data_4I1Q
# 
_entry.id   4I1Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4I1Q         
RCSB  RCSB076193   
WWPDB D_1000076193 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4I1Q 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Sanchez-Barrena, M.J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Bin2 Is a Membrane Sculpting N-BAR Protein That Influences Leucocyte Podosomes, Motility and Phagocytosis' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            7 
_citation.page_first                e52401 
_citation.page_last                 e52401 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23285027 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0052401 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sanchez-Barrena, M.J.' 1 
primary 'Vallis, Y.'            2 
primary 'Clatworthy, M.R.'      3 
primary 'Doherty, G.J.'         4 
primary 'Veprintsev, D.B.'      5 
primary 'Evans, P.R.'           6 
primary 'McMahon, H.T.'         7 
# 
_cell.entry_id           4I1Q 
_cell.length_a           79.147 
_cell.length_b           81.278 
_cell.length_c           81.101 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4I1Q 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Bridging integrator 2' 26063.312 2  ? ? 'N-BAR domain, UNP residues 20-238' ? 
2 water   nat water                   18.015    62 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Breast cancer-associated protein 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSKFSRAQEKVLQKLGKAVETKDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHE
ELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEF
NKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSKFSRAQEKVLQKLGKAVETKDERFEQSANNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHE
ELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEF
NKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   PHE n 
1 5   SER n 
1 6   ARG n 
1 7   ALA n 
1 8   GLN n 
1 9   GLU n 
1 10  LYS n 
1 11  VAL n 
1 12  LEU n 
1 13  GLN n 
1 14  LYS n 
1 15  LEU n 
1 16  GLY n 
1 17  LYS n 
1 18  ALA n 
1 19  VAL n 
1 20  GLU n 
1 21  THR n 
1 22  LYS n 
1 23  ASP n 
1 24  GLU n 
1 25  ARG n 
1 26  PHE n 
1 27  GLU n 
1 28  GLN n 
1 29  SER n 
1 30  ALA n 
1 31  ASN n 
1 32  ASN n 
1 33  PHE n 
1 34  TYR n 
1 35  GLN n 
1 36  GLN n 
1 37  GLN n 
1 38  ALA n 
1 39  GLU n 
1 40  GLY n 
1 41  HIS n 
1 42  LYS n 
1 43  LEU n 
1 44  TYR n 
1 45  LYS n 
1 46  ASP n 
1 47  LEU n 
1 48  LYS n 
1 49  ASN n 
1 50  PHE n 
1 51  LEU n 
1 52  SER n 
1 53  ALA n 
1 54  VAL n 
1 55  LYS n 
1 56  VAL n 
1 57  MET n 
1 58  HIS n 
1 59  GLU n 
1 60  SER n 
1 61  SER n 
1 62  LYS n 
1 63  ARG n 
1 64  VAL n 
1 65  SER n 
1 66  GLU n 
1 67  THR n 
1 68  LEU n 
1 69  GLN n 
1 70  GLU n 
1 71  ILE n 
1 72  TYR n 
1 73  SER n 
1 74  SER n 
1 75  GLU n 
1 76  TRP n 
1 77  ASP n 
1 78  GLY n 
1 79  HIS n 
1 80  GLU n 
1 81  GLU n 
1 82  LEU n 
1 83  LYS n 
1 84  ALA n 
1 85  ILE n 
1 86  VAL n 
1 87  TRP n 
1 88  ASN n 
1 89  ASN n 
1 90  ASP n 
1 91  LEU n 
1 92  LEU n 
1 93  TRP n 
1 94  GLU n 
1 95  ASP n 
1 96  TYR n 
1 97  GLU n 
1 98  GLU n 
1 99  LYS n 
1 100 LEU n 
1 101 ALA n 
1 102 ASP n 
1 103 GLN n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 THR n 
1 108 MET n 
1 109 GLU n 
1 110 ILE n 
1 111 TYR n 
1 112 VAL n 
1 113 ALA n 
1 114 GLN n 
1 115 PHE n 
1 116 SER n 
1 117 GLU n 
1 118 ILE n 
1 119 LYS n 
1 120 GLU n 
1 121 ARG n 
1 122 ILE n 
1 123 ALA n 
1 124 LYS n 
1 125 ARG n 
1 126 GLY n 
1 127 ARG n 
1 128 LYS n 
1 129 LEU n 
1 130 VAL n 
1 131 ASP n 
1 132 TYR n 
1 133 ASP n 
1 134 SER n 
1 135 ALA n 
1 136 ARG n 
1 137 HIS n 
1 138 HIS n 
1 139 LEU n 
1 140 GLU n 
1 141 ALA n 
1 142 VAL n 
1 143 GLN n 
1 144 ASN n 
1 145 ALA n 
1 146 LYS n 
1 147 LYS n 
1 148 LYS n 
1 149 ASP n 
1 150 GLU n 
1 151 ALA n 
1 152 LYS n 
1 153 THR n 
1 154 ALA n 
1 155 LYS n 
1 156 ALA n 
1 157 GLU n 
1 158 GLU n 
1 159 GLU n 
1 160 PHE n 
1 161 ASN n 
1 162 LYS n 
1 163 ALA n 
1 164 GLN n 
1 165 THR n 
1 166 VAL n 
1 167 PHE n 
1 168 GLU n 
1 169 ASP n 
1 170 LEU n 
1 171 ASN n 
1 172 GLN n 
1 173 GLU n 
1 174 LEU n 
1 175 LEU n 
1 176 GLU n 
1 177 GLU n 
1 178 LEU n 
1 179 PRO n 
1 180 ILE n 
1 181 LEU n 
1 182 TYR n 
1 183 ASN n 
1 184 SER n 
1 185 ARG n 
1 186 ILE n 
1 187 GLY n 
1 188 CYS n 
1 189 TYR n 
1 190 VAL n 
1 191 THR n 
1 192 ILE n 
1 193 PHE n 
1 194 GLN n 
1 195 ASN n 
1 196 ILE n 
1 197 SER n 
1 198 ASN n 
1 199 LEU n 
1 200 ARG n 
1 201 ASP n 
1 202 VAL n 
1 203 PHE n 
1 204 TYR n 
1 205 ARG n 
1 206 GLU n 
1 207 MET n 
1 208 SER n 
1 209 LYS n 
1 210 LEU n 
1 211 ASN n 
1 212 HIS n 
1 213 ASN n 
1 214 LEU n 
1 215 TYR n 
1 216 GLU n 
1 217 VAL n 
1 218 MET n 
1 219 SER n 
1 220 LYS n 
1 221 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BIN2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Dh5alpha 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-4T-2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BIN2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UBW5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEEL
KAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNK
AQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKL
;
_struct_ref.pdbx_align_begin           20 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4I1Q A 3 ? 221 ? Q9UBW5 20 ? 238 ? 20 238 
2 1 4I1Q B 3 ? 221 ? Q9UBW5 20 ? 238 ? 20 238 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4I1Q GLY A 1  ? UNP Q9UBW5 ?   ?  'EXPRESSION TAG' 18 1 
1 4I1Q SER A 2  ? UNP Q9UBW5 ?   ?  'EXPRESSION TAG' 19 2 
1 4I1Q ASN A 31 ? UNP Q9UBW5 SER 48 'SEE REMARK 999' 48 3 
2 4I1Q GLY B 1  ? UNP Q9UBW5 ?   ?  'EXPRESSION TAG' 18 4 
2 4I1Q SER B 2  ? UNP Q9UBW5 ?   ?  'EXPRESSION TAG' 19 5 
2 4I1Q ASN B 31 ? UNP Q9UBW5 SER 48 'SEE REMARK 999' 48 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4I1Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_percent_sol   50.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.3 
_exptl_crystal_grow.pdbx_details    
'10% MPD, 7% PEG 4000, 0.1M sodium citrate, pH 5.3, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
3 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' 2006-10-07 ? 
2 CCD 'ADSC QUANTUM 4' 2006-10-07 ? 
3 CCD 'ADSC QUANTUM 4' 2006-10-07 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'liquid nitrogen cooled channel-cut silicon monochromator' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'liquid nitrogen cooled channel-cut silicon monochromator' MAD                 x-ray 
3 1 M 'liquid nitrogen cooled channel-cut silicon monochromator' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9791 1.0 
2 0.9792 1.0 
3 0.9756 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ESRF BEAMLINE ID29' ESRF ID29 ? 0.9791                   
2 SYNCHROTRON 'ESRF BEAMLINE ID29' ESRF ID29 ? '0.9791, 0.9792, 0.9756' 
3 SYNCHROTRON 'ESRF BEAMLINE ID29' ESRF ID29 ? 0.9791                   
# 
_reflns.entry_id                     4I1Q 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             57.41 
_reflns.d_resolution_high            2.53 
_reflns.number_obs                   15899 
_reflns.number_all                   15899 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.9 
_reflns.B_iso_Wilson_estimate        59.298 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high                  2.53 
_reflns_shell.d_res_low                   2.73 
_reflns_shell.percent_possible_all        96.5 
_reflns_shell.Rmerge_I_obs                0.386 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.9 
_reflns_shell.pdbx_redundancy             4.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           2323 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1,2 
# 
_refine.entry_id                                 4I1Q 
_refine.ls_number_reflns_obs                     14986 
_refine.ls_number_reflns_all                     14986 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             57.41 
_refine.ls_d_res_high                            2.53 
_refine.ls_percent_reflns_obs                    87.61 
_refine.ls_R_factor_obs                          0.19891 
_refine.ls_R_factor_all                          0.19891 
_refine.ls_R_factor_R_work                       0.19587 
_refine.ls_R_factor_R_free                       0.25220 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  860 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               59.786 
_refine.aniso_B[1][1]                            8.91 
_refine.aniso_B[2][2]                            -5.93 
_refine.aniso_B[3][3]                            -2.98 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.173 
_refine.pdbx_overall_ESU_R_Free                  0.068 
_refine.overall_SU_ML                            0.198 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             8.582 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3331 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             62 
_refine_hist.number_atoms_total               3393 
_refine_hist.d_res_high                       2.53 
_refine_hist.d_res_low                        57.41 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.014  0.019  ? 3391 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.741  1.942  ? 4558 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 6.556  5.000  ? 396  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 42.621 25.179 ? 195  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 21.409 15.000 ? 655  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 21.222 15.000 ? 20   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.114  0.200  ? 480  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.006  0.020  ? 2588 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 'interatomic distance' A 244 0.250 0.050 ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 'interatomic distance' B 244 0.250 0.050 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.528 
_refine_ls_shell.d_res_low                        2.594 
_refine_ls_shell.number_reflns_R_work             71 
_refine_ls_shell.R_factor_R_work                  0.229 
_refine_ls_shell.percent_reflns_obs               5.95 
_refine_ls_shell.R_factor_R_free                  0.238 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             7 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                71 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 0 0 A 41 A 237 ? . . . . . . . . 
1 2 0 0 B 41 B 237 ? . . . . . . . . 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4I1Q 
_struct.title                     'Crystal Structure of hBRAP1 N-BAR domain' 
_struct.pdbx_descriptor           'Bridging integrator 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4I1Q 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'N-BAR MEMBRANE BINDING DOMAIN, PIX and Endophilin A2, CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 24  ? TYR A 72  ? GLU A 41  TYR A 89  1 ? 49 
HELX_P HELX_P2  2  GLY A 78  ? ALA A 104 ? GLY A 95  ALA A 121 1 ? 27 
HELX_P HELX_P3  3  ALA A 104 ? ALA A 113 ? ALA A 121 ALA A 130 1 ? 10 
HELX_P HELX_P4  4  GLN A 114 ? ASN A 144 ? GLN A 131 ASN A 161 1 ? 31 
HELX_P HELX_P5  5  ALA A 154 ? SER A 184 ? ALA A 171 SER A 201 1 ? 31 
HELX_P HELX_P6  6  SER A 184 ? SER A 219 ? SER A 201 SER A 236 1 ? 36 
HELX_P HELX_P7  7  ARG B 25  ? TYR B 72  ? ARG B 42  TYR B 89  1 ? 48 
HELX_P HELX_P8  8  GLY B 78  ? ALA B 104 ? GLY B 95  ALA B 121 1 ? 27 
HELX_P HELX_P9  9  ALA B 104 ? HIS B 138 ? ALA B 121 HIS B 155 1 ? 35 
HELX_P HELX_P10 10 THR B 153 ? SER B 184 ? THR B 170 SER B 201 1 ? 32 
HELX_P HELX_P11 11 SER B 184 ? LYS B 220 ? SER B 201 LYS B 237 1 ? 37 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          4I1Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4I1Q 
_atom_sites.fract_transf_matrix[1][1]   0.012635 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012303 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012330 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 22  ? -32.122 38.381  -4.153  1.00 76.47  ? 39  LYS A N   1 
ATOM   2    C CA  . LYS A 1 22  ? -33.258 38.865  -3.292  1.00 82.56  ? 39  LYS A CA  1 
ATOM   3    C C   . LYS A 1 22  ? -33.446 37.902  -2.058  1.00 81.31  ? 39  LYS A C   1 
ATOM   4    O O   . LYS A 1 22  ? -33.227 38.288  -0.886  1.00 59.88  ? 39  LYS A O   1 
ATOM   5    C CB  . LYS A 1 22  ? -34.543 39.046  -4.173  1.00 70.82  ? 39  LYS A CB  1 
ATOM   6    C CG  . LYS A 1 22  ? -35.628 40.028  -3.676  1.00 61.20  ? 39  LYS A CG  1 
ATOM   7    C CD  . LYS A 1 22  ? -35.624 41.379  -4.440  1.00 52.88  ? 39  LYS A CD  1 
ATOM   8    C CE  . LYS A 1 22  ? -34.550 42.373  -3.914  1.00 55.75  ? 39  LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 22  ? -33.857 43.326  -4.884  1.00 57.85  ? 39  LYS A NZ  1 
ATOM   10   N N   . ASP A 1 23  ? -33.890 36.676  -2.348  1.00 80.51  ? 40  ASP A N   1 
ATOM   11   C CA  . ASP A 1 23  ? -33.789 35.572  -1.426  1.00 89.09  ? 40  ASP A CA  1 
ATOM   12   C C   . ASP A 1 23  ? -32.498 34.890  -1.852  1.00 94.37  ? 40  ASP A C   1 
ATOM   13   O O   . ASP A 1 23  ? -32.385 33.665  -1.808  1.00 98.02  ? 40  ASP A O   1 
ATOM   14   C CB  . ASP A 1 23  ? -35.009 34.606  -1.481  1.00 103.94 ? 40  ASP A CB  1 
ATOM   15   C CG  . ASP A 1 23  ? -35.783 34.635  -2.830  1.00 111.34 ? 40  ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 23  ? -36.515 35.623  -3.078  1.00 111.03 ? 40  ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 23  ? -35.715 33.648  -3.610  1.00 99.87  ? 40  ASP A OD2 1 
ATOM   18   N N   . GLU A 1 24  ? -31.538 35.717  -2.282  1.00 87.95  ? 41  GLU A N   1 
ATOM   19   C CA  . GLU A 1 24  ? -30.279 35.263  -2.894  1.00 86.01  ? 41  GLU A CA  1 
ATOM   20   C C   . GLU A 1 24  ? -29.063 36.026  -2.295  1.00 81.42  ? 41  GLU A C   1 
ATOM   21   O O   . GLU A 1 24  ? -27.936 35.529  -2.275  1.00 80.09  ? 41  GLU A O   1 
ATOM   22   C CB  . GLU A 1 24  ? -30.361 35.356  -4.438  1.00 85.18  ? 41  GLU A CB  1 
ATOM   23   C CG  . GLU A 1 24  ? -31.787 35.605  -4.980  1.00 100.51 ? 41  GLU A CG  1 
ATOM   24   C CD  . GLU A 1 24  ? -32.238 34.729  -6.159  1.00 102.04 ? 41  GLU A CD  1 
ATOM   25   O OE1 . GLU A 1 24  ? -31.455 33.895  -6.667  1.00 97.92  ? 41  GLU A OE1 1 
ATOM   26   O OE2 . GLU A 1 24  ? -33.411 34.873  -6.580  1.00 99.15  ? 41  GLU A OE2 1 
ATOM   27   N N   . ARG A 1 25  ? -29.311 37.240  -1.812  1.00 72.31  ? 42  ARG A N   1 
ATOM   28   C CA  . ARG A 1 25  ? -28.449 37.877  -0.829  1.00 68.30  ? 42  ARG A CA  1 
ATOM   29   C C   . ARG A 1 25  ? -28.707 37.113  0.483   1.00 68.63  ? 42  ARG A C   1 
ATOM   30   O O   . ARG A 1 25  ? -27.788 36.820  1.293   1.00 61.68  ? 42  ARG A O   1 
ATOM   31   C CB  . ARG A 1 25  ? -28.858 39.338  -0.666  1.00 74.38  ? 42  ARG A CB  1 
ATOM   32   C CG  . ARG A 1 25  ? -29.115 40.051  -1.981  1.00 76.31  ? 42  ARG A CG  1 
ATOM   33   C CD  . ARG A 1 25  ? -30.473 40.752  -1.992  1.00 75.27  ? 42  ARG A CD  1 
ATOM   34   N NE  . ARG A 1 25  ? -30.445 42.099  -1.417  1.00 69.71  ? 42  ARG A NE  1 
ATOM   35   C CZ  . ARG A 1 25  ? -31.533 42.801  -1.099  1.00 65.78  ? 42  ARG A CZ  1 
ATOM   36   N NH1 . ARG A 1 25  ? -32.743 42.286  -1.293  1.00 71.75  ? 42  ARG A NH1 1 
ATOM   37   N NH2 . ARG A 1 25  ? -31.417 44.014  -0.561  1.00 59.22  ? 42  ARG A NH2 1 
ATOM   38   N N   . PHE A 1 26  ? -29.985 36.791  0.673   1.00 61.03  ? 43  PHE A N   1 
ATOM   39   C CA  . PHE A 1 26  ? -30.395 35.942  1.751   1.00 56.05  ? 43  PHE A CA  1 
ATOM   40   C C   . PHE A 1 26  ? -29.656 34.615  1.789   1.00 57.65  ? 43  PHE A C   1 
ATOM   41   O O   . PHE A 1 26  ? -29.180 34.253  2.834   1.00 63.79  ? 43  PHE A O   1 
ATOM   42   C CB  . PHE A 1 26  ? -31.871 35.661  1.718   1.00 50.43  ? 43  PHE A CB  1 
ATOM   43   C CG  . PHE A 1 26  ? -32.307 34.775  2.841   1.00 49.91  ? 43  PHE A CG  1 
ATOM   44   C CD1 . PHE A 1 26  ? -32.439 35.289  4.126   1.00 44.07  ? 43  PHE A CD1 1 
ATOM   45   C CD2 . PHE A 1 26  ? -32.528 33.410  2.626   1.00 48.96  ? 43  PHE A CD2 1 
ATOM   46   C CE1 . PHE A 1 26  ? -32.811 34.465  5.177   1.00 48.42  ? 43  PHE A CE1 1 
ATOM   47   C CE2 . PHE A 1 26  ? -32.896 32.581  3.672   1.00 45.85  ? 43  PHE A CE2 1 
ATOM   48   C CZ  . PHE A 1 26  ? -33.039 33.108  4.945   1.00 51.03  ? 43  PHE A CZ  1 
ATOM   49   N N   . GLU A 1 27  ? -29.596 33.891  0.679   1.00 56.18  ? 44  GLU A N   1 
ATOM   50   C CA  . GLU A 1 27  ? -28.906 32.614  0.642   1.00 62.74  ? 44  GLU A CA  1 
ATOM   51   C C   . GLU A 1 27  ? -27.455 32.729  1.064   1.00 61.93  ? 44  GLU A C   1 
ATOM   52   O O   . GLU A 1 27  ? -26.983 31.929  1.853   1.00 70.55  ? 44  GLU A O   1 
ATOM   53   C CB  . GLU A 1 27  ? -28.965 31.976  -0.746  1.00 67.96  ? 44  GLU A CB  1 
ATOM   54   C CG  . GLU A 1 27  ? -30.364 31.720  -1.297  1.00 77.66  ? 44  GLU A CG  1 
ATOM   55   C CD  . GLU A 1 27  ? -31.325 30.986  -0.361  1.00 85.81  ? 44  GLU A CD  1 
ATOM   56   O OE1 . GLU A 1 27  ? -31.014 30.755  0.833   1.00 86.49  ? 44  GLU A OE1 1 
ATOM   57   O OE2 . GLU A 1 27  ? -32.430 30.636  -0.842  1.00 90.64  ? 44  GLU A OE2 1 
ATOM   58   N N   . GLN A 1 28  ? -26.753 33.720  0.530   1.00 61.81  ? 45  GLN A N   1 
ATOM   59   C CA  . GLN A 1 28  ? -25.351 33.942  0.862   1.00 59.70  ? 45  GLN A CA  1 
ATOM   60   C C   . GLN A 1 28  ? -25.215 34.332  2.342   1.00 56.08  ? 45  GLN A C   1 
ATOM   61   O O   . GLN A 1 28  ? -24.368 33.809  3.057   1.00 59.92  ? 45  GLN A O   1 
ATOM   62   C CB  . GLN A 1 28  ? -24.735 34.987  -0.078  1.00 59.29  ? 45  GLN A CB  1 
ATOM   63   C CG  . GLN A 1 28  ? -23.267 35.306  0.178   1.00 64.60  ? 45  GLN A CG  1 
ATOM   64   C CD  . GLN A 1 28  ? -22.307 34.198  -0.258  1.00 72.78  ? 45  GLN A CD  1 
ATOM   65   O OE1 . GLN A 1 28  ? -21.607 33.598  0.569   1.00 68.14  ? 45  GLN A OE1 1 
ATOM   66   N NE2 . GLN A 1 28  ? -22.260 33.931  -1.563  1.00 74.01  ? 45  GLN A NE2 1 
ATOM   67   N N   . SER A 1 29  ? -26.084 35.205  2.823   1.00 54.52  ? 46  SER A N   1 
ATOM   68   C CA  . SER A 1 29  ? -26.065 35.524  4.244   1.00 49.74  ? 46  SER A CA  1 
ATOM   69   C C   . SER A 1 29  ? -26.398 34.360  5.174   1.00 47.51  ? 46  SER A C   1 
ATOM   70   O O   . SER A 1 29  ? -25.850 34.271  6.256   1.00 48.68  ? 46  SER A O   1 
ATOM   71   C CB  . SER A 1 29  ? -26.953 36.729  4.522   1.00 55.29  ? 46  SER A CB  1 
ATOM   72   O OG  . SER A 1 29  ? -26.176 37.907  4.363   1.00 53.84  ? 46  SER A OG  1 
ATOM   73   N N   . ALA A 1 30  ? -27.285 33.470  4.734   1.00 47.29  ? 47  ALA A N   1 
ATOM   74   C CA  . ALA A 1 30  ? -27.662 32.231  5.428   1.00 45.63  ? 47  ALA A CA  1 
ATOM   75   C C   . ALA A 1 30  ? -26.537 31.175  5.395   1.00 48.29  ? 47  ALA A C   1 
ATOM   76   O O   . ALA A 1 30  ? -26.307 30.497  6.377   1.00 51.25  ? 47  ALA A O   1 
ATOM   77   C CB  . ALA A 1 30  ? -28.936 31.663  4.816   1.00 41.58  ? 47  ALA A CB  1 
ATOM   78   N N   . ASN A 1 31  ? -25.863 31.037  4.260   1.00 49.35  ? 48  ASN A N   1 
ATOM   79   C CA  . ASN A 1 31  ? -24.620 30.269  4.137   1.00 56.44  ? 48  ASN A CA  1 
ATOM   80   C C   . ASN A 1 31  ? -23.612 30.685  5.195   1.00 52.17  ? 48  ASN A C   1 
