -0.0106 -0.0126 144 GLN A CB  
470  C CG  . GLN A 61  ? 0.4933 0.4920 0.6185 -0.0134 -0.0085 -0.0192 144 GLN A CG  
471  C CD  . GLN A 61  ? 0.5094 0.5132 0.6523 -0.0145 -0.0064 -0.0312 144 GLN A CD  
472  O OE1 . GLN A 61  ? 0.5375 0.5470 0.7203 -0.0137 -0.0025 -0.0460 144 GLN A OE1 
473  N NE2 . GLN A 61  ? 0.4691 0.4720 0.5856 -0.0166 -0.0081 -0.0271 144 GLN A NE2 
474  N N   . LEU A 62  ? 0.4485 0.4449 0.6513 -0.0098 -0.0159 0.0302  145 LEU A N   
475  C CA  . LEU A 62  ? 0.4361 0.4351 0.6930 -0.0090 -0.0189 0.0484  145 LEU A CA  
476  C C   . LEU A 62  ? 0.4337 0.4299 0.7069 -0.0070 -0.0136 0.0441  145 LEU A C   
477  O O   . LEU A 62  ? 0.4484 0.4415 0.6797 -0.0072 -0.0096 0.0427  145 LEU A O   
478  C CB  . LEU A 62  ? 0.4697 0.4742 0.7089 -0.0122 -0.0256 0.0815  145 LEU A CB  
479  C CG  . LEU A 62  ? 0.4903 0.5011 0.7491 -0.0141 -0.0351 0.0959  145 LEU A CG  
480  C CD1 . LEU A 62  ? 0.4499 0.4578 0.7316 -0.0123 -0.0337 0.0705  145 LEU A CD1 
481  C CD2 . LEU A 62  ? 0.5136 0.5314 0.7177 -0.0183 -0.0405 0.1125  145 LEU A CD2 
482  N N   . PRO A 63  ? 0.4198 0.4169 0.7587 -0.0050 -0.0134 0.0407  146 PRO A N   
483  C CA  . PRO A 63  ? 0.4245 0.4192 0.7753 -0.0035 -0.0091 0.0409  146 PRO A CA  
484  C C   . PRO A 63  ? 0.4504 0.4467 0.7795 -0.0058 -0.0098 0.0758  146 PRO A C   
485  O O   . PRO A 63  ? 0.4918 0.4943 0.8293 -0.0082 -0.0156 0.1040  146 PRO A O   
486  C CB  . PRO A 63  ? 0.3649 0.3613 0.7992 -0.0013 -0.0092 0.0321  146 PRO A CB  
487  C CG  . PRO A 63  ? 0.3348 0.3348 0.8019 -0.0016 -0.0131 0.0283  146 PRO A CG  
488  C CD  . PRO A 63  ? 0.3764 0.3765 0.7798 -0.0036 -0.0147 0.0274  146 PRO A CD  
489  N N   . GLY A 64  ? 0.4812 0.4748 0.7813 -0.0057 -0.0042 0.0740  147 GLY A N   
490  C CA  . GLY A 64  ? 0.5310 0.5292 0.7975 -0.0089 -0.0021 0.1018  147 GLY A CA  
491  C C   . GLY A 64  ? 0.5731 0.5712 0.8588 -0.0084 0.0045  0.1115  147 GLY A C   
492  O O   . GLY A 64  ? 0.6259 0.6201 0.9640 -0.0055 0.0057  0.1016  147 GLY A O   
493  N N   . ALA A 65  ? 0.5564 0.5604 0.8032 -0.0119 0.0093  0.1299  148 ALA A N   
494  C CA  . ALA A 65  ? 0.5474 0.5528 0.8075 -0.0122 0.0177  0.1405  148 ALA A CA  
495  C C   . ALA A 65  ? 0.5466 0.5410 0.8062 -0.0083 0.0218  0.1097  148 ALA A C   
496  O O   . ALA A 65  ? 0.5822 0.5706 0.8170 -0.0065 0.0187  0.0844  148 ALA A O   
497  C CB  . ALA A 65  ? 0.5225 0.5394 0.7328 -0.0175 0.0239  0.1602  148 ALA A CB  
498  N N   . GLY A 66  ? 0.5323 0.5254 0.8229 -0.0072 0.0280  0.1131  149 GLY A N   
499  C CA  . GLY A 66  ? 0.5002 0.4855 0.7858 -0.0042 0.0311  0.0871  149 GLY A CA  
500  C C   . GLY A 66  ? 0.5117 0.4915 0.8260 -0.0002 0.0246  0.0565  149 GLY A C   
501  O O   . GLY A 66  ? 0.5046 0.4807 0.8101 0.0018  0.0247  0.0351  149 GLY A O   
502  N N   . GLY A 67  ? 0.5160 0.4976 0.8666 0.0005  0.0190  0.0540  150 GLY A N   
503  C CA  . GLY A 67  ? 0.4899 0.4708 0.8665 0.0032  0.0141  0.0217  150 GLY A CA  
504  C C   . GLY A 67  ? 0.4913 0.4731 0.8233 0.0027  0.0103  0.0042  150 GLY A C   
505  O O   . GLY A 67  ? 0.4821 0.4674 0.8245 0.0039  0.0073  -0.0247 150 GLY A O   
506  N N   . TYR A 68  ? 0.4598 0.4410 0.7444 0.0004  0.0107  0.0208  151 TYR A N   
507  C CA  . TYR A 68  ? 0.4611 0.4424 0.7010 -0.0003 0.0080  0.0068  151 TYR A CA  
508  C C   . TYR A 68  ? 0.4629 0.4482 0.7348 -0.0001 0.0043  -0.0030 151 TYR A C   
509  O O   . TYR A 68  ? 0.4783 0.4652 0.7772 -0.0009 0.0022  0.0160  151 TYR A O   
510  C CB  . TYR A 68  ? 0.4788 0.4595 0.6687 -0.0032 0.0092  0.0259  151 TYR A CB  
511  C CG  . TYR A 68  ? 0.5239 0.5045 0.6758 -0.0041 0.0065  0.0146  151 TYR A CG  
512  C CD1 . TYR A 68  ? 0.5307 0.5090 0.6491 -0.0036 0.0073  -0.0030 151 TYR A CD1 
513  C CD2 . TYR A 68  ? 0.5170 0.5006 0.6692 -0.0058 0.0026  0.0236  151 TYR A CD2 
514  C CE1 . TYR A 68  ? 0.4990 0.4778 0.5860 -0.0048 0.0056  -0.0107 151 TYR A CE1 
515  C CE2 . TYR A 68  ? 0.5197 0.5032 0.6403 -0.0068 0.0009  0.0134  151 TYR A CE2 
516  C CZ  . TYR A 68  ? 0.5141 0.4951 0.6026 -0.0064 0.0031  -0.0036 151 TYR A CZ  
517  O OH  . TYR A 68  ? 0.5318 0.5133 0.5921 -0.0077 0.0022  -0.0117 151 TYR A OH  
518  N N   . PRO A 69  ? 0.4498 0.4390 0.7210 0.0008  0.0035  -0.0325 152 PRO A N   
519  C CA  . PRO A 69  ? 0.4114 0.4070 0.7169 0.0008  0.0024  -0.0501 152 PRO A CA  
520  C C   . PRO A 69  ? 0.4487 0.4454 0.7263 -0.0011 0.0014  -0.0466 152 PRO A C   
521  O O   . PRO A 69  ? 0.4796 0.4810 0.7928 -0.0013 0.0010  -0.0556 152 PRO A O   
522  C CB  . PRO A 69  ? 0.3801 0.3842 0.6825 0.0011  0.0031  -0.0841 152 PRO A CB  
523  C CG  . PRO A 69  ? 0.3775 0.3784 0.6227 0.0007  0.0028  -0.0803 152 PRO A CG  
524  C CD  . PRO A 69  ? 0.4231 0.4133 0.6536 0.0009  0.0039  -0.0497 152 PRO A CD  
525  N N   . GLY A 70  ? 0.4809 0.4735 0.7008 -0.0025 0.0012  -0.0353 153 GLY A N   
526  C CA  . GLY A 70  ? 0.4773 0.4712 0.6734 -0.0044 0.0000  -0.0339 153 GLY A CA  
527  C C   . GLY A 70  ? 0.5075 0.5075 0.6799 -0.0050 0.0029  -0.0595 153 GLY A C   
528  O O   . GLY A 70  ? 0.4971 0.5036 0.6856 -0.0042 0.0044  -0.0798 153 GLY A O   
529  N N   . GLY A 71  ? 0.4983 0.4983 0.6322 -0.0069 0.0032  -0.0578 154 GLY A N   
530  C CA  . GLY A 71  ? 0.4458 0.4539 0.5532 -0.0084 0.0064  -0.0766 154 GLY A CA  
531  C C   . GLY A 71  ? 0.4719 0.4780 0.5502 -0.0105 0.0067  -0.0684 154 GLY A C   
532  O O   . GLY A 71  ? 0.4731 0.4735 0.5570 -0.0107 0.0038  -0.0533 154 GLY A O   
533  N N   . LYS A 72  ? 0.4875 0.5001 0.5358 -0.0123 0.0096  -0.0775 155 LYS A N   
534  C CA  . LYS A 72  ? 0.4823 0.4958 0.5088 -0.0147 0.0115  -0.0738 155 LYS A CA  
535  C C   . LYS A 72  ? 0.5404 0.5440 0.5320 -0.0151 0.0091  -0.0582 155 LYS A C   
536  O O   . LYS A 72  ? 0.5337 0.5325 0.5131 -0.0139 0.0075  -0.0536 155 LYS A O   
537  C CB  . LYS A 72  ? 0.4818 0.5111 0.4960 -0.0173 0.0170  -0.0903 155 LYS A CB  
538  C CG  . LYS A 72  ? 0.5009 0.5441 0.5493 -0.0180 0.0216  -0.1120 155 LYS A CG  
539  C CD  . LYS A 72  ? 0.4907 0.5526 0.5250 -0.0221 0.0293  -0.1265 155 LYS A CD  
540  C CE  . LYS A 72  ? 0.4903 0.5683 0.5619 -0.0230 0.0348  -0.1535 155 LYS A CE  
541  N NZ  . LYS A 72  ? 0.5897 0.6905 0.6448 -0.0280 0.0441  -0.1691 155 LYS A NZ  
542  N N   . ILE A 73  ? 0.4888 0.4904 0.4694 -0.0170 0.0095  -0.0523 156 ILE A N   
543  C CA  . ILE A 73  ? 0.4801 0.4730 0.4372 -0.0177 0.0074  -0.0405 156 ILE A CA  
544  C C   . ILE A 73  ? 0.4894 0.4864 0.4313 -0.0202 0.0107  -0.0416 156 ILE A C   
545  O O   . ILE A 73  ? 0.4512 0.4569 0.4016 -0.0218 0.0145  -0.0484 156 ILE A O   
546  C CB  . ILE A 73  ? 0.4603 0.4481 0.4244 -0.0183 0.0029  -0.0309 156 ILE A CB  
547  C CG1 . ILE A 73  ? 0.4389 0.4253 0.4208 -0.0166 -0.0004 -0.0245 156 ILE A CG1 
548  C CG2 . ILE A 73  ? 0.3923 0.3745 0.3340 -0.0200 0.0014  -0.0244 156 ILE A CG2 
549  C CD1 . ILE A 73  ? 0.4193 0.4109 0.4377 -0.0157 -0.0011 -0.0285 156 ILE A CD1 
550  N N   . ILE A 74  ? 0.4863 0.4777 0.4102 -0.0207 0.0101  -0.0347 157 ILE A N   
551  C CA  . ILE A 74  ? 0.5025 0.4963 0.4177 -0.0232 0.0126  -0.0310 157 ILE A CA  
552  C C   . ILE A 74  ? 0.4804 0.4639 0.3938 -0.0238 0.0100  -0.0251 157 ILE A C   
553  O O   . ILE A 74  ? 0.4777 0.4543 0.3865 -0.0227 0.0078  -0.0233 157 ILE A O   
554  C CB  . ILE A 74  ? 0.5455 0.5448 0.4486 -0.0237 0.0137  -0.0275 157 ILE A CB  
555  C CG1 . ILE A 74  ? 0.5958 0.6122 0.4974 -0.0251 0.0171  -0.0357 157 ILE A CG1 
556  C CG2 . ILE A 74  ? 0.5900 0.5881 0.4898 -0.0261 0.0152  -0.0178 157 ILE A CG2 
557  C CD1 . ILE A 74  ? 0.6349 0.6635 0.5218 -0.0267 0.0166  -0.0308 157 ILE A CD1 
558  N N   . PHE A 75  ? 0.4832 0.4675 0.4021 -0.0261 0.0108  -0.0242 158 PHE A N   
559  C CA  . PHE A 75  ? 0.4507 0.4283 0.3714 -0.0274 0.0073  -0.0230 158 PHE A CA  
560  C C   . PHE A 75  ? 0.4855 0.4623 0.4111 -0.0297 0.0100  -0.0199 158 PHE A C   
561  O O   . PHE A 75  ? 0.5793 0.5624 0.5115 -0.0313 0.0138  -0.0183 158 PHE A O   
562  C CB  . PHE A 75  ? 0.4191 0.3991 0.3500 -0.0280 0.0031  -0.0248 158 PHE A CB  
563  C CG  . PHE A 75  ? 0.4098 0.3876 0.3396 -0.0299 -0.0028 -0.0250 158 PHE A CG  
564  C CD1 . PHE A 75  ? 0.3885 0.3692 0.3167 -0.0301 -0.0094 -0.0226 158 PHE A CD1 
565  C CD2 . PHE A 75  ? 0.4268 0.4019 0.3589 -0.0321 -0.0022 -0.0275 158 PHE A CD2 
566  C CE1 . PHE A 75  ? 0.4067 0.3906 0.3295 -0.0330 -0.0156 -0.0239 158 PHE A CE1 
567  C CE2 . PHE A 75  ? 0.4573 0.4337 0.3892 -0.0347 -0.0081 -0.0323 158 PHE A CE2 
568  C CZ  . PHE A 75  ? 0.4104 0.3928 0.3344 -0.0354 -0.0152 -0.0311 158 PHE A CZ  
569  N N   . ILE A 76  ? 0.4908 0.4611 0.4174 -0.0302 0.0090  -0.0194 159 ILE A N   
570  C CA  . ILE A 76  ? 0.4494 0.4181 0.3900 -0.0324 0.0114  -0.0154 159 ILE A CA  
571  C C   . ILE A 76  ? 0.4962 0.4609 0.4472 -0.0343 0.0079  -0.0238 159 ILE A C   
572  O O   . ILE A 76  ? 0.5395 0.5013 0.4856 -0.0341 0.0056  -0.0312 159 ILE A O   
573  C CB  . ILE A 76  ? 0.4521 0.4178 0.3961 -0.0317 0.0131  -0.0084 159 ILE A CB  
574  C CG1 . ILE A 76  ? 0.4578 0.4319 0.3903 -0.0308 0.0150  0.0000  159 ILE A CG1 
575  C CG2 . ILE A 76  ? 0.4526 0.4159 0.4206 -0.0341 0.0150  -0.0024 159 ILE A CG2 
576  C CD1 . ILE A 76  ? 0.4608 0.4331 0.3962 -0.0298 0.0140  0.0082  159 ILE A CD1 
577  N N   . ASP A 77  ? 0.4811 0.4479 0.4467 -0.0365 0.0078  -0.0240 160 ASP A N   
578  C CA  . ASP A 77  ? 0.4634 0.4301 0.4397 -0.0389 0.0027  -0.0340 160 ASP A CA  
579  C C   . ASP A 77  ? 0.4808 0.4436 0.4845 -0.0411 0.0051  -0.0354 160 ASP A C   
580  O O   . ASP A 77  ? 0.4786 0.4422 0.5001 -0.0423 0.0094  -0.0263 160 ASP A O   
581  C CB  . ASP A 77  ? 0.4689 0.4412 0.4485 -0.0396 -0.0001 -0.0336 160 ASP A CB  
582  C CG  . ASP A 77  ? 0.5190 0.4947 0.5081 -0.0424 -0.0088 -0.0437 160 ASP A CG  
583  O OD1 . ASP A 77  ? 0.5104 0.4855 0.5025 -0.0443 -0.0115 -0.0537 160 ASP A OD1 
584  O OD2 . ASP A 77  ? 0.5150 0.4956 0.5112 -0.0431 -0.0131 -0.0428 160 ASP A OD2 
585  N N   . THR A 78  ? 0.4863 0.4463 0.4974 -0.0421 0.0034  -0.0471 161 THR A N   
586  C CA  . THR A 78  ? 0.4995 0.4560 0.5459 -0.0443 0.0051  -0.0515 161 THR A CA  
587  C C   . THR A 78  ? 0.5264 0.4877 0.5847 -0.0476 -0.0008 -0.0680 161 THR A C   
588  O O   . THR A 78  ? 0.5647 0.5243 0.6579 -0.0500 -0.0004 -0.0756 161 THR A O   
589  C CB  . THR A 78  ? 0.4872 0.4390 0.5462 -0.0440 0.0076  -0.0593 161 THR A CB  
590  O OG1 . THR A 78  ? 0.5055 0.4624 0.5468 -0.0452 0.0043  -0.0785 161 THR A OG1 
591  C CG2 . THR A 78  ? 0.4713 0.4193 0.5208 -0.0409 0.0114  -0.0439 161 THR A CG2 
592  N N   . GLU A 79  ? 0.5856 0.5541 0.6183 -0.0480 -0.0074 -0.0732 162 GLU A N   
593  C CA  . GLU A 79  ? 0.6036 0.5815 0.6394 -0.0518 -0.0161 -0.0909 162 GLU A CA  
594  C C   . GLU A 79  ? 0.5537 0.5359 0.5983 -0.0530 -0.0220 -0.0868 162 GLU A C   
595  O O   . GLU A 79  ? 0.4956 0.4866 0.5479 -0.0564 -0.0306 -0.1000 162 GLU A O   
596  C CB  . GLU A 79  ? 0.7129 0.7002 0.7139 -0.0525 -0.0210 -0.0977 162 GLU A CB  
597  C CG  . GLU A 79  ? 0.8399 0.8262 0.8358 -0.0526 -0.0151 -0.1082 162 GLU A CG  
598  C CD  . GLU A 79  ? 0.9085 0.8937 0.9401 -0.0554 -0.0126 -0.1269 162 GLU A CD  
599  O OE1 . GLU A 79  ? 0.9810 0.9545 1.0382 -0.0533 -0.0050 -0.1212 162 GLU A OE1 
600  O OE2 . GLU A 79  ? 0.9360 0.9331 0.9737 -0.0599 -0.0189 -0.1465 162 GLU A OE2 
601  N N   . ASN A 80  ? 0.5277 0.5058 0.5720 -0.0504 -0.0171 -0.0698 163 ASN A N   
602  C CA  . ASN A 80  ? 0.5129 0.4950 0.5679 -0.0511 -0.0205 -0.0651 163 ASN A CA  
603  C C   . ASN A 80  ? 0.5161 0.5078 0.5538 -0.0519 -0.0323 -0.0687 163 ASN A C   
604  O O   . ASN A 80  ? 0.5646 0.5630 0.6172 -0.0543 -0.0409 -0.0734 163 ASN A O   
605  C CB  . ASN A 80  ? 0.5072 0.4893 0.5997 -0.0542 -0.0212 -0.0718 163 ASN A CB  
606  C CG  . ASN A 80  ? 0.5179 0.5020 0.6296 -0.0545 -0.0194 -0.0633 163 ASN A CG  
607  O OD1 . ASN A 80  ? 0.5226 0.5081 0.6214 -0.0524 -0.0158 -0.0533 163 ASN A OD1 
608  N ND2 . ASN A 80  ? 0.5366 0.5219 0.6841 -0.0575 -0.0212 -0.0693 163 ASN A ND2 
609  N N   . THR A 81  ? 0.5039 0.4975 0.5126 -0.0501 -0.0336 -0.0650 164 THR A N   
610  C CA  . THR A 81  ? 0.5318 0.5374 0.5255 -0.0516 -0.0460 -0.0644 164 THR A CA  
611  C C   . THR A 81  ? 0.5585 0.5645 0.5414 -0.0485 -0.0464 -0.0498 164 THR A C   
612  O O   . THR A 81  ? 0.6263 0.6430 0.5996 -0.0499 -0.0569 -0.0446 164 THR A O   
613  C CB  . THR A 81  ? 0.5269 0.5425 0.4986 -0.0549 -0.0515 -0.0759 164 THR A CB  
614  O OG1 . THR A 81  ? 0.5666 0.5746 0.5258 -0.0529 -0.0411 -0.0780 164 THR A OG1 
615  C CG2 . THR A 81  ? 0.5160 0.5389 0.5036 -0.0596 -0.0570 -0.0947 164 THR A CG2 
616  N N   . PHE A 82  ? 0.5131 0.5102 0.4998 -0.0450 -0.0357 -0.0431 165 PHE A N   
617  C CA  . PHE A 82  ? 0.5436 0.5412 0.5281 -0.0421 -0.0348 -0.0333 165 PHE A CA  
618  C C   . PHE A 82  ? 0.5593 0.5620 0.5695 -0.0425 -0.0404 -0.0295 165 PHE A C   
619  O O   . PHE A 82  ? 0.5372 0.5392 0.5676 -0.0437 -0.0378 -0.0333 165 PHE A O   
620  C CB  . PHE A 82  ? 0.5596 0.5498 0.5410 -0.0391 -0.0219 -0.0315 165 PHE A CB  
621  C CG  . PHE A 82  ? 0.5466 0.5383 0.5309 -0.0363 -0.0195 -0.0263 165 PHE A CG  
622  C CD1 . PHE A 82  ? 0.5460 0.5396 0.5479 -0.0355 -0.0121 -0.0276 165 PHE A CD1 
623  C CD2 . PHE A 82  ? 0.5541 0.5467 0.5264 -0.0347 -0.0233 -0.0215 165 PHE A CD2 
624  C CE1 . PHE A 82  ? 0.4986 0.4949 0.5083 -0.0332 -0.0090 -0.0275 165 PHE A CE1 
625  C CE2 . PHE A 82  ? 0.5283 0.5220 0.5111 -0.0321 -0.0208 -0.0183 165 PHE A CE2 
626  C CZ  . PHE A 82  ? 0.5104 0.5059 0.5133 -0.0313 -0.0141 -0.0230 165 PHE A CZ  
627  N N   . ARG A 83  ? 0.5776 0.5858 0.5919 -0.0415 -0.0476 -0.0208 166 ARG A N   
628  C CA  . ARG A 83  ? 0.5203 0.5347 0.5644 -0.0422 -0.0556 -0.0161 166 ARG A CA  
629  C C   . ARG A 83  ? 0.5117 0.5262 0.5707 -0.0391 -0.0535 -0.0084 166 ARG A C   
630  O O   . ARG A 83  ? 0.5776 0.5969 0.6323 -0.0388 -0.0617 0.0026  166 ARG A O   
631  C CB  . ARG A 83  ? 0.5036 0.5299 0.5433 -0.0458 -0.0731 -0.0111 166 ARG A CB  
632  C CG  . ARG A 83  ? 0.5220 0.5519 0.5590 -0.0497 -0.0782 -0.0225 166 ARG A CG  
633  C CD  . ARG A 83  ? 0.5301 0.5566 0.6006 -0.0501 -0.0753 -0.0287 166 ARG A CD  
634  N NE  . ARG A 83  ? 0.6369 0.6535 0.7003 -0.0498 -0.0616 -0.0383 166 ARG A NE  
635  C CZ  . ARG A 83  ? 0.6268 0.6428 0.6982 -0.0525 -0.0618 -0.0487 166 ARG A CZ  
636  N NH1 . ARG A 83  ? 0.6286 0.6537 0.7156 -0.0559 -0.0748 -0.0538 166 ARG A NH1 
637  N NH2 . ARG A 83  ? 0.6209 0.6279 0.6890 -0.0519 -0.0493 -0.0532 166 ARG A NH2 
638  N N   . PRO A 84  ? 0.4828 0.4938 0.5616 -0.0371 -0.0418 -0.0144 167 PRO A N   
639  C CA  . PRO A 84  ? 0.5257 0.5382 0.6271 -0.0344 -0.0395 -0.0114 167 PRO A CA  
640  C C   . PRO A 84  ? 0.5540 0.5733 0.6853 -0.0346 -0.0544 0.0021  167 PRO A C   
641  O O   . PRO A 84  ? 0.6664 0.6869 0.8101 -0.0326 -0.0565 0.0102  167 PRO A O   
642  C CB  . PRO A 84  ? 0.4847 0.4978 0.6080 -0.0340 -0.0256 -0.0239 167 PRO A CB  
643  C CG  . PRO A 84  ? 0.4461 0.4559 0.5438 -0.0358 -0.0172 -0.0297 167 PRO A CG  
644  C CD  . PRO A 84  ? 0.4750 0.4826 0.5547 -0.0377 -0.0287 -0.0244 167 PRO A CD  
645  N N   . ASP A 85  ? 0.5789 0.6038 0.7240 -0.0372 -0.0657 0.0062  168 ASP A N   
646  C CA  . ASP A 85  ? 0.5927 0.6272 0.7620 -0.0383 -0.0832 0.0232  168 ASP A CA  
647  C C   . ASP A 85  ? 0.5779 0.6195 0.7207 -0.0396 -0.0945 0.0402  168 ASP A C   
648  O O   . ASP A 85  ? 0.5389 0.5874 0.7072 -0.0393 -0.1043 0.0582  168 ASP A O   
649  C CB  . ASP A 85  ? 0.6402 0.6815 0.8278 -0.0413 -0.0947 0.0236  168 ASP A CB  
650  C CG  . ASP A 85  ? 0.8086 0.8542 1.0546 -0.0403 -0.1006 0.0304  168 ASP A CG  
651  O OD1 . ASP A 85  ? 0.9056 0.9602 1.1733 -0.0429 -0.1163 0.0383  168 ASP A OD1 
652  O OD2 . ASP A 85  ? 0.8496 0.8906 1.1236 -0.0371 -0.0896 0.0266  168 ASP A OD2 
653  N N   . ARG A 86  ? 0.5530 0.5945 0.6488 -0.0414 -0.0927 0.0359  169 ARG A N   
654  C CA  . ARG A 86  ? 0.5677 0.6176 0.6410 -0.0427 -0.0996 0.0514  169 ARG A CA  
655  C C   . ARG A 86  ? 0.5880 0.6316 0.6792 -0.0387 -0.0919 0.0584  169 ARG A C   
656  O O   . ARG A 86  ? 0.6200 0.6722 0.7191 -0.0394 -0.1002 0.0788  169 ARG A O   
657  C CB  . ARG A 86  ? 0.5986 0.6493 0.6228 -0.0450 -0.0952 0.0422  169 ARG A CB  
658  C CG  . ARG A 86  ? 0.7023 0.7641 0.7088 -0.0501 -0.1053 0.0351  169 ARG A CG  
659  C CD  . ARG A 86  ? 0.7670 0.8503 0.7789 -0.0547 -0.1258 0.0532  169 ARG A CD  
660  N NE  . ARG A 86  ? 0.8479 0.9430 0.8552 -0.0555 -0.1322 0.0777  169 ARG A NE  
661  C CZ  . ARG A 86  ? 0.7639 0.8638 0.7375 -0.0568 -0.1264 0.0817  169 ARG A CZ  
662  N NH1 . ARG A 86  ? 0.7538 0.8463 0.6953 -0.0568 -0.1136 0.0611  169 ARG A NH1 
663  N NH2 . ARG A 86  ? 0.6956 0.8078 0.6731 -0.0580 -0.1330 0.1078  169 ARG A NH2 
664  N N   . LEU A 87  ? 0.5971 0.6278 0.6958 -0.0350 -0.0763 0.0423  170 LEU A N   
665  C CA  . LEU A 87  ? 0.6282 0.6543 0.7399 -0.0317 -0.0689 0.0451  170 LEU A CA  
666  C C   . LEU A 87  ? 0.6914 0.7223 0.8576 -0.0304 -0.0761 0.0581  170 LEU A C   
667  O O   . LEU A 87  ? 0.7495 0.7816 0.9339 -0.0289 -0.0772 0.0707  170 LEU A O   
668  C CB  . LEU A 87  ? 0.5923 0.6081 0.6995 -0.0287 -0.0521 0.0244  170 LEU A CB  
669  C CG  . LEU A 87  ? 0.5765 0.5865 0.6396 -0.0295 -0.0440 0.0124  170 LEU A CG  
670  C CD1 . LEU A 87  ? 0.5176 0.5218 0.5789 -0.0268 -0.0303 -0.0015 170 LEU A CD1 
671  C CD2 . LEU A 87  ? 0.5896 0.6017 0.6163 -0.0313 -0.0487 0.0206  170 LEU A CD2 
672  N N   . ARG A 88  ? 0.7012 0.7349 0.8995 -0.0311 -0.0810 0.0557  171 ARG A N   
673  C CA  . ARG A 88  ? 0.6690 0.7071 0.9281 -0.0299 -0.0878 0.0672  171 ARG A CA  
674  C C   . ARG A 88  ? 0.6884 0.7379 0.9516 -0.0320 -0.1049 0.0991  171 ARG A C   
675  O O   . ARG A 88  ? 0.6595 0.7100 0.9604 -0.0301 -0.1062 0.1131  171 ARG A O   
676  C CB  . ARG A 88  ? 0.7068 0.7461 1.0025 -0.0303 -0.0888 0.0576  171 ARG A CB  
677  C CG  . ARG A 88  ? 0.7119 0.7439 1.0215 -0.0279 -0.0684 0.0290  171 ARG A CG  
678  C CD  . ARG A 88  ? 0.7174 0.7525 1.0762 -0.0283 -0.0663 0.0188  171 ARG A CD  
679  N NE  . ARG A 88  ? 0.8100 0.8430 1.1352 -0.0303 -0.0587 0.0047  171 ARG A NE  
680  C CZ  . ARG A 88  ? 0.8082 0.8406 1.1374 -0.0304 -0.0407 -0.0175 171 ARG A CZ  
681  N NH1 . ARG A 88  ? 0.8089 0.8443 1.1753 -0.0288 -0.0279 -0.0332 171 ARG A NH1 
682  N NH2 . ARG A 88  ? 0.7888 0.8198 1.0873 -0.0326 -0.0354 -0.0244 171 ARG A NH2 
683  N N   . ASP A 89  ? 0.6578 0.7175 0.8807 -0.0363 -0.1167 0.1102  172 ASP A N   
684  C CA  . ASP A 89  ? 0.6829 0.7596 0.9033 -0.0398 -0.1336 0.1425  172 ASP A CA  
685  C C   . ASP A 89  ? 0.6942 0.7707 0.8960 -0.0392 -0.1271 0.1535  172 ASP A C   
686  O O   . ASP A 89  ? 0.6992 0.7837 0.9327 -0.0394 -0.1345 0.1806  172 ASP A O   
687  C CB  . ASP A 89  ? 0.8256 0.9170 1.0008 -0.0456 -0.1462 0.1454  172 ASP A CB  
688  C CG  . ASP A 89  ? 0.8866 0.9756 1.0760 -0.0461 -0.1498 0.1284  172 ASP A CG  
689  O OD1 . ASP A 89  ? 0.8094 0.9031 0.9581 -0.0497 -0.1522 0.1155  172 ASP A OD1 
690  O OD2 . ASP A 89  ? 0.8708 0.9541 1.1165 -0.0433 -0.1499 0.1274  172 ASP A OD2 
691  N N   . ILE A 90  ? 0.6594 0.7263 0.8149 -0.0382 -0.1127 0.1332  173 ILE A N   
692  C CA  . ILE A 90  ? 0.5885 0.6527 0.7265 -0.0371 -0.1038 0.1379  173 ILE A CA  
693  C C   . ILE A 90  ? 0.6378 0.6923 0.8308 -0.0322 -0.0969 0.1386  173 ILE A C   
694  O O   . ILE A 90  ? 0.6722 0.7306 0.8795 -0.0320 -0.0974 0.1580  173 ILE A O   
695  C CB  . ILE A 90  ? 0.5705 0.6244 0.6579 -0.0365 -0.0898 0.1123  173 ILE A CB  
696  C CG1 . ILE A 90  ? 0.5616 0.6271 0.6013 -0.0418 -0.0964 0.1100  173 ILE A CG1 
697  C CG2 . ILE A 90  ? 0.5190 0.5683 0.5941 -0.0347 -0.0795 0.1141  173 ILE A CG2 
698  C CD1 . ILE A 90  ? 0.4913 0.5462 0.4953 -0.0413 -0.0850 0.0830  173 ILE A CD1 
699  N N   . ALA A 91  ? 0.6219 0.6656 0.8478 -0.0288 -0.0897 0.1166  174 ALA A N   
700  C CA  . ALA A 91  ? 0.6223 0.6592 0.9053 -0.0246 -0.0824 0.1103  174 ALA A CA  
701  C C   . ALA A 91  ? 0.6163 0.6620 0.9616 -0.0248 -0.0951 0.1398  174 ALA A C   
702  O O   . ALA A 91  ? 0.6305 0.6743 1.0179 -0.0225 -0.0920 0.1465  174 ALA A O   
703  C CB  . ALA A 91  ? 0.5669 0.5963 0.8719 -0.0223 -0.0720 0.0799  174 ALA A CB  
704  N N   . ASP A 92  ? 0.6654 0.7218 1.0196 -0.0279 -0.1104 0.1581  175 ASP A N   
705  C CA  . ASP A 92  ? 0.6928 0.7608 1.1042 -0.0291 -0.1259 0.1925  175 ASP A CA  
706  C C   . ASP A 92  ? 0.6427 0.7209 1.0364 -0.0315 -0.1307 0.2240  175 ASP A C   
707  O O   . ASP A 92  ? 0.6999 0.7793 1.1505 -0.0300 -0.1324 0.2436  175 ASP A O   
708  C CB  . ASP A 92  ? 0.7452 0.8249 1.1656 -0.0324 -0.1433 0.2056  175 ASP A CB  
709  C CG  . ASP A 92  ? 0.7970 0.8670 1.2569 -0.0296 -0.1371 0.1769  175 ASP A CG  
710  O OD1 . ASP A 92  ? 0.8874 0.9456 1.3814 -0.0255 -0.1213 0.1522  175 ASP A OD1 
711  O OD2 . ASP A 92  ? 0.7510 0.8270 1.2092 -0.0319 -0.1471 0.1774  175 ASP A OD2 
712  N N   . ARG A 93  ? 0.5804 0.6664 0.8998 -0.0355 -0.1314 0.2274  176 ARG A N   
713  C CA  . ARG A 93  ? 0.5866 0.6849 0.8856 -0.0386 -0.1334 0.2558  176 ARG A CA  
714  C C   . ARG A 93  ? 0.5909 0.6755 0.9177 -0.0340 -0.1185 0.2485  176 ARG A C   
715  O O   . ARG A 93  ? 0.6105 0.7031 0.9666 -0.0350 -0.1215 0.2783  176 ARG A O   
716  C CB  . ARG A 93  ? 0.6095 0.7184 0.8243 -0.0436 -0.1323 0.2513  176 ARG A CB  
717  C CG  . ARG A 93  ? 0.6177 0.7409 0.8030 -0.0475 -0.1298 0.2754  176 ARG A CG  
718  C CD  . ARG A 93  ? 0.6412 0.7544 0.7673 -0.0468 -0.1131 0.2453  176 ARG A CD  
719  N NE  . ARG A 93  ? 0.6639 0.7913 0.7529 -0.0510 -0.1077 0.2611  176 ARG A NE  
720  C CZ  . ARG A 93  ? 0.6289 0.7593 0.6571 -0.0537 -0.0984 0.2420  176 ARG A CZ  
721  N NH1 . ARG A 93  ? 0.6232 0.7429 0.6237 -0.0526 -0.0953 0.2093  176 ARG A NH1 
722  N NH2 . ARG A 93  ? 0.6083 0.7536 0.6074 -0.0579 -0.0919 0.2560  176 ARG A NH2 
723  N N   . PHE A 94  ? 0.5512 0.6170 0.8727 -0.0294 -0.1032 0.2107  177 PHE A N   
724  C CA  . PHE A 94  ? 0.5415 0.5966 0.8913 -0.0255 -0.0909 0.2015  177 PHE A CA  
725  C C   . PHE A 94  ? 0.5497 0.5970 0.9824 -0.0211 -0.0886 0.1915  177 PHE A C   
726  O O   . PHE A 94  ? 0.5766 0.6161 1.0380 -0.0179 -0.0786 0.1793  177 PHE A O   
727  C CB  . PHE A 94  ? 0.5144 0.5574 0.8119 -0.0236 -0.0760 0.1687  177 PHE A CB  
728  C CG  . PHE A 94  ? 0.5533 0.6031 0.7829 -0.0273 -0.0745 0.1772  177 PHE A CG  
729  C CD1 . PHE A 94  ? 0.5314 0.5828 0.7016 -0.0299 -0.0750 0.1632  177 PHE A CD1 
730  C CD2 . PHE A 94  ? 0.5311 0.5864 0.7595 -0.0284 -0.0714 0.1972  177 PHE A CD2 
731  C CE1 . PHE A 94  ? 0.5146 0.5735 0.6274 -0.0336 -0.0721 0.1664  177 PHE A CE1 
732  C CE2 . PHE A 94  ? 0.5362 0.5994 0.7029 -0.0323 -0.0675 0.2013  177 PHE A CE2 
733  C CZ  . PHE A 94  ? 0.5646 0.6301 0.6744 -0.0349 -0.0680 0.1849  177 PHE A CZ  
734  N N   . ASN A 95  ? 0.5784 0.6290 1.0539 -0.0212 -0.0976 0.1947  178 ASN A N   
735  C CA  . ASN A 95  ? 0.5736 0.6200 1.1408 -0.0177 -0.0962 0.1878  178 ASN A CA  
736  C C   . ASN A 95  ? 0.5325 0.5670 1.1088 -0.0139 -0.0793 0.1410  178 ASN A C   
737  O O   . ASN A 95  ? 0.5294 0.5601 1.1618 -0.0110 -0.0721 0.1285  178 ASN A O   
738  C CB  . ASN A 95  ? 0.5607 0.6117 1.1858 -0.0173 -0.1005 0.2193  178 ASN A CB  
739  C CG  . ASN A 95  ? 0.6368 0.7041 1.2824 -0.0214 -0.1199 0.2683  178 ASN A CG  
740  O OD1 . ASN A 95  ? 0.6657 0.7383 1.3383 -0.0223 -0.1312 0.2749  178 ASN A OD1 
741  N ND2 . ASN A 95  ? 0.6631 0.7406 1.2946 -0.0243 -0.1241 0.3037  178 ASN A ND2 
742  N N   . VAL A 96  ? 0.5236 0.5549 1.0466 -0.0145 -0.0737 0.1158  179 VAL A N   
743  C CA  . VAL A 96  ? 0.5344 0.5589 1.0463 -0.0123 -0.0577 0.0739  179 VAL A CA  
744  C C   . VAL A 96  ? 0.5335 0.5593 1.0460 -0.0131 -0.0549 0.0529  179 VAL A C   
745  O O   . VAL A 96  ? 0.5676 0.5963 1.0565 -0.0154 -0.0642 0.0673  179 VAL A O   
746  C CB  . VAL A 96  ? 0.5545 0.5743 0.9892 -0.0127 -0.0509 0.0673  179 VAL A CB  
747  C CG1 . VAL A 96  ? 0.5113 0.5277 0.9000 -0.0128 -0.0399 0.0348  179 VAL A CG1 
748  C CG2 . VAL A 96  ? 0.5139 0.5310 0.9725 -0.0106 -0.0457 0.0671  179 VAL A CG2 
749  N N   . ASP A 97  ? 0.5695 0.5952 1.1118 -0.0116 -0.0417 0.0179  180 ASP A N   
750  C CA  . ASP A 97  ? 0.5522 0.5812 1.1025 -0.0126 -0.0356 -0.0040 180 ASP A CA  
751  C C   . ASP A 97  ? 0.5838 0.6107 1.0518 -0.0148 -0.0330 -0.0082 180 ASP A C   
752  O O   . ASP A 97  ? 0.5979 0.6214 1.0092 -0.0148 -0.0267 -0.0158 180 ASP A O   
753  C CB  . ASP A 97  ? 0.6191 0.6527 1.2113 -0.0115 -0.0196 -0.0430 180 ASP A CB  
754  C CG  . ASP A 97  ? 0.7578 0.7982 1.3560 -0.0133 -0.0089 -0.0702 180 ASP A CG  
755  O OD1 . ASP A 97  ? 0.9188 0.9658 1.4992 -0.0142 0.0066  -0.1033 180 ASP A OD1 
756  O OD2 . ASP A 97  ? 0.7720 0.8135 1.3937 -0.0142 -0.0152 -0.0595 180 ASP A OD2 
757  N N   . HIS A 98  ? 0.6110 0.6400 1.0779 -0.0167 -0.0387 -0.0020 181 HIS A N   
758  C CA  . HIS A 98  ? 0.6069 0.6341 1.0078 -0.0190 -0.0373 -0.0048 181 HIS A CA  
759  C C   . HIS A 98  ? 0.6369 0.6651 1.0115 -0.0193 -0.0197 -0.0352 181 HIS A C   
760  O O   . HIS A 98  ? 0.7068 0.7316 1.0204 -0.0202 -0.0161 -0.0369 181 HIS A O   
761  C CB  . HIS A 98  ? 0.6340 0.6646 1.0516 -0.0210 -0.0457 0.0031  181 HIS A CB  
762  C CG  . HIS A 98  ? 0.7931 0.8276 1.2501 -0.0213 -0.0648 0.0338  181 HIS A CG  
763  N ND1 . HIS A 98  ? 0.9123 0.9479 1.4090 -0.0196 -0.0706 0.0500  181 HIS A ND1 
764  C CD2 . HIS A 98  ? 0.7898 0.8298 1.2566 -0.0235 -0.0805 0.0526  181 HIS A CD2 
765  C CE1 . HIS A 98  ? 0.9584 1.0007 1.4861 -0.0209 -0.0892 0.0807  181 HIS A CE1 
766  N NE2 . HIS A 98  ? 0.8638 0.9093 1.3705 -0.0235 -0.0959 0.0816  181 HIS A NE2 
767  N N   . ASP A 99  ? 0.5835 0.6186 1.0050 -0.0192 -0.0086 -0.0591 182 ASP A N   
768  C CA  . ASP A 99  ? 0.5734 0.6155 0.9701 -0.0209 0.0089  -0.0881 182 ASP A CA  
769  C C   . ASP A 99  ? 0.6076 0.6490 0.9655 -0.0200 0.0140  -0.0958 182 ASP A C   
770  O O   . ASP A 99  ? 0.6767 0.7187 0.9779 -0.0216 0.0196  -0.1000 182 ASP A O   
771  C CB  . ASP A 99  ? 0.6058 0.6596 1.0632 -0.0216 0.0212  -0.1152 182 ASP A CB  
772  C CG  . ASP A 99  ? 0.7389 0.7950 1.2284 -0.0232 0.0197  -0.1121 182 ASP A CG  
773  O OD1 . ASP A 99  ? 0.7659 0.8319 1.3146 -0.0239 0.0297  -0.1337 182 ASP A OD1 
774  O OD2 . ASP A 99  ? 0.6639 0.7132 1.1236 -0.0240 0.0089  -0.0903 182 ASP A OD2 
775  N N   . ALA A 100 ? 0.5262 0.5663 0.9179 -0.0176 0.0109  -0.0954 183 ALA A N   
776  C CA  . ALA A 100 ? 0.5162 0.5563 0.8782 -0.0167 0.0149  -0.1038 183 ALA A CA  
777  C C   . ALA A 100 ? 0.5229 0.5537 0.8158 -0.0168 0.0090  -0.0839 183 ALA A C   
778  O O   . ALA A 100 ? 0.5120 0.5453 0.7608 -0.0176 0.0155  -0.0946 183 ALA A O   
779  C CB  . ALA A 100 ? 0.5098 0.5481 0.9251 -0.0139 0.0106  -0.1014 183 ALA A CB  
780  N N   . VAL A 101 ? 0.4621 0.4847 0.7489 -0.0165 -0.0035 -0.0559 184 VAL A N   
781  C CA  . VAL A 101 ? 0.4745 0.4900 0.7046 -0.0170 -0.0090 -0.0390 184 VAL A CA  
782  C C   . VAL A 101 ? 0.4686 0.4847 0.6540 -0.0193 -0.0031 -0.0475 184 VAL A C   
783  O O   . VAL A 101 ? 0.5164 0.5297 0.6583 -0.0196 0.0002  -0.0491 184 VAL A O   
784  C CB  . VAL A 101 ? 0.5423 0.5552 0.7773 -0.0177 -0.0233 -0.0104 184 VAL A CB  
785  C CG1 . VAL A 101 ? 0.5167 0.5257 0.6920 -0.0195 -0.0272 0.0005  184 VAL A CG1 
786  C CG2 . VAL A 101 ? 0.4999 0.5126 0.7676 -0.0160 -0.0293 0.0056  184 VAL A CG2 
787  N N   . LEU A 102 ? 0.4901 0.5099 0.6917 -0.0209 -0.0018 -0.0516 185 LEU A N   
788  C CA  . LEU A 102 ? 0.5128 0.5342 0.6817 -0.0235 0.0043  -0.0575 185 LEU A CA  
789  C C   . LEU A 102 ? 0.5266 0.5569 0.6804 -0.0245 0.0187  -0.0783 185 LEU A C   
790  O O   . LEU A 102 ? 0.5001 0.5316 0.6172 -0.0265 0.0237  -0.0786 185 LEU A O   
791  C CB  . LEU A 102 ? 0.4803 0.5051 0.6811 -0.0250 0.0028  -0.0575 185 LEU A CB  
792  C CG  . LEU A 102 ? 0.5105 0.5311 0.7024 -0.0266 -0.0081 -0.0419 185 LEU A CG  
793  C CD1 . LEU A 102 ? 0.5712 0.5869 0.7466 -0.0262 -0.0231 -0.0211 185 LEU A CD1 
794  C CD2 . LEU A 102 ? 0.5352 0.5614 0.7796 -0.0273 -0.0095 -0.0448 185 LEU A CD2 
795  N N   . ASP A 103 ? 0.5067 0.5454 0.6911 -0.0237 0.0248  -0.0954 186 ASP A N   
796  C CA  . ASP A 103 ? 0.5520 0.6036 0.7173 -0.0255 0.0368  -0.1156 186 ASP A CA  
797  C C   . ASP A 103 ? 0.5385 0.5864 0.6638 -0.0245 0.0341  -0.1105 186 ASP A C   
798  O O   . ASP A 103 ? 0.5474 0.6067 0.6454 -0.0267 0.0412  -0.1210 186 ASP A O   
799  C CB  . ASP A 103 ? 0.6786 0.7431 0.8899 -0.0255 0.0441  -0.1401 186 ASP A CB  
800  C CG  . ASP A 103 ? 0.8070 0.8899 1.0263 -0.0295 0.0585  -0.1619 186 ASP A CG  
801  O OD1 . ASP A 103 ? 1.0038 1.1019 1.1885 -0.0326 0.0673  -0.1747 186 ASP A OD1 
802  O OD2 . ASP A 103 ? 0.7856 0.8698 1.0455 -0.0300 0.0608  -0.1652 186 ASP A OD2 
803  N N   . ASN A 104 ? 0.4819 0.5164 0.6062 -0.0216 0.0238  -0.0943 187 ASN A N   
804  C CA  . ASN A 104 ? 0.4573 0.4885 0.5522 -0.0203 0.0219  -0.0914 187 ASN A CA  
805  C C   . ASN A 104 ? 0.4443 0.4655 0.4957 -0.0207 0.0177  -0.0741 187 ASN A C   
806  O O   . ASN A 104 ? 0.4268 0.4428 0.4579 -0.0194 0.0150  -0.0688 187 ASN A O   
807  C CB  . ASN A 104 ? 0.4404 0.4664 0.5638 -0.0172 0.0165  -0.0885 187 ASN A CB  
808  C CG  . ASN A 104 ? 0.4366 0.4734 0.6067 -0.0169 0.0216  -0.1102 187 ASN A CG  
809  O OD1 . ASN A 104 ? 0.4730 0.5245 0.6398 -0.0189 0.0300  -0.1329 187 ASN A OD1 
810  N ND2 . ASN A 104 ? 0.4305 0.4622 0.6471 -0.0147 0.0165  -0.1033 187 ASN A ND2 
811  N N   . VAL A 105 ? 0.4178 0.4372 0.4599 -0.0227 0.0178  -0.0675 188 VAL A N   
812  C CA  . VAL A 105 ? 0.4373 0.4484 0.4465 -0.0234 0.0146  -0.0549 188 VAL A CA  
813  C C   . VAL A 105 ? 0.4698 0.4881 0.4633 -0.0264 0.0219  -0.0583 188 VAL A C   
814  O O   . VAL A 105 ? 0.4564 0.4798 0.4658 -0.0283 0.0255  -0.0618 188 VAL A O   
815  C CB  . VAL A 105 ? 0.4148 0.4181 0.4295 -0.0237 0.0063  -0.0423 188 VAL A CB  
816  C CG1 . VAL A 105 ? 0.3753 0.3722 0.3609 -0.0251 0.0044  -0.0349 188 VAL A CG1 
817  C CG2 . VAL A 105 ? 0.3879 0.3877 0.4177 -0.0217 -0.0011 -0.0341 188 VAL A CG2 
818  N N   . LEU A 106 ? 0.4845 0.5045 0.4513 -0.0270 0.0240  -0.0557 189 LEU A N   
819  C CA  . LEU A 106 ? 0.5242 0.5512 0.4749 -0.0303 0.0298  -0.0516 189 LEU A CA  
820  C C   . LEU A 106 ? 0.5527 0.5672 0.4958 -0.0306 0.0255  -0.0385 189 LEU A C   
821  O O   . LEU A 106 ? 0.5377 0.5413 0.4725 -0.0286 0.0195  -0.0331 189 LEU A O   
822  C CB  . LEU A 106 ? 0.5901 0.6283 0.5199 -0.0314 0.0326  -0.0520 189 LEU A CB  
823  C CG  . LEU A 106 ? 0.6395 0.7003 0.5668 -0.0343 0.0404  -0.0652 189 LEU A CG  
824  C CD1 . LEU A 106 ? 0.7096 0.7817 0.6470 -0.0380 0.0498  -0.0694 189 LEU A CD1 
825  C CD2 . LEU A 106 ? 0.7298 0.7914 0.6768 -0.0316 0.0387  -0.0815 189 LEU A CD2 
826  N N   . TYR A 107 ? 0.5082 0.5257 0.4573 -0.0334 0.0296  -0.0353 190 TYR A N   
827  C CA  . TYR A 107 ? 0.4973 0.5038 0.4497 -0.0341 0.0252  -0.0274 190 TYR A CA  
828  C C   . TYR A 107 ? 0.5070 0.5183 0.4579 -0.0372 0.0312  -0.0189 190 TYR A C   
829  O O   . TYR A 107 ? 0.4516 0.4770 0.4049 -0.0400 0.0399  -0.0194 190 TYR A O   
830  C CB  . TYR A 107 ? 0.5062 0.5108 0.4794 -0.0345 0.0220  -0.0313 190 TYR A CB  
831  C CG  . TYR A 107 ? 0.4977 0.4947 0.4775 -0.0360 0.0170  -0.0270 190 TYR A CG  
832  C CD1 . TYR A 107 ? 0.4922 0.4811 0.4654 -0.0351 0.0081  -0.0266 190 TYR A CD1 
833  C CD2 . TYR A 107 ? 0.5615 0.5618 0.5562 -0.0389 0.0217  -0.0251 190 TYR A CD2 
834  C CE1 . TYR A 107 ? 0.4980 0.4832 0.4787 -0.0371 0.0030  -0.0275 190 TYR A CE1 
835  C CE2 . TYR A 107 ? 0.5518 0.5458 0.5583 -0.0405 0.0163  -0.0242 190 TYR A CE2 
836  C CZ  . TYR A 107 ? 0.5440 0.5309 0.5428 -0.0396 0.0065  -0.0269 190 TYR A CZ  
837  O OH  . TYR A 107 ? 0.5490 0.5329 0.5594 -0.0417 0.0008  -0.0305 190 TYR A OH  
838  N N   . ALA A 108 ? 0.4734 0.4747 0.4237 -0.0372 0.0273  -0.0113 191 ALA A N   
839  C CA  . ALA A 108 ? 0.4535 0.4561 0.4137 -0.0401 0.0313  -0.0002 191 ALA A CA  
840  C C   . ALA A 108 ? 0.4513 0.4407 0.4262 -0.0400 0.0255  -0.0012 191 ALA A C   
841  O O   . ALA A 108 ? 0.4561 0.4370 0.4245 -0.0378 0.0194  -0.0067 191 ALA A O   
842  C CB  . ALA A 108 ? 0.4125 0.4222 0.3617 -0.0410 0.0341  0.0124  191 ALA A CB  
843  N N   . ARG A 109 ? 0.4338 0.4238 0.4299 -0.0428 0.0284  0.0031  192 ARG A N   
844  C CA  . ARG A 109 ? 0.4368 0.4176 0.4549 -0.0438 0.0247  0.0016  192 ARG A CA  
845  C C   . ARG A 109 ? 0.4412 0.4206 0.4679 -0.0444 0.0275  0.0154  192 ARG A C   
846  O O   . ARG A 109 ? 0.4819 0.4713 0.5056 -0.0460 0.0337  0.0308  192 ARG A O   
847  C CB  . ARG A 109 ? 0.4271 0.4107 0.4712 -0.0468 0.0272  0.0013  192 ARG A CB  
848  C CG  . ARG A 109 ? 0.3938 0.3773 0.4401 -0.0465 0.0209  -0.0120 192 ARG A CG  
849  C CD  . ARG A 109 ? 0.4187 0.3949 0.4692 -0.0464 0.0104  -0.0244 192 ARG A CD  
850  N NE  . ARG A 109 ? 0.4037 0.3779 0.4869 -0.0493 0.0085  -0.0294 192 ARG A NE  
851  C CZ  . ARG A 109 ? 0.3946 0.3633 0.4945 -0.0503 0.0078  -0.0333 192 ARG A CZ  
852  N NH1 . ARG A 109 ? 0.3831 0.3478 0.4684 -0.0484 0.0087  -0.0324 192 ARG A NH1 
853  N NH2 . ARG A 109 ? 0.3774 0.3451 0.5127 -0.0530 0.0061  -0.0400 192 ARG A NH2 
854  N N   . ALA A 110 ? 0.4549 0.4244 0.4941 -0.0435 0.0231  0.0101  193 ALA A N   
855  C CA  . ALA A 110 ? 0.4494 0.4160 0.5124 -0.0443 0.0249  0.0232  193 ALA A CA  
856  C C   . ALA A 110 ? 0.4660 0.4267 0.5700 -0.0466 0.0245  0.0177  193 ALA A C   
857  O O   . ALA A 110 ? 0.5082 0.4642 0.6163 -0.0466 0.0199  -0.0027 193 ALA A O   
858  C CB  . ALA A 110 ? 0.4222 0.3828 0.4768 -0.0415 0.0215  0.0195  193 ALA A CB  
859  N N   . TYR A 111 ? 0.4983 0.4615 0.6339 -0.0490 0.0291  0.0362  194 TYR A N   
860  C CA  . TYR A 111 ? 0.4642 0.4228 0.6483 -0.0517 0.0297  0.0325  194 TYR A CA  
861  C C   . TYR A 111 ? 0.4845 0.4356 0.7130 -0.0519 0.0292  0.0372  194 TYR A C   
862  O O   . TYR A 111 ? 0.5200 0.4658 0.7951 -0.0538 0.0287  0.0270  194 TYR A O   
863  C CB  . TYR A 111 ? 0.4171 0.3844 0.6160 -0.0549 0.0365  0.0498  194 TYR A CB  
864  C CG  . TYR A 111 ? 0.4503 0.4246 0.6191 -0.0551 0.0379  0.0413  194 TYR A CG  
865  C CD1 . TYR A 111 ? 0.4496 0.4367 0.5849 -0.0554 0.0440  0.0540  194 TYR A CD1 
866  C CD2 . TYR A 111 ? 0.4354 0.4061 0.6123 -0.0554 0.0329  0.0199  194 TYR A CD2 
867  C CE1 . TYR A 111 ? 0.4307 0.4246 0.5466 -0.0556 0.0464  0.0446  194 TYR A CE1 
868  C CE2 . TYR A 111 ? 0.4367 0.4141 0.5935 -0.0554 0.0336  0.0143  194 TYR A CE2 
869  C CZ  . TYR A 111 ? 0.4747 0.4628 0.6037 -0.0553 0.0412  0.0263  194 TYR A CZ  
870  O OH  . TYR A 111 ? 0.4742 0.4697 0.5899 -0.0554 0.0434  0.0191  194 TYR A OH  
871  N N   . THR A 112 ? 0.4469 0.3982 0.6668 -0.0501 0.0288  0.0513  195 THR A N   
872  C CA  . THR A 112 ? 0.4946 0.4386 0.7606 -0.0498 0.0276  0.0555  195 THR A CA  
873  C C   . THR A 112 ? 0.5291 0.4710 0.7695 -0.0465 0.0245  0.0534  195 THR A C   
874  O O   . THR A 112 ? 0.5020 0.4494 0.6907 -0.0448 0.0234  0.0538  195 THR A O   
875  C CB  . THR A 112 ? 0.4944 0.4434 0.8037 -0.0524 0.0307  0.0913  195 THR A CB  
876  O OG1 . THR A 112 ? 0.5195 0.4802 0.7942 -0.0521 0.0304  0.1183  195 THR A OG1 
877  C CG2 . THR A 112 ? 0.4252 0.3790 0.7604 -0.0561 0.0358  0.1008  195 THR A CG2 
878  N N   . SER A 113 ? 0.5935 0.5278 0.8768 -0.0458 0.0234  0.0506  196 SER A N   
879  C CA  . SER A 113 ? 0.5854 0.5167 0.8602 -0.0428 0.0209  0.0500  196 SER A CA  
880  C C   . SER A 113 ? 0.5800 0.5210 0.8294 -0.0423 0.0187  0.0815  196 SER A C   
881  O O   . SER A 113 ? 0.5265 0.4703 0.7341 -0.0400 0.0164  0.0784  196 SER A O   
882  C CB  . SER A 113 ? 0.6486 0.5722 0.9915 -0.0430 0.0211  0.0500  196 SER A CB  
883  O OG  . SER A 113 ? 0.7898 0.7070 1.1389 -0.0423 0.0228  0.0131  196 SER A OG  
884  N N   . GLU A 114 ? 0.6370 0.5851 0.9154 -0.0451 0.0192  0.1126  197 GLU A N   
885  C CA  . GLU A 114 ? 0.6177 0.5807 0.8746 -0.0460 0.0164  0.1458  197 GLU A CA  
886  C C   . GLU A 114 ? 0.5998 0.5746 0.7911 -0.0464 0.0182  0.1411  197 GLU A C   
887  O O   . GLU A 114 ? 0.6024 0.5849 0.7557 -0.0449 0.0146  0.1437  197 GLU A O   
888  C CB  . GLU A 114 ? 0.6811 0.6522 0.9840 -0.0499 0.0170  0.1817  197 GLU A CB  
889  C CG  . GLU A 114 ? 0.8814 0.8400 1.2556 -0.0487 0.0139  0.1848  197 GLU A CG  
890  C CD  . GLU A 114 ? 1.0575 1.0270 1.4703 -0.0510 0.0088  0.2303  197 GLU A CD  