ATOM   81   O O   . ASN A 1 31  ? -23.146 29.869  5.984   1.00 52.23  ? 48  ASN A O   1 
ATOM   82   C CB  . ASN A 1 31  ? -23.946 30.600  2.801   1.00 61.98  ? 48  ASN A CB  1 
ATOM   83   C CG  . ASN A 1 31  ? -24.346 29.684  1.693   1.00 73.07  ? 48  ASN A CG  1 
ATOM   84   O OD1 . ASN A 1 31  ? -23.806 28.585  1.584   1.00 87.24  ? 48  ASN A OD1 1 
ATOM   85   N ND2 . ASN A 1 31  ? -25.247 30.148  0.811   1.00 81.53  ? 48  ASN A ND2 1 
ATOM   86   N N   . ASN A 1 32  ? -23.240 31.968  5.125   1.00 44.38  ? 49  ASN A N   1 
ATOM   87   C CA  . ASN A 1 32  ? -22.311 32.587  6.030   1.00 39.16  ? 49  ASN A CA  1 
ATOM   88   C C   . ASN A 1 32  ? -22.664 32.225  7.464   1.00 39.53  ? 49  ASN A C   1 
ATOM   89   O O   . ASN A 1 32  ? -21.796 31.776  8.220   1.00 40.01  ? 49  ASN A O   1 
ATOM   90   C CB  . ASN A 1 32  ? -22.326 34.114  5.849   1.00 34.12  ? 49  ASN A CB  1 
ATOM   91   C CG  . ASN A 1 32  ? -21.630 34.575  4.561   1.00 36.74  ? 49  ASN A CG  1 
ATOM   92   O OD1 . ASN A 1 32  ? -21.582 35.791  4.268   1.00 43.44  ? 49  ASN A OD1 1 
ATOM   93   N ND2 . ASN A 1 32  ? -21.073 33.639  3.800   1.00 31.70  ? 49  ASN A ND2 1 
ATOM   94   N N   . PHE A 1 33  ? -23.927 32.424  7.832   1.00 33.24  ? 50  PHE A N   1 
ATOM   95   C CA  . PHE A 1 33  ? -24.354 32.145  9.184   1.00 40.23  ? 50  PHE A CA  1 
ATOM   96   C C   . PHE A 1 33  ? -24.179 30.685  9.533   1.00 44.99  ? 50  PHE A C   1 
ATOM   97   O O   . PHE A 1 33  ? -23.893 30.355  10.674  1.00 49.31  ? 50  PHE A O   1 
ATOM   98   C CB  . PHE A 1 33  ? -25.811 32.492  9.400   1.00 36.29  ? 50  PHE A CB  1 
ATOM   99   C CG  . PHE A 1 33  ? -26.342 32.015  10.699  1.00 36.18  ? 50  PHE A CG  1 
ATOM   100  C CD1 . PHE A 1 33  ? -25.887 32.559  11.884  1.00 37.98  ? 50  PHE A CD1 1 
ATOM   101  C CD2 . PHE A 1 33  ? -27.308 31.007  10.751  1.00 43.17  ? 50  PHE A CD2 1 
ATOM   102  C CE1 . PHE A 1 33  ? -26.362 32.116  13.109  1.00 37.38  ? 50  PHE A CE1 1 
ATOM   103  C CE2 . PHE A 1 33  ? -27.795 30.545  11.971  1.00 39.92  ? 50  PHE A CE2 1 
ATOM   104  C CZ  . PHE A 1 33  ? -27.330 31.114  13.156  1.00 40.88  ? 50  PHE A CZ  1 
ATOM   105  N N   . TYR A 1 34  ? -24.377 29.798  8.572   1.00 46.48  ? 51  TYR A N   1 
ATOM   106  C CA  . TYR A 1 34  ? -24.311 28.389  8.909   1.00 47.86  ? 51  TYR A CA  1 
ATOM   107  C C   . TYR A 1 34  ? -22.891 27.989  9.105   1.00 43.30  ? 51  TYR A C   1 
ATOM   108  O O   . TYR A 1 34  ? -22.622 27.171  9.994   1.00 43.11  ? 51  TYR A O   1 
ATOM   109  C CB  . TYR A 1 34  ? -25.103 27.472  7.944   1.00 56.20  ? 51  TYR A CB  1 
ATOM   110  C CG  . TYR A 1 34  ? -26.598 27.550  8.232   1.00 62.16  ? 51  TYR A CG  1 
ATOM   111  C CD1 . TYR A 1 34  ? -27.114 27.141  9.471   1.00 63.77  ? 51  TYR A CD1 1 
ATOM   112  C CD2 . TYR A 1 34  ? -27.494 28.079  7.290   1.00 70.30  ? 51  TYR A CD2 1 
ATOM   113  C CE1 . TYR A 1 34  ? -28.478 27.229  9.744   1.00 71.44  ? 51  TYR A CE1 1 
ATOM   114  C CE2 . TYR A 1 34  ? -28.861 28.181  7.562   1.00 73.91  ? 51  TYR A CE2 1 
ATOM   115  C CZ  . TYR A 1 34  ? -29.341 27.751  8.791   1.00 70.01  ? 51  TYR A CZ  1 
ATOM   116  O OH  . TYR A 1 34  ? -30.677 27.844  9.064   1.00 77.93  ? 51  TYR A OH  1 
ATOM   117  N N   . GLN A 1 35  ? -21.980 28.610  8.345   1.00 38.80  ? 52  GLN A N   1 
ATOM   118  C CA  . GLN A 1 35  ? -20.576 28.416  8.608   1.00 40.65  ? 52  GLN A CA  1 
ATOM   119  C C   . GLN A 1 35  ? -20.188 28.933  10.024  1.00 41.03  ? 52  GLN A C   1 
ATOM   120  O O   . GLN A 1 35  ? -19.541 28.205  10.804  1.00 50.14  ? 52  GLN A O   1 
ATOM   121  C CB  . GLN A 1 35  ? -19.675 28.907  7.475   1.00 43.97  ? 52  GLN A CB  1 
ATOM   122  C CG  . GLN A 1 35  ? -19.404 30.401  7.475   1.00 66.24  ? 52  GLN A CG  1 
ATOM   123  C CD  . GLN A 1 35  ? -17.914 30.756  7.419   1.00 78.21  ? 52  GLN A CD  1 
ATOM   124  O OE1 . GLN A 1 35  ? -17.052 29.909  7.662   1.00 75.97  ? 52  GLN A OE1 1 
ATOM   125  N NE2 . GLN A 1 35  ? -17.609 32.023  7.111   1.00 74.76  ? 52  GLN A NE2 1 
ATOM   126  N N   . GLN A 1 36  ? -20.646 30.125  10.381  1.00 37.84  ? 53  GLN A N   1 
ATOM   127  C CA  . GLN A 1 36  ? -20.316 30.777  11.667  1.00 41.15  ? 53  GLN A CA  1 
ATOM   128  C C   . GLN A 1 36  ? -20.807 29.986  12.885  1.00 46.84  ? 53  GLN A C   1 
ATOM   129  O O   . GLN A 1 36  ? -20.023 29.687  13.796  1.00 49.03  ? 53  GLN A O   1 
ATOM   130  C CB  . GLN A 1 36  ? -20.891 32.209  11.698  1.00 40.07  ? 53  GLN A CB  1 
ATOM   131  C CG  . GLN A 1 36  ? -20.930 32.822  13.072  1.00 41.94  ? 53  GLN A CG  1 
ATOM   132  C CD  . GLN A 1 36  ? -21.715 34.115  13.141  1.00 46.15  ? 53  GLN A CD  1 
ATOM   133  O OE1 . GLN A 1 36  ? -22.791 34.234  12.573  1.00 47.62  ? 53  GLN A OE1 1 
ATOM   134  N NE2 . GLN A 1 36  ? -21.170 35.105  13.859  1.00 55.98  ? 53  GLN A NE2 1 
ATOM   135  N N   . GLN A 1 37  ? -22.108 29.658  12.889  1.00 49.32  ? 54  GLN A N   1 
ATOM   136  C CA  . GLN A 1 37  ? -22.715 28.735  13.854  1.00 48.16  ? 54  GLN A CA  1 
ATOM   137  C C   . GLN A 1 37  ? -22.020 27.370  14.023  1.00 43.36  ? 54  GLN A C   1 
ATOM   138  O O   . GLN A 1 37  ? -21.796 26.922  15.158  1.00 46.80  ? 54  GLN A O   1 
ATOM   139  C CB  . GLN A 1 37  ? -24.210 28.564  13.569  1.00 54.24  ? 54  GLN A CB  1 
ATOM   140  C CG  . GLN A 1 37  ? -24.545 27.822  12.289  1.00 61.95  ? 54  GLN A CG  1 
ATOM   141  C CD  . GLN A 1 37  ? -24.845 26.361  12.530  1.00 63.97  ? 54  GLN A CD  1 
ATOM   142  O OE1 . GLN A 1 37  ? -25.587 26.025  13.461  1.00 60.27  ? 54  GLN A OE1 1 
ATOM   143  N NE2 . GLN A 1 37  ? -24.275 25.478  11.688  1.00 55.33  ? 54  GLN A NE2 1 
ATOM   144  N N   . ALA A 1 38  ? -21.686 26.703  12.923  1.00 41.35  ? 55  ALA A N   1 
ATOM   145  C CA  . ALA A 1 38  ? -20.921 25.416  13.006  1.00 39.02  ? 55  ALA A CA  1 
ATOM   146  C C   . ALA A 1 38  ? -19.542 25.676  13.551  1.00 36.49  ? 55  ALA A C   1 
ATOM   147  O O   . ALA A 1 38  ? -19.046 24.861  14.313  1.00 37.70  ? 55  ALA A O   1 
ATOM   148  C CB  . ALA A 1 38  ? -20.837 24.681  11.661  1.00 31.46  ? 55  ALA A CB  1 
ATOM   149  N N   . GLU A 1 39  ? -18.931 26.815  13.165  1.00 37.88  ? 56  GLU A N   1 
ATOM   150  C CA  . GLU A 1 39  ? -17.613 27.247  13.718  1.00 37.90  ? 56  GLU A CA  1 
ATOM   151  C C   . GLU A 1 39  ? -17.585 27.469  15.230  1.00 34.40  ? 56  GLU A C   1 
ATOM   152  O O   . GLU A 1 39  ? -16.694 26.977  15.954  1.00 39.22  ? 56  GLU A O   1 
ATOM   153  C CB  . GLU A 1 39  ? -17.171 28.551  13.081  1.00 42.61  ? 56  GLU A CB  1 
ATOM   154  C CG  . GLU A 1 39  ? -16.107 28.367  12.043  1.00 47.22  ? 56  GLU A CG  1 
ATOM   155  C CD  . GLU A 1 39  ? -15.760 29.658  11.353  1.00 51.89  ? 56  GLU A CD  1 
ATOM   156  O OE1 . GLU A 1 39  ? -15.866 30.748  11.959  1.00 48.73  ? 56  GLU A OE1 1 
ATOM   157  O OE2 . GLU A 1 39  ? -15.340 29.560  10.187  1.00 62.90  ? 56  GLU A OE2 1 
ATOM   158  N N   . GLY A 1 40  ? -18.562 28.233  15.691  1.00 30.73  ? 57  GLY A N   1 
ATOM   159  C CA  . GLY A 1 40  ? -18.672 28.558  17.082  1.00 31.72  ? 57  GLY A CA  1 
ATOM   160  C C   . GLY A 1 40  ? -18.941 27.326  17.888  1.00 29.65  ? 57  GLY A C   1 
ATOM   161  O O   . GLY A 1 40  ? -18.326 27.157  18.926  1.00 29.98  ? 57  GLY A O   1 
ATOM   162  N N   . HIS A 1 41  ? -19.862 26.476  17.424  1.00 30.84  ? 58  HIS A N   1 
ATOM   163  C CA  . HIS A 1 41  ? -20.170 25.206  18.114  1.00 32.75  ? 58  HIS A CA  1 
ATOM   164  C C   . HIS A 1 41  ? -18.873 24.397  18.324  1.00 34.99  ? 58  HIS A C   1 
ATOM   165  O O   . HIS A 1 41  ? -18.461 24.091  19.473  1.00 38.77  ? 58  HIS A O   1 
ATOM   166  C CB  . HIS A 1 41  ? -21.232 24.390  17.382  1.00 32.42  ? 58  HIS A CB  1 
ATOM   167  C CG  . HIS A 1 41  ? -21.571 23.125  18.090  1.00 37.11  ? 58  HIS A CG  1 
ATOM   168  N ND1 . HIS A 1 41  ? -21.064 21.895  17.704  1.00 37.79  ? 58  HIS A ND1 1 
ATOM   169  C CD2 . HIS A 1 41  ? -22.276 22.905  19.229  1.00 38.13  ? 58  HIS A CD2 1 
ATOM   170  C CE1 . HIS A 1 41  ? -21.475 20.970  18.558  1.00 41.53  ? 58  HIS A CE1 1 
ATOM   171  N NE2 . HIS A 1 41  ? -22.204 21.559  19.498  1.00 40.15  ? 58  HIS A NE2 1 
ATOM   172  N N   . LYS A 1 42  ? -18.194 24.116  17.224  1.00 31.56  ? 59  LYS A N   1 
ATOM   173  C CA  . LYS A 1 42  ? -16.884 23.482  17.283  1.00 33.58  ? 59  LYS A CA  1 
ATOM   174  C C   . LYS A 1 42  ? -15.833 24.168  18.214  1.00 33.27  ? 59  LYS A C   1 
ATOM   175  O O   . LYS A 1 42  ? -15.238 23.488  19.082  1.00 35.59  ? 59  LYS A O   1 
ATOM   176  C CB  . LYS A 1 42  ? -16.356 23.345  15.860  1.00 34.20  ? 59  LYS A CB  1 
ATOM   177  C CG  . LYS A 1 42  ? -15.000 22.710  15.772  1.00 34.20  ? 59  LYS A CG  1 
ATOM   178  C CD  . LYS A 1 42  ? -14.673 22.402  14.328  1.00 35.70  ? 59  LYS A CD  1 
ATOM   179  C CE  . LYS A 1 42  ? -13.516 21.422  14.320  1.00 38.45  ? 59  LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 42  ? -12.645 21.607  13.129  1.00 45.48  ? 59  LYS A NZ  1 
ATOM   181  N N   . LEU A 1 43  ? -15.566 25.472  18.042  1.00 32.53  ? 60  LEU A N   1 
ATOM   182  C CA  . LEU A 1 43  ? -14.559 26.174  18.928  1.00 31.11  ? 60  LEU A CA  1 
ATOM   183  C C   . LEU A 1 43  ? -14.997 26.060  20.392  1.00 34.22  ? 60  LEU A C   1 
ATOM   184  O O   . LEU A 1 43  ? -14.215 25.826  21.312  1.00 38.82  ? 60  LEU A O   1 
ATOM   185  C CB  . LEU A 1 43  ? -14.404 27.658  18.566  1.00 28.27  ? 60  LEU A CB  1 
ATOM   186  C CG  . LEU A 1 43  ? -13.304 28.410  19.359  1.00 31.76  ? 60  LEU A CG  1 
ATOM   187  C CD1 . LEU A 1 43  ? -11.968 27.657  19.372  1.00 28.28  ? 60  LEU A CD1 1 
ATOM   188  C CD2 . LEU A 1 43  ? -13.064 29.873  18.894  1.00 27.10  ? 60  LEU A CD2 1 
ATOM   189  N N   . TYR A 1 44  ? -16.290 26.189  20.583  1.00 32.11  ? 61  TYR A N   1 
ATOM   190  C CA  . TYR A 1 44  ? -16.873 26.121  21.879  1.00 36.26  ? 61  TYR A CA  1 
ATOM   191  C C   . TYR A 1 44  ? -16.537 24.738  22.460  1.00 35.42  ? 61  TYR A C   1 
ATOM   192  O O   . TYR A 1 44  ? -16.055 24.640  23.586  1.00 36.83  ? 61  TYR A O   1 
ATOM   193  C CB  . TYR A 1 44  ? -18.394 26.393  21.750  1.00 36.70  ? 61  TYR A CB  1 
ATOM   194  C CG  . TYR A 1 44  ? -19.214 25.751  22.815  1.00 34.28  ? 61  TYR A CG  1 
ATOM   195  C CD1 . TYR A 1 44  ? -18.999 26.052  24.157  1.00 34.15  ? 61  TYR A CD1 1 
ATOM   196  C CD2 . TYR A 1 44  ? -20.170 24.809  22.486  1.00 37.00  ? 61  TYR A CD2 1 
ATOM   197  C CE1 . TYR A 1 44  ? -19.727 25.418  25.159  1.00 36.17  ? 61  TYR A CE1 1 
ATOM   198  C CE2 . TYR A 1 44  ? -20.910 24.160  23.470  1.00 41.12  ? 61  TYR A CE2 1 
ATOM   199  C CZ  . TYR A 1 44  ? -20.690 24.467  24.807  1.00 38.82  ? 61  TYR A CZ  1 
ATOM   200  O OH  . TYR A 1 44  ? -21.452 23.833  25.767  1.00 44.98  ? 61  TYR A OH  1 
ATOM   201  N N   . LYS A 1 45  ? -16.786 23.691  21.686  1.00 32.90  ? 62  LYS A N   1 
ATOM   202  C CA  . LYS A 1 45  ? -16.445 22.343  22.117  1.00 37.73  ? 62  LYS A CA  1 
ATOM   203  C C   . LYS A 1 45  ? -14.965 22.155  22.397  1.00 36.93  ? 62  LYS A C   1 
ATOM   204  O O   . LYS A 1 45  ? -14.616 21.640  23.486  1.00 34.95  ? 62  LYS A O   1 
ATOM   205  C CB  . LYS A 1 45  ? -16.936 21.280  21.130  1.00 39.57  ? 62  LYS A CB  1 
ATOM   206  C CG  . LYS A 1 45  ? -18.439 21.299  20.933  1.00 42.37  ? 62  LYS A CG  1 
ATOM   207  C CD  . LYS A 1 45  ? -19.160 20.670  22.119  1.00 48.81  ? 62  LYS A CD  1 
ATOM   208  C CE  . LYS A 1 45  ? -19.486 19.206  21.800  1.00 57.50  ? 62  LYS A CE  1 
ATOM   209  N NZ  . LYS A 1 45  ? -20.419 18.590  22.788  1.00 56.72  ? 62  LYS A NZ  1 
ATOM   210  N N   . ASP A 1 46  ? -14.091 22.594  21.479  1.00 34.98  ? 63  ASP A N   1 
ATOM   211  C CA  . ASP A 1 46  ? -12.631 22.376  21.746  1.00 36.61  ? 63  ASP A CA  1 
ATOM   212  C C   . ASP A 1 46  ? -12.173 23.155  22.973  1.00 37.48  ? 63  ASP A C   1 
ATOM   213  O O   . ASP A 1 46  ? -11.275 22.684  23.693  1.00 35.59  ? 63  ASP A O   1 
ATOM   214  C CB  . ASP A 1 46  ? -11.678 22.721  20.596  1.00 34.54  ? 63  ASP A CB  1 
ATOM   215  C CG  . ASP A 1 46  ? -12.147 22.245  19.262  1.00 35.74  ? 63  ASP A CG  1 
ATOM   216  O OD1 . ASP A 1 46  ? -12.697 21.129  19.156  1.00 33.85  ? 63  ASP A OD1 1 
ATOM   217  O OD2 . ASP A 1 46  ? -11.928 23.008  18.300  1.00 38.57  ? 63  ASP A OD2 1 
ATOM   218  N N   . LEU A 1 47  ? -12.752 24.342  23.180  1.00 33.26  ? 64  LEU A N   1 
ATOM   219  C CA  . LEU A 1 47  ? -12.482 25.109  24.413  1.00 39.79  ? 64  LEU A CA  1 
ATOM   220  C C   . LEU A 1 47  ? -12.951 24.380  25.693  1.00 38.86  ? 64  LEU A C   1 
ATOM   221  O O   . LEU A 1 47  ? -12.214 24.327  26.660  1.00 35.98  ? 64  LEU A O   1 
ATOM   222  C CB  . LEU A 1 47  ? -13.038 26.546  24.346  1.00 37.28  ? 64  LEU A CB  1 
ATOM   223  C CG  . LEU A 1 47  ? -12.230 27.445  23.408  1.00 42.41  ? 64  LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 47  ? -12.819 28.844  23.438  1.00 45.74  ? 64  LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 47  ? -10.737 27.482  23.730  1.00 40.99  ? 64  LEU A CD2 1 
ATOM   226  N N   . LYS A 1 48  ? -14.150 23.795  25.679  1.00 40.12  ? 65  LYS A N   1 
ATOM   227  C CA  . LYS A 1 48  ? -14.617 22.980  26.809  1.00 41.55  ? 65  LYS A CA  1 
ATOM   228  C C   . LYS A 1 48  ? -13.737 21.759  27.028  1.00 39.83  ? 65  LYS A C   1 
ATOM   229  O O   . LYS A 1 48  ? -13.233 21.536  28.125  1.00 48.49  ? 65  LYS A O   1 
ATOM   230  C CB  . LYS A 1 48  ? -16.037 22.548  26.572  1.00 45.86  ? 65  LYS A CB  1 
ATOM   231  C CG  . LYS A 1 48  ? -16.784 22.177  27.812  1.00 51.54  ? 65  LYS A CG  1 
ATOM   232  C CD  . LYS A 1 48  ? -18.249 22.474  27.594  1.00 56.32  ? 65  LYS A CD  1 
ATOM   233  C CE  . LYS A 1 48  ? -19.084 21.513  28.400  1.00 68.52  ? 65  LYS A CE  1 
ATOM   234  N NZ  . LYS A 1 48  ? -18.903 20.100  27.956  1.00 69.19  ? 65  LYS A NZ  1 
ATOM   235  N N   . ASN A 1 49  ? -13.495 21.004  25.972  1.00 39.32  ? 66  ASN A N   1 
ATOM   236  C CA  . ASN A 1 49  ? -12.525 19.902  26.002  1.00 38.15  ? 66  ASN A CA  1 
ATOM   237  C C   . ASN A 1 49  ? -11.138 20.272  26.545  1.00 37.89  ? 66  ASN A C   1 
ATOM   238  O O   . ASN A 1 49  ? -10.612 19.618  27.420  1.00 43.92  ? 66  ASN A O   1 
ATOM   239  C CB  . ASN A 1 49  ? -12.442 19.286  24.610  1.00 46.16  ? 66  ASN A CB  1 
ATOM   240  C CG  . ASN A 1 49  ? -11.514 18.099  24.565  1.00 59.88  ? 66  ASN A CG  1 
ATOM   241  O OD1 . ASN A 1 49  ? -11.834 17.046  25.117  1.00 71.38  ? 66  ASN A OD1 1 
ATOM   242  N ND2 . ASN A 1 49  ? -10.355 18.250  23.908  1.00 57.74  ? 66  ASN A ND2 1 
ATOM   243  N N   . PHE A 1 50  ? -10.547 21.347  26.036  1.00 39.70  ? 67  PHE A N   1 
ATOM   244  C CA  . PHE A 1 50  ? -9.331  21.956  26.568  1.00 33.44  ? 67  PHE A CA  1 
ATOM   245  C C   . PHE A 1 50  ? -9.342  22.184  28.066  1.00 35.99  ? 67  PHE A C   1 
ATOM   246  O O   . PHE A 1 50  ? -8.391  21.854  28.766  1.00 35.85  ? 67  PHE A O   1 
ATOM   247  C CB  . PHE A 1 50  ? -9.168  23.271  25.890  1.00 36.26  ? 67  PHE A CB  1 
ATOM   248  C CG  . PHE A 1 50  ? -7.849  23.933  26.149  1.00 39.72  ? 67  PHE A CG  1 
ATOM   249  C CD1 . PHE A 1 50  ? -6.730  23.584  25.433  1.00 40.85  ? 67  PHE A CD1 1 
ATOM   250  C CD2 . PHE A 1 50  ? -7.748  24.952  27.086  1.00 43.02  ? 67  PHE A CD2 1 
ATOM   251  C CE1 . PHE A 1 50  ? -5.507  24.207  25.683  1.00 45.10  ? 67  PHE A CE1 1 
ATOM   252  C CE2 . PHE A 1 50  ? -6.548  25.577  27.343  1.00 41.33  ? 67  PHE A CE2 1 
ATOM   253  C CZ  . PHE A 1 50  ? -5.419  25.204  26.633  1.00 44.90  ? 67  PHE A CZ  1 
ATOM   254  N N   . LEU A 1 51  ? -10.438 22.739  28.579  1.00 40.17  ? 68  LEU A N   1 
ATOM   255  C CA  . LEU A 1 51  ? -10.599 22.902  30.026  1.00 35.79  ? 68  LEU A CA  1 
ATOM   256  C C   . LEU A 1 51  ? -10.670 21.573  30.763  1.00 37.00  ? 68  LEU A C   1 
ATOM   257  O O   . LEU A 1 51  ? -10.094 21.451  31.850  1.00 43.67  ? 68  LEU A O   1 
ATOM   258  C CB  . LEU A 1 51  ? -11.805 23.761  30.364  1.00 33.68  ? 68  LEU A CB  1 
ATOM   259  C CG  . LEU A 1 51  ? -12.102 23.995  31.857  1.00 34.77  ? 68  LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 51  ? -10.936 24.619  32.641  1.00 28.96  ? 68  LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 51  ? -13.392 24.801  31.993  1.00 31.05  ? 68  LEU A CD2 1 
ATOM   262  N N   . SER A 1 52  ? -11.343 20.569  30.196  1.00 32.35  ? 69  SER A N   1 
ATOM   263  C CA  . SER A 1 52  ? -11.297 19.225  30.817  1.00 32.03  ? 69  SER A CA  1 
ATOM   264  C C   . SER A 1 52  ? -9.864  18.747  31.006  1.00 30.61  ? 69  SER A C   1 
ATOM   265  O O   . SER A 1 52  ? -9.476  18.318  32.088  1.00 32.91  ? 69  SER A O   1 
ATOM   266  C CB  . SER A 1 52  ? -12.010 18.182  29.956  1.00 34.04  ? 69  SER A CB  1 
ATOM   267  O OG  . SER A 1 52  ? -13.356 18.496  29.830  1.00 35.62  ? 69  SER A OG  1 
ATOM   268  N N   . ALA A 1 53  ? -9.090  18.841  29.936  1.00 28.39  ? 70  ALA A N   1 
ATOM   269  C CA  . ALA A 1 53  ? -7.734  18.355  29.920  1.00 31.36  ? 70  ALA A CA  1 
ATOM   270  C C   . ALA A 1 53  ? -6.865  19.086  30.918  1.00 33.00  ? 70  ALA A C   1 
ATOM   271  O O   . ALA A 1 53  ? -5.990  18.452  31.539  1.00 36.11  ? 70  ALA A O   1 
ATOM   272  C CB  . ALA A 1 53  ? -7.154  18.458  28.535  1.00 27.88  ? 70  ALA A CB  1 
ATOM   273  N N   . VAL A 1 54  ? -7.088  20.400  31.075  1.00 30.17  ? 71  VAL A N   1 
ATOM   274  C CA  . VAL A 1 54  ? -6.369  21.178  32.120  1.00 29.91  ? 71  VAL A CA  1 
ATOM   275  C C   . VAL A 1 54  ? -6.645  20.532  33.490  1.00 35.04  ? 71  VAL A C   1 
ATOM   276  O O   . VAL A 1 54  ? -5.732  20.350  34.300  1.00 36.12  ? 71  VAL A O   1 
ATOM   277  C CB  . VAL A 1 54  ? -6.791  22.675  32.126  1.00 27.45  ? 71  VAL A CB  1 
ATOM   278  C CG1 . VAL A 1 54  ? -6.357  23.318  33.409  1.00 26.52  ? 71  VAL A CG1 1 
ATOM   279  C CG2 . VAL A 1 54  ? -6.203  23.429  30.929  1.00 23.13  ? 71  VAL A CG2 1 
ATOM   280  N N   . LYS A 1 55  ? -7.907  20.132  33.710  1.00 37.22  ? 72  LYS A N   1 
ATOM   281  C CA  . LYS A 1 55  ? -8.345  19.542  34.978  1.00 34.28  ? 72  LYS A CA  1 
ATOM   282  C C   . LYS A 1 55  ? -7.769  18.211  35.156  1.00 35.93  ? 72  LYS A C   1 
ATOM   283  O O   . LYS A 1 55  ? -7.422  17.842  36.267  1.00 44.52  ? 72  LYS A O   1 
ATOM   284  C CB  . LYS A 1 55  ? -9.852  19.462  35.075  1.00 31.61  ? 72  LYS A CB  1 
ATOM   285  C CG  . LYS A 1 55  ? -10.427 20.849  35.320  1.00 30.73  ? 72  LYS A CG  1 
ATOM   286  C CD  . LYS A 1 55  ? -11.919 20.815  35.482  1.00 30.28  ? 72  LYS A CD  1 
ATOM   287  C CE  . LYS A 1 55  ? -12.335 22.141  36.095  1.00 31.79  ? 72  LYS A CE  1 
ATOM   288  N NZ  . LYS A 1 55  ? -13.668 22.391  35.514  1.00 38.34  ? 72  LYS A NZ  1 
ATOM   289  N N   . VAL A 1 56  ? -7.671  17.474  34.065  1.00 35.77  ? 73  VAL A N   1 
ATOM   290  C CA  . VAL A 1 56  ? -6.941  16.216  34.085  1.00 32.47  ? 73  VAL A CA  1 
ATOM   291  C C   . VAL A 1 56  ? -5.449  16.394  34.417  1.00 33.28  ? 73  VAL A C   1 
ATOM   292  O O   . VAL A 1 56  ? -4.935  15.682  35.254  1.00 38.55  ? 73  VAL A O   1 
ATOM   293  C CB  . VAL A 1 56  ? -7.234  15.382  32.814  1.00 36.43  ? 73  VAL A CB  1 
ATOM   294  C CG1 . VAL A 1 56  ? -6.133  14.354  32.562  1.00 36.94  ? 73  VAL A CG1 1 
ATOM   295  C CG2 . VAL A 1 56  ? -8.625  14.716  32.919  1.00 30.28  ? 73  VAL A CG2 1 
ATOM   296  N N   . MET A 1 57  ? -4.769  17.361  33.810  1.00 35.86  ? 74  MET A N   1 
ATOM   297  C CA  . MET A 1 57  ? -3.393  17.679  34.164  1.00 36.00  ? 74  MET A CA  1 
ATOM   298  C C   . MET A 1 57  ? -3.237  18.048  35.655  1.00 37.60  ? 74  MET A C   1 
ATOM   299  O O   . MET A 1 57  ? -2.331  17.576  36.390  1.00 37.95  ? 74  MET A O   1 
ATOM   300  C CB  . MET A 1 57  ? -2.929  18.862  33.343  1.00 36.03  ? 74  MET A CB  1 
ATOM   301  C CG  . MET A 1 57  ? -2.135  18.540  32.101  1.00 38.66  ? 74  MET A CG  1 
ATOM   302  S SD  . MET A 1 57  ? -0.716  17.436  32.318  1.00 44.49  ? 74  MET A SD  1 
ATOM   303  C CE  . MET A 1 57  ? -0.011  17.816  33.924  1.00 47.75  ? 74  MET A CE  1 
ATOM   304  N N   . HIS A 1 58  ? -4.138  18.913  36.087  1.00 36.96  ? 75  HIS A N   1 
ATOM   305  C CA  . HIS A 1 58  ? -4.188  19.396  37.454  1.00 35.53  ? 75  HIS A CA  1 
ATOM   306  C C   . HIS A 1 58  ? -4.205  18.193  38.412  1.00 35.57  ? 75  HIS A C   1 
ATOM   307  O O   . HIS A 1 58  ? -3.351  18.038  39.327  1.00 35.49  ? 75  HIS A O   1 
ATOM   308  C CB  . HIS A 1 58  ? -5.443  20.261  37.588  1.00 30.92  ? 75  HIS A CB  1 
ATOM   309  C CG  . HIS A 1 58  ? -5.690  20.759  38.973  1.00 32.56  ? 75  HIS A CG  1 
ATOM   310  N ND1 . HIS A 1 58  ? -6.678  21.674  39.263  1.00 32.24  ? 75  HIS A ND1 1 
ATOM   311  C CD2 . HIS A 1 58  ? -5.056  20.507  40.145  1.00 29.53  ? 75  HIS A CD2 1 
ATOM   312  C CE1 . HIS A 1 58  ? -6.662  21.940  40.557  1.00 32.11  ? 75  HIS A CE1 1 
ATOM   313  N NE2 . HIS A 1 58  ? -5.671  21.268  41.108  1.00 28.59  ? 75  HIS A NE2 1 
ATOM   314  N N   . GLU A 1 59  ? -5.167  17.319  38.156  1.00 36.95  ? 76  GLU A N   1 
ATOM   315  C CA  . GLU A 1 59  ? -5.380  16.123  38.937  1.00 40.52  ? 76  GLU A CA  1 
ATOM   316  C C   . GLU A 1 59  ? -4.119  15.266  38.951  1.00 39.91  ? 76  GLU A C   1 
ATOM   317  O O   . GLU A 1 59  ? -3.677  14.778  39.997  1.00 39.90  ? 76  GLU A O   1 
ATOM   318  C CB  . GLU A 1 59  ? -6.579  15.352  38.372  1.00 43.51  ? 76  GLU A CB  1 
ATOM   319  C CG  . GLU A 1 59  ? -7.187  14.393  39.359  1.00 53.87  ? 76  GLU A CG  1 
ATOM   320  C CD  . GLU A 1 59  ? -7.275  14.988  40.766  1.00 70.98  ? 76  GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 59  ? -7.783  16.132  40.938  1.00 68.27  ? 76  GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 59  ? -6.817  14.298  41.709  1.00 81.81  ? 76  GLU A OE2 1 
ATOM   323  N N   . SER A 1 60  ? -3.524  15.104  37.788  1.00 35.31  ? 77  SER A N   1 
ATOM   324  C CA  . SER A 1 60  ? -2.474  14.144  37.659  1.00 36.00  ? 77  SER A CA  1 
ATOM   325  C C   . SER A 1 60  ? -1.250  14.644  38.367  1.00 40.64  ? 77  SER A C   1 
ATOM   326  O O   . SER A 1 60  ? -0.466  13.854  38.932  1.00 44.33  ? 77  SER A O   1 
ATOM   327  C CB  . SER A 1 60  ? -2.145  13.969  36.209  1.00 38.39  ? 77  SER A CB  1 
ATOM   328  O OG  . SER A 1 60  ? -0.970  13.207  36.147  1.00 46.03  ? 77  SER A OG  1 
ATOM   329  N N   . SER A 1 61  ? -1.084  15.963  38.327  1.00 37.03  ? 78  SER A N   1 
ATOM   330  C CA  . SER A 1 61  ? 0.012   16.625  39.017  1.00 37.60  ? 78  SER A CA  1 
ATOM   331  C C   . SER A 1 61  ? -0.137  16.553  40.583  1.00 41.89  ? 78  SER A C   1 
ATOM   332  O O   . SER A 1 61  ? 0.795   16.146  41.342  1.00 42.46  ? 78  SER A O   1 
ATOM   333  C CB  . SER A 1 61  ? 0.089   18.057  38.457  1.00 39.35  ? 78  SER A CB  1 
ATOM   334  O OG  . SER A 1 61  ? 0.937   18.884  39.208  1.00 51.69  ? 78  SER A OG  1 
ATOM   335  N N   . LYS A 1 62  ? -1.324  16.913  41.065  1.00 38.37  ? 79  LYS A N   1 
ATOM   336  C CA  . LYS A 1 62  ? -1.715  16.659  42.460  1.00 37.75  ? 79  LYS A CA  1 
ATOM   337  C C   . LYS A 1 62  ? -1.381  15.215  42.941  1.00 38.28  ? 79  LYS A C   1 
ATOM   338  O O   . LYS A 1 62  ? -0.780  15.030  44.009  1.00 40.80  ? 79  LYS A O   1 
ATOM   339  C CB  . LYS A 1 62  ? -3.212  16.895  42.539  1.00 40.94  ? 79  LYS A CB  1 
ATOM   340  C CG  . LYS A 1 62  ? -3.813  16.995  43.907  1.00 49.30  ? 79  LYS A CG  1 
ATOM   341  C CD  . LYS A 1 62  ? -5.190  17.642  43.763  1.00 56.83  ? 79  LYS A CD  1 
ATOM   342  C CE  . LYS A 1 62  ? -5.886  17.795  45.110  1.00 58.59  ? 79  LYS A CE  1 
ATOM   343  N NZ  . LYS A 1 62  ? -6.903  18.867  44.945  1.00 66.53  ? 79  LYS A NZ  1 
ATOM   344  N N   . ARG A 1 63  ? -1.733  14.196  42.154  1.00 31.68  ? 80  ARG A N   1 
ATOM   345  C CA  . ARG A 1 63  ? -1.464  12.859  42.580  1.00 36.52  ? 80  ARG A CA  1 
ATOM   346  C C   . ARG A 1 63  ? 0.035   12.588  42.594  1.00 37.91  ? 80  ARG A C   1 
ATOM   347  O O   . ARG A 1 63  ? 0.552   11.909  43.494  1.00 41.29  ? 80  ARG A O   1 
ATOM   348  C CB  . ARG A 1 63  ? -2.254  11.859  41.743  1.00 42.62  ? 80  ARG A CB  1 
ATOM   349  C CG  . ARG A 1 63  ? -1.535  10.552  41.537  1.00 52.76  ? 80  ARG A CG  1 
ATOM   350  C CD  . ARG A 1 63  ? -2.132  9.803   40.360  1.00 61.03  ? 80  ARG A CD  1 
ATOM   351  N NE  . ARG A 1 63  ? -1.752  8.392   40.358  1.00 52.17  ? 80  ARG A NE  1 
ATOM   352  C CZ  . ARG A 1 63  ? -2.336  7.470   39.603  1.00 53.09  ? 80  ARG A CZ  1 
ATOM   353  N NH1 . ARG A 1 63  ? -3.344  7.805   38.799  1.00 48.42  ? 80  ARG A NH1 1 
ATOM   354  N NH2 . ARG A 1 63  ? -1.926  6.210   39.671  1.00 49.57  ? 80  ARG A NH2 1 
ATOM   355  N N   . VAL A 1 64  ? 0.762   13.183  41.656  1.00 37.86  ? 81  VAL A N   1 
ATOM   356  C CA  . VAL A 1 64  ? 2.203   13.039  41.680  1.00 35.72  ? 81  VAL A CA  1 
ATOM   357  C C   . VAL A 1 64  ? 2.854   13.668  42.927  1.00 43.44  ? 81  VAL A C   1 
ATOM   358  O O   . VAL A 1 64  ? 3.751   13.056  43.598  1.00 40.21  ? 81  VAL A O   1 
ATOM   359  C CB  . VAL A 1 64  ? 2.838   13.541  40.391  1.00 33.26  ? 81  VAL A CB  1 
ATOM   360  C CG1 . VAL A 1 64  ? 4.331   13.559  40.511  1.00 33.86  ? 81  VAL A CG1 1 
ATOM   361  C CG2 . VAL A 1 64  ? 2.486   12.610  39.254  1.00 31.58  ? 81  VAL A CG2 1 
ATOM   362  N N   . SER A 1 65  ? 2.399   14.875  43.258  1.00 45.11  ? 82  SER A N   1 
ATOM   363  C CA  . SER A 1 65  ? 3.000   15.599  44.367  1.00 44.36  ? 82  SER A CA  1 
ATOM   364  C C   . SER A 1 65  ? 2.617   14.982  45.737  1.00 44.20  ? 82  SER A C   1 
ATOM   365  O O   . SER A 1 65  ? 3.401   15.046  46.687  1.00 49.11  ? 82  SER A O   1 
ATOM   366  C CB  . SER A 1 65  ? 2.624   17.062  44.249  1.00 50.03  ? 82  SER A CB  1 
ATOM   367  O OG  . SER A 1 65  ? 1.327   17.258  44.773  1.00 59.51  ? 82  SER A OG  1 
ATOM   368  N N   . GLU A 1 66  ? 1.451   14.330  45.825  1.00 44.02  ? 83  GLU A N   1 
ATOM   369  C CA  . GLU A 1 66  ? 1.060   13.612  47.060  1.00 39.41  ? 83  GLU A CA  1 
ATOM   370  C C   . GLU A 1 66  ? 1.938   12.423  47.366  1.00 41.60  ? 83  GLU A C   1 
ATOM   371  O O   . GLU A 1 66  ? 2.242   12.167  48.533  1.00 47.44  ? 83  GLU A O   1 
ATOM   372  C CB  . GLU A 1 66  ? -0.404  13.193  47.031  1.00 41.99  ? 83  GLU A CB  1 
ATOM   373  C CG  . GLU A 1 66  ? -1.273  14.115  47.885  1.00 59.26  ? 83  GLU A CG  1 
ATOM   374  C CD  . GLU A 1 66  ? -2.451  14.767  47.145  1.00 67.73  ? 83  GLU A CD  1 
ATOM   375  O OE1 . GLU A 1 66  ? -2.483  16.031  47.078  1.00 63.05  ? 83  GLU A OE1 1 
ATOM   376  O OE2 . GLU A 1 66  ? -3.341  14.025  46.641  1.00 69.28  ? 83  GLU A OE2 1 
ATOM   377  N N   . THR A 1 67  ? 2.332   11.680  46.326  1.00 41.04  ? 84  THR A N   1 
ATOM   378  C CA  . THR A 1 67  ? 3.259   10.552  46.475  1.00 35.34  ? 84  THR A CA  1 
ATOM   379  C C   . THR A 1 67  ? 4.615   11.116  46.827  1.00 40.14  ? 84  THR A C   1 
ATOM   380  O O   . THR A 1 67  ? 5.339   10.541  47.646  1.00 42.64  ? 84  THR A O   1 
ATOM   381  C CB  . THR A 1 67  ? 3.339   9.680   45.201  1.00 31.59  ? 84  THR A CB  1 
ATOM   382  O OG1 . THR A 1 67  ? 2.084   9.024   44.989  1.00 36.70  ? 84  THR A OG1 1 
ATOM   383  C CG2 . THR A 1 67  ? 4.389   8.632   45.313  1.00 29.47  ? 84  THR A CG2 1 
ATOM   384  N N   . LEU A 1 68  ? 4.964   12.258  46.239  1.00 41.95  ? 85  LEU A N   1 
ATOM   385  C CA  . LEU A 1 68  ? 6.260   12.824  46.571  1.00 42.92  ? 85  LEU A CA  1 
ATOM   386  C C   . LEU A 1 68  ? 6.290   13.265  48.046  1.00 45.87  ? 85  LEU A C   1 
ATOM   387  O O   . LEU A 1 68  ? 7.255   12.966  48.753  1.00 47.89  ? 85  LEU A O   1 
ATOM   388  C CB  . LEU A 1 68  ? 6.675   13.930  45.614  1.00 36.17  ? 85  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 68  ? 8.030   14.489  46.061  1.00 37.14  ? 85  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 68  ? 9.098   13.405  45.970  1.00 34.98  ? 85  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 68  ? 8.419   15.772  45.301  1.00 31.53  ? 85  LEU A CD2 1 
ATOM   392  N N   . GLN A 1 69  ? 5.215   13.921  48.506  1.00 51.24  ? 86  GLN A N   1 
ATOM   393  C CA  . GLN A 1 69  ? 5.086   14.360  49.923  1.00 48.81  ? 86  GLN A CA  1 
ATOM   394  C C   . GLN A 1 69  ? 5.178   13.184  50.881  1.00 46.10  ? 86  GLN A C   1 
ATOM   395  O O   . GLN A 1 69  ? 5.915   13.239  51.838  1.00 58.58  ? 86  GLN A O   1 
ATOM   396  C CB  . GLN A 1 69  ? 3.772   15.106  50.170  1.00 46.97  ? 86  GLN A CB  1 
ATOM   397  C CG  . GLN A 1 69  ? 3.726   16.574  49.772  1.00 50.19  ? 86  GLN A CG  1 
ATOM   398  C CD  . GLN A 1 69  ? 2.437   17.293  50.243  1.00 56.43  ? 86  GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 69  ? 2.414   18.517  50.387  1.00 49.10  ? 86  GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 69  ? 1.358   16.528  50.470  1.00 55.20  ? 86  GLN A NE2 1 
ATOM   401  N N   . GLU A 1 70  ? 4.441   12.119  50.613  1.00 44.74  ? 87  GLU A N   1 
ATOM   402  C CA  . GLU A 1 70  ? 4.595   10.852  51.337  1.00 51.79  ? 87  GLU A CA  1 
ATOM   403  C C   . GLU A 1 70  ? 6.011   10.265  51.395  1.00 50.71  ? 87  GLU A C   1 
ATOM   404  O O   . GLU A 1 70  ? 6.365   9.581   52.352  1.00 50.12  ? 87  GLU A O   1 
ATOM   405  C CB  . GLU A 1 70  ? 3.741   9.786   50.682  1.00 53.52  ? 87  GLU A CB  1 
ATOM   406  C CG  . GLU A 1 70  ? 2.327   9.733   51.171  1.00 58.10  ? 87  GLU A CG  1 
ATOM   407  C CD  . GLU A 1 70  ? 1.413   9.036   50.183  1.00 61.94  ? 87  GLU A CD  1 
ATOM   408  O OE1 . GLU A 1 70  ? 1.776   7.927   49.701  1.00 50.25  ? 87  GLU A OE1 1 
ATOM   409  O OE2 . GLU A 1 70  ? 0.330   9.621   49.898  1.00 72.17  ? 87  GLU A OE2 1 
ATOM   410  N N   . ILE A 1 71  ? 6.795   10.464  50.342  1.00 48.65  ? 88  ILE A N   1 
ATOM   411  C CA  . ILE A 1 71  ? 8.124   9.886   50.293  1.00 44.21  ? 88  ILE A CA  1 
ATOM   412  C C   . ILE A 1 71  ? 9.019   10.815  51.100  1.00 51.85  ? 88  ILE A C   1 
ATOM   413  O O   . ILE A 1 71  ? 9.979   10.351  51.794  1.00 41.21  ? 88  ILE A O   1 
ATOM   414  C CB  . ILE A 1 71  ? 8.650   9.865   48.842  1.00 46.29  ? 88  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 71  ? 8.017   8.712   48.037  1.00 42.82  ? 88  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 71  ? 10.183  9.877   48.799  1.00 39.61  ? 88  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 71  ? 8.342   8.814   46.559  1.00 43.59  ? 88  ILE A CD1 1 
ATOM   418  N N   . TYR A 1 72  ? 8.700   12.122  51.000  1.00 43.60  ? 89  TYR A N   1 
ATOM   419  C CA  . TYR A 1 72  ? 9.566   13.151  51.556  1.00 41.75  ? 89  TYR A CA  1 
ATOM   420  C C   . TYR A 1 72  ? 9.399   13.215  53.064  1.00 44.44  ? 89  TYR A C   1 
ATOM   421  O O   . TYR A 1 72  ? 8.307   13.501  53.566  1.00 49.87  ? 89  TYR A O   1 
ATOM   422  C CB  . TYR A 1 72  ? 9.276   14.502  50.913  1.00 39.65  ? 89  TYR A CB  1 
ATOM   423  C CG  . TYR A 1 72  ? 10.470  15.437  50.857  1.00 39.51  ? 89  TYR A CG  1 
ATOM   424  C CD1 . TYR A 1 72  ? 11.112  15.892  52.053  1.00 39.58  ? 89  TYR A CD1 1 
ATOM   425  C CD2 . TYR A 1 72  ? 10.963  15.902  49.631  1.00 34.52  ? 89  TYR A CD2 1 
ATOM   426  C CE1 . TYR A 1 72  ? 12.203  16.765  52.004  1.00 33.39  ? 89  TYR A CE1 1 
ATOM   427  C CE2 . TYR A 1 72  ? 12.052  16.795  49.576  1.00 31.61  ? 89  TYR A CE2 1 
ATOM   428  C CZ  . TYR A 1 72  ? 12.678  17.222  50.756  1.00 33.13  ? 89  TYR A CZ  1 
ATOM   429  O OH  . TYR A 1 72  ? 13.802  18.085  50.707  1.00 33.21  ? 89  TYR A OH  1 
ATOM   430  N N   . SER A 1 73  ? 10.475  12.929  53.794  1.00 44.22  ? 90  SER A N   1 
ATOM   431  C CA  . SER A 1 73  ? 10.378  12.868  55.246  1.00 39.52  ? 90  SER A CA  1 
ATOM   432  C C   . SER A 1 73  ? 10.422  14.242  55.883  1.00 45.72  ? 90  SER A C   1 
ATOM   433  O O   . SER A 1 73  ? 11.247  15.101  55.486  1.00 52.57  ? 90  SER A O   1 
ATOM   434  C CB  . SER A 1 73  ? 11.454  11.960  55.864  1.00 34.45  ? 90  SER A CB  1 
ATOM   435  O OG  . SER A 1 73  ? 11.424  12.070  57.314  1.00 29.42  ? 90  SER A OG  1 
ATOM   436  N N   . SER A 1 74  ? 9.553   14.433  56.888  1.00 44.82  ? 91  SER A N   1 
ATOM   437  C CA  . SER A 1 74  ? 9.564   15.635  57.747  1.00 40.60  ? 91  SER A CA  1 
ATOM   438  C C   . SER A 1 74  ? 10.868  15.778  58.522  1.00 39.79  ? 91  SER A C   1 
ATOM   439  O O   . SER A 1 74  ? 11.146  16.826  59.064  1.00 38.89  ? 91  SER A O   1 
ATOM   440  C CB  . SER A 1 74  ? 8.355   15.666  58.698  1.00 42.84  ? 91  SER A CB  1 
ATOM   441  O OG  . SER A 1 74  ? 8.235   14.444  59.420  1.00 44.17  ? 91  SER A OG  1 
ATOM   442  N N   . GLU A 1 75  ? 11.682  14.722  58.539  1.00 42.57  ? 92  GLU A N   1 
ATOM   443  C CA  . GLU A 1 75  ? 13.005  14.767  59.159  1.00 42.41  ? 92  GLU A CA  1 
ATOM   444  C C   . GLU A 1 75  ? 14.030  15.340  58.195  1.00 44.98  ? 92  GLU A C   1 
ATOM   445  O O   . GLU A 1 75  ? 15.207  15.470  58.584  1.00 42.70  ? 92  GLU A O   1 
ATOM   446  C CB  . GLU A 1 75  ? 13.463  13.358  59.619  1.00 39.11  ? 92  GLU A CB  1 
ATOM   447  C CG  . GLU A 1 75  ? 12.656  12.788  60.757  1.00 36.77  ? 92  GLU A CG  1 
ATOM   448  C CD  . GLU A 1 75  ? 12.846  13.573  62.045  1.00 45.07  ? 92  GLU A CD  1 
ATOM   449  O OE1 . GLU A 1 75  ? 14.020  13.854  62.419  1.00 42.61  ? 92  GLU A OE1 1 
ATOM   450  O OE2 . GLU A 1 75  ? 11.815  13.916  62.688  1.00 52.23  ? 92  GLU A OE2 1 
ATOM   451  N N   . TRP A 1 76  ? 13.604  15.621  56.945  1.00 42.98  ? 93  TRP A N   1 
ATOM   452  C CA  . TRP A 1 76  ? 14.516  16.155  55.927  1.00 43.10  ? 93  TRP A CA  1 
ATOM   453  C C   . TRP A 1 76  ? 14.400  17.627  55.741  1.00 47.07  ? 93  TRP A C   1 
ATOM   454  O O   . TRP A 1 76  ? 13.328  18.192  55.859  1.00 49.36  ? 93  TRP A O   1 
ATOM   455  C CB  . TRP A 1 76  ? 14.360  15.476  54.572  1.00 41.81  ? 93  TRP A CB  1 
ATOM   456  C CG  . TRP A 1 76  ? 14.624  13.989  54.616  1.00 40.10  ? 93  TRP A CG  1 
ATOM   457  C CD1 . TRP A 1 76  ? 15.325  13.326  55.574  1.00 39.82  ? 93  TRP A CD1 1 
ATOM   458  C CD2 . TRP A 1 76  ? 14.194  12.996  53.666  1.00 36.81  ? 93  TRP A CD2 1 
ATOM   459  N NE1 . TRP A 1 76  ? 15.361  11.991  55.293  1.00 42.58  ? 93  TRP A NE1 1 
ATOM   460  C CE2 . TRP A 1 76  ? 14.684  11.750  54.123  1.00 36.40  ? 93  TRP A CE2 1 
ATOM   461  C CE3 . TRP A 1 76  ? 13.418  13.033  52.487  1.00 37.95  ? 93  TRP A CE3 1 
ATOM   462  C CZ2 . TRP A 1 76  ? 14.431  10.525  53.456  1.00 30.52  ? 93  TRP A CZ2 1 
ATOM   463  C CZ3 . TRP A 1 76  ? 13.195  11.809  51.795  1.00 35.67  ? 93  TRP A CZ3 1 
ATOM   464  C CH2 . TRP A 1 76  ? 13.695  10.565  52.314  1.00 30.43  ? 93  TRP A CH2 1 
ATOM   465  N N   . ASP A 1 77  ? 15.541  18.246  55.473  1.00 52.64  ? 94  ASP A N   1 
ATOM   466  C CA  . ASP A 1 77  ? 15.618  19.633  55.006  1.00 50.45  ? 94  ASP A CA  1 
ATOM   467  C C   . ASP A 1 77  ? 14.836  19.806  53.692  1.00 46.41  ? 94  ASP A C   1 
ATOM   468  O O   . ASP A 1 77  ? 14.893  18.950  52.799  1.00 40.84  ? 94  ASP A O   1 
ATOM   469  C CB  . ASP A 1 77  ? 17.102  20.035  54.821  1.00 56.90  ? 94  ASP A CB  1 
ATOM   470  C CG  . ASP A 1 77  ? 17.795  20.460  56.146  1.00 61.02  ? 94  ASP A CG  1 
ATOM   471  O OD1 . ASP A 1 77  ? 17.309  20.198  57.287  1.00 52.24  ? 94  ASP A OD1 1 
ATOM   472  O OD2 . ASP A 1 77  ? 18.861  21.085  56.033  1.00 63.87  ? 94  ASP A OD2 1 
ATOM   473  N N   . GLY A 1 78  ? 14.088  20.905  53.590  1.00 49.89  ? 95  GLY A N   1 
ATOM   474  C CA  . GLY A 1 78  ? 13.306  21.241  52.381  1.00 43.14  ? 95  GLY A CA  1 
ATOM   475  C C   . GLY A 1 78  ? 11.881  20.742  52.444  1.00 41.79  ? 95  GLY A C   1 
ATOM   476  O O   . GLY A 1 78  ? 11.047  21.038  51.548  1.00 38.43  ? 95  GLY A O   1 
ATOM   477  N N   . HIS A 1 79  ? 11.597  19.992  53.514  1.00 40.80  ? 96  HIS A N   1 
ATOM   478  C CA  . HIS A 1 79  ? 10.296  19.378  53.675  1.00 43.89  ? 96  HIS A CA  1 
ATOM   479  C C   . HIS A 1 79  ? 9.155   20.413  53.681  1.00 50.33  ? 96  HIS A C   1 
ATOM   480  O O   . HIS A 1 79  ? 8.085   20.161  53.149  1.00 47.21  ? 96  HIS A O   1 
ATOM   481  C CB  . HIS A 1 79  ? 10.215  18.573  54.950  1.00 38.23  ? 96  HIS A CB  1 
ATOM   482  C CG  . HIS A 1 79  ? 8.882   17.926  55.142  1.00 41.30  ? 96  HIS A CG  1 
ATOM   483  N ND1 . HIS A 1 79  ? 7.930   18.415  56.010  1.00 46.84  ? 96  HIS A ND1 1 
ATOM   484  C CD2 . HIS A 1 79  ? 8.323   16.847  54.542  1.00 42.51  ? 96  HIS A CD2 1 
ATOM   485  C CE1 . HIS A 1 79  ? 6.858   17.640  55.970  1.00 47.05  ? 96  HIS A CE1 1 
ATOM   486  N NE2 . HIS A 1 79  ? 7.064   16.695  55.068  1.00 49.46  ? 96  HIS A NE2 1 
ATOM   487  N N   . GLU A 1 80  ? 9.398   21.562  54.307  1.00 53.99  ? 97  GLU A N   1 
ATOM   488  C CA  . GLU A 1 80  ? 8.373   22.558  54.494  1.00 51.27  ? 97  GLU A CA  1 
ATOM   489  C C   . GLU A 1 80  ? 8.191   23.297  53.193  1.00 50.90  ? 97  GLU A C   1 
ATOM   490  O O   . GLU A 1 80  ? 7.049   23.549  52.775  1.00 53.98  ? 97  GLU A O   1 
ATOM   491  C CB  . GLU A 1 80  ? 8.756   23.513  55.631  1.00 50.32  ? 97  GLU A CB  1 
ATOM   492  C CG  . GLU A 1 80  ? 7.564   24.045  56.403  1.00 55.06  ? 97  GLU A CG  1 
ATOM   493  C CD  . GLU A 1 80  ? 6.790   22.970  57.169  1.00 66.39  ? 97  GLU A CD  1 
ATOM   494  O OE1 . GLU A 1 80  ? 5.668   23.277  57.639  1.00 70.99  ? 97  GLU A OE1 1 
ATOM   495  O OE2 . GLU A 1 80  ? 7.276   21.817  57.307  1.00 65.36  ? 97  GLU A OE2 1 
ATOM   496  N N   . GLU A 1 81  ? 9.311   23.618  52.545  1.00 47.48  ? 98  GLU A N   1 
ATOM   497  C CA  . GLU A 1 81  ? 9.278   24.271  51.249  1.00 43.60  ? 98  GLU A CA  1 
ATOM   498  C C   . GLU A 1 81  ? 8.505   23.410  50.256  1.00 45.65  ? 98  GLU A C   1 
ATOM   499  O O   . GLU A 1 81  ? 7.574   23.894  49.589  1.00 44.61  ? 98  GLU A O   1 
ATOM   500  C CB  . GLU A 1 81  ? 10.679  24.543  50.756  1.00 51.77  ? 98  GLU A CB  1 
ATOM   501  C CG  . GLU A 1 81  ? 10.719  25.280  49.413  1.00 65.67  ? 98  GLU A CG  1 
ATOM   502  C CD  . GLU A 1 81  ? 12.137  25.608  48.974  1.00 72.03  ? 98  GLU A CD  1 
ATOM   503  O OE1 . GLU A 1 81  ? 13.027  25.665  49.860  1.00 77.40  ? 98  GLU A OE1 1 
ATOM   504  O OE2 . GLU A 1 81  ? 12.366  25.796  47.753  1.00 75.74  ? 98  GLU A OE2 1 
ATOM   505  N N   . LEU A 1 82  ? 8.845   22.122  50.192  1.00 42.27  ? 99  LEU A N   1 
ATOM   506  C CA  . LEU A 1 82  ? 8.039   21.184  49.410  1.00 39.58  ? 99  LEU A CA  1 
ATOM   507  C C   . LEU A 1 82  ? 6.548   21.251  49.737  1.00 39.76  ? 99  LEU A C   1 
ATOM   508  O O   . LEU A 1 82  ? 5.688   21.307  48.841  1.00 42.05  ? 99  LEU A O   1 