891  O OE1 . GLU A 114 ? 1.1027 1.0848 1.5301 -0.0554 0.0116  0.2607  197 GLU A OE1 
892  O OE2 . GLU A 114 ? 1.0120 0.9786 1.4445 -0.0486 0.0020  0.2367  197 GLU A OE2 
893  N N   . HIS A 115 ? 0.5430 0.5180 0.7254 -0.0480 0.0236  0.1291  198 HIS A N   
894  C CA  . HIS A 115 ? 0.5159 0.5013 0.6470 -0.0484 0.0264  0.1220  198 HIS A CA  
895  C C   . HIS A 115 ? 0.5323 0.5128 0.6259 -0.0444 0.0225  0.1003  198 HIS A C   
896  O O   . HIS A 115 ? 0.4994 0.4916 0.5540 -0.0440 0.0218  0.1028  198 HIS A O   
897  C CB  . HIS A 115 ? 0.5079 0.4894 0.6484 -0.0499 0.0312  0.1075  198 HIS A CB  
898  C CG  . HIS A 115 ? 0.5203 0.5137 0.6207 -0.0510 0.0357  0.1026  198 HIS A CG  
899  N ND1 . HIS A 115 ? 0.5652 0.5777 0.6344 -0.0530 0.0385  0.1182  198 HIS A ND1 
900  C CD2 . HIS A 115 ? 0.4956 0.4863 0.5869 -0.0509 0.0378  0.0826  198 HIS A CD2 
901  C CE1 . HIS A 115 ? 0.5280 0.5487 0.5728 -0.0540 0.0439  0.1063  198 HIS A CE1 
902  N NE2 . HIS A 115 ? 0.5419 0.5482 0.6016 -0.0524 0.0428  0.0858  198 HIS A NE2 
903  N N   . GLN A 116 ? 0.5134 0.4783 0.6210 -0.0418 0.0203  0.0780  199 GLN A N   
904  C CA  . GLN A 116 ? 0.4975 0.4579 0.5732 -0.0385 0.0179  0.0576  199 GLN A CA  
905  C C   . GLN A 116 ? 0.5079 0.4742 0.5694 -0.0368 0.0141  0.0713  199 GLN A C   
906  O O   . GLN A 116 ? 0.5053 0.4764 0.5322 -0.0351 0.0127  0.0651  199 GLN A O   
907  C CB  . GLN A 116 ? 0.4686 0.4159 0.5645 -0.0374 0.0175  0.0332  199 GLN A CB  
908  C CG  . GLN A 116 ? 0.4742 0.4183 0.5411 -0.0346 0.0160  0.0161  199 GLN A CG  
909  C CD  . GLN A 116 ? 0.5144 0.4514 0.5953 -0.0348 0.0170  -0.0088 199 GLN A CD  
910  O OE1 . GLN A 116 ? 0.5106 0.4457 0.5805 -0.0331 0.0174  -0.0198 199 GLN A OE1 
911  N NE2 . GLN A 116 ? 0.5175 0.4529 0.6243 -0.0375 0.0179  -0.0188 199 GLN A NE2 
912  N N   . MET A 117 ? 0.5256 0.4929 0.6183 -0.0375 0.0116  0.0912  200 MET A N   
913  C CA  . MET A 117 ? 0.5428 0.5157 0.6276 -0.0359 0.0059  0.1034  200 MET A CA  
914  C C   . MET A 117 ? 0.5658 0.5602 0.6173 -0.0385 0.0043  0.1227  200 MET A C   
915  O O   . MET A 117 ? 0.6065 0.6089 0.6307 -0.0372 0.0000  0.1212  200 MET A O   
916  C CB  . MET A 117 ? 0.5669 0.5334 0.7045 -0.0358 0.0026  0.1180  200 MET A CB  
917  C CG  . MET A 117 ? 0.6144 0.5849 0.7564 -0.0339 -0.0050 0.1312  200 MET A CG  
918  S SD  . MET A 117 ? 0.7568 0.7226 0.8642 -0.0296 -0.0069 0.1074  200 MET A SD  
919  C CE  . MET A 117 ? 0.7686 0.7389 0.9105 -0.0287 -0.0170 0.1324  200 MET A CE  
920  N N   . GLU A 118 ? 0.5767 0.5825 0.6307 -0.0426 0.0085  0.1384  201 GLU A N   
921  C CA  . GLU A 118 ? 0.6038 0.6345 0.6209 -0.0463 0.0100  0.1509  201 GLU A CA  
922  C C   . GLU A 118 ? 0.5871 0.6210 0.5633 -0.0448 0.0132  0.1250  201 GLU A C   
923  O O   . GLU A 118 ? 0.6185 0.6727 0.5635 -0.0468 0.0127  0.1274  201 GLU A O   
924  C CB  . GLU A 118 ? 0.5992 0.6421 0.6270 -0.0514 0.0171  0.1693  201 GLU A CB  
925  C CG  . GLU A 118 ? 0.6964 0.7423 0.7679 -0.0543 0.0149  0.2023  201 GLU A CG  
926  C CD  . GLU A 118 ? 0.8039 0.8539 0.8979 -0.0585 0.0239  0.2140  201 GLU A CD  
927  O OE1 . GLU A 118 ? 0.8222 0.8738 0.9608 -0.0611 0.0230  0.2427  201 GLU A OE1 
928  O OE2 . GLU A 118 ? 0.7914 0.8429 0.8638 -0.0592 0.0318  0.1953  201 GLU A OE2 
929  N N   . LEU A 119 ? 0.5433 0.5597 0.5222 -0.0420 0.0161  0.1009  202 LEU A N   
930  C CA  . LEU A 119 ? 0.5613 0.5790 0.5107 -0.0404 0.0182  0.0785  202 LEU A CA  
931  C C   . LEU A 119 ? 0.5836 0.5999 0.5168 -0.0370 0.0124  0.0694  202 LEU A C   
932  O O   . LEU A 119 ? 0.5631 0.5896 0.4721 -0.0366 0.0129  0.0584  202 LEU A O   
933  C CB  . LEU A 119 ? 0.5766 0.5774 0.5369 -0.0386 0.0205  0.0596  202 LEU A CB  
934  C CG  . LEU A 119 ? 0.5953 0.5982 0.5704 -0.0418 0.0263  0.0626  202 LEU A CG  
935  C CD1 . LEU A 119 ? 0.5686 0.5582 0.5499 -0.0403 0.0257  0.0423  202 LEU A CD1 
936  C CD2 . LEU A 119 ? 0.5368 0.5605 0.4936 -0.0454 0.0327  0.0689  202 LEU A CD2 
937  N N   . LEU A 120 ? 0.5540 0.5581 0.5058 -0.0345 0.0076  0.0728  203 LEU A N   
938  C CA  . LEU A 120 ? 0.5674 0.5701 0.5097 -0.0314 0.0023  0.0663  203 LEU A CA  
939  C C   . LEU A 120 ? 0.5980 0.6219 0.5226 -0.0333 -0.0026 0.0785  203 LEU A C   
940  O O   . LEU A 120 ? 0.5847 0.6143 0.4908 -0.0317 -0.0051 0.0663  203 LEU A O   
941  C CB  . LEU A 120 ? 0.5793 0.5666 0.5501 -0.0290 -0.0005 0.0674  203 LEU A CB  
942  C CG  . LEU A 120 ? 0.6442 0.6155 0.6161 -0.0265 0.0032  0.0446  203 LEU A CG  
943  C CD1 . LEU A 120 ? 0.6216 0.5928 0.5770 -0.0273 0.0075  0.0321  203 LEU A CD1 
944  C CD2 . LEU A 120 ? 0.6706 0.6285 0.6760 -0.0262 0.0050  0.0408  203 LEU A CD2 
945  N N   . ASP A 121 ? 0.6307 0.6690 0.5614 -0.0372 -0.0042 0.1026  204 ASP A N   
946  C CA  . ASP A 121 ? 0.6623 0.7259 0.5744 -0.0402 -0.0106 0.1170  204 ASP A CA  
947  C C   . ASP A 121 ? 0.6582 0.7404 0.5366 -0.0425 -0.0057 0.1016  204 ASP A C   
948  O O   . ASP A 121 ? 0.7216 0.8169 0.5807 -0.0423 -0.0101 0.0911  204 ASP A O   
949  C CB  . ASP A 121 ? 0.7636 0.8414 0.6907 -0.0447 -0.0132 0.1502  204 ASP A CB  
950  C CG  . ASP A 121 ? 0.9077 0.9694 0.8774 -0.0423 -0.0200 0.1663  204 ASP A CG  
951  O OD1 . ASP A 121 ? 0.8990 0.9389 0.8852 -0.0372 -0.0216 0.1494  204 ASP A OD1 
952  O OD2 . ASP A 121 ? 0.9834 1.0562 0.9732 -0.0460 -0.0227 0.1968  204 ASP A OD2 
953  N N   . TYR A 122 ? 0.6470 0.7287 0.5235 -0.0444 0.0039  0.0961  205 TYR A N   
954  C CA  . TYR A 122 ? 0.6644 0.7601 0.5175 -0.0460 0.0105  0.0762  205 TYR A CA  
955  C C   . TYR A 122 ? 0.6617 0.7455 0.5110 -0.0412 0.0090  0.0489  205 TYR A C   
956  O O   . TYR A 122 ? 0.7028 0.8042 0.5354 -0.0423 0.0086  0.0352  205 TYR A O   
957  C CB  . TYR A 122 ? 0.6909 0.7854 0.5505 -0.0485 0.0211  0.0751  205 TYR A CB  
958  C CG  . TYR A 122 ? 0.7689 0.8801 0.6104 -0.0506 0.0288  0.0544  205 TYR A CG  
959  C CD1 . TYR A 122 ? 0.8081 0.9040 0.6565 -0.0467 0.0311  0.0300  205 TYR A CD1 
960  C CD2 . TYR A 122 ? 0.8390 0.9841 0.6581 -0.0568 0.0334  0.0582  205 TYR A CD2 
961  C CE1 . TYR A 122 ? 0.8830 0.9941 0.7239 -0.0484 0.0383  0.0094  205 TYR A CE1 
962  C CE2 . TYR A 122 ? 0.8767 1.0393 0.6836 -0.0590 0.0418  0.0339  205 TYR A CE2 
963  C CZ  . TYR A 122 ? 0.8651 1.0092 0.6866 -0.0545 0.0442  0.0094  205 TYR A CZ  
964  O OH  . TYR A 122 ? 0.9439 1.1049 0.7627 -0.0566 0.0527  -0.0149 205 TYR A OH  
965  N N   . VAL A 123 ? 0.5855 0.6424 0.4519 -0.0365 0.0085  0.0409  206 VAL A N   
966  C CA  . VAL A 123 ? 0.5357 0.5820 0.4021 -0.0324 0.0069  0.0211  206 VAL A CA  
967  C C   . VAL A 123 ? 0.5829 0.6377 0.4432 -0.0312 -0.0009 0.0204  206 VAL A C   
968  O O   . VAL A 123 ? 0.5976 0.6612 0.4510 -0.0305 -0.0014 0.0040  206 VAL A O   
969  C CB  . VAL A 123 ? 0.5186 0.5391 0.4019 -0.0287 0.0066  0.0187  206 VAL A CB  
970  C CG1 . VAL A 123 ? 0.4345 0.4453 0.3195 -0.0248 0.0039  0.0059  206 VAL A CG1 
971  C CG2 . VAL A 123 ? 0.5118 0.5256 0.4008 -0.0297 0.0122  0.0140  206 VAL A CG2 
972  N N   . ALA A 124 ? 0.5563 0.6087 0.4245 -0.0309 -0.0073 0.0376  207 ALA A N   
973  C CA  . ALA A 124 ? 0.5535 0.6133 0.4203 -0.0298 -0.0160 0.0383  207 ALA A CA  
974  C C   . ALA A 124 ? 0.6394 0.7285 0.4836 -0.0335 -0.0179 0.0310  207 ALA A C   
975  O O   . ALA A 124 ? 0.6565 0.7503 0.4987 -0.0318 -0.0209 0.0136  207 ALA A O   
976  C CB  . ALA A 124 ? 0.5101 0.5684 0.3921 -0.0302 -0.0230 0.0617  207 ALA A CB  
977  N N   . ALA A 125 ? 0.6747 0.7857 0.5038 -0.0390 -0.0152 0.0424  208 ALA A N   
978  C CA  . ALA A 125 ? 0.7062 0.8518 0.5106 -0.0440 -0.0167 0.0348  208 ALA A CA  
979  C C   . ALA A 125 ? 0.6978 0.8469 0.4985 -0.0436 -0.0081 0.0037  208 ALA A C   
980  O O   . ALA A 125 ? 0.7260 0.8957 0.5174 -0.0453 -0.0101 -0.0157 208 ALA A O   
981  C CB  . ALA A 125 ? 0.7570 0.9282 0.5456 -0.0509 -0.0147 0.0578  208 ALA A CB  
982  N N   . LYS A 126 ? 0.6802 0.8086 0.4937 -0.0412 0.0005  -0.0024 209 LYS A N   
983  C CA  . LYS A 126 ? 0.7065 0.8351 0.5263 -0.0402 0.0074  -0.0293 209 LYS A CA  
984  C C   . LYS A 126 ? 0.7529 0.8709 0.5870 -0.0354 0.0015  -0.0457 209 LYS A C   
985  O O   . LYS A 126 ? 0.7498 0.8826 0.5875 -0.0362 0.0028  -0.0687 209 LYS A O   
986  C CB  . LYS A 126 ? 0.6566 0.7662 0.4896 -0.0389 0.0155  -0.0280 209 LYS A CB  
987  C CG  . LYS A 126 ? 0.6776 0.7764 0.5290 -0.0359 0.0200  -0.0493 209 LYS A CG  
988  C CD  . LYS A 126 ? 0.7397 0.8626 0.5912 -0.0397 0.0282  -0.0705 209 LYS A CD  
989  C CE  . LYS A 126 ? 0.7106 0.8438 0.5578 -0.0441 0.0383  -0.0661 209 LYS A CE  
990  N NZ  . LYS A 126 ? 0.6819 0.8385 0.5356 -0.0471 0.0468  -0.0938 209 LYS A NZ  
991  N N   . PHE A 127 ? 0.7150 0.8098 0.5602 -0.0309 -0.0043 -0.0347 210 PHE A N   
992  C CA  . PHE A 127 ? 0.6624 0.7473 0.5235 -0.0267 -0.0086 -0.0470 210 PHE A CA  
993  C C   . PHE A 127 ? 0.7119 0.8205 0.5654 -0.0288 -0.0163 -0.0550 210 PHE A C   
994  O O   . PHE A 127 ? 0.7812 0.8930 0.6486 -0.0271 -0.0181 -0.0743 210 PHE A O   
995  C CB  . PHE A 127 ? 0.6081 0.6672 0.4810 -0.0225 -0.0118 -0.0332 210 PHE A CB  
996  C CG  . PHE A 127 ? 0.5037 0.5413 0.3854 -0.0205 -0.0055 -0.0310 210 PHE A CG  
997  C CD1 . PHE A 127 ? 0.4839 0.5229 0.3671 -0.0216 0.0008  -0.0396 210 PHE A CD1 
998  C CD2 . PHE A 127 ? 0.4793 0.4976 0.3696 -0.0180 -0.0062 -0.0217 210 PHE A CD2 
999  C CE1 . PHE A 127 ? 0.5232 0.5450 0.4140 -0.0202 0.0042  -0.0361 210 PHE A CE1 
1000 C CE2 . PHE A 127 ? 0.4864 0.4890 0.3817 -0.0170 -0.0014 -0.0210 210 PHE A CE2 
1001 C CZ  . PHE A 127 ? 0.4998 0.5045 0.3942 -0.0182 0.0028  -0.0271 210 PHE A CZ  
1002 N N   . HIS A 128 ? 0.7669 0.8941 0.6011 -0.0328 -0.0216 -0.0393 211 HIS A N   
1003 C CA  . HIS A 128 ? 0.8532 1.0064 0.6772 -0.0355 -0.0318 -0.0431 211 HIS A CA  
1004 C C   . HIS A 128 ? 0.9004 1.0853 0.7117 -0.0404 -0.0281 -0.0683 211 HIS A C   
1005 O O   . HIS A 128 ? 0.9778 1.1844 0.7868 -0.0422 -0.0355 -0.0838 211 HIS A O   
1006 C CB  . HIS A 128 ? 0.8845 1.0483 0.6954 -0.0385 -0.0403 -0.0131 211 HIS A CB  
1007 C CG  . HIS A 128 ? 0.9748 1.1732 0.7693 -0.0430 -0.0526 -0.0131 211 HIS A CG  
1008 N ND1 . HIS A 128 ? 0.9749 1.1711 0.7819 -0.0406 -0.0656 -0.0075 211 HIS A ND1 
1009 C CD2 . HIS A 128 ? 0.9865 1.2271 0.7514 -0.0508 -0.0537 -0.0182 211 HIS A CD2 
1010 C CE1 . HIS A 128 ? 1.0717 1.3064 0.8584 -0.0463 -0.0765 -0.0091 211 HIS A CE1 
1011 N NE2 . HIS A 128 ? 1.0174 1.2804 0.7761 -0.0529 -0.0688 -0.0159 211 HIS A NE2 
1012 N N   . GLU A 129 ? 0.9787 1.1673 0.7854 -0.0427 -0.0161 -0.0755 212 GLU A N   
1013 C CA  . GLU A 129 ? 1.0163 1.2377 0.8131 -0.0481 -0.0099 -0.1018 212 GLU A CA  
1014 C C   . GLU A 129 ? 0.9936 1.2115 0.8189 -0.0451 -0.0089 -0.1345 212 GLU A C   
1015 O O   . GLU A 129 ? 1.1299 1.3778 0.9527 -0.0489 -0.0105 -0.1601 212 GLU A O   
1016 C CB  . GLU A 129 ? 1.0757 1.3014 0.8655 -0.0514 0.0038  -0.1007 212 GLU A CB  
1017 C CG  . GLU A 129 ? 1.0891 1.3465 0.8447 -0.0592 0.0051  -0.0822 212 GLU A CG  
1018 C CD  . GLU A 129 ? 1.1618 1.4382 0.9110 -0.0645 0.0209  -0.0953 212 GLU A CD  
1019 O OE1 . GLU A 129 ? 1.2787 1.5956 0.9989 -0.0728 0.0242  -0.0956 212 GLU A OE1 
1020 O OE2 . GLU A 129 ? 1.0769 1.3300 0.8508 -0.0608 0.0299  -0.1050 212 GLU A OE2 
1021 N N   . GLU A 130 ? 0.8992 1.0830 0.7540 -0.0386 -0.0062 -0.1343 213 GLU A N   
1022 C CA  . GLU A 130 ? 0.9289 1.1073 0.8174 -0.0351 -0.0077 -0.1584 213 GLU A CA  
1023 C C   . GLU A 130 ? 0.8123 0.9539 0.7229 -0.0283 -0.0101 -0.1428 213 GLU A C   
1024 O O   . GLU A 130 ? 0.7637 0.8839 0.6766 -0.0262 -0.0048 -0.1282 213 GLU A O   
1025 C CB  . GLU A 130 ? 0.9413 1.1315 0.8532 -0.0369 0.0027  -0.1886 213 GLU A CB  
1026 C CG  . GLU A 130 ? 0.9518 1.1424 0.9060 -0.0342 0.0008  -0.2165 213 GLU A CG  
1027 C CD  . GLU A 130 ? 1.0572 1.2650 1.0399 -0.0369 0.0113  -0.2500 213 GLU A CD  
1028 O OE1 . GLU A 130 ? 1.0587 1.2766 1.0276 -0.0405 0.0211  -0.2510 213 GLU A OE1 
1029 O OE2 . GLU A 130 ? 1.0588 1.2707 1.0832 -0.0355 0.0105  -0.2763 213 GLU A OE2 
1030 N N   . ALA A 131 ? 0.7882 0.9264 0.7146 -0.0256 -0.0181 -0.1473 214 ALA A N   
1031 C CA  . ALA A 131 ? 0.8690 0.9781 0.8133 -0.0201 -0.0208 -0.1322 214 ALA A CA  
1032 C C   . ALA A 131 ? 0.8291 0.9237 0.8106 -0.0168 -0.0147 -0.1433 214 ALA A C   
1033 O O   . ALA A 131 ? 0.7962 0.9049 0.8020 -0.0179 -0.0129 -0.1683 214 ALA A O   
1034 C CB  . ALA A 131 ? 0.9177 1.0327 0.8681 -0.0191 -0.0315 -0.1341 214 ALA A CB  
1035 N N   . GLY A 132 ? 0.7732 0.8419 0.7618 -0.0134 -0.0117 -0.1249 215 GLY A N   
1036 C CA  . GLY A 132 ? 0.7457 0.8019 0.7712 -0.0106 -0.0076 -0.1291 215 GLY A CA  
1037 C C   . GLY A 132 ? 0.7234 0.7777 0.7546 -0.0115 -0.0010 -0.1300 215 GLY A C   
1038 O O   . GLY A 132 ? 0.8707 0.9117 0.9288 -0.0093 0.0012  -0.1239 215 GLY A O   
1039 N N   . ILE A 133 ? 0.6777 0.7459 0.6860 -0.0152 0.0021  -0.1355 216 ILE A N   
1040 C CA  . ILE A 133 ? 0.6768 0.7430 0.6956 -0.0161 0.0086  -0.1369 216 ILE A CA  
1041 C C   . ILE A 133 ? 0.6514 0.6967 0.6567 -0.0146 0.0088  -0.1117 216 ILE A C   
1042 O O   . ILE A 133 ? 0.5924 0.6268 0.6211 -0.0130 0.0100  -0.1059 216 ILE A O   
1043 C CB  . ILE A 133 ? 0.7776 0.8683 0.7845 -0.0208 0.0142  -0.1549 216 ILE A CB  
1044 C CG1 . ILE A 133 ? 0.9639 1.0677 0.9258 -0.0243 0.0118  -0.1461 216 ILE A CG1 
1045 C CG2 . ILE A 133 ? 0.6865 0.7982 0.7225 -0.0223 0.0157  -0.1869 216 ILE A CG2 
1046 C CD1 . ILE A 133 ? 1.1399 1.2658 1.0815 -0.0298 0.0192  -0.1529 216 ILE A CD1 
1047 N N   . PHE A 134 ? 0.5666 0.6071 0.5386 -0.0153 0.0067  -0.0963 217 PHE A N   
1048 C CA  . PHE A 134 ? 0.5164 0.5390 0.4783 -0.0144 0.0068  -0.0768 217 PHE A CA  
1049 C C   . PHE A 134 ? 0.4921 0.5001 0.4580 -0.0115 0.0040  -0.0657 217 PHE A C   
1050 O O   . PHE A 134 ? 0.4970 0.5063 0.4627 -0.0105 0.0012  -0.0674 217 PHE A O   
1051 C CB  . PHE A 134 ? 0.5017 0.5264 0.4348 -0.0169 0.0076  -0.0671 217 PHE A CB  
1052 C CG  . PHE A 134 ? 0.5129 0.5503 0.4424 -0.0202 0.0126  -0.0737 217 PHE A CG  
1053 C CD1 . PHE A 134 ? 0.5248 0.5848 0.4466 -0.0233 0.0148  -0.0866 217 PHE A CD1 
1054 C CD2 . PHE A 134 ? 0.5259 0.5556 0.4602 -0.0207 0.0154  -0.0682 217 PHE A CD2 
1055 C CE1 . PHE A 134 ? 0.5320 0.6069 0.4504 -0.0271 0.0219  -0.0938 217 PHE A CE1 
1056 C CE2 . PHE A 134 ? 0.5704 0.6124 0.5052 -0.0239 0.0213  -0.0747 217 PHE A CE2 
1057 C CZ  . PHE A 134 ? 0.5341 0.5988 0.4613 -0.0271 0.0257  -0.0878 217 PHE A CZ  
1058 N N   . LYS A 135 ? 0.5016 0.4977 0.4710 -0.0109 0.0048  -0.0543 218 LYS A N   
1059 C CA  . LYS A 135 ? 0.4690 0.4550 0.4443 -0.0091 0.0043  -0.0445 218 LYS A CA  
1060 C C   . LYS A 135 ? 0.4771 0.4548 0.4316 -0.0102 0.0052  -0.0329 218 LYS A C   
1061 O O   . LYS A 135 ? 0.5585 0.5308 0.5109 -0.0095 0.0064  -0.0276 218 LYS A O   
1062 C CB  . LYS A 135 ? 0.4754 0.4603 0.4800 -0.0081 0.0043  -0.0413 218 LYS A CB  
1063 C CG  . LYS A 135 ? 0.4927 0.4852 0.5305 -0.0068 0.0039  -0.0555 218 LYS A CG  
1064 C CD  . LYS A 135 ? 0.4959 0.4883 0.5428 -0.0050 0.0029  -0.0595 218 LYS A CD  
1065 C CE  . LYS A 135 ? 0.4903 0.4934 0.5700 -0.0043 0.0020  -0.0794 218 LYS A CE  
1066 N NZ  . LYS A 135 ? 0.5469 0.5565 0.6196 -0.0039 -0.0011 -0.0901 218 LYS A NZ  
1067 N N   . LEU A 136 ? 0.4574 0.4352 0.3994 -0.0122 0.0054  -0.0311 219 LEU A N   
1068 C CA  . LEU A 136 ? 0.4478 0.4198 0.3748 -0.0139 0.0059  -0.0238 219 LEU A CA  
1069 C C   . LEU A 136 ? 0.4998 0.4727 0.4152 -0.0157 0.0063  -0.0253 219 LEU A C   
1070 O O   . LEU A 136 ? 0.4659 0.4456 0.3838 -0.0164 0.0066  -0.0296 219 LEU A O   
1071 C CB  . LEU A 136 ? 0.5011 0.4743 0.4330 -0.0153 0.0041  -0.0185 219 LEU A CB  
1072 C CG  . LEU A 136 ? 0.5447 0.5175 0.4678 -0.0173 0.0032  -0.0102 219 LEU A CG  
1073 C CD1 . LEU A 136 ? 0.4774 0.4544 0.4030 -0.0195 -0.0014 -0.0065 219 LEU A CD1 
1074 C CD2 . LEU A 136 ? 0.5207 0.4903 0.4267 -0.0186 0.0065  -0.0121 219 LEU A CD2 
1075 N N   . LEU A 137 ? 0.5021 0.4697 0.4084 -0.0167 0.0072  -0.0225 220 LEU A N   
1076 C CA  . LEU A 137 ? 0.4762 0.4433 0.3781 -0.0185 0.0077  -0.0214 220 LEU A CA  
1077 C C   . LEU A 137 ? 0.5134 0.4760 0.4126 -0.0204 0.0081  -0.0221 220 LEU A C   
1078 O O   . LEU A 137 ? 0.4846 0.4440 0.3824 -0.0203 0.0100  -0.0239 220 LEU A O   
1079 C CB  . LEU A 137 ? 0.5000 0.4659 0.4026 -0.0178 0.0078  -0.0185 220 LEU A CB  
1080 C CG  . LEU A 137 ? 0.5545 0.5227 0.4582 -0.0198 0.0078  -0.0126 220 LEU A CG  
1081 C CD1 . LEU A 137 ? 0.4623 0.4251 0.3761 -0.0198 0.0076  -0.0073 220 LEU A CD1 
1082 C CD2 . LEU A 137 ? 0.5207 0.4889 0.4251 -0.0221 0.0091  -0.0137 220 LEU A CD2 
1083 N N   . ILE A 138 ? 0.4285 0.3931 0.3283 -0.0224 0.0066  -0.0228 221 ILE A N   
1084 C CA  . ILE A 138 ? 0.4635 0.4275 0.3607 -0.0250 0.0056  -0.0262 221 ILE A CA  
1085 C C   . ILE A 138 ? 0.4495 0.4108 0.3549 -0.0266 0.0067  -0.0280 221 ILE A C   
1086 O O   . ILE A 138 ? 0.4911 0.4540 0.4016 -0.0267 0.0072  -0.0239 221 ILE A O   
1087 C CB  . ILE A 138 ? 0.4735 0.4432 0.3702 -0.0265 0.0009  -0.0247 221 ILE A CB  
1088 C CG1 . ILE A 138 ? 0.4275 0.4006 0.3226 -0.0252 -0.0007 -0.0192 221 ILE A CG1 
1089 C CG2 . ILE A 138 ? 0.4387 0.4114 0.3317 -0.0300 -0.0018 -0.0300 221 ILE A CG2 
1090 C CD1 . ILE A 138 ? 0.4178 0.3967 0.3222 -0.0259 -0.0063 -0.0136 221 ILE A CD1 
1091 N N   . ILE A 139 ? 0.4902 0.4488 0.3999 -0.0281 0.0083  -0.0344 222 ILE A N   
1092 C CA  . ILE A 139 ? 0.4958 0.4519 0.4219 -0.0303 0.0090  -0.0377 222 ILE A CA  
1093 C C   . ILE A 139 ? 0.5615 0.5217 0.4875 -0.0336 0.0072  -0.0506 222 ILE A C   
1094 O O   . ILE A 139 ? 0.5606 0.5232 0.4826 -0.0348 0.0096  -0.0605 222 ILE A O   
1095 C CB  . ILE A 139 ? 0.5020 0.4523 0.4446 -0.0294 0.0125  -0.0363 222 ILE A CB  
1096 C CG1 . ILE A 139 ? 0.5275 0.4778 0.4662 -0.0266 0.0123  -0.0234 222 ILE A CG1 
1097 C CG2 . ILE A 139 ? 0.4906 0.4386 0.4586 -0.0316 0.0129  -0.0366 222 ILE A CG2 
1098 C CD1 . ILE A 139 ? 0.5077 0.4540 0.4614 -0.0251 0.0135  -0.0190 222 ILE A CD1 
1099 N N   . ASP A 140 ? 0.6064 0.5697 0.5373 -0.0357 0.0033  -0.0517 223 ASP A N   
1100 C CA  . ASP A 140 ? 0.5993 0.5700 0.5302 -0.0396 -0.0010 -0.0643 223 ASP A CA  
1101 C C   . ASP A 140 ? 0.6382 0.6060 0.5963 -0.0416 -0.0009 -0.0705 223 ASP A C   
1102 O O   . ASP A 140 ? 0.6536 0.6212 0.6209 -0.0419 -0.0031 -0.0641 223 ASP A O   
1103 C CB  . ASP A 140 ? 0.6501 0.6288 0.5673 -0.0402 -0.0082 -0.0585 223 ASP A CB  
1104 C CG  . ASP A 140 ? 0.7379 0.7297 0.6489 -0.0451 -0.0156 -0.0698 223 ASP A CG  
1105 O OD1 . ASP A 140 ? 0.7150 0.7131 0.6263 -0.0463 -0.0236 -0.0650 223 ASP A OD1 
1106 O OD2 . ASP A 140 ? 0.8045 0.8025 0.7115 -0.0481 -0.0139 -0.0844 223 ASP A OD2 
1107 N N   . SER A 141 ? 0.6418 0.6080 0.6185 -0.0433 0.0024  -0.0835 224 SER A N   
1108 C CA  . SER A 141 ? 0.6298 0.5967 0.6018 -0.0433 0.0072  -0.0929 224 SER A CA  
1109 C C   . SER A 141 ? 0.6096 0.5655 0.6094 -0.0409 0.0130  -0.0870 224 SER A C   
1110 O O   . SER A 141 ? 0.6618 0.6120 0.6883 -0.0407 0.0132  -0.0792 224 SER A O   
1111 C CB  . SER A 141 ? 0.5659 0.5434 0.5434 -0.0481 0.0070  -0.1178 224 SER A CB  
1112 O OG  . SER A 141 ? 0.5962 0.5691 0.6116 -0.0496 0.0073  -0.1256 224 SER A OG  
1113 N N   . ILE A 142 ? 0.5834 0.5382 0.5795 -0.0396 0.0176  -0.0908 225 ILE A N   
1114 C CA  . ILE A 142 ? 0.5977 0.5437 0.6175 -0.0370 0.0217  -0.0832 225 ILE A CA  
1115 C C   . ILE A 142 ? 0.6031 0.5434 0.6712 -0.0381 0.0235  -0.0865 225 ILE A C   
1116 O O   . ILE A 142 ? 0.6554 0.5893 0.7432 -0.0360 0.0230  -0.0676 225 ILE A O   
1117 C CB  . ILE A 142 ? 0.5785 0.5265 0.5894 -0.0362 0.0270  -0.0923 225 ILE A CB  
1118 C CG1 . ILE A 142 ? 0.5071 0.4461 0.5424 -0.0329 0.0291  -0.0806 225 ILE A CG1 
1119 C CG2 . ILE A 142 ? 0.5526 0.5098 0.5692 -0.0407 0.0316  -0.1195 225 ILE A CG2 
1120 C CD1 . ILE A 142 ? 0.5489 0.4851 0.5699 -0.0298 0.0238  -0.0561 225 ILE A CD1 
1121 N N   . MET A 143 ? 0.5963 0.5408 0.6851 -0.0417 0.0253  -0.1096 226 MET A N   
1122 C CA  . MET A 143 ? 0.6193 0.5585 0.7634 -0.0428 0.0286  -0.1175 226 MET A CA  
1123 C C   . MET A 143 ? 0.6144 0.5562 0.7865 -0.0464 0.0264  -0.1301 226 MET A C   
1124 O O   . MET A 143 ? 0.5929 0.5308 0.8197 -0.0478 0.0293  -0.1397 226 MET A O   
1125 C CB  . MET A 143 ? 0.7013 0.6457 0.8566 -0.0447 0.0354  -0.1450 226 MET A CB  
1126 C CG  . MET A 143 ? 0.7309 0.6679 0.9138 -0.0419 0.0404  -0.1397 226 MET A CG  
1127 S SD  . MET A 143 ? 0.8041 0.7517 1.0137 -0.0468 0.0499  -0.1835 226 MET A SD  
1128 C CE  . MET A 143 ? 0.7176 0.6548 1.0142 -0.0469 0.0511  -0.1862 226 MET A CE  
1129 N N   . ALA A 144 ? 0.5618 0.5108 0.7038 -0.0483 0.0211  -0.1325 227 ALA A N   
1130 C CA  . ALA A 144 ? 0.5324 0.4842 0.7043 -0.0517 0.0180  -0.1446 227 ALA A CA  
1131 C C   . ALA A 144 ? 0.5338 0.4745 0.7588 -0.0506 0.0198  -0.1263 227 ALA A C   
1132 O O   . ALA A 144 ? 0.5787 0.5179 0.8568 -0.0529 0.0216  -0.1410 227 ALA A O   
1133 C CB  . ALA A 144 ? 0.5023 0.4616 0.6382 -0.0530 0.0108  -0.1409 227 ALA A CB  
1134 N N   . LEU A 145 ? 0.5246 0.4595 0.7381 -0.0475 0.0195  -0.0942 228 LEU A N   
1135 C CA  . LEU A 145 ? 0.5259 0.4546 0.7833 -0.0472 0.0210  -0.0703 228 LEU A CA  
1136 C C   . LEU A 145 ? 0.5603 0.4823 0.8755 -0.0468 0.0244  -0.0696 228 LEU A C   
1137 O O   . LEU A 145 ? 0.5634 0.4815 0.9332 -0.0479 0.0254  -0.0559 228 LEU A O   
1138 C CB  . LEU A 145 ? 0.5231 0.4529 0.7461 -0.0448 0.0203  -0.0381 228 LEU A CB  
1139 C CG  . LEU A 145 ? 0.5147 0.4506 0.6993 -0.0456 0.0179  -0.0391 228 LEU A CG  
1140 C CD1 . LEU A 145 ? 0.5314 0.4712 0.6818 -0.0438 0.0186  -0.0141 228 LEU A CD1 
1141 C CD2 . LEU A 145 ? 0.5231 0.4598 0.7430 -0.0489 0.0176  -0.0428 228 LEU A CD2 
1142 N N   . PHE A 146 ? 0.5578 0.4791 0.8664 -0.0454 0.0267  -0.0836 229 PHE A N   
1143 C CA  . PHE A 146 ? 0.5817 0.4968 0.9483 -0.0447 0.0301  -0.0839 229 PHE A CA  
1144 C C   . PHE A 146 ? 0.6336 0.5497 1.0554 -0.0482 0.0336  -0.1181 229 PHE A C   
1145 O O   . PHE A 146 ? 0.6558 0.5658 1.1486 -0.0486 0.0354  -0.1132 229 PHE A O   
1146 C CB  . PHE A 146 ? 0.5376 0.4516 0.8815 -0.0417 0.0318  -0.0831 229 PHE A CB  
1147 C CG  . PHE A 146 ? 0.5318 0.4454 0.8389 -0.0385 0.0274  -0.0478 229 PHE A CG  
1148 C CD1 . PHE A 146 ? 0.5387 0.4576 0.7791 -0.0376 0.0250  -0.0435 229 PHE A CD1 
1149 C CD2 . PHE A 146 ? 0.5103 0.4204 0.8522 -0.0368 0.0249  -0.0186 229 PHE A CD2 
1150 C CE1 . PHE A 146 ? 0.5164 0.4377 0.7263 -0.0353 0.0214  -0.0158 229 PHE A CE1 
1151 C CE2 . PHE A 146 ? 0.5228 0.4371 0.8288 -0.0349 0.0200  0.0118  229 PHE A CE2 
1152 C CZ  . PHE A 146 ? 0.5313 0.4514 0.7711 -0.0342 0.0188  0.0107  229 PHE A CZ  
1153 N N   . ARG A 147 ? 0.6585 0.5841 1.0506 -0.0511 0.0341  -0.1520 230 ARG A N   
1154 C CA  . ARG A 147 ? 0.7200 0.6515 1.1586 -0.0556 0.0363  -0.1890 230 ARG A CA  
1155 C C   . ARG A 147 ? 0.7712 0.6980 1.2565 -0.0570 0.0329  -0.1763 230 ARG A C   
1156 O O   . ARG A 147 ? 0.6890 0.6134 1.2487 -0.0591 0.0354  -0.1917 230 ARG A O   
1157 C CB  . ARG A 147 ? 0.7660 0.7136 1.1524 -0.0594 0.0345  -0.2214 230 ARG A CB  
1158 C CG  . ARG A 147 ? 0.8417 0.7992 1.1984 -0.0605 0.0406  -0.2454 230 ARG A CG  
1159 C CD  . ARG A 147 ? 0.9500 0.9275 1.3076 -0.0671 0.0420  -0.2920 230 ARG A CD  
1160 N NE  . ARG A 147 ? 1.0072 0.9997 1.2971 -0.0697 0.0343  -0.2942 230 ARG A NE  
1161 C CZ  . ARG A 147 ? 1.0194 1.0353 1.2884 -0.0762 0.0328  -0.3293 230 ARG A CZ  
1162 N NH1 . ARG A 147 ? 0.9624 0.9907 1.2711 -0.0811 0.0402  -0.3710 230 ARG A NH1 
1163 N NH2 . ARG A 147 ? 0.9935 1.0226 1.2027 -0.0782 0.0237  -0.3228 230 ARG A NH2 
1164 N N   . VAL A 148 ? 0.8386 0.7646 1.2832 -0.0558 0.0280  -0.1483 231 VAL A N   
1165 C CA  . VAL A 148 ? 0.8923 0.8157 1.3697 -0.0572 0.0257  -0.1316 231 VAL A CA  
1166 C C   . VAL A 148 ? 0.9091 0.8231 1.4545 -0.0562 0.0285  -0.1006 231 VAL A C   
1167 O O   . VAL A 148 ? 0.9058 0.8179 1.5161 -0.0587 0.0293  -0.1048 231 VAL A O   
1168 C CB  . VAL A 148 ? 0.8635 0.7911 1.2793 -0.0566 0.0214  -0.1124 231 VAL A CB  
1169 C CG1 . VAL A 148 ? 0.7739 0.6995 1.2249 -0.0581 0.0214  -0.0917 231 VAL A CG1 
1170 C CG2 . VAL A 148 ? 0.8577 0.7961 1.2264 -0.0587 0.0166  -0.1423 231 VAL A CG2 
1171 N N   . ASP A 149 ? 0.9706 0.8805 1.5038 -0.0530 0.0292  -0.0687 232 ASP A N   
1172 C CA  . ASP A 149 ? 0.9739 0.8787 1.5670 -0.0526 0.0301  -0.0321 232 ASP A CA  
1173 C C   . ASP A 149 ? 0.9314 0.8297 1.5982 -0.0522 0.0326  -0.0442 232 ASP A C   
1174 O O   . ASP A 149 ? 0.8607 0.7549 1.5865 -0.0518 0.0322  -0.0131 232 ASP A O   
1175 C CB  . ASP A 149 ? 1.0427 0.9506 1.5877 -0.0502 0.0280  0.0103  232 ASP A CB  
1176 C CG  . ASP A 149 ? 1.0705 0.9861 1.5523 -0.0509 0.0273  0.0236  232 ASP A CG  
1177 O OD1 . ASP A 149 ? 1.0523 0.9695 1.5278 -0.0529 0.0276  0.0041  232 ASP A OD1 
1178 O OD2 . ASP A 149 ? 1.0536 0.9751 1.4940 -0.0497 0.0262  0.0527  232 ASP A OD2 
1179 N N   . PHE A 150 ? 0.9677 0.8673 1.6310 -0.0526 0.0353  -0.0884 233 PHE A N   
1180 C CA  . PHE A 150 ? 1.0135 0.9091 1.7384 -0.0522 0.0396  -0.1090 233 PHE A CA  
1181 C C   . PHE A 150 ? 1.1371 1.0403 1.8659 -0.0555 0.0444  -0.1674 233 PHE A C   
1182 O O   . PHE A 150 ? 1.1546 1.0635 1.8357 -0.0550 0.0474  -0.1892 233 PHE A O   
1183 C CB  . PHE A 150 ? 0.9019 0.7955 1.5945 -0.0484 0.0395  -0.0934 233 PHE A CB  
1184 C CG  . PHE A 150 ? 0.9010 0.7928 1.5734 -0.0458 0.0336  -0.0397 233 PHE A CG  
1185 C CD1 . PHE A 150 ? 0.8686 0.7564 1.6118 -0.0457 0.0310  -0.0038 233 PHE A CD1 
1186 C CD2 . PHE A 150 ? 0.9519 0.8487 1.5354 -0.0438 0.0304  -0.0249 233 PHE A CD2 
1187 C CE1 . PHE A 150 ? 0.8836 0.7754 1.6027 -0.0445 0.0251  0.0460  233 PHE A CE1 
1188 C CE2 . PHE A 150 ? 0.9388 0.8383 1.5009 -0.0423 0.0251  0.0202  233 PHE A CE2 
1189 C CZ  . PHE A 150 ? 0.9628 0.8612 1.5897 -0.0429 0.0223  0.0559  233 PHE A CZ  
1190 N N   . SER A 151 ? 1.1911 1.0969 1.9747 -0.0593 0.0452  -0.1928 234 SER A N   
1191 C CA  . SER A 151 ? 1.2965 1.2123 2.1091 -0.0634 0.0505  -0.2513 234 SER A CA  
1192 C C   . SER A 151 ? 1.3309 1.2432 2.2590 -0.0661 0.0538  -0.2709 234 SER A C   
1193 O O   . SER A 151 ? 1.3180 1.2201 2.3051 -0.0651 0.0512  -0.2373 234 SER A O   
1194 C CB  . SER A 151 ? 1.2568 1.1886 1.9956 -0.0671 0.0473  -0.2828 234 SER A CB  
1195 O OG  . SER A 151 ? 1.2908 1.2233 2.0344 -0.0690 0.0409  -0.2751 234 SER A OG  
1196 N N   . GLY A 152 ? 1.3878 1.3109 2.3501 -0.0700 0.0601  -0.3261 235 GLY A N   
1197 C CA  . GLY A 152 ? 1.4323 1.3509 2.5143 -0.0714 0.0661  -0.3472 235 GLY A CA  
1198 C C   . GLY A 152 ? 1.4681 1.3823 2.5597 -0.0683 0.0729  -0.3443 235 GLY A C   
1199 O O   . GLY A 152 ? 1.2883 1.1911 2.3564 -0.0632 0.0693  -0.2945 235 GLY A O   
1200 N N   . ARG A 153 ? 1.4670 1.3927 2.5926 -0.0717 0.0828  -0.3992 236 ARG A N   
1201 C CA  . ARG A 153 ? 1.4038 1.3309 2.5160 -0.0697 0.0911  -0.4075 236 ARG A CA  
1202 C C   . ARG A 153 ? 1.3826 1.2909 2.5616 -0.0641 0.0908  -0.3651 236 ARG A C   
1203 O O   . ARG A 153 ? 1.3995 1.3068 2.5496 -0.0613 0.0946  -0.3587 236 ARG A O   
1204 C CB  . ARG A 153 ? 1.3772 1.3256 2.5058 -0.0757 0.1040  -0.4797 236 ARG A CB  
1205 C CG  . ARG A 153 ? 1.3275 1.2877 2.5350 -0.0820 0.1074  -0.5325 236 ARG A CG  
1206 C CD  . ARG A 153 ? 1.3324 1.3195 2.5389 -0.0889 0.1212  -0.6049 236 ARG A CD  
1207 N NE  . ARG A 153 ? 1.3168 1.3196 2.5994 -0.0958 0.1248  -0.6630 236 ARG A NE  
1208 C CZ  . ARG A 153 ? 1.3520 1.3764 2.6844 -0.1020 0.1390  -0.7302 236 ARG A CZ  
1209 N NH1 . ARG A 153 ? 1.3301 1.3627 2.6448 -0.1022 0.1523  -0.7472 236 ARG A NH1 
1210 N NH2 . ARG A 153 ? 1.3068 1.3462 2.7110 -0.1085 0.1407  -0.7831 236 ARG A NH2 
1211 N N   . GLY A 154 ? 1.2783 1.1732 2.5442 -0.0626 0.0854  -0.3332 237 GLY A N   
1212 C CA  . GLY A 154 ? 1.2023 1.0823 2.5426 -0.0581 0.0830  -0.2899 237 GLY A CA  
1213 C C   . GLY A 154 ? 1.0992 0.9695 2.4005 -0.0541 0.0707  -0.2171 237 GLY A C   
1214 O O   . GLY A 154 ? 1.0576 0.9197 2.4315 -0.0535 0.0652  -0.1789 237 GLY A O   
1215 N N   . GLU A 155 ? 1.1894 1.0627 2.3777 -0.0519 0.0669  -0.1983 238 GLU A N   
1216 C CA  . GLU A 155 ? 1.1531 1.0232 2.2790 -0.0494 0.0563  -0.1393 238 GLU A CA  
1217 C C   . GLU A 155 ? 1.0269 0.9003 2.0485 -0.0463 0.0541  -0.1276 238 GLU A C   
1218 O O   . GLU A 155 ? 0.9668 0.8397 1.9325 -0.0441 0.0460  -0.0822 238 GLU A O   
1219 C CB  . GLU A 155 ? 1.2247 1.0992 2.3149 -0.0525 0.0539  -0.1426 238 GLU A CB  
1220 C CG  . GLU A 155 ? 1.3137 1.1878 2.3442 -0.0511 0.0455  -0.0881 238 GLU A CG  
1221 C CD  . GLU A 155 ? 1.3692 1.2377 2.4662 -0.0499 0.0399  -0.0315 238 GLU A CD  
1222 O OE1 . GLU A 155 ? 1.3700 1.2354 2.4921 -0.0472 0.0374  -0.0106 238 GLU A OE1 
1223 O OE2 . GLU A 155 ? 1.3155 1.1842 2.4396 -0.0520 0.0378  -0.0061 238 GLU A OE2 
1224 N N   . LEU A 156 ? 0.9330 0.8114 1.9332 -0.0466 0.0624  -0.1703 239 LEU A N   
1225 C CA  . LEU A 156 ? 0.9776 0.8601 1.8842 -0.0443 0.0622  -0.1669 239 LEU A CA  
1226 C C   . LEU A 156 ? 0.9232 0.7989 1.8359 -0.0397 0.0554  -0.1216 239 LEU A C   
1227 O O   . LEU A 156 ? 0.8519 0.7300 1.6849 -0.0375 0.0512  -0.1034 239 LEU A O   
1228 C CB  . LEU A 156 ? 1.0293 0.9215 1.9189 -0.0466 0.0744  -0.2224 239 LEU A CB  
1229 C CG  . LEU A 156 ? 1.0748 0.9787 1.9899 -0.0523 0.0838  -0.2807 239 LEU A CG  
1230 C CD1 . LEU A 156 ? 1.0165 0.9309 1.9391 -0.0544 0.0975  -0.3270 239 LEU A CD1 
1231 C CD2 . LEU A 156 ? 1.0955 1.0096 1.9302 -0.0554 0.0798  -0.2906 239 LEU A CD2 
1232 N N   . ALA A 157 ? 0.9731 0.8417 1.9833 -0.0386 0.0533  -0.1033 240 ALA A N   
1233 C CA  . ALA A 157 ? 0.9295 0.7944 1.9497 -0.0347 0.0445  -0.0586 240 ALA A CA  
1234 C C   . ALA A 157 ? 0.9501 0.8189 1.8889 -0.0336 0.0330  -0.0115 240 ALA A C   
1235 O O   . ALA A 157 ? 0.9187 0.7906 1.7977 -0.0310 0.0280  0.0056  240 ALA A O   
1236 C CB  . ALA A 157 ? 0.8742 0.7324 2.0143 -0.0343 0.0406  -0.0352 240 ALA A CB  
1237 N N   . GLU A 158 ? 0.9447 0.8150 1.8835 -0.0359 0.0301  0.0056  241 GLU A N   
1238 C CA  . GLU A 158 ? 0.9259 0.8026 1.7985 -0.0360 0.0213  0.0485  241 GLU A CA  
1239 C C   . GLU A 158 ? 0.8720 0.7542 1.6327 -0.0357 0.0234  0.0299  241 GLU A C   
1240 O O   . GLU A 158 ? 0.7995 0.6874 1.4941 -0.0340 0.0174  0.0539  241 GLU A O   
1241 C CB  . GLU A 158 ? 1.0046 0.8816 1.9241 -0.0391 0.0200  0.0697  241 GLU A CB  
1242 C CG  . GLU A 158 ? 1.1249 1.0080 2.0651 -0.0394 0.0096  0.1325  241 GLU A CG  
1243 C CD  . GLU A 158 ? 1.1484 1.0430 1.9866 -0.0387 0.0032  0.1589  241 GLU A CD  
1244 O OE1 . GLU A 158 ? 1.1167 1.0147 1.9357 -0.0363 -0.0033 0.1734  241 GLU A OE1 
1245 O OE2 . GLU A 158 ? 1.1591 1.0599 1.9398 -0.0407 0.0051  0.1619  241 GLU A OE2 
1246 N N   . ARG A 159 ? 0.8111 0.6931 1.5559 -0.0377 0.0314  -0.0134 242 ARG A N   
1247 C CA  . ARG A 159 ? 0.7712 0.6587 1.4234 -0.0378 0.0336  -0.0347 242 ARG A CA  
1248 C C   . ARG A 159 ? 0.7594 0.6483 1.3656 -0.0348 0.0338  -0.0381 242 ARG A C   
1249 O O   . ARG A 159 ? 0.8022 0.6955 1.3334 -0.0335 0.0303  -0.0263 242 ARG A O   
1250 C CB  . ARG A 159 ? 0.8162 0.7061 1.4749 -0.0410 0.0418  -0.0851 242 ARG A CB  
1251 C CG  . ARG A 159 ? 0.8122 0.7100 1.3806 -0.0419 0.0425  -0.1036 242 ARG A CG  
1252 C CD  . ARG A 159 ? 0.8374 0.7422 1.4131 -0.0460 0.0492  -0.1530 242 ARG A CD  
1253 N NE  . ARG A 159 ? 0.8669 0.7784 1.4097 -0.0462 0.0559  -0.1816 242 ARG A NE  
1254 C CZ  . ARG A 159 ? 0.8785 0.8027 1.4005 -0.0503 0.0618  -0.2237 242 ARG A CZ  
1255 N NH1 . ARG A 159 ? 0.8473 0.7784 1.3798 -0.0545 0.0603  -0.2451 242 ARG A NH1 
1256 N NH2 . ARG A 159 ? 0.8944 0.8265 1.3847 -0.0508 0.0690  -0.2436 242 ARG A NH2 
1257 N N   . GLN A 160 ? 0.7883 0.6736 1.4447 -0.0339 0.0388  -0.0563 243 GLN A N   
1258 C CA  . GLN A 160 ? 0.7193 0.6060 1.3413 -0.0316 0.0417  -0.0672 243 GLN A CA  
1259 C C   . GLN A 160 ? 0.6966 0.5832 1.2960 -0.0282 0.0313  -0.0251 243 GLN A C   
1260 O O   . GLN A 160 ? 0.7244 0.6148 1.2565 -0.0266 0.0303  -0.0252 243 GLN A O   
1261 C CB  . GLN A 160 ? 0.8206 0.7048 1.5103 -0.0320 0.0514  -0.0994 243 GLN A CB  
1262 C CG  . GLN A 160 ? 0.9463 0.8351 1.6627 -0.0363 0.0625  -0.1478 243 GLN A CG  
1263 C CD  . GLN A 160 ? 1.0040 0.9040 1.6391 -0.0389 0.0690  -0.1801 243 GLN A CD  
1264 O OE1 . GLN A 160 ? 1.0012 0.9045 1.5675 -0.0392 0.0632  -0.1676 243 GLN A OE1 
1265 N NE2 . GLN A 160 ? 0.9992 0.9072 1.6455 -0.0414 0.0815  -0.2222 243 GLN A NE2 
1266 N N   . GLN A 161 ? 0.6363 0.5209 1.2913 -0.0275 0.0228  0.0115  244 GLN A N   
1267 C CA  . GLN A 161 ? 0.6476 0.5375 1.2732 -0.0254 0.0106  0.0537  244 GLN A CA  
1268 C C   . GLN A 161 ? 0.6180 0.5161 1.1521 -0.0260 0.0076  0.0631  244 GLN A C   
1269 O O   . GLN A 161 ? 0.6447 0.5471 1.1224 -0.0241 0.0048  0.0645  244 GLN A O   
1270 C CB  . GLN A 161 ? 0.7216 0.6133 1.4134 -0.0259 0.0004  0.0979  244 GLN A CB  
1271 C CG  . GLN A 161 ? 0.8502 0.7330 1.6482 -0.0257 0.0037  0.0892  244 GLN A CG  
1272 C CD  . GLN A 161 ? 0.9674 0.8533 1.8297 -0.0249 -0.0094 0.1369  244 GLN A CD  
1273 O OE1 . GLN A 161 ? 1.0967 0.9885 1.9348 -0.0229 -0.0190 0.1584  244 GLN A OE1 
1274 N NE2 . GLN A 161 ? 0.9685 0.8511 1.9186 -0.0267 -0.0106 0.1537  244 GLN A NE2 
1275 N N   . LYS A 162 ? 0.5967 0.4966 1.1223 -0.0287 0.0090  0.0662  245 LYS A N   
1276 C CA  . LYS A 162 ? 0.5576 0.4657 1.0091 -0.0298 0.0072  0.0751  245 LYS A CA  
1277 C C   . LYS A 162 ? 0.5585 0.4668 0.9428 -0.0286 0.0120  0.0451  245 LYS A C   
1278 O O   . LYS A 162 ? 0.5571 0.4719 0.8853 -0.0273 0.0079  0.0555  245 LYS A O   
1279 C CB  . LYS A 162 ? 0.5463 0.4547 1.0148 -0.0331 0.0100  0.0776  245 LYS A CB  
1280 C CG  . LYS A 162 ? 0.5522 0.4674 1.0554 -0.0352 0.0039  0.1221  245 LYS A CG  
1281 C CD  . LYS A 162 ? 0.5998 0.5289 1.0523 -0.0348 -0.0045 0.1551  245 LYS A CD  
1282 C CE  . LYS A 162 ? 0.6528 0.5949 1.1280 -0.0382 -0.0104 0.2020  245 LYS A CE  
1283 N NZ  . LYS A 162 ? 0.7116 0.6469 1.2805 -0.0385 -0.0127 0.2180  245 LYS A NZ  
1284 N N   . LEU A 163 ? 0.5492 0.4524 0.9423 -0.0294 0.0205  0.0080  246 LEU A N   
1285 C CA  . LEU A 163 ? 0.5337 0.4390 0.8710 -0.0289 0.0251  -0.0180 246 LEU A CA  
1286 C C   . LEU A 163 ? 0.5592 0.4652 0.8761 -0.0257 0.0231  -0.0118 246 LEU A C   
1287 O O   . LEU A 163 ? 0.6260 0.5365 0.8843 -0.0245 0.0215  -0.0104 246 LEU A O   
1288 C CB  . LEU A 163 ? 0.5521 0.4563 0.9112 -0.0312 0.0344  -0.0575 246 LEU A CB  
1289 C CG  . LEU A 163 ? 0.6059 0.5158 0.9088 -0.0316 0.0397  -0.0826 246 LEU A CG  
1290 C CD1 . LEU A 163 ? 0.6312 0.5469 0.8782 -0.0331 0.0368  -0.0828 246 LEU A CD1 
1291 C CD2 . LEU A 163 ? 0.6701 0.5830 1.0052 -0.0345 0.0498  -0.1210 246 LEU A CD2 
1292 N N   . ALA A 164 ? 0.5423 0.4441 0.9122 -0.0242 0.0227  -0.0074 247 ALA A N   
1293 C CA  . ALA A 164 ? 0.5842 0.4863 0.9426 -0.0213 0.0209  -0.0040 247 ALA A CA  
1294 C C   . ALA A 164 ? 0.6073 0.5163 0.9288 -0.0198 0.0094  0.0284  247 ALA A C   
1295 O O   . ALA A 164 ? 0.5664 0.4784 0.8461 -0.0180 0.0084  0.0253  247 ALA A O   
1296 C CB  . ALA A 164 ? 0.5640 0.4607 0.9949 -0.0201 0.0223  -0.0056 247 ALA A CB  
1297 N N   . GLN A 165 ? 0.6546 0.5679 0.9930 -0.0211 0.0013  0.0587  248 GLN A N   
1298 C CA  . GLN A 165 ? 0.6946 0.6202 0.9931 -0.0212 -0.0091 0.0887  248 GLN A CA  
1299 C C   . GLN A 165 ? 0.6940 0.6245 0.9214 -0.0213 -0.0064 0.0757  248 GLN A C   
1300 O O   . GLN A 165 ? 0.7151 0.6514 0.9067 -0.0196 -0.0103 0.0765  248 GLN A O   
1301 C CB  . GLN A 165 ? 0.7617 0.6946 1.0814 -0.0242 -0.0144 0.1197  248 GLN A CB  
1302 C CG  . GLN A 165 ? 0.8529 0.7957 1.2044 -0.0246 -0.0267 0.1579  248 GLN A CG  
1303 C CD  . GLN A 165 ? 0.9273 0.8634 1.3615 -0.0256 -0.0273 0.1723  248 GLN A CD  
1304 O OE1 . GLN A 165 ? 0.9268 0.8627 1.3820 -0.0284 -0.0239 0.1805  248 GLN A OE1 
1305 N NE2 . GLN A 165 ? 0.8919 0.8224 1.3799 -0.0234 -0.0313 0.1751  248 GLN A NE2 
1306 N N   . MET A 166 ? 0.6412 0.5695 0.8542 -0.0232 0.0000  0.0625  249 MET A N   
1307 C CA  . MET A 166 ? 0.5937 0.5262 0.7494 -0.0234 0.0023  0.0511  249 MET A CA  
1308 C C   . MET A 166 ? 0.5815 0.5112 0.7098 -0.0210 0.0055  0.0306  249 MET A C   
1309 O O   . MET A 166 ? 0.5336 0.4696 0.6222 -0.0200 0.0029  0.0324  249 MET A O   
1310 C CB  . MET A 166 ? 0.5855 0.5146 0.7418 -0.0257 0.0083  0.0371  249 MET A CB  
1311 C CG  . MET A 166 ? 0.6078 0.5415 0.7117 -0.0260 0.0097  0.0274  249 MET A CG  