ATOM   509  C CB  . LEU A 1 82  ? 8.549   19.745  49.542  1.00 41.91  ? 99  LEU A CB  1 
ATOM   510  C CG  . LEU A 1 82  ? 7.612   18.744  48.872  1.00 42.04  ? 99  LEU A CG  1 
ATOM   511  C CD1 . LEU A 1 82  ? 7.927   18.706  47.392  1.00 42.54  ? 99  LEU A CD1 1 
ATOM   512  C CD2 . LEU A 1 82  ? 7.788   17.362  49.433  1.00 46.46  ? 99  LEU A CD2 1 
ATOM   513  N N   . LYS A 1 83  ? 6.209   21.254  51.004  1.00 39.77  ? 100 LYS A N   1 
ATOM   514  C CA  . LYS A 1 83  ? 4.795   21.393  51.343  1.00 46.34  ? 100 LYS A CA  1 
ATOM   515  C C   . LYS A 1 83  ? 4.172   22.723  50.741  1.00 48.50  ? 100 LYS A C   1 
ATOM   516  O O   . LYS A 1 83  ? 2.969   22.790  50.461  1.00 48.56  ? 100 LYS A O   1 
ATOM   517  C CB  . LYS A 1 83  ? 4.636   21.242  52.866  1.00 54.04  ? 100 LYS A CB  1 
ATOM   518  C CG  . LYS A 1 83  ? 3.221   21.341  53.453  1.00 63.69  ? 100 LYS A CG  1 
ATOM   519  C CD  . LYS A 1 83  ? 3.242   21.506  54.976  1.00 58.90  ? 100 LYS A CD  1 
ATOM   520  C CE  . LYS A 1 83  ? 3.802   20.258  55.670  1.00 56.70  ? 100 LYS A CE  1 
ATOM   521  N NZ  . LYS A 1 83  ? 4.287   20.522  57.062  1.00 55.82  ? 100 LYS A NZ  1 
ATOM   522  N N   . ALA A 1 84  ? 4.989   23.750  50.491  1.00 41.17  ? 101 ALA A N   1 
ATOM   523  C CA  . ALA A 1 84  ? 4.488   25.000  49.914  1.00 39.39  ? 101 ALA A CA  1 
ATOM   524  C C   . ALA A 1 84  ? 4.422   24.871  48.395  1.00 39.50  ? 101 ALA A C   1 
ATOM   525  O O   . ALA A 1 84  ? 3.481   25.368  47.741  1.00 45.39  ? 101 ALA A O   1 
ATOM   526  C CB  . ALA A 1 84  ? 5.387   26.184  50.307  1.00 34.09  ? 101 ALA A CB  1 
ATOM   527  N N   . ILE A 1 85  ? 5.425   24.227  47.819  1.00 32.69  ? 102 ILE A N   1 
ATOM   528  C CA  . ILE A 1 85  ? 5.401   24.052  46.376  1.00 34.21  ? 102 ILE A CA  1 
ATOM   529  C C   . ILE A 1 85  ? 4.069   23.380  46.030  1.00 38.81  ? 102 ILE A C   1 
ATOM   530  O O   . ILE A 1 85  ? 3.230   23.936  45.297  1.00 38.53  ? 102 ILE A O   1 
ATOM   531  C CB  . ILE A 1 85  ? 6.599   23.207  45.861  1.00 31.76  ? 102 ILE A CB  1 
ATOM   532  C CG1 . ILE A 1 85  ? 7.895   24.028  45.898  1.00 31.61  ? 102 ILE A CG1 1 
ATOM   533  C CG2 . ILE A 1 85  ? 6.332   22.688  44.469  1.00 24.28  ? 102 ILE A CG2 1 
ATOM   534  C CD1 . ILE A 1 85  ? 9.129   23.142  45.969  1.00 37.20  ? 102 ILE A CD1 1 
ATOM   535  N N   . VAL A 1 86  ? 3.873   22.195  46.597  1.00 37.49  ? 103 VAL A N   1 
ATOM   536  C CA  . VAL A 1 86  ? 2.702   21.420  46.345  1.00 36.87  ? 103 VAL A CA  1 
ATOM   537  C C   . VAL A 1 86  ? 1.472   22.293  46.584  1.00 44.11  ? 103 VAL A C   1 
ATOM   538  O O   . VAL A 1 86  ? 0.568   22.352  45.748  1.00 50.24  ? 103 VAL A O   1 
ATOM   539  C CB  . VAL A 1 86  ? 2.689   20.178  47.225  1.00 39.47  ? 103 VAL A CB  1 
ATOM   540  C CG1 . VAL A 1 86  ? 1.388   19.407  47.075  1.00 42.43  ? 103 VAL A CG1 1 
ATOM   541  C CG2 . VAL A 1 86  ? 3.880   19.282  46.882  1.00 41.53  ? 103 VAL A CG2 1 
ATOM   542  N N   . TRP A 1 87  ? 1.445   23.010  47.689  1.00 42.93  ? 104 TRP A N   1 
ATOM   543  C CA  . TRP A 1 87  ? 0.301   23.881  47.971  1.00 43.98  ? 104 TRP A CA  1 
ATOM   544  C C   . TRP A 1 87  ? 0.015   24.887  46.884  1.00 39.76  ? 104 TRP A C   1 
ATOM   545  O O   . TRP A 1 87  ? -1.051  24.828  46.288  1.00 36.50  ? 104 TRP A O   1 
ATOM   546  C CB  . TRP A 1 87  ? 0.471   24.588  49.312  1.00 52.05  ? 104 TRP A CB  1 
ATOM   547  C CG  . TRP A 1 87  ? -0.756  25.277  49.802  1.00 60.21  ? 104 TRP A CG  1 
ATOM   548  C CD1 . TRP A 1 87  ? -1.085  26.609  49.632  1.00 62.49  ? 104 TRP A CD1 1 
ATOM   549  C CD2 . TRP A 1 87  ? -1.807  24.700  50.578  1.00 69.04  ? 104 TRP A CD2 1 
ATOM   550  N NE1 . TRP A 1 87  ? -2.280  26.879  50.247  1.00 64.30  ? 104 TRP A NE1 1 
ATOM   551  C CE2 . TRP A 1 87  ? -2.747  25.731  50.839  1.00 71.90  ? 104 TRP A CE2 1 
ATOM   552  C CE3 . TRP A 1 87  ? -2.052  23.411  51.084  1.00 85.23  ? 104 TRP A CE3 1 
ATOM   553  C CZ2 . TRP A 1 87  ? -3.915  25.509  51.584  1.00 76.75  ? 104 TRP A CZ2 1 
ATOM   554  C CZ3 . TRP A 1 87  ? -3.222  23.188  51.827  1.00 82.90  ? 104 TRP A CZ3 1 
ATOM   555  C CH2 . TRP A 1 87  ? -4.133  24.233  52.068  1.00 83.50  ? 104 TRP A CH2 1 
ATOM   556  N N   . ASN A 1 88  ? 0.950   25.805  46.624  1.00 41.75  ? 105 ASN A N   1 
ATOM   557  C CA  . ASN A 1 88  ? 0.771   26.805  45.553  1.00 45.74  ? 105 ASN A CA  1 
ATOM   558  C C   . ASN A 1 88  ? 0.518   26.282  44.152  1.00 41.48  ? 105 ASN A C   1 
ATOM   559  O O   . ASN A 1 88  ? -0.227  26.851  43.329  1.00 47.06  ? 105 ASN A O   1 
ATOM   560  C CB  . ASN A 1 88  ? 1.967   27.741  45.510  1.00 52.58  ? 105 ASN A CB  1 
ATOM   561  C CG  . ASN A 1 88  ? 2.147   28.450  46.805  1.00 55.57  ? 105 ASN A CG  1 
ATOM   562  O OD1 . ASN A 1 88  ? 1.171   28.853  47.422  1.00 69.19  ? 105 ASN A OD1 1 
ATOM   563  N ND2 . ASN A 1 88  ? 3.374   28.549  47.264  1.00 61.62  ? 105 ASN A ND2 1 
ATOM   564  N N   . ASN A 1 89  ? 1.188   25.204  43.863  1.00 44.28  ? 106 ASN A N   1 
ATOM   565  C CA  . ASN A 1 89  ? 0.933   24.474  42.662  1.00 44.35  ? 106 ASN A CA  1 
ATOM   566  C C   . ASN A 1 89  ? -0.548  24.238  42.498  1.00 44.33  ? 106 ASN A C   1 
ATOM   567  O O   . ASN A 1 89  ? -1.104  24.397  41.412  1.00 40.76  ? 106 ASN A O   1 
ATOM   568  C CB  . ASN A 1 89  ? 1.604   23.148  42.803  1.00 48.96  ? 106 ASN A CB  1 
ATOM   569  C CG  . ASN A 1 89  ? 1.886   22.539  41.490  1.00 53.27  ? 106 ASN A CG  1 
ATOM   570  O OD1 . ASN A 1 89  ? 2.622   23.115  40.691  1.00 60.22  ? 106 ASN A OD1 1 
ATOM   571  N ND2 . ASN A 1 89  ? 1.275   21.394  41.225  1.00 46.99  ? 106 ASN A ND2 1 
ATOM   572  N N   . ASP A 1 90  ? -1.196  23.925  43.612  1.00 40.22  ? 107 ASP A N   1 
ATOM   573  C CA  . ASP A 1 90  ? -2.560  23.531  43.578  1.00 43.37  ? 107 ASP A CA  1 
ATOM   574  C C   . ASP A 1 90  ? -3.478  24.749  43.428  1.00 45.01  ? 107 ASP A C   1 
ATOM   575  O O   . ASP A 1 90  ? -4.467  24.685  42.705  1.00 52.41  ? 107 ASP A O   1 
ATOM   576  C CB  . ASP A 1 90  ? -2.870  22.696  44.800  1.00 47.47  ? 107 ASP A CB  1 
ATOM   577  C CG  . ASP A 1 90  ? -4.250  22.201  44.800  1.00 54.30  ? 107 ASP A CG  1 
ATOM   578  O OD1 . ASP A 1 90  ? -4.568  21.463  43.859  1.00 62.22  ? 107 ASP A OD1 1 
ATOM   579  O OD2 . ASP A 1 90  ? -5.023  22.559  45.723  1.00 63.51  ? 107 ASP A OD2 1 
ATOM   580  N N   . LEU A 1 91  ? -3.124  25.865  44.060  1.00 45.27  ? 108 LEU A N   1 
ATOM   581  C CA  . LEU A 1 91  ? -3.828  27.148  43.915  1.00 39.95  ? 108 LEU A CA  1 
ATOM   582  C C   . LEU A 1 91  ? -3.686  27.717  42.473  1.00 42.15  ? 108 LEU A C   1 
ATOM   583  O O   . LEU A 1 91  ? -4.641  28.251  41.895  1.00 44.78  ? 108 LEU A O   1 
ATOM   584  C CB  . LEU A 1 91  ? -3.276  28.136  44.954  1.00 43.55  ? 108 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 91  ? -3.314  27.779  46.476  1.00 47.96  ? 108 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 91  ? -3.051  29.018  47.327  1.00 39.92  ? 108 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 91  ? -4.625  27.123  46.949  1.00 40.49  ? 108 LEU A CD2 1 
ATOM   588  N N   . LEU A 1 92  ? -2.505  27.582  41.872  1.00 44.27  ? 109 LEU A N   1 
ATOM   589  C CA  . LEU A 1 92  ? -2.316  27.997  40.467  1.00 40.71  ? 109 LEU A CA  1 
ATOM   590  C C   . LEU A 1 92  ? -3.284  27.258  39.522  1.00 41.31  ? 109 LEU A C   1 
ATOM   591  O O   . LEU A 1 92  ? -4.187  27.875  38.911  1.00 40.21  ? 109 LEU A O   1 
ATOM   592  C CB  . LEU A 1 92  ? -0.857  27.833  40.030  1.00 38.84  ? 109 LEU A CB  1 
ATOM   593  C CG  . LEU A 1 92  ? 0.155   28.837  40.628  1.00 50.84  ? 109 LEU A CG  1 
ATOM   594  C CD1 . LEU A 1 92  ? 1.602   28.455  40.366  1.00 54.08  ? 109 LEU A CD1 1 
ATOM   595  C CD2 . LEU A 1 92  ? -0.043  30.262  40.132  1.00 54.86  ? 109 LEU A CD2 1 
ATOM   596  N N   . TRP A 1 93  ? -3.108  25.941  39.400  1.00 36.83  ? 110 TRP A N   1 
ATOM   597  C CA  . TRP A 1 93  ? -4.000  25.154  38.577  1.00 33.86  ? 110 TRP A CA  1 
ATOM   598  C C   . TRP A 1 93  ? -5.423  25.634  38.741  1.00 35.69  ? 110 TRP A C   1 
ATOM   599  O O   . TRP A 1 93  ? -6.102  25.906  37.730  1.00 36.56  ? 110 TRP A O   1 
ATOM   600  C CB  . TRP A 1 93  ? -3.882  23.678  38.904  1.00 34.64  ? 110 TRP A CB  1 
ATOM   601  C CG  . TRP A 1 93  ? -2.669  23.007  38.298  1.00 32.19  ? 110 TRP A CG  1 
ATOM   602  C CD1 . TRP A 1 93  ? -1.609  22.475  38.974  1.00 33.06  ? 110 TRP A CD1 1 
ATOM   603  C CD2 . TRP A 1 93  ? -2.419  22.758  36.891  1.00 31.67  ? 110 TRP A CD2 1 
ATOM   604  N NE1 . TRP A 1 93  ? -0.705  21.911  38.081  1.00 34.29  ? 110 TRP A NE1 1 
ATOM   605  C CE2 . TRP A 1 93  ? -1.176  22.075  36.801  1.00 30.16  ? 110 TRP A CE2 1 
ATOM   606  C CE3 . TRP A 1 93  ? -3.113  23.073  35.708  1.00 31.04  ? 110 TRP A CE3 1 
ATOM   607  C CZ2 . TRP A 1 93  ? -0.613  21.693  35.593  1.00 32.26  ? 110 TRP A CZ2 1 
ATOM   608  C CZ3 . TRP A 1 93  ? -2.544  22.687  34.471  1.00 34.31  ? 110 TRP A CZ3 1 
ATOM   609  C CH2 . TRP A 1 93  ? -1.305  22.011  34.426  1.00 36.95  ? 110 TRP A CH2 1 
ATOM   610  N N   . GLU A 1 94  ? -5.838  25.828  40.003  1.00 40.15  ? 111 GLU A N   1 
ATOM   611  C CA  . GLU A 1 94  ? -7.216  26.190  40.351  1.00 41.23  ? 111 GLU A CA  1 
ATOM   612  C C   . GLU A 1 94  ? -7.573  27.510  39.776  1.00 40.78  ? 111 GLU A C   1 
ATOM   613  O O   . GLU A 1 94  ? -8.580  27.641  39.087  1.00 45.35  ? 111 GLU A O   1 
ATOM   614  C CB  . GLU A 1 94  ? -7.406  26.298  41.860  1.00 54.53  ? 111 GLU A CB  1 
ATOM   615  C CG  . GLU A 1 94  ? -7.556  24.983  42.600  1.00 64.21  ? 111 GLU A CG  1 
ATOM   616  C CD  . GLU A 1 94  ? -8.957  24.402  42.532  1.00 72.85  ? 111 GLU A CD  1 
ATOM   617  O OE1 . GLU A 1 94  ? -9.897  25.097  42.047  1.00 69.23  ? 111 GLU A OE1 1 
ATOM   618  O OE2 . GLU A 1 94  ? -9.096  23.239  42.986  1.00 77.57  ? 111 GLU A OE2 1 
ATOM   619  N N   . ASP A 1 95  ? -6.752  28.507  40.072  1.00 42.81  ? 112 ASP A N   1 
ATOM   620  C CA  . ASP A 1 95  ? -7.000  29.842  39.578  1.00 44.90  ? 112 ASP A CA  1 
ATOM   621  C C   . ASP A 1 95  ? -7.113  29.844  38.053  1.00 45.63  ? 112 ASP A C   1 
ATOM   622  O O   . ASP A 1 95  ? -7.993  30.509  37.465  1.00 54.76  ? 112 ASP A O   1 
ATOM   623  C CB  . ASP A 1 95  ? -5.852  30.746  40.017  1.00 52.22  ? 112 ASP A CB  1 
ATOM   624  C CG  . ASP A 1 95  ? -6.098  32.203  39.686  1.00 60.64  ? 112 ASP A CG  1 
ATOM   625  O OD1 . ASP A 1 95  ? -7.041  32.788  40.288  1.00 69.49  ? 112 ASP A OD1 1 
ATOM   626  O OD2 . ASP A 1 95  ? -5.355  32.750  38.827  1.00 62.70  ? 112 ASP A OD2 1 
ATOM   627  N N   . TYR A 1 96  ? -6.208  29.105  37.413  1.00 39.51  ? 113 TYR A N   1 
ATOM   628  C CA  . TYR A 1 96  ? -6.126  29.044  35.966  1.00 39.10  ? 113 TYR A CA  1 
ATOM   629  C C   . TYR A 1 96  ? -7.375  28.425  35.405  1.00 40.16  ? 113 TYR A C   1 
ATOM   630  O O   . TYR A 1 96  ? -7.924  28.945  34.429  1.00 38.72  ? 113 TYR A O   1 
ATOM   631  C CB  . TYR A 1 96  ? -4.926  28.178  35.593  1.00 45.67  ? 113 TYR A CB  1 
ATOM   632  C CG  . TYR A 1 96  ? -4.628  28.070  34.118  1.00 44.79  ? 113 TYR A CG  1 
ATOM   633  C CD1 . TYR A 1 96  ? -4.675  29.189  33.288  1.00 46.29  ? 113 TYR A CD1 1 
ATOM   634  C CD2 . TYR A 1 96  ? -4.266  26.838  33.552  1.00 47.11  ? 113 TYR A CD2 1 
ATOM   635  C CE1 . TYR A 1 96  ? -4.403  29.080  31.927  1.00 52.26  ? 113 TYR A CE1 1 
ATOM   636  C CE2 . TYR A 1 96  ? -3.989  26.727  32.188  1.00 50.66  ? 113 TYR A CE2 1 
ATOM   637  C CZ  . TYR A 1 96  ? -4.062  27.849  31.388  1.00 46.37  ? 113 TYR A CZ  1 
ATOM   638  O OH  . TYR A 1 96  ? -3.780  27.741  30.064  1.00 54.73  ? 113 TYR A OH  1 
ATOM   639  N N   . GLU A 1 97  ? -7.831  27.341  36.046  1.00 38.92  ? 114 GLU A N   1 
ATOM   640  C CA  . GLU A 1 97  ? -9.089  26.706  35.655  1.00 43.70  ? 114 GLU A CA  1 
ATOM   641  C C   . GLU A 1 97  ? -10.301 27.625  35.797  1.00 46.36  ? 114 GLU A C   1 
ATOM   642  O O   . GLU A 1 97  ? -11.128 27.701  34.896  1.00 51.96  ? 114 GLU A O   1 
ATOM   643  C CB  . GLU A 1 97  ? -9.348  25.437  36.455  1.00 42.67  ? 114 GLU A CB  1 
ATOM   644  C CG  . GLU A 1 97  ? -8.502  24.241  36.080  1.00 39.04  ? 114 GLU A CG  1 
ATOM   645  C CD  . GLU A 1 97  ? -8.485  23.213  37.202  1.00 46.34  ? 114 GLU A CD  1 
ATOM   646  O OE1 . GLU A 1 97  ? -9.480  23.098  37.959  1.00 50.35  ? 114 GLU A OE1 1 
ATOM   647  O OE2 . GLU A 1 97  ? -7.463  22.520  37.354  1.00 44.32  ? 114 GLU A OE2 1 
ATOM   648  N N   . GLU A 1 98  ? -10.436 28.305  36.930  1.00 49.18  ? 115 GLU A N   1 
ATOM   649  C CA  . GLU A 1 98  ? -11.534 29.263  37.091  1.00 44.33  ? 115 GLU A CA  1 
ATOM   650  C C   . GLU A 1 98  ? -11.503 30.296  35.969  1.00 43.78  ? 115 GLU A C   1 
ATOM   651  O O   . GLU A 1 98  ? -12.554 30.634  35.391  1.00 42.77  ? 115 GLU A O   1 
ATOM   652  C CB  . GLU A 1 98  ? -11.488 29.932  38.470  1.00 47.83  ? 115 GLU A CB  1 
ATOM   653  C CG  . GLU A 1 98  ? -12.141 29.085  39.575  1.00 60.95  ? 115 GLU A CG  1 
ATOM   654  C CD  . GLU A 1 98  ? -11.371 29.009  40.919  1.00 69.43  ? 115 GLU A CD  1 
ATOM   655  O OE1 . GLU A 1 98  ? -10.652 29.971  41.324  1.00 63.86  ? 115 GLU A OE1 1 
ATOM   656  O OE2 . GLU A 1 98  ? -11.495 27.954  41.596  1.00 72.56  ? 115 GLU A OE2 1 
ATOM   657  N N   . LYS A 1 99  ? -10.306 30.770  35.631  1.00 37.78  ? 116 LYS A N   1 
ATOM   658  C CA  . LYS A 1 99  ? -10.188 31.860  34.672  1.00 40.21  ? 116 LYS A CA  1 
ATOM   659  C C   . LYS A 1 99  ? -10.374 31.456  33.217  1.00 42.94  ? 116 LYS A C   1 
ATOM   660  O O   . LYS A 1 99  ? -11.104 32.145  32.457  1.00 42.08  ? 116 LYS A O   1 
ATOM   661  C CB  . LYS A 1 99  ? -8.875  32.585  34.856  1.00 44.79  ? 116 LYS A CB  1 
ATOM   662  C CG  . LYS A 1 99  ? -9.029  33.735  35.822  1.00 48.15  ? 116 LYS A CG  1 
ATOM   663  C CD  . LYS A 1 99  ? -7.681  34.327  36.150  1.00 55.42  ? 116 LYS A CD  1 
ATOM   664  C CE  . LYS A 1 99  ? -7.665  34.874  37.561  1.00 53.51  ? 116 LYS A CE  1 
ATOM   665  N NZ  . LYS A 1 99  ? -6.436  35.696  37.738  1.00 57.96  ? 116 LYS A NZ  1 
ATOM   666  N N   . LEU A 1 100 ? -9.746  30.343  32.821  1.00 41.83  ? 117 LEU A N   1 
ATOM   667  C CA  . LEU A 1 100 ? -10.142 29.699  31.562  1.00 42.46  ? 117 LEU A CA  1 
ATOM   668  C C   . LEU A 1 100 ? -11.649 29.468  31.475  1.00 39.71  ? 117 LEU A C   1 
ATOM   669  O O   . LEU A 1 100 ? -12.259 29.725  30.437  1.00 42.45  ? 117 LEU A O   1 
ATOM   670  C CB  . LEU A 1 100 ? -9.464  28.360  31.375  1.00 43.83  ? 117 LEU A CB  1 
ATOM   671  C CG  . LEU A 1 100 ? -8.062  28.339  30.806  1.00 46.83  ? 117 LEU A CG  1 
ATOM   672  C CD1 . LEU A 1 100 ? -7.640  26.899  31.060  1.00 41.38  ? 117 LEU A CD1 1 
ATOM   673  C CD2 . LEU A 1 100 ? -8.067  28.678  29.318  1.00 40.07  ? 117 LEU A CD2 1 
ATOM   674  N N   . ALA A 1 101 ? -12.263 28.973  32.537  1.00 36.31  ? 118 ALA A N   1 
ATOM   675  C CA  . ALA A 1 101 ? -13.717 28.856  32.509  1.00 38.13  ? 118 ALA A CA  1 
ATOM   676  C C   . ALA A 1 101 ? -14.450 30.182  32.158  1.00 41.74  ? 118 ALA A C   1 
ATOM   677  O O   . ALA A 1 101 ? -15.342 30.170  31.330  1.00 46.86  ? 118 ALA A O   1 
ATOM   678  C CB  . ALA A 1 101 ? -14.218 28.296  33.811  1.00 38.97  ? 118 ALA A CB  1 
ATOM   679  N N   . ASP A 1 102 ? -14.071 31.308  32.754  1.00 41.29  ? 119 ASP A N   1 
ATOM   680  C CA  . ASP A 1 102 ? -14.851 32.538  32.624  1.00 43.09  ? 119 ASP A CA  1 
ATOM   681  C C   . ASP A 1 102 ? -14.534 33.262  31.349  1.00 45.37  ? 119 ASP A C   1 
ATOM   682  O O   . ASP A 1 102 ? -15.419 33.839  30.668  1.00 47.15  ? 119 ASP A O   1 
ATOM   683  C CB  . ASP A 1 102 ? -14.595 33.473  33.818  1.00 44.59  ? 119 ASP A CB  1 
ATOM   684  C CG  . ASP A 1 102 ? -15.575 33.239  34.964  1.00 52.96  ? 119 ASP A CG  1 
ATOM   685  O OD1 . ASP A 1 102 ? -16.728 32.780  34.735  1.00 50.31  ? 119 ASP A OD1 1 
ATOM   686  O OD2 . ASP A 1 102 ? -15.190 33.515  36.124  1.00 62.31  ? 119 ASP A OD2 1 
ATOM   687  N N   . GLN A 1 103 ? -13.250 33.268  31.051  1.00 42.86  ? 120 GLN A N   1 
ATOM   688  C CA  . GLN A 1 103 ? -12.723 34.069  29.955  1.00 40.42  ? 120 GLN A CA  1 
ATOM   689  C C   . GLN A 1 103 ? -12.776 33.401  28.559  1.00 38.33  ? 120 GLN A C   1 
ATOM   690  O O   . GLN A 1 103 ? -12.753 34.082  27.549  1.00 43.94  ? 120 GLN A O   1 
ATOM   691  C CB  . GLN A 1 103 ? -11.284 34.528  30.323  1.00 34.29  ? 120 GLN A CB  1 
ATOM   692  C CG  . GLN A 1 103 ? -11.261 35.858  31.056  1.00 32.22  ? 120 GLN A CG  1 
ATOM   693  C CD  . GLN A 1 103 ? -9.964  36.114  31.770  1.00 36.16  ? 120 GLN A CD  1 
ATOM   694  O OE1 . GLN A 1 103 ? -8.890  36.175  31.162  1.00 35.36  ? 120 GLN A OE1 1 
ATOM   695  N NE2 . GLN A 1 103 ? -10.047 36.218  33.099  1.00 38.00  ? 120 GLN A NE2 1 
ATOM   696  N N   . ALA A 1 104 ? -12.851 32.077  28.507  1.00 38.52  ? 121 ALA A N   1 
ATOM   697  C CA  . ALA A 1 104 ? -12.795 31.323  27.234  1.00 38.65  ? 121 ALA A CA  1 
ATOM   698  C C   . ALA A 1 104 ? -14.051 30.489  27.035  1.00 35.81  ? 121 ALA A C   1 
ATOM   699  O O   . ALA A 1 104 ? -14.736 30.627  26.025  1.00 39.71  ? 121 ALA A O   1 
ATOM   700  C CB  . ALA A 1 104 ? -11.548 30.411  27.180  1.00 34.71  ? 121 ALA A CB  1 
ATOM   701  N N   . VAL A 1 105 ? -14.362 29.612  27.992  1.00 36.50  ? 122 VAL A N   1 
ATOM   702  C CA  . VAL A 1 105 ? -15.567 28.770  27.890  1.00 35.11  ? 122 VAL A CA  1 
ATOM   703  C C   . VAL A 1 105 ? -16.853 29.561  28.026  1.00 36.85  ? 122 VAL A C   1 
ATOM   704  O O   . VAL A 1 105 ? -17.660 29.584  27.095  1.00 44.38  ? 122 VAL A O   1 
ATOM   705  C CB  . VAL A 1 105 ? -15.566 27.605  28.849  1.00 35.81  ? 122 VAL A CB  1 
ATOM   706  C CG1 . VAL A 1 105 ? -16.709 26.668  28.476  1.00 34.12  ? 122 VAL A CG1 1 
ATOM   707  C CG2 . VAL A 1 105 ? -14.217 26.889  28.736  1.00 34.23  ? 122 VAL A CG2 1 
ATOM   708  N N   . ARG A 1 106 ? -17.040 30.271  29.113  1.00 31.78  ? 123 ARG A N   1 
ATOM   709  C CA  . ARG A 1 106 ? -18.280 31.081  29.215  1.00 32.65  ? 123 ARG A CA  1 
ATOM   710  C C   . ARG A 1 106 ? -18.385 32.284  28.283  1.00 35.56  ? 123 ARG A C   1 
ATOM   711  O O   . ARG A 1 106 ? -19.483 32.715  27.920  1.00 34.16  ? 123 ARG A O   1 
ATOM   712  C CB  . ARG A 1 106 ? -18.539 31.461  30.657  1.00 29.45  ? 123 ARG A CB  1 
ATOM   713  C CG  . ARG A 1 106 ? -18.196 30.290  31.544  1.00 33.13  ? 123 ARG A CG  1 
ATOM   714  C CD  . ARG A 1 106 ? -18.686 30.494  32.927  1.00 35.95  ? 123 ARG A CD  1 
ATOM   715  N NE  . ARG A 1 106 ? -18.706 29.230  33.657  1.00 34.10  ? 123 ARG A NE  1 
ATOM   716  C CZ  . ARG A 1 106 ? -18.157 29.083  34.855  1.00 34.37  ? 123 ARG A CZ  1 
ATOM   717  N NH1 . ARG A 1 106 ? -17.496 30.116  35.410  1.00 32.25  ? 123 ARG A NH1 1 
ATOM   718  N NH2 . ARG A 1 106 ? -18.279 27.924  35.497  1.00 31.40  ? 123 ARG A NH2 1 
ATOM   719  N N   . THR A 1 107 ? -17.242 32.825  27.876  1.00 35.25  ? 124 THR A N   1 
ATOM   720  C CA  . THR A 1 107 ? -17.269 33.795  26.787  1.00 34.05  ? 124 THR A CA  1 
ATOM   721  C C   . THR A 1 107 ? -17.855 33.201  25.486  1.00 36.68  ? 124 THR A C   1 
ATOM   722  O O   . THR A 1 107 ? -18.616 33.851  24.763  1.00 39.02  ? 124 THR A O   1 
ATOM   723  C CB  . THR A 1 107 ? -15.879 34.374  26.595  1.00 30.05  ? 124 THR A CB  1 
ATOM   724  O OG1 . THR A 1 107 ? -15.627 35.198  27.714  1.00 30.76  ? 124 THR A OG1 1 
ATOM   725  C CG2 . THR A 1 107 ? -15.814 35.235  25.423  1.00 32.27  ? 124 THR A CG2 1 
ATOM   726  N N   . MET A 1 108 ? -17.496 31.961  25.186  1.00 38.45  ? 125 MET A N   1 
ATOM   727  C CA  . MET A 1 108 ? -18.091 31.301  24.025  1.00 39.79  ? 125 MET A CA  1 
ATOM   728  C C   . MET A 1 108 ? -19.552 30.966  24.269  1.00 33.83  ? 125 MET A C   1 
ATOM   729  O O   . MET A 1 108 ? -20.347 30.969  23.343  1.00 38.62  ? 125 MET A O   1 
ATOM   730  C CB  . MET A 1 108 ? -17.312 30.036  23.633  1.00 39.25  ? 125 MET A CB  1 
ATOM   731  C CG  . MET A 1 108 ? -16.027 30.314  22.897  1.00 34.03  ? 125 MET A CG  1 
ATOM   732  S SD  . MET A 1 108 ? -16.280 31.020  21.241  1.00 40.54  ? 125 MET A SD  1 
ATOM   733  C CE  . MET A 1 108 ? -17.596 30.105  20.474  1.00 38.83  ? 125 MET A CE  1 
ATOM   734  N N   . GLU A 1 109 ? -19.911 30.676  25.499  1.00 33.01  ? 126 GLU A N   1 
ATOM   735  C CA  . GLU A 1 109 ? -21.313 30.347  25.806  1.00 37.13  ? 126 GLU A CA  1 
ATOM   736  C C   . GLU A 1 109 ? -22.263 31.504  25.557  1.00 39.69  ? 126 GLU A C   1 
ATOM   737  O O   . GLU A 1 109 ? -23.346 31.328  24.974  1.00 36.66  ? 126 GLU A O   1 
ATOM   738  C CB  . GLU A 1 109 ? -21.440 29.832  27.242  1.00 37.74  ? 126 GLU A CB  1 
ATOM   739  C CG  . GLU A 1 109 ? -21.097 28.349  27.335  1.00 34.62  ? 126 GLU A CG  1 
ATOM   740  C CD  . GLU A 1 109 ? -20.773 27.890  28.742  1.00 39.91  ? 126 GLU A CD  1 
ATOM   741  O OE1 . GLU A 1 109 ? -20.779 28.707  29.678  1.00 40.64  ? 126 GLU A OE1 1 
ATOM   742  O OE2 . GLU A 1 109 ? -20.512 26.684  28.924  1.00 44.24  ? 126 GLU A OE2 1 
ATOM   743  N N   . ILE A 1 110 ? -21.834 32.706  25.952  1.00 43.08  ? 127 ILE A N   1 
ATOM   744  C CA  . ILE A 1 110 ? -22.641 33.902  25.702  1.00 44.02  ? 127 ILE A CA  1 
ATOM   745  C C   . ILE A 1 110 ? -22.762 34.072  24.190  1.00 42.80  ? 127 ILE A C   1 
ATOM   746  O O   . ILE A 1 110 ? -23.849 34.396  23.687  1.00 42.29  ? 127 ILE A O   1 
ATOM   747  C CB  . ILE A 1 110 ? -22.084 35.164  26.429  1.00 48.53  ? 127 ILE A CB  1 
ATOM   748  C CG1 . ILE A 1 110 ? -22.185 34.975  27.966  1.00 44.29  ? 127 ILE A CG1 1 
ATOM   749  C CG2 . ILE A 1 110 ? -22.829 36.446  26.022  1.00 42.71  ? 127 ILE A CG2 1 
ATOM   750  C CD1 . ILE A 1 110 ? -20.991 35.474  28.742  1.00 42.65  ? 127 ILE A CD1 1 
ATOM   751  N N   . TYR A 1 111 ? -21.652 33.822  23.487  1.00 36.21  ? 128 TYR A N   1 
ATOM   752  C CA  . TYR A 1 111 ? -21.574 34.027  22.035  1.00 35.63  ? 128 TYR A CA  1 
ATOM   753  C C   . TYR A 1 111 ? -22.423 33.040  21.230  1.00 40.75  ? 128 TYR A C   1 
ATOM   754  O O   . TYR A 1 111 ? -23.371 33.442  20.556  1.00 35.58  ? 128 TYR A O   1 
ATOM   755  C CB  . TYR A 1 111 ? -20.133 34.030  21.585  1.00 31.25  ? 128 TYR A CB  1 
ATOM   756  C CG  . TYR A 1 111 ? -19.881 34.047  20.097  1.00 36.36  ? 128 TYR A CG  1 
ATOM   757  C CD1 . TYR A 1 111 ? -20.091 35.202  19.316  1.00 37.76  ? 128 TYR A CD1 1 
ATOM   758  C CD2 . TYR A 1 111 ? -19.378 32.904  19.451  1.00 34.37  ? 128 TYR A CD2 1 
ATOM   759  C CE1 . TYR A 1 111 ? -19.811 35.197  17.934  1.00 39.71  ? 128 TYR A CE1 1 
ATOM   760  C CE2 . TYR A 1 111 ? -19.151 32.894  18.079  1.00 33.52  ? 128 TYR A CE2 1 
ATOM   761  C CZ  . TYR A 1 111 ? -19.336 34.019  17.320  1.00 36.98  ? 128 TYR A CZ  1 
ATOM   762  O OH  . TYR A 1 111 ? -19.041 33.949  15.943  1.00 41.46  ? 128 TYR A OH  1 
ATOM   763  N N   . VAL A 1 112 ? -22.096 31.750  21.304  1.00 41.35  ? 129 VAL A N   1 
ATOM   764  C CA  . VAL A 1 112 ? -22.916 30.750  20.616  1.00 40.06  ? 129 VAL A CA  1 
ATOM   765  C C   . VAL A 1 112 ? -24.403 30.828  20.968  1.00 34.79  ? 129 VAL A C   1 
ATOM   766  O O   . VAL A 1 112 ? -25.239 30.514  20.139  1.00 42.36  ? 129 VAL A O   1 
ATOM   767  C CB  . VAL A 1 112 ? -22.352 29.301  20.725  1.00 36.68  ? 129 VAL A CB  1 
ATOM   768  C CG1 . VAL A 1 112 ? -21.008 29.259  20.057  1.00 34.95  ? 129 VAL A CG1 1 
ATOM   769  C CG2 . VAL A 1 112 ? -22.258 28.835  22.152  1.00 35.67  ? 129 VAL A CG2 1 
ATOM   770  N N   . ALA A 1 113 ? -24.746 31.300  22.143  1.00 33.59  ? 130 ALA A N   1 
ATOM   771  C CA  . ALA A 1 113 ? -26.184 31.354  22.543  1.00 36.86  ? 130 ALA A CA  1 
ATOM   772  C C   . ALA A 1 113 ? -27.016 32.294  21.689  1.00 32.80  ? 130 ALA A C   1 
ATOM   773  O O   . ALA A 1 113 ? -28.225 32.153  21.623  1.00 37.91  ? 130 ALA A O   1 
ATOM   774  C CB  . ALA A 1 113 ? -26.354 31.729  24.016  1.00 37.30  ? 130 ALA A CB  1 
ATOM   775  N N   . GLN A 1 114 ? -26.381 33.230  21.006  1.00 32.38  ? 131 GLN A N   1 
ATOM   776  C CA  . GLN A 1 114 ? -27.132 34.139  20.128  1.00 35.16  ? 131 GLN A CA  1 
ATOM   777  C C   . GLN A 1 114 ? -27.739 33.408  18.958  1.00 38.98  ? 131 GLN A C   1 
ATOM   778  O O   . GLN A 1 114 ? -28.618 33.935  18.270  1.00 42.87  ? 131 GLN A O   1 
ATOM   779  C CB  . GLN A 1 114 ? -26.247 35.264  19.617  1.00 34.68  ? 131 GLN A CB  1 
ATOM   780  C CG  . GLN A 1 114 ? -25.470 35.993  20.704  1.00 38.54  ? 131 GLN A CG  1 
ATOM   781  C CD  . GLN A 1 114 ? -24.462 36.964  20.113  1.00 42.13  ? 131 GLN A CD  1 
ATOM   782  O OE1 . GLN A 1 114 ? -23.282 36.660  19.959  1.00 45.16  ? 131 GLN A OE1 1 
ATOM   783  N NE2 . GLN A 1 114 ? -24.929 38.134  19.779  1.00 44.95  ? 131 GLN A NE2 1 
ATOM   784  N N   . PHE A 1 115 ? -27.260 32.187  18.725  1.00 44.79  ? 132 PHE A N   1 
ATOM   785  C CA  . PHE A 1 115 ? -27.620 31.423  17.519  1.00 43.13  ? 132 PHE A CA  1 
ATOM   786  C C   . PHE A 1 115 ? -29.009 30.778  17.636  1.00 41.56  ? 132 PHE A C   1 
ATOM   787  O O   . PHE A 1 115 ? -29.627 30.499  16.632  1.00 48.09  ? 132 PHE A O   1 
ATOM   788  C CB  . PHE A 1 115 ? -26.545 30.354  17.164  1.00 40.67  ? 132 PHE A CB  1 
ATOM   789  C CG  . PHE A 1 115 ? -25.132 30.893  16.994  1.00 38.47  ? 132 PHE A CG  1 
ATOM   790  C CD1 . PHE A 1 115 ? -24.877 32.271  16.690  1.00 39.60  ? 132 PHE A CD1 1 
ATOM   791  C CD2 . PHE A 1 115 ? -24.035 30.023  17.090  1.00 34.92  ? 132 PHE A CD2 1 
ATOM   792  C CE1 . PHE A 1 115 ? -23.573 32.757  16.512  1.00 30.72  ? 132 PHE A CE1 1 
ATOM   793  C CE2 . PHE A 1 115 ? -22.730 30.500  16.903  1.00 34.19  ? 132 PHE A CE2 1 
ATOM   794  C CZ  . PHE A 1 115 ? -22.501 31.867  16.620  1.00 33.27  ? 132 PHE A CZ  1 
ATOM   795  N N   . SER A 1 116 ? -29.507 30.539  18.840  1.00 46.32  ? 133 SER A N   1 
ATOM   796  C CA  . SER A 1 116 ? -30.909 30.084  18.981  1.00 47.29  ? 133 SER A CA  1 
ATOM   797  C C   . SER A 1 116 ? -31.911 30.990  18.280  1.00 48.67  ? 133 SER A C   1 
ATOM   798  O O   . SER A 1 116 ? -32.616 30.539  17.366  1.00 52.37  ? 133 SER A O   1 
ATOM   799  C CB  . SER A 1 116 ? -31.323 29.963  20.445  1.00 47.39  ? 133 SER A CB  1 
ATOM   800  O OG  . SER A 1 116 ? -30.873 28.737  20.972  1.00 55.82  ? 133 SER A OG  1 
ATOM   801  N N   . GLU A 1 117 ? -31.984 32.255  18.702  1.00 45.60  ? 134 GLU A N   1 
ATOM   802  C CA  . GLU A 1 117 ? -32.999 33.185  18.175  1.00 48.84  ? 134 GLU A CA  1 
ATOM   803  C C   . GLU A 1 117 ? -32.852 33.235  16.662  1.00 54.50  ? 134 GLU A C   1 
ATOM   804  O O   . GLU A 1 117 ? -33.837 33.143  15.893  1.00 51.84  ? 134 GLU A O   1 
ATOM   805  C CB  . GLU A 1 117 ? -32.859 34.591  18.790  1.00 54.48  ? 134 GLU A CB  1 
ATOM   806  C CG  . GLU A 1 117 ? -32.844 34.640  20.341  1.00 66.88  ? 134 GLU A CG  1 
ATOM   807  C CD  . GLU A 1 117 ? -31.417 34.697  20.959  1.00 78.22  ? 134 GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 117 ? -30.889 33.608  21.392  1.00 62.17  ? 134 GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 117 ? -30.821 35.834  20.996  1.00 64.64  ? 134 GLU A OE2 1 
ATOM   810  N N   . ILE A 1 118 ? -31.600 33.326  16.223  1.00 47.45  ? 135 ILE A N   1 
ATOM   811  C CA  . ILE A 1 118 ? -31.360 33.424  14.822  1.00 44.08  ? 135 ILE A CA  1 
ATOM   812  C C   . ILE A 1 118 ? -31.958 32.238  14.079  1.00 47.04  ? 135 ILE A C   1 
ATOM   813  O O   . ILE A 1 118 ? -32.793 32.448  13.203  1.00 51.44  ? 135 ILE A O   1 
ATOM   814  C CB  . ILE A 1 118 ? -29.889 33.691  14.515  1.00 42.04  ? 135 ILE A CB  1 
ATOM   815  C CG1 . ILE A 1 118 ? -29.528 35.050  15.076  1.00 45.11  ? 135 ILE A CG1 1 
ATOM   816  C CG2 . ILE A 1 118 ? -29.653 33.774  13.030  1.00 38.09  ? 135 ILE A CG2 1 
ATOM   817  C CD1 . ILE A 1 118 ? -29.897 36.154  14.119  1.00 50.59  ? 135 ILE A CD1 1 
ATOM   818  N N   . LYS A 1 119 ? -31.560 31.011  14.427  1.00 48.25  ? 136 LYS A N   1 
ATOM   819  C CA  . LYS A 1 119 ? -32.103 29.813  13.774  1.00 50.64  ? 136 LYS A CA  1 
ATOM   820  C C   . LYS A 1 119 ? -33.632 29.724  13.777  1.00 55.72  ? 136 LYS A C   1 
ATOM   821  O O   . LYS A 1 119 ? -34.210 29.274  12.787  1.00 58.60  ? 136 LYS A O   1 
ATOM   822  C CB  . LYS A 1 119 ? -31.549 28.542  14.397  1.00 50.21  ? 136 LYS A CB  1 
ATOM   823  C CG  . LYS A 1 119 ? -30.170 28.155  13.908  1.00 50.13  ? 136 LYS A CG  1 
ATOM   824  C CD  . LYS A 1 119 ? -29.512 27.313  14.988  1.00 47.22  ? 136 LYS A CD  1 
ATOM   825  C CE  . LYS A 1 119 ? -28.114 26.907  14.577  1.00 48.76  ? 136 LYS A CE  1 
ATOM   826  N NZ  . LYS A 1 119 ? -27.336 26.327  15.707  1.00 46.97  ? 136 LYS A NZ  1 
ATOM   827  N N   . GLU A 1 120 ? -34.283 30.135  14.871  1.00 56.62  ? 137 GLU A N   1 
ATOM   828  C CA  . GLU A 1 120 ? -35.748 30.124  14.906  1.00 59.49  ? 137 GLU A CA  1 
ATOM   829  C C   . GLU A 1 120 ? -36.363 31.258  14.049  1.00 60.52  ? 137 GLU A C   1 
ATOM   830  O O   . GLU A 1 120 ? -37.454 31.108  13.474  1.00 69.09  ? 137 GLU A O   1 
ATOM   831  C CB  . GLU A 1 120 ? -36.335 29.975  16.354  1.00 64.07  ? 137 GLU A CB  1 
ATOM   832  C CG  . GLU A 1 120 ? -36.457 31.218  17.254  1.00 73.69  ? 137 GLU A CG  1 
ATOM   833  C CD  . GLU A 1 120 ? -36.385 30.921  18.784  1.00 83.89  ? 137 GLU A CD  1 
ATOM   834  O OE1 . GLU A 1 120 ? -35.984 29.796  19.201  1.00 81.41  ? 137 GLU A OE1 1 
ATOM   835  O OE2 . GLU A 1 120 ? -36.715 31.829  19.599  1.00 63.88  ? 137 GLU A OE2 1 
ATOM   836  N N   . ARG A 1 121 ? -35.651 32.366  13.905  1.00 62.63  ? 138 ARG A N   1 
ATOM   837  C CA  . ARG A 1 121 ? -36.131 33.431  13.024  1.00 64.29  ? 138 ARG A CA  1 
ATOM   838  C C   . ARG A 1 121 ? -36.037 33.035  11.524  1.00 68.26  ? 138 ARG A C   1 
ATOM   839  O O   . ARG A 1 121 ? -36.957 33.357  10.737  1.00 66.21  ? 138 ARG A O   1 
ATOM   840  C CB  . ARG A 1 121 ? -35.393 34.719  13.329  1.00 63.82  ? 138 ARG A CB  1 
ATOM   841  C CG  . ARG A 1 121 ? -36.205 35.990  13.151  1.00 70.88  ? 138 ARG A CG  1 
ATOM   842  C CD  . ARG A 1 121 ? -35.478 37.179  13.777  1.00 71.35  ? 138 ARG A CD  1 
ATOM   843  N NE  . ARG A 1 121 ? -35.268 36.986  15.220  1.00 77.87  ? 138 ARG A NE  1 
ATOM   844  C CZ  . ARG A 1 121 ? -34.260 37.517  15.914  1.00 83.19  ? 138 ARG A CZ  1 
ATOM   845  N NH1 . ARG A 1 121 ? -33.373 38.270  15.286  1.00 75.72  ? 138 ARG A NH1 1 
ATOM   846  N NH2 . ARG A 1 121 ? -34.127 37.295  17.230  1.00 84.58  ? 138 ARG A NH2 1 
ATOM   847  N N   . ILE A 1 122 ? -34.963 32.314  11.150  1.00 60.27  ? 139 ILE A N   1 
ATOM   848  C CA  . ILE A 1 122 ? -34.778 31.774  9.780   1.00 55.83  ? 139 ILE A CA  1 
ATOM   849  C C   . ILE A 1 122 ? -35.715 30.616  9.424   1.00 63.01  ? 139 ILE A C   1 
ATOM   850  O O   . ILE A 1 122 ? -36.175 30.479  8.275   1.00 67.03  ? 139 ILE A O   1 
ATOM   851  C CB  . ILE A 1 122 ? -33.358 31.259  9.548   1.00 54.57  ? 139 ILE A CB  1 
ATOM   852  C CG1 . ILE A 1 122 ? -32.340 32.402  9.611   1.00 58.46  ? 139 ILE A CG1 1 
ATOM   853  C CG2 . ILE A 1 122 ? -33.266 30.566  8.198   1.00 54.54  ? 139 ILE A CG2 1 
ATOM   854  C CD1 . ILE A 1 122 ? -30.902 31.950  9.449   1.00 56.26  ? 139 ILE A CD1 1 
ATOM   855  N N   . ALA A 1 123 ? -35.981 29.752  10.394  1.00 70.45  ? 140 ALA A N   1 
ATOM   856  C CA  . ALA A 1 123 ? -36.894 28.655  10.144  1.00 75.05  ? 140 ALA A CA  1 
ATOM   857  C C   . ALA A 1 123 ? -38.277 29.278  9.962   1.00 85.08  ? 140 ALA A C   1 
ATOM   858  O O   . ALA A 1 123 ? -39.091 28.768  9.186   1.00 92.61  ? 140 ALA A O   1 
ATOM   859  C CB  . ALA A 1 123 ? -36.878 27.654  11.287  1.00 69.22  ? 140 ALA A CB  1 
ATOM   860  N N   . LYS A 1 124 ? -38.502 30.399  10.657  1.00 75.69  ? 141 LYS A N   1 
ATOM   861  C CA  . LYS A 1 124 ? -39.763 31.125  10.637  1.00 73.79  ? 141 LYS A CA  1 
ATOM   862  C C   . LYS A 1 124 ? -39.947 31.900  9.335   1.00 83.65  ? 141 LYS A C   1 
ATOM   863  O O   . LYS A 1 124 ? -41.048 31.991  8.764   1.00 89.97  ? 141 LYS A O   1 
ATOM   864  C CB  . LYS A 1 124 ? -39.793 32.084  11.805  1.00 66.54  ? 141 LYS A CB  1 
ATOM   865  C CG  . LYS A 1 124 ? -41.183 32.558  12.119  1.00 63.08  ? 141 LYS A CG  1 
ATOM   866  C CD  . LYS A 1 124 ? -41.410 33.978  11.667  1.00 66.32  ? 141 LYS A CD  1 
ATOM   867  C CE  . LYS A 1 124 ? -42.512 34.605  12.504  1.00 65.61  ? 141 LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 124 ? -42.262 34.469  13.966  1.00 55.77  ? 141 LYS A NZ  1 
ATOM   869  N N   . ARG A 1 125 ? -38.848 32.470  8.867   1.00 82.95  ? 142 ARG A N   1 
ATOM   870  C CA  . ARG A 1 125 ? -38.843 33.124  7.573   1.00 72.96  ? 142 ARG A CA  1 
ATOM   871  C C   . ARG A 1 125 ? -39.015 32.138  6.395   1.00 71.43  ? 142 ARG A C   1 
ATOM   872  O O   . ARG A 1 125 ? -39.306 32.557  5.291   1.00 63.64  ? 142 ARG A O   1 
ATOM   873  C CB  . ARG A 1 125 ? -37.570 33.962  7.459   1.00 64.11  ? 142 ARG A CB  1 
ATOM   874  C CG  . ARG A 1 125 ? -37.336 34.676  6.145   1.00 56.00  ? 142 ARG A CG  1 
ATOM   875  C CD  . ARG A 1 125 ? -36.352 33.864  5.339   1.00 57.48  ? 142 ARG A CD  1 
ATOM   876  N NE  . ARG A 1 125 ? -36.060 34.432  4.033   1.00 52.83  ? 142 ARG A NE  1 
ATOM   877  C CZ  . ARG A 1 125 ? -35.955 33.692  2.934   1.00 61.82  ? 142 ARG A CZ  1 
ATOM   878  N NH1 . ARG A 1 125 ? -36.150 32.379  3.024   1.00 67.45  ? 142 ARG A NH1 1 
ATOM   879  N NH2 . ARG A 1 125 ? -35.692 34.251  1.747   1.00 63.25  ? 142 ARG A NH2 1 
ATOM   880  N N   . GLY A 1 126 ? -38.838 30.838  6.627   1.00 79.55  ? 143 GLY A N   1 
ATOM   881  C CA  . GLY A 1 126 ? -39.037 29.822  5.569   1.00 73.14  ? 143 GLY A CA  1 
ATOM   882  C C   . GLY A 1 126 ? -40.509 29.483  5.400   1.00 73.45  ? 143 GLY A C   1 
ATOM   883  O O   . GLY A 1 126 ? -40.999 29.308  4.289   1.00 70.22  ? 143 GLY A O   1 
ATOM   884  N N   . ARG A 1 127 ? -41.206 29.399  6.526   1.00 73.05  ? 144 ARG A N   1 
ATOM   885  C CA  . ARG A 1 127 ? -42.640 29.198  6.566   1.00 74.93  ? 144 ARG A CA  1 
ATOM   886  C C   . ARG A 1 127 ? -43.390 30.321  5.837   1.00 79.34  ? 144 ARG A C   1 
ATOM   887  O O   . ARG A 1 127 ? -44.200 30.064  4.944   1.00 81.66  ? 144 ARG A O   1 
ATOM   888  C CB  . ARG A 1 127 ? -43.100 29.081  8.025   1.00 67.15  ? 144 ARG A CB  1 
ATOM   889  C CG  . ARG A 1 127 ? -42.519 27.844  8.698   1.00 62.23  ? 144 ARG A CG  1 
ATOM   890  C CD  . ARG A 1 127 ? -42.909 27.702  10.163  1.00 65.38  ? 144 ARG A CD  1 
ATOM   891  N NE  . ARG A 1 127 ? -42.890 28.908  11.012  1.00 61.85  ? 144 ARG A NE  1 
ATOM   892  C CZ  . ARG A 1 127 ? -42.171 29.012  12.139  1.00 61.54  ? 144 ARG A CZ  1 
ATOM   893  N NH1 . ARG A 1 127 ? -41.382 28.009  12.507  1.00 57.21  ? 144 ARG A NH1 1 
ATOM   894  N NH2 . ARG A 1 127 ? -42.223 30.111  12.906  1.00 51.28  ? 144 ARG A NH2 1 
ATOM   895  N N   . LYS A 1 128 ? -43.087 31.558  6.211   1.00 75.49  ? 145 LYS A N   1 
ATOM   896  C CA  . LYS A 1 128 ? -43.685 32.759  5.618   1.00 67.18  ? 145 LYS A CA  1 
ATOM   897  C C   . LYS A 1 128 ? -43.437 32.960  4.101   1.00 68.77  ? 145 LYS A C   1 
ATOM   898  O O   . LYS A 1 128 ? -44.200 33.672  3.424   1.00 63.06  ? 145 LYS A O   1 
ATOM   899  C CB  . LYS A 1 128 ? -43.216 33.973  6.423   1.00 66.36  ? 145 LYS A CB  1 
ATOM   900  C CG  . LYS A 1 128 ? -43.594 33.895  7.895   1.00 57.06  ? 145 LYS A CG  1 
ATOM   901  C CD  . LYS A 1 128 ? -45.007 34.401  8.089   1.00 57.66  ? 145 LYS A CD  1 
ATOM   902  C CE  . LYS A 1 128 ? -45.542 34.164  9.494   1.00 66.19  ? 145 LYS A CE  1 
ATOM   903  N NZ  . LYS A 1 128 ? -45.501 32.711  9.814   1.00 67.65  ? 145 LYS A NZ  1 
ATOM   904  N N   . LEU A 1 129 ? -42.374 32.340  3.585   1.00 66.77  ? 146 LEU A N   1 
ATOM   905  C CA  . LEU A 1 129 ? -42.098 32.300  2.140   1.00 71.92  ? 146 LEU A CA  1 
ATOM   906  C C   . LEU A 1 129 ? -42.892 31.168  1.482   1.00 78.58  ? 146 LEU A C   1 
ATOM   907  O O   . LEU A 1 129 ? -43.116 31.181  0.275   1.00 76.81  ? 146 LEU A O   1 
ATOM   908  C CB  . LEU A 1 129 ? -40.598 32.120  1.869   1.00 64.08  ? 146 LEU A CB  1 
ATOM   909  C CG  . LEU A 1 129 ? -40.058 31.858  0.462   1.00 64.87  ? 146 LEU A CG  1 
ATOM   910  C CD1 . LEU A 1 129 ? -40.560 32.865  -0.565  1.00 69.00  ? 146 LEU A CD1 1 
ATOM   911  C CD2 . LEU A 1 129 ? -38.540 31.828  0.469   1.00 61.35  ? 146 LEU A CD2 1 
ATOM   912  N N   . VAL A 1 130 ? -43.284 30.184  2.287   1.00 81.29  ? 147 VAL A N   1 
ATOM   913  C CA  . VAL A 1 130 ? -44.270 29.185  1.889   1.00 83.09  ? 147 VAL A CA  1 
ATOM   914  C C   . VAL A 1 130 ? -45.664 29.812  1.892   1.00 93.94  ? 147 VAL A C   1 
ATOM   915  O O   . VAL A 1 130 ? -46.497 29.481  1.051   1.00 92.90  ? 147 VAL A O   1 
ATOM   916  C CB  . VAL A 1 130 ? -44.222 27.949  2.809   1.00 81.18  ? 147 VAL A CB  1 
ATOM   917  C CG1 . VAL A 1 130 ? -45.616 27.533  3.276   1.00 74.61  ? 147 VAL A CG1 1 
ATOM   918  C CG2 . VAL A 1 130 ? -43.465 26.825  2.115   1.00 79.47  ? 147 VAL A CG2 1 
ATOM   919  N N   . ASP A 1 131 ? -45.904 30.732  2.827   1.00 96.32  ? 148 ASP A N   1 
ATOM   920  C CA  . ASP A 1 131 ? -47.145 31.506  2.850   1.00 93.36  ? 148 ASP A CA  1 
ATOM   921  C C   . ASP A 1 131 ? -47.247 32.397  1.613   1.00 102.06 ? 148 ASP A C   1 
ATOM   922  O O   . ASP A 1 131 ? -48.337 32.611  1.067   1.00 102.60 ? 148 ASP A O   1 
ATOM   923  C CB  . ASP A 1 131 ? -47.229 32.339  4.126   1.00 84.97  ? 148 ASP A CB  1 
ATOM   924  C CG  . ASP A 1 131 ? -47.744 31.542  5.297   1.00 81.79  ? 148 ASP A CG  1 
ATOM   925  O OD1 . ASP A 1 131 ? -47.704 30.296  5.212   1.00 72.81  ? 148 ASP A OD1 1 
ATOM   926  O OD2 . ASP A 1 131 ? -48.204 32.162  6.287   1.00 77.43  ? 148 ASP A OD2 1 
ATOM   927  N N   . TYR A 1 132 ? -46.085 32.895  1.196   1.00 99.66  ? 149 TYR A N   1 
ATOM   928  C CA  . TYR A 1 132 ? -45.913 33.671  -0.009  1.00 92.53  ? 149 TYR A CA  1 
ATOM   929  C C   . TYR A 1 132 ? -46.210 32.809  -1.234  1.00 94.10  ? 149 TYR A C   1 
ATOM   930  O O   . TYR A 1 132 ? -47.118 33.112  -2.001  1.00 91.51  ? 149 TYR A O   1 
ATOM   931  C CB  . TYR A 1 132 ? -44.465 34.159  -0.051  1.00 92.80  ? 149 TYR A CB  1 
ATOM   932  C CG  . TYR A 1 132 ? -44.182 35.315  -0.978  1.00 87.71  ? 149 TYR A CG  1 
ATOM   933  C CD1 . TYR A 1 132 ? -45.072 36.366  -1.100  1.00 83.14  ? 149 TYR A CD1 1 
ATOM   934  C CD2 . TYR A 1 132 ? -42.993 35.370  -1.703  1.00 93.23  ? 149 TYR A CD2 1 
ATOM   935  C CE1 . TYR A 1 132 ? -44.803 37.428  -1.938  1.00 89.86  ? 149 TYR A CE1 1 
ATOM   936  C CE2 . TYR A 1 132 ? -42.709 36.437  -2.541  1.00 94.06  ? 149 TYR A CE2 1 
ATOM   937  C CZ  . TYR A 1 132 ? -43.624 37.468  -2.648  1.00 94.79  ? 149 TYR A CZ  1 