1312 S SD  . MET A 166 ? 0.7441 0.6740 0.8529 -0.0286 0.0152  0.0064  249 MET A SD  
1313 C CE  . MET A 166 ? 0.5953 0.5206 0.7040 -0.0282 0.0209  -0.0248 249 MET A CE  
1314 N N   . LEU A 167 ? 0.6262 0.5481 0.7791 -0.0205 0.0121  0.0102  250 LEU A N   
1315 C CA  . LEU A 167 ? 0.5565 0.4775 0.6858 -0.0190 0.0172  -0.0083 250 LEU A CA  
1316 C C   . LEU A 167 ? 0.5394 0.4618 0.6703 -0.0161 0.0123  0.0021  250 LEU A C   
1317 O O   . LEU A 167 ? 0.5269 0.4516 0.6279 -0.0147 0.0134  -0.0041 250 LEU A O   
1318 C CB  . LEU A 167 ? 0.5915 0.5085 0.7434 -0.0207 0.0275  -0.0351 250 LEU A CB  
1319 C CG  . LEU A 167 ? 0.5988 0.5182 0.7372 -0.0241 0.0315  -0.0514 250 LEU A CG  
1320 C CD1 . LEU A 167 ? 0.6089 0.5291 0.7717 -0.0266 0.0414  -0.0804 250 LEU A CD1 
1321 C CD2 . LEU A 167 ? 0.5740 0.4992 0.6581 -0.0245 0.0306  -0.0534 250 LEU A CD2 
1322 N N   . SER A 168 ? 0.5447 0.4670 0.7128 -0.0153 0.0056  0.0200  251 SER A N   
1323 C CA  . SER A 168 ? 0.5505 0.4774 0.7162 -0.0129 -0.0023 0.0325  251 SER A CA  
1324 C C   . SER A 168 ? 0.5197 0.4583 0.6396 -0.0131 -0.0104 0.0456  251 SER A C   
1325 O O   . SER A 168 ? 0.5332 0.4751 0.6306 -0.0114 -0.0118 0.0398  251 SER A O   
1326 C CB  . SER A 168 ? 0.5293 0.4553 0.7488 -0.0120 -0.0093 0.0496  251 SER A CB  
1327 O OG  . SER A 168 ? 0.6147 0.5436 0.8533 -0.0143 -0.0139 0.0689  251 SER A OG  
1328 N N   . ARG A 169 ? 0.5051 0.4509 0.6143 -0.0156 -0.0140 0.0603  252 ARG A N   
1329 C CA  . ARG A 169 ? 0.6180 0.5767 0.6819 -0.0168 -0.0177 0.0654  252 ARG A CA  
1330 C C   . ARG A 169 ? 0.5712 0.5272 0.6002 -0.0157 -0.0113 0.0438  252 ARG A C   
1331 O O   . ARG A 169 ? 0.5349 0.4990 0.5402 -0.0148 -0.0149 0.0414  252 ARG A O   
1332 C CB  . ARG A 169 ? 0.7305 0.6966 0.7894 -0.0203 -0.0178 0.0799  252 ARG A CB  
1333 C CG  . ARG A 169 ? 1.0029 0.9785 1.0896 -0.0223 -0.0263 0.1095  252 ARG A CG  
1334 C CD  . ARG A 169 ? 1.2376 1.2322 1.3057 -0.0229 -0.0377 0.1256  252 ARG A CD  
1335 N NE  . ARG A 169 ? 1.5095 1.5226 1.5331 -0.0260 -0.0378 0.1280  252 ARG A NE  
1336 C CZ  . ARG A 169 ? 1.4547 1.4789 1.4424 -0.0257 -0.0398 0.1152  252 ARG A CZ  
1337 N NH1 . ARG A 169 ? 1.3108 1.3292 1.3002 -0.0222 -0.0427 0.1014  252 ARG A NH1 
1338 N NH2 . ARG A 169 ? 1.3070 1.3496 1.2610 -0.0292 -0.0381 0.1155  252 ARG A NH2 
1339 N N   . LEU A 170 ? 0.5335 0.4800 0.5630 -0.0162 -0.0026 0.0285  253 LEU A N   
1340 C CA  . LEU A 170 ? 0.5513 0.4959 0.5535 -0.0155 0.0026  0.0118  253 LEU A CA  
1341 C C   . LEU A 170 ? 0.5529 0.4967 0.5524 -0.0130 0.0029  0.0051  253 LEU A C   
1342 O O   . LEU A 170 ? 0.5204 0.4687 0.4974 -0.0121 0.0022  0.0011  253 LEU A O   
1343 C CB  . LEU A 170 ? 0.5669 0.5043 0.5749 -0.0170 0.0105  -0.0028 253 LEU A CB  
1344 C CG  . LEU A 170 ? 0.5960 0.5360 0.5889 -0.0193 0.0110  -0.0033 253 LEU A CG  
1345 C CD1 . LEU A 170 ? 0.5637 0.5000 0.5550 -0.0209 0.0172  -0.0214 253 LEU A CD1 
1346 C CD2 . LEU A 170 ? 0.6152 0.5630 0.5776 -0.0188 0.0081  -0.0001 253 LEU A CD2 
1347 N N   . GLN A 171 ? 0.5360 0.4741 0.5639 -0.0118 0.0045  0.0034  254 GLN A N   
1348 C CA  . GLN A 171 ? 0.5112 0.4477 0.5427 -0.0095 0.0067  -0.0037 254 GLN A CA  
1349 C C   . GLN A 171 ? 0.4963 0.4415 0.5183 -0.0081 -0.0033 0.0061  254 GLN A C   
1350 O O   . GLN A 171 ? 0.4775 0.4254 0.4844 -0.0069 -0.0027 -0.0005 254 GLN A O   
1351 C CB  . GLN A 171 ? 0.5216 0.4517 0.5920 -0.0087 0.0104  -0.0072 254 GLN A CB  
1352 C CG  . GLN A 171 ? 0.5467 0.4715 0.6290 -0.0108 0.0227  -0.0245 254 GLN A CG  
1353 C CD  . GLN A 171 ? 0.5507 0.4719 0.6656 -0.0100 0.0307  -0.0357 254 GLN A CD  
1354 O OE1 . GLN A 171 ? 0.5758 0.4983 0.6848 -0.0118 0.0428  -0.0533 254 GLN A OE1 
1355 N NE2 . GLN A 171 ? 0.4711 0.3903 0.6198 -0.0078 0.0242  -0.0252 254 GLN A NE2 
1356 N N   . LYS A 172 ? 0.5166 0.4686 0.5485 -0.0087 -0.0128 0.0222  255 LYS A N   
1357 C CA  . LYS A 172 ? 0.4767 0.4427 0.4998 -0.0085 -0.0245 0.0321  255 LYS A CA  
1358 C C   . LYS A 172 ? 0.4574 0.4322 0.4463 -0.0095 -0.0240 0.0249  255 LYS A C   
1359 O O   . LYS A 172 ? 0.4721 0.4538 0.4537 -0.0084 -0.0277 0.0184  255 LYS A O   
1360 C CB  . LYS A 172 ? 0.5070 0.4829 0.5418 -0.0105 -0.0344 0.0539  255 LYS A CB  
1361 C CG  . LYS A 172 ? 0.5628 0.5465 0.6196 -0.0096 -0.0464 0.0664  255 LYS A CG  
1362 C CD  . LYS A 172 ? 0.5821 0.5591 0.6836 -0.0096 -0.0489 0.0822  255 LYS A CD  
1363 C CE  . LYS A 172 ? 0.6018 0.5885 0.7068 -0.0131 -0.0544 0.1061  255 LYS A CE  
1364 N NZ  . LYS A 172 ? 0.7285 0.7188 0.8792 -0.0131 -0.0655 0.1300  255 LYS A NZ  
1365 N N   . ILE A 173 ? 0.4596 0.4333 0.4331 -0.0115 -0.0187 0.0238  256 ILE A N   
1366 C CA  . ILE A 173 ? 0.4806 0.4624 0.4275 -0.0125 -0.0170 0.0158  256 ILE A CA  
1367 C C   . ILE A 173 ? 0.5200 0.4961 0.4647 -0.0102 -0.0126 0.0008  256 ILE A C   
1368 O O   . ILE A 173 ? 0.5267 0.5113 0.4685 -0.0093 -0.0165 -0.0052 256 ILE A O   
1369 C CB  . ILE A 173 ? 0.4954 0.4752 0.4332 -0.0149 -0.0116 0.0174  256 ILE A CB  
1370 C CG1 . ILE A 173 ? 0.5268 0.5198 0.4617 -0.0181 -0.0164 0.0342  256 ILE A CG1 
1371 C CG2 . ILE A 173 ? 0.4431 0.4248 0.3629 -0.0152 -0.0070 0.0052  256 ILE A CG2 
1372 C CD1 . ILE A 173 ? 0.5379 0.5281 0.4720 -0.0205 -0.0108 0.0380  256 ILE A CD1 
1373 N N   . SER A 174 ? 0.5446 0.5085 0.4922 -0.0098 -0.0046 -0.0049 257 SER A N   
1374 C CA  . SER A 174 ? 0.5300 0.4873 0.4824 -0.0082 0.0011  -0.0131 257 SER A CA  
1375 C C   . SER A 174 ? 0.5617 0.5215 0.5264 -0.0058 -0.0022 -0.0156 257 SER A C   
1376 O O   . SER A 174 ? 0.5494 0.5125 0.5131 -0.0049 -0.0020 -0.0213 257 SER A O   
1377 C CB  . SER A 174 ? 0.5128 0.4610 0.4775 -0.0087 0.0072  -0.0142 257 SER A CB  
1378 O OG  . SER A 174 ? 0.6066 0.5511 0.5731 -0.0083 0.0146  -0.0211 257 SER A OG  
1379 N N   . GLU A 175 ? 0.5859 0.5445 0.5679 -0.0048 -0.0057 -0.0112 258 GLU A N   
1380 C CA  . GLU A 175 ? 0.5407 0.5015 0.5398 -0.0025 -0.0093 -0.0138 258 GLU A CA  
1381 C C   . GLU A 175 ? 0.5385 0.5139 0.5330 -0.0026 -0.0207 -0.0142 258 GLU A C   
1382 O O   . GLU A 175 ? 0.5422 0.5217 0.5450 -0.0012 -0.0227 -0.0223 258 GLU A O   
1383 C CB  . GLU A 175 ? 0.5331 0.4872 0.5580 -0.0015 -0.0083 -0.0102 258 GLU A CB  
1384 C CG  . GLU A 175 ? 0.5438 0.4877 0.5716 -0.0022 0.0054  -0.0165 258 GLU A CG  
1385 C CD  . GLU A 175 ? 0.5967 0.5343 0.6532 -0.0019 0.0100  -0.0174 258 GLU A CD  
1386 O OE1 . GLU A 175 ? 0.6544 0.5875 0.7116 -0.0038 0.0189  -0.0230 258 GLU A OE1 
1387 O OE2 . GLU A 175 ? 0.5835 0.5217 0.6648 0.0000  0.0051  -0.0146 258 GLU A OE2 
1388 N N   . GLU A 176 ? 0.5159 0.5016 0.4973 -0.0048 -0.0276 -0.0063 259 GLU A N   
1389 C CA  . GLU A 176 ? 0.5239 0.5287 0.4981 -0.0060 -0.0386 -0.0072 259 GLU A CA  
1390 C C   . GLU A 176 ? 0.5328 0.5465 0.4925 -0.0070 -0.0361 -0.0216 259 GLU A C   
1391 O O   . GLU A 176 ? 0.5402 0.5680 0.5028 -0.0072 -0.0426 -0.0320 259 GLU A O   
1392 C CB  . GLU A 176 ? 0.5835 0.6000 0.5480 -0.0090 -0.0459 0.0090  259 GLU A CB  
1393 C CG  . GLU A 176 ? 0.7728 0.8146 0.7282 -0.0115 -0.0594 0.0125  259 GLU A CG  
1394 C CD  . GLU A 176 ? 1.0363 1.0910 0.9816 -0.0154 -0.0653 0.0347  259 GLU A CD  
1395 O OE1 . GLU A 176 ? 0.9722 1.0118 0.9284 -0.0150 -0.0595 0.0469  259 GLU A OE1 
1396 O OE2 . GLU A 176 ? 1.1111 1.1929 1.0391 -0.0192 -0.0755 0.0399  259 GLU A OE2 
1397 N N   . TYR A 177 ? 0.5278 0.5345 0.4764 -0.0076 -0.0273 -0.0238 260 TYR A N   
1398 C CA  . TYR A 177 ? 0.5281 0.5441 0.4683 -0.0088 -0.0248 -0.0368 260 TYR A CA  
1399 C C   . TYR A 177 ? 0.5334 0.5366 0.4881 -0.0065 -0.0173 -0.0443 260 TYR A C   
1400 O O   . TYR A 177 ? 0.4550 0.4610 0.4096 -0.0071 -0.0137 -0.0520 260 TYR A O   
1401 C CB  . TYR A 177 ? 0.5667 0.5881 0.4867 -0.0119 -0.0217 -0.0319 260 TYR A CB  
1402 C CG  . TYR A 177 ? 0.5866 0.6261 0.4915 -0.0153 -0.0285 -0.0224 260 TYR A CG  
1403 C CD1 . TYR A 177 ? 0.5986 0.6334 0.5004 -0.0165 -0.0288 -0.0041 260 TYR A CD1 
1404 C CD2 . TYR A 177 ? 0.6228 0.6867 0.5195 -0.0177 -0.0353 -0.0312 260 TYR A CD2 
1405 C CE1 . TYR A 177 ? 0.6370 0.6907 0.5277 -0.0202 -0.0356 0.0101  260 TYR A CE1 
1406 C CE2 . TYR A 177 ? 0.6575 0.7431 0.5371 -0.0218 -0.0424 -0.0191 260 TYR A CE2 
1407 C CZ  . TYR A 177 ? 0.6727 0.7527 0.5496 -0.0230 -0.0426 0.0040  260 TYR A CZ  
1408 O OH  . TYR A 177 ? 0.7527 0.8556 0.6157 -0.0276 -0.0500 0.0213  260 TYR A OH  
1409 N N   . ASN A 178 ? 0.5529 0.5433 0.5228 -0.0041 -0.0146 -0.0403 261 ASN A N   
1410 C CA  . ASN A 178 ? 0.4907 0.4713 0.4733 -0.0027 -0.0073 -0.0417 261 ASN A CA  
1411 C C   . ASN A 178 ? 0.4586 0.4361 0.4296 -0.0042 -0.0021 -0.0395 261 ASN A C   
1412 O O   . ASN A 178 ? 0.4163 0.3961 0.3986 -0.0040 -0.0007 -0.0442 261 ASN A O   
1413 C CB  . ASN A 178 ? 0.4189 0.4055 0.4254 -0.0013 -0.0095 -0.0523 261 ASN A CB  
1414 C CG  . ASN A 178 ? 0.4319 0.4090 0.4580 0.0001  -0.0023 -0.0478 261 ASN A CG  
1415 O OD1 . ASN A 178 ? 0.4823 0.4503 0.5013 -0.0003 0.0040  -0.0375 261 ASN A OD1 
1416 N ND2 . ASN A 178 ? 0.4218 0.4031 0.4751 0.0011  -0.0029 -0.0555 261 ASN A ND2 
1417 N N   . VAL A 179 ? 0.4345 0.4077 0.3882 -0.0058 -0.0002 -0.0328 262 VAL A N   
1418 C CA  . VAL A 179 ? 0.4745 0.4455 0.4191 -0.0073 0.0033  -0.0309 262 VAL A CA  
1419 C C   . VAL A 179 ? 0.5215 0.4837 0.4620 -0.0080 0.0086  -0.0249 262 VAL A C   
1420 O O   . VAL A 179 ? 0.5387 0.4965 0.4814 -0.0077 0.0104  -0.0236 262 VAL A O   
1421 C CB  . VAL A 179 ? 0.4879 0.4642 0.4174 -0.0095 0.0017  -0.0306 262 VAL A CB  
1422 C CG1 . VAL A 179 ? 0.5068 0.4970 0.4344 -0.0101 -0.0028 -0.0367 262 VAL A CG1 
1423 C CG2 . VAL A 179 ? 0.4871 0.4574 0.4087 -0.0106 0.0025  -0.0233 262 VAL A CG2 
1424 N N   . ALA A 180 ? 0.5044 0.4661 0.4409 -0.0094 0.0110  -0.0221 263 ALA A N   
1425 C CA  . ALA A 180 ? 0.5217 0.4805 0.4482 -0.0114 0.0155  -0.0189 263 ALA A CA  
1426 C C   . ALA A 180 ? 0.5284 0.4860 0.4432 -0.0133 0.0143  -0.0209 263 ALA A C   
1427 O O   . ALA A 180 ? 0.5527 0.5131 0.4646 -0.0138 0.0111  -0.0210 263 ALA A O   
1428 C CB  . ALA A 180 ? 0.4829 0.4456 0.4093 -0.0129 0.0166  -0.0125 263 ALA A CB  
1429 N N   . VAL A 181 ? 0.5694 0.5236 0.4824 -0.0145 0.0176  -0.0234 264 VAL A N   
1430 C CA  . VAL A 181 ? 0.5216 0.4751 0.4288 -0.0169 0.0170  -0.0257 264 VAL A CA  
1431 C C   . VAL A 181 ? 0.5368 0.4930 0.4365 -0.0201 0.0207  -0.0307 264 VAL A C   
1432 O O   . VAL A 181 ? 0.5552 0.5127 0.4557 -0.0209 0.0263  -0.0346 264 VAL A O   
1433 C CB  . VAL A 181 ? 0.5527 0.5028 0.4691 -0.0166 0.0154  -0.0245 264 VAL A CB  
1434 C CG1 . VAL A 181 ? 0.5702 0.5196 0.4970 -0.0140 0.0135  -0.0210 264 VAL A CG1 
1435 C CG2 . VAL A 181 ? 0.5148 0.4620 0.4382 -0.0190 0.0182  -0.0298 264 VAL A CG2 
1436 N N   . PHE A 182 ? 0.5590 0.5187 0.4510 -0.0223 0.0175  -0.0311 265 PHE A N   
1437 C CA  . PHE A 182 ? 0.5404 0.5075 0.4216 -0.0262 0.0185  -0.0360 265 PHE A CA  
1438 C C   . PHE A 182 ? 0.5711 0.5374 0.4559 -0.0285 0.0167  -0.0438 265 PHE A C   
1439 O O   . PHE A 182 ? 0.6393 0.6034 0.5281 -0.0279 0.0124  -0.0398 265 PHE A O   
1440 C CB  . PHE A 182 ? 0.4669 0.4417 0.3396 -0.0271 0.0138  -0.0269 265 PHE A CB  
1441 C CG  . PHE A 182 ? 0.5216 0.5077 0.3810 -0.0319 0.0113  -0.0300 265 PHE A CG  
1442 C CD1 . PHE A 182 ? 0.5082 0.5058 0.3541 -0.0357 0.0158  -0.0334 265 PHE A CD1 
1443 C CD2 . PHE A 182 ? 0.5009 0.4891 0.3612 -0.0334 0.0043  -0.0304 265 PHE A CD2 
1444 C CE1 . PHE A 182 ? 0.5459 0.5590 0.3760 -0.0412 0.0124  -0.0376 265 PHE A CE1 
1445 C CE2 . PHE A 182 ? 0.5488 0.5498 0.3972 -0.0383 0.0000  -0.0344 265 PHE A CE2 
1446 C CZ  . PHE A 182 ? 0.5369 0.5517 0.3683 -0.0425 0.0034  -0.0382 265 PHE A CZ  
1447 N N   . VAL A 183 ? 0.6062 0.5760 0.4925 -0.0316 0.0208  -0.0564 266 VAL A N   
1448 C CA  . VAL A 183 ? 0.5703 0.5395 0.4681 -0.0340 0.0194  -0.0666 266 VAL A CA  
1449 C C   . VAL A 183 ? 0.5856 0.5684 0.4729 -0.0395 0.0198  -0.0817 266 VAL A C   
1450 O O   . VAL A 183 ? 0.5874 0.5802 0.4621 -0.0419 0.0249  -0.0881 266 VAL A O   
1451 C CB  . VAL A 183 ? 0.5696 0.5291 0.4941 -0.0325 0.0237  -0.0709 266 VAL A CB  
1452 C CG1 . VAL A 183 ? 0.5316 0.4831 0.4611 -0.0282 0.0218  -0.0552 266 VAL A CG1 
1453 C CG2 . VAL A 183 ? 0.5530 0.5152 0.4850 -0.0338 0.0318  -0.0845 266 VAL A CG2 
1454 N N   . THR A 184 ? 0.5633 0.5488 0.4560 -0.0420 0.0145  -0.0877 267 THR A N   
1455 C CA  . THR A 184 ? 0.5792 0.5793 0.4663 -0.0476 0.0137  -0.1057 267 THR A CA  
1456 C C   . THR A 184 ? 0.5861 0.5815 0.5038 -0.0489 0.0190  -0.1252 267 THR A C   
1457 O O   . THR A 184 ? 0.5097 0.4900 0.4548 -0.0454 0.0206  -0.1191 267 THR A O   
1458 C CB  . THR A 184 ? 0.6314 0.6396 0.5100 -0.0500 0.0031  -0.1021 267 THR A CB  
1459 O OG1 . THR A 184 ? 0.6522 0.6495 0.5565 -0.0486 0.0007  -0.1027 267 THR A OG1 
1460 C CG2 . THR A 184 ? 0.6539 0.6626 0.5160 -0.0476 -0.0022 -0.0800 267 THR A CG2 
1461 N N   . ASN A 185 ? 0.6198 0.6308 0.5351 -0.0545 0.0220  -0.1486 268 ASN A N   
1462 C CA  . ASN A 185 ? 0.6234 0.6326 0.5741 -0.0565 0.0274  -0.1718 268 ASN A CA  
1463 C C   . ASN A 185 ? 0.6929 0.7249 0.6366 -0.0640 0.0259  -0.2000 268 ASN A C   
1464 O O   . ASN A 185 ? 0.7323 0.7843 0.6377 -0.0682 0.0230  -0.2009 268 ASN A O   
1465 C CB  . ASN A 185 ? 0.6132 0.6152 0.5814 -0.0541 0.0385  -0.1757 268 ASN A CB  
1466 C CG  . ASN A 185 ? 0.7054 0.7034 0.7224 -0.0555 0.0447  -0.1985 268 ASN A CG  
1467 O OD1 . ASN A 185 ? 0.7877 0.7920 0.8169 -0.0574 0.0548  -0.2175 268 ASN A OD1 
1468 N ND2 . ASN A 185 ? 0.7244 0.7133 0.7743 -0.0549 0.0396  -0.1973 268 ASN A ND2 
1469 N N   . GLN A 186 ? 0.7515 0.7821 0.7346 -0.0662 0.0273  -0.2224 269 GLN A N   
1470 C CA  . GLN A 186 ? 0.7942 0.8470 0.7796 -0.0737 0.0249  -0.2545 269 GLN A CA  
1471 C C   . GLN A 186 ? 0.8781 0.9467 0.8728 -0.0786 0.0373  -0.2877 269 GLN A C   
1472 O O   . GLN A 186 ? 0.9381 0.9969 0.9472 -0.0755 0.0482  -0.2863 269 GLN A O   
1473 C CB  . GLN A 186 ? 0.7614 0.8045 0.7941 -0.0737 0.0201  -0.2634 269 GLN A CB  
1474 C CG  . GLN A 186 ? 0.7914 0.8237 0.8188 -0.0705 0.0088  -0.2366 269 GLN A CG  
1475 C CD  . GLN A 186 ? 0.8082 0.8157 0.8471 -0.0631 0.0114  -0.2044 269 GLN A CD  
1476 O OE1 . GLN A 186 ? 0.8085 0.8018 0.8876 -0.0604 0.0178  -0.2032 269 GLN A OE1 
1477 N NE2 . GLN A 186 ? 0.7555 0.7599 0.7612 -0.0601 0.0058  -0.1784 269 GLN A NE2 
1478 N N   . MET A 187 ? 0.9539 1.0486 0.9435 -0.0865 0.0356  -0.3200 270 MET A N   
1479 C CA  . MET A 187 ? 1.0235 1.1403 1.0183 -0.0929 0.0483  -0.3577 270 MET A CA  
1480 C C   . MET A 187 ? 1.0753 1.1928 1.1324 -0.0959 0.0517  -0.3961 270 MET A C   
1481 O O   . MET A 187 ? 1.1411 1.2429 1.2326 -0.0933 0.0429  -0.3897 270 MET A O   
1482 C CB  . MET A 187 ? 1.0586 1.2135 0.9942 -0.1016 0.0444  -0.3681 270 MET A CB  
1483 C CG  . MET A 187 ? 1.0885 1.2459 0.9686 -0.0995 0.0396  -0.3294 270 MET A CG  
1484 S SD  . MET A 187 ? 1.2056 1.3816 1.0541 -0.1028 0.0572  -0.3327 270 MET A SD  
1485 C CE  . MET A 187 ? 1.1823 1.4131 0.9766 -0.1165 0.0543  -0.3559 270 MET A CE  
1486 N N   . THR A 188 ? 1.1157 1.2511 1.1919 -0.1013 0.0656  -0.4354 271 THR A N   
1487 C CA  . THR A 188 ? 1.1403 1.2934 1.2625 -0.1083 0.0686  -0.4857 271 THR A CA  
1488 C C   . THR A 188 ? 1.1141 1.3052 1.2156 -0.1177 0.0823  -0.5286 271 THR A C   
1489 O O   . THR A 188 ? 1.0319 1.2267 1.1083 -0.1172 0.0945  -0.5214 271 THR A O   
1490 C CB  . THR A 188 ? 1.1153 1.2412 1.3287 -0.1036 0.0742  -0.4959 271 THR A CB  
1491 O OG1 . THR A 188 ? 1.0039 1.1017 1.2356 -0.0954 0.0815  -0.4655 271 THR A OG1 
1492 C CG2 . THR A 188 ? 1.0423 1.1520 1.2882 -0.1011 0.0599  -0.4830 271 THR A CG2 
1493 N N   . LYS A 203 ? 0.9942 1.1954 1.0031 -0.1151 0.1158  -0.4891 286 LYS A N   
1494 C CA  . LYS A 203 ? 1.0669 1.2406 1.0697 -0.1063 0.1187  -0.4478 286 LYS A CA  
1495 C C   . LYS A 203 ? 1.0310 1.1667 1.0482 -0.0964 0.1023  -0.4058 286 LYS A C   
1496 O O   . LYS A 203 ? 1.0375 1.1684 1.0701 -0.0964 0.0901  -0.4082 286 LYS A O   
1497 C CB  . LYS A 203 ? 1.1076 1.2724 1.1617 -0.1044 0.1379  -0.4670 286 LYS A CB  
1498 C CG  . LYS A 203 ? 1.2370 1.4339 1.3141 -0.1140 0.1553  -0.5243 286 LYS A CG  
1499 C CD  . LYS A 203 ? 1.2439 1.4820 1.2603 -0.1232 0.1686  -0.5382 286 LYS A CD  
1500 C CE  . LYS A 203 ? 1.2156 1.4914 1.2527 -0.1343 0.1845  -0.6011 286 LYS A CE  
1501 N NZ  . LYS A 203 ? 1.2401 1.5277 1.2924 -0.1391 0.1721  -0.6297 286 LYS A NZ  
1502 N N   . PRO A 204 ? 1.0405 1.1518 1.0521 -0.0884 0.1020  -0.3681 287 PRO A N   
1503 C CA  . PRO A 204 ? 0.9630 1.0432 0.9879 -0.0801 0.0878  -0.3324 287 PRO A CA  
1504 C C   . PRO A 204 ? 0.8801 0.9356 0.9766 -0.0754 0.0886  -0.3367 287 PRO A C   
1505 O O   . PRO A 204 ? 0.9211 0.9744 1.0616 -0.0755 0.1008  -0.3565 287 PRO A O   
1506 C CB  . PRO A 204 ? 0.9780 1.0454 0.9746 -0.0742 0.0882  -0.2961 287 PRO A CB  
1507 C CG  . PRO A 204 ? 1.0314 1.1128 1.0269 -0.0772 0.1052  -0.3137 287 PRO A CG  
1508 C CD  . PRO A 204 ? 0.9994 1.1145 0.9842 -0.0873 0.1127  -0.3544 287 PRO A CD  
1509 N N   . ILE A 205 ? 0.8306 0.8687 0.9426 -0.0716 0.0763  -0.3168 288 ILE A N   
1510 C CA  . ILE A 205 ? 0.8282 0.8436 1.0089 -0.0672 0.0763  -0.3123 288 ILE A CA  
1511 C C   . ILE A 205 ? 0.7531 0.7478 0.9431 -0.0600 0.0778  -0.2808 288 ILE A C   
1512 O O   . ILE A 205 ? 0.8084 0.8050 0.9529 -0.0582 0.0782  -0.2642 288 ILE A O   
1513 C CB  . ILE A 205 ? 0.8492 0.8552 1.0501 -0.0664 0.0644  -0.3020 288 ILE A CB  
1514 C CG1 . ILE A 205 ? 0.8372 0.8357 0.9899 -0.0627 0.0530  -0.2646 288 ILE A CG1 
1515 C CG2 . ILE A 205 ? 0.8405 0.8671 1.0494 -0.0739 0.0631  -0.3396 288 ILE A CG2 
1516 C CD1 . ILE A 205 ? 0.8465 0.8346 1.0248 -0.0616 0.0438  -0.2517 288 ILE A CD1 
1517 N N   . GLY A 206 ? 0.7358 0.7129 0.9874 -0.0562 0.0782  -0.2726 289 GLY A N   
1518 C CA  . GLY A 206 ? 0.7579 0.7184 1.0188 -0.0499 0.0773  -0.2419 289 GLY A CA  
1519 C C   . GLY A 206 ? 0.7783 0.7366 1.0811 -0.0489 0.0882  -0.2541 289 GLY A C   
1520 O O   . GLY A 206 ? 0.7589 0.7030 1.0827 -0.0437 0.0851  -0.2279 289 GLY A O   
1521 N N   . GLY A 207 ? 0.7762 0.7505 1.0922 -0.0542 0.1009  -0.2944 290 GLY A N   
1522 C CA  . GLY A 207 ? 0.7636 0.7380 1.1280 -0.0540 0.1138  -0.3127 290 GLY A CA  
1523 C C   . GLY A 207 ? 0.7688 0.7377 1.1087 -0.0497 0.1159  -0.2905 290 GLY A C   
1524 O O   . GLY A 207 ? 0.8029 0.7755 1.0775 -0.0489 0.1119  -0.2725 290 GLY A O   
1525 N N   . HIS A 208 ? 0.7946 0.7545 1.1935 -0.0470 0.1217  -0.2916 291 HIS A N   
1526 C CA  . HIS A 208 ? 0.7659 0.7182 1.1547 -0.0423 0.1216  -0.2685 291 HIS A CA  
1527 C C   . HIS A 208 ? 0.6846 0.6234 1.0407 -0.0367 0.1047  -0.2238 291 HIS A C   
1528 O O   . HIS A 208 ? 0.6400 0.5783 0.9583 -0.0342 0.1033  -0.2072 291 HIS A O   
1529 C CB  . HIS A 208 ? 0.7813 0.7249 1.2511 -0.0399 0.1275  -0.2743 291 HIS A CB  
1530 C CG  . HIS A 208 ? 0.9580 0.9166 1.4668 -0.0453 0.1473  -0.3223 291 HIS A CG  
1531 N ND1 . HIS A 208 ? 1.0094 0.9697 1.5849 -0.0483 0.1521  -0.3506 291 HIS A ND1 
1532 C CD2 . HIS A 208 ? 0.9692 0.9439 1.4623 -0.0488 0.1649  -0.3483 291 HIS A CD2 
1533 C CE1 . HIS A 208 ? 0.9707 0.9484 1.5707 -0.0536 0.1720  -0.3958 291 HIS A CE1 
1534 N NE2 . HIS A 208 ? 0.9685 0.9558 1.5153 -0.0541 0.1803  -0.3934 291 HIS A NE2 
1535 N N   . ILE A 209 ? 0.6300 0.5591 1.0037 -0.0352 0.0926  -0.2046 292 ILE A N   
1536 C CA  . ILE A 209 ? 0.6945 0.6135 1.0445 -0.0304 0.0778  -0.1631 292 ILE A CA  
1537 C C   . ILE A 209 ? 0.7162 0.6418 0.9867 -0.0306 0.0749  -0.1551 292 ILE A C   
1538 O O   . ILE A 209 ? 0.7154 0.6381 0.9581 -0.0272 0.0698  -0.1340 292 ILE A O   
1539 C CB  . ILE A 209 ? 0.7533 0.6647 1.1322 -0.0299 0.0673  -0.1436 292 ILE A CB  
1540 C CG1 . ILE A 209 ? 0.8415 0.7470 1.3080 -0.0302 0.0704  -0.1514 292 ILE A CG1 
1541 C CG2 . ILE A 209 ? 0.7211 0.6267 1.0772 -0.0260 0.0534  -0.1018 292 ILE A CG2 
1542 C CD1 . ILE A 209 ? 0.9372 0.8388 1.4410 -0.0317 0.0648  -0.1440 292 ILE A CD1 
1543 N N   . LEU A 210 ? 0.7158 0.6516 0.9545 -0.0349 0.0780  -0.1736 293 LEU A N   
1544 C CA  . LEU A 210 ? 0.6860 0.6282 0.8581 -0.0353 0.0735  -0.1637 293 LEU A CA  
1545 C C   . LEU A 210 ? 0.6676 0.6203 0.8077 -0.0366 0.0827  -0.1736 293 LEU A C   
1546 O O   . LEU A 210 ? 0.6809 0.6338 0.7817 -0.0345 0.0788  -0.1558 293 LEU A O   
1547 C CB  . LEU A 210 ? 0.6851 0.6358 0.8400 -0.0397 0.0716  -0.1775 293 LEU A CB  
1548 C CG  . LEU A 210 ? 0.7213 0.6701 0.8361 -0.0384 0.0605  -0.1552 293 LEU A CG  
1549 C CD1 . LEU A 210 ? 0.8484 0.8120 0.9404 -0.0439 0.0615  -0.1771 293 LEU A CD1 
1550 C CD2 . LEU A 210 ? 0.7176 0.6660 0.7887 -0.0353 0.0569  -0.1344 293 LEU A CD2 
1551 N N   . ALA A 211 ? 0.6523 0.6150 0.8131 -0.0404 0.0961  -0.2030 294 ALA A N   
1552 C CA  . ALA A 211 ? 0.6493 0.6244 0.7851 -0.0424 0.1075  -0.2125 294 ALA A CA  
1553 C C   . ALA A 211 ? 0.6521 0.6152 0.7933 -0.0366 0.1049  -0.1882 294 ALA A C   
1554 O O   . ALA A 211 ? 0.6386 0.6067 0.7423 -0.0361 0.1062  -0.1772 294 ALA A O   
1555 C CB  . ALA A 211 ? 0.6096 0.5978 0.7794 -0.0476 0.1241  -0.2503 294 ALA A CB  
1556 N N   . HIS A 212 ? 0.6264 0.5745 0.8173 -0.0323 0.0998  -0.1782 295 HIS A N   
1557 C CA  . HIS A 212 ? 0.5999 0.5396 0.8014 -0.0275 0.0968  -0.1592 295 HIS A CA  
1558 C C   . HIS A 212 ? 0.6264 0.5618 0.7840 -0.0241 0.0833  -0.1301 295 HIS A C   
1559 O O   . HIS A 212 ? 0.5939 0.5293 0.7356 -0.0218 0.0830  -0.1193 295 HIS A O   
1560 C CB  . HIS A 212 ? 0.5844 0.5125 0.8526 -0.0245 0.0931  -0.1540 295 HIS A CB  
1561 C CG  . HIS A 212 ? 0.6592 0.5789 0.9361 -0.0192 0.0832  -0.1275 295 HIS A CG  
1562 N ND1 . HIS A 212 ? 0.6280 0.5413 0.8944 -0.0159 0.0661  -0.0975 295 HIS A ND1 
1563 C CD2 . HIS A 212 ? 0.6549 0.5746 0.9455 -0.0172 0.0883  -0.1277 295 HIS A CD2 
1564 C CE1 . HIS A 212 ? 0.6481 0.5589 0.9211 -0.0123 0.0597  -0.0816 295 HIS A CE1 
1565 N NE2 . HIS A 212 ? 0.7326 0.6459 1.0225 -0.0127 0.0729  -0.0995 295 HIS A NE2 
1566 N N   . ALA A 213 ? 0.6040 0.5364 0.7464 -0.0241 0.0730  -0.1192 296 ALA A N   
1567 C CA  . ALA A 213 ? 0.6126 0.5414 0.7252 -0.0210 0.0604  -0.0939 296 ALA A CA  
1568 C C   . ALA A 213 ? 0.6405 0.5768 0.7025 -0.0220 0.0614  -0.0923 296 ALA A C   
1569 O O   . ALA A 213 ? 0.6602 0.5946 0.7045 -0.0190 0.0544  -0.0757 296 ALA A O   
1570 C CB  . ALA A 213 ? 0.5846 0.5091 0.7029 -0.0209 0.0507  -0.0820 296 ALA A CB  
1571 N N   . SER A 214 ? 0.6527 0.5995 0.6945 -0.0265 0.0692  -0.1091 297 SER A N   
1572 C CA  . SER A 214 ? 0.6390 0.5952 0.6369 -0.0281 0.0691  -0.1042 297 SER A CA  
1573 C C   . SER A 214 ? 0.6842 0.6463 0.6810 -0.0284 0.0794  -0.1074 297 SER A C   
1574 O O   . SER A 214 ? 0.7324 0.6998 0.7488 -0.0310 0.0912  -0.1257 297 SER A O   
1575 C CB  . SER A 214 ? 0.6708 0.6400 0.6470 -0.0337 0.0718  -0.1188 297 SER A CB  
1576 O OG  . SER A 214 ? 0.7201 0.6850 0.7106 -0.0346 0.0660  -0.1242 297 SER A OG  
1577 N N   . THR A 215 ? 0.6090 0.5711 0.5876 -0.0262 0.0762  -0.0914 298 THR A N   
1578 C CA  . THR A 215 ? 0.6444 0.6120 0.6273 -0.0267 0.0867  -0.0932 298 THR A CA  
1579 C C   . THR A 215 ? 0.6591 0.6456 0.6097 -0.0324 0.0954  -0.0963 298 THR A C   
1580 O O   . THR A 215 ? 0.6758 0.6728 0.6273 -0.0350 0.1082  -0.1016 298 THR A O   
1581 C CB  . THR A 215 ? 0.7037 0.6613 0.7011 -0.0211 0.0807  -0.0773 298 THR A CB  
1582 O OG1 . THR A 215 ? 0.6866 0.6506 0.6650 -0.0214 0.0819  -0.0658 298 THR A OG1 
1583 C CG2 . THR A 215 ? 0.6226 0.5691 0.6273 -0.0171 0.0658  -0.0663 298 THR A CG2 
1584 N N   . THR A 216 ? 0.6691 0.6619 0.5924 -0.0348 0.0884  -0.0924 299 THR A N   
1585 C CA  . THR A 216 ? 0.6570 0.6712 0.5490 -0.0412 0.0938  -0.0943 299 THR A CA  
1586 C C   . THR A 216 ? 0.6815 0.7011 0.5615 -0.0446 0.0877  -0.1060 299 THR A C   
1587 O O   . THR A 216 ? 0.6943 0.7015 0.5773 -0.0412 0.0754  -0.0979 299 THR A O   
1588 C CB  . THR A 216 ? 0.6450 0.6622 0.5185 -0.0402 0.0868  -0.0694 299 THR A CB  
1589 O OG1 . THR A 216 ? 0.6304 0.6403 0.5219 -0.0363 0.0908  -0.0589 299 THR A OG1 
1590 C CG2 . THR A 216 ? 0.6761 0.7185 0.5178 -0.0473 0.0906  -0.0652 299 THR A CG2 
1591 N N   . ARG A 217 ? 0.6925 0.7325 0.5597 -0.0516 0.0965  -0.1259 300 ARG A N   
1592 C CA  . ARG A 217 ? 0.6673 0.7172 0.5239 -0.0561 0.0912  -0.1414 300 ARG A CA  
1593 C C   . ARG A 217 ? 0.6891 0.7688 0.5054 -0.0640 0.0924  -0.1407 300 ARG A C   
1594 O O   . ARG A 217 ? 0.6976 0.7976 0.5013 -0.0693 0.1056  -0.1486 300 ARG A O   
1595 C CB  . ARG A 217 ? 0.6482 0.6982 0.5345 -0.0583 0.0995  -0.1731 300 ARG A CB  
1596 C CG  . ARG A 217 ? 0.6365 0.6636 0.5690 -0.0522 0.1025  -0.1753 300 ARG A CG  
1597 C CD  . ARG A 217 ? 0.6420 0.6580 0.6071 -0.0512 0.0970  -0.1883 300 ARG A CD  
1598 N NE  . ARG A 217 ? 0.6702 0.6936 0.6690 -0.0550 0.1089  -0.2206 300 ARG A NE  
1599 C CZ  . ARG A 217 ? 0.6858 0.7088 0.7123 -0.0571 0.1070  -0.2407 300 ARG A CZ  
1600 N NH1 . ARG A 217 ? 0.6856 0.7013 0.7080 -0.0560 0.0938  -0.2305 300 ARG A NH1 
1601 N NH2 . ARG A 217 ? 0.7226 0.7538 0.7857 -0.0608 0.1195  -0.2731 300 ARG A NH2 
1602 N N   . ILE A 218 ? 0.6835 0.7672 0.4812 -0.0651 0.0784  -0.1303 301 ILE A N   
1603 C CA  . ILE A 218 ? 0.7050 0.8170 0.4657 -0.0722 0.0744  -0.1233 301 ILE A CA  
1604 C C   . ILE A 218 ? 0.7468 0.8743 0.4989 -0.0782 0.0690  -0.1472 301 ILE A C   
1605 O O   . ILE A 218 ? 0.6939 0.8060 0.4624 -0.0750 0.0586  -0.1502 301 ILE A O   
1606 C CB  . ILE A 218 ? 0.6968 0.8026 0.4484 -0.0689 0.0602  -0.0903 301 ILE A CB  
1607 C CG1 . ILE A 218 ? 0.7526 0.8445 0.5168 -0.0633 0.0646  -0.0685 301 ILE A CG1 
1608 C CG2 . ILE A 218 ? 0.7255 0.8630 0.4419 -0.0766 0.0545  -0.0771 301 ILE A CG2 
1609 C CD1 . ILE A 218 ? 0.7976 0.8736 0.5713 -0.0576 0.0509  -0.0439 301 ILE A CD1 
1610 N N   . SER A 219 ? 0.7949 0.9561 0.5209 -0.0875 0.0763  -0.1643 302 SER A N   
1611 C CA  . SER A 219 ? 0.8160 0.9984 0.5293 -0.0944 0.0690  -0.1866 302 SER A CA  
1612 C C   . SER A 219 ? 0.8334 1.0361 0.5115 -0.0984 0.0537  -0.1612 302 SER A C   
1613 O O   . SER A 219 ? 0.8649 1.0818 0.5197 -0.1005 0.0552  -0.1356 302 SER A O   
1614 C CB  . SER A 219 ? 0.8638 1.0784 0.5646 -0.1038 0.0835  -0.2210 302 SER A CB  
1615 O OG  . SER A 219 ? 0.9438 1.1896 0.6150 -0.1122 0.0724  -0.2306 302 SER A OG  
1616 N N   . LEU A 220 ? 0.8468 1.0520 0.5256 -0.0999 0.0388  -0.1677 303 LEU A N   
1617 C CA  . LEU A 220 ? 0.8559 1.0806 0.5077 -0.1037 0.0216  -0.1441 303 LEU A CA  
1618 C C   . LEU A 220 ? 0.9440 1.2015 0.5774 -0.1133 0.0143  -0.1717 303 LEU A C   
1619 O O   . LEU A 220 ? 0.9878 1.2399 0.6435 -0.1139 0.0180  -0.2068 303 LEU A O   
1620 C CB  . LEU A 220 ? 0.8259 1.0198 0.5019 -0.0952 0.0076  -0.1216 303 LEU A CB  
1621 C CG  . LEU A 220 ? 0.8067 0.9684 0.5043 -0.0855 0.0111  -0.0962 303 LEU A CG  
1622 C CD1 . LEU A 220 ? 0.7137 0.8502 0.4358 -0.0788 -0.0015 -0.0843 303 LEU A CD1 
1623 C CD2 . LEU A 220 ? 0.8337 1.0107 0.5108 -0.0873 0.0112  -0.0647 303 LEU A CD2 
1624 N N   . ARG A 221 ? 1.0138 1.3069 0.6092 -0.1212 0.0035  -0.1550 304 ARG A N   
1625 C CA  . ARG A 221 ? 1.0640 1.3969 0.6341 -0.1320 -0.0066 -0.1776 304 ARG A CA  
1626 C C   . ARG A 221 ? 1.1370 1.4973 0.6742 -0.1368 -0.0244 -0.1375 304 ARG A C   
1627 O O   . ARG A 221 ? 1.1338 1.4838 0.6704 -0.1325 -0.0241 -0.0980 304 ARG A O   
1628 C CB  . ARG A 221 ? 1.0487 1.4153 0.5982 -0.1416 0.0108  -0.2162 304 ARG A CB  
1629 C CG  . ARG A 221 ? 1.0900 1.4875 0.5995 -0.1480 0.0214  -0.1956 304 ARG A CG  
1630 C CD  . ARG A 221 ? 1.1039 1.5281 0.6013 -0.1558 0.0445  -0.2349 304 ARG A CD  
1631 N NE  . ARG A 221 ? 1.1704 1.6425 0.6163 -0.1666 0.0498  -0.2167 304 ARG A NE  
1632 C CZ  . ARG A 221 ? 1.1766 1.6497 0.6141 -0.1660 0.0662  -0.1945 304 ARG A CZ  
1633 N NH1 . ARG A 221 ? 1.1074 1.5358 0.5848 -0.1549 0.0787  -0.1895 304 ARG A NH1 
1634 N NH2 . ARG A 221 ? 1.1866 1.7087 0.5759 -0.1773 0.0700  -0.1766 304 ARG A NH2 
1635 N N   . LYS A 222 ? 1.1398 1.5353 0.6544 -0.1458 -0.0406 -0.1465 305 LYS A N   
1636 C CA  . LYS A 222 ? 1.1203 1.5377 0.6146 -0.1492 -0.0620 -0.1053 305 LYS A CA  
1637 C C   . LYS A 222 ? 1.1395 1.6144 0.5809 -0.1628 -0.0628 -0.0992 305 LYS A C   
1638 O O   . LYS A 222 ? 1.1867 1.6916 0.6055 -0.1715 -0.0536 -0.1389 305 LYS A O   
1639 C CB  . LYS A 222 ? 1.1357 1.5508 0.6472 -0.1489 -0.0846 -0.1113 305 LYS A CB  
1640 C CG  . LYS A 222 ? 1.1439 1.5648 0.6653 -0.1527 -0.0829 -0.1645 305 LYS A CG  
1641 C CD  . LYS A 222 ? 1.1816 1.5827 0.7373 -0.1482 -0.1019 -0.1653 305 LYS A CD  
1642 C CE  . LYS A 222 ? 1.2542 1.6838 0.7914 -0.1533 -0.1281 -0.1313 305 LYS A CE  
1643 N NZ  . LYS A 222 ? 1.1966 1.6092 0.7697 -0.1493 -0.1468 -0.1315 305 LYS A NZ  
1644 N N   . GLY A 223 ? 1.1666 1.6581 0.5911 -0.1648 -0.0730 -0.0493 306 GLY A N   
1645 C CA  . GLY A 223 ? 1.2559 1.8097 0.6280 -0.1791 -0.0823 -0.0315 306 GLY A CA  
1646 C C   . GLY A 223 ? 1.2528 1.8299 0.6197 -0.1838 -0.1134 -0.0157 306 GLY A C   
1647 O O   . GLY A 223 ? 1.1692 1.7242 0.5645 -0.1792 -0.1243 -0.0386 306 GLY A O   
1648 N N   . ARG A 224 ? 1.3364 1.9580 0.6707 -0.1930 -0.1282 0.0258  307 ARG A N   
1649 C CA  . ARG A 224 ? 1.4134 2.0630 0.7423 -0.1986 -0.1602 0.0447  307 ARG A CA  
1650 C C   . ARG A 224 ? 1.4592 2.0613 0.8464 -0.1859 -0.1770 0.0692  307 ARG A C   
1651 O O   . ARG A 224 ? 1.5065 2.0969 0.9162 -0.1812 -0.1844 0.1198  307 ARG A O   
1652 C CB  . ARG A 224 ? 1.4003 2.1087 0.6851 -0.2111 -0.1726 0.0915  307 ARG A CB  
1653 C CG  . ARG A 224 ? 1.3931 2.0881 0.6898 -0.2065 -0.1614 0.1429  307 ARG A CG  
1654 C CD  . ARG A 224 ? 1.4411 2.2000 0.6809 -0.2214 -0.1577 0.1699  307 ARG A CD  
1655 N NE  . ARG A 224 ? 1.4470 2.2389 0.6843 -0.2271 -0.1842 0.2338  307 ARG A NE  
1656 C CZ  . ARG A 224 ? 1.4801 2.3147 0.6965 -0.2364 -0.2137 0.2437  307 ARG A CZ  
1657 N NH1 . ARG A 224 ? 1.4667 2.3165 0.6626 -0.2413 -0.2211 0.1907  307 ARG A NH1 
1658 N NH2 . ARG A 224 ? 1.5123 2.3751 0.7331 -0.2410 -0.2370 0.3081  307 ARG A NH2 
1659 N N   . GLY A 225 ? 1.4304 2.0061 0.8458 -0.1808 -0.1818 0.0322  308 GLY A N   
1660 C CA  . GLY A 225 ? 1.4585 1.9943 0.9271 -0.1703 -0.1965 0.0497  308 GLY A CA  
1661 C C   . GLY A 225 ? 1.5334 2.0138 1.0436 -0.1564 -0.1794 0.0645  308 GLY A C   
1662 O O   . GLY A 225 ? 1.6464 2.0946 1.1681 -0.1502 -0.1583 0.0319  308 GLY A O   
1663 N N   . GLU A 226 ? 1.5563 2.0277 1.0917 -0.1520 -0.1891 0.1137  309 GLU A N   
1664 C CA  . GLU A 226 ? 1.4668 1.8879 1.0479 -0.1390 -0.1763 0.1294  309 GLU A CA  
1665 C C   . GLU A 226 ? 1.3524 1.7618 0.9199 -0.1367 -0.1495 0.1245  309 GLU A C   
1666 O O   . GLU A 226 ? 1.2839 1.6509 0.8852 -0.1262 -0.1361 0.1242  309 GLU A O   
1667 C CB  . GLU A 226 ? 1.5225 1.9426 1.1391 -0.1362 -0.1937 0.1820  309 GLU A CB  
1668 C CG  . GLU A 226 ? 1.6870 2.1605 1.2724 -0.1478 -0.2097 0.2225  309 GLU A CG  
1669 C CD  . GLU A 226 ? 1.6985 2.1680 1.3237 -0.1443 -0.2183 0.2793  309 GLU A CD  
1670 O OE1 . GLU A 226 ? 1.5986 2.0285 1.2620 -0.1342 -0.2029 0.2848  309 GLU A OE1 
1671 O OE2 . GLU A 226 ? 1.5631 2.0714 1.1838 -0.1522 -0.2411 0.3186  309 GLU A OE2 
1672 N N   . LEU A 227 ? 1.2555 1.7049 0.7738 -0.1471 -0.1421 0.1196  310 LEU A N   
1673 C CA  . LEU A 227 ? 1.1444 1.5898 0.6481 -0.1466 -0.1170 0.1162  310 LEU A CA  
1674 C C   . LEU A 227 ? 1.0701 1.4931 0.5726 -0.1433 -0.0965 0.0636  310 LEU A C   
1675 O O   . LEU A 227 ? 1.0360 1.4777 0.5181 -0.1495 -0.0982 0.0262  310 LEU A O   
1676 C CB  . LEU A 227 ? 1.2098 1.7117 0.6622 -0.1601 -0.1163 0.1336  310 LEU A CB  
1677 C CG  . LEU A 227 ? 1.2228 1.7242 0.6777 -0.1590 -0.1012 0.1685  310 LEU A CG  
1678 C CD1 . LEU A 227 ? 1.1893 1.6706 0.6908 -0.1519 -0.1156 0.2190  310 LEU A CD1 
1679 C CD2 . LEU A 227 ? 1.3366 1.8996 0.7350 -0.1740 -0.0983 0.1819  310 LEU A CD2 
1680 N N   . ARG A 228 ? 1.0160 1.3990 0.5457 -0.1336 -0.0785 0.0608  311 ARG A N   
1681 C CA  . ARG A 228 ? 0.9536 1.3136 0.4891 -0.1299 -0.0588 0.0167  311 ARG A CA  
1682 C C   . ARG A 228 ? 0.9335 1.2936 0.4600 -0.1298 -0.0360 0.0188  311 ARG A C   
1683 O O   . ARG A 228 ? 0.9667 1.3277 0.4978 -0.1285 -0.0348 0.0569  311 ARG A O   
1684 C CB  . ARG A 228 ? 0.9461 1.2563 0.5276 -0.1178 -0.0597 0.0067  311 ARG A CB  
1685 C CG  . ARG A 228 ? 0.9337 1.2420 0.5250 -0.1185 -0.0739 -0.0158 311 ARG A CG  
1686 C CD  . ARG A 228 ? 1.0606 1.3927 0.6468 -0.1229 -0.0980 0.0134  311 ARG A CD  
1687 N NE  . ARG A 228 ? 1.1572 1.4905 0.7549 -0.1242 -0.1134 -0.0065 311 ARG A NE  
1688 C CZ  . ARG A 228 ? 1.1991 1.5082 0.8181 -0.1201 -0.1068 -0.0423 311 ARG A CZ  
1689 N NH1 . ARG A 228 ? 1.1375 1.4203 0.7675 -0.1148 -0.0860 -0.0620 311 ARG A NH1 
1690 N NH2 . ARG A 228 ? 1.2279 1.5402 0.8606 -0.1217 -0.1216 -0.0567 311 ARG A NH2 
1691 N N   . ILE A 229 ? 0.9055 1.2659 0.4240 -0.1317 -0.0182 -0.0219 312 ILE A N   
1692 C CA  . ILE A 229 ? 0.9005 1.2626 0.4126 -0.1323 0.0051  -0.0253 312 ILE A CA  
1693 C C   . ILE A 229 ? 0.8760 1.1918 0.4274 -0.1215 0.0190  -0.0471 312 ILE A C   
1694 O O   . ILE A 229 ? 0.8223 1.1207 0.3914 -0.1187 0.0191  -0.0806 312 ILE A O   
1695 C CB  . ILE A 229 ? 0.9704 1.3762 0.4436 -0.1444 0.0179  -0.0576 312 ILE A CB  
1696 C CG1 . ILE A 229 ? 1.0277 1.4896 0.4537 -0.1578 0.0029  -0.0448 312 ILE A CG1 
1697 C CG2 . ILE A 229 ? 0.9853 1.3916 0.4575 -0.1447 0.0431  -0.0597 312 ILE A CG2 
1698 C CD1 . ILE A 229 ? 1.0287 1.5090 0.4416 -0.1603 -0.0080 0.0129  312 ILE A CD1 
1699 N N   . ALA A 230 ? 0.8539 1.1509 0.4215 -0.1158 0.0303  -0.0271 313 ALA A N   
1700 C CA  . ALA A 230 ? 0.8289 1.0863 0.4319 -0.1064 0.0426  -0.0454 313 ALA A CA  
1701 C C   . ALA A 230 ? 0.8581 1.1267 0.4546 -0.1097 0.0652  -0.0595 313 ALA A C   
1702 O O   . ALA A 230 ? 0.8826 1.1812 0.4539 -0.1165 0.0722  -0.0417 313 ALA A O   
1703 C CB  . ALA A 230 ? 0.7933 1.0149 0.4293 -0.0957 0.0361  -0.0165 313 ALA A CB  
1704 N N   . LYS A 231 ? 0.8458 1.0911 0.4685 -0.1049 0.0767  -0.0899 314 LYS A N   
1705 C CA  . LYS A 231 ? 0.8601 1.1173 0.4825 -0.1086 0.0989  -0.1125 314 LYS A CA  
1706 C C   . LYS A 231 ? 0.8513 1.0686 0.5192 -0.0989 0.1067  -0.1273 314 LYS A C   
1707 O O   . LYS A 231 ? 0.8144 1.0074 0.5064 -0.0935 0.0981  -0.1414 314 LYS A O   
1708 C CB  . LYS A 231 ? 0.9119 1.2055 0.5093 -0.1195 0.1043  -0.1499 314 LYS A CB  
1709 C CG  . LYS A 231 ? 0.9317 1.2296 0.5453 -0.1219 0.1273  -0.1883 314 LYS A CG  
1710 C CD  . LYS A 231 ? 0.9118 1.2619 0.4843 -0.1354 0.1410  -0.2028 314 LYS A CD  
1711 C CE  . LYS A 231 ? 0.9495 1.3005 0.5379 -0.1357 0.1667  -0.2141 314 LYS A CE  
1712 N NZ  . LYS A 231 ? 1.0067 1.4117 0.5537 -0.1494 0.1843  -0.2253 314 LYS A NZ  
1713 N N   . ILE A 232 ? 0.8271 1.0378 0.5086 -0.0964 0.1216  -0.1204 315 ILE A N   
1714 C CA  . ILE A 232 ? 0.8499 1.0292 0.5741 -0.0887 0.1297  -0.1361 315 ILE A CA  
1715 C C   . ILE A 232 ? 0.9305 1.1200 0.6655 -0.0933 0.1406  -0.1796 315 ILE A C   
1716 O O   . ILE A 232 ? 1.0749 1.2979 0.7893 -0.1025 0.1552  -0.1985 315 ILE A O   
1717 C CB  . ILE A 232 ? 0.8310 1.0071 0.5684 -0.0867 0.1446  -0.1236 315 ILE A CB  
1718 C CG1 . ILE A 232 ? 0.7996 0.9507 0.5516 -0.0783 0.1335  -0.0882 315 ILE A CG1 
1719 C CG2 . ILE A 232 ? 0.8202 0.9786 0.5978 -0.0828 0.1575  -0.1506 315 ILE A CG2 
1720 C CD1 . ILE A 232 ? 0.8384 1.0076 0.5623 -0.0819 0.1243  -0.0555 315 ILE A CD1 
1721 N N   . TYR A 233 ? 0.9672 1.1307 0.7361 -0.0876 0.1342  -0.1961 316 TYR A N   
1722 C CA  . TYR A 233 ? 1.0710 1.2418 0.8628 -0.0915 0.1443  -0.2385 316 TYR A CA  
1723 C C   . TYR A 233 ? 1.1715 1.3412 0.9912 -0.0911 0.1649  -0.2535 316 TYR A C   
1724 O O   . TYR A 233 ? 1.0644 1.2115 0.9046 -0.0840 0.1664  -0.2327 316 TYR A O   
1725 C CB  . TYR A 233 ? 1.0711 1.2136 0.9002 -0.0854 0.1326  -0.2474 316 TYR A CB  
1726 C CG  . TYR A 233 ? 1.1431 1.2930 1.0045 -0.0895 0.1410  -0.2910 316 TYR A CG  
1727 C CD1 . TYR A 233 ? 1.1741 1.3561 1.0128 -0.0990 0.1413  -0.3189 316 TYR A CD1 
1728 C CD2 . TYR A 233 ? 1.1457 1.2713 1.0653 -0.0839 0.1473  -0.3043 316 TYR A CD2 
1729 C CE1 . TYR A 233 ? 1.1953 1.3845 1.0705 -0.1029 0.1489  -0.3623 316 TYR A CE1 
1730 C CE2 . TYR A 233 ? 1.1339 1.2654 1.0936 -0.0875 0.1551  -0.3443 316 TYR A CE2 
1731 C CZ  . TYR A 233 ? 1.2204 1.3831 1.1592 -0.0969 0.1564  -0.3750 316 TYR A CZ  
1732 O OH  . TYR A 233 ? 1.2417 1.4112 1.2268 -0.1007 0.1642  -0.4185 316 TYR A OH  
1733 N N   . ASP A 234 ? 1.3094 1.5051 1.1331 -0.0992 0.1803  -0.2925 317 ASP A N   