ATOM   938  O OH  . TYR A 1 132 ? -43.376 38.538  -3.475  1.00 88.84  ? 149 TYR A OH  1 
ATOM   939  N N   . ASP A 1 133 ? -45.449 31.727  -1.396  1.00 93.30  ? 150 ASP A N   1 
ATOM   940  C CA  . ASP A 1 133 ? -45.508 30.876  -2.595  1.00 103.31 ? 150 ASP A CA  1 
ATOM   941  C C   . ASP A 1 133 ? -46.880 30.239  -2.889  1.00 100.64 ? 150 ASP A C   1 
ATOM   942  O O   . ASP A 1 133 ? -47.192 29.941  -4.048  1.00 104.68 ? 150 ASP A O   1 
ATOM   943  C CB  . ASP A 1 133 ? -44.413 29.788  -2.553  1.00 111.37 ? 150 ASP A CB  1 
ATOM   944  C CG  . ASP A 1 133 ? -43.026 30.298  -2.998  1.00 114.34 ? 150 ASP A CG  1 
ATOM   945  O OD1 . ASP A 1 133 ? -42.830 31.527  -3.171  1.00 119.16 ? 150 ASP A OD1 1 
ATOM   946  O OD2 . ASP A 1 133 ? -42.119 29.449  -3.172  1.00 107.86 ? 150 ASP A OD2 1 
ATOM   947  N N   . SER A 1 134 ? -47.676 30.015  -1.846  1.00 97.06  ? 151 SER A N   1 
ATOM   948  C CA  . SER A 1 134 ? -49.000 29.399  -1.988  1.00 95.69  ? 151 SER A CA  1 
ATOM   949  C C   . SER A 1 134 ? -50.023 30.457  -2.378  1.00 103.54 ? 151 SER A C   1 
ATOM   950  O O   . SER A 1 134 ? -50.907 30.218  -3.220  1.00 102.71 ? 151 SER A O   1 
ATOM   951  C CB  . SER A 1 134 ? -49.426 28.721  -0.683  1.00 82.98  ? 151 SER A CB  1 
ATOM   952  O OG  . SER A 1 134 ? -49.645 29.684  0.337   1.00 80.72  ? 151 SER A OG  1 
ATOM   953  N N   . ALA A 1 135 ? -49.890 31.622  -1.743  1.00 106.27 ? 152 ALA A N   1 
ATOM   954  C CA  . ALA A 1 135 ? -50.700 32.795  -2.038  1.00 110.47 ? 152 ALA A CA  1 
ATOM   955  C C   . ALA A 1 135 ? -50.651 33.156  -3.540  1.00 112.99 ? 152 ALA A C   1 
ATOM   956  O O   . ALA A 1 135 ? -51.704 33.294  -4.173  1.00 103.01 ? 152 ALA A O   1 
ATOM   957  C CB  . ALA A 1 135 ? -50.245 33.958  -1.167  1.00 104.65 ? 152 ALA A CB  1 
ATOM   958  N N   . ARG A 1 136 ? -49.428 33.272  -4.084  1.00 118.22 ? 153 ARG A N   1 
ATOM   959  C CA  . ARG A 1 136 ? -49.145 33.478  -5.528  1.00 124.20 ? 153 ARG A CA  1 
ATOM   960  C C   . ARG A 1 136 ? -49.867 32.481  -6.447  1.00 134.90 ? 153 ARG A C   1 
ATOM   961  O O   . ARG A 1 136 ? -50.328 32.851  -7.534  1.00 138.93 ? 153 ARG A O   1 
ATOM   962  C CB  . ARG A 1 136 ? -47.638 33.355  -5.812  1.00 113.62 ? 153 ARG A CB  1 
ATOM   963  C CG  . ARG A 1 136 ? -46.783 34.611  -5.684  1.00 108.54 ? 153 ARG A CG  1 
ATOM   964  C CD  . ARG A 1 136 ? -45.313 34.197  -5.765  1.00 116.94 ? 153 ARG A CD  1 
ATOM   965  N NE  . ARG A 1 136 ? -44.357 35.282  -6.030  1.00 112.93 ? 153 ARG A NE  1 
ATOM   966  C CZ  . ARG A 1 136 ? -43.028 35.127  -6.057  1.00 97.81  ? 153 ARG A CZ  1 
ATOM   967  N NH1 . ARG A 1 136 ? -42.494 33.935  -5.823  1.00 91.24  ? 153 ARG A NH1 1 
ATOM   968  N NH2 . ARG A 1 136 ? -42.225 36.162  -6.307  1.00 82.37  ? 153 ARG A NH2 1 
ATOM   969  N N   . HIS A 1 137 ? -49.920 31.218  -6.016  1.00 136.74 ? 154 HIS A N   1 
ATOM   970  C CA  . HIS A 1 137 ? -50.599 30.143  -6.740  1.00 127.44 ? 154 HIS A CA  1 
ATOM   971  C C   . HIS A 1 137 ? -52.120 30.315  -6.641  1.00 126.83 ? 154 HIS A C   1 
ATOM   972  O O   . HIS A 1 137 ? -52.806 30.411  -7.664  1.00 120.09 ? 154 HIS A O   1 
ATOM   973  C CB  . HIS A 1 137 ? -50.139 28.778  -6.198  1.00 121.70 ? 154 HIS A CB  1 
ATOM   974  C CG  . HIS A 1 137 ? -50.924 27.607  -6.714  1.00 131.87 ? 154 HIS A CG  1 
ATOM   975  N ND1 . HIS A 1 137 ? -52.020 27.093  -6.052  1.00 127.07 ? 154 HIS A ND1 1 
ATOM   976  C CD2 . HIS A 1 137 ? -50.755 26.832  -7.813  1.00 131.67 ? 154 HIS A CD2 1 
ATOM   977  C CE1 . HIS A 1 137 ? -52.499 26.063  -6.725  1.00 121.64 ? 154 HIS A CE1 1 
ATOM   978  N NE2 . HIS A 1 137 ? -51.750 25.883  -7.798  1.00 129.34 ? 154 HIS A NE2 1 
ATOM   979  N N   . HIS A 1 138 ? -52.638 30.392  -5.414  1.00 127.76 ? 155 HIS A N   1 
ATOM   980  C CA  . HIS A 1 138 ? -54.090 30.477  -5.202  1.00 125.06 ? 155 HIS A CA  1 
ATOM   981  C C   . HIS A 1 138 ? -54.737 31.845  -5.469  1.00 116.45 ? 155 HIS A C   1 
ATOM   982  O O   . HIS A 1 138 ? -55.953 31.975  -5.386  1.00 107.82 ? 155 HIS A O   1 
ATOM   983  C CB  . HIS A 1 138 ? -54.513 29.872  -3.849  1.00 124.90 ? 155 HIS A CB  1 
ATOM   984  C CG  . HIS A 1 138 ? -55.176 28.529  -3.975  1.00 132.14 ? 155 HIS A CG  1 
ATOM   985  N ND1 . HIS A 1 138 ? -54.596 27.468  -4.641  1.00 130.00 ? 155 HIS A ND1 1 
ATOM   986  C CD2 . HIS A 1 138 ? -56.376 28.080  -3.534  1.00 129.61 ? 155 HIS A CD2 1 
ATOM   987  C CE1 . HIS A 1 138 ? -55.407 26.426  -4.603  1.00 123.15 ? 155 HIS A CE1 1 
ATOM   988  N NE2 . HIS A 1 138 ? -56.494 26.770  -3.937  1.00 129.84 ? 155 HIS A NE2 1 
ATOM   989  N N   . LEU A 1 139 ? -53.933 32.850  -5.809  1.00 125.92 ? 156 LEU A N   1 
ATOM   990  C CA  . LEU A 1 139 ? -54.475 34.090  -6.379  1.00 128.93 ? 156 LEU A CA  1 
ATOM   991  C C   . LEU A 1 139 ? -54.673 33.933  -7.883  1.00 134.13 ? 156 LEU A C   1 
ATOM   992  O O   . LEU A 1 139 ? -55.603 34.504  -8.451  1.00 137.87 ? 156 LEU A O   1 
ATOM   993  C CB  . LEU A 1 139 ? -53.564 35.293  -6.099  1.00 121.25 ? 156 LEU A CB  1 
ATOM   994  C CG  . LEU A 1 139 ? -54.013 36.695  -6.551  1.00 124.47 ? 156 LEU A CG  1 
ATOM   995  C CD1 . LEU A 1 139 ? -55.177 37.232  -5.729  1.00 126.61 ? 156 LEU A CD1 1 
ATOM   996  C CD2 . LEU A 1 139 ? -52.856 37.685  -6.534  1.00 122.14 ? 156 LEU A CD2 1 
ATOM   997  N N   . GLU A 1 140 ? -53.802 33.141  -8.507  1.00 136.46 ? 157 GLU A N   1 
ATOM   998  C CA  . GLU A 1 140 ? -53.714 33.039  -9.963  1.00 139.68 ? 157 GLU A CA  1 
ATOM   999  C C   . GLU A 1 140 ? -54.776 32.135  -10.583 1.00 140.03 ? 157 GLU A C   1 
ATOM   1000 O O   . GLU A 1 140 ? -55.115 32.284  -11.763 1.00 146.28 ? 157 GLU A O   1 
ATOM   1001 C CB  . GLU A 1 140 ? -52.316 32.570  -10.370 1.00 140.14 ? 157 GLU A CB  1 
ATOM   1002 C CG  . GLU A 1 140 ? -51.808 33.180  -11.668 1.00 132.41 ? 157 GLU A CG  1 
ATOM   1003 C CD  . GLU A 1 140 ? -50.340 33.548  -11.594 1.00 132.73 ? 157 GLU A CD  1 
ATOM   1004 O OE1 . GLU A 1 140 ? -49.714 33.716  -12.663 1.00 132.55 ? 157 GLU A OE1 1 
ATOM   1005 O OE2 . GLU A 1 140 ? -49.813 33.677  -10.464 1.00 129.86 ? 157 GLU A OE2 1 
ATOM   1006 N N   . ALA A 1 141 ? -55.277 31.182  -9.799  1.00 132.16 ? 158 ALA A N   1 
ATOM   1007 C CA  . ALA A 1 141 ? -56.411 30.366  -10.218 1.00 120.38 ? 158 ALA A CA  1 
ATOM   1008 C C   . ALA A 1 141 ? -57.672 31.240  -10.238 1.00 116.47 ? 158 ALA A C   1 
ATOM   1009 O O   . ALA A 1 141 ? -58.290 31.419  -11.292 1.00 110.50 ? 158 ALA A O   1 
ATOM   1010 C CB  . ALA A 1 141 ? -56.580 29.162  -9.297  1.00 113.72 ? 158 ALA A CB  1 
ATOM   1011 N N   . VAL A 1 142 ? -58.011 31.809  -9.077  1.00 112.65 ? 159 VAL A N   1 
ATOM   1012 C CA  . VAL A 1 142 ? -59.163 32.716  -8.898  1.00 106.85 ? 159 VAL A CA  1 
ATOM   1013 C C   . VAL A 1 142 ? -59.348 33.710  -10.063 1.00 102.96 ? 159 VAL A C   1 
ATOM   1014 O O   . VAL A 1 142 ? -60.424 33.786  -10.650 1.00 114.15 ? 159 VAL A O   1 
ATOM   1015 C CB  . VAL A 1 142 ? -59.095 33.461  -7.513  1.00 101.09 ? 159 VAL A CB  1 
ATOM   1016 C CG1 . VAL A 1 142 ? -60.126 34.585  -7.391  1.00 83.33  ? 159 VAL A CG1 1 
ATOM   1017 C CG2 . VAL A 1 142 ? -59.248 32.485  -6.347  1.00 94.87  ? 159 VAL A CG2 1 
ATOM   1018 N N   . GLN A 1 143 ? -58.283 34.418  -10.423 1.00 102.76 ? 160 GLN A N   1 
ATOM   1019 C CA  . GLN A 1 143 ? -58.375 35.661  -11.204 1.00 106.02 ? 160 GLN A CA  1 
ATOM   1020 C C   . GLN A 1 143 ? -58.494 35.599  -12.738 1.00 111.62 ? 160 GLN A C   1 
ATOM   1021 O O   . GLN A 1 143 ? -59.038 36.530  -13.326 1.00 103.47 ? 160 GLN A O   1 
ATOM   1022 C CB  . GLN A 1 143 ? -57.164 36.537  -10.869 1.00 105.38 ? 160 GLN A CB  1 
ATOM   1023 C CG  . GLN A 1 143 ? -55.848 35.998  -11.438 1.00 96.85  ? 160 GLN A CG  1 
ATOM   1024 C CD  . GLN A 1 143 ? -54.624 36.651  -10.831 1.00 90.52  ? 160 GLN A CD  1 
ATOM   1025 O OE1 . GLN A 1 143 ? -54.532 36.801  -9.609  1.00 75.19  ? 160 GLN A OE1 1 
ATOM   1026 N NE2 . GLN A 1 143 ? -53.669 37.040  -11.684 1.00 84.45  ? 160 GLN A NE2 1 
ATOM   1027 N N   . ASN A 1 144 ? -58.002 34.521  -13.366 1.00 126.68 ? 161 ASN A N   1 
ATOM   1028 C CA  . ASN A 1 144 ? -57.444 34.567  -14.755 1.00 141.72 ? 161 ASN A CA  1 
ATOM   1029 C C   . ASN A 1 144 ? -58.294 34.370  -16.050 1.00 158.11 ? 161 ASN A C   1 
ATOM   1030 O O   . ASN A 1 144 ? -58.019 33.450  -16.835 1.00 166.80 ? 161 ASN A O   1 
ATOM   1031 C CB  . ASN A 1 144 ? -56.165 33.703  -14.833 1.00 135.99 ? 161 ASN A CB  1 
ATOM   1032 C CG  . ASN A 1 144 ? -56.399 32.252  -14.427 1.00 134.16 ? 161 ASN A CG  1 
ATOM   1033 O OD1 . ASN A 1 144 ? -57.524 31.837  -14.142 1.00 137.67 ? 161 ASN A OD1 1 
ATOM   1034 N ND2 . ASN A 1 144 ? -55.324 31.476  -14.390 1.00 125.69 ? 161 ASN A ND2 1 
ATOM   1035 N N   . ALA A 1 145 ? -59.287 35.236  -16.280 1.00 160.53 ? 162 ALA A N   1 
ATOM   1036 C CA  . ALA A 1 145 ? -60.041 35.319  -17.562 1.00 154.55 ? 162 ALA A CA  1 
ATOM   1037 C C   . ALA A 1 145 ? -60.751 34.045  -18.085 1.00 160.07 ? 162 ALA A C   1 
ATOM   1038 O O   . ALA A 1 145 ? -61.124 33.975  -19.265 1.00 161.29 ? 162 ALA A O   1 
ATOM   1039 C CB  . ALA A 1 145 ? -59.173 35.946  -18.659 1.00 145.60 ? 162 ALA A CB  1 
ATOM   1040 N N   . LYS A 1 146 ? -60.946 33.055  -17.213 1.00 160.01 ? 163 LYS A N   1 
ATOM   1041 C CA  . LYS A 1 146 ? -61.733 31.858  -17.550 1.00 151.35 ? 163 LYS A CA  1 
ATOM   1042 C C   . LYS A 1 146 ? -63.219 32.031  -17.190 1.00 160.08 ? 163 LYS A C   1 
ATOM   1043 O O   . LYS A 1 146 ? -63.843 31.137  -16.604 1.00 169.12 ? 163 LYS A O   1 
ATOM   1044 C CB  . LYS A 1 146 ? -61.131 30.570  -16.942 1.00 139.91 ? 163 LYS A CB  1 
ATOM   1045 C CG  . LYS A 1 146 ? -60.448 30.720  -15.585 1.00 131.27 ? 163 LYS A CG  1 
ATOM   1046 C CD  . LYS A 1 146 ? -61.425 30.699  -14.420 1.00 127.57 ? 163 LYS A CD  1 
ATOM   1047 C CE  . LYS A 1 146 ? -60.945 31.617  -13.306 1.00 116.72 ? 163 LYS A CE  1 
ATOM   1048 N NZ  . LYS A 1 146 ? -61.871 31.657  -12.142 1.00 114.34 ? 163 LYS A NZ  1 
ATOM   1049 N N   . LYS A 1 147 ? -63.757 33.205  -17.534 1.00 153.23 ? 164 LYS A N   1 
ATOM   1050 C CA  . LYS A 1 147 ? -65.200 33.515  -17.498 1.00 145.22 ? 164 LYS A CA  1 
ATOM   1051 C C   . LYS A 1 147 ? -65.997 33.131  -16.228 1.00 143.83 ? 164 LYS A C   1 
ATOM   1052 O O   . LYS A 1 147 ? -67.200 32.861  -16.301 1.00 139.17 ? 164 LYS A O   1 
ATOM   1053 C CB  . LYS A 1 147 ? -65.891 32.966  -18.760 1.00 135.48 ? 164 LYS A CB  1 
ATOM   1054 C CG  . LYS A 1 147 ? -65.687 33.791  -20.026 1.00 124.77 ? 164 LYS A CG  1 
ATOM   1055 C CD  . LYS A 1 147 ? -66.401 35.137  -19.948 1.00 122.85 ? 164 LYS A CD  1 
ATOM   1056 C CE  . LYS A 1 147 ? -67.424 35.311  -21.066 1.00 112.14 ? 164 LYS A CE  1 
ATOM   1057 N NZ  . LYS A 1 147 ? -66.951 34.805  -22.384 1.00 104.63 ? 164 LYS A NZ  1 
ATOM   1058 N N   . LYS A 1 148 ? -65.334 33.118  -15.075 1.00 144.86 ? 165 LYS A N   1 
ATOM   1059 C CA  . LYS A 1 148 ? -66.025 32.931  -13.792 1.00 141.81 ? 165 LYS A CA  1 
ATOM   1060 C C   . LYS A 1 148 ? -65.481 33.864  -12.697 1.00 143.78 ? 165 LYS A C   1 
ATOM   1061 O O   . LYS A 1 148 ? -65.411 33.490  -11.518 1.00 140.86 ? 165 LYS A O   1 
ATOM   1062 C CB  . LYS A 1 148 ? -66.030 31.452  -13.361 1.00 132.70 ? 165 LYS A CB  1 
ATOM   1063 C CG  . LYS A 1 148 ? -64.675 30.759  -13.402 1.00 119.30 ? 165 LYS A CG  1 
ATOM   1064 C CD  . LYS A 1 148 ? -64.811 29.249  -13.439 1.00 107.39 ? 165 LYS A CD  1 
ATOM   1065 C CE  . LYS A 1 148 ? -65.397 28.718  -12.143 1.00 103.23 ? 165 LYS A CE  1 
ATOM   1066 N NZ  . LYS A 1 148 ? -65.644 27.258  -12.260 1.00 101.65 ? 165 LYS A NZ  1 
ATOM   1067 N N   . ASP A 1 149 ? -65.116 35.083  -13.114 1.00 134.06 ? 166 ASP A N   1 
ATOM   1068 C CA  . ASP A 1 149 ? -64.657 36.158  -12.221 1.00 130.91 ? 166 ASP A CA  1 
ATOM   1069 C C   . ASP A 1 149 ? -65.736 36.483  -11.189 1.00 133.08 ? 166 ASP A C   1 
ATOM   1070 O O   . ASP A 1 149 ? -66.930 36.447  -11.504 1.00 143.51 ? 166 ASP A O   1 
ATOM   1071 C CB  . ASP A 1 149 ? -64.320 37.439  -13.011 1.00 122.62 ? 166 ASP A CB  1 
ATOM   1072 C CG  . ASP A 1 149 ? -63.725 37.161  -14.389 1.00 120.99 ? 166 ASP A CG  1 
ATOM   1073 O OD1 . ASP A 1 149 ? -64.326 36.395  -15.174 1.00 119.63 ? 166 ASP A OD1 1 
ATOM   1074 O OD2 . ASP A 1 149 ? -62.663 37.736  -14.702 1.00 117.44 ? 166 ASP A OD2 1 
ATOM   1075 N N   . GLU A 1 150 ? -65.316 36.803  -9.965  1.00 128.51 ? 167 GLU A N   1 
ATOM   1076 C CA  . GLU A 1 150 ? -66.249 37.098  -8.871  1.00 122.21 ? 167 GLU A CA  1 
ATOM   1077 C C   . GLU A 1 150 ? -66.100 38.537  -8.362  1.00 125.54 ? 167 GLU A C   1 
ATOM   1078 O O   . GLU A 1 150 ? -65.009 38.948  -7.949  1.00 116.19 ? 167 GLU A O   1 
ATOM   1079 C CB  . GLU A 1 150 ? -66.072 36.095  -7.727  1.00 112.53 ? 167 GLU A CB  1 
ATOM   1080 C CG  . GLU A 1 150 ? -67.134 36.187  -6.645  1.00 115.41 ? 167 GLU A CG  1 
ATOM   1081 C CD  . GLU A 1 150 ? -66.778 35.388  -5.406  1.00 121.77 ? 167 GLU A CD  1 
ATOM   1082 O OE1 . GLU A 1 150 ? -65.605 35.455  -4.962  1.00 121.74 ? 167 GLU A OE1 1 
ATOM   1083 O OE2 . GLU A 1 150 ? -67.677 34.700  -4.872  1.00 111.10 ? 167 GLU A OE2 1 
ATOM   1084 N N   . ALA A 1 151 ? -67.213 39.279  -8.382  1.00 132.51 ? 168 ALA A N   1 
ATOM   1085 C CA  . ALA A 1 151 ? -67.266 40.700  -7.990  1.00 123.76 ? 168 ALA A CA  1 
ATOM   1086 C C   . ALA A 1 151 ? -66.506 41.010  -6.697  1.00 120.11 ? 168 ALA A C   1 
ATOM   1087 O O   . ALA A 1 151 ? -65.957 42.104  -6.542  1.00 107.69 ? 168 ALA A O   1 
ATOM   1088 C CB  . ALA A 1 151 ? -68.712 41.187  -7.902  1.00 113.38 ? 168 ALA A CB  1 
ATOM   1089 N N   . LYS A 1 152 ? -66.461 40.043  -5.781  1.00 122.55 ? 169 LYS A N   1 
ATOM   1090 C CA  . LYS A 1 152 ? -65.675 40.210  -4.565  1.00 126.56 ? 169 LYS A CA  1 
ATOM   1091 C C   . LYS A 1 152 ? -64.650 39.091  -4.310  1.00 130.87 ? 169 LYS A C   1 
ATOM   1092 O O   . LYS A 1 152 ? -64.884 38.163  -3.520  1.00 124.57 ? 169 LYS A O   1 
ATOM   1093 C CB  . LYS A 1 152 ? -66.576 40.441  -3.347  1.00 120.93 ? 169 LYS A CB  1 
ATOM   1094 C CG  . LYS A 1 152 ? -66.054 41.518  -2.402  1.00 118.49 ? 169 LYS A CG  1 
ATOM   1095 C CD  . LYS A 1 152 ? -66.097 41.069  -0.946  1.00 120.52 ? 169 LYS A CD  1 
ATOM   1096 C CE  . LYS A 1 152 ? -67.505 40.712  -0.483  1.00 117.50 ? 169 LYS A CE  1 
ATOM   1097 N NZ  . LYS A 1 152 ? -67.478 39.941  0.792   1.00 109.72 ? 169 LYS A NZ  1 
ATOM   1098 N N   . THR A 1 153 ? -63.532 39.171  -5.028  1.00 128.40 ? 170 THR A N   1 
ATOM   1099 C CA  . THR A 1 153 ? -62.278 38.573  -4.573  1.00 122.66 ? 170 THR A CA  1 
ATOM   1100 C C   . THR A 1 153 ? -61.260 39.698  -4.399  1.00 118.95 ? 170 THR A C   1 
ATOM   1101 O O   . THR A 1 153 ? -60.145 39.667  -4.930  1.00 107.04 ? 170 THR A O   1 
ATOM   1102 C CB  . THR A 1 153 ? -61.737 37.412  -5.453  1.00 114.66 ? 170 THR A CB  1 
ATOM   1103 O OG1 . THR A 1 153 ? -61.997 37.675  -6.835  1.00 109.78 ? 170 THR A OG1 1 
ATOM   1104 C CG2 . THR A 1 153 ? -62.363 36.085  -5.046  1.00 107.21 ? 170 THR A CG2 1 
ATOM   1105 N N   . ALA A 1 154 ? -61.696 40.717  -3.668  1.00 121.25 ? 171 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 154 ? -60.783 41.599  -2.973  1.00 130.87 ? 171 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 154 ? -60.137 40.762  -1.855  1.00 138.73 ? 171 ALA A C   1 
ATOM   1108 O O   . ALA A 1 154 ? -59.063 41.109  -1.360  1.00 137.63 ? 171 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 154 ? -61.529 42.797  -2.400  1.00 123.78 ? 171 ALA A CB  1 
ATOM   1110 N N   . LYS A 1 155 ? -60.794 39.647  -1.500  1.00 141.94 ? 172 LYS A N   1 
ATOM   1111 C CA  . LYS A 1 155 ? -60.378 38.718  -0.421  1.00 130.49 ? 172 LYS A CA  1 
ATOM   1112 C C   . LYS A 1 155 ? -59.108 37.887  -0.675  1.00 117.17 ? 172 LYS A C   1 
ATOM   1113 O O   . LYS A 1 155 ? -58.317 37.679  0.248   1.00 112.31 ? 172 LYS A O   1 
ATOM   1114 C CB  . LYS A 1 155 ? -61.543 37.804  -0.017  1.00 126.61 ? 172 LYS A CB  1 
ATOM   1115 C CG  . LYS A 1 155 ? -62.396 38.380  1.104   1.00 130.43 ? 172 LYS A CG  1 
ATOM   1116 C CD  . LYS A 1 155 ? -63.803 37.792  1.135   1.00 129.83 ? 172 LYS A CD  1 
ATOM   1117 C CE  . LYS A 1 155 ? -64.446 37.953  2.513   1.00 119.97 ? 172 LYS A CE  1 
ATOM   1118 N NZ  . LYS A 1 155 ? -65.930 37.805  2.499   1.00 107.33 ? 172 LYS A NZ  1 
ATOM   1119 N N   . ALA A 1 156 ? -58.926 37.403  -1.905  1.00 103.69 ? 173 ALA A N   1 
ATOM   1120 C CA  . ALA A 1 156 ? -57.648 36.818  -2.318  1.00 97.35  ? 173 ALA A CA  1 
ATOM   1121 C C   . ALA A 1 156 ? -56.593 37.911  -2.584  1.00 103.56 ? 173 ALA A C   1 
ATOM   1122 O O   . ALA A 1 156 ? -55.400 37.635  -2.593  1.00 109.01 ? 173 ALA A O   1 
ATOM   1123 C CB  . ALA A 1 156 ? -57.822 35.909  -3.529  1.00 86.85  ? 173 ALA A CB  1 
ATOM   1124 N N   . GLU A 1 157 ? -57.023 39.157  -2.781  1.00 111.58 ? 174 GLU A N   1 
ATOM   1125 C CA  . GLU A 1 157 ? -56.069 40.274  -2.874  1.00 111.44 ? 174 GLU A CA  1 
ATOM   1126 C C   . GLU A 1 157 ? -55.543 40.722  -1.493  1.00 109.33 ? 174 GLU A C   1 
ATOM   1127 O O   . GLU A 1 157 ? -54.347 40.985  -1.365  1.00 105.56 ? 174 GLU A O   1 
ATOM   1128 C CB  . GLU A 1 157 ? -56.617 41.460  -3.716  1.00 116.86 ? 174 GLU A CB  1 
ATOM   1129 C CG  . GLU A 1 157 ? -56.085 41.522  -5.167  1.00 113.24 ? 174 GLU A CG  1 
ATOM   1130 C CD  . GLU A 1 157 ? -56.705 42.614  -6.069  1.00 102.18 ? 174 GLU A CD  1 
ATOM   1131 O OE1 . GLU A 1 157 ? -56.613 42.474  -7.314  1.00 87.16  ? 174 GLU A OE1 1 
ATOM   1132 O OE2 . GLU A 1 157 ? -57.277 43.611  -5.560  1.00 90.09  ? 174 GLU A OE2 1 
ATOM   1133 N N   . GLU A 1 158 ? -56.424 40.778  -0.481  1.00 106.63 ? 175 GLU A N   1 
ATOM   1134 C CA  . GLU A 1 158 ? -56.082 41.231  0.893   1.00 105.64 ? 175 GLU A CA  1 
ATOM   1135 C C   . GLU A 1 158 ? -55.084 40.301  1.581   1.00 109.24 ? 175 GLU A C   1 
ATOM   1136 O O   . GLU A 1 158 ? -54.190 40.744  2.316   1.00 102.51 ? 175 GLU A O   1 
ATOM   1137 C CB  . GLU A 1 158 ? -57.322 41.307  1.808   1.00 105.14 ? 175 GLU A CB  1 
ATOM   1138 C CG  . GLU A 1 158 ? -58.615 41.826  1.191   1.00 115.77 ? 175 GLU A CG  1 
ATOM   1139 C CD  . GLU A 1 158 ? -58.681 43.341  1.036   1.00 116.06 ? 175 GLU A CD  1 
ATOM   1140 O OE1 . GLU A 1 158 ? -57.949 44.067  1.747   1.00 117.33 ? 175 GLU A OE1 1 
ATOM   1141 O OE2 . GLU A 1 158 ? -59.492 43.809  0.205   1.00 109.22 ? 175 GLU A OE2 1 
ATOM   1142 N N   . GLU A 1 159 ? -55.282 39.005  1.354   1.00 100.54 ? 176 GLU A N   1 
ATOM   1143 C CA  . GLU A 1 159 ? -54.458 37.956  1.923   1.00 91.22  ? 176 GLU A CA  1 
ATOM   1144 C C   . GLU A 1 159 ? -53.064 37.938  1.315   1.00 91.81  ? 176 GLU A C   1 
ATOM   1145 O O   . GLU A 1 159 ? -52.040 37.918  2.018   1.00 89.37  ? 176 GLU A O   1 
ATOM   1146 C CB  . GLU A 1 159 ? -55.095 36.618  1.604   1.00 78.07  ? 176 GLU A CB  1 
ATOM   1147 C CG  . GLU A 1 159 ? -56.265 36.210  2.457   1.00 82.12  ? 176 GLU A CG  1 
ATOM   1148 C CD  . GLU A 1 159 ? -56.735 34.823  2.066   1.00 87.06  ? 176 GLU A CD  1 
ATOM   1149 O OE1 . GLU A 1 159 ? -56.789 33.942  2.955   1.00 83.93  ? 176 GLU A OE1 1 
ATOM   1150 O OE2 . GLU A 1 159 ? -57.005 34.605  0.857   1.00 80.52  ? 176 GLU A OE2 1 
ATOM   1151 N N   . PHE A 1 160 ? -53.046 37.916  -0.010  1.00 92.06  ? 177 PHE A N   1 
ATOM   1152 C CA  . PHE A 1 160 ? -51.825 37.682  -0.756  1.00 104.56 ? 177 PHE A CA  1 