1734 C CA  . ASP A 234 ? 1.4984 1.7082 1.3375 -0.1028 0.2041  -0.3120 317 ASP A CA  
1735 C C   . ASP A 234 ? 1.4427 1.6833 1.2344 -0.1095 0.2144  -0.2929 317 ASP A C   
1736 O O   . ASP A 234 ? 1.4684 1.7047 1.2728 -0.1074 0.2274  -0.2817 317 ASP A O   
1737 C CB  . ASP A 234 ? 1.6240 1.7985 1.5230 -0.0933 0.2088  -0.3106 317 ASP A CB  
1738 C CG  . ASP A 234 ? 1.7321 1.9045 1.6853 -0.0945 0.2195  -0.3540 317 ASP A CG  
1739 O OD1 . ASP A 234 ? 1.7647 1.9396 1.7521 -0.0951 0.2381  -0.3714 317 ASP A OD1 
1740 O OD2 . ASP A 234 ? 1.6643 1.8336 1.6303 -0.0952 0.2099  -0.3713 317 ASP A OD2 
1741 N N   . SER A 235 ? 1.4440 1.7167 1.1833 -0.1178 0.2074  -0.2877 318 SER A N   
1742 C CA  . SER A 235 ? 1.4383 1.7524 1.1279 -0.1276 0.2178  -0.2740 318 SER A CA  
1743 C C   . SER A 235 ? 1.3906 1.6904 1.0857 -0.1223 0.2229  -0.2347 318 SER A C   
1744 O O   . SER A 235 ? 1.2014 1.4655 0.9132 -0.1121 0.2064  -0.2034 318 SER A O   
1745 C CB  . SER A 235 ? 1.4321 1.7894 1.1115 -0.1398 0.2409  -0.3203 318 SER A CB  
1746 O OG  . SER A 235 ? 1.3735 1.7609 1.0231 -0.1485 0.2325  -0.3453 318 SER A OG  
1747 N N   . PRO A 236 ? 1.3639 1.6935 1.0453 -0.1296 0.2455  -0.2358 319 PRO A N   
1748 C CA  . PRO A 236 ? 1.4025 1.7859 1.0490 -0.1442 0.2654  -0.2654 319 PRO A CA  
1749 C C   . PRO A 236 ? 1.4448 1.8690 1.0269 -0.1541 0.2539  -0.2433 319 PRO A C   
1750 O O   . PRO A 236 ? 1.4287 1.8365 1.0001 -0.1489 0.2322  -0.2021 319 PRO A O   
1751 C CB  . PRO A 236 ? 1.3649 1.7582 1.0237 -0.1462 0.2911  -0.2598 319 PRO A CB  
1752 C CG  . PRO A 236 ? 1.4061 1.7590 1.0904 -0.1344 0.2803  -0.2152 319 PRO A CG  
1753 C CD  . PRO A 236 ? 1.3239 1.6333 1.0317 -0.1232 0.2542  -0.2091 319 PRO A CD  
1754 N N   . GLU A 237 ? 1.4642 1.9424 1.0060 -0.1686 0.2672  -0.2705 320 GLU A N   
1755 C CA  . GLU A 237 ? 1.5061 2.0291 0.9845 -0.1793 0.2542  -0.2489 320 GLU A CA  
1756 C C   . GLU A 237 ? 1.5622 2.1062 1.0099 -0.1832 0.2574  -0.1945 320 GLU A C   
1757 O O   . GLU A 237 ? 1.6541 2.2546 1.0509 -0.1973 0.2668  -0.1884 320 GLU A O   
1758 C CB  . GLU A 237 ? 1.5290 2.1069 0.9712 -0.1943 0.2636  -0.2975 320 GLU A CB  
1759 C CG  . GLU A 237 ? 1.4825 2.0455 0.9467 -0.1918 0.2499  -0.3402 320 GLU A CG  
1760 C CD  . GLU A 237 ? 1.4206 1.9718 0.8673 -0.1882 0.2169  -0.3116 320 GLU A CD  
1761 O OE1 . GLU A 237 ? 1.3540 1.9513 0.7514 -0.1997 0.2069  -0.3152 320 GLU A OE1 
1762 O OE2 . GLU A 237 ? 1.3352 1.8331 0.8184 -0.1745 0.2011  -0.2875 320 GLU A OE2 
1763 N N   . MET A 238 ? 1.5261 2.0253 1.0081 -0.1708 0.2493  -0.1551 321 MET A N   
1764 C CA  . MET A 238 ? 1.4922 1.9995 0.9627 -0.1714 0.2485  -0.0988 321 MET A CA  
1765 C C   . MET A 238 ? 1.4568 1.9457 0.9232 -0.1656 0.2172  -0.0566 321 MET A C   
1766 O O   . MET A 238 ? 1.2796 1.7248 0.7764 -0.1545 0.1996  -0.0631 321 MET A O   
1767 C CB  . MET A 238 ? 1.4375 1.9111 0.9568 -0.1625 0.2645  -0.0882 321 MET A CB  
1768 C CG  . MET A 238 ? 1.4519 1.9215 1.0003 -0.1626 0.2900  -0.1379 321 MET A CG  
1769 S SD  . MET A 238 ? 1.6367 2.1746 1.1455 -0.1807 0.3246  -0.1607 321 MET A SD  
1770 C CE  . MET A 238 ? 1.5630 2.1063 1.0896 -0.1839 0.3384  -0.2385 321 MET A CE  
1771 N N   . PRO A 239 ? 1.4962 2.0212 0.9267 -0.1737 0.2104  -0.0125 322 PRO A N   
1772 C CA  . PRO A 239 ? 1.4273 1.9429 0.8549 -0.1701 0.1810  0.0280  322 PRO A CA  
1773 C C   . PRO A 239 ? 1.2894 1.7463 0.7726 -0.1544 0.1703  0.0508  322 PRO A C   
1774 O O   . PRO A 239 ? 1.2881 1.7220 0.7834 -0.1479 0.1466  0.0646  322 PRO A O   
1775 C CB  . PRO A 239 ? 1.4548 2.0209 0.8454 -0.1819 0.1827  0.0754  322 PRO A CB  
1776 C CG  . PRO A 239 ? 1.4750 2.0598 0.8655 -0.1872 0.2143  0.0692  322 PRO A CG  
1777 C CD  . PRO A 239 ? 1.4777 2.0561 0.8726 -0.1871 0.2308  0.0041  322 PRO A CD  
1778 N N   . GLU A 240 ? 1.2297 1.6652 0.7473 -0.1488 0.1881  0.0525  323 GLU A N   
1779 C CA  . GLU A 240 ? 1.1862 1.5701 0.7572 -0.1348 0.1802  0.0699  323 GLU A CA  
1780 C C   . GLU A 240 ? 1.0962 1.4363 0.6935 -0.1241 0.1683  0.0377  323 GLU A C   
1781 O O   . GLU A 240 ? 1.0570 1.3603 0.6879 -0.1137 0.1538  0.0545  323 GLU A O   
1782 C CB  . GLU A 240 ? 1.2554 1.6299 0.8580 -0.1321 0.2019  0.0767  323 GLU A CB  
1783 C CG  . GLU A 240 ? 1.4082 1.7866 1.0141 -0.1344 0.2262  0.0312  323 GLU A CG  
1784 C CD  . GLU A 240 ? 1.4054 1.7416 1.0672 -0.1232 0.2348  0.0230  323 GLU A CD  
1785 O OE1 . GLU A 240 ? 1.3790 1.7179 1.0526 -0.1248 0.2555  -0.0096 323 GLU A OE1 
1786 O OE2 . GLU A 240 ? 1.3772 1.6789 1.0735 -0.1132 0.2205  0.0472  323 GLU A OE2 
1787 N N   . ASN A 241 ? 1.0611 1.4079 0.6452 -0.1273 0.1749  -0.0078 324 ASN A N   
1788 C CA  . ASN A 241 ? 0.9864 1.2980 0.5934 -0.1191 0.1641  -0.0388 324 ASN A CA  
1789 C C   . ASN A 241 ? 0.9897 1.3072 0.5752 -0.1209 0.1424  -0.0421 324 ASN A C   
1790 O O   . ASN A 241 ? 0.9485 1.2410 0.5524 -0.1154 0.1349  -0.0683 324 ASN A O   
1791 C CB  . ASN A 241 ? 0.9945 1.3059 0.6137 -0.1206 0.1825  -0.0874 324 ASN A CB  
1792 C CG  . ASN A 241 ? 1.0417 1.3522 0.6828 -0.1201 0.2058  -0.0893 324 ASN A CG  
1793 O OD1 . ASN A 241 ? 1.0245 1.2985 0.7065 -0.1100 0.2050  -0.0790 324 ASN A OD1 
1794 N ND2 . ASN A 241 ? 0.9885 1.3411 0.6034 -0.1315 0.2271  -0.1042 324 ASN A ND2 
1795 N N   . GLU A 242 ? 0.9994 1.3514 0.5484 -0.1291 0.1323  -0.0152 325 GLU A N   
1796 C CA  . GLU A 242 ? 0.9805 1.3387 0.5127 -0.1306 0.1093  -0.0122 325 GLU A CA  
1797 C C   . GLU A 242 ? 0.9520 1.3023 0.4938 -0.1268 0.0916  0.0376  325 GLU A C   
1798 O O   . GLU A 242 ? 1.0206 1.3843 0.5618 -0.1292 0.0974  0.0715  325 GLU A O   
1799 C CB  . GLU A 242 ? 1.0960 1.5087 0.5768 -0.1451 0.1099  -0.0269 325 GLU A CB  
1800 C CG  . GLU A 242 ? 1.1957 1.6226 0.6692 -0.1506 0.1276  -0.0823 325 GLU A CG  
1801 C CD  . GLU A 242 ? 1.2702 1.7305 0.7116 -0.1599 0.1168  -0.1111 325 GLU A CD  
1802 O OE1 . GLU A 242 ? 1.3318 1.8055 0.7533 -0.1624 0.0947  -0.0855 325 GLU A OE1 
1803 O OE2 . GLU A 242 ? 1.2670 1.7410 0.7072 -0.1649 0.1299  -0.1605 325 GLU A OE2 
1804 N N   . ALA A 243 ? 0.9140 1.2434 0.4695 -0.1212 0.0706  0.0423  326 ALA A N   
1805 C CA  . ALA A 243 ? 0.9004 1.2320 0.4631 -0.1201 0.0519  0.0870  326 ALA A CA  
1806 C C   . ALA A 243 ? 0.9403 1.2798 0.4929 -0.1219 0.0284  0.0893  326 ALA A C   
1807 O O   . ALA A 243 ? 0.9416 1.2683 0.4957 -0.1199 0.0227  0.0568  326 ALA A O   
1808 C CB  . ALA A 243 ? 0.8611 1.1520 0.4720 -0.1085 0.0509  0.1076  326 ALA A CB  
1809 N N   . THR A 244 ? 0.9967 1.3580 0.5440 -0.1260 0.0141  0.1311  327 THR A N   
1810 C CA  . THR A 244 ? 1.0054 1.3829 0.5411 -0.1297 -0.0089 0.1389  327 THR A CA  
1811 C C   . THR A 244 ? 1.0030 1.3502 0.5841 -0.1206 -0.0260 0.1665  327 THR A C   
1812 O O   . THR A 244 ? 1.0207 1.3569 0.6330 -0.1163 -0.0255 0.2011  327 THR A O   
1813 C CB  . THR A 244 ? 1.0069 1.4425 0.4966 -0.1438 -0.0148 0.1621  327 THR A CB  
1814 O OG1 . THR A 244 ? 1.0245 1.4888 0.4714 -0.1527 -0.0021 0.1205  327 THR A OG1 
1815 C CG2 . THR A 244 ? 1.0124 1.4643 0.5000 -0.1469 -0.0427 0.1833  327 THR A CG2 
1816 N N   . PHE A 245 ? 0.9559 1.2902 0.5448 -0.1177 -0.0402 0.1484  328 PHE A N   
1817 C CA  . PHE A 245 ? 0.9715 1.2777 0.6046 -0.1094 -0.0551 0.1673  328 PHE A CA  
1818 C C   . PHE A 245 ? 0.9821 1.3032 0.6081 -0.1131 -0.0767 0.1652  328 PHE A C   
1819 O O   . PHE A 245 ? 0.9566 1.3084 0.5428 -0.1220 -0.0803 0.1462  328 PHE A O   
1820 C CB  . PHE A 245 ? 0.9031 1.1605 0.5721 -0.0975 -0.0447 0.1434  328 PHE A CB  
1821 C CG  . PHE A 245 ? 0.8599 1.1031 0.5201 -0.0959 -0.0413 0.0993  328 PHE A CG  
1822 C CD1 . PHE A 245 ? 0.8748 1.1026 0.5537 -0.0922 -0.0548 0.0901  328 PHE A CD1 
1823 C CD2 . PHE A 245 ? 0.8420 1.0856 0.4831 -0.0976 -0.0239 0.0678  328 PHE A CD2 
1824 C CE1 . PHE A 245 ? 0.8630 1.0767 0.5406 -0.0906 -0.0510 0.0522  328 PHE A CE1 
1825 C CE2 . PHE A 245 ? 0.8474 1.0767 0.4903 -0.0958 -0.0209 0.0296  328 PHE A CE2 
1826 C CZ  . PHE A 245 ? 0.8222 1.0363 0.4835 -0.0923 -0.0345 0.0227  328 PHE A CZ  
1827 N N   . ALA A 246 ? 0.9559 1.2560 0.6235 -0.1066 -0.0909 0.1828  329 ALA A N   
1828 C CA  . ALA A 246 ? 0.9413 1.2529 0.6111 -0.1094 -0.1123 0.1837  329 ALA A CA  
1829 C C   . ALA A 246 ? 0.8830 1.1528 0.5967 -0.0990 -0.1139 0.1679  329 ALA A C   
1830 O O   . ALA A 246 ? 0.8516 1.0902 0.5981 -0.0905 -0.1034 0.1704  329 ALA A O   
1831 C CB  . ALA A 246 ? 0.8913 1.2325 0.5690 -0.1147 -0.1314 0.2319  329 ALA A CB  
1832 N N   . ILE A 247 ? 0.8696 1.1413 0.5814 -0.1004 -0.1255 0.1480  330 ILE A N   
1833 C CA  . ILE A 247 ? 0.8580 1.0977 0.6099 -0.0924 -0.1296 0.1357  330 ILE A CA  
1834 C C   . ILE A 247 ? 0.8713 1.1219 0.6546 -0.0932 -0.1515 0.1692  330 ILE A C   
1835 O O   . ILE A 247 ? 0.8646 1.1507 0.6277 -0.1015 -0.1679 0.1864  330 ILE A O   
1836 C CB  . ILE A 247 ? 0.8388 1.0743 0.5763 -0.0938 -0.1282 0.0947  330 ILE A CB  
1837 C CG1 . ILE A 247 ? 0.9311 1.2072 0.6353 -0.1045 -0.1441 0.0900  330 ILE A CG1 
1838 C CG2 . ILE A 247 ? 0.7591 0.9830 0.4761 -0.0927 -0.1068 0.0644  330 ILE A CG2 
1839 C CD1 . ILE A 247 ? 0.9310 1.2155 0.6558 -0.1062 -0.1667 0.0959  330 ILE A CD1 
1840 N N   . THR A 248 ? 0.8332 1.0565 0.6678 -0.0850 -0.1520 0.1796  331 THR A N   
1841 C CA  . THR A 248 ? 0.8179 1.0489 0.6920 -0.0852 -0.1723 0.2065  331 THR A CA  
1842 C C   . THR A 248 ? 0.8046 1.0042 0.7234 -0.0773 -0.1700 0.1895  331 THR A C   
1843 O O   . THR A 248 ? 0.7911 0.9650 0.7073 -0.0721 -0.1534 0.1603  331 THR A O   
1844 C CB  . THR A 248 ? 0.8129 1.0501 0.7208 -0.0843 -0.1770 0.2495  331 THR A CB  
1845 O OG1 . THR A 248 ? 0.7556 0.9693 0.6746 -0.0782 -0.1569 0.2449  331 THR A OG1 
1846 C CG2 . THR A 248 ? 0.8674 1.1477 0.7414 -0.0944 -0.1894 0.2814  331 THR A CG2 
1847 N N   . ALA A 249 ? 0.7975 1.0010 0.7605 -0.0766 -0.1864 0.2102  332 ALA A N   
1848 C CA  . ALA A 249 ? 0.7839 0.9602 0.7991 -0.0693 -0.1831 0.1989  332 ALA A CA  
1849 C C   . ALA A 249 ? 0.7396 0.8887 0.7776 -0.0617 -0.1633 0.1923  332 ALA A C   
1850 O O   . ALA A 249 ? 0.7868 0.9124 0.8454 -0.0562 -0.1523 0.1688  332 ALA A O   
1851 C CB  . ALA A 249 ? 0.7763 0.9640 0.8437 -0.0700 -0.2037 0.2280  332 ALA A CB  
1852 N N   . GLY A 250 ? 0.7404 0.8953 0.7747 -0.0621 -0.1589 0.2132  333 GLY A N   
1853 C CA  . GLY A 250 ? 0.6583 0.7908 0.7173 -0.0556 -0.1421 0.2084  333 GLY A CA  
1854 C C   . GLY A 250 ? 0.6801 0.8028 0.6929 -0.0547 -0.1239 0.1851  333 GLY A C   
1855 O O   . GLY A 250 ? 0.6702 0.7800 0.6951 -0.0506 -0.1113 0.1844  333 GLY A O   
1856 N N   . GLY A 251 ? 0.6675 0.7964 0.6324 -0.0585 -0.1227 0.1649  334 GLY A N   
1857 C CA  . GLY A 251 ? 0.6642 0.7832 0.5921 -0.0576 -0.1057 0.1411  334 GLY A CA  
1858 C C   . GLY A 251 ? 0.7208 0.8604 0.6095 -0.0632 -0.1025 0.1521  334 GLY A C   
1859 O O   . GLY A 251 ? 0.7236 0.8912 0.6000 -0.0698 -0.1148 0.1765  334 GLY A O   
1860 N N   . ILE A 252 ? 0.7034 0.8317 0.5721 -0.0612 -0.0859 0.1346  335 ILE A N   
1861 C CA  . ILE A 252 ? 0.6946 0.8420 0.5278 -0.0666 -0.0794 0.1409  335 ILE A CA  
1862 C C   . ILE A 252 ? 0.7202 0.8791 0.5749 -0.0674 -0.0829 0.1785  335 ILE A C   
1863 O O   . ILE A 252 ? 0.6513 0.7913 0.5473 -0.0612 -0.0791 0.1868  335 ILE A O   
1864 C CB  . ILE A 252 ? 0.6718 0.8032 0.4880 -0.0638 -0.0609 0.1144  335 ILE A CB  
1865 C CG1 . ILE A 252 ? 0.6863 0.8262 0.4669 -0.0684 -0.0582 0.0854  335 ILE A CG1 
1866 C CG2 . ILE A 252 ? 0.6862 0.8300 0.4883 -0.0665 -0.0509 0.1287  335 ILE A CG2 
1867 C CD1 . ILE A 252 ? 0.6468 0.7738 0.4377 -0.0663 -0.0641 0.0650  335 ILE A CD1 
1868 N N   . GLY A 253 ? 0.7795 0.9716 0.6091 -0.0757 -0.0909 0.2017  336 GLY A N   
1869 C CA  . GLY A 253 ? 0.8130 1.0211 0.6644 -0.0779 -0.0960 0.2439  336 GLY A CA  
1870 C C   . GLY A 253 ? 0.8747 1.1143 0.6813 -0.0865 -0.0893 0.2564  336 GLY A C   
1871 O O   . GLY A 253 ? 0.8801 1.1252 0.6432 -0.0897 -0.0782 0.2274  336 GLY A O   
1872 N N   . ASP A 254 ? 0.9089 1.1709 0.7289 -0.0907 -0.0952 0.2994  337 ASP A N   
1873 C CA  . ASP A 254 ? 0.9466 1.2435 0.7230 -0.1000 -0.0874 0.3150  337 ASP A CA  
1874 C C   . ASP A 254 ? 0.9619 1.3041 0.6999 -0.1113 -0.1042 0.3344  337 ASP A C   
1875 O O   . ASP A 254 ? 0.9465 1.2937 0.7063 -0.1115 -0.1249 0.3511  337 ASP A O   
1876 C CB  . ASP A 254 ? 0.9881 1.2859 0.7997 -0.0989 -0.0804 0.3525  337 ASP A CB  
1877 C CG  . ASP A 254 ? 1.0221 1.2827 0.8613 -0.0897 -0.0615 0.3304  337 ASP A CG  
1878 O OD1 . ASP A 254 ? 0.9785 1.2370 0.7846 -0.0906 -0.0435 0.3047  337 ASP A OD1 
1879 O OD2 . ASP A 254 ? 1.0710 1.3062 0.9688 -0.0819 -0.0653 0.3387  337 ASP A OD2 
1880 N N   . ALA A 255 ? 1.0144 1.3914 0.6958 -0.1211 -0.0950 0.3303  338 ALA A N   
1881 C CA  . ALA A 255 ? 0.9889 1.4206 0.6270 -0.1345 -0.1084 0.3564  338 ALA A CA  
1882 C C   . ALA A 255 ? 1.0130 1.4543 0.6718 -0.1355 -0.1367 0.3781  338 ALA A C   
1883 O O   . ALA A 255 ? 1.1016 1.5579 0.7914 -0.1374 -0.1507 0.4284  338 ALA A O   
1884 C CB  . ALA A 255 ? 0.9682 1.4278 0.6059 -0.1405 -0.1019 0.4033  338 ALA A CB  
1885 N N   . GLY B 1   ? 0.8998 0.9661 1.0745 0.1575  0.0253  0.1034  84  GLY B N   
1886 C CA  . GLY B 1   ? 0.9435 1.0006 1.1250 0.1313  0.0296  0.0881  84  GLY B CA  
1887 C C   . GLY B 1   ? 0.7981 0.8476 1.0026 0.1065  0.0231  0.0618  84  GLY B C   
1888 O O   . GLY B 1   ? 0.6633 0.7069 0.8643 0.0899  0.0230  0.0468  84  GLY B O   
1889 N N   . PHE B 2   ? 0.6938 0.7442 0.9207 0.1071  0.0188  0.0584  85  PHE B N   
1890 C CA  . PHE B 2   ? 0.6115 0.6567 0.8592 0.0901  0.0136  0.0368  85  PHE B CA  
1891 C C   . PHE B 2   ? 0.6183 0.6675 0.8498 0.0967  -0.0051 0.0205  85  PHE B C   
1892 O O   . PHE B 2   ? 0.6266 0.6838 0.8311 0.1172  -0.0171 0.0242  85  PHE B O   
1893 C CB  . PHE B 2   ? 0.6128 0.6579 0.8972 0.0899  0.0185  0.0429  85  PHE B CB  
1894 C CG  . PHE B 2   ? 0.6147 0.6559 0.9268 0.0833  0.0355  0.0560  85  PHE B CG  
1895 C CD1 . PHE B 2   ? 0.6503 0.6954 0.9605 0.0977  0.0452  0.0818  85  PHE B CD1 
1896 C CD2 . PHE B 2   ? 0.5470 0.5811 0.8872 0.0644  0.0422  0.0415  85  PHE B CD2 
1897 C CE1 . PHE B 2   ? 0.6089 0.6503 0.9572 0.0910  0.0607  0.0929  85  PHE B CE1 
1898 C CE2 . PHE B 2   ? 0.5619 0.5931 0.9344 0.0593  0.0540  0.0482  85  PHE B CE2 
1899 C CZ  . PHE B 2   ? 0.5941 0.6286 0.9763 0.0713  0.0631  0.0738  85  PHE B CZ  
1900 N N   . LEU B 3   ? 0.5575 0.6015 0.8076 0.0807  -0.0070 0.0017  86  LEU B N   
1901 C CA  . LEU B 3   ? 0.5551 0.6023 0.8128 0.0851  -0.0239 -0.0148 86  LEU B CA  
1902 C C   . LEU B 3   ? 0.5226 0.5639 0.8205 0.0692  -0.0165 -0.0247 86  LEU B C   
1903 O O   . LEU B 3   ? 0.5544 0.5899 0.8622 0.0570  0.0000  -0.0204 86  LEU B O   
1904 C CB  . LEU B 3   ? 0.5670 0.6143 0.8041 0.0846  -0.0316 -0.0255 86  LEU B CB  
1905 C CG  . LEU B 3   ? 0.5855 0.6241 0.8231 0.0649  -0.0176 -0.0299 86  LEU B CG  
1906 C CD1 . LEU B 3   ? 0.5190 0.5589 0.7437 0.0670  -0.0276 -0.0401 86  LEU B CD1 
1907 C CD2 . LEU B 3   ? 0.6358 0.6705 0.8570 0.0589  -0.0019 -0.0167 86  LEU B CD2 
1908 N N   . THR B 4   ? 0.4558 0.4992 0.7808 0.0710  -0.0284 -0.0382 87  THR B N   
1909 C CA  . THR B 4   ? 0.4010 0.4391 0.7647 0.0575  -0.0172 -0.0440 87  THR B CA  
1910 C C   . THR B 4   ? 0.3931 0.4240 0.7595 0.0427  -0.0028 -0.0500 87  THR B C   
1911 O O   . THR B 4   ? 0.3678 0.3984 0.7157 0.0426  -0.0061 -0.0529 87  THR B O   
1912 C CB  . THR B 4   ? 0.4060 0.4484 0.8074 0.0640  -0.0325 -0.0554 87  THR B CB  
1913 O OG1 . THR B 4   ? 0.4040 0.4470 0.8214 0.0635  -0.0429 -0.0703 87  THR B OG1 
1914 C CG2 . THR B 4   ? 0.4121 0.4635 0.8005 0.0848  -0.0508 -0.0501 87  THR B CG2 
1915 N N   . ALA B 5   ? 0.3810 0.4066 0.7694 0.0324  0.0142  -0.0510 88  ALA B N   
1916 C CA  . ALA B 5   ? 0.3851 0.4048 0.7732 0.0230  0.0311  -0.0536 88  ALA B CA  
1917 C C   . ALA B 5   ? 0.4001 0.4204 0.8150 0.0233  0.0257  -0.0606 88  ALA B C   
1918 O O   . ALA B 5   ? 0.4291 0.4462 0.8348 0.0197  0.0344  -0.0595 88  ALA B O   
1919 C CB  . ALA B 5   ? 0.3773 0.3929 0.7824 0.0172  0.0502  -0.0542 88  ALA B CB  
1920 N N   . PHE B 6   ? 0.4091 0.4339 0.8616 0.0288  0.0102  -0.0682 89  PHE B N   
1921 C CA  . PHE B 6   ? 0.4333 0.4600 0.9205 0.0310  -0.0010 -0.0784 89  PHE B CA  
1922 C C   . PHE B 6   ? 0.4596 0.4895 0.9142 0.0373  -0.0166 -0.0817 89  PHE B C   
1923 O O   . PHE B 6   ? 0.4520 0.4790 0.9153 0.0328  -0.0107 -0.0832 89  PHE B O   
1924 C CB  . PHE B 6   ? 0.5105 0.5432 1.0431 0.0391  -0.0216 -0.0901 89  PHE B CB  
1925 C CG  . PHE B 6   ? 0.5242 0.5600 1.1057 0.0431  -0.0384 -0.1060 89  PHE B CG  
1926 C CD1 . PHE B 6   ? 0.5924 0.6244 1.2412 0.0351  -0.0249 -0.1088 89  PHE B CD1 
1927 C CD2 . PHE B 6   ? 0.5212 0.5644 1.0873 0.0566  -0.0674 -0.1189 89  PHE B CD2 
1928 C CE1 . PHE B 6   ? 0.5874 0.6222 1.2961 0.0385  -0.0407 -0.1246 89  PHE B CE1 
1929 C CE2 . PHE B 6   ? 0.5296 0.5763 1.1488 0.0613  -0.0862 -0.1383 89  PHE B CE2 
1930 C CZ  . PHE B 6   ? 0.5478 0.5901 1.2426 0.0512  -0.0733 -0.1413 89  PHE B CZ  
1931 N N   . GLU B 7   ? 0.4830 0.5191 0.9013 0.0494  -0.0345 -0.0813 90  GLU B N   
1932 C CA  . GLU B 7   ? 0.5063 0.5462 0.8932 0.0577  -0.0487 -0.0852 90  GLU B CA  
1933 C C   . GLU B 7   ? 0.4693 0.5027 0.8253 0.0470  -0.0299 -0.0755 90  GLU B C   
1934 O O   . GLU B 7   ? 0.5170 0.5508 0.8670 0.0482  -0.0358 -0.0806 90  GLU B O   
1935 C CB  . GLU B 7   ? 0.5836 0.6317 0.9310 0.0761  -0.0660 -0.0821 90  GLU B CB  
1936 C CG  . GLU B 7   ? 0.6936 0.7497 1.0616 0.0919  -0.0867 -0.0904 90  GLU B CG  
1937 C CD  . GLU B 7   ? 0.8136 0.8767 1.1353 0.1110  -0.0929 -0.0769 90  GLU B CD  
1938 O OE1 . GLU B 7   ? 0.8789 0.9510 1.1745 0.1324  -0.1138 -0.0842 90  GLU B OE1 
1939 O OE2 . GLU B 7   ? 0.7532 0.8132 1.0664 0.1063  -0.0757 -0.0586 90  GLU B OE2 
1940 N N   . TYR B 8   ? 0.4264 0.4541 0.7675 0.0376  -0.0088 -0.0638 91  TYR B N   
1941 C CA  . TYR B 8   ? 0.4419 0.4640 0.7529 0.0296  0.0073  -0.0564 91  TYR B CA  
1942 C C   . TYR B 8   ? 0.4540 0.4709 0.7887 0.0219  0.0223  -0.0574 91  TYR B C   
1943 O O   . TYR B 8   ? 0.4392 0.4533 0.7563 0.0195  0.0283  -0.0544 91  TYR B O   
1944 C CB  . TYR B 8   ? 0.4132 0.4321 0.7059 0.0251  0.0218  -0.0482 91  TYR B CB  
1945 C CG  . TYR B 8   ? 0.3870 0.4014 0.6482 0.0201  0.0337  -0.0441 91  TYR B CG  
1946 C CD1 . TYR B 8   ? 0.4046 0.4205 0.6362 0.0230  0.0262  -0.0414 91  TYR B CD1 
1947 C CD2 . TYR B 8   ? 0.3785 0.3881 0.6377 0.0152  0.0515  -0.0442 91  TYR B CD2 
1948 C CE1 . TYR B 8   ? 0.3989 0.4110 0.6038 0.0191  0.0349  -0.0387 91  TYR B CE1 
1949 C CE2 . TYR B 8   ? 0.3743 0.3811 0.6027 0.0142  0.0587  -0.0431 91  TYR B CE2 
1950 C CZ  . TYR B 8   ? 0.4294 0.4372 0.6330 0.0152  0.0498  -0.0403 91  TYR B CZ  
1951 O OH  . TYR B 8   ? 0.4945 0.4999 0.6706 0.0147  0.0544  -0.0402 91  TYR B OH  
1952 N N   . SER B 9   ? 0.4128 0.4282 0.7895 0.0193  0.0308  -0.0593 92  SER B N   
1953 C CA  . SER B 9   ? 0.4431 0.4545 0.8529 0.0151  0.0474  -0.0566 92  SER B CA  
1954 C C   . SER B 9   ? 0.4776 0.4910 0.9147 0.0173  0.0335  -0.0640 92  SER B C   
1955 O O   . SER B 9   ? 0.5690 0.5789 1.0101 0.0147  0.0466  -0.0575 92  SER B O   
1956 C CB  . SER B 9   ? 0.3952 0.4057 0.8535 0.0136  0.0580  -0.0571 92  SER B CB  
1957 O OG  . SER B 9   ? 0.4867 0.4959 0.9994 0.0126  0.0646  -0.0574 92  SER B OG  
1958 N N   . GLU B 10  ? 0.5061 0.5261 0.9634 0.0243  0.0062  -0.0783 93  GLU B N   
1959 C CA  . GLU B 10  ? 0.5217 0.5453 1.0032 0.0293  -0.0130 -0.0911 93  GLU B CA  
1960 C C   . GLU B 10  ? 0.5695 0.5911 1.0028 0.0280  -0.0086 -0.0842 93  GLU B C   
1961 O O   . GLU B 10  ? 0.6723 0.6916 1.1287 0.0253  -0.0040 -0.0843 93  GLU B O   
1962 C CB  . GLU B 10  ? 0.5283 0.5614 1.0104 0.0434  -0.0474 -0.1092 93  GLU B CB  
1963 C CG  . GLU B 10  ? 0.6246 0.6613 1.1732 0.0472  -0.0604 -0.1234 93  GLU B CG  
1964 C CD  . GLU B 10  ? 0.7406 0.7735 1.3679 0.0396  -0.0506 -0.1276 93  GLU B CD  
1965 O OE1 . GLU B 10  ? 0.8232 0.8610 1.4949 0.0467  -0.0742 -0.1476 93  GLU B OE1 
1966 O OE2 . GLU B 10  ? 0.7959 0.8214 1.4443 0.0285  -0.0188 -0.1108 93  GLU B OE2 
1967 N N   . LYS B 11  ? 0.5511 0.5731 0.9237 0.0296  -0.0083 -0.0769 94  LYS B N   
1968 C CA  . LYS B 11  ? 0.5505 0.5718 0.8771 0.0300  -0.0083 -0.0721 94  LYS B CA  
1969 C C   . LYS B 11  ? 0.5510 0.5649 0.8752 0.0210  0.0163  -0.0604 94  LYS B C   
1970 O O   . LYS B 11  ? 0.5589 0.5717 0.8847 0.0205  0.0160  -0.0604 94  LYS B O   
1971 C CB  . LYS B 11  ? 0.5670 0.5901 0.8426 0.0336  -0.0099 -0.0649 94  LYS B CB  
1972 C CG  . LYS B 11  ? 0.5974 0.6238 0.8346 0.0402  -0.0202 -0.0646 94  LYS B CG  
1973 C CD  . LYS B 11  ? 0.6853 0.7136 0.8837 0.0450  -0.0188 -0.0542 94  LYS B CD  
1974 C CE  . LYS B 11  ? 0.7465 0.7749 0.9085 0.0470  -0.0185 -0.0491 94  LYS B CE  
1975 N NZ  . LYS B 11  ? 0.8077 0.8355 0.9458 0.0474  -0.0095 -0.0359 94  LYS B NZ  
1976 N N   . ARG B 12  ? 0.5711 0.5805 0.8920 0.0163  0.0375  -0.0507 95  ARG B N   
1977 C CA  . ARG B 12  ? 0.5166 0.5201 0.8329 0.0132  0.0633  -0.0384 95  ARG B CA  
1978 C C   . ARG B 12  ? 0.5360 0.5371 0.9052 0.0125  0.0759  -0.0335 95  ARG B C   
1979 O O   . ARG B 12  ? 0.5233 0.5206 0.8807 0.0133  0.0939  -0.0213 95  ARG B O   
1980 C CB  . ARG B 12  ? 0.5032 0.5042 0.8092 0.0131  0.0819  -0.0324 95  ARG B CB  
1981 C CG  . ARG B 12  ? 0.4450 0.4467 0.7053 0.0136  0.0770  -0.0345 95  ARG B CG  
1982 C CD  . ARG B 12  ? 0.4534 0.4517 0.6862 0.0168  0.0972  -0.0288 95  ARG B CD  
1983 N NE  . ARG B 12  ? 0.5386 0.5378 0.7317 0.0169  0.0865  -0.0327 95  ARG B NE  
1984 C CZ  . ARG B 12  ? 0.5318 0.5295 0.6922 0.0195  0.0886  -0.0303 95  ARG B CZ  
1985 N NH1 . ARG B 12  ? 0.4598 0.4551 0.6162 0.0237  0.1035  -0.0218 95  ARG B NH1 
1986 N NH2 . ARG B 12  ? 0.5979 0.5968 0.7333 0.0188  0.0767  -0.0350 95  ARG B NH2 
1987 N N   . LYS B 13  ? 0.5421 0.5455 0.9731 0.0124  0.0677  -0.0419 96  LYS B N   
1988 C CA  . LYS B 13  ? 0.5664 0.5678 1.0608 0.0117  0.0771  -0.0382 96  LYS B CA  
1989 C C   . LYS B 13  ? 0.5672 0.5680 1.0444 0.0120  0.0720  -0.0370 96  LYS B C   
1990 O O   . LYS B 13  ? 0.5302 0.5272 1.0378 0.0118  0.0910  -0.0241 96  LYS B O   
1991 C CB  . LYS B 13  ? 0.5827 0.5885 1.1508 0.0127  0.0560  -0.0562 96  LYS B CB  
1992 C CG  . LYS B 13  ? 0.7467 0.7534 1.3523 0.0123  0.0597  -0.0587 96  LYS B CG  
1993 C CD  . LYS B 13  ? 0.8790 0.8798 1.4951 0.0105  0.0989  -0.0366 96  LYS B CD  
1994 C CE  . LYS B 13  ? 0.8396 0.8409 1.5372 0.0099  0.1047  -0.0394 96  LYS B CE  
1995 N NZ  . LYS B 13  ? 0.7790 0.7782 1.4579 0.0104  0.1268  -0.0288 96  LYS B NZ  
1996 N N   . MET B 14  ? 0.5658 0.5704 0.9965 0.0139  0.0481  -0.0485 97  MET B N   
1997 C CA  . MET B 14  ? 0.5762 0.5813 0.9974 0.0149  0.0388  -0.0515 97  MET B CA  
1998 C C   . MET B 14  ? 0.5546 0.5555 0.9174 0.0136  0.0548  -0.0359 97  MET B C   
1999 O O   . MET B 14  ? 0.5886 0.5899 0.9366 0.0142  0.0469  -0.0378 97  MET B O   
2000 C CB  . MET B 14  ? 0.6012 0.6137 1.0063 0.0212  0.0052  -0.0722 97  MET B CB  
2001 C CG  . MET B 14  ? 0.7556 0.7738 1.2254 0.0266  -0.0168 -0.0929 97  MET B CG  
2002 S SD  . MET B 14  ? 0.9784 1.0077 1.4199 0.0424  -0.0579 -0.1188 97  MET B SD  
2003 C CE  . MET B 14  ? 0.8467 0.8767 1.1993 0.0448  -0.0526 -0.1045 97  MET B CE  
2004 N N   . VAL B 15  ? 0.5473 0.5448 0.8788 0.0133  0.0755  -0.0228 98  VAL B N   
2005 C CA  . VAL B 15  ? 0.5652 0.5594 0.8427 0.0152  0.0891  -0.0107 98  VAL B CA  
2006 C C   . VAL B 15  ? 0.5954 0.5858 0.8939 0.0178  0.1096  0.0053  98  VAL B C   
2007 O O   . VAL B 15  ? 0.6836 0.6719 1.0234 0.0202  0.1306  0.0169  98  VAL B O   
2008 C CB  . VAL B 15  ? 0.5626 0.5555 0.8072 0.0180  0.1036  -0.0053 98  VAL B CB  
2009 C CG1 . VAL B 15  ? 0.5802 0.5704 0.7787 0.0247  0.1197  0.0062  98  VAL B CG1 
2010 C CG2 . VAL B 15  ? 0.5374 0.5336 0.7574 0.0156  0.0847  -0.0179 98  VAL B CG2 
2011 N N   . PHE B 16  ? 0.6113 0.6009 0.8834 0.0186  0.1057  0.0081  99  PHE B N   
2012 C CA  . PHE B 16  ? 0.5710 0.5571 0.8590 0.0228  0.1263  0.0264  99  PHE B CA  
2013 C C   . PHE B 16  ? 0.6146 0.5986 0.8384 0.0309  0.1396  0.0392  99  PHE B C   
2014 O O   . PHE B 16  ? 0.6563 0.6419 0.8283 0.0307  0.1267  0.0293  99  PHE B O   
2015 C CB  . PHE B 16  ? 0.4826 0.4696 0.8037 0.0188  0.1103  0.0185  99  PHE B CB  
2016 C CG  . PHE B 16  ? 0.4840 0.4741 0.7592 0.0165  0.0847  0.0033  99  PHE B CG  
2017 C CD1 . PHE B 16  ? 0.4838 0.4722 0.7114 0.0186  0.0875  0.0107  99  PHE B CD1 
2018 C CD2 . PHE B 16  ? 0.4497 0.4449 0.7291 0.0146  0.0590  -0.0173 99  PHE B CD2 
2019 C CE1 . PHE B 16  ? 0.4954 0.4866 0.6874 0.0169  0.0669  -0.0013 99  PHE B CE1 
2020 C CE2 . PHE B 16  ? 0.5026 0.5011 0.7400 0.0154  0.0400  -0.0272 99  PHE B CE2 
2021 C CZ  . PHE B 16  ? 0.5114 0.5076 0.7078 0.0156  0.0448  -0.0189 99  PHE B CZ  
2022 N N   . HIS B 17  ? 0.6662 0.6474 0.8981 0.0399  0.1654  0.0613  100 HIS B N   
2023 C CA  . HIS B 17  ? 0.6936 0.6739 0.8663 0.0519  0.1762  0.0736  100 HIS B CA  
2024 C C   . HIS B 17  ? 0.6624 0.6410 0.8499 0.0513  0.1760  0.0824  100 HIS B C   
2025 O O   . HIS B 17  ? 0.5711 0.5481 0.8228 0.0484  0.1856  0.0913  100 HIS B O   
2026 C CB  . HIS B 17  ? 0.7371 0.7165 0.9002 0.0692  0.2098  0.0962  100 HIS B CB  
2027 C CG  . HIS B 17  ? 0.8303 0.8116 0.9731 0.0728  0.2121  0.0876  100 HIS B CG  
2028 N ND1 . HIS B 17  ? 0.9182 0.9018 0.9958 0.0831  0.2068  0.0787  100 HIS B ND1 
2029 C CD2 . HIS B 17  ? 0.7879 0.7694 0.9735 0.0672  0.2171  0.0840  100 HIS B CD2 
2030 C CE1 . HIS B 17  ? 0.8139 0.7990 0.8931 0.0838  0.2092  0.0702  100 HIS B CE1 
2031 N NE2 . HIS B 17  ? 0.7998 0.7835 0.9435 0.0738  0.2163  0.0747  100 HIS B NE2 
2032 N N   . ILE B 18  ? 0.6368 0.6159 0.7727 0.0539  0.1644  0.0788  101 ILE B N   
2033 C CA  . ILE B 18  ? 0.6054 0.5827 0.7508 0.0556  0.1672  0.0900  101 ILE B CA  
2034 C C   . ILE B 18  ? 0.6509 0.6273 0.7554 0.0753  0.1909  0.1134  101 ILE B C   
2035 O O   . ILE B 18  ? 0.6920 0.6704 0.7345 0.0853  0.1864  0.1077  101 ILE B O   
2036 C CB  . ILE B 18  ? 0.5911 0.5698 0.7097 0.0472  0.1392  0.0719  101 ILE B CB  
2037 C CG1 . ILE B 18  ? 0.6052 0.5864 0.7540 0.0334  0.1155  0.0494  101 ILE B CG1 
2038 C CG2 . ILE B 18  ? 0.5538 0.5306 0.6826 0.0500  0.1436  0.0843  101 ILE B CG2 
2039 C CD1 . ILE B 18  ? 0.5832 0.5669 0.6935 0.0284  0.0910  0.0324  101 ILE B CD1 
2040 N N   . THR B 19  ? 0.6225 0.5964 0.7651 0.0827  0.2152  0.1390  102 THR B N   
2041 C CA  . THR B 19  ? 0.6806 0.6544 0.7887 0.1063  0.2431  0.1673  102 THR B CA  
2042 C C   . THR B 19  ? 0.7294 0.7045 0.7743 0.1141  0.2281  0.1630  102 THR B C   
2043 O O   . THR B 19  ? 0.7670 0.7412 0.8232 0.1004  0.2070  0.1507  102 THR B O   
2044 C CB  . THR B 19  ? 0.6971 0.6678 0.8755 0.1122  0.2759  0.1998  102 THR B CB  
2045 O OG1 . THR B 19  ? 0.7087 0.6798 0.8477 0.1387  0.3039  0.2311  102 THR B OG1 
2046 C CG2 . THR B 19  ? 0.6685 0.6368 0.9103 0.0952  0.2618  0.1939  102 THR B CG2 
2047 N N   . THR B 20  ? 0.7546 0.7325 0.7329 0.1376  0.2369  0.1704  103 THR B N   
2048 C CA  . THR B 20  ? 0.7759 0.7558 0.6963 0.1482  0.2213  0.1648  103 THR B CA  
2049 C C   . THR B 20  ? 0.8255 0.8037 0.7561 0.1621  0.2425  0.1963  103 THR B C   
2050 O O   . THR B 20  ? 0.8544 0.8334 0.7520 0.1675  0.2290  0.1936  103 THR B O   
2051 C CB  . THR B 20  ? 0.8305 0.8155 0.6748 0.1746  0.2208  0.1588  103 THR B CB  
2052 O OG1 . THR B 20  ? 0.8751 0.8617 0.7064 0.2034  0.2581  0.1910  103 THR B OG1 
2053 C CG2 . THR B 20  ? 0.8036 0.7907 0.6378 0.1646  0.2022  0.1293  103 THR B CG2 
2054 N N   . GLY B 21  ? 0.8211 0.7970 0.7994 0.1696  0.2772  0.2276  104 GLY B N   
2055 C CA  . GLY B 21  ? 0.8754 0.8499 0.8662 0.1873  0.3037  0.2638  104 GLY B CA  
2056 C C   . GLY B 21  ? 0.9809 0.9594 0.9132 0.2266  0.3348  0.2929  104 GLY B C   
2057 O O   . GLY B 21  ? 0.9881 0.9663 0.9282 0.2477  0.3648  0.3306  104 GLY B O   
2058 N N   . SER B 22  ? 1.0195 1.0026 0.8938 0.2390  0.3285  0.2760  105 SER B N   
2059 C CA  . SER B 22  ? 1.0148 1.0032 0.8332 0.2797  0.3590  0.3004  105 SER B CA  
2060 C C   . SER B 22  ? 1.0191 1.0075 0.8654 0.2791  0.3805  0.3045  105 SER B C   
2061 O O   . SER B 22  ? 1.0586 1.0491 0.8831 0.2699  0.3585  0.2721  105 SER B O   
2062 C CB  . SER B 22  ? 1.0359 1.0315 0.7558 0.3033  0.3326  0.2751  105 SER B CB  
2063 O OG  . SER B 22  ? 1.0998 1.1023 0.7592 0.3436  0.3552  0.2874  105 SER B OG  
2064 N N   . GLN B 23  ? 1.0698 1.0559 0.9696 0.2896  0.4248  0.3455  106 GLN B N   
2065 C CA  . GLN B 23  ? 1.0955 1.0827 1.0154 0.2989  0.4545  0.3580  106 GLN B CA  
2066 C C   . GLN B 23  ? 1.0860 1.0807 0.9141 0.3249  0.4471  0.3387  106 GLN B C   
2067 O O   . GLN B 23  ? 0.9756 0.9708 0.8162 0.3171  0.4472  0.3234  106 GLN B O   
2068 C CB  . GLN B 23  ? 1.1803 1.1666 1.1399 0.3258  0.5121  0.4152  106 GLN B CB  
2069 C CG  . GLN B 23  ? 1.2576 1.2376 1.3062 0.3097  0.5246  0.4405  106 GLN B CG  
2070 C CD  . GLN B 23  ? 1.3608 1.3418 1.4195 0.3474  0.5800  0.5011  106 GLN B CD  
2071 O OE1 . GLN B 23  ? 1.4113 1.3958 1.4528 0.3784  0.6206  0.5310  106 GLN B OE1 
2072 N NE2 . GLN B 23  ? 1.3620 1.3401 1.4492 0.3466  0.5835  0.5212  106 GLN B NE2 
2073 N N   . GLU B 24  ? 1.1476 1.1485 0.8866 0.3580  0.4407  0.3387  107 GLU B N   
2074 C CA  . GLU B 24  ? 1.1917 1.2012 0.8428 0.3875  0.4297  0.3159  107 GLU B CA  
2075 C C   . GLU B 24  ? 1.1124 1.1218 0.7531 0.3582  0.3775  0.2610  107 GLU B C   
2076 O O   . GLU B 24  ? 1.1217 1.1350 0.7368 0.3627  0.3668  0.2355  107 GLU B O   
2077 C CB  . GLU B 24  ? 1.3067 1.3244 0.8652 0.4365  0.4348  0.3287  107 GLU B CB  
2078 C CG  . GLU B 24  ? 1.4550 1.4760 1.0004 0.4805  0.4924  0.3860  107 GLU B CG  
2079 C CD  . GLU B 24  ? 1.5087 1.5286 1.0976 0.4841  0.5340  0.4090  107 GLU B CD  
2080 O OE1 . GLU B 24  ? 1.5246 1.5390 1.1888 0.4798  0.5765  0.4543  107 GLU B OE1 
2081 O OE2 . GLU B 24  ? 1.5319 1.5566 1.0866 0.4914  0.5247  0.3821  107 GLU B OE2 
2082 N N   . PHE B 25  ? 1.0667 1.0718 0.7309 0.3290  0.3464  0.2441  108 PHE B N   
2083 C CA  . PHE B 25  ? 1.0529 1.0576 0.7162 0.3008  0.3004  0.1969  108 PHE B CA  
2084 C C   . PHE B 25  ? 1.0146 1.0148 0.7428 0.2677  0.2991  0.1851  108 PHE B C   
2085 O O   . PHE B 25  ? 0.9719 0.9741 0.6885 0.2589  0.2764  0.1528  108 PHE B O   
2086 C CB  . PHE B 25  ? 1.0316 1.0329 0.7083 0.2799  0.2735  0.1875  108 PHE B CB  
2087 C CG  . PHE B 25  ? 1.0259 1.0296 0.6757 0.2678  0.2287  0.1439  108 PHE B CG  
2088 C CD1 . PHE B 25  ? 1.0045 1.0092 0.6286 0.2707  0.2054  0.1344  108 PHE B CD1 
2089 C CD2 . PHE B 25  ? 1.0262 1.0308 0.6835 0.2536  0.2106  0.1134  108 PHE B CD2 
2090 C CE1 . PHE B 25  ? 1.0175 1.0242 0.6286 0.2591  0.1657  0.0955  108 PHE B CE1 
2091 C CE2 . PHE B 25  ? 0.9824 0.9889 0.6270 0.2423  0.1720  0.0759  108 PHE B CE2 
2092 C CZ  . PHE B 25  ? 1.0268 1.0344 0.6503 0.2451  0.1500  0.0671  108 PHE B CZ  
2093 N N   . ASP B 26  ? 0.9846 0.9790 0.7846 0.2518  0.3236  0.2117  109 ASP B N   
2094 C CA  . ASP B 26  ? 0.9386 0.9290 0.8070 0.2227  0.3226  0.2029  109 ASP B CA  
2095 C C   . ASP B 26  ? 0.9920 0.9853 0.8518 0.2349  0.3390  0.2010  109 ASP B C   
2096 O O   . ASP B 26  ? 0.9327 0.9253 0.8144 0.2131  0.3191  0.1747  109 ASP B O   
2097 C CB  . ASP B 26  ? 0.9342 0.9188 0.8858 0.2084  0.3446  0.2306  109 ASP B CB  
2098 C CG  . ASP B 26  ? 0.9887 0.9701 0.9616 0.1885  0.3209  0.2231  109 ASP B CG  
2099 O OD1 . ASP B 26  ? 0.9777 0.9607 0.9079 0.1807  0.2865  0.1953  109 ASP B OD1 
2100 O OD2 . ASP B 26  ? 1.0140 0.9916 1.0529 0.1810  0.3375  0.2450  109 ASP B OD2 
2101 N N   . LYS B 27  ? 1.0905 1.0876 0.9178 0.2713  0.3760  0.2298  110 LYS B N   
2102 C CA  . LYS B 27  ? 1.1539 1.1547 0.9668 0.2884  0.3952  0.2298  110 LYS B CA  
2103 C C   . LYS B 27  ? 1.1395 1.1451 0.8968 0.2887  0.3581  0.1857  110 LYS B C   
2104 O O   . LYS B 27  ? 1.0921 1.0974 0.8721 0.2740  0.3497  0.1659  110 LYS B O   
2105 C CB  . LYS B 27  ? 1.3154 1.3213 1.0861 0.3354  0.4410  0.2681  110 LYS B CB  
2106 C CG  . LYS B 27  ? 1.4925 1.5076 1.1558 0.3761  0.4298  0.2555  110 LYS B CG  
2107 C CD  . LYS B 27  ? 1.5702 1.5932 1.1789 0.4255  0.4681  0.2773  110 LYS B CD  
2108 C CE  . LYS B 27  ? 1.6023 1.6299 1.1882 0.4277  0.4528  0.2416  110 LYS B CE  
2109 N NZ  . LYS B 27  ? 1.6272 1.6619 1.1749 0.4728  0.4957  0.2654  110 LYS B NZ  
2110 N N   . LEU B 28  ? 1.1485 1.1585 0.8404 0.3051  0.3348  0.1698  111 LEU B N   
2111 C CA  . LEU B 28  ? 1.1444 1.1594 0.7911 0.3073  0.2969  0.1259  111 LEU B CA  
2112 C C   . LEU B 28  ? 1.0748 1.0849 0.7734 0.2636  0.2640  0.0965  111 LEU B C   
2113 O O   . LEU B 28  ? 1.1060 1.1190 0.7922 0.2599  0.2396  0.0636  111 LEU B O   
2114 C CB  . LEU B 28  ? 1.1485 1.1686 0.7304 0.3303  0.2756  0.1148  111 LEU B CB  
2115 C CG  . LEU B 28  ? 1.1222 1.1485 0.6633 0.3369  0.2342  0.0673  111 LEU B CG  
2116 C CD1 . LEU B 28  ? 1.1987 1.2338 0.6855 0.3772  0.2449  0.0583  111 LEU B CD1 
2117 C CD2 . LEU B 28  ? 1.0930 1.1219 0.5979 0.3456  0.2056  0.0530  111 LEU B CD2 
2118 N N   . LEU B 29  ? 1.0352 1.0384 0.7932 0.2329  0.2638  0.1085  112 LEU B N   
2119 C CA  . LEU B 29  ? 0.9444 0.9437 0.7484 0.1957  0.2354  0.0847  112 LEU B CA  
2120 C C   . LEU B 29  ? 0.8973 0.8930 0.7657 0.1766  0.2500  0.0929  112 LEU B C   
2121 O O   . LEU B 29  ? 0.9149 0.9080 0.8222 0.1490  0.2290  0.0768  112 LEU B O   
2122 C CB  . LEU B 29  ? 0.9093 0.9050 0.7326 0.1766  0.2191  0.0863  112 LEU B CB  
2123 C CG  . LEU B 29  ? 0.9083 0.9048 0.7103 0.1663  0.1829  0.0604  112 LEU B CG  
2124 C CD1 . LEU B 29  ? 0.8954 0.8977 0.6477 0.1832  0.1626  0.0325  112 LEU B CD1 
2125 C CD2 . LEU B 29  ? 0.8483 0.8429 0.6449 0.1688  0.1849  0.0771  112 LEU B CD2 
2126 N N   . GLY B 30  ? 0.8841 0.8798 0.7655 0.1931  0.2864  0.1193  113 GLY B N   
2127 C CA  . GLY B 30  ? 0.8223 0.8148 0.7730 0.1777  0.3031  0.1295  113 GLY B CA  
2128 C C   . GLY B 30  ? 0.8233 0.8104 0.8448 0.1520  0.2991  0.1379  113 GLY B C   
2129 O O   . GLY B 30  ? 0.8059 0.7911 0.8823 0.1306  0.2897  0.1274  113 GLY B O   
2130 N N   . GLY B 31  ? 0.8503 0.8358 0.8705 0.1562  0.3046  0.1549  114 GLY B N   
2131 C CA  . GLY B 31  ? 0.7659 0.7471 0.8549 0.1366  0.3024  0.1635  114 GLY B CA  
2132 C C   . GLY B 31  ? 0.7821 0.7627 0.8484 0.1277  0.2760  0.1525  114 GLY B C   
2133 O O   . GLY B 31  ? 0.7780 0.7558 0.8852 0.1218  0.2807  0.1659  114 GLY B O   
2134 N N   . GLY B 32  ? 0.7249 0.7081 0.7331 0.1266  0.2482  0.1275  115 GLY B N   
2135 C CA  . GLY B 32  ? 0.7088 0.6916 0.6973 0.1182  0.2233  0.1163  115 GLY B CA  
2136 C C   . GLY B 32  ? 0.6859 0.6705 0.6519 0.1043  0.1894  0.0843  115 GLY B C   
2137 O O   . GLY B 32  ? 0.6574 0.6442 0.6078 0.1067  0.1854  0.0709  115 GLY B O   
2138 N N   . ILE B 33  ? 0.6857 0.6696 0.6538 0.0910  0.1669  0.0735  116 ILE B N   
2139 C CA  . ILE B 33  ? 0.6951 0.6807 0.6501 0.0782  0.1379  0.0479  116 ILE B CA  
2140 C C   . ILE B 33  ? 0.6714 0.6567 0.6707 0.0631  0.1339  0.0408  116 ILE B C   
2141 O O   . ILE B 33  ? 0.6857 0.6694 0.7302 0.0541  0.1363  0.0466  116 ILE B O   
2142 C CB  . ILE B 33  ? 0.6915 0.6763 0.6459 0.0690  0.1201  0.0436  116 ILE B CB  
2143 C CG1 . ILE B 33  ? 0.6957 0.6807 0.6122 0.0849  0.1250  0.0532  116 ILE B CG1 
2144 C CG2 . ILE B 33  ? 0.5862 0.5729 0.5297 0.0585  0.0945  0.0221  116 ILE B CG2 
2145 C CD1 . ILE B 33  ? 0.7947 0.7832 0.6612 0.1011  0.1190  0.0413  116 ILE B CD1 
2146 N N   . GLU B 34  ? 0.7202 0.7073 0.7101 0.0617  0.1268  0.0269  117 GLU B N   
2147 C CA  . GLU B 34  ? 0.6820 0.6695 0.7110 0.0505  0.1240  0.0209  117 GLU B CA  
2148 C C   . GLU B 34  ? 0.6226 0.6116 0.6619 0.0366  0.0992  0.0065  117 GLU B C   
2149 O O   . GLU B 34  ? 0.6125 0.6029 0.6250 0.0359  0.0853  -0.0034 117 GLU B O   
2150 C CB  . GLU B 34  ? 0.7179 0.7070 0.7316 0.0579  0.1298  0.0143  117 GLU B CB  
2151 C CG  . GLU B 34  ? 0.8451 0.8344 0.8985 0.0495  0.1313  0.0108  117 GLU B CG  
2152 C CD  . GLU B 34  ? 0.9038 0.8943 0.9468 0.0599  0.1451  0.0093  117 GLU B CD  
2153 O OE1 . GLU B 34  ? 0.9988 0.9889 1.0319 0.0750  0.1690  0.0233  117 GLU B OE1 
2154 O OE2 . GLU B 34  ? 0.9775 0.9696 1.0233 0.0548  0.1334  -0.0049 117 GLU B OE2 