ATOM   1153 C C   . PHE A 1 160 ? -51.005 38.982  -0.929  1.00 100.23 ? 177 PHE A C   1 
ATOM   1154 O O   . PHE A 1 160 ? -49.834 38.952  -1.293  1.00 89.83  ? 177 PHE A O   1 
ATOM   1155 C CB  . PHE A 1 160 ? -52.153 36.926  -2.055  1.00 112.35 ? 177 PHE A CB  1 
ATOM   1156 C CG  . PHE A 1 160 ? -53.063 35.712  -1.845  1.00 123.85 ? 177 PHE A CG  1 
ATOM   1157 C CD1 . PHE A 1 160 ? -53.102 35.032  -0.619  1.00 131.87 ? 177 PHE A CD1 1 
ATOM   1158 C CD2 . PHE A 1 160 ? -53.867 35.232  -2.878  1.00 127.40 ? 177 PHE A CD2 1 
ATOM   1159 C CE1 . PHE A 1 160 ? -53.927 33.923  -0.432  1.00 132.77 ? 177 PHE A CE1 1 
ATOM   1160 C CE2 . PHE A 1 160 ? -54.694 34.123  -2.695  1.00 129.05 ? 177 PHE A CE2 1 
ATOM   1161 C CZ  . PHE A 1 160 ? -54.725 33.468  -1.472  1.00 128.83 ? 177 PHE A CZ  1 
ATOM   1162 N N   . ASN A 1 161 ? -51.636 40.114  -0.617  1.00 98.87  ? 178 ASN A N   1 
ATOM   1163 C CA  . ASN A 1 161 ? -50.936 41.356  -0.285  1.00 89.80  ? 178 ASN A CA  1 
ATOM   1164 C C   . ASN A 1 161 ? -50.217 41.267  1.065   1.00 92.15  ? 178 ASN A C   1 
ATOM   1165 O O   . ASN A 1 161 ? -49.105 41.797  1.222   1.00 86.31  ? 178 ASN A O   1 
ATOM   1166 C CB  . ASN A 1 161 ? -51.926 42.525  -0.233  1.00 83.74  ? 178 ASN A CB  1 
ATOM   1167 C CG  . ASN A 1 161 ? -51.889 43.387  -1.479  1.00 85.14  ? 178 ASN A CG  1 
ATOM   1168 O OD1 . ASN A 1 161 ? -51.370 42.985  -2.525  1.00 80.45  ? 178 ASN A OD1 1 
ATOM   1169 N ND2 . ASN A 1 161 ? -52.442 44.588  -1.373  1.00 83.01  ? 178 ASN A ND2 1 
ATOM   1170 N N   . LYS A 1 162 ? -50.870 40.602  2.027   1.00 87.49  ? 179 LYS A N   1 
ATOM   1171 C CA  . LYS A 1 162 ? -50.383 40.490  3.405   1.00 75.00  ? 179 LYS A CA  1 
ATOM   1172 C C   . LYS A 1 162 ? -49.236 39.495  3.510   1.00 71.43  ? 179 LYS A C   1 
ATOM   1173 O O   . LYS A 1 162 ? -48.223 39.784  4.155   1.00 70.94  ? 179 LYS A O   1 
ATOM   1174 C CB  . LYS A 1 162 ? -51.519 40.103  4.357   1.00 73.47  ? 179 LYS A CB  1 
ATOM   1175 C CG  . LYS A 1 162 ? -51.654 41.040  5.549   1.00 72.28  ? 179 LYS A CG  1 
ATOM   1176 C CD  . LYS A 1 162 ? -52.467 40.402  6.668   1.00 78.80  ? 179 LYS A CD  1 
ATOM   1177 C CE  . LYS A 1 162 ? -51.607 40.051  7.881   1.00 85.22  ? 179 LYS A CE  1 
ATOM   1178 N NZ  . LYS A 1 162 ? -50.651 38.925  7.666   1.00 83.21  ? 179 LYS A NZ  1 
ATOM   1179 N N   . ALA A 1 163 ? -49.402 38.336  2.867   1.00 69.66  ? 180 ALA A N   1 
ATOM   1180 C CA  . ALA A 1 163 ? -48.342 37.317  2.776   1.00 68.61  ? 180 ALA A CA  1 
ATOM   1181 C C   . ALA A 1 163 ? -46.977 37.878  2.360   1.00 76.69  ? 180 ALA A C   1 
ATOM   1182 O O   . ALA A 1 163 ? -45.974 37.602  3.031   1.00 80.79  ? 180 ALA A O   1 
ATOM   1183 C CB  . ALA A 1 163 ? -48.749 36.162  1.863   1.00 56.30  ? 180 ALA A CB  1 
ATOM   1184 N N   . GLN A 1 164 ? -46.946 38.663  1.273   1.00 78.14  ? 181 GLN A N   1 
ATOM   1185 C CA  . GLN A 1 164 ? -45.695 39.265  0.761   1.00 73.84  ? 181 GLN A CA  1 
ATOM   1186 C C   . GLN A 1 164 ? -45.079 40.353  1.663   1.00 77.13  ? 181 GLN A C   1 
ATOM   1187 O O   . GLN A 1 164 ? -43.857 40.407  1.839   1.00 75.03  ? 181 GLN A O   1 
ATOM   1188 C CB  . GLN A 1 164 ? -45.888 39.827  -0.648  1.00 71.80  ? 181 GLN A CB  1 
ATOM   1189 C CG  . GLN A 1 164 ? -46.685 41.117  -0.686  1.00 73.71  ? 181 GLN A CG  1 
ATOM   1190 C CD  . GLN A 1 164 ? -46.396 41.952  -1.905  1.00 69.94  ? 181 GLN A CD  1 
ATOM   1191 O OE1 . GLN A 1 164 ? -45.777 41.480  -2.866  1.00 56.55  ? 181 GLN A OE1 1 
ATOM   1192 N NE2 . GLN A 1 164 ? -46.848 43.213  -1.876  1.00 77.94  ? 181 GLN A NE2 1 
ATOM   1193 N N   . THR A 1 165 ? -45.918 41.224  2.219   1.00 73.49  ? 182 THR A N   1 
ATOM   1194 C CA  . THR A 1 165 ? -45.416 42.230  3.129   1.00 70.06  ? 182 THR A CA  1 
ATOM   1195 C C   . THR A 1 165 ? -44.930 41.586  4.454   1.00 81.44  ? 182 THR A C   1 
ATOM   1196 O O   . THR A 1 165 ? -43.915 42.004  5.027   1.00 79.82  ? 182 THR A O   1 
ATOM   1197 C CB  . THR A 1 165 ? -46.405 43.402  3.332   1.00 60.25  ? 182 THR A CB  1 
ATOM   1198 O OG1 . THR A 1 165 ? -45.865 44.291  4.310   1.00 65.02  ? 182 THR A OG1 1 
ATOM   1199 C CG2 . THR A 1 165 ? -47.737 42.923  3.823   1.00 66.96  ? 182 THR A CG2 1 
ATOM   1200 N N   . VAL A 1 166 ? -45.633 40.542  4.903   1.00 85.70  ? 183 VAL A N   1 
ATOM   1201 C CA  . VAL A 1 166 ? -45.198 39.748  6.060   1.00 82.46  ? 183 VAL A CA  1 
ATOM   1202 C C   . VAL A 1 166 ? -43.841 39.032  5.834   1.00 80.16  ? 183 VAL A C   1 
ATOM   1203 O O   . VAL A 1 166 ? -42.983 39.072  6.719   1.00 83.99  ? 183 VAL A O   1 
ATOM   1204 C CB  . VAL A 1 166 ? -46.321 38.795  6.567   1.00 82.12  ? 183 VAL A CB  1 
ATOM   1205 C CG1 . VAL A 1 166 ? -45.762 37.477  7.064   1.00 81.53  ? 183 VAL A CG1 1 
ATOM   1206 C CG2 . VAL A 1 166 ? -47.138 39.458  7.666   1.00 74.64  ? 183 VAL A CG2 1 
ATOM   1207 N N   . PHE A 1 167 ? -43.643 38.409  4.667   1.00 72.86  ? 184 PHE A N   1 
ATOM   1208 C CA  . PHE A 1 167 ? -42.374 37.717  4.366   1.00 64.21  ? 184 PHE A CA  1 
ATOM   1209 C C   . PHE A 1 167 ? -41.215 38.661  3.979   1.00 63.81  ? 184 PHE A C   1 
ATOM   1210 O O   . PHE A 1 167 ? -40.051 38.398  4.340   1.00 63.79  ? 184 PHE A O   1 
ATOM   1211 C CB  . PHE A 1 167 ? -42.539 36.583  3.328   1.00 54.86  ? 184 PHE A CB  1 
ATOM   1212 C CG  . PHE A 1 167 ? -41.242 36.214  2.611   1.00 57.48  ? 184 PHE A CG  1 
ATOM   1213 C CD1 . PHE A 1 167 ? -40.275 35.421  3.232   1.00 53.37  ? 184 PHE A CD1 1 
ATOM   1214 C CD2 . PHE A 1 167 ? -40.968 36.696  1.323   1.00 58.02  ? 184 PHE A CD2 1 
ATOM   1215 C CE1 . PHE A 1 167 ? -39.084 35.111  2.588   1.00 52.99  ? 184 PHE A CE1 1 
ATOM   1216 C CE2 . PHE A 1 167 ? -39.772 36.389  0.676   1.00 56.81  ? 184 PHE A CE2 1 
ATOM   1217 C CZ  . PHE A 1 167 ? -38.830 35.591  1.308   1.00 57.59  ? 184 PHE A CZ  1 
ATOM   1218 N N   . GLU A 1 168 ? -41.526 39.737  3.243   1.00 72.35  ? 185 GLU A N   1 
ATOM   1219 C CA  . GLU A 1 168 ? -40.493 40.714  2.789   1.00 69.48  ? 185 GLU A CA  1 
ATOM   1220 C C   . GLU A 1 168 ? -39.814 41.487  3.925   1.00 69.73  ? 185 GLU A C   1 
ATOM   1221 O O   . GLU A 1 168 ? -38.591 41.644  3.905   1.00 66.20  ? 185 GLU A O   1 
ATOM   1222 C CB  . GLU A 1 168 ? -41.026 41.649  1.699   1.00 62.97  ? 185 GLU A CB  1 
ATOM   1223 C CG  . GLU A 1 168 ? -41.204 40.937  0.352   1.00 67.72  ? 185 GLU A CG  1 
ATOM   1224 C CD  . GLU A 1 168 ? -41.260 41.871  -0.853  1.00 77.46  ? 185 GLU A CD  1 
ATOM   1225 O OE1 . GLU A 1 168 ? -41.773 43.016  -0.703  1.00 82.86  ? 185 GLU A OE1 1 
ATOM   1226 O OE2 . GLU A 1 168 ? -40.802 41.452  -1.957  1.00 68.89  ? 185 GLU A OE2 1 
ATOM   1227 N N   . ASP A 1 169 ? -40.613 41.935  4.903   1.00 68.24  ? 186 ASP A N   1 
ATOM   1228 C CA  . ASP A 1 169 ? -40.142 42.564  6.147   1.00 64.31  ? 186 ASP A CA  1 
ATOM   1229 C C   . ASP A 1 169 ? -39.183 41.707  6.937   1.00 68.87  ? 186 ASP A C   1 
ATOM   1230 O O   . ASP A 1 169 ? -38.195 42.211  7.490   1.00 62.96  ? 186 ASP A O   1 
ATOM   1231 C CB  . ASP A 1 169 ? -41.304 42.825  7.095   1.00 63.77  ? 186 ASP A CB  1 
ATOM   1232 C CG  . ASP A 1 169 ? -42.146 43.979  6.671   1.00 73.94  ? 186 ASP A CG  1 
ATOM   1233 O OD1 . ASP A 1 169 ? -41.630 44.886  5.976   1.00 70.18  ? 186 ASP A OD1 1 
ATOM   1234 O OD2 . ASP A 1 169 ? -43.348 43.966  7.029   1.00 86.77  ? 186 ASP A OD2 1 
ATOM   1235 N N   . LEU A 1 170 ? -39.528 40.423  7.023   1.00 67.64  ? 187 LEU A N   1 
ATOM   1236 C CA  . LEU A 1 170 ? -38.826 39.458  7.849   1.00 66.42  ? 187 LEU A CA  1 
ATOM   1237 C C   . LEU A 1 170 ? -37.572 39.043  7.124   1.00 61.06  ? 187 LEU A C   1 
ATOM   1238 O O   . LEU A 1 170 ? -36.506 38.942  7.723   1.00 61.11  ? 187 LEU A O   1 
ATOM   1239 C CB  . LEU A 1 170 ? -39.703 38.240  8.099   1.00 71.44  ? 187 LEU A CB  1 
ATOM   1240 C CG  . LEU A 1 170 ? -39.477 37.441  9.384   1.00 85.37  ? 187 LEU A CG  1 
ATOM   1241 C CD1 . LEU A 1 170 ? -40.619 36.447  9.562   1.00 91.44  ? 187 LEU A CD1 1 
ATOM   1242 C CD2 . LEU A 1 170 ? -38.135 36.720  9.402   1.00 80.47  ? 187 LEU A CD2 1 
ATOM   1243 N N   . ASN A 1 171 ? -37.715 38.827  5.826   1.00 55.53  ? 188 ASN A N   1 
ATOM   1244 C CA  . ASN A 1 171 ? -36.598 38.558  4.975   1.00 54.49  ? 188 ASN A CA  1 
ATOM   1245 C C   . ASN A 1 171 ? -35.620 39.730  5.103   1.00 60.31  ? 188 ASN A C   1 
ATOM   1246 O O   . ASN A 1 171 ? -34.392 39.556  5.197   1.00 58.51  ? 188 ASN A O   1 
ATOM   1247 C CB  . ASN A 1 171 ? -37.123 38.419  3.557   1.00 56.26  ? 188 ASN A CB  1 
ATOM   1248 C CG  . ASN A 1 171 ? -36.046 38.062  2.565   1.00 62.06  ? 188 ASN A CG  1 
ATOM   1249 O OD1 . ASN A 1 171 ? -35.555 36.925  2.541   1.00 64.09  ? 188 ASN A OD1 1 
ATOM   1250 N ND2 . ASN A 1 171 ? -35.675 39.029  1.723   1.00 54.73  ? 188 ASN A ND2 1 
ATOM   1251 N N   . GLN A 1 172 ? -36.196 40.924  5.159   1.00 61.22  ? 189 GLN A N   1 
ATOM   1252 C CA  . GLN A 1 172 ? -35.441 42.169  5.261   1.00 61.52  ? 189 GLN A CA  1 
ATOM   1253 C C   . GLN A 1 172 ? -34.701 42.297  6.605   1.00 55.85  ? 189 GLN A C   1 
ATOM   1254 O O   . GLN A 1 172 ? -33.506 42.581  6.622   1.00 60.75  ? 189 GLN A O   1 
ATOM   1255 C CB  . GLN A 1 172 ? -36.356 43.388  4.973   1.00 50.44  ? 189 GLN A CB  1 
ATOM   1256 C CG  . GLN A 1 172 ? -35.718 44.756  5.174   1.00 49.82  ? 189 GLN A CG  1 
ATOM   1257 C CD  . GLN A 1 172 ? -34.483 44.989  4.323   1.00 56.72  ? 189 GLN A CD  1 
ATOM   1258 O OE1 . GLN A 1 172 ? -34.277 44.332  3.300   1.00 60.33  ? 189 GLN A OE1 1 
ATOM   1259 N NE2 . GLN A 1 172 ? -33.639 45.919  4.754   1.00 60.29  ? 189 GLN A NE2 1 
ATOM   1260 N N   . GLU A 1 173 ? -35.407 42.084  7.708   1.00 50.77  ? 190 GLU A N   1 
ATOM   1261 C CA  . GLU A 1 173 ? -34.815 42.085  9.039   1.00 56.81  ? 190 GLU A CA  1 
ATOM   1262 C C   . GLU A 1 173 ? -33.475 41.287  9.060   1.00 54.06  ? 190 GLU A C   1 
ATOM   1263 O O   . GLU A 1 173 ? -32.406 41.809  9.452   1.00 51.16  ? 190 GLU A O   1 
ATOM   1264 C CB  . GLU A 1 173 ? -35.841 41.532  10.035  1.00 60.65  ? 190 GLU A CB  1 
ATOM   1265 C CG  . GLU A 1 173 ? -35.660 41.965  11.489  1.00 81.47  ? 190 GLU A CG  1 
ATOM   1266 C CD  . GLU A 1 173 ? -36.895 41.662  12.357  1.00 101.85 ? 190 GLU A CD  1 
ATOM   1267 O OE1 . GLU A 1 173 ? -38.038 41.865  11.877  1.00 104.86 ? 190 GLU A OE1 1 
ATOM   1268 O OE2 . GLU A 1 173 ? -36.738 41.227  13.528  1.00 105.39 ? 190 GLU A OE2 1 
ATOM   1269 N N   . LEU A 1 174 ? -33.547 40.065  8.544   1.00 44.35  ? 191 LEU A N   1 
ATOM   1270 C CA  . LEU A 1 174 ? -32.464 39.120  8.560   1.00 46.63  ? 191 LEU A CA  1 
ATOM   1271 C C   . LEU A 1 174 ? -31.324 39.566  7.688   1.00 52.31  ? 191 LEU A C   1 
ATOM   1272 O O   . LEU A 1 174 ? -30.166 39.279  7.994   1.00 56.57  ? 191 LEU A O   1 
ATOM   1273 C CB  . LEU A 1 174 ? -32.946 37.733  8.085   1.00 43.57  ? 191 LEU A CB  1 
ATOM   1274 C CG  . LEU A 1 174 ? -33.762 36.979  9.147   1.00 42.09  ? 191 LEU A CG  1 
ATOM   1275 C CD1 . LEU A 1 174 ? -34.403 35.669  8.656   1.00 38.30  ? 191 LEU A CD1 1 
ATOM   1276 C CD2 . LEU A 1 174 ? -32.890 36.777  10.376  1.00 40.37  ? 191 LEU A CD2 1 
ATOM   1277 N N   . LEU A 1 175 ? -31.640 40.228  6.582   1.00 51.85  ? 192 LEU A N   1 
ATOM   1278 C CA  . LEU A 1 175 ? -30.600 40.733  5.700   1.00 50.57  ? 192 LEU A CA  1 
ATOM   1279 C C   . LEU A 1 175 ? -29.866 41.872  6.406   1.00 47.82  ? 192 LEU A C   1 
ATOM   1280 O O   . LEU A 1 175 ? -28.808 42.289  5.958   1.00 42.23  ? 192 LEU A O   1 
ATOM   1281 C CB  . LEU A 1 175 ? -31.158 41.197  4.325   1.00 52.39  ? 192 LEU A CB  1 
ATOM   1282 C CG  . LEU A 1 175 ? -31.822 40.230  3.316   1.00 51.42  ? 192 LEU A CG  1 
ATOM   1283 C CD1 . LEU A 1 175 ? -32.640 40.993  2.265   1.00 44.30  ? 192 LEU A CD1 1 
ATOM   1284 C CD2 . LEU A 1 175 ? -30.821 39.284  2.652   1.00 52.14  ? 192 LEU A CD2 1 
ATOM   1285 N N   . GLU A 1 176 ? -30.404 42.369  7.518   1.00 50.67  ? 193 GLU A N   1 
ATOM   1286 C CA  . GLU A 1 176 ? -29.669 43.401  8.263   1.00 63.45  ? 193 GLU A CA  1 
ATOM   1287 C C   . GLU A 1 176 ? -28.880 42.801  9.424   1.00 60.68  ? 193 GLU A C   1 
ATOM   1288 O O   . GLU A 1 176 ? -27.790 43.277  9.770   1.00 62.75  ? 193 GLU A O   1 
ATOM   1289 C CB  . GLU A 1 176 ? -30.608 44.488  8.789   1.00 71.02  ? 193 GLU A CB  1 
ATOM   1290 C CG  . GLU A 1 176 ? -31.346 45.272  7.715   1.00 77.58  ? 193 GLU A CG  1 
ATOM   1291 C CD  . GLU A 1 176 ? -32.643 45.845  8.252   1.00 88.77  ? 193 GLU A CD  1 
ATOM   1292 O OE1 . GLU A 1 176 ? -33.529 45.051  8.668   1.00 89.23  ? 193 GLU A OE1 1 
ATOM   1293 O OE2 . GLU A 1 176 ? -32.768 47.088  8.273   1.00 87.20  ? 193 GLU A OE2 1 
ATOM   1294 N N   . GLU A 1 177 ? -29.452 41.761  10.018  1.00 53.13  ? 194 GLU A N   1 
ATOM   1295 C CA  . GLU A 1 177 ? -28.939 41.161  11.242  1.00 51.31  ? 194 GLU A CA  1 
ATOM   1296 C C   . GLU A 1 177 ? -27.783 40.208  10.996  1.00 50.23  ? 194 GLU A C   1 
ATOM   1297 O O   . GLU A 1 177 ? -26.759 40.271  11.670  1.00 48.86  ? 194 GLU A O   1 
ATOM   1298 C CB  . GLU A 1 177 ? -30.057 40.389  11.901  1.00 58.52  ? 194 GLU A CB  1 
ATOM   1299 C CG  . GLU A 1 177 ? -31.153 41.283  12.421  1.00 62.61  ? 194 GLU A CG  1 
ATOM   1300 C CD  . GLU A 1 177 ? -32.258 40.480  13.051  1.00 69.30  ? 194 GLU A CD  1 
ATOM   1301 O OE1 . GLU A 1 177 ? -32.161 40.274  14.273  1.00 68.45  ? 194 GLU A OE1 1 
ATOM   1302 O OE2 . GLU A 1 177 ? -33.197 40.052  12.329  1.00 73.35  ? 194 GLU A OE2 1 
ATOM   1303 N N   . LEU A 1 178 ? -27.966 39.329  10.011  1.00 49.25  ? 195 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 178 ? -27.024 38.283  9.720   1.00 43.81  ? 195 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 178 ? -25.616 38.803  9.444   1.00 45.01  ? 195 LEU A C   1 
ATOM   1306 O O   . LEU A 1 178 ? -24.670 38.281  9.991   1.00 48.77  ? 195 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 178 ? -27.532 37.381  8.597   1.00 41.65  ? 195 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 178 ? -28.777 36.526  8.890   1.00 43.26  ? 195 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 178 ? -29.210 35.729  7.666   1.00 38.71  ? 195 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 178 ? -28.549 35.574  10.055  1.00 45.23  ? 195 LEU A CD2 1 
ATOM   1311 N N   . PRO A 1 179 ? -25.452 39.805  8.569   1.00 46.74  ? 196 PRO A N   1 
ATOM   1312 C CA  . PRO A 1 179 ? -24.044 40.298  8.427   1.00 44.85  ? 196 PRO A CA  1 
ATOM   1313 C C   . PRO A 1 179 ? -23.453 40.948  9.706   1.00 41.28  ? 196 PRO A C   1 
ATOM   1314 O O   . PRO A 1 179 ? -22.263 40.852  9.997   1.00 38.82  ? 196 PRO A O   1 
ATOM   1315 C CB  . PRO A 1 179 ? -24.159 41.341  7.294   1.00 42.93  ? 196 PRO A CB  1 
ATOM   1316 C CG  . PRO A 1 179 ? -25.641 41.625  7.156   1.00 41.57  ? 196 PRO A CG  1 
ATOM   1317 C CD  . PRO A 1 179 ? -26.328 40.335  7.504   1.00 40.38  ? 196 PRO A CD  1 
ATOM   1318 N N   . ILE A 1 180 ? -24.279 41.641  10.465  1.00 43.69  ? 197 ILE A N   1 
ATOM   1319 C CA  . ILE A 1 180 ? -23.771 42.272  11.674  1.00 43.79  ? 197 ILE A CA  1 
ATOM   1320 C C   . ILE A 1 180 ? -23.224 41.188  12.603  1.00 40.15  ? 197 ILE A C   1 
ATOM   1321 O O   . ILE A 1 180 ? -22.144 41.297  13.166  1.00 45.04  ? 197 ILE A O   1 
ATOM   1322 C CB  . ILE A 1 180 ? -24.859 43.143  12.339  1.00 43.33  ? 197 ILE A CB  1 
ATOM   1323 C CG1 . ILE A 1 180 ? -25.054 44.442  11.511  1.00 45.28  ? 197 ILE A CG1 1 
ATOM   1324 C CG2 . ILE A 1 180 ? -24.481 43.463  13.776  1.00 38.24  ? 197 ILE A CG2 1 
ATOM   1325 C CD1 . ILE A 1 180 ? -26.325 45.223  11.821  1.00 44.33  ? 197 ILE A CD1 1 
ATOM   1326 N N   . LEU A 1 181 ? -23.990 40.133  12.729  1.00 36.83  ? 198 LEU A N   1 
ATOM   1327 C CA  . LEU A 1 181 ? -23.640 39.048  13.586  1.00 42.79  ? 198 LEU A CA  1 
ATOM   1328 C C   . LEU A 1 181 ? -22.442 38.215  13.004  1.00 41.20  ? 198 LEU A C   1 
ATOM   1329 O O   . LEU A 1 181 ? -21.489 37.881  13.710  1.00 40.84  ? 198 LEU A O   1 
ATOM   1330 C CB  . LEU A 1 181 ? -24.914 38.213  13.834  1.00 39.81  ? 198 LEU A CB  1 
ATOM   1331 C CG  . LEU A 1 181 ? -24.713 36.870  14.508  1.00 41.63  ? 198 LEU A CG  1 
ATOM   1332 C CD1 . LEU A 1 181 ? -24.395 37.113  15.988  1.00 40.87  ? 198 LEU A CD1 1 
ATOM   1333 C CD2 . LEU A 1 181 ? -25.965 36.025  14.290  1.00 39.00  ? 198 LEU A CD2 1 
ATOM   1334 N N   . TYR A 1 182 ? -22.493 37.930  11.711  1.00 39.39  ? 199 TYR A N   1 
ATOM   1335 C CA  . TYR A 1 182 ? -21.454 37.197  11.016  1.00 39.11  ? 199 TYR A CA  1 
ATOM   1336 C C   . TYR A 1 182 ? -20.082 37.822  11.214  1.00 40.93  ? 199 TYR A C   1 
ATOM   1337 O O   . TYR A 1 182 ? -19.107 37.145  11.608  1.00 41.72  ? 199 TYR A O   1 
ATOM   1338 C CB  . TYR A 1 182 ? -21.769 37.176  9.536   1.00 36.49  ? 199 TYR A CB  1 
ATOM   1339 C CG  . TYR A 1 182 ? -20.745 36.410  8.734   1.00 35.64  ? 199 TYR A CG  1 
ATOM   1340 C CD1 . TYR A 1 182 ? -20.434 35.089  9.060   1.00 35.98  ? 199 TYR A CD1 1 
ATOM   1341 C CD2 . TYR A 1 182 ? -20.101 37.001  7.663   1.00 32.41  ? 199 TYR A CD2 1 
ATOM   1342 C CE1 . TYR A 1 182 ? -19.491 34.378  8.353   1.00 36.87  ? 199 TYR A CE1 1 
ATOM   1343 C CE2 . TYR A 1 182 ? -19.161 36.307  6.938   1.00 38.65  ? 199 TYR A CE2 1 
ATOM   1344 C CZ  . TYR A 1 182 ? -18.858 34.989  7.284   1.00 39.93  ? 199 TYR A CZ  1 
ATOM   1345 O OH  . TYR A 1 182 ? -17.912 34.288  6.555   1.00 37.78  ? 199 TYR A OH  1 
ATOM   1346 N N   . ASN A 1 183 ? -20.031 39.115  10.930  1.00 36.61  ? 200 ASN A N   1 
ATOM   1347 C CA  . ASN A 1 183 ? -18.847 39.920  11.104  1.00 39.35  ? 200 ASN A CA  1 
ATOM   1348 C C   . ASN A 1 183 ? -18.357 40.000  12.536  1.00 38.67  ? 200 ASN A C   1 
ATOM   1349 O O   . ASN A 1 183 ? -17.156 40.185  12.763  1.00 47.78  ? 200 ASN A O   1 
ATOM   1350 C CB  . ASN A 1 183 ? -19.104 41.336  10.604  1.00 37.68  ? 200 ASN A CB  1 
ATOM   1351 C CG  . ASN A 1 183 ? -19.489 41.362  9.147   1.00 46.79  ? 200 ASN A CG  1 
ATOM   1352 O OD1 . ASN A 1 183 ? -19.136 40.425  8.380   1.00 44.04  ? 200 ASN A OD1 1 
ATOM   1353 N ND2 . ASN A 1 183 ? -20.225 42.434  8.732   1.00 40.29  ? 200 ASN A ND2 1 
ATOM   1354 N N   . SER A 1 184 ? -19.258 39.912  13.503  1.00 35.69  ? 201 SER A N   1 
ATOM   1355 C CA  . SER A 1 184 ? -18.814 39.956  14.907  1.00 35.87  ? 201 SER A CA  1 
ATOM   1356 C C   . SER A 1 184 ? -17.996 38.691  15.311  1.00 36.71  ? 201 SER A C   1 
ATOM   1357 O O   . SER A 1 184 ? -17.505 38.568  16.436  1.00 41.14  ? 201 SER A O   1 
ATOM   1358 C CB  . SER A 1 184 ? -20.003 40.178  15.840  1.00 30.96  ? 201 SER A CB  1 
ATOM   1359 O OG  . SER A 1 184 ? -20.735 38.967  16.017  1.00 29.03  ? 201 SER A OG  1 
ATOM   1360 N N   . ARG A 1 185 ? -17.808 37.746  14.400  1.00 41.15  ? 202 ARG A N   1 
ATOM   1361 C CA  . ARG A 1 185 ? -17.131 36.506  14.833  1.00 40.48  ? 202 ARG A CA  1 
ATOM   1362 C C   . ARG A 1 185 ? -15.674 36.853  15.049  1.00 41.72  ? 202 ARG A C   1 
ATOM   1363 O O   . ARG A 1 185 ? -15.020 36.272  15.912  1.00 38.61  ? 202 ARG A O   1 
ATOM   1364 C CB  . ARG A 1 185 ? -17.304 35.375  13.830  1.00 35.02  ? 202 ARG A CB  1 
ATOM   1365 C CG  . ARG A 1 185 ? -16.597 35.638  12.522  1.00 34.53  ? 202 ARG A CG  1 
ATOM   1366 C CD  . ARG A 1 185 ? -17.044 34.727  11.409  1.00 32.62  ? 202 ARG A CD  1 