2155 N N   . SER B 35  ? 0.5380 0.5274 0.6180 0.0283  0.0939  0.0053  118 SER B N   
2156 C CA  . SER B 35  ? 0.5046 0.4971 0.5908 0.0208  0.0725  -0.0072 118 SER B CA  
2157 C C   . SER B 35  ? 0.5173 0.5119 0.5976 0.0196  0.0668  -0.0153 118 SER B C   
2158 O O   . SER B 35  ? 0.5566 0.5502 0.6337 0.0229  0.0778  -0.0143 118 SER B O   
2159 C CB  . SER B 35  ? 0.5241 0.5181 0.6543 0.0172  0.0654  -0.0104 118 SER B CB  
2160 O OG  . SER B 35  ? 0.5870 0.5814 0.7525 0.0165  0.0710  -0.0115 118 SER B OG  
2161 N N   . MET B 36  ? 0.5437 0.5414 0.6220 0.0167  0.0509  -0.0222 119 MET B N   
2162 C CA  . MET B 36  ? 0.4812 0.4809 0.5578 0.0163  0.0465  -0.0268 119 MET B CA  
2163 C C   . MET B 36  ? 0.5183 0.5165 0.5733 0.0186  0.0516  -0.0291 119 MET B C   
2164 O O   . MET B 36  ? 0.5520 0.5506 0.6130 0.0192  0.0535  -0.0335 119 MET B O   
2165 C CB  . MET B 36  ? 0.4345 0.4351 0.5409 0.0156  0.0498  -0.0283 119 MET B CB  
2166 C CG  . MET B 36  ? 0.4326 0.4373 0.5599 0.0165  0.0354  -0.0325 119 MET B CG  
2167 S SD  . MET B 36  ? 0.5106 0.5170 0.6772 0.0167  0.0355  -0.0366 119 MET B SD  
2168 C CE  . MET B 36  ? 0.4020 0.4107 0.5557 0.0181  0.0321  -0.0363 119 MET B CE  
2169 N N   . ALA B 37  ? 0.5131 0.5098 0.5450 0.0211  0.0515  -0.0283 120 ALA B N   
2170 C CA  . ALA B 37  ? 0.5175 0.5138 0.5301 0.0266  0.0521  -0.0351 120 ALA B CA  
2171 C C   . ALA B 37  ? 0.5391 0.5351 0.5310 0.0287  0.0453  -0.0359 120 ALA B C   
2172 O O   . ALA B 37  ? 0.5473 0.5424 0.5358 0.0268  0.0452  -0.0286 120 ALA B O   
2173 C CB  . ALA B 37  ? 0.5026 0.4976 0.5052 0.0353  0.0667  -0.0336 120 ALA B CB  
2174 N N   . ILE B 38  ? 0.5528 0.5497 0.5364 0.0330  0.0381  -0.0467 121 ILE B N   
2175 C CA  . ILE B 38  ? 0.5927 0.5896 0.5568 0.0383  0.0309  -0.0511 121 ILE B CA  
2176 C C   . ILE B 38  ? 0.6549 0.6521 0.5892 0.0535  0.0351  -0.0568 121 ILE B C   
2177 O O   . ILE B 38  ? 0.6911 0.6901 0.6219 0.0621  0.0348  -0.0688 121 ILE B O   
2178 C CB  . ILE B 38  ? 0.6165 0.6150 0.5984 0.0357  0.0177  -0.0614 121 ILE B CB  
2179 C CG1 . ILE B 38  ? 0.6314 0.6305 0.6371 0.0257  0.0177  -0.0510 121 ILE B CG1 
2180 C CG2 . ILE B 38  ? 0.5569 0.5556 0.5240 0.0412  0.0082  -0.0675 121 ILE B CG2 
2181 C CD1 . ILE B 38  ? 0.5863 0.5871 0.6216 0.0236  0.0111  -0.0547 121 ILE B CD1 
2182 N N   . THR B 39  ? 0.6303 0.6264 0.5424 0.0592  0.0393  -0.0479 122 THR B N   
2183 C CA  . THR B 39  ? 0.6607 0.6580 0.5375 0.0782  0.0440  -0.0492 122 THR B CA  
2184 C C   . THR B 39  ? 0.6865 0.6854 0.5475 0.0847  0.0270  -0.0602 122 THR B C   
2185 O O   . THR B 39  ? 0.6679 0.6652 0.5354 0.0761  0.0230  -0.0531 122 THR B O   
2186 C CB  . THR B 39  ? 0.6790 0.6738 0.5482 0.0815  0.0635  -0.0268 122 THR B CB  
2187 O OG1 . THR B 39  ? 0.6870 0.6805 0.5816 0.0744  0.0773  -0.0185 122 THR B OG1 
2188 C CG2 . THR B 39  ? 0.7373 0.7340 0.5667 0.1054  0.0734  -0.0223 122 THR B CG2 
2189 N N   . GLU B 40  ? 0.7311 0.7338 0.5737 0.1012  0.0155  -0.0797 123 GLU B N   
2190 C CA  . GLU B 40  ? 0.7738 0.7787 0.6093 0.1082  -0.0045 -0.0944 123 GLU B CA  
2191 C C   . GLU B 40  ? 0.8748 0.8832 0.6605 0.1357  -0.0054 -0.0972 123 GLU B C   
2192 O O   . GLU B 40  ? 0.8043 0.8163 0.5611 0.1564  0.0004  -0.1032 123 GLU B O   
2193 C CB  . GLU B 40  ? 0.7751 0.7829 0.6420 0.1063  -0.0248 -0.1209 123 GLU B CB  
2194 C CG  . GLU B 40  ? 0.8323 0.8432 0.6983 0.1168  -0.0479 -0.1404 123 GLU B CG  
2195 C CD  . GLU B 40  ? 0.8735 0.8882 0.7767 0.1205  -0.0698 -0.1714 123 GLU B CD  
2196 O OE1 . GLU B 40  ? 0.8964 0.9109 0.8305 0.1123  -0.0665 -0.1760 123 GLU B OE1 
2197 O OE2 . GLU B 40  ? 0.9673 0.9855 0.8748 0.1320  -0.0918 -0.1922 123 GLU B OE2 
2198 N N   . ALA B 41  ? 0.8462 0.8543 0.6202 0.1385  -0.0128 -0.0930 124 ALA B N   
2199 C CA  . ALA B 41  ? 0.8643 0.8762 0.5882 0.1674  -0.0144 -0.0933 124 ALA B CA  
2200 C C   . ALA B 41  ? 0.9175 0.9332 0.6416 0.1761  -0.0435 -0.1177 124 ALA B C   
2201 O O   . ALA B 41  ? 0.9567 0.9695 0.7098 0.1586  -0.0517 -0.1155 124 ALA B O   
2202 C CB  . ALA B 41  ? 0.7949 0.8033 0.5016 0.1683  0.0079  -0.0609 124 ALA B CB  
2203 N N   . PHE B 42  ? 0.9813 1.0041 0.6756 0.2048  -0.0600 -0.1427 125 PHE B N   
2204 C CA  . PHE B 42  ? 1.0294 1.0570 0.7244 0.2183  -0.0913 -0.1699 125 PHE B CA  
2205 C C   . PHE B 42  ? 1.1186 1.1538 0.7475 0.2598  -0.0990 -0.1773 125 PHE B C   
2206 O O   . PHE B 42  ? 1.1233 1.1604 0.7031 0.2810  -0.0774 -0.1603 125 PHE B O   
2207 C CB  . PHE B 42  ? 1.0127 1.0431 0.7577 0.2118  -0.1162 -0.2053 125 PHE B CB  
2208 C CG  . PHE B 42  ? 1.0189 1.0536 0.7524 0.2266  -0.1158 -0.2222 125 PHE B CG  
2209 C CD1 . PHE B 42  ? 0.9834 1.0140 0.7531 0.2043  -0.1012 -0.2150 125 PHE B CD1 
2210 C CD2 . PHE B 42  ? 1.1421 1.1858 0.8257 0.2660  -0.1307 -0.2464 125 PHE B CD2 
2211 C CE1 . PHE B 42  ? 1.0431 1.0777 0.8052 0.2177  -0.1004 -0.2311 125 PHE B CE1 
2212 C CE2 . PHE B 42  ? 1.1780 1.2264 0.8495 0.2821  -0.1301 -0.2639 125 PHE B CE2 
2213 C CZ  . PHE B 42  ? 1.1501 1.1936 0.8636 0.2563  -0.1145 -0.2562 125 PHE B CZ  
2214 N N   . GLY B 43  ? 1.0806 1.1204 0.7107 0.2729  -0.1295 -0.2017 126 GLY B N   
2215 C CA  . GLY B 43  ? 1.1987 1.2448 0.7680 0.3095  -0.1377 -0.2023 126 GLY B CA  
2216 C C   . GLY B 43  ? 1.2941 1.3417 0.8918 0.3069  -0.1693 -0.2229 126 GLY B C   
2217 O O   . GLY B 43  ? 1.1970 1.2383 0.8571 0.2724  -0.1721 -0.2209 126 GLY B O   
2218 N N   . GLU B 44  ? 1.3814 1.4378 0.9319 0.3461  -0.1923 -0.2419 127 GLU B N   
2219 C CA  . GLU B 44  ? 1.3813 1.4420 0.9579 0.3529  -0.2308 -0.2726 127 GLU B CA  
2220 C C   . GLU B 44  ? 1.3822 1.4380 0.9560 0.3429  -0.2230 -0.2447 127 GLU B C   
2221 O O   . GLU B 44  ? 1.2475 1.2951 0.8165 0.3220  -0.1882 -0.2028 127 GLU B O   
2222 C CB  . GLU B 44  ? 1.4218 1.4962 0.9497 0.4046  -0.2657 -0.3136 127 GLU B CB  
2223 C CG  . GLU B 44  ? 1.3880 1.4684 0.9768 0.4060  -0.3072 -0.3692 127 GLU B CG  
2224 C CD  . GLU B 44  ? 1.5529 1.6478 1.0918 0.4583  -0.3380 -0.4130 127 GLU B CD  
2225 O OE1 . GLU B 44  ? 1.5917 1.6954 1.0625 0.5008  -0.3525 -0.4188 127 GLU B OE1 
2226 O OE2 . GLU B 44  ? 1.4869 1.5851 1.0555 0.4594  -0.3496 -0.4437 127 GLU B OE2 
2227 N N   . PHE B 45  ? 1.5591 1.6203 1.1428 0.3581  -0.2580 -0.2717 128 PHE B N   
2228 C CA  . PHE B 45  ? 1.7064 1.7660 1.2788 0.3603  -0.2600 -0.2541 128 PHE B CA  
2229 C C   . PHE B 45  ? 1.6198 1.6696 1.1798 0.3378  -0.2179 -0.2005 128 PHE B C   
2230 O O   . PHE B 45  ? 1.5310 1.5737 1.1386 0.3065  -0.2135 -0.1880 128 PHE B O   
2231 C CB  . PHE B 45  ? 1.8448 1.9161 1.3477 0.4137  -0.2852 -0.2715 128 PHE B CB  
2232 C CG  . PHE B 45  ? 1.9829 2.0639 1.5154 0.4344  -0.3384 -0.3288 128 PHE B CG  
2233 C CD1 . PHE B 45  ? 1.9946 2.0793 1.5756 0.4306  -0.3611 -0.3705 128 PHE B CD1 
2234 C CD2 . PHE B 45  ? 2.0267 2.1143 1.5395 0.4618  -0.3676 -0.3429 128 PHE B CD2 
2235 C CE1 . PHE B 45  ? 2.0056 2.0998 1.6236 0.4514  -0.4121 -0.4260 128 PHE B CE1 
2236 C CE2 . PHE B 45  ? 2.0336 2.1311 1.5785 0.4836  -0.4198 -0.3990 128 PHE B CE2 
2237 C CZ  . PHE B 45  ? 2.0397 2.1405 1.6403 0.4783  -0.4425 -0.4416 128 PHE B CZ  
2238 N N   . ARG B 46  ? 1.5070 1.5569 1.0082 0.3553  -0.1874 -0.1701 129 ARG B N   
2239 C CA  . ARG B 46  ? 1.4706 1.5128 0.9623 0.3417  -0.1512 -0.1221 129 ARG B CA  
2240 C C   . ARG B 46  ? 1.3961 1.4363 0.8564 0.3474  -0.1131 -0.0913 129 ARG B C   
2241 O O   . ARG B 46  ? 1.3901 1.4294 0.8150 0.3631  -0.0863 -0.0551 129 ARG B O   
2242 C CB  . ARG B 46  ? 1.5947 1.6406 1.0457 0.3698  -0.1572 -0.1092 129 ARG B CB  
2243 C CG  . ARG B 46  ? 1.5686 1.6063 1.0586 0.3406  -0.1472 -0.0850 129 ARG B CG  
2244 C CD  . ARG B 46  ? 1.6272 1.6632 1.0780 0.3577  -0.1179 -0.0410 129 ARG B CD  
2245 N NE  . ARG B 46  ? 1.6680 1.6971 1.1286 0.3405  -0.0766 -0.0058 129 ARG B NE  
2246 C CZ  . ARG B 46  ? 1.6181 1.6449 1.0578 0.3528  -0.0427 0.0366  129 ARG B CZ  
2247 N NH1 . ARG B 46  ? 1.6149 1.6457 1.0156 0.3843  -0.0421 0.0538  129 ARG B NH1 
2248 N NH2 . ARG B 46  ? 1.4488 1.4696 0.9123 0.3344  -0.0090 0.0623  129 ARG B NH2 
2249 N N   . THR B 47  ? 1.4701 1.5096 0.9490 0.3349  -0.1087 -0.1035 130 THR B N   
2250 C CA  . THR B 47  ? 1.5082 1.5440 0.9735 0.3323  -0.0699 -0.0717 130 THR B CA  
2251 C C   . THR B 47  ? 1.6084 1.6334 1.1235 0.2916  -0.0422 -0.0397 130 THR B C   
2252 O O   . THR B 47  ? 1.5548 1.5747 1.1177 0.2609  -0.0526 -0.0438 130 THR B O   
2253 C CB  . THR B 47  ? 1.3570 1.3961 0.8204 0.3363  -0.0707 -0.0922 130 THR B CB  
2254 O OG1 . THR B 47  ? 1.3023 1.3509 0.7469 0.3630  -0.1079 -0.1360 130 THR B OG1 
2255 C CG2 . THR B 47  ? 1.3238 1.3639 0.7433 0.3587  -0.0346 -0.0611 130 THR B CG2 
2256 N N   . GLY B 48  ? 1.4423 1.4649 0.9469 0.2946  -0.0074 -0.0098 131 GLY B N   
2257 C CA  . GLY B 48  ? 1.2295 1.2437 0.7717 0.2688  0.0216  0.0240  131 GLY B CA  
2258 C C   . GLY B 48  ? 1.0617 1.0705 0.6593 0.2305  0.0214  0.0150  131 GLY B C   
2259 O O   . GLY B 48  ? 1.0499 1.0535 0.6761 0.2143  0.0463  0.0377  131 GLY B O   
2260 N N   . LYS B 49  ? 1.0110 1.0213 0.6271 0.2182  -0.0070 -0.0179 132 LYS B N   
2261 C CA  . LYS B 49  ? 0.8964 0.9023 0.5643 0.1841  -0.0097 -0.0264 132 LYS B CA  
2262 C C   . LYS B 49  ? 0.9196 0.9194 0.6201 0.1611  0.0024  -0.0048 132 LYS B C   
2263 O O   . LYS B 49  ? 0.8886 0.8843 0.6192 0.1419  0.0186  0.0077  132 LYS B O   
2264 C CB  . LYS B 49  ? 0.8159 0.8244 0.5056 0.1769  -0.0409 -0.0596 132 LYS B CB  
2265 C CG  . LYS B 49  ? 0.8542 0.8691 0.5270 0.1968  -0.0590 -0.0894 132 LYS B CG  
2266 C CD  . LYS B 49  ? 0.8742 0.8921 0.5774 0.1940  -0.0922 -0.1220 132 LYS B CD  
2267 C CE  . LYS B 49  ? 0.9837 1.0065 0.6573 0.2189  -0.1122 -0.1320 132 LYS B CE  
2268 N NZ  . LYS B 49  ? 1.0321 1.0570 0.7495 0.2127  -0.1436 -0.1617 132 LYS B NZ  
2269 N N   . THR B 50  ? 0.9439 0.9437 0.6394 0.1651  -0.0073 -0.0024 133 THR B N   
2270 C CA  . THR B 50  ? 0.9071 0.9021 0.6372 0.1432  -0.0023 0.0106  133 THR B CA  
2271 C C   . THR B 50  ? 0.8795 0.8710 0.6127 0.1461  0.0249  0.0425  133 THR B C   
2272 O O   . THR B 50  ? 0.8341 0.8216 0.6057 0.1259  0.0342  0.0520  133 THR B O   
2273 C CB  . THR B 50  ? 0.9548 0.9510 0.6878 0.1436  -0.0246 -0.0020 133 THR B CB  
2274 O OG1 . THR B 50  ? 0.9263 0.9241 0.6833 0.1318  -0.0447 -0.0281 133 THR B OG1 
2275 C CG2 . THR B 50  ? 0.9548 0.9467 0.7146 0.1279  -0.0174 0.0140  133 THR B CG2 
2276 N N   . GLN B 51  ? 0.9124 0.9061 0.6086 0.1733  0.0381  0.0589  134 GLN B N   
2277 C CA  . GLN B 51  ? 0.9624 0.9529 0.6717 0.1771  0.0692  0.0919  134 GLN B CA  
2278 C C   . GLN B 51  ? 0.9282 0.9162 0.6679 0.1632  0.0864  0.0966  134 GLN B C   
2279 O O   . GLN B 51  ? 0.9107 0.8947 0.6919 0.1524  0.1058  0.1163  134 GLN B O   
2280 C CB  . GLN B 51  ? 1.0857 1.0800 0.7460 0.2142  0.0842  0.1130  134 GLN B CB  
2281 C CG  . GLN B 51  ? 1.2475 1.2428 0.8903 0.2276  0.0756  0.1207  134 GLN B CG  
2282 C CD  . GLN B 51  ? 1.2737 1.2628 0.9694 0.2052  0.0849  0.1381  134 GLN B CD  
2283 O OE1 . GLN B 51  ? 1.1586 1.1454 0.8853 0.1799  0.0660  0.1196  134 GLN B OE1 
2284 N NE2 . GLN B 51  ? 1.2847 1.2716 0.9942 0.2165  0.1155  0.1743  134 GLN B NE2 
2285 N N   . LEU B 52  ? 0.8643 0.8551 0.5893 0.1641  0.0783  0.0772  135 LEU B N   
2286 C CA  . LEU B 52  ? 0.8512 0.8399 0.6067 0.1502  0.0917  0.0794  135 LEU B CA  
2287 C C   . LEU B 52  ? 0.7968 0.7821 0.6019 0.1189  0.0808  0.0693  135 LEU B C   
2288 O O   . LEU B 52  ? 0.7244 0.7067 0.5714 0.1062  0.0943  0.0806  135 LEU B O   
2289 C CB  . LEU B 52  ? 0.8510 0.8436 0.5814 0.1583  0.0840  0.0597  135 LEU B CB  
2290 C CG  . LEU B 52  ? 0.8975 0.8902 0.6299 0.1661  0.1083  0.0720  135 LEU B CG  
2291 C CD1 . LEU B 52  ? 0.8621 0.8586 0.5756 0.1706  0.0960  0.0471  135 LEU B CD1 
2292 C CD2 . LEU B 52  ? 0.8882 0.8760 0.6774 0.1444  0.1250  0.0864  135 LEU B CD2 
2293 N N   . SER B 53  ? 0.7343 0.7209 0.5366 0.1092  0.0564  0.0477  136 SER B N   
2294 C CA  . SER B 53  ? 0.7500 0.7348 0.5902 0.0854  0.0467  0.0395  136 SER B CA  
2295 C C   . SER B 53  ? 0.6944 0.6760 0.5666 0.0785  0.0579  0.0562  136 SER B C   
2296 O O   . SER B 53  ? 0.6033 0.5836 0.5120 0.0661  0.0632  0.0573  136 SER B O   
2297 C CB  . SER B 53  ? 0.7572 0.7437 0.5912 0.0808  0.0239  0.0211  136 SER B CB  
2298 O OG  . SER B 53  ? 0.8798 0.8694 0.6942 0.0889  0.0127  0.0042  136 SER B OG  
2299 N N   . HIS B 54  ? 0.7123 0.6931 0.5743 0.0885  0.0610  0.0686  137 HIS B N   
2300 C CA  . HIS B 54  ? 0.6733 0.6512 0.5733 0.0817  0.0704  0.0828  137 HIS B CA  
2301 C C   . HIS B 54  ? 0.6836 0.6594 0.6148 0.0840  0.0942  0.1014  137 HIS B C   
2302 O O   . HIS B 54  ? 0.6785 0.6526 0.6606 0.0718  0.0976  0.1028  137 HIS B O   
2303 C CB  . HIS B 54  ? 0.6865 0.6638 0.5729 0.0922  0.0696  0.0939  137 HIS B CB  
2304 C CG  . HIS B 54  ? 0.7107 0.6896 0.5834 0.0864  0.0458  0.0751  137 HIS B CG  
2305 N ND1 . HIS B 54  ? 0.8029 0.7848 0.6396 0.0949  0.0308  0.0606  137 HIS B ND1 
2306 C CD2 . HIS B 54  ? 0.7220 0.7002 0.6184 0.0740  0.0352  0.0687  137 HIS B CD2 
2307 C CE1 . HIS B 54  ? 0.8021 0.7848 0.6448 0.0869  0.0129  0.0471  137 HIS B CE1 
2308 N NE2 . HIS B 54  ? 0.7883 0.7687 0.6639 0.0746  0.0167  0.0532  137 HIS B NE2 
2309 N N   . THR B 55  ? 0.7141 0.6907 0.6200 0.1008  0.1106  0.1142  138 THR B N   
2310 C CA  . THR B 55  ? 0.7035 0.6780 0.6466 0.1046  0.1380  0.1365  138 THR B CA  
2311 C C   . THR B 55  ? 0.7319 0.7060 0.7177 0.0860  0.1336  0.1220  138 THR B C   
2312 O O   . THR B 55  ? 0.7455 0.7174 0.7912 0.0784  0.1445  0.1304  138 THR B O   
2313 C CB  . THR B 55  ? 0.7242 0.7004 0.6275 0.1311  0.1604  0.1567  138 THR B CB  
2314 O OG1 . THR B 55  ? 0.7440 0.7218 0.6048 0.1518  0.1611  0.1688  138 THR B OG1 
2315 C CG2 . THR B 55  ? 0.6783 0.6521 0.6290 0.1358  0.1930  0.1843  138 THR B CG2 
2316 N N   . LEU B 56  ? 0.6848 0.6613 0.6458 0.0791  0.1160  0.0990  139 LEU B N   
2317 C CA  . LEU B 56  ? 0.6449 0.6217 0.6411 0.0643  0.1109  0.0858  139 LEU B CA  
2318 C C   . LEU B 56  ? 0.6662 0.6430 0.7053 0.0483  0.0953  0.0729  139 LEU B C   
2319 O O   . LEU B 56  ? 0.6708 0.6481 0.7547 0.0403  0.0944  0.0665  139 LEU B O   
2320 C CB  . LEU B 56  ? 0.6188 0.5982 0.5815 0.0630  0.0989  0.0679  139 LEU B CB  
2321 C CG  . LEU B 56  ? 0.5974 0.5779 0.5250 0.0793  0.1119  0.0740  139 LEU B CG  
2322 C CD1 . LEU B 56  ? 0.5830 0.5666 0.4756 0.0792  0.0930  0.0520  139 LEU B CD1 
2323 C CD2 . LEU B 56  ? 0.5992 0.5788 0.5587 0.0793  0.1312  0.0839  139 LEU B CD2 
2324 N N   . CYS B 57  ? 0.5840 0.5612 0.6112 0.0461  0.0825  0.0677  140 CYS B N   
2325 C CA  . CYS B 57  ? 0.5535 0.5317 0.6171 0.0356  0.0689  0.0554  140 CYS B CA  
2326 C C   . CYS B 57  ? 0.6207 0.5969 0.7479 0.0345  0.0807  0.0652  140 CYS B C   
2327 O O   . CYS B 57  ? 0.6129 0.5912 0.7817 0.0273  0.0676  0.0494  140 CYS B O   
2328 C CB  . CYS B 57  ? 0.5375 0.5159 0.5812 0.0356  0.0580  0.0525  140 CYS B CB  
2329 S SG  . CYS B 57  ? 0.6481 0.6291 0.6382 0.0351  0.0415  0.0381  140 CYS B SG  
2330 N N   . VAL B 58  ? 0.6123 0.5853 0.7500 0.0442  0.1051  0.0908  141 VAL B N   
2331 C CA  . VAL B 58  ? 0.5953 0.5660 0.8056 0.0440  0.1207  0.1046  141 VAL B CA  
2332 C C   . VAL B 58  ? 0.6067 0.5769 0.8504 0.0448  0.1360  0.1106  141 VAL B C   
2333 O O   . VAL B 58  ? 0.6074 0.5785 0.9151 0.0369  0.1300  0.0988  141 VAL B O   
2334 C CB  . VAL B 58  ? 0.5970 0.5644 0.8110 0.0561  0.1426  0.1348  141 VAL B CB  
2335 C CG1 . VAL B 58  ? 0.5717 0.5364 0.8742 0.0557  0.1615  0.1510  141 VAL B CG1 
2336 C CG2 . VAL B 58  ? 0.5622 0.5300 0.7519 0.0544  0.1264  0.1278  141 VAL B CG2 
2337 N N   . THR B 59  ? 0.6072 0.5769 0.8084 0.0557  0.1535  0.1261  142 THR B N   
2338 C CA  . THR B 59  ? 0.6282 0.5974 0.8612 0.0582  0.1720  0.1351  142 THR B CA  
2339 C C   . THR B 59  ? 0.6031 0.5749 0.8546 0.0452  0.1516  0.1074  142 THR B C   
2340 O O   . THR B 59  ? 0.6736 0.6450 0.9787 0.0436  0.1624  0.1107  142 THR B O   
2341 C CB  . THR B 59  ? 0.6485 0.6179 0.8233 0.0752  0.1927  0.1529  142 THR B CB  
2342 O OG1 . THR B 59  ? 0.6786 0.6507 0.7844 0.0737  0.1705  0.1312  142 THR B OG1 
2343 C CG2 . THR B 59  ? 0.6714 0.6393 0.8274 0.0951  0.2182  0.1856  142 THR B CG2 
2344 N N   . ALA B 60  ? 0.5554 0.5302 0.7654 0.0379  0.1241  0.0825  143 ALA B N   
2345 C CA  . ALA B 60  ? 0.5691 0.5473 0.7939 0.0288  0.1041  0.0578  143 ALA B CA  
2346 C C   . ALA B 60  ? 0.5911 0.5711 0.8851 0.0225  0.0902  0.0427  143 ALA B C   
2347 O O   . ALA B 60  ? 0.6075 0.5908 0.9281 0.0188  0.0760  0.0241  143 ALA B O   
2348 C CB  . ALA B 60  ? 0.5434 0.5246 0.7095 0.0257  0.0825  0.0401  143 ALA B CB  
2349 N N   . GLN B 61  ? 0.6304 0.6088 0.9547 0.0231  0.0925  0.0489  144 GLN B N   
2350 C CA  . GLN B 61  ? 0.5834 0.5640 0.9805 0.0192  0.0777  0.0318  144 GLN B CA  
2351 C C   . GLN B 61  ? 0.5907 0.5688 1.0765 0.0197  0.0960  0.0436  144 GLN B C   
2352 O O   . GLN B 61  ? 0.5823 0.5629 1.1423 0.0170  0.0812  0.0248  144 GLN B O   
2353 C CB  . GLN B 61  ? 0.5693 0.5491 0.9685 0.0196  0.0728  0.0329  144 GLN B CB  
2354 C CG  . GLN B 61  ? 0.6121 0.5936 0.9307 0.0198  0.0594  0.0261  144 GLN B CG  
2355 C CD  . GLN B 61  ? 0.5833 0.5675 0.9156 0.0187  0.0403  0.0093  144 GLN B CD  
2356 O OE1 . GLN B 61  ? 0.6158 0.6027 1.0113 0.0182  0.0281  -0.0077 144 GLN B OE1 
2357 N NE2 . GLN B 61  ? 0.5248 0.5087 0.8027 0.0195  0.0366  0.0123  144 GLN B NE2 
2358 N N   . LEU B 62  ? 0.6035 0.5774 1.0858 0.0251  0.1282  0.0740  145 LEU B N   
2359 C CA  . LEU B 62  ? 0.6021 0.5728 1.1745 0.0279  0.1544  0.0949  145 LEU B CA  
2360 C C   . LEU B 62  ? 0.5761 0.5477 1.1846 0.0263  0.1590  0.0901  145 LEU B C   
2361 O O   . LEU B 62  ? 0.5833 0.5559 1.1283 0.0276  0.1592  0.0887  145 LEU B O   
2362 C CB  . LEU B 62  ? 0.5843 0.5502 1.1372 0.0401  0.1932  0.1377  145 LEU B CB  
2363 C CG  . LEU B 62  ? 0.6008 0.5652 1.1034 0.0462  0.1964  0.1516  145 LEU B CG  
2364 C CD1 . LEU B 62  ? 0.6787 0.6397 1.1713 0.0637  0.2389  0.1963  145 LEU B CD1 
2365 C CD2 . LEU B 62  ? 0.5778 0.5420 1.1430 0.0399  0.1829  0.1417  145 LEU B CD2 
2366 N N   . PRO B 63  ? 0.5663 0.5378 1.2837 0.0237  0.1627  0.0873  146 PRO B N   
2367 C CA  . PRO B 63  ? 0.6033 0.5750 1.3586 0.0235  0.1731  0.0886  146 PRO B CA  
2368 C C   . PRO B 63  ? 0.6472 0.6147 1.3605 0.0342  0.2159  0.1295  146 PRO B C   
2369 O O   . PRO B 63  ? 0.6655 0.6293 1.3863 0.0435  0.2461  0.1630  146 PRO B O   
2370 C CB  . PRO B 63  ? 0.5652 0.5366 1.4581 0.0208  0.1750  0.0842  146 PRO B CB  
2371 C CG  . PRO B 63  ? 0.5595 0.5288 1.4850 0.0219  0.1786  0.0934  146 PRO B CG  
2372 C CD  . PRO B 63  ? 0.5100 0.4804 1.3253 0.0222  0.1627  0.0872  146 PRO B CD  
2373 N N   . GLY B 64  ? 0.6826 0.6514 1.3459 0.0355  0.2177  0.1266  147 GLY B N   
2374 C CA  . GLY B 64  ? 0.7385 0.7049 1.3527 0.0492  0.2550  0.1603  147 GLY B CA  
2375 C C   . GLY B 64  ? 0.8047 0.7710 1.4694 0.0502  0.2723  0.1659  147 GLY B C   
2376 O O   . GLY B 64  ? 0.8198 0.7872 1.5704 0.0404  0.2578  0.1472  147 GLY B O   
2377 N N   . ALA B 65  ? 0.8908 0.8564 1.5028 0.0639  0.3018  0.1895  148 ALA B N   
2378 C CA  . ALA B 65  ? 0.8712 0.8370 1.5170 0.0666  0.3204  0.1956  148 ALA B CA  
2379 C C   . ALA B 65  ? 0.8281 0.7972 1.4777 0.0512  0.2831  0.1562  148 ALA B C   
2380 O O   . ALA B 65  ? 0.7528 0.7245 1.3519 0.0424  0.2463  0.1274  148 ALA B O   
2381 C CB  . ALA B 65  ? 0.8854 0.8514 1.4521 0.0871  0.3530  0.2222  148 ALA B CB  
2382 N N   . GLY B 66  ? 0.8117 0.7809 1.5254 0.0496  0.2941  0.1569  149 GLY B N   
2383 C CA  . GLY B 66  ? 0.7560 0.7287 1.4693 0.0389  0.2629  0.1239  149 GLY B CA  
2384 C C   . GLY B 66  ? 0.7405 0.7165 1.5045 0.0260  0.2195  0.0875  149 GLY B C   
2385 O O   . GLY B 66  ? 0.6300 0.6100 1.3710 0.0201  0.1885  0.0589  149 GLY B O   
2386 N N   . GLY B 67  ? 0.7588 0.7339 1.5932 0.0241  0.2173  0.0883  150 GLY B N   
2387 C CA  . GLY B 67  ? 0.7335 0.7130 1.6120 0.0162  0.1735  0.0504  150 GLY B CA  
2388 C C   . GLY B 67  ? 0.7375 0.7203 1.5257 0.0142  0.1405  0.0285  150 GLY B C   
2389 O O   . GLY B 67  ? 0.7500 0.7385 1.5509 0.0117  0.1015  -0.0060 150 GLY B O   
2390 N N   . TYR B 68  ? 0.6711 0.6512 1.3694 0.0178  0.1557  0.0480  151 TYR B N   
2391 C CA  . TYR B 68  ? 0.6146 0.5969 1.2394 0.0163  0.1307  0.0332  151 TYR B CA  
2392 C C   . TYR B 68  ? 0.5766 0.5594 1.2496 0.0150  0.1183  0.0253  151 TYR B C   
2393 O O   . TYR B 68  ? 0.5344 0.5128 1.2380 0.0179  0.1441  0.0508  151 TYR B O   
2394 C CB  . TYR B 68  ? 0.5986 0.5781 1.1292 0.0216  0.1500  0.0550  151 TYR B CB  
2395 C CG  . TYR B 68  ? 0.6037 0.5847 1.0632 0.0204  0.1292  0.0441  151 TYR B CG  
2396 C CD1 . TYR B 68  ? 0.5660 0.5507 0.9635 0.0178  0.1058  0.0247  151 TYR B CD1 
2397 C CD2 . TYR B 68  ? 0.5995 0.5782 1.0566 0.0227  0.1357  0.0561  151 TYR B CD2 
2398 C CE1 . TYR B 68  ? 0.5161 0.5022 0.8563 0.0173  0.0896  0.0168  151 TYR B CE1 
2399 C CE2 . TYR B 68  ? 0.5514 0.5315 0.9459 0.0218  0.1180  0.0468  151 TYR B CE2 
2400 C CZ  . TYR B 68  ? 0.5447 0.5285 0.8830 0.0190  0.0955  0.0272  151 TYR B CZ  
2401 O OH  . TYR B 68  ? 0.6021 0.5872 0.8855 0.0186  0.0803  0.0198  151 TYR B OH  
2402 N N   . PRO B 69  ? 0.5234 0.5121 1.2006 0.0130  0.0791  -0.0098 152 PRO B N   
2403 C CA  . PRO B 69  ? 0.5029 0.4941 1.2310 0.0132  0.0587  -0.0280 152 PRO B CA  
2404 C C   . PRO B 69  ? 0.5239 0.5135 1.1896 0.0138  0.0601  -0.0191 152 PRO B C   
2405 O O   . PRO B 69  ? 0.4896 0.4798 1.1982 0.0141  0.0511  -0.0271 152 PRO B O   
2406 C CB  . PRO B 69  ? 0.4806 0.4805 1.2023 0.0165  0.0157  -0.0691 152 PRO B CB  
2407 C CG  . PRO B 69  ? 0.4512 0.4524 1.0800 0.0169  0.0150  -0.0660 152 PRO B CG  
2408 C CD  . PRO B 69  ? 0.4456 0.4399 1.0650 0.0135  0.0526  -0.0331 152 PRO B CD  
2409 N N   . GLY B 70  ? 0.5593 0.5472 1.1283 0.0143  0.0689  -0.0055 153 GLY B N   
2410 C CA  . GLY B 70  ? 0.5676 0.5550 1.0758 0.0150  0.0636  -0.0031 153 GLY B CA  
2411 C C   . GLY B 70  ? 0.5778 0.5723 1.0538 0.0163  0.0276  -0.0353 153 GLY B C   
2412 O O   . GLY B 70  ? 0.6510 0.6510 1.1595 0.0186  0.0062  -0.0596 153 GLY B O   
2413 N N   . GLY B 71  ? 0.5972 0.5922 1.0082 0.0171  0.0215  -0.0349 154 GLY B N   
2414 C CA  . GLY B 71  ? 0.5433 0.5453 0.9119 0.0215  -0.0067 -0.0592 154 GLY B CA  
2415 C C   . GLY B 71  ? 0.5880 0.5887 0.8928 0.0213  -0.0045 -0.0505 154 GLY B C   
2416 O O   . GLY B 71  ? 0.5887 0.5837 0.8894 0.0185  0.0135  -0.0305 154 GLY B O   
2417 N N   . LYS B 72  ? 0.5867 0.5930 0.8434 0.0264  -0.0221 -0.0645 155 LYS B N   
2418 C CA  . LYS B 72  ? 0.5138 0.5205 0.7197 0.0277  -0.0241 -0.0611 155 LYS B CA  
2419 C C   . LYS B 72  ? 0.5132 0.5165 0.6614 0.0243  -0.0112 -0.0443 155 LYS B C   
2420 O O   . LYS B 72  ? 0.5005 0.5031 0.6380 0.0229  -0.0051 -0.0400 155 LYS B O   
2421 C CB  . LYS B 72  ? 0.4918 0.5073 0.6826 0.0385  -0.0478 -0.0839 155 LYS B CB  
2422 C CG  . LYS B 72  ? 0.5494 0.5682 0.7833 0.0436  -0.0624 -0.1018 155 LYS B CG  
2423 C CD  . LYS B 72  ? 0.5462 0.5760 0.7677 0.0603  -0.0885 -0.1291 155 LYS B CD  
2424 C CE  . LYS B 72  ? 0.5849 0.6182 0.8493 0.0665  -0.1043 -0.1498 155 LYS B CE  
2425 N NZ  . LYS B 72  ? 0.6266 0.6721 0.8694 0.0881  -0.1307 -0.1783 155 LYS B NZ  
2426 N N   . ILE B 73  ? 0.4263 0.4279 0.5428 0.0236  -0.0084 -0.0370 156 ILE B N   
2427 C CA  . ILE B 73  ? 0.4639 0.4624 0.5376 0.0212  0.0015  -0.0243 156 ILE B CA  
2428 C C   . ILE B 73  ? 0.5128 0.5148 0.5535 0.0242  -0.0073 -0.0288 156 ILE B C   
2429 O O   . ILE B 73  ? 0.4988 0.5035 0.5444 0.0275  -0.0159 -0.0360 156 ILE B O   
2430 C CB  . ILE B 73  ? 0.5106 0.5031 0.5802 0.0195  0.0162  -0.0077 156 ILE B CB  
2431 C CG1 . ILE B 73  ? 0.4455 0.4343 0.5446 0.0195  0.0323  0.0040  156 ILE B CG1 
2432 C CG2 . ILE B 73  ? 0.4707 0.4617 0.4950 0.0203  0.0190  -0.0015 156 ILE B CG2 
2433 C CD1 . ILE B 73  ? 0.4551 0.4433 0.6109 0.0190  0.0335  0.0036  156 ILE B CD1 
2434 N N   . ILE B 74  ? 0.4912 0.4932 0.5033 0.0237  -0.0043 -0.0244 157 ILE B N   
2435 C CA  . ILE B 74  ? 0.4788 0.4828 0.4673 0.0260  -0.0075 -0.0234 157 ILE B CA  
2436 C C   . ILE B 74  ? 0.4705 0.4700 0.4433 0.0223  -0.0012 -0.0152 157 ILE B C   
2437 O O   . ILE B 74  ? 0.4686 0.4655 0.4362 0.0208  0.0044  -0.0121 157 ILE B O   
2438 C CB  . ILE B 74  ? 0.4766 0.4857 0.4535 0.0314  -0.0104 -0.0254 157 ILE B CB  
2439 C CG1 . ILE B 74  ? 0.5298 0.5452 0.5156 0.0403  -0.0204 -0.0362 157 ILE B CG1 
2440 C CG2 . ILE B 74  ? 0.4950 0.5059 0.4567 0.0345  -0.0096 -0.0208 157 ILE B CG2 
2441 C CD1 . ILE B 74  ? 0.5531 0.5756 0.5190 0.0523  -0.0227 -0.0352 157 ILE B CD1 
2442 N N   . PHE B 75  ? 0.4715 0.4709 0.4369 0.0230  -0.0039 -0.0140 158 PHE B N   
2443 C CA  . PHE B 75  ? 0.4966 0.4925 0.4503 0.0219  -0.0022 -0.0095 158 PHE B CA  
2444 C C   . PHE B 75  ? 0.5180 0.5160 0.4678 0.0227  -0.0059 -0.0105 158 PHE B C   
2445 O O   . PHE B 75  ? 0.6204 0.6202 0.5727 0.0242  -0.0082 -0.0105 158 PHE B O   
2446 C CB  . PHE B 75  ? 0.4396 0.4323 0.3965 0.0223  -0.0003 -0.0045 158 PHE B CB  
2447 C CG  . PHE B 75  ? 0.4322 0.4217 0.3720 0.0259  0.0017  0.0004  158 PHE B CG  
2448 C CD1 . PHE B 75  ? 0.4564 0.4430 0.3924 0.0305  0.0107  0.0094  158 PHE B CD1 
2449 C CD2 . PHE B 75  ? 0.4220 0.4123 0.3516 0.0273  -0.0056 -0.0041 158 PHE B CD2 
2450 C CE1 . PHE B 75  ? 0.4449 0.4303 0.3570 0.0396  0.0115  0.0133  158 PHE B CE1 
2451 C CE2 . PHE B 75  ? 0.4188 0.4075 0.3315 0.0344  -0.0084 -0.0041 158 PHE B CE2 
2452 C CZ  . PHE B 75  ? 0.4395 0.4263 0.3385 0.0420  -0.0003 0.0043  158 PHE B CZ  
2453 N N   . ILE B 76  ? 0.6191 0.6170 0.5685 0.0224  -0.0058 -0.0116 159 ILE B N   
2454 C CA  . ILE B 76  ? 0.5468 0.5460 0.5057 0.0230  -0.0082 -0.0118 159 ILE B CA  
2455 C C   . ILE B 76  ? 0.5680 0.5644 0.5248 0.0239  -0.0152 -0.0173 159 ILE B C   
2456 O O   . ILE B 76  ? 0.5710 0.5661 0.5201 0.0262  -0.0175 -0.0226 159 ILE B O   
2457 C CB  . ILE B 76  ? 0.5183 0.5200 0.4909 0.0236  -0.0044 -0.0103 159 ILE B CB  
2458 C CG1 . ILE B 76  ? 0.5296 0.5355 0.4987 0.0278  0.0009  -0.0047 159 ILE B CG1 
2459 C CG2 . ILE B 76  ? 0.4584 0.4609 0.4549 0.0241  -0.0050 -0.0096 159 ILE B CG2 
2460 C CD1 . ILE B 76  ? 0.5476 0.5558 0.5264 0.0298  0.0061  -0.0009 159 ILE B CD1 
2461 N N   . ASP B 77  ? 0.5437 0.5400 0.5062 0.0245  -0.0194 -0.0172 160 ASP B N   
2462 C CA  . ASP B 77  ? 0.5326 0.5273 0.4917 0.0280  -0.0289 -0.0231 160 ASP B CA  
2463 C C   . ASP B 77  ? 0.5579 0.5542 0.5477 0.0279  -0.0351 -0.0291 160 ASP B C   
2464 O O   . ASP B 77  ? 0.5236 0.5216 0.5338 0.0255  -0.0292 -0.0224 160 ASP B O   
2465 C CB  . ASP B 77  ? 0.5615 0.5549 0.5127 0.0281  -0.0283 -0.0171 160 ASP B CB  
2466 C CG  . ASP B 77  ? 0.6250 0.6168 0.5657 0.0346  -0.0378 -0.0203 160 ASP B CG  
2467 O OD1 . ASP B 77  ? 0.6000 0.5924 0.5380 0.0410  -0.0476 -0.0303 160 ASP B OD1 
2468 O OD2 . ASP B 77  ? 0.6655 0.6559 0.6010 0.0351  -0.0364 -0.0137 160 ASP B OD2 
2469 N N   . THR B 78  ? 0.5169 0.5133 0.5135 0.0325  -0.0468 -0.0422 161 THR B N   
2470 C CA  . THR B 78  ? 0.5082 0.5063 0.5471 0.0327  -0.0548 -0.0511 161 THR B CA  
2471 C C   . THR B 78  ? 0.5740 0.5720 0.6085 0.0404  -0.0724 -0.0642 161 THR B C   
2472 O O   . THR B 78  ? 0.6579 0.6574 0.7312 0.0419  -0.0834 -0.0746 161 THR B O   
2473 C CB  . THR B 78  ? 0.4801 0.4794 0.5408 0.0335  -0.0577 -0.0612 161 THR B CB  
2474 O OG1 . THR B 78  ? 0.4959 0.4954 0.5304 0.0427  -0.0708 -0.0769 161 THR B OG1 
2475 C CG2 . THR B 78  ? 0.4494 0.4488 0.5025 0.0283  -0.0411 -0.0479 161 THR B CG2 
2476 N N   . GLU B 79  ? 0.5817 0.5786 0.5723 0.0471  -0.0744 -0.0628 162 GLU B N   
2477 C CA  . GLU B 79  ? 0.6414 0.6391 0.6161 0.0598  -0.0914 -0.0739 162 GLU B CA  
2478 C C   . GLU B 79  ? 0.6394 0.6355 0.6089 0.0584  -0.0899 -0.0635 162 GLU B C   
2479 O O   . GLU B 79  ? 0.6365 0.6337 0.5955 0.0700  -0.1048 -0.0714 162 GLU B O   
2480 C CB  . GLU B 79  ? 0.6852 0.6833 0.6117 0.0740  -0.0924 -0.0755 162 GLU B CB  
2481 C CG  . GLU B 79  ? 0.7869 0.7871 0.7120 0.0792  -0.0958 -0.0886 162 GLU B CG  
2482 C CD  . GLU B 79  ? 0.8248 0.8278 0.7959 0.0794  -0.1135 -0.1106 162 GLU B CD  
2483 O OE1 . GLU B 79  ? 0.9260 0.9283 0.9376 0.0660  -0.1054 -0.1073 162 GLU B OE1 
2484 O OE2 . GLU B 79  ? 0.8641 0.8704 0.8351 0.0943  -0.1354 -0.1305 162 GLU B OE2 
2485 N N   . ASN B 80  ? 0.5538 0.5482 0.5277 0.0472  -0.0737 -0.0472 163 ASN B N   
2486 C CA  . ASN B 80  ? 0.5361 0.5291 0.5053 0.0459  -0.0711 -0.0377 163 ASN B CA  
2487 C C   . ASN B 80  ? 0.5537 0.5453 0.4854 0.0569  -0.0732 -0.0328 163 ASN B C   
2488 O O   . ASN B 80  ? 0.4837 0.4750 0.4111 0.0629  -0.0802 -0.0312 163 ASN B O   
2489 C CB  . ASN B 80  ? 0.5538 0.5480 0.5566 0.0460  -0.0826 -0.0458 163 ASN B CB  
2490 C CG  . ASN B 80  ? 0.5581 0.5514 0.5666 0.0421  -0.0776 -0.0359 163 ASN B CG  
2491 O OD1 . ASN B 80  ? 0.6866 0.6787 0.6818 0.0376  -0.0648 -0.0243 163 ASN B OD1 
2492 N ND2 . ASN B 80  ? 0.5643 0.5583 0.5978 0.0446  -0.0892 -0.0428 163 ASN B ND2 
2493 N N   . THR B 81  ? 0.5510 0.5420 0.4575 0.0613  -0.0653 -0.0283 164 THR B N   
2494 C CA  . THR B 81  ? 0.5747 0.5644 0.4496 0.0732  -0.0599 -0.0166 164 THR B CA  
2495 C C   . THR B 81  ? 0.6103 0.5973 0.4830 0.0676  -0.0402 0.0009  164 THR B C   
2496 O O   . THR B 81  ? 0.6206 0.6065 0.4733 0.0789  -0.0314 0.0145  164 THR B O   
2497 C CB  . THR B 81  ? 0.5778 0.5700 0.4218 0.0915  -0.0670 -0.0245 164 THR B CB  
2498 O OG1 . THR B 81  ? 0.6021 0.5951 0.4532 0.0856  -0.0641 -0.0325 164 THR B OG1 
2499 C CG2 . THR B 81  ? 0.5803 0.5762 0.4217 0.1056  -0.0916 -0.0432 164 THR B CG2 
2500 N N   . PHE B 82  ? 0.5286 0.5151 0.4237 0.0530  -0.0331 0.0014  165 PHE B N   
2501 C CA  . PHE B 82  ? 0.5199 0.5044 0.4230 0.0485  -0.0189 0.0136  165 PHE B CA  
2502 C C   . PHE B 82  ? 0.5349 0.5177 0.4492 0.0487  -0.0165 0.0233  165 PHE B C   
2503 O O   . PHE B 82  ? 0.5454 0.5288 0.4685 0.0461  -0.0249 0.0186  165 PHE B O   
2504 C CB  . PHE B 82  ? 0.5787 0.5646 0.5002 0.0373  -0.0160 0.0082  165 PHE B CB  
2505 C CG  . PHE B 82  ? 0.6156 0.6005 0.5543 0.0335  -0.0062 0.0149  165 PHE B CG  
2506 C CD1 . PHE B 82  ? 0.5924 0.5788 0.5524 0.0281  -0.0085 0.0110  165 PHE B CD1 
2507 C CD2 . PHE B 82  ? 0.6468 0.6299 0.5850 0.0370  0.0047  0.0236  165 PHE B CD2 
2508 C CE1 . PHE B 82  ? 0.5777 0.5641 0.5616 0.0259  -0.0039 0.0116  165 PHE B CE1 
2509 C CE2 . PHE B 82  ? 0.6392 0.6216 0.6061 0.0332  0.0123  0.0277  165 PHE B CE2 
2510 C CZ  . PHE B 82  ? 0.5841 0.5683 0.5758 0.0275  0.0061  0.0199  165 PHE B CZ  
2511 N N   . ARG B 83  ? 0.5903 0.5708 0.5089 0.0529  -0.0040 0.0381  166 ARG B N   
2512 C CA  . ARG B 83  ? 0.5841 0.5627 0.5198 0.0539  -0.0009 0.0486  166 ARG B CA  
2513 C C   . ARG B 83  ? 0.5696 0.5464 0.5358 0.0502  0.0132  0.0584  166 ARG B C   
2514 O O   . ARG B 83  ? 0.6024 0.5774 0.5650 0.0590  0.0276  0.0744  166 ARG B O   
2515 C CB  . ARG B 83  ? 0.6163 0.5940 0.5278 0.0705  0.0011  0.0625  166 ARG B CB  
2516 C CG  . ARG B 83  ? 0.6091 0.5892 0.4935 0.0792  -0.0164 0.0516  166 ARG B CG  
2517 C CD  . ARG B 83  ? 0.6069 0.5871 0.5115 0.0707  -0.0283 0.0431  166 ARG B CD  
2518 N NE  . ARG B 83  ? 0.6592 0.6419 0.5681 0.0627  -0.0400 0.0241  166 ARG B NE  
2519 C CZ  . ARG B 83  ? 0.6633 0.6480 0.5694 0.0668  -0.0557 0.0121  166 ARG B CZ  
2520 N NH1 . ARG B 83  ? 0.7715 0.7566 0.6648 0.0797  -0.0645 0.0145  166 ARG B NH1 
2521 N NH2 . ARG B 83  ? 0.7029 0.6895 0.6230 0.0596  -0.0624 -0.0021 166 ARG B NH2 
2522 N N   . PRO B 84  ? 0.5350 0.5127 0.5340 0.0396  0.0094  0.0487  167 PRO B N   
2523 C CA  . PRO B 84  ? 0.5896 0.5662 0.6306 0.0366  0.0188  0.0535  167 PRO B CA  
2524 C C   . PRO B 84  ? 0.6218 0.5946 0.6843 0.0441  0.0337  0.0765  167 PRO B C   
2525 O O   . PRO B 84  ? 0.6305 0.6016 0.7304 0.0444  0.0469  0.0864  167 PRO B O   
2526 C CB  . PRO B 84  ? 0.5107 0.4901 0.5769 0.0294  0.0069  0.0357  167 PRO B CB  
2527 C CG  . PRO B 84  ? 0.4949 0.4776 0.5283 0.0276  -0.0040 0.0228  167 PRO B CG  
2528 C CD  . PRO B 84  ? 0.4908 0.4715 0.4923 0.0329  -0.0037 0.0323  167 PRO B CD  
2529 N N   . ASP B 85  ? 0.7352 0.7070 0.7780 0.0515  0.0326  0.0863  168 ASP B N   
2530 C CA  . ASP B 85  ? 0.8661 0.8347 0.9308 0.0609  0.0484  0.1114  168 ASP B CA  
2531 C C   . ASP B 85  ? 0.8806 0.8478 0.9300 0.0748  0.0690  0.1346  168 ASP B C   
2532 O O   . ASP B 85  ? 0.9497 0.9143 1.0380 0.0801  0.0895  0.1572  168 ASP B O   
2533 C CB  . ASP B 85  ? 0.9383 0.9066 0.9864 0.0674  0.0415  0.1169  168 ASP B CB  
2534 C CG  . ASP B 85  ? 1.0827 1.0487 1.1842 0.0644  0.0471  0.1259  168 ASP B CG  
2535 O OD1 . ASP B 85  ? 1.1853 1.1486 1.3122 0.0739  0.0672  0.1527  168 ASP B OD1 
2536 O OD2 . ASP B 85  ? 1.1490 1.1163 1.2706 0.0537  0.0328  0.1067  168 ASP B OD2 
2537 N N   . ARG B 86  ? 0.8582 0.8275 0.8554 0.0818  0.0644  0.1289  169 ARG B N   
2538 C CA  . ARG B 86  ? 0.8758 0.8451 0.8516 0.0971  0.0831  0.1473  169 ARG B CA  
2539 C C   . ARG B 86  ? 0.8081 0.7757 0.8307 0.0894  0.0994  0.1531  169 ARG B C   
2540 O O   . ARG B 86  ? 0.8006 0.7669 0.8313 0.1025  0.1237  0.1787  169 ARG B O   
2541 C CB  . ARG B 86  ? 0.9674 0.9400 0.8856 0.1042  0.0707  0.1320  169 ARG B CB  
2542 C CG  . ARG B 86  ? 1.0882 1.0634 0.9543 0.1266  0.0648  0.1377  169 ARG B CG  
2543 C CD  . ARG B 86  ? 1.2752 1.2489 1.1442 0.1459  0.0860  0.1714  169 ARG B CD  
2544 N NE  . ARG B 86  ? 1.1950 1.1679 1.0694 0.1604  0.1166  0.1995  169 ARG B NE  
2545 C CZ  . ARG B 86  ? 1.0599 1.0345 0.9131 0.1660  0.1239  0.1966  169 ARG B CZ  
2546 N NH1 . ARG B 86  ? 1.0031 0.9803 0.8292 0.1581  0.1017  0.1660  169 ARG B NH1 
2547 N NH2 . ARG B 86  ? 0.9591 0.9329 0.8233 0.1802  0.1550  0.2258  169 ARG B NH2 
2548 N N   . LEU B 87  ? 0.7567 0.7249 0.8116 0.0707  0.0867  0.1302  170 LEU B N   
2549 C CA  . LEU B 87  ? 0.7478 0.7152 0.8498 0.0644  0.0979  0.1315  170 LEU B CA  
2550 C C   . LEU B 87  ? 0.8373 0.8017 1.0088 0.0652  0.1152  0.1506  170 LEU B C   
2551 O O   . LEU B 87  ? 0.9234 0.8864 1.1397 0.0658  0.1325  0.1619  170 LEU B O   
2552 C CB  . LEU B 87  ? 0.7444 0.7145 0.8610 0.0485  0.0778  0.1009  170 LEU B CB  
2553 C CG  . LEU B 87  ? 0.7323 0.7055 0.7970 0.0450  0.0610  0.0809  170 LEU B CG  
2554 C CD1 . LEU B 87  ? 0.6854 0.6618 0.7729 0.0335  0.0464  0.0572  170 LEU B CD1 
2555 C CD2 . LEU B 87  ? 0.7138 0.6869 0.7437 0.0539  0.0719  0.0896  170 LEU B CD2 
2556 N N   . ARG B 88  ? 0.8402 0.8034 1.0278 0.0655  0.1117  0.1551  171 ARG B N   
2557 C CA  . ARG B 88  ? 0.8326 0.7933 1.1002 0.0636  0.1245  0.1680  171 ARG B CA  
2558 C C   . ARG B 88  ? 0.9544 0.9120 1.2346 0.0813  0.1597  0.2103  171 ARG B C   
2559 O O   . ARG B 88  ? 0.9472 0.9025 1.3040 0.0809  0.1792  0.2259  171 ARG B O   
2560 C CB  . ARG B 88  ? 0.8637 0.8245 1.1533 0.0573  0.1088  0.1566  171 ARG B CB  
2561 C CG  . ARG B 88  ? 0.8590 0.8236 1.1627 0.0424  0.0804  0.1168  171 ARG B CG  
2562 C CD  . ARG B 88  ? 0.9606 0.9261 1.2723 0.0390  0.0652  0.1050  171 ARG B CD  
2563 N NE  . ARG B 88  ? 1.1420 1.1070 1.5396 0.0351  0.0646  0.0998  171 ARG B NE  
2564 C CZ  . ARG B 88  ? 1.1891 1.1507 1.6289 0.0392  0.0763  0.1201  171 ARG B CZ  
2565 N NH1 . ARG B 88  ? 1.2337 1.1924 1.6328 0.0494  0.0904  0.1493  171 ARG B NH1 
2566 N NH2 . ARG B 88  ? 0.9896 0.9514 1.5163 0.0349  0.0730  0.1102  171 ARG B NH2 
2567 N N   . ASP B 89  ? 0.9387 0.8971 1.1455 0.0991  0.1679  0.2279  172 ASP B N   
2568 C CA  . ASP B 89  ? 0.9358 0.8930 1.1359 0.1225  0.2026  0.2691  172 ASP B CA  
2569 C C   . ASP B 89  ? 0.9909 0.9482 1.2062 0.1241  0.2204  0.2752  172 ASP B C   
2570 O O   . ASP B 89  ? 1.0214 0.9763 1.2900 0.1338  0.2533  0.3075  172 ASP B O   
2571 C CB  . ASP B 89  ? 1.0380 0.9981 1.1440 0.1447  0.2000  0.2773  172 ASP B CB  
2572 C CG  . ASP B 89  ? 1.1450 1.1051 1.2367 0.1502  0.1897  0.2816  172 ASP B CG  
2573 O OD1 . ASP B 89  ? 1.0087 0.9703 1.0772 0.1363  0.1583  0.2497  172 ASP B OD1 
2574 O OD2 . ASP B 89  ? 1.1403 1.0990 1.2451 0.1700  0.2152  0.3193  172 ASP B OD2 
2575 N N   . ILE B 90  ? 0.8928 0.8527 1.0633 0.1157  0.2004  0.2462  173 ILE B N   
2576 C CA  . ILE B 90  ? 0.8199 0.7805 0.9897 0.1182  0.2136  0.2485  173 ILE B CA  
2577 C C   . ILE B 90  ? 0.7617 0.7199 1.0287 0.1020  0.2199  0.2450  173 ILE B C   
2578 O O   . ILE B 90  ? 0.7341 0.6911 1.0409 0.1087  0.2470  0.2662  173 ILE B O   
2579 C CB  . ILE B 90  ? 0.8149 0.7789 0.9200 0.1112  0.1866  0.2155  173 ILE B CB  
2580 C CG1 . ILE B 90  ? 0.7891 0.7558 0.8092 0.1313  0.1817  0.2195  173 ILE B CG1 
2581 C CG2 . ILE B 90  ? 0.7479 0.7125 0.8597 0.1089  0.1950  0.2112  173 ILE B CG2 
2582 C CD1 . ILE B 90  ? 0.7471 0.7169 0.7188 0.1215  0.1496  0.1838  173 ILE B CD1 
2583 N N   . ALA B 91  ? 0.7039 0.6622 1.0119 0.0834  0.1949  0.2183  174 ALA B N   
2584 C CA  . ALA B 91  ? 0.7288 0.6860 1.1365 0.0702  0.1937  0.2089  174 ALA B CA  
2585 C C   . ALA B 91  ? 0.7793 0.7326 1.2680 0.0800  0.2289  0.2473  174 ALA B C   
2586 O O   . ALA B 91  ? 0.8398 0.7920 1.4064 0.0767  0.2429  0.2523  174 ALA B O   
2587 C CB  . ALA B 91  ? 0.6634 0.6224 1.0895 0.0558  0.1616  0.1761  174 ALA B CB  
2588 N N   . ASP B 92  ? 0.7920 0.7436 1.2660 0.0931  0.2440  0.2753  175 ASP B N   
2589 C CA  . ASP B 92  ? 0.8602 0.8081 1.4060 0.1063  0.2821  0.3190  175 ASP B CA  
2590 C C   . ASP B 92  ? 0.8611 0.8085 1.3996 0.1250  0.3205  0.3552  175 ASP B C   
2591 O O   . ASP B 92  ? 0.9091 0.8539 1.5408 0.1273  0.3493  0.3791  175 ASP B O   
2592 C CB  . ASP B 92  ? 0.9668 0.9138 1.4813 0.1201  0.2893  0.3429  175 ASP B CB  
2593 C CG  . ASP B 92  ? 1.0730 1.0191 1.6435 0.1038  0.2656  0.3205  175 ASP B CG  
2594 O OD1 . ASP B 92  ? 1.0678 1.0162 1.6388 0.0844  0.2300  0.2753  175 ASP B OD1 
2595 O OD2 . ASP B 92  ? 1.2866 1.2300 1.9019 0.1122  0.2834  0.3487  175 ASP B OD2 
2596 N N   . ARG B 93  ? 0.8324 0.7826 1.2645 0.1396  0.3210  0.3581  176 ARG B N   
2597 C CA  . ARG B 93  ? 0.8216 0.7726 1.2327 0.1594  0.3545  0.3870  176 ARG B CA  
2598 C C   . ARG B 93  ? 0.7925 0.7424 1.2795 0.1427  0.3563  0.3727  176 ARG B C   
2599 O O   . ARG B 93  ? 0.7963 0.7448 1.3351 0.1541  0.3933  0.4049  176 ARG B O   
2600 C CB  . ARG B 93  ? 0.8180 0.7734 1.1045 0.1738  0.3422  0.3761  176 ARG B CB  
2601 C CG  . ARG B 93  ? 0.8574 0.8148 1.1145 0.1928  0.3699  0.3951  176 ARG B CG  
2602 C CD  . ARG B 93  ? 0.8641 0.8260 1.0209 0.1942  0.3416  0.3624  176 ARG B CD  
2603 N NE  . ARG B 93  ? 0.8475 0.8118 0.9767 0.2096  0.3625  0.3721  176 ARG B NE  
2604 C CZ  . ARG B 93  ? 0.8474 0.8160 0.8944 0.2168  0.3451  0.3490  176 ARG B CZ  
2605 N NH1 . ARG B 93  ? 0.8221 0.7931 0.8093 0.2098  0.3070  0.3156  176 ARG B NH1 
2606 N NH2 . ARG B 93  ? 0.8663 0.8371 0.8962 0.2318  0.3669  0.3595  176 ARG B NH2 
2607 N N   . PHE B 94  ? 0.7680 0.7191 1.2650 0.1174  0.3169  0.3254  177 PHE B N   
2608 C CA  . PHE B 94  ? 0.7623 0.7133 1.3312 0.1028  0.3135  0.3078  177 PHE B CA  
2609 C C   . PHE B 94  ? 0.7751 0.7242 1.4702 0.0873  0.3062  0.2965  177 PHE B C   
2610 O O   . PHE B 94  ? 0.7901 0.7402 1.5504 0.0744  0.2940  0.2729  177 PHE B O   
2611 C CB  . PHE B 94  ? 0.7578 0.7124 1.2636 0.0892  0.2774  0.2646  177 PHE B CB  
2612 C CG  . PHE B 94  ? 0.7530 0.7097 1.1628 0.1038  0.2872  0.2731  177 PHE B CG  
2613 C CD1 . PHE B 94  ? 0.7067 0.6658 1.0163 0.1074  0.2653  0.2575  177 PHE B CD1 
2614 C CD2 . PHE B 94  ? 0.7706 0.7269 1.1956 0.1151  0.3180  0.2954  177 PHE B CD2 
2615 C CE1 . PHE B 94  ? 0.7498 0.7116 0.9782 0.1224  0.2713  0.2609  177 PHE B CE1 
2616 C CE2 . PHE B 94  ? 0.7304 0.6894 1.0676 0.1310  0.3261  0.3005  177 PHE B CE2 
2617 C CZ  . PHE B 94  ? 0.7769 0.7388 1.0163 0.1349  0.3012  0.2818  177 PHE B CZ  
2618 N N   . ASN B 95  ? 0.8352 0.7822 1.5701 0.0899  0.3121  0.3114  178 ASN B N   
2619 C CA  . ASN B 95  ? 0.8587 0.8045 1.7211 0.0767  0.3034  0.2974  178 ASN B CA  
2620 C C   . ASN B 95  ? 0.8370 0.7868 1.7253 0.0561  0.2557  0.2389  178 ASN B C   
2621 O O   . ASN B 95  ? 0.8505 0.8008 1.8409 0.0487  0.2517  0.2243  178 ASN B O   
2622 C CB  . ASN B 95  ? 0.8822 0.8249 1.8566 0.0834  0.3434  0.3313  178 ASN B CB  
2623 C CG  . ASN B 95  ? 0.9681 0.9072 1.9532 0.1059  0.3926  0.3922  178 ASN B CG  
2624 O OD1 . ASN B 95  ? 0.9465 0.8840 1.9391 0.1095  0.3937  0.4043  178 ASN B OD1 
2625 N ND2 . ASN B 95  ? 0.9844 0.9224 1.9692 0.1234  0.4353  0.4326  178 ASN B ND2 
2626 N N   . VAL B 96  ? 0.8326 0.7858 1.6322 0.0496  0.2206  0.2066  179 VAL B N   
2627 C CA  . VAL B 96  ? 0.8361 0.7944 1.6515 0.0354  0.1758  0.1530  179 VAL B CA  
2628 C C   . VAL B 96  ? 0.7784 0.7386 1.5561 0.0319  0.1495  0.1323  179 VAL B C   
2629 O O   . VAL B 96  ? 0.7378 0.6962 1.4405 0.0379  0.1581  0.1521  179 VAL B O   
2630 C CB  . VAL B 96  ? 0.9436 0.9057 1.6907 0.0313  0.1572  0.1281  179 VAL B CB  
2631 C CG1 . VAL B 96  ? 1.0072 0.9756 1.7732 0.0223  0.1139  0.0768  179 VAL B CG1 
2632 C CG2 . VAL B 96  ? 0.8032 0.7636 1.5864 0.0347  0.1825  0.1470  179 VAL B CG2 
2633 N N   . ASP B 97  ? 0.7164 0.6811 1.5453 0.0244  0.1166  0.0914  180 ASP B N   
2634 C CA  . ASP B 97  ? 0.7838 0.7506 1.5853 0.0228  0.0946  0.0731  180 ASP B CA  
2635 C C   . ASP B 97  ? 0.9327 0.9018 1.6080 0.0230  0.0806  0.0646  180 ASP B C   
2636 O O   . ASP B 97  ? 0.9752 0.9477 1.5996 0.0213  0.0677  0.0473  180 ASP B O   
2637 C CB  . ASP B 97  ? 0.7154 0.6877 1.5942 0.0192  0.0617  0.0290  180 ASP B CB  
2638 C CG  . ASP B 97  ? 0.8879 0.8595 1.7950 0.0196  0.0564  0.0276  180 ASP B CG  
2639 O OD1 . ASP B 97  ? 0.8144 0.7876 1.6390 0.0201  0.0445  0.0210  180 ASP B OD1 
2640 O OD2 . ASP B 97  ? 0.9206 0.8899 1.9392 0.0196  0.0657  0.0342  180 ASP B OD2 
2641 N N   . HIS B 98  ? 0.9918 0.9589 1.6236 0.0255  0.0842  0.0783  181 HIS B N   
2642 C CA  . HIS B 98  ? 0.9461 0.9147 1.4703 0.0264  0.0747  0.0750  181 HIS B CA  
2643 C C   . HIS B 98  ? 0.9139 0.8890 1.4148 0.0220  0.0417  0.0341  181 HIS B C   
2644 O O   . HIS B 98  ? 0.9714 0.9491 1.4008 0.0216  0.0325  0.0248  181 HIS B O   
2645 C CB  . HIS B 98  ? 1.0237 0.9890 1.5201 0.0311  0.0843  0.0971  181 HIS B CB  
2646 C CG  . HIS B 98  ? 1.2541 1.2149 1.8280 0.0358  0.1081  0.1261  181 HIS B CG  
2647 N ND1 . HIS B 98  ? 1.2927 1.2494 1.8814 0.0450  0.1411  0.1646  181 HIS B ND1 
2648 C CD2 . HIS B 98  ? 1.3475 1.3075 1.9936 0.0339  0.1043  0.1227  181 HIS B CD2 
2649 C CE1 . HIS B 98  ? 1.4181 1.3713 2.0870 0.0489  0.1599  0.1879  181 HIS B CE1 
2650 N NE2 . HIS B 98  ? 1.4202 1.3752 2.1263 0.0410  0.1362  0.1611  181 HIS B NE2 
2651 N N   . ASP B 99  ? 0.9509 0.9292 1.5148 0.0209  0.0243  0.0097  182 ASP B N   
2652 C CA  . ASP B 99  ? 0.8984 0.8848 1.4462 0.0222  -0.0074 -0.0312 182 ASP B CA  
2653 C C   . ASP B 99  ? 0.7973 0.7873 1.3190 0.0229  -0.0149 -0.0442 182 ASP B C   
2654 O O   . ASP B 99  ? 0.8392 0.8314 1.2827 0.0239  -0.0200 -0.0470 182 ASP B O   
2655 C CB  . ASP B 99  ? 1.0207 1.0110 1.6563 0.0245  -0.0260 -0.0593 182 ASP B CB  
2656 C CG  . ASP B 99  ? 1.1382 1.1267 1.7833 0.0246  -0.0250 -0.0537 182 ASP B CG  
2657 O OD1 . ASP B 99  ? 1.1756 1.1636 1.9113 0.0247  -0.0273 -0.0604 182 ASP B OD1 
2658 O OD2 . ASP B 99  ? 0.9438 0.9312 1.5114 0.0245  -0.0222 -0.0430 182 ASP B OD2 
2659 N N   . ALA B 100 ? 0.6832 0.6734 1.2742 0.0223  -0.0136 -0.0495 183 ALA B N   
2660 C CA  . ALA B 100 ? 0.6599 0.6541 1.2355 0.0236  -0.0228 -0.0641 183 ALA B CA  
2661 C C   . ALA B 100 ? 0.6654 0.6569 1.1553 0.0216  -0.0082 -0.0430 183 ALA B C   
2662 O O   . ALA B 100 ? 0.6685 0.6648 1.1174 0.0239  -0.0216 -0.0593 183 ALA B O   
2663 C CB  . ALA B 100 ? 0.6785 0.6714 1.3513 0.0223  -0.0171 -0.0650 183 ALA B CB  
2664 N N   . VAL B 101 ? 0.6059 0.5903 1.0715 0.0196  0.0184  -0.0080 184 VAL B N   
2665 C CA  . VAL B 101 ? 0.5749 0.5571 0.9644 0.0197  0.0311  0.0099  184 VAL B CA  
2666 C C   . VAL B 101 ? 0.5887 0.5746 0.9034 0.0202  0.0142  -0.0042 184 VAL B C   
2667 O O   . VAL B 101 ? 0.5449 0.5334 0.8135 0.0204  0.0083  -0.0113 184 VAL B O   
2668 C CB  . VAL B 101 ? 0.5622 0.5377 0.9363 0.0231  0.0595  0.0471  184 VAL B CB  
2669 C CG1 . VAL B 101 ? 0.5000 0.4750 0.7848 0.0261  0.0635  0.0567  184 VAL B CG1 
2670 C CG2 . VAL B 101 ? 0.5682 0.5400 1.0050 0.0256  0.0845  0.0694  184 VAL B CG2 
2671 N N   . LEU B 102 ? 0.5545 0.5405 0.8641 0.0209  0.0086  -0.0060 185 LEU B N   
2672 C CA  . LEU B 102 ? 0.5508 0.5396 0.8004 0.0220  -0.0028 -0.0142 185 LEU B CA  
2673 C C   . LEU B 102 ? 0.5685 0.5653 0.8074 0.0260  -0.0248 -0.0439 185 LEU B C   
2674 O O   . LEU B 102 ? 0.5782 0.5782 0.7632 0.0284  -0.0304 -0.0481 185 LEU B O   
2675 C CB  . LEU B 102 ? 0.5671 0.5540 0.8299 0.0223  -0.0021 -0.0087 185 LEU B CB  
2676 C CG  . LEU B 102 ? 0.5852 0.5675 0.8043 0.0229  0.0096  0.0143  185 LEU B CG  
2677 C CD1 . LEU B 102 ? 0.6097 0.5881 0.7940 0.0254  0.0263  0.0365  185 LEU B CD1 
2678 C CD2 . LEU B 102 ? 0.5473 0.5266 0.8051 0.0238  0.0151  0.0249  185 LEU B CD2 
2679 N N   . ASP B 103 ? 0.5449 0.5456 0.8387 0.0289  -0.0366 -0.0636 186 ASP B N   
2680 C CA  . ASP B 103 ? 0.5792 0.5887 0.8640 0.0377  -0.0580 -0.0918 186 ASP B CA  
2681 C C   . ASP B 103 ? 0.5580 0.5689 0.8129 0.0382  -0.0564 -0.0902 186 ASP B C   
2682 O O   . ASP B 103 ? 0.5539 0.5720 0.7756 0.0474  -0.0701 -0.1059 186 ASP B O   
2683 C CB  . ASP B 103 ? 0.6825 0.6963 1.0419 0.0428  -0.0745 -0.1171 186 ASP B CB  
2684 C CG  . ASP B 103 ? 0.8404 0.8610 1.2031 0.0530  -0.0943 -0.1420 186 ASP B CG  
2685 O OD1 . ASP B 103 ? 0.9283 0.9584 1.2587 0.0671  -0.1134 -0.1657 186 ASP B OD1 
2686 O OD2 . ASP B 103 ? 0.8289 0.8460 1.2215 0.0490  -0.0895 -0.1361 186 ASP B OD2 
2687 N N   . ASN B 104 ? 0.4774 0.4821 0.7453 0.0305  -0.0390 -0.0708 187 ASN B N   
2688 C CA  . ASN B 104 ? 0.4839 0.4901 0.7345 0.0309  -0.0386 -0.0718 187 ASN B CA  
2689 C C   . ASN B 104 ? 0.4842 0.4876 0.6689 0.0279  -0.0267 -0.0543 187 ASN B C   
2690 O O   . ASN B 104 ? 0.5115 0.5144 0.6843 0.0265  -0.0215 -0.0499 187 ASN B O   
2691 C CB  . ASN B 104 ? 0.5272 0.5302 0.8403 0.0270  -0.0297 -0.0672 187 ASN B CB  
2692 C CG  . ASN B 104 ? 0.5948 0.6022 0.9844 0.0315  -0.0473 -0.0919 187 ASN B CG  
2693 O OD1 . ASN B 104 ? 0.5991 0.6149 0.9855 0.0414  -0.0728 -0.1209 187 ASN B OD1 
2694 N ND2 . ASN B 104 ? 0.6188 0.6211 1.0799 0.0265  -0.0336 -0.0803 187 ASN B ND2 
2695 N N   . VAL B 105 ? 0.4313 0.4337 0.5785 0.0277  -0.0248 -0.0474 188 VAL B N   
2696 C CA  . VAL B 105 ? 0.4342 0.4344 0.5301 0.0254  -0.0164 -0.0343 188 VAL B CA  
2697 C C   . VAL B 105 ? 0.5146 0.5197 0.5768 0.0305  -0.0258 -0.0419 188 VAL B C   
2698 O O   . VAL B 105 ? 0.4767 0.4828 0.5427 0.0327  -0.0304 -0.0457 188 VAL B O   
2699 C CB  . VAL B 105 ? 0.4202 0.4140 0.5069 0.0219  -0.0029 -0.0152 188 VAL B CB  
2700 C CG1 . VAL B 105 ? 0.4035 0.3962 0.4431 0.0216  0.0001  -0.0082 188 VAL B CG1 
2701 C CG2 . VAL B 105 ? 0.3872 0.3761 0.5042 0.0206  0.0122  -0.0010 188 VAL B CG2 
2702 N N   . LEU B 106 ? 0.5308 0.5390 0.5642 0.0335  -0.0266 -0.0425 189 LEU B N   
2703 C CA  . LEU B 106 ? 0.5124 0.5254 0.5170 0.0405  -0.0303 -0.0444 189 LEU B CA  
2704 C C   . LEU B 106 ? 0.5559 0.5647 0.5392 0.0347  -0.0209 -0.0305 189 LEU B C   
2705 O O   . LEU B 106 ? 0.5882 0.5935 0.5660 0.0298  -0.0148 -0.0237 189 LEU B O   
2706 C CB  . LEU B 106 ? 0.5199 0.5398 0.5112 0.0505  -0.0353 -0.0509 189 LEU B CB  
2707 C CG  . LEU B 106 ? 0.5911 0.6201 0.5829 0.0664  -0.0492 -0.0681 189 LEU B CG  
2708 C CD1 . LEU B 106 ? 0.6281 0.6587 0.6262 0.0704  -0.0547 -0.0758 189 LEU B CD1 
2709 C CD2 . LEU B 106 ? 0.6097 0.6398 0.6329 0.0668  -0.0589 -0.0816 189 LEU B CD2 
2710 N N   . TYR B 107 ? 0.5427 0.5524 0.5169 0.0369  -0.0212 -0.0285 190 TYR B N   
2711 C CA  . TYR B 107 ? 0.5208 0.5263 0.4865 0.0317  -0.0161 -0.0190 190 TYR B CA  
2712 C C   . TYR B 107 ? 0.5736 0.5831 0.5300 0.0371  -0.0137 -0.0160 190 TYR B C   
2713 O O   . TYR B 107 ? 0.5665 0.5816 0.5197 0.0463  -0.0152 -0.0196 190 TYR B O   
2714 C CB  . TYR B 107 ? 0.5242 0.5263 0.4984 0.0289  -0.0175 -0.0174 190 TYR B CB  
2715 C CG  . TYR B 107 ? 0.5203 0.5188 0.4858 0.0260  -0.0160 -0.0105 190 TYR B CG  
2716 C CD1 . TYR B 107 ? 0.5202 0.5153 0.4774 0.0239  -0.0139 -0.0066 190 TYR B CD1 
2717 C CD2 . TYR B 107 ? 0.5160 0.5157 0.4830 0.0274  -0.0178 -0.0100 190 TYR B CD2 
2718 C CE1 . TYR B 107 ? 0.5389 0.5321 0.4897 0.0245  -0.0169 -0.0051 190 TYR B CE1 
2719 C CE2 . TYR B 107 ? 0.4989 0.4960 0.4643 0.0258  -0.0195 -0.0068 190 TYR B CE2 
2720 C CZ  . TYR B 107 ? 0.5806 0.5747 0.5378 0.0249  -0.0207 -0.0058 190 TYR B CZ  
2721 O OH  . TYR B 107 ? 0.6072 0.5999 0.5636 0.0265  -0.0268 -0.0074 190 TYR B OH  
2722 N N   . ALA B 108 ? 0.4867 0.4940 0.4425 0.0334  -0.0097 -0.0097 191 ALA B N   
2723 C CA  . ALA B 108 ? 0.4719 0.4818 0.4325 0.0374  -0.0045 -0.0034 191 ALA B CA  
2724 C C   . ALA B 108 ? 0.4717 0.4773 0.4439 0.0309  -0.0059 -0.0022 191 ALA B C   
2725 O O   . ALA B 108 ? 0.4952 0.4977 0.4650 0.0268  -0.0090 -0.0056 191 ALA B O   
2726 C CB  . ALA B 108 ? 0.3816 0.3967 0.3397 0.0456  0.0027  0.0022  191 ALA B CB  
2727 N N   . ARG B 109 ? 0.4239 0.4299 0.4099 0.0319  -0.0047 0.0008  192 ARG B N   
2728 C CA  . ARG B 109 ? 0.4541 0.4575 0.4601 0.0283  -0.0093 -0.0015 192 ARG B CA  
2729 C C   . ARG B 109 ? 0.4532 0.4591 0.4816 0.0306  -0.0006 0.0047  192 ARG B C   
2730 O O   . ARG B 109 ? 0.4855 0.4956 0.5135 0.0372  0.0108  0.0149  192 ARG B O   
2731 C CB  . ARG B 109 ? 0.4410 0.4440 0.4612 0.0287  -0.0117 -0.0009 192 ARG B CB  
2732 C CG  . ARG B 109 ? 0.4309 0.4306 0.4358 0.0267  -0.0216 -0.0064 192 ARG B CG  
2733 C CD  . ARG B 109 ? 0.4394 0.4360 0.4454 0.0265  -0.0339 -0.0148 192 ARG B CD  
2734 N NE  . ARG B 109 ? 0.4462 0.4433 0.4822 0.0275  -0.0416 -0.0201 192 ARG B NE  
2735 C CZ  . ARG B 109 ? 0.4942 0.4918 0.5541 0.0285  -0.0484 -0.0289 192 ARG B CZ  
2736 N NH1 . ARG B 109 ? 0.5865 0.5842 0.6387 0.0284  -0.0472 -0.0318 192 ARG B NH1 
2737 N NH2 . ARG B 109 ? 0.4525 0.4508 0.5493 0.0299  -0.0577 -0.0365 192 ARG B NH2 
2738 N N   . ALA B 110 ? 0.5065 0.5106 0.5557 0.0274  -0.0060 -0.0013 193 ALA B N   
2739 C CA  . ALA B 110 ? 0.4816 0.4877 0.5699 0.0290  0.0024  0.0052  193 ALA B CA  
2740 C C   . ALA B 110 ? 0.4826 0.4875 0.6137 0.0274  -0.0050 -0.0014 193 ALA B C   
2741 O O   . ALA B 110 ? 0.5273 0.5299 0.6552 0.0255  -0.0224 -0.0178 193 ALA B O   
2742 C CB  . ALA B 110 ? 0.4666 0.4719 0.5559 0.0269  -0.0004 -0.0007 193 ALA B CB  
2743 N N   . TYR B 111 ? 0.4631 0.4705 0.6356 0.0304  0.0081  0.0114  194 TYR B N   
2744 C CA  . TYR B 111 ? 0.4567 0.4633 0.6843 0.0291  0.0018  0.0054  194 TYR B CA  
2745 C C   . TYR B 111 ? 0.4678 0.4751 0.7634 0.0288  0.0048  0.0050  194 TYR B C   
2746 O O   . TYR B 111 ? 0.5202 0.5270 0.8707 0.0275  -0.0056 -0.0061 194 TYR B O   
2747 C CB  . TYR B 111 ? 0.4233 0.4319 0.6635 0.0331  0.0156  0.0204  194 TYR B CB  
2748 C CG  . TYR B 111 ? 0.4541 0.4622 0.6412 0.0335  0.0111  0.0184  194 TYR B CG  
2749 C CD1 . TYR B 111 ? 0.4558 0.4671 0.6035 0.0401  0.0252  0.0311  194 TYR B CD1 
2750 C CD2 . TYR B 111 ? 0.4342 0.4393 0.6126 0.0296  -0.0081 0.0029  194 TYR B CD2 
2751 C CE1 . TYR B 111 ? 0.4379 0.4490 0.5461 0.0406  0.0195  0.0264  194 TYR B CE1 
2752 C CE2 . TYR B 111 ? 0.4767 0.4812 0.6135 0.0300  -0.0106 0.0029  194 TYR B CE2 
2753 C CZ  . TYR B 111 ? 0.5146 0.5218 0.6202 0.0344  0.0030  0.0137  194 TYR B CZ  
2754 O OH  . TYR B 111 ? 0.5647 0.5714 0.6388 0.0348  -0.0013 0.0107  194 TYR B OH  
2755 N N   . THR B 112 ? 0.4399 0.4486 0.7378 0.0307  0.0184  0.0167  195 THR B N   
2756 C CA  . THR B 112 ? 0.4609 0.4701 0.8278 0.0303  0.0225  0.0175  195 THR B CA  
2757 C C   . THR B 112 ? 0.4509 0.4601 0.7909 0.0297  0.0228  0.0159  195 THR B C   
2758 O O   . THR B 112 ? 0.4517 0.4614 0.7283 0.0312  0.0267  0.0217  195 THR B O   
2759 C CB  . THR B 112 ? 0.4659 0.4780 0.8913 0.0370  0.0520  0.0475  195 THR B CB  
2760 O OG1 . THR B 112 ? 0.5310 0.5463 0.9184 0.0456  0.0748  0.0726  195 THR B OG1 
2761 C CG2 . THR B 112 ? 0.3687 0.3817 0.8113 0.0398  0.0592  0.0562  195 THR B CG2 
2762 N N   . SER B 113 ? 0.4746 0.4833 0.8668 0.0274  0.0157  0.0043  196 SER B N   
2763 C CA  . SER B 113 ? 0.4521 0.4613 0.8454 0.0276  0.0217  0.0079  196 SER B CA  
2764 C C   . SER B 113 ? 0.4746 0.4863 0.8365 0.0339  0.0471  0.0383  196 SER B C   
2765 O O   . SER B 113 ? 0.4435 0.4555 0.7509 0.0346  0.0464  0.0384  196 SER B O   
2766 C CB  . SER B 113 ? 0.4889 0.4988 0.9774 0.0277  0.0273  0.0100  196 SER B CB  
2767 O OG  . SER B 113 ? 0.6234 0.6322 1.1386 0.0245  0.0020  -0.0225 196 SER B OG  
2768 N N   . GLU B 114 ? 0.5252 0.5396 0.9276 0.0412  0.0705  0.0648  197 GLU B N   
2769 C CA  . GLU B 114 ? 0.5606 0.5792 0.9365 0.0533  0.0957  0.0950  197 GLU B CA  
2770 C C   . GLU B 114 ? 0.5624 0.5825 0.8521 0.0574  0.0913  0.0933  197 GLU B C   
2771 O O   . GLU B 114 ? 0.6155 0.6379 0.8584 0.0631  0.0937  0.0980  197 GLU B O   
2772 C CB  . GLU B 114 ? 0.6203 0.6420 1.0537 0.0642  0.1242  0.1260  197 GLU B CB  
2773 C CG  . GLU B 114 ? 0.8686 0.8898 1.3886 0.0636  0.1353  0.1358  197 GLU B CG  
2774 C CD  . GLU B 114 ? 1.0507 1.0768 1.6055 0.0816  0.1744  0.1803  197 GLU B CD  
2775 O OE1 . GLU B 114 ? 1.0732 1.1024 1.6172 0.0926  0.1918  0.1996  197 GLU B OE1 
2776 O OE2 . GLU B 114 ? 0.9612 0.9884 1.5536 0.0864  0.1889  0.1970  197 GLU B OE2 
2777 N N   . HIS B 115 ? 0.4766 0.4955 0.7516 0.0543  0.0825  0.0838  198 HIS B N   
2778 C CA  . HIS B 115 ? 0.4629 0.4833 0.6709 0.0582  0.0783  0.0811  198 HIS B CA  
2779 C C   . HIS B 115 ? 0.4887 0.5071 0.6525 0.0521  0.0624  0.0643  198 HIS B C   
2780 O O   . HIS B 115 ? 0.4986 0.5201 0.6166 0.0594  0.0647  0.0683  198 HIS B O   
2781 C CB  . HIS B 115 ? 0.4549 0.4730 0.6650 0.0527  0.0678  0.0698  198 HIS B CB  
2782 C CG  . HIS B 115 ? 0.4989 0.5186 0.6498 0.0570  0.0641  0.0670  198 HIS B CG  
2783 N ND1 . HIS B 115 ? 0.5106 0.5360 0.6235 0.0713  0.0763  0.0801  198 HIS B ND1 
2784 C CD2 . HIS B 115 ? 0.4790 0.4959 0.6069 0.0502  0.0482  0.0511  198 HIS B CD2 
2785 C CE1 . HIS B 115 ? 0.4888 0.5149 0.5619 0.0727  0.0672  0.0701  198 HIS B CE1 
2786 N NE2 . HIS B 115 ? 0.4922 0.5126 0.5761 0.0588  0.0516  0.0544  198 HIS B NE2 
2787 N N   . GLN B 116 ? 0.4699 0.4839 0.6513 0.0409  0.0464  0.0450  199 GLN B N   
2788 C CA  . GLN B 116 ? 0.4696 0.4813 0.6120 0.0353  0.0324  0.0288  199 GLN B CA  
2789 C C   . GLN B 116 ? 0.5139 0.5284 0.6479 0.0407  0.0427  0.0402  199 GLN B C   
2790 O O   . GLN B 116 ? 0.6050 0.6204 0.6972 0.0424  0.0397  0.0378  199 GLN B O   
2791 C CB  . GLN B 116 ? 0.4356 0.4435 0.5985 0.0276  0.0147  0.0065  199 GLN B CB  
2792 C CG  . GLN B 116 ? 0.4724 0.4781 0.5944 0.0245  0.0033  -0.0083 199 GLN B CG  
2793 C CD  . GLN B 116 ? 0.5336 0.5373 0.6714 0.0230  -0.0133 -0.0309 199 GLN B CD  
2794 O OE1 . GLN B 116 ? 0.5357 0.5388 0.6592 0.0230  -0.0170 -0.0395 199 GLN B OE1 
2795 N NE2 . GLN B 116 ? 0.4885 0.4920 0.6568 0.0239  -0.0242 -0.0419 199 GLN B NE2 
2796 N N   . MET B 117 ? 0.5318 0.5479 0.7107 0.0442  0.0552  0.0533  200 MET B N   
2797 C CA  . MET B 117 ? 0.5791 0.5984 0.7520 0.0517  0.0664  0.0672  200 MET B CA  
2798 C C   . MET B 117 ? 0.6074 0.6326 0.7369 0.0674  0.0778  0.0846  200 MET B C   
2799 O O   . MET B 117 ? 0.6401 0.6679 0.7359 0.0729  0.0753  0.0840  200 MET B O   
2800 C CB  . MET B 117 ? 0.5912 0.6110 0.8309 0.0535  0.0798  0.0808  200 MET B CB  
2801 C CG  . MET B 117 ? 0.6314 0.6538 0.8744 0.0604  0.0906  0.0949  200 MET B CG  
2802 S SD  . MET B 117 ? 0.7158 0.7358 0.9171 0.0520  0.0722  0.0724  200 MET B SD  
2803 C CE  . MET B 117 ? 0.6322 0.6542 0.8739 0.0573  0.0856  0.0884  200 MET B CE  
2804 N N   . GLU B 118 ? 0.5416 0.5698 0.6708 0.0764  0.0883  0.0971  201 GLU B N   
2805 C CA  . GLU B 118 ? 0.5975 0.6327 0.6791 0.0952  0.0956  0.1083  201 GLU B CA  
2806 C C   . GLU B 118 ? 0.6196 0.6547 0.6506 0.0922  0.0762  0.0869  201 GLU B C   
2807 O O   . GLU B 118 ? 0.6874 0.7282 0.6826 0.1061  0.0744  0.0875  201 GLU B O   
2808 C CB  . GLU B 118 ? 0.6044 0.6429 0.6926 0.1064  0.1103  0.1234  201 GLU B CB  
2809 C CG  . GLU B 118 ? 0.7048 0.7460 0.8426 0.1172  0.1369  0.1531  201 GLU B CG  
2810 C CD  . GLU B 118 ? 0.8514 0.8951 1.0063 0.1270  0.1538  0.1692  201 GLU B CD  
2811 O OE1 . GLU B 118 ? 0.8426 0.8916 1.0216 0.1461  0.1826  0.2014  201 GLU B OE1 
2812 O OE2 . GLU B 118 ? 0.7490 0.7896 0.8942 0.1169  0.1401  0.1515  201 GLU B OE2 
2813 N N   . LEU B 119 ? 0.5712 0.6002 0.6029 0.0759  0.0612  0.0678  202 LEU B N   
2814 C CA  . LEU B 119 ? 0.5511 0.5790 0.5479 0.0715  0.0450  0.0496  202 LEU B CA  
2815 C C   . LEU B 119 ? 0.5285 0.5563 0.5141 0.0697  0.0384  0.0426  202 LEU B C   
2816 O O   . LEU B 119 ? 0.5200 0.5509 0.4793 0.0758  0.0301  0.0342  202 LEU B O   
2817 C CB  . LEU B 119 ? 0.5187 0.5401 0.5221 0.0563  0.0338  0.0354  202 LEU B CB  
2818 C CG  . LEU B 119 ? 0.5256 0.5475 0.5337 0.0587  0.0366  0.0387  202 LEU B CG  
2819 C CD1 . LEU B 119 ? 0.4615 0.4768 0.4796 0.0448  0.0244  0.0254  202 LEU B CD1 
2820 C CD2 . LEU B 119 ? 0.4362 0.4633 0.4134 0.0706  0.0359  0.0378  202 LEU B CD2 
2821 N N   . LEU B 120 ? 0.4835 0.5084 0.4941 0.0628  0.0416  0.0450  203 LEU B N   
2822 C CA  . LEU B 120 ? 0.5078 0.5327 0.5105 0.0611  0.0363  0.0389  203 LEU B CA  
2823 C C   . LEU B 120 ? 0.6049 0.6374 0.5898 0.0792  0.0415  0.0496  203 LEU B C   
2824 O O   . LEU B 120 ? 0.6242 0.6585 0.5907 0.0818  0.0316  0.0394  203 LEU B O   
2825 C CB  . LEU B 120 ? 0.5350 0.5555 0.5679 0.0508  0.0372  0.0363  203 LEU B CB  
2826 C CG  . LEU B 120 ? 0.6300 0.6441 0.6645 0.0370  0.0259  0.0179  203 LEU B CG  
2827 C CD1 . LEU B 120 ? 0.6116 0.6242 0.6163 0.0340  0.0175  0.0072  203 LEU B CD1 
2828 C CD2 . LEU B 120 ? 0.5884 0.5995 0.6388 0.0319  0.0223  0.0126  203 LEU B CD2 
2829 N N   . ASP B 121 ? 0.6334 0.6711 0.6233 0.0945  0.0566  0.0699  204 ASP B N   
2830 C CA  . ASP B 121 ? 0.7493 0.7963 0.7137 0.1189  0.0626  0.0826  204 ASP B CA  
2831 C C   . ASP B 121 ? 0.7393 0.7915 0.6640 0.1302  0.0481  0.0672  204 ASP B C   
2832 O O   . ASP B 121 ? 0.8124 0.8700 0.7159 0.1423  0.0381  0.0595  204 ASP B O   
2833 C CB  . ASP B 121 ? 0.8661 0.9186 0.8393 0.1380  0.0857  0.1112  204 ASP B CB  
2834 C CG  . ASP B 121 ? 0.9478 0.9970 0.9716 0.1318  0.1022  0.1297  204 ASP B CG  
2835 O OD1 . ASP B 121 ? 0.9089 0.9537 0.9514 0.1182  0.0949  0.1207  204 ASP B OD1 
2836 O OD2 . ASP B 121 ? 1.0258 1.0769 1.0760 0.1409  0.1230  0.1529  204 ASP B OD2 
2837 N N   . TYR B 122 ? 0.7233 0.7742 0.6425 0.1269  0.0455  0.0608  205 TYR B N   
2838 C CA  . TYR B 122 ? 0.7391 0.7942 0.6304 0.1353  0.0301  0.0427  205 TYR B CA  
2839 C C   . TYR B 122 ? 0.7157 0.7668 0.6110 0.1214  0.0105  0.0192  205 TYR B C   
2840 O O   . TYR B 122 ? 0.7806 0.8380 0.6606 0.1347  -0.0030 0.0058  205 TYR B O   
2841 C CB  . TYR B 122 ? 0.7623 0.8154 0.6555 0.1309  0.0324  0.0413  205 TYR B CB  
2842 C CG  . TYR B 122 ? 0.8665 0.9248 0.7359 0.1419  0.0173  0.0227  205 TYR B CG  
2843 C CD1 . TYR B 122 ? 0.8488 0.9011 0.7294 0.1245  0.0029  0.0034  205 TYR B CD1 
2844 C CD2 . TYR B 122 ? 0.9635 1.0335 0.8004 0.1728  0.0169  0.0235  205 TYR B CD2 
2845 C CE1 . TYR B 122 ? 0.9075 0.9645 0.7772 0.1342  -0.0122 -0.0158 205 TYR B CE1 
2846 C CE2 . TYR B 122 ? 1.0294 1.1051 0.8488 0.1847  -0.0011 0.0005  205 TYR B CE2 
2847 C CZ  . TYR B 122 ? 0.9539 1.0226 0.7946 0.1636  -0.0157 -0.0195 205 TYR B CZ  
2848 O OH  . TYR B 122 ? 1.0751 1.1490 0.9101 0.1742  -0.0337 -0.0432 205 TYR B OH  
2849 N N   . VAL B 123 ? 0.5893 0.6309 0.5072 0.0974  0.0093  0.0142  206 VAL B N   
2850 C CA  . VAL B 123 ? 0.5515 0.5888 0.4790 0.0849  -0.0021 -0.0012 206 VAL B CA  
2851 C C   . VAL B 123 ? 0.5839 0.6246 0.5123 0.0914  -0.0056 -0.0025 206 VAL B C   
2852 O O   . VAL B 123 ? 0.5808 0.6235 0.5117 0.0938  -0.0189 -0.0179 206 VAL B O   
2853 C CB  . VAL B 123 ? 0.4932 0.5211 0.4390 0.0642  0.0023  -0.0003 206 VAL B CB  
2854 C CG1 . VAL B 123 ? 0.4183 0.4419 0.3750 0.0539  -0.0026 -0.0096 206 VAL B CG1 
2855 C CG2 . VAL B 123 ? 0.4612 0.4859 0.4062 0.0585  0.0015  -0.0025 206 VAL B CG2 
2856 N N   . ALA B 124 ? 0.5267 0.5680 0.4598 0.0943  0.0057  0.0127  207 ALA B N   
2857 C CA  . ALA B 124 ? 0.6194 0.6649 0.5521 0.1028  0.0017  0.0121  207 ALA B CA  
2858 C C   . ALA B 124 ? 0.7157 0.7716 0.6232 0.1275  -0.0106 0.0039  207 ALA B C   
2859 O O   . ALA B 124 ? 0.8044 0.8624 0.7160 0.1297  -0.0268 -0.0141 207 ALA B O   
2860 C CB  . ALA B 124 ? 0.4903 0.5359 0.4348 0.1054  0.0166  0.0319  207 ALA B CB  
2861 N N   . ALA B 125 ? 0.8031 0.8659 0.6871 0.1475  -0.0035 0.0155  208 ALA B N   
2862 C CA  . ALA B 125 ? 0.8568 0.9317 0.7087 0.1778  -0.0150 0.0075  208 ALA B CA  
2863 C C   . ALA B 125 ? 0.8430 0.9189 0.6988 0.1756  -0.0388 -0.0233 208 ALA B C   
2864 O O   . ALA B 125 ? 0.8438 0.9280 0.6909 0.1940  -0.0582 -0.0417 208 ALA B O   
2865 C CB  . ALA B 125 ? 0.8802 0.9610 0.7077 0.1978  0.0006  0.0260  208 ALA B CB  
2866 N N   . LYS B 126 ? 0.7304 0.7979 0.6048 0.1538  -0.0380 -0.0293 209 LYS B N   
2867 C CA  . LYS B 126 ? 0.7339 0.8016 0.6222 0.1506  -0.0569 -0.0547 209 LYS B CA  
2868 C C   . LYS B 126 ? 0.7964 0.8606 0.7165 0.1385  -0.0681 -0.0685 209 LYS B C   
2869 O O   . LYS B 126 ? 0.8483 0.9190 0.7774 0.1514  -0.0885 -0.0905 209 LYS B O   
2870 C CB  . LYS B 126 ? 0.7095 0.7698 0.6077 0.1336  -0.0501 -0.0526 209 LYS B CB  
2871 C CG  . LYS B 126 ? 0.7324 0.7863 0.6643 0.1160  -0.0601 -0.0690 209 LYS B CG  
2872 C CD  . LYS B 126 ? 0.7096 0.7705 0.6468 0.1303  -0.0791 -0.0925 209 LYS B CD  
2873 C CE  . LYS B 126 ? 0.6630 0.7241 0.5851 0.1331  -0.0737 -0.0887 209 LYS B CE  
2874 N NZ  . LYS B 126 ? 0.6875 0.7575 0.6145 0.1516  -0.0954 -0.1159 209 LYS B NZ  
2875 N N   . PHE B 127 ? 0.8010 0.8557 0.7401 0.1166  -0.0557 -0.0570 210 PHE B N   
2876 C CA  . PHE B 127 ? 0.7617 0.8141 0.7301 0.1084  -0.0628 -0.0668 210 PHE B CA  
2877 C C   . PHE B 127 ? 0.8020 0.8647 0.7620 0.1311  -0.0778 -0.0765 210 PHE B C   
2878 O O   . PHE B 127 ? 0.7546 0.8201 0.7414 0.1342  -0.0953 -0.0969 210 PHE B O   
2879 C CB  . PHE B 127 ? 0.6662 0.7095 0.6464 0.0886  -0.0460 -0.0517 210 PHE B CB  
2880 C CG  . PHE B 127 ? 0.5816 0.6155 0.5703 0.0694  -0.0346 -0.0456 210 PHE B CG  
2881 C CD1 . PHE B 127 ? 0.5528 0.5850 0.5483 0.0664  -0.0389 -0.0530 210 PHE B CD1 
2882 C CD2 . PHE B 127 ? 0.4904 0.5176 0.4813 0.0565  -0.0208 -0.0338 210 PHE B CD2 
2883 C CE1 . PHE B 127 ? 0.5948 0.6189 0.5952 0.0517  -0.0283 -0.0455 210 PHE B CE1 
2884 C CE2 . PHE B 127 ? 0.5081 0.5279 0.5019 0.0434  -0.0125 -0.0299 210 PHE B CE2 
2885 C CZ  . PHE B 127 ? 0.5566 0.5748 0.5532 0.0414  -0.0155 -0.0342 210 PHE B CZ  
2886 N N   . HIS B 128 ? 0.8203 0.8894 0.7469 0.1490  -0.0711 -0.0615 211 HIS B N   
2887 C CA  . HIS B 128 ? 0.9097 0.9896 0.8213 0.1749  -0.0843 -0.0675 211 HIS B CA  
2888 C C   . HIS B 128 ? 0.9617 1.0522 0.8668 0.1985  -0.1110 -0.0955 211 HIS B C   
2889 O O   . HIS B 128 ? 0.9773 1.0745 0.8930 0.2121  -0.1315 -0.1142 211 HIS B O   
2890 C CB  . HIS B 128 ? 0.8781 0.9637 0.7529 0.1946  -0.0685 -0.0417 211 HIS B CB  
2891 C CG  . HIS B 128 ? 0.9333 1.0261 0.7994 0.2136  -0.0737 -0.0378 211 HIS B CG  
2892 N ND1 . HIS B 128 ? 0.9723 1.0604 0.8496 0.2041  -0.0565 -0.0158 211 HIS B ND1 
2893 C CD2 . HIS B 128 ? 0.9368 1.0421 0.7855 0.2439  -0.0968 -0.0553 211 HIS B CD2 
2894 C CE1 . HIS B 128 ? 0.9158 1.0123 0.7832 0.2258  -0.0660 -0.0164 211 HIS B CE1 
2895 N NE2 . HIS B 128 ? 0.9991 1.1065 0.8466 0.2514  -0.0915 -0.0409 211 HIS B NE2 
2896 N N   . GLU B 129 ? 1.0455 1.1378 0.9368 0.2037  -0.1124 -0.1009 212 GLU B N   
2897 C CA  . GLU B 129 ? 1.1118 1.2164 0.9874 0.2326  -0.1367 -0.1269 212 GLU B CA  
2898 C C   . GLU B 129 ? 1.1560 1.2612 1.0808 0.2278  -0.1642 -0.1618 212 GLU B C   
2899 O O   . GLU B 129 ? 1.3701 1.4876 1.2909 0.2560  -0.1924 -0.1911 212 GLU B O   
2900 C CB  . GLU B 129 ? 1.1425 1.2477 0.9955 0.2367  -0.1283 -0.1222 212 GLU B CB  
2901 C CG  . GLU B 129 ? 1.1158 1.2331 0.9107 0.2728  -0.1211 -0.1083 212 GLU B CG  
2902 C CD  . GLU B 129 ? 1.3148 1.4418 1.0897 0.2969  -0.1375 -0.1315 212 GLU B CD  
2903 O OE1 . GLU B 129 ? 1.4773 1.6190 1.2266 0.3338  -0.1613 -0.1542 212 GLU B OE1 
2904 O OE2 . GLU B 129 ? 1.1778 1.2983 0.9641 0.2803  -0.1292 -0.1299 212 GLU B OE2 
2905 N N   . GLU B 130 ? 1.0538 1.1467 1.0277 0.1950  -0.1560 -0.1591 213 GLU B N   
2906 C CA  . GLU B 130 ? 1.0741 1.1663 1.1074 0.1882  -0.1757 -0.1848 213 GLU B CA  
2907 C C   . GLU B 130 ? 0.9566 1.0342 1.0260 0.1536  -0.1531 -0.1662 213 GLU B C   
2908 O O   . GLU B 130 ? 0.8848 0.9541 0.9416 0.1370  -0.1321 -0.1466 213 GLU B O   
2909 C CB  . GLU B 130 ? 1.2453 1.3420 1.3124 0.1956  -0.1989 -0.2166 213 GLU B CB  
2910 C CG  . GLU B 130 ? 1.3045 1.4006 1.4493 0.1890  -0.2192 -0.2436 213 GLU B CG  
2911 C CD  . GLU B 130 ? 1.3827 1.4816 1.5771 0.1923  -0.2396 -0.2737 213 GLU B CD  
2912 O OE1 . GLU B 130 ? 1.4496 1.5456 1.6283 0.1876  -0.2301 -0.2671 213 GLU B OE1 
2913 O OE2 . GLU B 130 ? 1.3437 1.4478 1.6000 0.1997  -0.2660 -0.3053 213 GLU B OE2 
2914 N N   . ALA B 131 ? 0.9259 1.0012 1.0401 0.1454  -0.1581 -0.1736 214 ALA B N   
2915 C CA  . ALA B 131 ? 0.9460 1.0091 1.0841 0.1184  -0.1341 -0.1530 214 ALA B CA  
2916 C C   . ALA B 131 ? 0.8820 0.9391 1.0914 0.1030  -0.1348 -0.1631 214 ALA B C   
2917 O O   . ALA B 131 ? 0.8899 0.9527 1.1436 0.1126  -0.1577 -0.1897 214 ALA B O   
2918 C CB  . ALA B 131 ? 1.0079 1.0721 1.1316 0.1211  -0.1294 -0.1425 214 ALA B CB  
2919 N N   . GLY B 132 ? 0.8070 0.8531 1.0303 0.0813  -0.1089 -0.1415 215 GLY B N   
2920 C CA  . GLY B 132 ? 0.7903 0.8298 1.0795 0.0677  -0.1010 -0.1425 215 GLY B CA  
2921 C C   . GLY B 132 ? 0.8028 0.8385 1.0991 0.0623  -0.0953 -0.1394 215 GLY B C   
2922 O O   . GLY B 132 ? 0.8888 0.9186 1.2382 0.0518  -0.0837 -0.1341 215 GLY B O   
2923 N N   . ILE B 133 ? 0.7623 0.8017 1.0078 0.0703  -0.1012 -0.1404 216 ILE B N   
2924 C CA  . ILE B 133 ? 0.7690 0.8061 1.0201 0.0674  -0.0994 -0.1405 216 ILE B CA  
2925 C C   . ILE B 133 ? 0.6878 0.7152 0.9109 0.0523  -0.0721 -0.1122 216 ILE B C   
2926 O O   . ILE B 133 ? 0.6388 0.6605 0.8944 0.0440  -0.0619 -0.1052 216 ILE B O   
2927 C CB  . ILE B 133 ? 0.8097 0.8567 1.0281 0.0865  -0.1213 -0.1594 216 ILE B CB  
2928 C CG1 . ILE B 133 ? 0.9456 0.9984 1.0943 0.0996  -0.1216 -0.1519 216 ILE B CG1 
2929 C CG2 . ILE B 133 ? 0.7351 0.7913 1.0046 0.1020  -0.1519 -0.1946 216 ILE B CG2 
2930 C CD1 . ILE B 133 ? 0.8946 0.9409 1.0132 0.0876  -0.0989 -0.1252 216 ILE B CD1 
2931 N N   . PHE B 134 ? 0.5934 0.6195 0.7615 0.0507  -0.0614 -0.0967 217 PHE B N   
2932 C CA  . PHE B 134 ? 0.5623 0.5808 0.7012 0.0400  -0.0409 -0.0750 217 PHE B CA  
2933 C C   . PHE B 134 ? 0.5969 0.6093 0.7419 0.0309  -0.0230 -0.0607 217 PHE B C   
2934 O O   . PHE B 134 ? 0.6105 0.6252 0.7608 0.0329  -0.0261 -0.0646 217 PHE B O   
2935 C CB  . PHE B 134 ? 0.5572 0.5785 0.6425 0.0452  -0.0414 -0.0696 217 PHE B CB  
2936 C CG  . PHE B 134 ? 0.5985 0.6240 0.6713 0.0533  -0.0513 -0.0773 217 PHE B CG  
2937 C CD1 . PHE B 134 ? 0.5938 0.6292 0.6580 0.0710  -0.0699 -0.0944 217 PHE B CD1 
2938 C CD2 . PHE B 134 ? 0.5573 0.5776 0.6251 0.0460  -0.0427 -0.0683 217 PHE B CD2 
2939 C CE1 . PHE B 134 ? 0.5778 0.6178 0.6282 0.0809  -0.0781 -0.1024 217 PHE B CE1 
2940 C CE2 . PHE B 134 ? 0.5329 0.5570 0.5916 0.0532  -0.0511 -0.0757 217 PHE B CE2 
2941 C CZ  . PHE B 134 ? 0.5934 0.6273 0.6443 0.0704  -0.0682 -0.0930 217 PHE B CZ  
2942 N N   . LYS B 135 ? 0.5378 0.5432 0.6817 0.0234  -0.0048 -0.0446 218 LYS B N   
2943 C CA  . LYS B 135 ? 0.5262 0.5270 0.6773 0.0191  0.0130  -0.0323 218 LYS B CA  
2944 C C   . LYS B 135 ? 0.5655 0.5625 0.6714 0.0175  0.0254  -0.0193 218 LYS B C   
2945 O O   . LYS B 135 ? 0.5575 0.5524 0.6577 0.0171  0.0368  -0.0131 218 LYS B O   
2946 C CB  . LYS B 135 ? 0.5533 0.5499 0.7543 0.0170  0.0270  -0.0237 218 LYS B CB  
2947 C CG  . LYS B 135 ? 0.5523 0.5522 0.8176 0.0183  0.0144  -0.0390 218 LYS B CG  
2948 C CD  . LYS B 135 ? 0.5538 0.5567 0.8390 0.0195  0.0081  -0.0486 218 LYS B CD  
2949 C CE  . LYS B 135 ? 0.5882 0.5977 0.9236 0.0250  -0.0167 -0.0736 218 LYS B CE  
2950 N NZ  . LYS B 135 ? 0.5848 0.5990 0.9250 0.0292  -0.0287 -0.0856 218 LYS B NZ  
2951 N N   . LEU B 136 ? 0.5047 0.5015 0.5824 0.0181  0.0215  -0.0179 219 LEU B N   
2952 C CA  . LEU B 136 ? 0.5105 0.5046 0.5504 0.0184  0.0284  -0.0096 219 LEU B CA  
2953 C C   . LEU B 136 ? 0.5286 0.5255 0.5429 0.0189  0.0173  -0.0148 219 LEU B C   
2954 O O   . LEU B 136 ? 0.5541 0.5538 0.5726 0.0203  0.0080  -0.0200 219 LEU B O   
2955 C CB  . LEU B 136 ? 0.5799 0.5702 0.6194 0.0202  0.0381  0.0013  219 LEU B CB  
2956 C CG  . LEU B 136 ? 0.6117 0.5984 0.6319 0.0260  0.0545  0.0143  219 LEU B CG  
2957 C CD1 . LEU B 136 ? 0.5236 0.5081 0.5312 0.0308  0.0592  0.0244  219 LEU B CD1 
2958 C CD2 . LEU B 136 ? 0.5715 0.5592 0.5601 0.0282  0.0522  0.0088  219 LEU B CD2 
2959 N N   . LEU B 137 ? 0.5284 0.5247 0.5199 0.0191  0.0188  -0.0135 220 LEU B N   
2960 C CA  . LEU B 137 ? 0.4972 0.4952 0.4728 0.0196  0.0122  -0.0152 220 LEU B CA  
2961 C C   . LEU B 137 ? 0.5544 0.5490 0.5135 0.0210  0.0160  -0.0128 220 LEU B C   
2962 O O   . LEU B 137 ? 0.5139 0.5075 0.4674 0.0230  0.0204  -0.0142 220 LEU B O   
2963 C CB  . LEU B 137 ? 0.4926 0.4936 0.4683 0.0203  0.0099  -0.0173 220 LEU B CB  
2964 C CG  . LEU B 137 ? 0.5841 0.5883 0.5551 0.0229  0.0058  -0.0154 220 LEU B CG  
2965 C CD1 . LEU B 137 ? 0.5152 0.5214 0.4933 0.0242  0.0080  -0.0130 220 LEU B CD1 
2966 C CD2 . LEU B 137 ? 0.5588 0.5609 0.5225 0.0219  0.0045  -0.0145 220 LEU B CD2 
2967 N N   . ILE B 138 ? 0.4659 0.4595 0.4165 0.0220  0.0131  -0.0109 221 ILE B N   
2968 C CA  . ILE B 138 ? 0.4868 0.4785 0.4195 0.0268  0.0127  -0.0114 221 ILE B CA  
2969 C C   . ILE B 138 ? 0.4965 0.4899 0.4299 0.0258  0.0032  -0.0173 221 ILE B C   
2970 O O   . ILE B 138 ? 0.5508 0.5455 0.4914 0.0231  0.0002  -0.0154 221 ILE B O   
2971 C CB  . ILE B 138 ? 0.4769 0.4663 0.4022 0.0309  0.0169  -0.0033 221 ILE B CB  
2972 C CG1 . ILE B 138 ? 0.4298 0.4173 0.3656 0.0329  0.0304  0.0066  221 ILE B CG1 
2973 C CG2 . ILE B 138 ? 0.4406 0.4297 0.3429 0.0394  0.0117  -0.0063 221 ILE B CG2 
2974 C CD1 . ILE B 138 ? 0.4335 0.4186 0.3752 0.0364  0.0375  0.0185  221 ILE B CD1 
2975 N N   . ILE B 139 ? 0.5271 0.5209 0.4571 0.0295  -0.0017 -0.0253 222 ILE B N   
2976 C CA  . ILE B 139 ? 0.5046 0.4996 0.4463 0.0292  -0.0111 -0.0315 222 ILE B CA  
2977 C C   . ILE B 139 ? 0.5636 0.5583 0.4918 0.0382  -0.0205 -0.0411 222 ILE B C   
2978 O O   . ILE B 139 ? 0.5788 0.5743 0.4988 0.0457  -0.0240 -0.0510 222 ILE B O   
2979 C CB  . ILE B 139 ? 0.4871 0.4841 0.4538 0.0264  -0.0121 -0.0360 222 ILE B CB  
2980 C CG1 . ILE B 139 ? 0.4824 0.4810 0.4572 0.0222  -0.0036 -0.0261 222 ILE B CG1 
2981 C CG2 . ILE B 139 ? 0.4652 0.4633 0.4566 0.0265  -0.0198 -0.0408 222 ILE B CG2 
2982 C CD1 . ILE B 139 ? 0.5005 0.5007 0.4953 0.0214  -0.0010 -0.0273 222 ILE B CD1 
2983 N N   . ASP B 140 ? 0.6193 0.6135 0.5445 0.0397  -0.0260 -0.0399 223 ASP B N   
2984 C CA  . ASP B 140 ? 0.6512 0.6460 0.5598 0.0515  -0.0372 -0.0490 223 ASP B CA  
2985 C C   . ASP B 140 ? 0.6795 0.6755 0.6156 0.0492  -0.0499 -0.0576 223 ASP B C   
2986 O O   . ASP B 140 ? 0.6575 0.6527 0.5984 0.0451  -0.0489 -0.0499 223 ASP B O   
2987 C CB  . ASP B 140 ? 0.7013 0.6940 0.5833 0.0569  -0.0297 -0.0356 223 ASP B CB  
2988 C CG  . ASP B 140 ? 0.7693 0.7634 0.6239 0.0745  -0.0393 -0.0412 223 ASP B CG  
2989 O OD1 . ASP B 140 ? 0.8149 0.8075 0.6546 0.0794  -0.0346 -0.0289 223 ASP B OD1 
2990 O OD2 . ASP B 140 ? 0.8276 0.8247 0.6765 0.0855  -0.0526 -0.0587 223 ASP B OD2 
2991 N N   . SER B 141 ? 0.6363 0.6345 0.5971 0.0520  -0.0617 -0.0742 224 SER B N   
2992 C CA  . SER B 141 ? 0.6733 0.6731 0.6298 0.0585  -0.0649 -0.0864 224 SER B CA  
2993 C C   . SER B 141 ? 0.6312 0.6317 0.6321 0.0491  -0.0623 -0.0889 224 SER B C   
2994 O O   . SER B 141 ? 0.6475 0.6479 0.6824 0.0408  -0.0588 -0.0815 224 SER B O   
2995 C CB  . SER B 141 ? 0.6655 0.6685 0.6132 0.0758  -0.0857 -0.1095 224 SER B CB  
2996 O OG  . SER B 141 ? 0.7046 0.7089 0.6982 0.0728  -0.0999 -0.1219 224 SER B OG  
2997 N N   . ILE B 142 ? 0.6471 0.6487 0.6487 0.0526  -0.0629 -0.0982 225 ILE B N   
2998 C CA  . ILE B 142 ? 0.6104 0.6123 0.6501 0.0440  -0.0559 -0.0955 225 ILE B CA  
2999 C C   . ILE B 142 ? 0.5593 0.5628 0.6610 0.0409  -0.0635 -0.1037 225 ILE B C   
3000 O O   . ILE B 142 ? 0.5653 0.5685 0.6978 0.0328  -0.0507 -0.0883 225 ILE B O   
3001 C CB  . ILE B 142 ? 0.5766 0.5793 0.6039 0.0489  -0.0546 -0.1043 225 ILE B CB  
3002 C CG1 . ILE B 142 ? 0.4879 0.4905 0.5508 0.0392  -0.0439 -0.0956 225 ILE B CG1 
3003 C CG2 . ILE B 142 ? 0.5916 0.5975 0.6216 0.0635  -0.0746 -0.1326 225 ILE B CG2 
3004 C CD1 . ILE B 142 ? 0.4511 0.4522 0.5052 0.0302  -0.0276 -0.0709 225 ILE B CD1 
3005 N N   . MET B 143 ? 0.6359 0.6415 0.7580 0.0496  -0.0837 -0.1271 226 MET B N   
3006 C CA  . MET B 143 ? 0.6733 0.6808 0.8687 0.0485  -0.0939 -0.1412 226 MET B CA  
3007 C C   . MET B 143 ? 0.6712 0.6798 0.8988 0.0514  -0.1086 -0.1514 226 MET B C   
3008 O O   . MET B 143 ? 0.6294 0.6396 0.9309 0.0504  -0.1172 -0.1633 226 MET B O   
3009 C CB  . MET B 143 ? 0.7620 0.7727 0.9651 0.0607  -0.1139 -0.1729 226 MET B CB  
3010 C CG  . MET B 143 ? 0.8078 0.8186 1.0320 0.0568  -0.1053 -0.1726 226 MET B CG  
3011 S SD  . MET B 143 ? 0.8663 0.8824 1.1375 0.0718  -0.1364 -0.2178 226 MET B SD  
3012 C CE  . MET B 143 ? 0.9113 0.9277 1.2822 0.0647  -0.1444 -0.2215 226 MET B CE  
3013 N N   . ALA B 144 ? 0.6257 0.6337 0.8052 0.0562  -0.1131 -0.1491 227 ALA B N   
3014 C CA  . ALA B 144 ? 0.6716 0.6812 0.8783 0.0617  -0.1316 -0.1635 227 ALA B CA  
3015 C C   . ALA B 144 ? 0.6485 0.6574 0.9319 0.0505  -0.1226 -0.1519 227 ALA B C   
3016 O O   . ALA B 144 ? 0.6483 0.6595 0.9992 0.0538  -0.1395 -0.1719 227 ALA B O   
3017 C CB  . ALA B 144 ? 0.6636 0.6721 0.8089 0.0668  -0.1323 -0.1553 227 ALA B CB  
3018 N N   . LEU B 145 ? 0.5857 0.5921 0.8615 0.0396  -0.0954 -0.1200 228 LEU B N   
3019 C CA  . LEU B 145 ? 0.5186 0.5249 0.8575 0.0323  -0.0784 -0.1010 228 LEU B CA  
3020 C C   . LEU B 145 ? 0.5278 0.5354 0.9438 0.0311  -0.0768 -0.1062 228 LEU B C   
3021 O O   . LEU B 145 ? 0.5453 0.5536 1.0346 0.0288  -0.0694 -0.0982 228 LEU B O   
3022 C CB  . LEU B 145 ? 0.5185 0.5236 0.8193 0.0270  -0.0510 -0.0682 228 LEU B CB  
3023 C CG  . LEU B 145 ? 0.5546 0.5584 0.7977 0.0273  -0.0511 -0.0618 228 LEU B CG  
3024 C CD1 . LEU B 145 ? 0.5199 0.5236 0.7245 0.0248  -0.0288 -0.0362 228 LEU B CD1 
3025 C CD2 . LEU B 145 ? 0.4759 0.4800 0.7559 0.0281  -0.0574 -0.0646 228 LEU B CD2 
3026 N N   . PHE B 146 ? 0.5119 0.5200 0.9177 0.0329  -0.0818 -0.1179 229 PHE B N   
3027 C CA  . PHE B 146 ? 0.5334 0.5429 1.0199 0.0322  -0.0826 -0.1260 229 PHE B CA  
3028 C C   . PHE B 146 ? 0.5878 0.5999 1.1392 0.0390  -0.1130 -0.1632 229 PHE B C   
3029 O O   . PHE B 146 ? 0.6026 0.6157 1.2499 0.0368  -0.1115 -0.1652 229 PHE B O   
3030 C CB  . PHE B 146 ? 0.5250 0.5344 0.9856 0.0317  -0.0769 -0.1258 229 PHE B CB  
3031 C CG  . PHE B 146 ? 0.5270 0.5347 0.9480 0.0261  -0.0478 -0.0897 229 PHE B CG  
3032 C CD1 . PHE B 146 ? 0.4961 0.5025 0.8338 0.0257  -0.0428 -0.0792 229 PHE B CD1 
3033 C CD2 . PHE B 146 ? 0.4687 0.4769 0.9406 0.0234  -0.0256 -0.0657 229 PHE B CD2 
3034 C CE1 . PHE B 146 ? 0.5285 0.5346 0.8352 0.0231  -0.0204 -0.0510 229 PHE B CE1 
3035 C CE2 . PHE B 146 ? 0.4658 0.4740 0.8983 0.0228  -0.0014 -0.0343 229 PHE B CE2 
3036 C CZ  . PHE B 146 ? 0.5113 0.5187 0.8615 0.0229  -0.0009 -0.0295 229 PHE B CZ  
3037 N N   . ARG B 147 ? 0.6366 0.6505 1.1399 0.0495  -0.1403 -0.1921 230 ARG B N   
3038 C CA  . ARG B 147 ? 0.6771 0.6949 1.2350 0.0598  -0.1732 -0.2298 230 ARG B CA  
3039 C C   . ARG B 147 ? 0.7207 0.7376 1.3447 0.0537  -0.1680 -0.2181 230 ARG B C   
3040 O O   . ARG B 147 ? 0.7018 0.7209 1.4264 0.0552  -0.1819 -0.2370 230 ARG B O   
3041 C CB  . ARG B 147 ? 0.7299 0.7506 1.2079 0.0766  -0.2003 -0.2570 230 ARG B CB  
3042 C CG  . ARG B 147 ? 0.8257 0.8490 1.2581 0.0881  -0.2105 -0.2772 230 ARG B CG  
3043 C CD  . ARG B 147 ? 0.9239 0.9539 1.3421 0.1129  -0.2506 -0.3234 230 ARG B CD  
3044 N NE  . ARG B 147 ? 0.9955 1.0265 1.3168 0.1269  -0.2556 -0.3205 230 ARG B NE  
3045 C CZ  . ARG B 147 ? 1.0730 1.1106 1.3496 0.1544  -0.2854 -0.3536 230 ARG B CZ  
3046 N NH1 . ARG B 147 ? 1.1681 1.2125 1.4863 0.1717  -0.3167 -0.3977 230 ARG B NH1 
3047 N NH2 . ARG B 147 ? 1.1268 1.1648 1.3172 0.1674  -0.2840 -0.3429 230 ARG B NH2 
3048 N N   . VAL B 148 ? 0.7127 0.7267 1.2871 0.0472  -0.1470 -0.1869 231 VAL B N   
3049 C CA  . VAL B 148 ? 0.7678 0.7811 1.3912 0.0431  -0.1403 -0.1741 231 VAL B CA  
3050 C C   . VAL B 148 ? 0.8193 0.8318 1.5407 0.0349  -0.1131 -0.1485 231 VAL B C   
3051 O O   . VAL B 148 ? 0.8344 0.8482 1.6512 0.0353  -0.1203 -0.1575 231 VAL B O   
3052 C CB  . VAL B 148 ? 0.7816 0.7926 1.3203 0.0412  -0.1292 -0.1528 231 VAL B CB  
3053 C CG1 . VAL B 148 ? 0.6683 0.6784 1.2527 0.0361  -0.1138 -0.1321 231 VAL B CG1 
3054 C CG2 . VAL B 148 ? 0.7248 0.7373 1.1998 0.0528  -0.1590 -0.1799 231 VAL B CG2 
3055 N N   . ASP B 149 ? 0.8245 0.8354 1.5265 0.0296  -0.0821 -0.1164 232 ASP B N   
3056 C CA  . ASP B 149 ? 0.8502 0.8610 1.6344 0.0261  -0.0509 -0.0851 232 ASP B CA  
3057 C C   . ASP B 149 ? 0.8506 0.8627 1.7422 0.0264  -0.0591 -0.1019 232 ASP B C   
3058 O O   . ASP B 149 ? 0.8719 0.8842 1.8543 0.0251  -0.0351 -0.0781 232 ASP B O   
3059 C CB  . ASP B 149 ? 0.8902 0.9001 1.6134 0.0248  -0.0161 -0.0449 232 ASP B CB  
3060 C CG  . ASP B 149 ? 0.9329 0.9423 1.5740 0.0255  -0.0043 -0.0254 232 ASP B CG  
3061 O OD1 . ASP B 149 ? 0.9301 0.9390 1.5546 0.0255  -0.0220 -0.0414 232 ASP B OD1 
3062 O OD2 . ASP B 149 ? 0.9246 0.9345 1.5180 0.0277  0.0211  0.0042  232 ASP B OD2 
3063 N N   . PHE B 150 ? 0.9196 0.9332 1.8037 0.0302  -0.0915 -0.1422 233 PHE B N   
3064 C CA  . PHE B 150 ? 0.9253 0.9407 1.9062 0.0315  -0.1025 -0.1633 233 PHE B CA  
3065 C C   . PHE B 150 ? 0.9484 0.9674 1.9427 0.0412  -0.1511 -0.2211 233 PHE B C   
3066 O O   . PHE B 150 ? 1.0501 1.0711 2.0150 0.0470  -0.1692 -0.2473 233 PHE B O   
3067 C CB  . PHE B 150 ? 0.9117 0.9262 1.8590 0.0291  -0.0850 -0.1480 233 PHE B CB  
3068 C CG  . PHE B 150 ? 0.9579 0.9702 1.8764 0.0245  -0.0406 -0.0938 233 PHE B CG  
3069 C CD1 . PHE B 150 ? 0.9323 0.9446 1.9453 0.0237  -0.0096 -0.0605 233 PHE B CD1 
3070 C CD2 . PHE B 150 ? 1.0055 1.0165 1.8041 0.0240  -0.0296 -0.0759 233 PHE B CD2 
3071 C CE1 . PHE B 150 ? 0.9642 0.9761 1.9422 0.0255  0.0306  -0.0107 233 PHE B CE1 
3072 C CE2 . PHE B 150 ? 1.0216 1.0323 1.7916 0.0241  0.0067  -0.0310 233 PHE B CE2 
3073 C CZ  . PHE B 150 ? 0.9622 0.9738 1.8165 0.0264  0.0367  0.0017  233 PHE B CZ  
3074 N N   . SER B 151 ? 0.9506 0.9714 1.9847 0.0455  -0.1723 -0.2410 234 SER B N   
3075 C CA  . SER B 151 ? 0.9836 1.0095 2.0407 0.0593  -0.2218 -0.2982 234 SER B CA  
3076 C C   . SER B 151 ? 1.0459 1.0746 2.2559 0.0604  -0.2361 -0.3235 234 SER B C   
3077 O O   . SER B 151 ? 1.1130 1.1390 2.4151 0.0496  -0.2043 -0.2905 234 SER B O   
3078 C CB  . SER B 151 ? 0.9496 0.9764 1.9927 0.0636  -0.2371 -0.3058 234 SER B CB  
3079 O OG  . SER B 151 ? 0.9050 0.9314 2.0776 0.0575  -0.2293 -0.2983 234 SER B OG  
3080 N N   . GLY B 152 ? 1.1525 1.1872 2.3948 0.0757  -0.2838 -0.3817 235 GLY B N   
3081 C CA  . GLY B 152 ? 1.1272 1.1653 2.5179 0.0782  -0.3023 -0.4134 235 GLY B CA  
3082 C C   . GLY B 152 ? 1.1684 1.2048 2.5596 0.0729  -0.2824 -0.4005 235 GLY B C   
3083 O O   . GLY B 152 ? 1.2721 1.3051 2.5504 0.0677  -0.2565 -0.3688 235 GLY B O   
3084 N N   . ARG B 153 ? 1.2770 1.3159 2.8000 0.0739  -0.2941 -0.4247 236 ARG B N   
3085 C CA  . ARG B 153 ? 1.2418 1.2799 2.7626 0.0711  -0.2810 -0.4194 236 ARG B CA  
3086 C C   . ARG B 153 ? 1.1776 1.2125 2.8367 0.0584  -0.2475 -0.3878 236 ARG B C   
3087 O O   . ARG B 153 ? 1.1549 1.1903 2.8375 0.0583  -0.2451 -0.3940 236 ARG B O   
3088 C CB  . ARG B 153 ? 1.2638 1.3091 2.7586 0.0906  -0.3304 -0.4848 236 ARG B CB  
3089 C CG  . ARG B 153 ? 1.2199 1.2727 2.8116 0.1071  -0.3830 -0.5478 236 ARG B CG  
3090 C CD  . ARG B 153 ? 1.2345 1.2944 2.7065 0.1321  -0.4276 -0.5957 236 ARG B CD  
3091 N NE  . ARG B 153 ? 1.3250 1.3944 2.8638 0.1548  -0.4800 -0.6675 236 ARG B NE  
3092 C CZ  . ARG B 153 ? 1.2588 1.3341 2.9328 0.1646  -0.5194 -0.7151 236 ARG B CZ  
3093 N NH1 . ARG B 153 ? 1.2731 1.3453 3.0340 0.1527  -0.5105 -0.6966 236 ARG B NH1 
3094 N NH2 . ARG B 153 ? 1.2520 1.3369 2.9769 0.1880  -0.5690 -0.7838 236 ARG B NH2 
3095 N N   . GLY B 154 ? 1.1350 1.1669 2.8839 0.0493  -0.2191 -0.3513 237 GLY B N   
3096 C CA  . GLY B 154 ? 1.1086 1.1366 2.9572 0.0386  -0.1713 -0.3000 237 GLY B CA  
3097 C C   . GLY B 154 ? 1.1295 1.1527 2.8569 0.0314  -0.1226 -0.2362 237 GLY B C   
3098 O O   . GLY B 154 ? 1.1269 1.1475 2.8949 0.0265  -0.0812 -0.1899 237 GLY B O   
3099 N N   . GLU B 155 ? 1.1334 1.1561 2.7132 0.0331  -0.1299 -0.2363 238 GLU B N   
3100 C CA  . GLU B 155 ? 1.0256 1.0447 2.4780 0.0284  -0.0927 -0.1854 238 GLU B CA  
3101 C C   . GLU B 155 ? 0.9511 0.9698 2.2949 0.0288  -0.0929 -0.1868 238 GLU B C   
3102 O O   . GLU B 155 ? 0.9375 0.9537 2.1953 0.0254  -0.0612 -0.1448 238 GLU B O   
3103 C CB  . GLU B 155 ? 1.0399 1.0588 2.3954 0.0302  -0.1045 -0.1900 238 GLU B CB  
3104 C CG  . GLU B 155 ? 1.0569 1.0768 2.5022 0.0308  -0.1118 -0.1963 238 GLU B CG  
3105 C CD  . GLU B 155 ? 1.0582 1.0759 2.5987 0.0259  -0.0647 -0.1434 238 GLU B CD  
3106 O OE1 . GLU B 155 ? 1.0034 1.0189 2.4687 0.0242  -0.0251 -0.0934 238 GLU B OE1 
3107 O OE2 . GLU B 155 ? 1.0294 1.0482 2.7211 0.0260  -0.0675 -0.1527 238 GLU B OE2 
3108 N N   . LEU B 156 ? 0.9126 0.9342 2.2599 0.0349  -0.1300 -0.2371 239 LEU B N   
3109 C CA  . LEU B 156 ? 0.8791 0.9010 2.1112 0.0378  -0.1374 -0.2477 239 LEU B CA  
3110 C C   . LEU B 156 ? 0.8458 0.8649 2.0605 0.0310  -0.1009 -0.2062 239 LEU B C   
3111 O O   . LEU B 156 ? 0.8479 0.8655 1.9454 0.0300  -0.0903 -0.1902 239 LEU B O   
3112 C CB  . LEU B 156 ? 0.8920 0.9190 2.1365 0.0500  -0.1841 -0.3114 239 LEU B CB  
3113 C CG  . LEU B 156 ? 0.9343 0.9644 2.0634 0.0629  -0.2167 -0.3460 239 LEU B CG  
3114 C CD1 . LEU B 156 ? 0.9315 0.9591 1.9193 0.0615  -0.1985 -0.3226 239 LEU B CD1 
3115 C CD2 . LEU B 156 ? 0.9277 0.9580 2.0511 0.0645  -0.2256 -0.3460 239 LEU B CD2 
3116 N N   . ALA B 157 ? 0.8015 0.8200 2.1349 0.0275  -0.0813 -0.1878 240 ALA B N   
3117 C CA  . ALA B 157 ? 0.7601 0.7765 2.0794 0.0236  -0.0453 -0.1450 240 ALA B CA  
3118 C C   . ALA B 157 ? 0.7575 0.7718 1.9660 0.0220  -0.0147 -0.0982 240 ALA B C   
3119 O O   . ALA B 157 ? 0.7646 0.7780 1.8735 0.0217  -0.0071 -0.0866 240 ALA B O   
3120 C CB  . ALA B 157 ? 0.6475 0.6635 2.1155 0.0220  -0.0201 -0.1192 240 ALA B CB  
3121 N N   . GLU B 158 ? 0.7204 0.7342 1.9488 0.0221  -0.0002 -0.0756 241 GLU B N   
3122 C CA  . GLU B 158 ? 0.7412 0.7539 1.8792 0.0232  0.0286  -0.0326 241 GLU B CA  
3123 C C   . GLU B 158 ? 0.6842 0.6964 1.6823 0.0225  0.0106  -0.0491 241 GLU B C   
3124 O O   . GLU B 158 ? 0.6771 0.6888 1.5878 0.0234  0.0283  -0.0235 241 GLU B O   
3125 C CB  . GLU B 158 ? 0.8571 0.8699 2.0524 0.0249  0.0464  -0.0089 241 GLU B CB  
3126 C CG  . GLU B 158 ? 0.9661 0.9794 2.1346 0.0314  0.0934  0.0518  241 GLU B CG  
3127 C CD  . GLU B 158 ? 1.1151 1.1290 2.2843 0.0354  0.1168  0.0795  241 GLU B CD  
3128 O OE1 . GLU B 158 ? 1.1217 1.1355 2.3978 0.0344  0.1194  0.0767  241 GLU B OE1 
3129 O OE2 . GLU B 158 ? 1.1483 1.1631 2.2143 0.0405  0.1313  0.1029  241 GLU B OE2 
3130 N N   . ARG B 159 ? 0.6439 0.6567 1.6243 0.0229  -0.0247 -0.0919 242 ARG B N   
3131 C CA  . ARG B 159 ? 0.6423 0.6546 1.4988 0.0240  -0.0402 -0.1062 242 ARG B CA  
3132 C C   . ARG B 159 ? 0.6215 0.6335 1.4176 0.0237  -0.0374 -0.1062 242 ARG B C   
3133 O O   . ARG B 159 ? 0.6428 0.6536 1.3509 0.0226  -0.0226 -0.0840 242 ARG B O   
3134 C CB  . ARG B 159 ? 0.7188 0.7331 1.5753 0.0292  -0.0802 -0.1550 242 ARG B CB  
3135 C CG  . ARG B 159 ? 0.6847 0.6984 1.4288 0.0321  -0.0914 -0.1617 242 ARG B CG  
3136 C CD  . ARG B 159 ? 0.7790 0.7960 1.5214 0.0427  -0.1321 -0.2114 242 ARG B CD  
3137 N NE  . ARG B 159 ? 0.8632 0.8820 1.5587 0.0501  -0.1471 -0.2364 242 ARG B NE  
3138 C CZ  . ARG B 159 ? 0.9198 0.9427 1.5851 0.0650  -0.1808 -0.2787 242 ARG B CZ  
3139 N NH1 . ARG B 159 ? 0.9227 0.9482 1.5999 0.0737  -0.2053 -0.3017 242 ARG B NH1 
3140 N NH2 . ARG B 159 ? 0.9462 0.9712 1.5670 0.0737  -0.1896 -0.2976 242 ARG B NH2 
3141 N N   . GLN B 160 ? 0.6249 0.6382 1.4755 0.0252  -0.0517 -0.1319 243 GLN B N   
3142 C CA  . GLN B 160 ? 0.5850 0.5981 1.3942 0.0250  -0.0486 -0.1329 243 GLN B CA  
3143 C C   . GLN B 160 ? 0.5444 0.5560 1.3256 0.0216  -0.0131 -0.0850 243 GLN B C   
3144 O O   . GLN B 160 ? 0.5579 0.5687 1.2465 0.0214  -0.0087 -0.0769 243 GLN B O   
3145 C CB  . GLN B 160 ? 0.7358 0.7508 1.6327 0.0274  -0.0648 -0.1631 243 GLN B CB  
3146 C CG  . GLN B 160 ? 0.8840 0.9023 1.8244 0.0352  -0.1038 -0.2155 243 GLN B CG  
3147 C CD  . GLN B 160 ? 0.9668 0.9868 1.8003 0.0444  -0.1293 -0.2454 243 GLN B CD  
3148 O OE1 . GLN B 160 ? 0.9010 0.9191 1.6455 0.0427  -0.1193 -0.2252 243 GLN B OE1 
3149 N NE2 . GLN B 160 ? 1.0918 1.1162 1.9371 0.0568  -0.1625 -0.2944 243 GLN B NE2 
3150 N N   . GLN B 161 ? 0.4900 0.5016 1.3484 0.0214  0.0126  -0.0524 244 GLN B N   
3151 C CA  . GLN B 161 ? 0.5122 0.5239 1.3300 0.0238  0.0452  -0.0063 244 GLN B CA  
3152 C C   . GLN B 161 ? 0.5341 0.5457 1.2426 0.0253  0.0497  0.0071  244 GLN B C   
3153 O O   . GLN B 161 ? 0.5451 0.5567 1.1766 0.0260  0.0519  0.0124  244 GLN B O   
3154 C CB  . GLN B 161 ? 0.5932 0.6059 1.5003 0.0285  0.0765  0.0333  244 GLN B CB  
3155 C CG  . GLN B 161 ? 0.7548 0.7678 1.7523 0.0284  0.0829  0.0353  244 GLN B CG  
3156 C CD  . GLN B 161 ? 0.8180 0.8315 1.9401 0.0324  0.1079  0.0640  244 GLN B CD  
3157 O OE1 . GLN B 161 ? 0.9148 0.9290 2.0502 0.0370  0.1266  0.0901  244 GLN B OE1 
3158 N NE2 . GLN B 161 ? 0.8026 0.8161 2.0220 0.0314  0.1102  0.0606  244 GLN B NE2 
3159 N N   . LYS B 162 ? 0.5043 0.5159 1.2118 0.0259  0.0491  0.0096  245 LYS B N   
3160 C CA  . LYS B 162 ? 0.4826 0.4942 1.0976 0.0277  0.0531  0.0213  245 LYS B CA  
3161 C C   . LYS B 162 ? 0.4841 0.4944 1.0094 0.0243  0.0318  -0.0045 245 LYS B C   
3162 O O   . LYS B 162 ? 0.4348 0.4455 0.8897 0.0259  0.0395  0.0087  245 LYS B O   
3163 C CB  . LYS B 162 ? 0.4303 0.4420 1.0684 0.0283  0.0535  0.0239  245 LYS B CB  
3164 C CG  . LYS B 162 ? 0.4586 0.4720 1.1729 0.0346  0.0835  0.0600  245 LYS B CG  
3165 C CD  . LYS B 162 ? 0.4736 0.4900 1.1336 0.0458  0.1137  0.1019  245 LYS B CD  
3166 C CE  . LYS B 162 ? 0.5731 0.5920 1.3115 0.0566  0.1485  0.1425  245 LYS B CE  
3167 N NZ  . LYS B 162 ? 0.6583 0.6778 1.4206 0.0590  0.1571  0.1525  245 LYS B NZ  
3168 N N   . LEU B 163 ? 0.5009 0.5103 1.0341 0.0219  0.0052  -0.0413 246 LEU B N   
3169 C CA  . LEU B 163 ? 0.4829 0.4914 0.9396 0.0219  -0.0119 -0.0634 246 LEU B CA  
3170 C C   . LEU B 163 ? 0.5099 0.5183 0.9333 0.0212  -0.0036 -0.0562 246 LEU B C   
3171 O O   . LEU B 163 ? 0.5293 0.5369 0.8793 0.0211  -0.0031 -0.0539 246 LEU B O   
3172 C CB  . LEU B 163 ? 0.5174 0.5266 0.9969 0.0252  -0.0406 -0.1040 246 LEU B CB  
3173 C CG  . LEU B 163 ? 0.5758 0.5848 0.9730 0.0300  -0.0560 -0.1245 246 LEU B CG  
3174 C CD1 . LEU B 163 ? 0.6015 0.6094 0.9417 0.0303  -0.0558 -0.1160 246 LEU B CD1 
3175 C CD2 . LEU B 163 ? 0.5905 0.6022 1.0114 0.0392  -0.0840 -0.1660 246 LEU B CD2 
3176 N N   . ALA B 164 ? 0.5087 0.5178 0.9913 0.0209  0.0039  -0.0512 247 ALA B N   
3177 C CA  . ALA B 164 ? 0.5217 0.5308 0.9793 0.0205  0.0088  -0.0486 247 ALA B CA  
3178 C C   . ALA B 164 ? 0.5346 0.5446 0.9592 0.0225  0.0312  -0.0129 247 ALA B C   
3179 O O   . ALA B 164 ? 0.5200 0.5300 0.8901 0.0225  0.0325  -0.0107 247 ALA B O   
3180 C CB  . ALA B 164 ? 0.4933 0.5031 1.0278 0.0203  0.0060  -0.0601 247 ALA B CB  
3181 N N   . GLN B 165 ? 0.5413 0.5529 1.0008 0.0264  0.0487  0.0143  248 GLN B N   
3182 C CA  . GLN B 165 ? 0.5530 0.5672 0.9734 0.0343  0.0688  0.0476  248 GLN B CA  
3183 C C   . GLN B 165 ? 0.5553 0.5691 0.8906 0.0334  0.0593  0.0393  248 GLN B C   
3184 O O   . GLN B 165 ? 0.5714 0.5870 0.8589 0.0375  0.0631  0.0482  248 GLN B O   
3185 C CB  . GLN B 165 ? 0.5713 0.5876 1.0321 0.0414  0.0877  0.0744  248 GLN B CB  
3186 C CG  . GLN B 165 ? 0.6843 0.7047 1.1592 0.0551  0.1152  0.1137  248 GLN B CG  
3187 C CD  . GLN B 165 ? 0.7880 0.8087 1.3628 0.0586  0.1341  0.1336  248 GLN B CD  
3188 O OE1 . GLN B 165 ? 0.8103 0.8314 1.4188 0.0610  0.1430  0.1436  248 GLN B OE1 
3189 N NE2 . GLN B 165 ? 0.7697 0.7904 1.3999 0.0589  0.1410  0.1399  248 GLN B NE2 
3190 N N   . MET B 166 ? 0.4808 0.4925 0.8029 0.0284  0.0451  0.0201  249 MET B N   
3191 C CA  . MET B 166 ? 0.4941 0.5051 0.7480 0.0278  0.0382  0.0148  249 MET B CA  
3192 C C   . MET B 166 ? 0.5155 0.5246 0.7257 0.0239  0.0265  -0.0036 249 MET B C   
3193 O O   . MET B 166 ? 0.4970 0.5066 0.6595 0.0252  0.0279  0.0013  249 MET B O   
3194 C CB  . MET B 166 ? 0.4883 0.4980 0.7445 0.0258  0.0296  0.0053  249 MET B CB  
3195 C CG  . MET B 166 ? 0.5564 0.5653 0.7481 0.0254  0.0240  0.0019  249 MET B CG  
3196 S SD  . MET B 166 ? 0.7431 0.7494 0.9203 0.0224  0.0065  -0.0195 249 MET B SD  
3197 C CE  . MET B 166 ? 0.6635 0.6684 0.8530 0.0220  -0.0112 -0.0490 249 MET B CE  
3198 N N   . LEU B 167 ? 0.5062 0.5136 0.7344 0.0210  0.0150  -0.0257 250 LEU B N   
3199 C CA  . LEU B 167 ? 0.5227 0.5289 0.7118 0.0201  0.0087  -0.0393 250 LEU B CA  
3200 C C   . LEU B 167 ? 0.5756 0.5828 0.7631 0.0202  0.0186  -0.0273 250 LEU B C   
3201 O O   . LEU B 167 ? 0.5968 0.6034 0.7464 0.0197  0.0186  -0.0288 250 LEU B O   
3202 C CB  . LEU B 167 ? 0.5197 0.5252 0.7229 0.0218  -0.0061 -0.0671 250 LEU B CB  
3203 C CG  . LEU B 167 ? 0.5218 0.5270 0.7202 0.0249  -0.0197 -0.0820 250 LEU B CG  
3204 C CD1 . LEU B 167 ? 0.5735 0.5800 0.7907 0.0313  -0.0362 -0.1118 250 LEU B CD1 
3205 C CD2 . LEU B 167 ? 0.4790 0.4829 0.6167 0.0268  -0.0210 -0.0803 250 LEU B CD2 
3206 N N   . SER B 168 ? 0.5846 0.5937 0.8163 0.0219  0.0279  -0.0136 251 SER B N   
3207 C CA  . SER B 168 ? 0.5743 0.5853 0.7987 0.0246  0.0369  0.0006  251 SER B CA  
3208 C C   . SER B 168 ? 0.5238 0.5372 0.7027 0.0299  0.0415  0.0159  251 SER B C   
3209 O O   . SER B 168 ? 0.5639 0.5779 0.7186 0.0305  0.0398  0.0140  251 SER B O   
3210 C CB  . SER B 168 ? 0.5505 0.5631 0.8310 0.0274  0.0471  0.0136  251 SER B CB  
3211 O OG  . SER B 168 ? 0.6516 0.6657 0.9707 0.0318  0.0577  0.0317  251 SER B OG  
3212 N N   . ARG B 169 ? 0.4780 0.4931 0.6482 0.0347  0.0458  0.0279  252 ARG B N   
3213 C CA  . ARG B 169 ? 0.5429 0.5609 0.6665 0.0413  0.0456  0.0350  252 ARG B CA  
3214 C C   . ARG B 169 ? 0.5331 0.5483 0.6209 0.0348  0.0340  0.0173  252 ARG B C   
3215 O O   . ARG B 169 ? 0.4455 0.4627 0.5081 0.0385  0.0309  0.0168  252 ARG B O   
3216 C CB  . ARG B 169 ? 0.6068 0.6274 0.7270 0.0486  0.0522  0.0486  252 ARG B CB  
3217 C CG  . ARG B 169 ? 0.8670 0.8912 1.0226 0.0592  0.0693  0.0731  252 ARG B CG  
3218 C CD  . ARG B 169 ? 1.0267 1.0578 1.1562 0.0776  0.0782  0.0930  252 ARG B CD  
3219 N NE  . ARG B 169 ? 1.1734 1.2088 1.2695 0.0896  0.0809  0.1007  252 ARG B NE  
3220 C CZ  . ARG B 169 ? 1.1338 1.1709 1.1842 0.0924  0.0680  0.0872  252 ARG B CZ  
3221 N NH1 . ARG B 169 ? 1.0686 1.1036 1.1045 0.0841  0.0535  0.0684  252 ARG B NH1 
3222 N NH2 . ARG B 169 ? 0.9980 1.0395 1.0230 0.1044  0.0704  0.0928  252 ARG B NH2 
3223 N N   . LEU B 170 ? 0.5224 0.5335 0.6120 0.0273  0.0277  0.0031  253 LEU B N   
3224 C CA  . LEU B 170 ? 0.4556 0.4637 0.5168 0.0231  0.0209  -0.0098 253 LEU B CA  
3225 C C   . LEU B 170 ? 0.4533 0.4609 0.5107 0.0217  0.0214  -0.0148 253 LEU B C   
3226 O O   . LEU B 170 ? 0.4520 0.4594 0.4904 0.0217  0.0204  -0.0158 253 LEU B O   
3227 C CB  . LEU B 170 ? 0.5329 0.5380 0.5965 0.0201  0.0146  -0.0232 253 LEU B CB  
3228 C CG  . LEU B 170 ? 0.5986 0.6029 0.6448 0.0204  0.0112  -0.0226 253 LEU B CG  
3229 C CD1 . LEU B 170 ? 0.6124 0.6140 0.6461 0.0209  0.0035  -0.0380 253 LEU B CD1 
3230 C CD2 . LEU B 170 ? 0.5317 0.5369 0.5517 0.0216  0.0132  -0.0152 253 LEU B CD2 
3231 N N   . GLN B 171 ? 0.4402 0.4477 0.5223 0.0208  0.0233  -0.0177 254 GLN B N   
3232 C CA  . GLN B 171 ? 0.4435 0.4503 0.5245 0.0194  0.0245  -0.0235 254 GLN B CA  
3233 C C   . GLN B 171 ? 0.4576 0.4674 0.5328 0.0228  0.0261  -0.0136 254 GLN B C   
3234 O O   . GLN B 171 ? 0.4625 0.4716 0.5265 0.0218  0.0249  -0.0177 254 GLN B O   
3235 C CB  . GLN B 171 ? 0.4714 0.4781 0.5840 0.0188  0.0257  -0.0289 254 GLN B CB  
3236 C CG  . GLN B 171 ? 0.4785 0.4832 0.5972 0.0187  0.0196  -0.0471 254 GLN B CG  
3237 C CD  . GLN B 171 ? 0.4637 0.4687 0.6097 0.0193  0.0192  -0.0581 254 GLN B CD  
3238 O OE1 . GLN B 171 ? 0.4972 0.5014 0.6318 0.0226  0.0157  -0.0745 254 GLN B OE1 
3239 N NE2 . GLN B 171 ? 0.4387 0.4452 0.6185 0.0181  0.0239  -0.0481 254 GLN B NE2 
3240 N N   . LYS B 172 ? 0.4751 0.4888 0.5597 0.0291  0.0287  -0.0002 255 LYS B N   
3241 C CA  . LYS B 172 ? 0.4490 0.4677 0.5250 0.0385  0.0279  0.0090  255 LYS B CA  
3242 C C   . LYS B 172 ? 0.4645 0.4847 0.5149 0.0413  0.0203  0.0036  255 LYS B C   
3243 O O   . LYS B 172 ? 0.5216 0.5433 0.5706 0.0431  0.0146  -0.0025 255 LYS B O   
3244 C CB  . LYS B 172 ? 0.4480 0.4713 0.5316 0.0495  0.0350  0.0274  255 LYS B CB  
3245 C CG  . LYS B 172 ? 0.4904 0.5187 0.5806 0.0606  0.0377  0.0386  255 LYS B CG  
3246 C CD  . LYS B 172 ? 0.4985 0.5270 0.6246 0.0628  0.0502  0.0543  255 LYS B CD  
3247 C CE  . LYS B 172 ? 0.5758 0.6048 0.7128 0.0665  0.0597  0.0676  255 LYS B CE  
3248 N NZ  . LYS B 172 ? 0.6457 0.6735 0.8358 0.0651  0.0716  0.0793  255 LYS B NZ  
3249 N N   . ILE B 173 ? 0.5096 0.5291 0.5465 0.0410  0.0195  0.0040  256 ILE B N   
3250 C CA  . ILE B 173 ? 0.5452 0.5660 0.5635 0.0435  0.0120  -0.0023 256 ILE B CA  
3251 C C   . ILE B 173 ? 0.5279 0.5450 0.5521 0.0358  0.0088  -0.0138 256 ILE B C   
3252 O O   . ILE B 173 ? 0.6177 0.6376 0.6457 0.0401  0.0015  -0.0198 256 ILE B O   
3253 C CB  . ILE B 173 ? 0.5721 0.5911 0.5802 0.0414  0.0134  -0.0005 256 ILE B CB  
3254 C CG1 . ILE B 173 ? 0.5535 0.5783 0.5543 0.0544  0.0169  0.0123  256 ILE B CG1 
3255 C CG2 . ILE B 173 ? 0.4605 0.4779 0.4579 0.0386  0.0070  -0.0096 256 ILE B CG2 
3256 C CD1 . ILE B 173 ? 0.6069 0.6296 0.6093 0.0512  0.0216  0.0169  256 ILE B CD1 
3257 N N   . SER B 174 ? 0.5463 0.5578 0.5733 0.0268  0.0145  -0.0168 257 SER B N   
3258 C CA  . SER B 174 ? 0.4839 0.4915 0.5173 0.0214  0.0186  -0.0224 257 SER B CA  
3259 C C   . SER B 174 ? 0.5521 0.5613 0.6039 0.0223  0.0181  -0.0250 257 SER B C   
3260 O O   . SER B 174 ? 0.5160 0.5241 0.5807 0.0210  0.0187  -0.0284 257 SER B O   
3261 C CB  . SER B 174 ? 0.4635 0.4683 0.4976 0.0186  0.0241  -0.0244 257 SER B CB  
3262 O OG  . SER B 174 ? 0.5553 0.5565 0.5822 0.0176  0.0299  -0.0280 257 SER B OG  
3263 N N   . GLU B 175 ? 0.5342 0.5455 0.5937 0.0244  0.0183  -0.0225 258 GLU B N   
3264 C CA  . GLU B 175 ? 0.4748 0.4875 0.5536 0.0252  0.0180  -0.0249 258 GLU B CA  
3265 C C   . GLU B 175 ? 0.4830 0.5019 0.5634 0.0346  0.0064  -0.0257 258 GLU B C   
3266 O O   . GLU B 175 ? 0.4980 0.5181 0.5967 0.0357  0.0008  -0.0332 258 GLU B O   
3267 C CB  . GLU B 175 ? 0.3973 0.4094 0.4867 0.0238  0.0235  -0.0225 258 GLU B CB  
3268 C CG  . GLU B 175 ? 0.4313 0.4384 0.5187 0.0181  0.0316  -0.0284 258 GLU B CG  
3269 C CD  . GLU B 175 ? 0.4790 0.4858 0.5795 0.0175  0.0342  -0.0309 258 GLU B CD  
3270 O OE1 . GLU B 175 ? 0.5151 0.5199 0.6100 0.0169  0.0347  -0.0373 258 GLU B OE1 
3271 O OE2 . GLU B 175 ? 0.5683 0.5771 0.6882 0.0186  0.0343  -0.0279 258 GLU B OE2 
3272 N N   . GLU B 176 ? 0.4358 0.4590 0.4988 0.0437  0.0025  -0.0190 259 GLU B N   
3273 C CA  . GLU B 176 ? 0.4606 0.4916 0.5173 0.0589  -0.0094 -0.0204 259 GLU B CA  
3274 C C   . GLU B 176 ? 0.4887 0.5213 0.5473 0.0611  -0.0212 -0.0338 259 GLU B C   
3275 O O   . GLU B 176 ? 0.5066 0.5444 0.5756 0.0706  -0.0347 -0.0440 259 GLU B O   
3276 C CB  . GLU B 176 ? 0.5716 0.6076 0.6070 0.0719  -0.0068 -0.0069 259 GLU B CB  
3277 C CG  . GLU B 176 ? 0.7121 0.7576 0.7364 0.0938  -0.0148 -0.0025 259 GLU B CG  
3278 C CD  . GLU B 176 ? 0.9544 1.0051 0.9546 0.1098  -0.0071 0.0151  259 GLU B CD  
3279 O OE1 . GLU B 176 ? 0.8429 0.8892 0.8526 0.1017  0.0088  0.0298  259 GLU B OE1 
3280 O OE2 . GLU B 176 ? 1.0702 1.1299 1.0446 0.1323  -0.0170 0.0135  259 GLU B OE2 
3281 N N   . TYR B 177 ? 0.4962 0.5243 0.5502 0.0529  -0.0174 -0.0352 260 TYR B N   
3282 C CA  . TYR B 177 ? 0.5057 0.5358 0.5668 0.0562  -0.0287 -0.0473 260 TYR B CA  
3283 C C   . TYR B 177 ? 0.5173 0.5408 0.6087 0.0434  -0.0226 -0.0517 260 TYR B C   
3284 O O   . TYR B 177 ? 0.4420 0.4659 0.5511 0.0440  -0.0293 -0.0604 260 TYR B O   
3285 C CB  . TYR B 177 ? 0.4929 0.5245 0.5278 0.0610  -0.0297 -0.0442 260 TYR B CB  
3286 C CG  . TYR B 177 ? 0.5678 0.6076 0.5764 0.0792  -0.0342 -0.0385 260 TYR B CG  
3287 C CD1 . TYR B 177 ? 0.5505 0.5894 0.5424 0.0796  -0.0208 -0.0211 260 TYR B CD1 
3288 C CD2 . TYR B 177 ? 0.5698 0.6189 0.5736 0.0988  -0.0514 -0.0500 260 TYR B CD2 
3289 C CE1 . TYR B 177 ? 0.5784 0.6250 0.5493 0.0989  -0.0197 -0.0102 260 TYR B CE1 
3290 C CE2 . TYR B 177 ? 0.6501 0.7079 0.6231 0.1210  -0.0530 -0.0415 260 TYR B CE2 
3291 C CZ  . TYR B 177 ? 0.6958 0.7521 0.6524 0.1210  -0.0346 -0.0189 260 TYR B CZ  
3292 O OH  . TYR B 177 ? 0.7239 0.7891 0.6531 0.1456  -0.0308 -0.0048 260 TYR B OH  
3293 N N   . ASN B 178 ? 0.5251 0.5431 0.6249 0.0338  -0.0085 -0.0450 261 ASN B N   
3294 C CA  . ASN B 178 ? 0.4903 0.5027 0.6164 0.0257  0.0022  -0.0443 261 ASN B CA  
3295 C C   . ASN B 178 ? 0.5143 0.5232 0.6329 0.0227  0.0074  -0.0404 261 ASN B C   
3296 O O   . ASN B 178 ? 0.5324 0.5404 0.6813 0.0219  0.0069  -0.0435 261 ASN B O   
3297 C CB  . ASN B 178 ? 0.4070 0.4218 0.5787 0.0279  -0.0056 -0.0545 261 ASN B CB  
3298 C CG  . ASN B 178 ? 0.4416 0.4506 0.6488 0.0208  0.0118  -0.0484 261 ASN B CG  
3299 O OD1 . ASN B 178 ? 0.4698 0.4738 0.6606 0.0167  0.0306  -0.0365 261 ASN B OD1 
3300 N ND2 . ASN B 178 ? 0.4015 0.4116 0.6600 0.0217  0.0060  -0.0566 261 ASN B ND2 
3301 N N   . VAL B 179 ? 0.5201 0.5271 0.6045 0.0213  0.0120  -0.0338 262 VAL B N   
3302 C CA  . VAL B 179 ? 0.5063 0.5097 0.5811 0.0190  0.0180  -0.0287 262 VAL B CA  
3303 C C   . VAL B 179 ? 0.5142 0.5130 0.5713 0.0170  0.0324  -0.0207 262 VAL B C   
3304 O O   . VAL B 179 ? 0.5191 0.5181 0.5678 0.0169  0.0347  -0.0215 262 VAL B O   
3305 C CB  . VAL B 179 ? 0.4977 0.5035 0.5485 0.0218  0.0090  -0.0298 262 VAL B CB  
3306 C CG1 . VAL B 179 ? 0.5182 0.5309 0.5728 0.0298  -0.0062 -0.0387 262 VAL B CG1 
3307 C CG2 . VAL B 179 ? 0.5011 0.5063 0.5262 0.0211  0.0123  -0.0250 262 VAL B CG2 
3308 N N   . ALA B 180 ? 0.5306 0.5259 0.5834 0.0177  0.0420  -0.0136 263 ALA B N   
3309 C CA  . ALA B 180 ? 0.5255 0.5181 0.5517 0.0212  0.0522  -0.0084 263 ALA B CA  
3310 C C   . ALA B 180 ? 0.5668 0.5601 0.5668 0.0213  0.0420  -0.0119 263 ALA B C   
3311 O O   . ALA B 180 ? 0.5400 0.5342 0.5425 0.0197  0.0350  -0.0119 263 ALA B O   
3312 C CB  . ALA B 180 ? 0.4889 0.4782 0.5200 0.0262  0.0685  0.0038  263 ALA B CB  
3313 N N   . VAL B 181 ? 0.5933 0.5870 0.5751 0.0235  0.0396  -0.0167 264 VAL B N   
3314 C CA  . VAL B 181 ? 0.5630 0.5569 0.5278 0.0246  0.0315  -0.0198 264 VAL B CA  
3315 C C   . VAL B 181 ? 0.6212 0.6140 0.5629 0.0333  0.0336  -0.0226 264 VAL B C   
3316 O O   . VAL B 181 ? 0.6850 0.6783 0.6212 0.0387  0.0366  -0.0283 264 VAL B O   
3317 C CB  . VAL B 181 ? 0.5018 0.4985 0.4748 0.0210  0.0220  -0.0241 264 VAL B CB  
3318 C CG1 . VAL B 181 ? 0.5340 0.5328 0.5240 0.0190  0.0228  -0.0241 264 VAL B CG1 
3319 C CG2 . VAL B 181 ? 0.5016 0.4984 0.4698 0.0236  0.0163  -0.0315 264 VAL B CG2 
3320 N N   . PHE B 182 ? 0.5975 0.5894 0.5250 0.0366  0.0313  -0.0194 265 PHE B N   
3321 C CA  . PHE B 182 ? 0.5652 0.5569 0.4654 0.0491  0.0315  -0.0213 265 PHE B CA  
3322 C C   . PHE B 182 ? 0.5459 0.5389 0.4420 0.0494  0.0159  -0.0313 265 PHE B C   
3323 O O   . PHE B 182 ? 0.6286 0.6210 0.5328 0.0428  0.0119  -0.0273 265 PHE B O   
3324 C CB  . PHE B 182 ? 0.5797 0.5693 0.4711 0.0551  0.0442  -0.0055 265 PHE B CB  
3325 C CG  . PHE B 182 ? 0.6082 0.5986 0.4645 0.0728  0.0448  -0.0044 265 PHE B CG  
3326 C CD1 . PHE B 182 ? 0.6638 0.6561 0.4950 0.0896  0.0520  -0.0063 265 PHE B CD1 
3327 C CD2 . PHE B 182 ? 0.6037 0.5937 0.4501 0.0751  0.0372  -0.0025 265 PHE B CD2 
3328 C CE1 . PHE B 182 ? 0.7887 0.7833 0.5807 0.1115  0.0505  -0.0070 265 PHE B CE1 
3329 C CE2 . PHE B 182 ? 0.7000 0.6917 0.5119 0.0942  0.0352  -0.0024 265 PHE B CE2 
3330 C CZ  . PHE B 182 ? 0.7901 0.7845 0.5722 0.1141  0.0415  -0.0047 265 PHE B CZ  
3331 N N   . VAL B 183 ? 0.5639 0.5590 0.4517 0.0579  0.0063  -0.0461 266 VAL B N   
3332 C CA  . VAL B 183 ? 0.5615 0.5580 0.4550 0.0592  -0.0100 -0.0578 266 VAL B CA  
3333 C C   . VAL B 183 ? 0.5936 0.5925 0.4592 0.0781  -0.0203 -0.0706 266 VAL B C   
3334 O O   . VAL B 183 ? 0.6457 0.6465 0.4870 0.0929  -0.0168 -0.0758 266 VAL B O   
3335 C CB  . VAL B 183 ? 0.5709 0.5689 0.4996 0.0512  -0.0180 -0.0686 266 VAL B CB  
3336 C CG1 . VAL B 183 ? 0.5069 0.5039 0.4548 0.0382  -0.0076 -0.0551 266 VAL B CG1 
3337 C CG2 . VAL B 183 ? 0.5723 0.5725 0.5022 0.0603  -0.0235 -0.0858 266 VAL B CG2 
3338 N N   . THR B 184 ? 0.5810 0.5805 0.4479 0.0802  -0.0330 -0.0759 267 THR B N   
3339 C CA  . THR B 184 ? 0.6780 0.6810 0.5197 0.1008  -0.0479 -0.0918 267 THR B CA  
3340 C C   . THR B 184 ? 0.6905 0.6965 0.5670 0.1007  -0.0696 -0.1175 267 THR B C   
3341 O O   . THR B 184 ? 0.7080 0.7125 0.6284 0.0836  -0.0698 -0.1161 267 THR B O   
3342 C CB  . THR B 184 ? 0.6747 0.6770 0.4964 0.1069  -0.0500 -0.0824 267 THR B CB  
3343 O OG1 . THR B 184 ? 0.6212 0.6223 0.4781 0.0922  -0.0590 -0.0845 267 THR B OG1 
3344 C CG2 . THR B 184 ? 0.6765 0.6753 0.4786 0.1052  -0.0268 -0.0547 267 THR B CG2 
3345 N N   . ASN B 185 ? 0.7193 0.7301 0.5787 0.1222  -0.0877 -0.1409 268 ASN B N   
3346 C CA  . ASN B 185 ? 0.7421 0.7567 0.6430 0.1251  -0.1119 -0.1707 268 ASN B CA  
3347 C C   . ASN B 185 ? 0.8317 0.8522 0.7013 0.1534  -0.1354 -0.1945 268 ASN B C   
3348 O O   . ASN B 185 ? 0.8810 0.9034 0.6908 0.1738  -0.1290 -0.1873 268 ASN B O   
3349 C CB  . ASN B 185 ? 0.7389 0.7546 0.6595 0.1234  -0.1095 -0.1818 268 ASN B CB  
3350 C CG  . ASN B 185 ? 0.7587 0.7773 0.7425 0.1215  -0.1311 -0.2100 268 ASN B CG  
3351 O OD1 . ASN B 185 ? 0.7710 0.7927 0.7690 0.1288  -0.1384 -0.2300 268 ASN B OD1 
3352 N ND2 . ASN B 185 ? 0.7751 0.7928 0.8038 0.1115  -0.1399 -0.2110 268 ASN B ND2 
3353 N N   . GLN B 186 ? 0.9031 0.9270 0.8150 0.1569  -0.1622 -0.2216 269 GLN B N   
3354 C CA  . GLN B 186 ? 0.9521 0.9830 0.8383 0.1867  -0.1906 -0.2499 269 GLN B CA  
3355 C C   . GLN B 186 ? 1.0365 1.0740 0.9461 0.2027  -0.2141 -0.2894 269 GLN B C   
3356 O O   . GLN B 186 ? 0.9951 1.0307 0.9377 0.1890  -0.2043 -0.2897 269 GLN B O   
3357 C CB  . GLN B 186 ? 0.9283 0.9592 0.8497 0.1826  -0.2088 -0.2569 269 GLN B CB  
3358 C CG  . GLN B 186 ? 0.9294 0.9531 0.8577 0.1583  -0.1863 -0.2212 269 GLN B CG  
3359 C CD  . GLN B 186 ? 0.8592 0.8780 0.8532 0.1285  -0.1723 -0.2090 269 GLN B CD  
3360 O OE1 . GLN B 186 ? 0.9110 0.9315 0.9708 0.1235  -0.1868 -0.2282 269 GLN B OE1 
3361 N NE2 . GLN B 186 ? 0.7501 0.7635 0.7289 0.1111  -0.1440 -0.1768 269 GLN B NE2 
3362 N N   . MET B 187 ? 1.0986 1.1443 0.9926 0.2331  -0.2465 -0.3240 270 MET B N   
3363 C CA  . MET B 187 ? 1.1285 1.1826 1.0378 0.2564  -0.2753 -0.3692 270 MET B CA  
3364 C C   . MET B 187 ? 1.1374 1.1966 1.1179 0.2621  -0.3155 -0.4101 270 MET B C   
3365 O O   . MET B 187 ? 1.1578 1.2153 1.1545 0.2561  -0.3224 -0.4037 270 MET B O   
3366 C CB  . MET B 187 ? 1.2279 1.2900 1.0439 0.2978  -0.2797 -0.3784 270 MET B CB  
3367 C CG  . MET B 187 ? 1.2442 1.3020 0.9832 0.3003  -0.2452 -0.3322 270 MET B CG  
3368 S SD  . MET B 187 ? 1.3847 1.4443 1.0520 0.3197  -0.2153 -0.3149 270 MET B SD  
3369 C CE  . MET B 187 ? 1.4697 1.5442 1.0589 0.3817  -0.2434 -0.3505 270 MET B CE  
3370 N N   . THR B 188 ? 1.1404 1.2057 1.1711 0.2729  -0.3419 -0.4525 271 THR B N   
3371 C CA  . THR B 188 ? 1.1452 1.2164 1.2561 0.2813  -0.3839 -0.4977 271 THR B CA  
3372 C C   . THR B 188 ? 1.2579 1.3402 1.3095 0.3258  -0.4206 -0.5333 271 THR B C   
3373 O O   . THR B 188 ? 1.3666 1.4590 1.3907 0.3599  -0.4457 -0.5728 271 THR B O   
3374 C CB  . THR B 188 ? 1.1179 1.1923 1.3156 0.2782  -0.4011 -0.5337 271 THR B CB  
3375 O OG1 . THR B 188 ? 1.1211 1.1988 1.2598 0.2947  -0.3927 -0.5391 271 THR B OG1 
3376 C CG2 . THR B 188 ? 1.0573 1.1219 1.3505 0.2356  -0.3753 -0.5054 271 THR B CG2 
3377 N N   . LYS B 203 ? 1.2945 1.3818 1.0762 0.3760  -0.3176 -0.4871 286 LYS B N   
3378 C CA  . LYS B 203 ? 1.2637 1.3421 1.1338 0.3324  -0.3038 -0.4760 286 LYS B CA  
3379 C C   . LYS B 203 ? 1.2160 1.2829 1.1193 0.2923  -0.2807 -0.4328 286 LYS B C   
3380 O O   . LYS B 203 ? 1.2396 1.3065 1.1678 0.2894  -0.2978 -0.4383 286 LYS B O   
3381 C CB  . LYS B 203 ? 1.3262 1.4098 1.2899 0.3334  -0.3429 -0.5279 286 LYS B CB  
3382 C CG  . LYS B 203 ? 1.3155 1.3940 1.3551 0.3049  -0.3299 -0.5258 286 LYS B CG  
3383 C CD  . LYS B 203 ? 1.3391 1.4202 1.4962 0.2973  -0.3638 -0.5670 286 LYS B CD  
3384 C CE  . LYS B 203 ? 1.3521 1.4322 1.5737 0.2847  -0.3584 -0.5779 286 LYS B CE  
3385 N NZ  . LYS B 203 ? 1.3385 1.4073 1.5621 0.2487  -0.3126 -0.5236 286 LYS B NZ  
3386 N N   . PRO B 204 ? 1.1560 1.2139 1.0616 0.2628  -0.2429 -0.3916 287 PRO B N   
3387 C CA  . PRO B 204 ? 1.0675 1.1157 1.0040 0.2274  -0.2217 -0.3534 287 PRO B CA  
3388 C C   . PRO B 204 ? 1.0188 1.0642 1.0586 0.2016  -0.2319 -0.3637 287 PRO B C   
3389 O O   . PRO B 204 ? 1.0172 1.0662 1.1103 0.2050  -0.2482 -0.3941 287 PRO B O   
3390 C CB  . PRO B 204 ? 1.0058 1.0477 0.9102 0.2116  -0.1829 -0.3142 287 PRO B CB  
3391 C CG  . PRO B 204 ? 1.0676 1.1138 0.9705 0.2248  -0.1853 -0.3354 287 PRO B CG  
3392 C CD  . PRO B 204 ? 1.1483 1.2053 1.0342 0.2622  -0.2209 -0.3826 287 PRO B CD  
3393 N N   . ILE B 205 ? 0.9368 0.9761 1.0079 0.1779  -0.2214 -0.3382 288 ILE B N   
3394 C CA  . ILE B 205 ? 0.8620 0.8988 1.0322 0.1562  -0.2260 -0.3418 288 ILE B CA  
3395 C C   . ILE B 205 ? 0.8131 0.8440 1.0093 0.1321  -0.1964 -0.3132 288 ILE B C   
3396 O O   . ILE B 205 ? 0.8286 0.8565 0.9672 0.1284  -0.1730 -0.2881 288 ILE B O   
3397 C CB  . ILE B 205 ? 0.8262 0.8605 1.0291 0.1458  -0.2303 -0.3319 288 ILE B CB  
3398 C CG1 . ILE B 205 ? 0.7641 0.7917 0.9229 0.1287  -0.1997 -0.2866 288 ILE B CG1 
3399 C CG2 . ILE B 205 ? 0.8663 0.9073 1.0475 0.1719  -0.2636 -0.3638 288 ILE B CG2 
3400 C CD1 . ILE B 205 ? 0.7014 0.7265 0.9044 0.1161  -0.2006 -0.2757 288 ILE B CD1 
3401 N N   . GLY B 206 ? 0.7992 0.8292 1.0854 0.1182  -0.1979 -0.3178 289 GLY B N   
3402 C CA  . GLY B 206 ? 0.7247 0.7495 1.0380 0.0967  -0.1692 -0.2862 289 GLY B CA  
3403 C C   . GLY B 206 ? 0.7606 0.7871 1.1055 0.0983  -0.1699 -0.3009 289 GLY B C   
3404 O O   . GLY B 206 ? 0.7439 0.7666 1.1127 0.0822  -0.1466 -0.2745 289 GLY B O   
3405 N N   . GLY B 207 ? 0.7529 0.7858 1.0953 0.1199  -0.1971 -0.3432 290 GLY B N   
3406 C CA  . GLY B 207 ? 0.7455 0.7813 1.1227 0.1253  -0.2034 -0.3661 290 GLY B CA  
3407 C C   . GLY B 207 ? 0.7414 0.7732 1.0903 0.1138  -0.1744 -0.3378 290 GLY B C   
3408 O O   . GLY B 207 ? 0.7894 0.8180 1.0634 0.1107  -0.1537 -0.3096 290 GLY B O   
3409 N N   . HIS B 208 ? 0.7634 0.7953 1.1804 0.1072  -0.1730 -0.3451 291 HIS B N   
3410 C CA  . HIS B 208 ? 0.7678 0.7965 1.1714 0.0966  -0.1479 -0.3212 291 HIS B CA  
3411 C C   . HIS B 208 ? 0.7320 0.7543 1.1131 0.0768  -0.1174 -0.2719 291 HIS B C   
3412 O O   . HIS B 208 ? 0.7340 0.7539 1.0673 0.0726  -0.0985 -0.2513 291 HIS B O   
3413 C CB  . HIS B 208 ? 0.7637 0.7933 1.2610 0.0912  -0.1514 -0.3342 291 HIS B CB  
3414 C CG  . HIS B 208 ? 0.9170 0.9537 1.4464 0.1118  -0.1835 -0.3879 291 HIS B CG  
3415 N ND1 . HIS B 208 ? 0.9630 1.0026 1.5961 0.1131  -0.2054 -0.4163 291 HIS B ND1 
3416 C CD2 . HIS B 208 ? 1.0186 1.0609 1.4912 0.1346  -0.1970 -0.4195 291 HIS B CD2 
3417 C CE1 . HIS B 208 ? 0.9552 1.0023 1.5967 0.1358  -0.2354 -0.4678 291 HIS B CE1 
3418 N NE2 . HIS B 208 ? 1.0159 1.0650 1.5543 0.1502  -0.2296 -0.4691 291 HIS B NE2 
3419 N N   . ILE B 209 ? 0.6819 0.7019 1.1004 0.0661  -0.1131 -0.2539 292 ILE B N   
3420 C CA  . ILE B 209 ? 0.6994 0.7148 1.1034 0.0508  -0.0860 -0.2099 292 ILE B CA  
3421 C C   . ILE B 209 ? 0.8048 0.8185 1.1141 0.0527  -0.0773 -0.1956 292 ILE B C   
3422 O O   . ILE B 209 ? 0.8778 0.8892 1.1535 0.0461  -0.0585 -0.1719 292 ILE B O   
3423 C CB  . ILE B 209 ? 0.6699 0.6842 1.1274 0.0434  -0.0828 -0.1949 292 ILE B CB  
3424 C CG1 . ILE B 209 ? 0.7334 0.7492 1.2989 0.0418  -0.0889 -0.2067 292 ILE B CG1 
3425 C CG2 . ILE B 209 ? 0.6003 0.6113 1.0357 0.0326  -0.0556 -0.1512 292 ILE B CG2 
3426 C CD1 . ILE B 209 ? 0.8590 0.8779 1.4737 0.0500  -0.1164 -0.2407 292 ILE B CD1 
3427 N N   . LEU B 210 ? 0.8192 0.8345 1.0899 0.0630  -0.0917 -0.2105 293 LEU B N   
3428 C CA  . LEU B 210 ? 0.7643 0.7777 0.9555 0.0652  -0.0815 -0.1943 293 LEU B CA  
3429 C C   . LEU B 210 ? 0.7921 0.8069 0.9329 0.0766  -0.0783 -0.2030 293 LEU B C   
3430 O O   . LEU B 210 ? 0.7697 0.7821 0.8624 0.0740  -0.0612 -0.1817 293 LEU B O   
3431 C CB  . LEU B 210 ? 0.7607 0.7753 0.9276 0.0739  -0.0954 -0.2033 293 LEU B CB  
3432 C CG  . LEU B 210 ? 0.7481 0.7593 0.8705 0.0668  -0.0809 -0.1750 293 LEU B CG  
3433 C CD1 . LEU B 210 ? 0.7692 0.7822 0.8707 0.0782  -0.0976 -0.1882 293 LEU B CD1 
3434 C CD2 . LEU B 210 ? 0.7591 0.7683 0.8238 0.0674  -0.0635 -0.1580 293 LEU B CD2 
3435 N N   . ALA B 211 ? 0.7285 0.7477 0.8840 0.0907  -0.0943 -0.2348 294 ALA B N   
3436 C CA  . ALA B 211 ? 0.7030 0.7242 0.8075 0.1049  -0.0890 -0.2421 294 ALA B CA  
3437 C C   . ALA B 211 ? 0.6672 0.6846 0.7786 0.0899  -0.0660 -0.2176 294 ALA B C   
3438 O O   . ALA B 211 ? 0.7161 0.7323 0.7800 0.0926  -0.0498 -0.2027 294 ALA B O   
3439 C CB  . ALA B 211 ? 0.6387 0.6664 0.7587 0.1254  -0.1117 -0.2837 294 ALA B CB  
3440 N N   . HIS B 212 ? 0.6384 0.6543 0.8133 0.0749  -0.0638 -0.2117 295 HIS B N   
3441 C CA  . HIS B 212 ? 0.6168 0.6302 0.8022 0.0634  -0.0455 -0.1913 295 HIS B CA  
3442 C C   . HIS B 212 ? 0.5998 0.6094 0.7521 0.0524  -0.0271 -0.1578 295 HIS B C   
3443 O O   . HIS B 212 ? 0.6241 0.6324 0.7590 0.0491  -0.0134 -0.1447 295 HIS B O   
3444 C CB  . HIS B 212 ? 0.6264 0.6397 0.8887 0.0536  -0.0468 -0.1907 295 HIS B CB  
3445 C CG  . HIS B 212 ? 0.6932 0.7041 0.9662 0.0423  -0.0278 -0.1648 295 HIS B CG  
3446 N ND1 . HIS B 212 ? 0.6719 0.6807 0.9491 0.0318  -0.0145 -0.1337 295 HIS B ND1 
3447 C CD2 . HIS B 212 ? 0.6947 0.7059 0.9723 0.0426  -0.0211 -0.1670 295 HIS B CD2 
3448 C CE1 . HIS B 212 ? 0.7114 0.7196 0.9951 0.0270  -0.0020 -0.1180 295 HIS B CE1 
3449 N NE2 . HIS B 212 ? 0.7501 0.7593 1.0366 0.0321  -0.0056 -0.1377 295 HIS B NE2 
3450 N N   . ALA B 213 ? 0.5553 0.5636 0.7031 0.0476  -0.0282 -0.1459 296 ALA B N   
3451 C CA  . ALA B 213 ? 0.5783 0.5840 0.7052 0.0379  -0.0140 -0.1174 296 ALA B CA  
3452 C C   . ALA B 213 ? 0.6278 0.6323 0.6988 0.0427  -0.0068 -0.1117 296 ALA B C   
3453 O O   . ALA B 213 ? 0.6642 0.6670 0.7222 0.0361  0.0052  -0.0925 296 ALA B O   
3454 C CB  . ALA B 213 ? 0.5500 0.5553 0.6926 0.0329  -0.0166 -0.1072 296 ALA B CB  
3455 N N   . SER B 214 ? 0.6594 0.6653 0.6999 0.0563  -0.0140 -0.1276 297 SER B N   
3456 C CA  . SER B 214 ? 0.7327 0.7374 0.7241 0.0626  -0.0033 -0.1165 297 SER B CA  
3457 C C   . SER B 214 ? 0.7078 0.7136 0.6846 0.0715  0.0061  -0.1207 297 SER B C   
3458 O O   . SER B 214 ? 0.7799 0.7889 0.7608 0.0830  -0.0032 -0.1429 297 SER B O   
3459 C CB  . SER B 214 ? 0.7846 0.7905 0.7435 0.0750  -0.0122 -0.1232 297 SER B CB  
3460 O OG  . SER B 214 ? 0.9305 0.9402 0.9005 0.0864  -0.0322 -0.1501 297 SER B OG  
3461 N N   . THR B 215 ? 0.6713 0.6747 0.6376 0.0668  0.0238  -0.1013 298 THR B N   
3462 C CA  . THR B 215 ? 0.7518 0.7559 0.7081 0.0754  0.0368  -0.1019 298 THR B CA  
3463 C C   . THR B 215 ? 0.7491 0.7554 0.6585 0.0980  0.0431  -0.1047 298 THR B C   
3464 O O   . THR B 215 ? 0.8247 0.8341 0.7196 0.1138  0.0466  -0.1163 298 THR B O   
3465 C CB  . THR B 215 ? 0.8033 0.8046 0.7760 0.0635  0.0529  -0.0819 298 THR B CB  
3466 O OG1 . THR B 215 ? 1.0671 1.0662 1.0216 0.0645  0.0639  -0.0643 298 THR B OG1 
3467 C CG2 . THR B 215 ? 0.7257 0.7261 0.7358 0.0462  0.0455  -0.0773 298 THR B CG2 
3468 N N   . THR B 216 ? 0.7501 0.7554 0.6348 0.1019  0.0448  -0.0936 299 THR B N   
3469 C CA  . THR B 216 ? 0.7705 0.7782 0.6077 0.1262  0.0529  -0.0908 299 THR B CA  
3470 C C   . THR B 216 ? 0.7824 0.7922 0.5992 0.1351  0.0337  -0.1026 299 THR B C   
3471 O O   . THR B 216 ? 0.7517 0.7587 0.5842 0.1199  0.0269  -0.0954 299 THR B O   
3472 C CB  . THR B 216 ? 0.7647 0.7690 0.5952 0.1255  0.0789  -0.0604 299 THR B CB  
3473 O OG1 . THR B 216 ? 0.7920 0.7953 0.6432 0.1215  0.0960  -0.0528 299 THR B OG1 
3474 C CG2 . THR B 216 ? 0.7524 0.7593 0.5345 0.1527  0.0906  -0.0512 299 THR B CG2 
3475 N N   . ARG B 217 ? 0.8261 0.8417 0.6080 0.1618  0.0238  -0.1223 300 ARG B N   
3476 C CA  . ARG B 217 ? 0.8235 0.8426 0.5851 0.1756  0.0018  -0.1389 300 ARG B CA  
3477 C C   . ARG B 217 ? 0.9076 0.9308 0.6072 0.2081  0.0124  -0.1308 300 ARG B C   
3478 O O   . ARG B 217 ? 0.9529 0.9804 0.6210 0.2317  0.0238  -0.1335 300 ARG B O   
3479 C CB  . ARG B 217 ? 0.8106 0.8349 0.5915 0.1834  -0.0269 -0.1777 300 ARG B CB  
3480 C CG  . ARG B 217 ? 0.7766 0.7979 0.6221 0.1566  -0.0338 -0.1847 300 ARG B CG  
3481 C CD  . ARG B 217 ? 0.7802 0.8011 0.6640 0.1452  -0.0558 -0.1969 300 ARG B CD  
3482 N NE  . ARG B 217 ? 0.7857 0.8110 0.7109 0.1506  -0.0803 -0.2319 300 ARG B NE  
3483 C CZ  . ARG B 217 ? 0.7860 0.8142 0.7366 0.1553  -0.1056 -0.2545 300 ARG B CZ  
3484 N NH1 . ARG B 217 ? 0.8295 0.8568 0.7599 0.1568  -0.1098 -0.2458 300 ARG B NH1 
3485 N NH2 . ARG B 217 ? 0.7575 0.7895 0.7581 0.1596  -0.1275 -0.2870 300 ARG B NH2 
3486 N N   . ILE B 218 ? 0.8971 0.9195 0.5784 0.2116  0.0091  -0.1201 301 ILE B N   
3487 C CA  . ILE B 218 ? 0.9340 0.9598 0.5586 0.2421  0.0222  -0.1050 301 ILE B CA  
3488 C C   . ILE B 218 ? 0.9872 1.0181 0.5884 0.2599  -0.0066 -0.1273 301 ILE B C   
3489 O O   . ILE B 218 ? 0.9521 0.9800 0.5849 0.2399  -0.0237 -0.1328 301 ILE B O   
3490 C CB  . ILE B 218 ? 0.9310 0.9501 0.5643 0.2276  0.0482  -0.0659 301 ILE B CB  
3491 C CG1 . ILE B 218 ? 0.9773 0.9922 0.6370 0.2138  0.0758  -0.0456 301 ILE B CG1 
3492 C CG2 . ILE B 218 ? 0.9750 0.9971 0.5559 0.2586  0.0619  -0.0461 301 ILE B CG2 
3493 C CD1 . ILE B 218 ? 0.9687 0.9762 0.6770 0.1805  0.0833  -0.0265 301 ILE B CD1 
3494 N N   . SER B 219 ? 1.1053 1.1447 0.6502 0.3005  -0.0123 -0.1408 302 SER B N   
3495 C CA  . SER B 219 ? 1.1252 1.1708 0.6397 0.3247  -0.0400 -0.1610 302 SER B CA  
3496 C C   . SER B 219 ? 1.1652 1.2109 0.6297 0.3454  -0.0183 -0.1259 302 SER B C   
3497 O O   . SER B 219 ? 1.1324 1.1759 0.5785 0.3515  0.0180  -0.0913 302 SER B O   
3498 C CB  . SER B 219 ? 1.1682 1.2249 0.6511 0.3612  -0.0660 -0.2028 302 SER B CB  
3499 O OG  . SER B 219 ? 1.3518 1.4156 0.7579 0.4059  -0.0490 -0.1894 302 SER B OG  
3500 N N   . LEU B 220 ? 1.1846 1.2327 0.6345 0.3557  -0.0399 -0.1341 303 LEU B N   
3501 C CA  . LEU B 220 ? 1.2018 1.2492 0.6147 0.3713  -0.0219 -0.1003 303 LEU B CA  
3502 C C   . LEU B 220 ? 1.3358 1.3933 0.6960 0.4124  -0.0505 -0.1230 303 LEU B C   
3503 O O   . LEU B 220 ? 1.4042 1.4640 0.7893 0.4064  -0.0888 -0.1589 303 LEU B O   
3504 C CB  . LEU B 220 ? 1.1511 1.1887 0.6165 0.3306  -0.0174 -0.0805 303 LEU B CB  
3505 C CG  . LEU B 220 ? 1.1160 1.1440 0.6344 0.2909  0.0085  -0.0562 303 LEU B CG  
3506 C CD1 . LEU B 220 ? 1.0104 1.0310 0.5672 0.2614  0.0097  -0.0391 303 LEU B CD1 
3507 C CD2 . LEU B 220 ? 1.1141 1.1412 0.6105 0.3052  0.0484  -0.0218 303 LEU B CD2 
3508 N N   . ARG B 221 ? 1.3842 1.4479 0.6742 0.4560  -0.0314 -0.1012 304 ARG B N   
3509 C CA  . ARG B 221 ? 1.4451 1.5198 0.6738 0.5027  -0.0570 -0.1193 304 ARG B CA  
3510 C C   . ARG B 221 ? 1.4651 1.5402 0.6440 0.5294  -0.0263 -0.0717 304 ARG B C   
3511 O O   . ARG B 221 ? 1.3912 1.4589 0.5828 0.5160  0.0180  -0.0246 304 ARG B O   
3512 C CB  . ARG B 221 ? 1.4685 1.5563 0.6464 0.5475  -0.0780 -0.1584 304 ARG B CB  
3513 C CG  . ARG B 221 ? 1.5446 1.6329 0.7027 0.5573  -0.0423 -0.1401 304 ARG B CG  
3514 C CD  . ARG B 221 ? 1.6630 1.7616 0.8048 0.5821  -0.0711 -0.1912 304 ARG B CD  
3515 N NE  . ARG B 221 ? 1.8129 1.9270 0.8717 0.6462  -0.0938 -0.2148 304 ARG B NE  
3516 C CZ  . ARG B 221 ? 1.9075 2.0305 0.8824 0.6989  -0.0660 -0.1916 304 ARG B CZ  
3517 N NH1 . ARG B 221 ? 1.8743 1.9914 0.8455 0.6924  -0.0125 -0.1428 304 ARG B NH1 
3518 N NH2 . ARG B 221 ? 1.9709 2.1094 0.8670 0.7606  -0.0916 -0.2168 304 ARG B NH2 
3519 N N   . LYS B 222 ? 1.4648 1.5488 0.5938 0.5675  -0.0509 -0.0846 305 LYS B N   
3520 C CA  . LYS B 222 ? 1.5197 1.6039 0.6086 0.5913  -0.0274 -0.0410 305 LYS B CA  
3521 C C   . LYS B 222 ? 1.6572 1.7499 0.6668 0.6462  0.0081  -0.0098 305 LYS B C   
3522 O O   . LYS B 222 ? 1.6568 1.7558 0.6387 0.6669  0.0115  -0.0258 305 LYS B O   
3523 C CB  . LYS B 222 ? 1.5352 1.6258 0.6047 0.6106  -0.0700 -0.0680 305 LYS B CB  
3524 C CG  . LYS B 222 ? 1.4383 1.5248 0.5804 0.5686  -0.1135 -0.1138 305 LYS B CG  
3525 C CD  . LYS B 222 ? 1.4435 1.5363 0.5747 0.5876  -0.1558 -0.1409 305 LYS B CD  
3526 C CE  . LYS B 222 ? 1.4048 1.4907 0.5447 0.5751  -0.1378 -0.0997 305 LYS B CE  
3527 N NZ  . LYS B 222 ? 1.3944 1.4657 0.6194 0.5114  -0.1232 -0.0848 305 LYS B NZ  
3528 N N   . GLY B 223 ? 1.7464 1.8396 0.7205 0.6717  0.0363  0.0366  306 GLY B N   
3529 C CA  . GLY B 223 ? 1.7700 1.8702 0.6756 0.7235  0.0802  0.0783  306 GLY B CA  
3530 C C   . GLY B 223 ? 1.8015 1.9057 0.6585 0.7626  0.0981  0.1199  306 GLY B C   
3531 O O   . GLY B 223 ? 1.6841 1.7871 0.5520 0.7541  0.0699  0.1094  306 GLY B O   
3532 N N   . ARG B 224 ? 1.9723 2.0812 0.7781 0.8068  0.1477  0.1694  307 ARG B N   
3533 C CA  . ARG B 224 ? 2.0656 2.1801 0.8145 0.8561  0.1739  0.2174  307 ARG B CA  
3534 C C   . ARG B 224 ? 2.0327 2.1348 0.8496 0.8144  0.1801  0.2462  307 ARG B C   
3535 O O   . ARG B 224 ? 2.0739 2.1680 0.9288 0.8048  0.2311  0.3051  307 ARG B O   
3536 C CB  . ARG B 224 ? 2.1221 2.2400 0.8348 0.8964  0.2392  0.2761  307 ARG B CB  
3537 C CG  . ARG B 224 ? 2.2079 2.3377 0.8298 0.9711  0.2661  0.3204  307 ARG B CG  
3538 C CD  . ARG B 224 ? 2.3141 2.4634 0.8257 1.0365  0.2203  0.2717  307 ARG B CD  
3539 N NE  . ARG B 224 ? 2.3319 2.4906 0.7760 1.0880  0.2107  0.2885  307 ARG B NE  
3540 C CZ  . ARG B 224 ? 2.2896 2.4441 0.7639 1.0632  0.1727  0.2707  307 ARG B CZ  
3541 N NH1 . ARG B 224 ? 2.2036 2.3446 0.7745 0.9879  0.1425  0.2372  307 ARG B NH1 
3542 N NH2 . ARG B 224 ? 2.3127 2.4770 0.7200 1.1160  0.1663  0.2883  307 ARG B NH2 
3543 N N   . GLY B 225 ? 1.9395 2.0405 0.7772 0.7905  0.1276  0.2025  308 GLY B N   
3544 C CA  . GLY B 225 ? 1.8455 1.9359 0.7460 0.7509  0.1254  0.2199  308 GLY B CA  
3545 C C   . GLY B 225 ? 1.7767 1.8526 0.7792 0.6761  0.1219  0.2058  308 GLY B C   
3546 O O   . GLY B 225 ? 1.7104 1.7845 0.7446 0.6440  0.0767  0.1556  308 GLY B O   
3547 N N   . GLU B 226 ? 1.7620 1.8279 0.8184 0.6508  0.1701  0.2504  309 GLU B N   
3548 C CA  . GLU B 226 ? 1.6789 1.7315 0.8323 0.5834  0.1703  0.2428  309 GLU B CA  
3549 C C   . GLU B 226 ? 1.6682 1.7180 0.8462 0.5679  0.1932  0.2432  309 GLU B C   
3550 O O   . GLU B 226 ? 1.5358 1.5760 0.7876 0.5165  0.1915  0.2331  309 GLU B O   
3551 C CB  . GLU B 226 ? 1.6548 1.6974 0.8707 0.5587  0.1975  0.2865  309 GLU B CB  
3552 C CG  . GLU B 226 ? 1.6657 1.6996 0.9458 0.5387  0.2487  0.3310  309 GLU B CG  
3553 C CD  . GLU B 226 ? 1.7931 1.8322 1.0333 0.5889  0.3001  0.3839  309 GLU B CD  
3554 O OE1 . GLU B 226 ? 1.8016 1.8335 1.1061 0.5743  0.3444  0.4252  309 GLU B OE1 
3555 O OE2 . GLU B 226 ? 1.8192 1.8701 0.9676 0.6446  0.2972  0.3849  309 GLU B OE2 
3556 N N   . LEU B 227 ? 1.7410 1.7999 0.8545 0.6155  0.2145  0.2549  310 LEU B N   
3557 C CA  . LEU B 227 ? 1.7203 1.7792 0.8423 0.6086  0.2276  0.2447  310 LEU B CA  
3558 C C   . LEU B 227 ? 1.6779 1.7373 0.8145 0.5792  0.1766  0.1812  310 LEU B C   
3559 O O   . LEU B 227 ? 1.6869 1.7522 0.7934 0.5896  0.1322  0.1427  310 LEU B O   
3560 C CB  . LEU B 227 ? 1.8174 1.8890 0.8517 0.6729  0.2485  0.2572  310 LEU B CB  
3561 C CG  . LEU B 227 ? 2.0006 2.0734 1.0176 0.7102  0.3114  0.3251  310 LEU B CG  
3562 C CD1 . LEU B 227 ? 2.0164 2.0917 1.0037 0.7407  0.3216  0.3610  310 LEU B CD1 
3563 C CD2 . LEU B 227 ? 2.0911 2.1766 1.0255 0.7671  0.3272  0.3243  310 LEU B CD2 
3564 N N   . ARG B 228 ? 1.5711 1.6246 0.7579 0.5443  0.1833  0.1708  311 ARG B N   
3565 C CA  . ARG B 228 ? 1.4861 1.5388 0.6989 0.5133  0.1402  0.1161  311 ARG B CA  
3566 C C   . ARG B 228 ? 1.4412 1.4949 0.6611 0.5097  0.1519  0.1048  311 ARG B C   
3567 O O   . ARG B 228 ? 1.4631 1.5139 0.6949 0.5135  0.1960  0.1425  311 ARG B O   
3568 C CB  . ARG B 228 ? 1.4133 1.4550 0.7045 0.4566  0.1246  0.1096  311 ARG B CB  
3569 C CG  . ARG B 228 ? 1.3861 1.4301 0.6737 0.4511  0.0784  0.0744  311 ARG B CG  
3570 C CD  . ARG B 228 ? 1.4371 1.4820 0.7021 0.4699  0.0802  0.0978  311 ARG B CD  
3571 N NE  . ARG B 228 ? 1.5211 1.5630 0.8202 0.4427  0.0437  0.0719  311 ARG B NE  
3572 C CZ  . ARG B 228 ? 1.5582 1.5949 0.9139 0.4001  0.0196  0.0409  311 ARG B CZ  
3573 N NH1 . ARG B 228 ? 1.5081 1.5422 0.8931 0.3782  0.0244  0.0288  311 ARG B NH1 
3574 N NH2 . ARG B 228 ? 1.4129 1.4474 0.7973 0.3808  -0.0083 0.0235  311 ARG B NH2 
3575 N N   . ILE B 229 ? 1.3646 1.4225 0.5810 0.5044  0.1132  0.0536  312 ILE B N   
3576 C CA  . ILE B 229 ? 1.3949 1.4562 0.6044 0.5116  0.1203  0.0381  312 ILE B CA  
3577 C C   . ILE B 229 ? 1.3166 1.3717 0.5934 0.4633  0.0979  0.0053  312 ILE B C   
3578 O O   . ILE B 229 ? 1.2462 1.3035 0.5358 0.4526  0.0554  -0.0378 312 ILE B O   
3579 C CB  . ILE B 229 ? 1.4723 1.5486 0.5989 0.5691  0.1010  0.0077  312 ILE B CB  
3580 C CG1 . ILE B 229 ? 1.5773 1.6617 0.6256 0.6263  0.1285  0.0446  312 ILE B CG1 
3581 C CG2 . ILE B 229 ? 1.4631 1.5425 0.5886 0.5740  0.1081  -0.0099 312 ILE B CG2 
3582 C CD1 . ILE B 229 ? 1.5971 1.6782 0.6454 0.6370  0.1900  0.1023  312 ILE B CD1 
3583 N N   . ALA B 230 ? 1.2870 1.3349 0.6087 0.4372  0.1281  0.0273  313 ALA B N   
3584 C CA  . ALA B 230 ? 1.2203 1.2630 0.6012 0.3965  0.1131  0.0021  313 ALA B CA  
3585 C C   . ALA B 230 ? 1.2618 1.3105 0.6212 0.4163  0.1176  -0.0152 313 ALA B C   
3586 O O   . ALA B 230 ? 1.2951 1.3456 0.6315 0.4389  0.1546  0.0135  313 ALA B O   
3587 C CB  . ALA B 230 ? 1.1484 1.1800 0.5975 0.3543  0.1380  0.0323  313 ALA B CB  
3588 N N   . LYS B 231 ? 1.2367 1.2886 0.6091 0.4083  0.0810  -0.0615 314 LYS B N   
3589 C CA  . LYS B 231 ? 1.2414 1.2974 0.6127 0.4165  0.0805  -0.0836 314 LYS B CA  
3590 C C   . LYS B 231 ? 1.1492 1.1977 0.5972 0.3677  0.0650  -0.1017 314 LYS B C   
3591 O O   . LYS B 231 ? 1.0621 1.1079 0.5446 0.3439  0.0359  -0.1210 314 LYS B O   
3592 C CB  . LYS B 231 ? 1.3086 1.3779 0.6219 0.4621  0.0494  -0.1265 314 LYS B CB  
3593 C CG  . LYS B 231 ? 1.3299 1.4043 0.6457 0.4717  0.0434  -0.1568 314 LYS B CG  
3594 C CD  . LYS B 231 ? 1.4329 1.5221 0.6852 0.5248  0.0148  -0.1989 314 LYS B CD  
3595 C CE  . LYS B 231 ? 1.4581 1.5533 0.6953 0.5455  0.0253  -0.2143 314 LYS B CE  
3596 N NZ  . LYS B 231 ? 1.5830 1.6935 0.7685 0.5955  -0.0100 -0.2661 314 LYS B NZ  
3597 N N   . ILE B 232 ? 1.1177 1.1632 0.5925 0.3549  0.0866  -0.0928 315 ILE B N   
3598 C CA  . ILE B 232 ? 1.0724 1.1138 0.6084 0.3200  0.0709  -0.1146 315 ILE B CA  
3599 C C   . ILE B 232 ? 1.1254 1.1744 0.6552 0.3346  0.0316  -0.1637 315 ILE B C   
3600 O O   . ILE B 232 ? 1.1894 1.2471 0.6779 0.3701  0.0284  -0.1836 315 ILE B O   
3601 C CB  . ILE B 232 ? 1.0571 1.0977 0.6072 0.3183  0.0966  -0.1053 315 ILE B CB  
3602 C CG1 . ILE B 232 ? 1.0755 1.1109 0.6282 0.3163  0.1404  -0.0573 315 ILE B CG1 
3603 C CG2 . ILE B 232 ? 0.9583 0.9946 0.5723 0.2830  0.0800  -0.1256 315 ILE B CG2 
3604 C CD1 . ILE B 232 ? 1.0795 1.1051 0.6882 0.2762  0.1470  -0.0336 315 ILE B CD1 
3605 N N   . TYR B 233 ? 1.1991 1.2454 0.7725 0.3098  0.0019  -0.1837 316 TYR B N   
3606 C CA  . TYR B 233 ? 1.3001 1.3536 0.8822 0.3231  -0.0381 -0.2323 316 TYR B CA  
3607 C C   . TYR B 233 ? 1.3415 1.3982 0.9451 0.3261  -0.0422 -0.2573 316 TYR B C   
3608 O O   . TYR B 233 ? 1.3064 1.3571 0.9445 0.3012  -0.0212 -0.2393 316 TYR B O   
3609 C CB  . TYR B 233 ? 1.2963 1.3453 0.9364 0.2925  -0.0636 -0.2438 316 TYR B CB  
3610 C CG  . TYR B 233 ? 1.3269 1.3817 1.0052 0.2981  -0.1037 -0.2930 316 TYR B CG  
3611 C CD1 . TYR B 233 ? 1.3358 1.4011 0.9772 0.3370  -0.1334 -0.3289 316 TYR B CD1 
3612 C CD2 . TYR B 233 ? 1.2697 1.3201 1.0267 0.2659  -0.1125 -0.3037 316 TYR B CD2 
3613 C CE1 . TYR B 233 ? 1.3261 1.3971 1.0155 0.3419  -0.1728 -0.3776 316 TYR B CE1 
3614 C CE2 . TYR B 233 ? 1.2692 1.3246 1.0758 0.2701  -0.1473 -0.3472 316 TYR B CE2 
3615 C CZ  . TYR B 233 ? 1.2924 1.3579 1.0692 0.3072  -0.1785 -0.3859 316 TYR B CZ  
3616 O OH  . TYR B 233 ? 1.1839 1.2546 1.0225 0.3109  -0.2153 -0.4321 316 TYR B OH  
3617 N N   . ASP B 234 ? 1.5308 1.5978 1.1156 0.3582  -0.0715 -0.3009 317 ASP B N   
3618 C CA  . ASP B 234 ? 1.6468 1.7201 1.2345 0.3756  -0.0774 -0.3309 317 ASP B CA  
3619 C C   . ASP B 234 ? 1.6627 1.7390 1.1878 0.4028  -0.0403 -0.3058 317 ASP B C   
3620 O O   . ASP B 234 ? 1.5655 1.6353 1.1137 0.3813  -0.0103 -0.2789 317 ASP B O   
3621 C CB  . ASP B 234 ? 1.6032 1.6706 1.2786 0.3369  -0.0853 -0.3429 317 ASP B CB  
3622 C CG  . ASP B 234 ? 1.6599 1.7356 1.3717 0.3520  -0.1248 -0.3998 317 ASP B CG  
3623 O OD1 . ASP B 234 ? 1.7188 1.8016 1.4119 0.3773  -0.1258 -0.4229 317 ASP B OD1 
3624 O OD2 . ASP B 234 ? 1.5281 1.6034 1.2934 0.3387  -0.1545 -0.4219 317 ASP B OD2 
3625 N N   . SER B 235 ? 1.7795 1.8659 1.2259 0.4519  -0.0422 -0.3128 318 SER B N   
3626 C CA  . SER B 235 ? 1.8920 1.9854 1.2678 0.4937  -0.0117 -0.2978 318 SER B CA  
3627 C C   . SER B 235 ? 1.9111 1.9965 1.3090 0.4719  0.0342  -0.2573 318 SER B C   
3628 O O   . SER B 235 ? 1.8723 1.9462 1.3165 0.4301  0.0523  -0.2229 318 SER B O   
3629 C CB  . SER B 235 ? 1.9272 2.0351 1.2689 0.5394  -0.0428 -0.3528 318 SER B CB  
3630 O OG  . SER B 235 ? 1.8622 1.9806 1.1456 0.5812  -0.0708 -0.3761 318 SER B OG  
3631 N N   . PRO B 236 ? 1.9384 2.0306 1.3013 0.5032  0.0539  -0.2602 319 PRO B N   
3632 C CA  . PRO B 236 ? 2.0415 2.1490 1.3249 0.5654  0.0463  -0.2872 319 PRO B CA  
3633 C C   . PRO B 236 ? 2.0740 2.1872 1.2752 0.6068  0.0621  -0.2596 319 PRO B C   
3634 O O   . PRO B 236 ? 1.9815 2.0858 1.1891 0.5878  0.0935  -0.2093 319 PRO B O   
3635 C CB  . PRO B 236 ? 1.9921 2.1008 1.2704 0.5759  0.0816  -0.2740 319 PRO B CB  
3636 C CG  . PRO B 236 ? 1.8788 1.9754 1.2511 0.5172  0.0821  -0.2704 319 PRO B CG  
3637 C CD  . PRO B 236 ? 1.8812 1.9665 1.2929 0.4753  0.0812  -0.2427 319 PRO B CD  
3638 N N   . GLU B 237 ? 2.1236 2.2519 1.2516 0.6641  0.0386  -0.2940 320 GLU B N   
3639 C CA  . GLU B 237 ? 2.1645 2.3010 1.2058 0.7125  0.0469  -0.2744 320 GLU B CA  
3640 C C   . GLU B 237 ? 2.1525 2.2871 1.1485 0.7330  0.1107  -0.2077 320 GLU B C   
3641 O O   . GLU B 237 ? 2.1080 2.2502 1.0277 0.7795  0.1251  -0.1849 320 GLU B O   
3642 C CB  . GLU B 237 ? 2.2806 2.4361 1.2477 0.7776  0.0096  -0.3286 320 GLU B CB  
3643 C CG  . GLU B 237 ? 2.3045 2.4639 1.3103 0.7687  -0.0567 -0.3933 320 GLU B CG  
3644 C CD  . GLU B 237 ? 2.4484 2.6281 1.3810 0.8383  -0.0962 -0.4503 320 GLU B CD  
3645 O OE1 . GLU B 237 ? 2.4815 2.6662 1.4534 0.8360  -0.1531 -0.5106 320 GLU B OE1 
3646 O OE2 . GLU B 237 ? 2.5161 2.7075 1.3537 0.8980  -0.0708 -0.4358 320 GLU B OE2 
3647 N N   . MET B 238 ? 2.1456 2.2704 1.1938 0.6994  0.1485  -0.1765 321 MET B N   
3648 C CA  . MET B 238 ? 2.1085 2.2289 1.1446 0.7073  0.2117  -0.1111 321 MET B CA  
3649 C C   . MET B 238 ? 2.0490 2.1593 1.1058 0.6831  0.2297  -0.0638 321 MET B C   
3650 O O   . MET B 238 ? 1.9307 2.0317 1.0460 0.6349  0.2019  -0.0748 321 MET B O   
3651 C CB  . MET B 238 ? 2.0290 2.1406 1.1353 0.6695  0.2367  -0.0998 321 MET B CB  
3652 C CG  . MET B 238 ? 2.0711 2.1829 1.1616 0.6925  0.3001  -0.0471 321 MET B CG  
3653 S SD  . MET B 238 ? 2.1765 2.3068 1.1665 0.7733  0.3206  -0.0574 321 MET B SD  
3654 C CE  . MET B 238 ? 2.0675 2.1903 1.1113 0.7577  0.3852  -0.0078 321 MET B CE  
3655 N N   . PRO B 239 ? 2.0761 2.1891 1.0849 0.7195  0.2769  -0.0108 322 PRO B N   
3656 C CA  . PRO B 239 ? 1.9702 2.0746 0.9994 0.7023  0.2984  0.0371  322 PRO B CA  
3657 C C   . PRO B 239 ? 1.8985 1.9859 1.0331 0.6337  0.3119  0.0619  322 PRO B C   
3658 O O   . PRO B 239 ? 1.7893 1.8694 0.9606 0.5988  0.2894  0.0595  322 PRO B O   
3659 C CB  . PRO B 239 ? 2.0414 2.1527 1.0086 0.7584  0.3554  0.0912  322 PRO B CB  
3660 C CG  . PRO B 239 ? 2.1013 2.2297 0.9771 0.8211  0.3426  0.0565  322 PRO B CG  
3661 C CD  . PRO B 239 ? 2.1082 2.2352 1.0287 0.7896  0.3076  0.0020  322 PRO B CD  
3662 N N   . GLU B 240 ? 1.8655 1.9476 1.0480 0.6168  0.3468  0.0836  323 GLU B N   
3663 C CA  . GLU B 240 ? 1.7012 1.7689 0.9826 0.5585  0.3617  0.1084  323 GLU B CA  
3664 C C   . GLU B 240 ? 1.6488 1.7095 0.9853 0.5056  0.3124  0.0672  323 GLU B C   
3665 O O   . GLU B 240 ? 1.5852 1.6350 0.9995 0.4579  0.3165  0.0803  323 GLU B O   
3666 C CB  . GLU B 240 ? 1.6817 1.7463 1.0070 0.5524  0.4026  0.1317  323 GLU B CB  
3667 C CG  . GLU B 240 ? 1.8171 1.8913 1.0817 0.6112  0.4492  0.1615  323 GLU B CG  
3668 C CD  . GLU B 240 ? 1.8633 1.9501 1.0591 0.6491  0.4278  0.1169  323 GLU B CD  
3669 O OE1 . GLU B 240 ? 1.7773 1.8625 1.0045 0.6194  0.3899  0.0701  323 GLU B OE1 
3670 O OE2 . GLU B 240 ? 1.8882 1.9871 0.9995 0.7110  0.4494  0.1288  323 GLU B OE2 
3671 N N   . ASN B 241 ? 1.6241 1.6918 0.9231 0.5164  0.2662  0.0175  324 ASN B N   
3672 C CA  . ASN B 241 ? 1.5845 1.6467 0.9297 0.4733  0.2197  -0.0179 324 ASN B CA  
3673 C C   . ASN B 241 ? 1.5626 1.6237 0.8926 0.4717  0.2008  -0.0141 324 ASN B C   
3674 O O   . ASN B 241 ? 1.4106 1.4683 0.7737 0.4415  0.1632  -0.0423 324 ASN B O   
3675 C CB  . ASN B 241 ? 1.5575 1.6268 0.8929 0.4802  0.1787  -0.0749 324 ASN B CB  
3676 C CG  . ASN B 241 ? 1.5063 1.5746 0.8758 0.4691  0.1909  -0.0829 324 ASN B CG  
3677 O OD1 . ASN B 241 ? 1.3967 1.4554 0.8304 0.4301  0.2084  -0.0619 324 ASN B OD1 
3678 N ND2 . ASN B 241 ? 1.5563 1.6352 0.8837 0.5050  0.1793  -0.1160 324 ASN B ND2 
3679 N N   . GLU B 242 ? 1.6337 1.6978 0.9163 0.5055  0.2294  0.0228  325 GLU B N   
3680 C CA  . GLU B 242 ? 1.6260 1.6895 0.8894 0.5102  0.2191  0.0347  325 GLU B CA  
3681 C C   . GLU B 242 ? 1.6113 1.6671 0.9022 0.5016  0.2628  0.0929  325 GLU B C   
3682 O O   . GLU B 242 ? 1.6833 1.7347 1.0101 0.4943  0.3024  0.1250  325 GLU B O   
3683 C CB  . GLU B 242 ? 1.7254 1.8025 0.8954 0.5699  0.2059  0.0201  325 GLU B CB  
3684 C CG  . GLU B 242 ? 1.7452 1.8298 0.8971 0.5767  0.1496  -0.0433 325 GLU B CG  
3685 C CD  . GLU B 242 ? 1.7816 1.8792 0.8484 0.6326  0.1284  -0.0596 325 GLU B CD  
3686 O OE1 . GLU B 242 ? 1.7580 1.8557 0.7928 0.6514  0.1481  -0.0226 325 GLU B OE1 
3687 O OE2 . GLU B 242 ? 1.7650 1.8732 0.8002 0.6589  0.0904  -0.1111 325 GLU B OE2 
3688 N N   . ALA B 243 ? 1.5788 1.6333 0.8585 0.5034  0.2548  0.1051  326 ALA B N   
3689 C CA  . ALA B 243 ? 1.5082 1.5548 0.8267 0.4906  0.2897  0.1559  326 ALA B CA  
3690 C C   . ALA B 243 ? 1.4824 1.5298 0.7750 0.5005  0.2753  0.1631  326 ALA B C   
3691 O O   . ALA B 243 ? 1.4653 1.5137 0.7512 0.4880  0.2306  0.1257  326 ALA B O   
3692 C CB  . ALA B 243 ? 1.3959 1.4306 0.8101 0.4331  0.2922  0.1601  326 ALA B CB  
3693 N N   . THR B 244 ? 1.4481 1.4948 0.7337 0.5228  0.3159  0.2139  327 THR B N   
3694 C CA  . THR B 244 ? 1.4338 1.4819 0.6911 0.5399  0.3114  0.2304  327 THR B CA  
3695 C C   . THR B 244 ? 1.3372 1.3737 0.6768 0.5002  0.3292  0.2621  327 THR B C   
3696 O O   . THR B 244 ? 1.3020 1.3328 0.6966 0.4902  0.3705  0.2991  327 THR B O   
3697 C CB  . THR B 244 ? 1.5092 1.5670 0.6903 0.6047  0.3481  0.2692  327 THR B CB  
3698 O OG1 . THR B 244 ? 1.5976 1.6685 0.6911 0.6481  0.3218  0.2319  327 THR B OG1 
3699 C CG2 . THR B 244 ? 1.5434 1.6008 0.7102 0.6203  0.3551  0.3004  327 THR B CG2 
3700 N N   . PHE B 245 ? 1.2904 1.3239 0.6410 0.4799  0.2973  0.2463  328 PHE B N   
3701 C CA  . PHE B 245 ? 1.2999 1.3236 0.7233 0.4456  0.3079  0.2712  328 PHE B CA  
3702 C C   . PHE B 245 ? 1.3366 1.3622 0.7279 0.4590  0.2893  0.2730  328 PHE B C   
3703 O O   . PHE B 245 ? 1.4092 1.4429 0.7338 0.4837  0.2573  0.2432  328 PHE B O   
3704 C CB  . PHE B 245 ? 1.2023 1.2178 0.6984 0.3887  0.2818  0.2402  328 PHE B CB  
3705 C CG  . PHE B 245 ? 1.1445 1.1618 0.6216 0.3727  0.2299  0.1913  328 PHE B CG  
3706 C CD1 . PHE B 245 ? 1.0900 1.1031 0.5920 0.3503  0.2083  0.1851  328 PHE B CD1 
3707 C CD2 . PHE B 245 ? 1.1528 1.1761 0.5931 0.3809  0.2036  0.1515  328 PHE B CD2 
3708 C CE1 . PHE B 245 ? 1.0525 1.0673 0.5445 0.3364  0.1636  0.1427  328 PHE B CE1 
3709 C CE2 . PHE B 245 ? 1.1312 1.1561 0.5668 0.3665  0.1578  0.1081  328 PHE B CE2 
3710 C CZ  . PHE B 245 ? 1.0939 1.1144 0.5565 0.3439  0.1389  0.1049  328 PHE B CZ  
3711 N N   . ALA B 246 ? 1.3030 1.3218 0.7462 0.4433  0.3069  0.3050  329 ALA B N   
3712 C CA  . ALA B 246 ? 1.3073 1.3270 0.7294 0.4499  0.2861  0.3038  329 ALA B CA  
3713 C C   . ALA B 246 ? 1.1767 1.1880 0.6669 0.3986  0.2586  0.2832  329 ALA B C   
3714 O O   . ALA B 246 ? 1.0803 1.0844 0.6406 0.3604  0.2631  0.2800  329 ALA B O   
3715 C CB  . ALA B 246 ? 1.3063 1.3280 0.7100 0.4885  0.3265  0.3587  329 ALA B CB  
3716 N N   . ILE B 247 ? 1.1882 1.2015 0.6522 0.4020  0.2283  0.2667  330 ILE B N   
3717 C CA  . ILE B 247 ? 1.2244 1.2310 0.7422 0.3633  0.2063  0.2537  330 ILE B CA  
3718 C C   . ILE B 247 ? 1.2770 1.2804 0.8191 0.3731  0.2344  0.2983  330 ILE B C   
3719 O O   . ILE B 247 ? 1.3937 1.4025 0.8851 0.4159  0.2537  0.3270  330 ILE B O   
3720 C CB  . ILE B 247 ? 1.2433 1.2543 0.7237 0.3628  0.1579  0.2101  330 ILE B CB  
3721 C CG1 . ILE B 247 ? 1.3662 1.3869 0.7647 0.4143  0.1510  0.2139  330 ILE B CG1 
3722 C CG2 . ILE B 247 ? 1.1660 1.1788 0.6443 0.3467  0.1321  0.1673  330 ILE B CG2 
3723 C CD1 . ILE B 247 ? 1.3808 1.4017 0.7719 0.4247  0.1432  0.2276  330 ILE B CD1 
3724 N N   . THR B 248 ? 1.2223 1.2176 0.8421 0.3370  0.2378  0.3051  331 THR B N   
3725 C CA  . THR B 248 ? 1.2209 1.2126 0.8780 0.3444  0.2659  0.3476  331 THR B CA  
3726 C C   . THR B 248 ? 1.1951 1.1802 0.9191 0.3046  0.2468  0.3330  331 THR B C   
3727 O O   . THR B 248 ? 1.1447 1.1281 0.8869 0.2725  0.2167  0.2942  331 THR B O   
3728 C CB  . THR B 248 ? 1.2062 1.1940 0.9207 0.3466  0.3136  0.3888  331 THR B CB  
3729 O OG1 . THR B 248 ? 1.1571 1.1398 0.9366 0.3065  0.3057  0.3658  331 THR B OG1 
3730 C CG2 . THR B 248 ? 1.2508 1.2450 0.9069 0.3880  0.3419  0.4111  331 THR B CG2 
3731 N N   . ALA B 249 ? 1.1972 1.1789 0.9627 0.3080  0.2671  0.3661  332 ALA B N   
3732 C CA  . ALA B 249 ? 1.1628 1.1383 1.0023 0.2718  0.2539  0.3549  332 ALA B CA  
3733 C C   . ALA B 249 ? 1.0796 1.0512 0.9805 0.2364  0.2494  0.3325  332 ALA B C   
3734 O O   . ALA B 249 ? 1.0638 1.0339 0.9838 0.2074  0.2192  0.2977  332 ALA B O   
3735 C CB  . ALA B 249 ? 1.1588 1.1307 1.0520 0.2813  0.2853  0.3990  332 ALA B CB  
3736 N N   . GLY B 250 ? 1.0800 1.0506 1.0083 0.2421  0.2797  0.3531  333 GLY B N   
3737 C CA  . GLY B 250 ? 0.9493 0.9167 0.9405 0.2125  0.2771  0.3349  333 GLY B CA  
3738 C C   . GLY B 250 ? 0.9659 0.9365 0.9102 0.2068  0.2577  0.3027  333 GLY B C   
3739 O O   . GLY B 250 ? 0.9670 0.9359 0.9522 0.1916  0.2633  0.2954  333 GLY B O   
3740 N N   . GLY B 251 ? 1.0008 0.9760 0.8654 0.2193  0.2340  0.2824  334 GLY B N   
3741 C CA  . GLY B 251 ? 0.9607 0.9388 0.7891 0.2106  0.2102  0.2465  334 GLY B CA  
3742 C C   . GLY B 251 ? 1.0077 0.9900 0.7901 0.2368  0.2282  0.2557  334 GLY B C   
3743 O O   . GLY B 251 ? 1.0849 1.0704 0.8307 0.2713  0.2525  0.2857  334 GLY B O   
3744 N N   . ILE B 252 ? 0.9445 0.9276 0.7272 0.2232  0.2175  0.2309  335 ILE B N   
3745 C CA  . ILE B 252 ? 0.9620 0.9492 0.7050 0.2468  0.2340  0.2363  335 ILE B CA  
3746 C C   . ILE B 252 ? 0.9833 0.9684 0.7644 0.2601  0.2805  0.2790  335 ILE B C   
3747 O O   . ILE B 252 ? 0.9173 0.8972 0.7751 0.2356  0.2916  0.2848  335 ILE B O   
3748 C CB  . ILE B 252 ? 0.9220 0.9098 0.6683 0.2266  0.2137  0.2014  335 ILE B CB  
3749 C CG1 . ILE B 252 ? 0.8880 0.8812 0.5738 0.2347  0.1799  0.1662  335 ILE B CG1 
3750 C CG2 . ILE B 252 ? 0.9709 0.9605 0.7122 0.2423  0.2415  0.2154  335 ILE B CG2 
3751 C CD1 . ILE B 252 ? 0.8810 0.8754 0.5444 0.2365  0.1543  0.1543  335 ILE B CD1 
3752 N N   . GLY B 253 ? 1.0161 1.0059 0.7458 0.3010  0.3071  0.3081  336 GLY B N   
3753 C CA  . GLY B 253 ? 1.0515 1.0404 0.8118 0.3204  0.3567  0.3532  336 GLY B CA  
3754 C C   . GLY B 253 ? 1.1505 1.1470 0.8354 0.3637  0.3773  0.3655  336 GLY B C   
3755 O O   . GLY B 253 ? 1.1510 1.1536 0.7641 0.3762  0.3488  0.3326  336 GLY B O   
3756 N N   . ASP B 254 ? 1.2239 1.2206 0.9287 0.3885  0.4273  0.4125  337 ASP B N   
3757 C CA  . ASP B 254 ? 1.3325 1.3373 0.9648 0.4355  0.4538  0.4299  337 ASP B CA  
3758 C C   . ASP B 254 ? 1.3928 1.4049 0.9465 0.4862  0.4674  0.4579  337 ASP B C   
3759 O O   . ASP B 254 ? 1.4346 1.4443 1.0017 0.4844  0.4643  0.4726  337 ASP B O   
3760 C CB  . ASP B 254 ? 1.3405 1.3428 1.0333 0.4415  0.5063  0.4701  337 ASP B CB  
3761 C CG  . ASP B 254 ? 1.3295 1.3249 1.1078 0.3941  0.4951  0.4456  337 ASP B CG  
3762 O OD1 . ASP B 254 ? 1.2811 1.2787 1.0312 0.3829  0.4688  0.4062  337 ASP B OD1 
3763 O OD2 . ASP B 254 ? 1.3067 1.2949 1.1842 0.3702  0.5127  0.4664  337 ASP B OD2 
3764 N N   . ALA B 255 ? 1.4773 1.4991 0.9463 0.5335  0.4808  0.4631  338 ALA B N   
3765 C CA  . ALA B 255 ? 1.5120 1.5421 0.9106 0.5941  0.5138  0.5064  338 ALA B CA  
3766 C C   . ALA B 255 ? 1.5087 1.5341 0.9465 0.5936  0.5302  0.5455  338 ALA B C   
3767 O O   . ALA B 255 ? 1.5741 1.6014 1.0120 0.6305  0.5804  0.6035  338 ALA B O   
3768 C CB  . ALA B 255 ? 1.5034 1.5367 0.9018 0.6275  0.5712  0.5497  338 ALA B CB  
3769 N N   . GLY C 1   ? 0.9061 0.9787 0.9708 -0.0959 -0.0841 -0.1256 84  GLY C N   
3770 C CA  . GLY C 1   ? 0.7974 0.8480 0.8657 -0.0809 -0.0702 -0.1060 84  GLY C CA  
3771 C C   . GLY C 1   ? 0.7694 0.8197 0.8556 -0.0740 -0.0728 -0.0813 84  GLY C C   
3772 O O   . GLY C 1   ? 0.7703 0.8120 0.8490 -0.0642 -0.0652 -0.0641 84  GLY C O   
3773 N N   . PHE C 2   ? 0.7226 0.7848 0.8335 -0.0801 -0.0836 -0.0815 85  PHE C N   
3774 C CA  . PHE C 2   ? 0.6838 0.7468 0.8228 -0.0746 -0.0841 -0.0620 85  PHE C CA  
3775 C C   . PHE C 2   ? 0.6682 0.7455 0.7981 -0.0734 -0.0945 -0.0454 85  PHE C C   
3776 O O   . PHE C 2   ? 0.7219 0.8169 0.8353 -0.0823 -0.1093 -0.0489 85  PHE C O   
3777 C CB  . PHE C 2   ? 0.6795 0.7490 0.8568 -0.0822 -0.0911 -0.0697 85  PHE C CB  
3778 C CG  . PHE C 2   ? 0.6981 0.7521 0.9002 -0.0824 -0.0805 -0.0806 85  PHE C CG  
3779 C CD1 . PHE C 2   ? 0.6960 0.7467 0.8931 -0.0893 -0.0802 -0.1055 85  PHE C CD1 
3780 C CD2 . PHE C 2   ? 0.6664 0.7104 0.8982 -0.0760 -0.0695 -0.0650 85  PHE C CD2 
3781 C CE1 . PHE C 2   ? 0.6851 0.7204 0.9144 -0.0889 -0.0706 -0.1135 85  PHE C CE1 
3782 C CE2 . PHE C 2   ? 0.6561 0.6873 0.9145 -0.0768 -0.0611 -0.0698 85  PHE C CE2 
3783 C CZ  . PHE C 2   ? 0.6498 0.6754 0.9106 -0.0828 -0.0623 -0.0934 85  PHE C CZ  
3784 N N   . LEU C 3   ? 0.6446 0.7162 0.7888 -0.0633 -0.0864 -0.0272 86  LEU C N   
3785 C CA  . LEU C 3   ? 0.6175 0.7017 0.7743 -0.0607 -0.0951 -0.0096 86  LEU C CA  
3786 C C   . LEU C 3   ? 0.5902 0.6737 0.7894 -0.0554 -0.0875 -0.0001 86  LEU C C   
3787 O O   . LEU C 3   ? 0.6186 0.6918 0.8303 -0.0537 -0.0746 -0.0046 86  LEU C O   
3788 C CB  . LEU C 3   ? 0.5748 0.6550 0.7078 -0.0537 -0.0913 0.0011  86  LEU C CB  
3789 C CG  . LEU C 3   ? 0.5511 0.6133 0.6759 -0.0430 -0.0720 0.0036  86  LEU C CG  
3790 C CD1 . LEU C 3   ? 0.5107 0.5733 0.6106 -0.0404 -0.0752 0.0111  86  LEU C CD1 
3791 C CD2 . LEU C 3   ? 0.5695 0.6164 0.6794 -0.0428 -0.0595 -0.0093 86  LEU C CD2 
3792 N N   . THR C 4   ? 0.5596 0.6560 0.7850 -0.0537 -0.0955 0.0140  87  THR C N   
3793 C CA  . THR C 4   ? 0.5103 0.6080 0.7783 -0.0490 -0.0858 0.0212  87  THR C CA  
3794 C C   . THR C 4   ? 0.4694 0.5552 0.7326 -0.0385 -0.0648 0.0248  87  THR C C   
3795 O O   . THR C 4   ? 0.4564 0.5353 0.6913 -0.0347 -0.0628 0.0254  87  THR C O   
3796 C CB  . THR C 4   ? 0.5173 0.6339 0.8239 -0.0506 -0.1008 0.0345  87  THR C CB  
3797 O OG1 . THR C 4   ? 0.5518 0.6724 0.8541 -0.0460 -0.1066 0.0470  87  THR C OG1 
3798 C CG2 . THR C 4   ? 0.5285 0.6604 0.8359 -0.0633 -0.1234 0.0298  87  THR C CG2 
3799 N N   . ALA C 5   ? 0.4570 0.5418 0.7458 -0.0353 -0.0485 0.0262  88  ALA C N   
3800 C CA  . ALA C 5   ? 0.4573 0.5349 0.7390 -0.0278 -0.0274 0.0266  88  ALA C CA  
3801 C C   . ALA C 5   ? 0.4822 0.5646 0.7796 -0.0213 -0.0288 0.0330  88  ALA C C   
3802 O O   . ALA C 5   ? 0.5233 0.5977 0.8025 -0.0160 -0.0191 0.0307  88  ALA C O   
3803 C CB  . ALA C 5   ? 0.4478 0.5297 0.7533 -0.0282 -0.0094 0.0274  88  ALA C CB  
3804 N N   . PHE C 6   ? 0.5062 0.6018 0.8399 -0.0223 -0.0432 0.0418  89  PHE C N   
3805 C CA  . PHE C 6   ? 0.5367 0.6372 0.8932 -0.0167 -0.0484 0.0515  89  PHE C CA  
3806 C C   . PHE C 6   ? 0.5582 0.6511 0.8757 -0.0162 -0.0573 0.0538  89  PHE C C   
3807 O O   . PHE C 6   ? 0.5466 0.6330 0.8669 -0.0093 -0.0483 0.0551  89  PHE C O   
3808 C CB  . PHE C 6   ? 0.5675 0.6859 0.9692 -0.0199 -0.0682 0.0649  89  PHE C CB  
3809 C CG  . PHE C 6   ? 0.5677 0.6922 1.0014 -0.0144 -0.0762 0.0794  89  PHE C CG  
3810 C CD1 . PHE C 6   ? 0.6171 0.7469 1.1099 -0.0070 -0.0644 0.0826  89  PHE C CD1 
3811 C CD2 . PHE C 6   ? 0.5928 0.7184 1.0014 -0.0170 -0.0942 0.0901  89  PHE C CD2 
3812 C CE1 . PHE C 6   ? 0.6431 0.7770 1.1753 -0.0013 -0.0711 0.0964  89  PHE C CE1 
3813 C CE2 . PHE C 6   ? 0.6143 0.7455 1.0583 -0.0123 -0.1021 0.1072  89  PHE C CE2 
3814 C CZ  . PHE C 6   ? 0.6105 0.7446 1.1195 -0.0039 -0.0910 0.1105  89  PHE C CZ  
3815 N N   . GLU C 7   ? 0.5708 0.6659 0.8551 -0.0244 -0.0742 0.0532  90  GLU C N   
3816 C CA  . GLU C 7   ? 0.5921 0.6824 0.8359 -0.0256 -0.0813 0.0547  90  GLU C CA  
3817 C C   . GLU C 7   ? 0.5545 0.6262 0.7674 -0.0201 -0.0615 0.0435  90  GLU C C   
3818 O O   . GLU C 7   ? 0.5770 0.6426 0.7732 -0.0166 -0.0601 0.0466  90  GLU C O   
3819 C CB  . GLU C 7   ? 0.5962 0.6949 0.8084 -0.0370 -0.0991 0.0506  90  GLU C CB  
3820 C CG  . GLU C 7   ? 0.6833 0.8049 0.9183 -0.0451 -0.1229 0.0637  90  GLU C CG  
3821 C CD  . GLU C 7   ? 0.7543 0.8872 0.9621 -0.0588 -0.1375 0.0524  90  GLU C CD  
3822 O OE1 . GLU C 7   ? 0.8175 0.9705 1.0128 -0.0685 -0.1582 0.0619  90  GLU C OE1 
3823 O OE2 . GLU C 7   ? 0.7394 0.8632 0.9406 -0.0609 -0.1285 0.0341  90  GLU C OE2 
3824 N N   . TYR C 8   ? 0.5346 0.5990 0.7431 -0.0200 -0.0471 0.0327  91  TYR C N   
3825 C CA  . TYR C 8   ? 0.5585 0.6086 0.7373 -0.0166 -0.0307 0.0244  91  TYR C CA  
3826 C C   . TYR C 8   ? 0.5660 0.6134 0.7611 -0.0090 -0.0138 0.0242  91  TYR C C   
3827 O O   . TYR C 8   ? 0.5883 0.6265 0.7607 -0.0059 -0.0056 0.0202  91  TYR C O   
3828 C CB  . TYR C 8   ? 0.5037 0.5491 0.6730 -0.0208 -0.0234 0.0166  91  TYR C CB  
3829 C CG  . TYR C 8   ? 0.4812 0.5146 0.6213 -0.0188 -0.0096 0.0115  91  TYR C CG  
3830 C CD1 . TYR C 8   ? 0.4925 0.5170 0.5989 -0.0185 -0.0135 0.0082  91  TYR C CD1 
3831 C CD2 . TYR C 8   ? 0.4750 0.5088 0.6214 -0.0186 0.0069  0.0113  91  TYR C CD2 
3832 C CE1 . TYR C 8   ? 0.4791 0.4937 0.5619 -0.0171 -0.0025 0.0049  91  TYR C CE1 
3833 C CE2 . TYR C 8   ? 0.4937 0.5200 0.6134 -0.0185 0.0173  0.0093  91  TYR C CE2 
3834 C CZ  . TYR C 8   ? 0.5263 0.5421 0.6157 -0.0172 0.0120  0.0062  91  TYR C CZ  
3835 O OH  . TYR C 8   ? 0.5627 0.5724 0.6292 -0.0175 0.0210  0.0056  91  TYR C OH  
3836 N N   . SER C 9   ? 0.5578 0.6147 0.7950 -0.0068 -0.0079 0.0265  92  SER C N   
3837 C CA  . SER C 9   ? 0.5567 0.6145 0.8189 -0.0004 0.0081  0.0229  92  SER C CA  
3838 C C   . SER C 9   ? 0.5787 0.6323 0.8474 0.0044  0.0002  0.0288  92  SER C C   
3839 O O   . SER C 9   ? 0.6004 0.6480 0.8703 0.0089  0.0139  0.0211  92  SER C O   
3840 C CB  . SER C 9   ? 0.5207 0.5919 0.8359 0.0008  0.0131  0.0249  92  SE