ATOM   1367 N NE  . ARG A 1 185 ? -16.174 34.864  10.232  1.00 31.01  ? 202 ARG A NE  1 
ATOM   1368 C CZ  . ARG A 1 185 ? -16.224 35.874  9.363   1.00 37.23  ? 202 ARG A CZ  1 
ATOM   1369 N NH1 . ARG A 1 185 ? -17.075 36.891  9.546   1.00 40.15  ? 202 ARG A NH1 1 
ATOM   1370 N NH2 . ARG A 1 185 ? -15.409 35.890  8.300   1.00 40.31  ? 202 ARG A NH2 1 
ATOM   1371 N N   . ILE A 1 186 ? -15.206 37.860  14.299  1.00 41.07  ? 203 ILE A N   1 
ATOM   1372 C CA  . ILE A 1 186 ? -13.805 38.211  14.277  1.00 39.53  ? 203 ILE A CA  1 
ATOM   1373 C C   . ILE A 1 186 ? -13.380 38.722  15.636  1.00 44.36  ? 203 ILE A C   1 
ATOM   1374 O O   . ILE A 1 186 ? -12.387 38.239  16.179  1.00 48.70  ? 203 ILE A O   1 
ATOM   1375 C CB  . ILE A 1 186 ? -13.507 39.273  13.234  1.00 37.54  ? 203 ILE A CB  1 
ATOM   1376 C CG1 . ILE A 1 186 ? -13.962 38.818  11.852  1.00 35.88  ? 203 ILE A CG1 1 
ATOM   1377 C CG2 . ILE A 1 186 ? -12.050 39.673  13.280  1.00 36.53  ? 203 ILE A CG2 1 
ATOM   1378 C CD1 . ILE A 1 186 ? -13.359 39.623  10.719  1.00 35.29  ? 203 ILE A CD1 1 
ATOM   1379 N N   . GLY A 1 187 ? -14.139 39.672  16.200  1.00 46.68  ? 204 GLY A N   1 
ATOM   1380 C CA  . GLY A 1 187 ? -13.864 40.207  17.568  1.00 40.89  ? 204 GLY A CA  1 
ATOM   1381 C C   . GLY A 1 187 ? -13.907 39.186  18.700  1.00 39.95  ? 204 GLY A C   1 
ATOM   1382 O O   . GLY A 1 187 ? -13.074 39.184  19.596  1.00 46.53  ? 204 GLY A O   1 
ATOM   1383 N N   . CYS A 1 188 ? -14.888 38.316  18.664  1.00 37.47  ? 205 CYS A N   1 
ATOM   1384 C CA  . CYS A 1 188 ? -14.961 37.189  19.571  1.00 37.87  ? 205 CYS A CA  1 
ATOM   1385 C C   . CYS A 1 188 ? -13.691 36.341  19.565  1.00 36.30  ? 205 CYS A C   1 
ATOM   1386 O O   . CYS A 1 188 ? -13.160 35.991  20.612  1.00 38.69  ? 205 CYS A O   1 
ATOM   1387 C CB  . CYS A 1 188 ? -16.124 36.321  19.118  1.00 42.36  ? 205 CYS A CB  1 
ATOM   1388 S SG  . CYS A 1 188 ? -16.330 34.805  20.059  1.00 48.06  ? 205 CYS A SG  1 
ATOM   1389 N N   . TYR A 1 189 ? -13.209 35.991  18.381  1.00 34.06  ? 206 TYR A N   1 
ATOM   1390 C CA  . TYR A 1 189 ? -12.057 35.110  18.275  1.00 30.01  ? 206 TYR A CA  1 
ATOM   1391 C C   . TYR A 1 189 ? -10.839 35.829  18.823  1.00 31.98  ? 206 TYR A C   1 
ATOM   1392 O O   . TYR A 1 189 ? -10.068 35.226  19.571  1.00 31.76  ? 206 TYR A O   1 
ATOM   1393 C CB  . TYR A 1 189 ? -11.775 34.691  16.819  1.00 30.44  ? 206 TYR A CB  1 
ATOM   1394 C CG  . TYR A 1 189 ? -12.884 33.981  16.084  1.00 30.31  ? 206 TYR A CG  1 
ATOM   1395 C CD1 . TYR A 1 189 ? -13.914 33.332  16.755  1.00 30.41  ? 206 TYR A CD1 1 
ATOM   1396 C CD2 . TYR A 1 189 ? -12.881 33.930  14.697  1.00 33.29  ? 206 TYR A CD2 1 
ATOM   1397 C CE1 . TYR A 1 189 ? -14.932 32.678  16.046  1.00 33.08  ? 206 TYR A CE1 1 
ATOM   1398 C CE2 . TYR A 1 189 ? -13.891 33.281  13.984  1.00 32.48  ? 206 TYR A CE2 1 
ATOM   1399 C CZ  . TYR A 1 189 ? -14.907 32.667  14.669  1.00 32.07  ? 206 TYR A CZ  1 
ATOM   1400 O OH  . TYR A 1 189 ? -15.891 32.039  13.955  1.00 38.24  ? 206 TYR A OH  1 
ATOM   1401 N N   . VAL A 1 190 ? -10.644 37.098  18.420  1.00 32.38  ? 207 VAL A N   1 
ATOM   1402 C CA  . VAL A 1 190 ? -9.572  37.956  18.969  1.00 33.01  ? 207 VAL A CA  1 
ATOM   1403 C C   . VAL A 1 190 ? -9.637  38.018  20.514  1.00 37.95  ? 207 VAL A C   1 
ATOM   1404 O O   . VAL A 1 190 ? -8.689  37.621  21.209  1.00 39.60  ? 207 VAL A O   1 
ATOM   1405 C CB  . VAL A 1 190 ? -9.591  39.402  18.389  1.00 30.20  ? 207 VAL A CB  1 
ATOM   1406 C CG1 . VAL A 1 190 ? -8.728  40.313  19.270  1.00 30.18  ? 207 VAL A CG1 1 
ATOM   1407 C CG2 . VAL A 1 190 ? -9.025  39.434  16.984  1.00 24.36  ? 207 VAL A CG2 1 
ATOM   1408 N N   . THR A 1 191 ? -10.780 38.474  21.031  1.00 38.67  ? 208 THR A N   1 
ATOM   1409 C CA  . THR A 1 191 ? -11.026 38.539  22.466  1.00 39.23  ? 208 THR A CA  1 
ATOM   1410 C C   . THR A 1 191 ? -10.574 37.251  23.150  1.00 37.74  ? 208 THR A C   1 
ATOM   1411 O O   . THR A 1 191 ? -9.661  37.256  23.986  1.00 41.15  ? 208 THR A O   1 
ATOM   1412 C CB  . THR A 1 191 ? -12.514 38.844  22.720  1.00 40.30  ? 208 THR A CB  1 
ATOM   1413 O OG1 . THR A 1 191 ? -12.737 40.236  22.497  1.00 38.82  ? 208 THR A OG1 1 
ATOM   1414 C CG2 . THR A 1 191 ? -12.952 38.489  24.175  1.00 42.04  ? 208 THR A CG2 1 
ATOM   1415 N N   . ILE A 1 192 ? -11.193 36.142  22.749  1.00 36.78  ? 209 ILE A N   1 
ATOM   1416 C CA  . ILE A 1 192 ? -10.994 34.835  23.391  1.00 31.98  ? 209 ILE A CA  1 
ATOM   1417 C C   . ILE A 1 192 ? -9.555  34.328  23.363  1.00 34.49  ? 209 ILE A C   1 
ATOM   1418 O O   . ILE A 1 192 ? -9.047  33.893  24.400  1.00 37.03  ? 209 ILE A O   1 
ATOM   1419 C CB  . ILE A 1 192 ? -11.839 33.771  22.718  1.00 30.19  ? 209 ILE A CB  1 
ATOM   1420 C CG1 . ILE A 1 192 ? -13.218 33.779  23.312  1.00 29.61  ? 209 ILE A CG1 1 
ATOM   1421 C CG2 . ILE A 1 192 ? -11.217 32.390  22.917  1.00 29.35  ? 209 ILE A CG2 1 
ATOM   1422 C CD1 . ILE A 1 192 ? -13.905 32.497  22.938  1.00 34.73  ? 209 ILE A CD1 1 
ATOM   1423 N N   . PHE A 1 193 ? -8.906  34.370  22.197  1.00 31.43  ? 210 PHE A N   1 
ATOM   1424 C CA  . PHE A 1 193 ? -7.494  34.008  22.135  1.00 33.75  ? 210 PHE A CA  1 
ATOM   1425 C C   . PHE A 1 193 ? -6.539  35.004  22.801  1.00 37.13  ? 210 PHE A C   1 
ATOM   1426 O O   . PHE A 1 193 ? -5.436  34.628  23.235  1.00 37.19  ? 210 PHE A O   1 
ATOM   1427 C CB  . PHE A 1 193 ? -7.085  33.673  20.711  1.00 33.55  ? 210 PHE A CB  1 
ATOM   1428 C CG  . PHE A 1 193 ? -7.700  32.398  20.236  1.00 34.43  ? 210 PHE A CG  1 
ATOM   1429 C CD1 . PHE A 1 193 ? -7.106  31.145  20.584  1.00 35.90  ? 210 PHE A CD1 1 
ATOM   1430 C CD2 . PHE A 1 193 ? -8.918  32.409  19.562  1.00 30.43  ? 210 PHE A CD2 1 
ATOM   1431 C CE1 . PHE A 1 193 ? -7.692  29.941  20.201  1.00 32.22  ? 210 PHE A CE1 1 
ATOM   1432 C CE2 . PHE A 1 193 ? -9.508  31.204  19.193  1.00 33.96  ? 210 PHE A CE2 1 
ATOM   1433 C CZ  . PHE A 1 193 ? -8.896  29.979  19.499  1.00 33.07  ? 210 PHE A CZ  1 
ATOM   1434 N N   . GLN A 1 194 ? -6.950  36.262  22.933  1.00 37.07  ? 211 GLN A N   1 
ATOM   1435 C CA  . GLN A 1 194 ? -6.051  37.163  23.631  1.00 38.43  ? 211 GLN A CA  1 
ATOM   1436 C C   . GLN A 1 194 ? -6.198  36.907  25.126  1.00 42.43  ? 211 GLN A C   1 
ATOM   1437 O O   . GLN A 1 194 ? -5.195  36.914  25.863  1.00 44.50  ? 211 GLN A O   1 
ATOM   1438 C CB  . GLN A 1 194 ? -6.252  38.615  23.228  1.00 38.96  ? 211 GLN A CB  1 
ATOM   1439 C CG  . GLN A 1 194 ? -5.696  38.928  21.821  1.00 39.26  ? 211 GLN A CG  1 
ATOM   1440 C CD  . GLN A 1 194 ? -5.766  40.418  21.430  1.00 42.58  ? 211 GLN A CD  1 
ATOM   1441 O OE1 . GLN A 1 194 ? -6.561  41.210  21.981  1.00 41.03  ? 211 GLN A OE1 1 
ATOM   1442 N NE2 . GLN A 1 194 ? -4.919  40.806  20.478  1.00 41.20  ? 211 GLN A NE2 1 
ATOM   1443 N N   . ASN A 1 195 ? -7.430  36.621  25.558  1.00 41.17  ? 212 ASN A N   1 
ATOM   1444 C CA  . ASN A 1 195 ? -7.672  36.245  26.950  1.00 39.35  ? 212 ASN A CA  1 
ATOM   1445 C C   . ASN A 1 195 ? -6.814  35.024  27.347  1.00 39.74  ? 212 ASN A C   1 
ATOM   1446 O O   . ASN A 1 195 ? -5.975  35.106  28.267  1.00 42.04  ? 212 ASN A O   1 
ATOM   1447 C CB  . ASN A 1 195 ? -9.141  35.926  27.186  1.00 38.21  ? 212 ASN A CB  1 
ATOM   1448 C CG  . ASN A 1 195 ? -10.049 37.165  27.222  1.00 36.12  ? 212 ASN A CG  1 
ATOM   1449 O OD1 . ASN A 1 195 ? -9.610  38.326  27.111  1.00 34.70  ? 212 ASN A OD1 1 
ATOM   1450 N ND2 . ASN A 1 195 ? -11.356 36.901  27.366  1.00 28.89  ? 212 ASN A ND2 1 
ATOM   1451 N N   . ILE A 1 196 ? -7.014  33.906  26.651  1.00 38.01  ? 213 ILE A N   1 
ATOM   1452 C CA  . ILE A 1 196 ? -6.206  32.696  26.873  1.00 38.32  ? 213 ILE A CA  1 
ATOM   1453 C C   . ILE A 1 196 ? -4.718  33.011  26.875  1.00 38.80  ? 213 ILE A C   1 
ATOM   1454 O O   . ILE A 1 196 ? -3.961  32.475  27.698  1.00 39.47  ? 213 ILE A O   1 
ATOM   1455 C CB  . ILE A 1 196 ? -6.415  31.639  25.782  1.00 37.56  ? 213 ILE A CB  1 
ATOM   1456 C CG1 . ILE A 1 196 ? -7.837  31.124  25.805  1.00 37.83  ? 213 ILE A CG1 1 
ATOM   1457 C CG2 . ILE A 1 196 ? -5.425  30.494  25.937  1.00 37.76  ? 213 ILE A CG2 1 
ATOM   1458 C CD1 . ILE A 1 196 ? -8.212  30.298  24.576  1.00 42.68  ? 213 ILE A CD1 1 
ATOM   1459 N N   . SER A 1 197 ? -4.293  33.848  25.947  1.00 34.47  ? 214 SER A N   1 
ATOM   1460 C CA  . SER A 1 197 ? -2.882  34.072  25.826  1.00 38.25  ? 214 SER A CA  1 
ATOM   1461 C C   . SER A 1 197 ? -2.400  34.844  27.052  1.00 38.87  ? 214 SER A C   1 
ATOM   1462 O O   . SER A 1 197 ? -1.324  34.584  27.612  1.00 40.00  ? 214 SER A O   1 
ATOM   1463 C CB  . SER A 1 197 ? -2.557  34.792  24.513  1.00 41.02  ? 214 SER A CB  1 
ATOM   1464 O OG  . SER A 1 197 ? -1.348  35.533  24.644  1.00 50.15  ? 214 SER A OG  1 
ATOM   1465 N N   . ASN A 1 198 ? -3.212  35.789  27.485  1.00 41.09  ? 215 ASN A N   1 
ATOM   1466 C CA  . ASN A 1 198 ? -2.845  36.585  28.640  1.00 44.62  ? 215 ASN A CA  1 
ATOM   1467 C C   . ASN A 1 198 ? -2.744  35.752  29.862  1.00 43.39  ? 215 ASN A C   1 
ATOM   1468 O O   . ASN A 1 198 ? -1.845  35.957  30.642  1.00 50.10  ? 215 ASN A O   1 
ATOM   1469 C CB  . ASN A 1 198 ? -3.806  37.753  28.855  1.00 38.29  ? 215 ASN A CB  1 
ATOM   1470 C CG  . ASN A 1 198 ? -3.460  38.927  27.961  1.00 42.26  ? 215 ASN A CG  1 
ATOM   1471 O OD1 . ASN A 1 198 ? -2.308  39.091  27.589  1.00 44.02  ? 215 ASN A OD1 1 
ATOM   1472 N ND2 . ASN A 1 198 ? -4.452  39.717  27.573  1.00 43.28  ? 215 ASN A ND2 1 
ATOM   1473 N N   . LEU A 1 199 ? -3.697  34.819  29.992  1.00 47.73  ? 216 LEU A N   1 
ATOM   1474 C CA  . LEU A 1 199 ? -3.832  33.910  31.120  1.00 41.08  ? 216 LEU A CA  1 
ATOM   1475 C C   . LEU A 1 199 ? -2.682  32.947  31.148  1.00 38.44  ? 216 LEU A C   1 
ATOM   1476 O O   . LEU A 1 199 ? -2.069  32.755  32.176  1.00 37.84  ? 216 LEU A O   1 
ATOM   1477 C CB  . LEU A 1 199 ? -5.116  33.084  31.002  1.00 46.71  ? 216 LEU A CB  1 
ATOM   1478 C CG  . LEU A 1 199 ? -6.407  33.781  31.417  1.00 53.51  ? 216 LEU A CG  1 
ATOM   1479 C CD1 . LEU A 1 199 ? -7.627  32.905  31.159  1.00 37.59  ? 216 LEU A CD1 1 
ATOM   1480 C CD2 . LEU A 1 199 ? -6.295  34.276  32.875  1.00 52.28  ? 216 LEU A CD2 1 
ATOM   1481 N N   . ARG A 1 200 ? -2.407  32.301  30.023  1.00 42.29  ? 217 ARG A N   1 
ATOM   1482 C CA  . ARG A 1 200 ? -1.219  31.468  29.931  1.00 43.24  ? 217 ARG A CA  1 
ATOM   1483 C C   . ARG A 1 200 ? 0.072   32.156  30.313  1.00 45.94  ? 217 ARG A C   1 
ATOM   1484 O O   . ARG A 1 200 ? 0.970   31.511  30.881  1.00 46.27  ? 217 ARG A O   1 
ATOM   1485 C CB  . ARG A 1 200 ? -1.082  30.873  28.568  1.00 46.16  ? 217 ARG A CB  1 
ATOM   1486 C CG  . ARG A 1 200 ? -1.548  29.444  28.574  1.00 45.21  ? 217 ARG A CG  1 
ATOM   1487 C CD  . ARG A 1 200 ? -2.502  29.241  27.449  1.00 49.55  ? 217 ARG A CD  1 
ATOM   1488 N NE  . ARG A 1 200 ? -1.919  28.498  26.345  1.00 52.85  ? 217 ARG A NE  1 
ATOM   1489 C CZ  . ARG A 1 200 ? -1.406  29.032  25.246  1.00 62.32  ? 217 ARG A CZ  1 
ATOM   1490 N NH1 . ARG A 1 200 ? -1.359  30.342  25.078  1.00 69.07  ? 217 ARG A NH1 1 
ATOM   1491 N NH2 . ARG A 1 200 ? -0.923  28.245  24.302  1.00 70.33  ? 217 ARG A NH2 1 
ATOM   1492 N N   . ASP A 1 201 ? 0.165   33.460  30.073  1.00 41.82  ? 218 ASP A N   1 
ATOM   1493 C CA  . ASP A 1 201 ? 1.430   34.145  30.357  1.00 42.20  ? 218 ASP A CA  1 
ATOM   1494 C C   . ASP A 1 201 ? 1.747   34.134  31.819  1.00 40.94  ? 218 ASP A C   1 
ATOM   1495 O O   . ASP A 1 201 ? 2.871   33.851  32.198  1.00 42.95  ? 218 ASP A O   1 
ATOM   1496 C CB  . ASP A 1 201 ? 1.452   35.585  29.842  1.00 45.29  ? 218 ASP A CB  1 
ATOM   1497 C CG  . ASP A 1 201 ? 2.849   36.162  29.820  1.00 47.66  ? 218 ASP A CG  1 
ATOM   1498 O OD1 . ASP A 1 201 ? 3.735   35.617  29.127  1.00 51.41  ? 218 ASP A OD1 1 
ATOM   1499 O OD2 . ASP A 1 201 ? 3.085   37.156  30.511  1.00 50.54  ? 218 ASP A OD2 1 
ATOM   1500 N N   . VAL A 1 202 ? 0.761   34.446  32.655  1.00 43.57  ? 219 VAL A N   1 
ATOM   1501 C CA  . VAL A 1 202 ? 0.993   34.421  34.109  1.00 39.91  ? 219 VAL A CA  1 
ATOM   1502 C C   . VAL A 1 202 ? 1.254   32.980  34.533  1.00 38.89  ? 219 VAL A C   1 
ATOM   1503 O O   . VAL A 1 202 ? 2.186   32.706  35.283  1.00 38.94  ? 219 VAL A O   1 
ATOM   1504 C CB  . VAL A 1 202 ? -0.150  35.134  34.938  1.00 42.07  ? 219 VAL A CB  1 
ATOM   1505 C CG1 . VAL A 1 202 ? 0.094   35.047  36.445  1.00 35.98  ? 219 VAL A CG1 1 
ATOM   1506 C CG2 . VAL A 1 202 ? -0.284  36.615  34.548  1.00 39.50  ? 219 VAL A CG2 1 
ATOM   1507 N N   . PHE A 1 203 ? 0.427   32.058  34.026  1.00 40.13  ? 220 PHE A N   1 
ATOM   1508 C CA  . PHE A 1 203 ? 0.419   30.687  34.468  1.00 34.60  ? 220 PHE A CA  1 
ATOM   1509 C C   . PHE A 1 203 ? 1.791   30.067  34.192  1.00 39.81  ? 220 PHE A C   1 
ATOM   1510 O O   . PHE A 1 203 ? 2.392   29.497  35.113  1.00 39.47  ? 220 PHE A O   1 
ATOM   1511 C CB  . PHE A 1 203 ? -0.718  29.912  33.793  1.00 42.22  ? 220 PHE A CB  1 
ATOM   1512 C CG  . PHE A 1 203 ? -0.710  28.425  34.096  1.00 42.46  ? 220 PHE A CG  1 
ATOM   1513 C CD1 . PHE A 1 203 ? -1.073  27.952  35.351  1.00 44.60  ? 220 PHE A CD1 1 
ATOM   1514 C CD2 . PHE A 1 203 ? -0.299  27.515  33.136  1.00 42.51  ? 220 PHE A CD2 1 
ATOM   1515 C CE1 . PHE A 1 203 ? -1.039  26.599  35.638  1.00 43.36  ? 220 PHE A CE1 1 
ATOM   1516 C CE2 . PHE A 1 203 ? -0.277  26.166  33.413  1.00 47.07  ? 220 PHE A CE2 1 
ATOM   1517 C CZ  . PHE A 1 203 ? -0.648  25.705  34.666  1.00 45.23  ? 220 PHE A CZ  1 
ATOM   1518 N N   . TYR A 1 204 ? 2.323   30.230  32.973  1.00 37.78  ? 221 TYR A N   1 
ATOM   1519 C CA  . TYR A 1 204 ? 3.661   29.703  32.677  1.00 37.41  ? 221 TYR A CA  1 
ATOM   1520 C C   . TYR A 1 204 ? 4.708   30.278  33.616  1.00 41.84  ? 221 TYR A C   1 
ATOM   1521 O O   . TYR A 1 204 ? 5.566   29.543  34.123  1.00 47.59  ? 221 TYR A O   1 
ATOM   1522 C CB  . TYR A 1 204 ? 4.065   29.900  31.222  1.00 37.81  ? 221 TYR A CB  1 
ATOM   1523 C CG  . TYR A 1 204 ? 3.194   29.145  30.274  1.00 42.70  ? 221 TYR A CG  1 
ATOM   1524 C CD1 . TYR A 1 204 ? 2.497   28.018  30.717  1.00 53.44  ? 221 TYR A CD1 1 
ATOM   1525 C CD2 . TYR A 1 204 ? 3.031   29.539  28.915  1.00 50.50  ? 221 TYR A CD2 1 
ATOM   1526 C CE1 . TYR A 1 204 ? 1.651   27.292  29.863  1.00 55.62  ? 221 TYR A CE1 1 
ATOM   1527 C CE2 . TYR A 1 204 ? 2.186   28.805  28.035  1.00 50.14  ? 221 TYR A CE2 1 
ATOM   1528 C CZ  . TYR A 1 204 ? 1.491   27.668  28.530  1.00 51.53  ? 221 TYR A CZ  1 
ATOM   1529 O OH  . TYR A 1 204 ? 0.633   26.857  27.776  1.00 48.78  ? 221 TYR A OH  1 
ATOM   1530 N N   . ARG A 1 205 ? 4.617   31.575  33.889  1.00 42.70  ? 222 ARG A N   1 
ATOM   1531 C CA  . ARG A 1 205 ? 5.627   32.273  34.696  1.00 43.28  ? 222 ARG A CA  1 
ATOM   1532 C C   . ARG A 1 205 ? 5.567   31.799  36.158  1.00 46.53  ? 222 ARG A C   1 
ATOM   1533 O O   . ARG A 1 205 ? 6.599   31.580  36.806  1.00 45.76  ? 222 ARG A O   1 
ATOM   1534 C CB  . ARG A 1 205 ? 5.349   33.757  34.593  1.00 45.39  ? 222 ARG A CB  1 
ATOM   1535 C CG  . ARG A 1 205 ? 6.401   34.700  35.136  1.00 52.65  ? 222 ARG A CG  1 
ATOM   1536 C CD  . ARG A 1 205 ? 5.803   36.104  35.053  1.00 61.08  ? 222 ARG A CD  1 
ATOM   1537 N NE  . ARG A 1 205 ? 5.083   36.452  36.284  1.00 60.95  ? 222 ARG A NE  1 
ATOM   1538 C CZ  . ARG A 1 205 ? 3.958   37.169  36.357  1.00 66.68  ? 222 ARG A CZ  1 
ATOM   1539 N NH1 . ARG A 1 205 ? 3.342   37.627  35.263  1.00 57.79  ? 222 ARG A NH1 1 
ATOM   1540 N NH2 . ARG A 1 205 ? 3.435   37.420  37.556  1.00 69.62  ? 222 ARG A NH2 1 
ATOM   1541 N N   . GLU A 1 206 ? 4.350   31.600  36.668  1.00 43.04  ? 223 GLU A N   1 
ATOM   1542 C CA  . GLU A 1 206 ? 4.198   31.117  38.028  1.00 45.44  ? 223 GLU A CA  1 
ATOM   1543 C C   . GLU A 1 206 ? 4.637   29.629  38.114  1.00 43.61  ? 223 GLU A C   1 
ATOM   1544 O O   . GLU A 1 206 ? 5.405   29.227  39.008  1.00 41.91  ? 223 GLU A O   1 
ATOM   1545 C CB  . GLU A 1 206 ? 2.780   31.393  38.595  1.00 45.97  ? 223 GLU A CB  1 
ATOM   1546 C CG  . GLU A 1 206 ? 2.337   32.873  38.793  1.00 51.05  ? 223 GLU A CG  1 
ATOM   1547 C CD  . GLU A 1 206 ? 3.389   33.833  39.413  1.00 57.57  ? 223 GLU A CD  1 
ATOM   1548 O OE1 . GLU A 1 206 ? 3.987   33.526  40.466  1.00 51.99  ? 223 GLU A OE1 1 
ATOM   1549 O OE2 . GLU A 1 206 ? 3.619   34.937  38.847  1.00 61.92  ? 223 GLU A OE2 1 
ATOM   1550 N N   . MET A 1 207 ? 4.196   28.838  37.150  1.00 39.19  ? 224 MET A N   1 
ATOM   1551 C CA  . MET A 1 207 ? 4.597   27.462  37.084  1.00 40.15  ? 224 MET A CA  1 
ATOM   1552 C C   . MET A 1 207 ? 6.119   27.323  37.010  1.00 38.54  ? 224 MET A C   1 
ATOM   1553 O O   . MET A 1 207 ? 6.684   26.422  37.632  1.00 37.09  ? 224 MET A O   1 
ATOM   1554 C CB  . MET A 1 207 ? 3.930   26.749  35.912  1.00 39.46  ? 224 MET A CB  1 
ATOM   1555 C CG  . MET A 1 207 ? 2.546   26.213  36.152  1.00 38.93  ? 224 MET A CG  1 
ATOM   1556 S SD  . MET A 1 207 ? 2.328   25.344  37.706  1.00 53.02  ? 224 MET A SD  1 
ATOM   1557 C CE  . MET A 1 207 ? 1.152   24.114  37.151  1.00 47.91  ? 224 MET A CE  1 
ATOM   1558 N N   . SER A 1 208 ? 6.776   28.210  36.269  1.00 40.93  ? 225 SER A N   1 
ATOM   1559 C CA  . SER A 1 208 ? 8.259   28.178  36.137  1.00 41.58  ? 225 SER A CA  1 
ATOM   1560 C C   . SER A 1 208 ? 8.996   28.315  37.460  1.00 43.49  ? 225 SER A C   1 
ATOM   1561 O O   . SER A 1 208 ? 9.892   27.506  37.778  1.00 45.85  ? 225 SER A O   1 
ATOM   1562 C CB  . SER A 1 208 ? 8.750   29.281  35.222  1.00 38.72  ? 225 SER A CB  1 
ATOM   1563 O OG  . SER A 1 208 ? 9.677   28.774  34.287  1.00 39.64  ? 225 SER A OG  1 
ATOM   1564 N N   . LYS A 1 209 ? 8.613   29.343  38.215  1.00 44.22  ? 226 LYS A N   1 
ATOM   1565 C CA  . LYS A 1 209 ? 9.158   29.606  39.555  1.00 47.60  ? 226 LYS A CA  1 
ATOM   1566 C C   . LYS A 1 209 ? 9.088   28.333  40.418  1.00 51.91  ? 226 LYS A C   1 
ATOM   1567 O O   . LYS A 1 209 ? 10.123  27.876  40.998  1.00 56.31  ? 226 LYS A O   1 
ATOM   1568 C CB  . LYS A 1 209 ? 8.379   30.758  40.222  1.00 45.23  ? 226 LYS A CB  1 
ATOM   1569 C CG  . LYS A 1 209 ? 8.810   32.137  39.753  1.00 53.23  ? 226 LYS A CG  1 
ATOM   1570 C CD  . LYS A 1 209 ? 7.605   33.022  39.459  1.00 60.41  ? 226 LYS A CD  1 
ATOM   1571 C CE  . LYS A 1 209 ? 7.682   34.426  40.083  1.00 58.20  ? 226 LYS A CE  1 
ATOM   1572 N NZ  . LYS A 1 209 ? 6.462   35.254  39.820  1.00 57.48  ? 226 LYS A NZ  1 
ATOM   1573 N N   . LEU A 1 210 ? 7.870   27.767  40.479  1.00 45.31  ? 227 LEU A N   1 
ATOM   1574 C CA  . LEU A 1 210 ? 7.590   26.576  41.271  1.00 43.59  ? 227 LEU A CA  1 
ATOM   1575 C C   . LEU A 1 210 ? 8.361   25.418  40.758  1.00 42.77  ? 227 LEU A C   1 
ATOM   1576 O O   . LEU A 1 210 ? 8.814   24.599  41.533  1.00 49.20  ? 227 LEU A O   1 
ATOM   1577 C CB  . LEU A 1 210 ? 6.121   26.217  41.257  1.00 40.79  ? 227 LEU A CB  1 
ATOM   1578 C CG  . LEU A 1 210 ? 5.221   27.220  41.984  1.00 39.92  ? 227 LEU A CG  1 
ATOM   1579 C CD1 . LEU A 1 210 ? 3.924   26.455  42.040  1.00 37.52  ? 227 LEU A CD1 1 
ATOM   1580 C CD2 . LEU A 1 210 ? 5.744   27.645  43.364  1.00 35.81  ? 227 LEU A CD2 1 
ATOM   1581 N N   . ASN A 1 211 ? 8.531   25.362  39.450  1.00 40.73  ? 228 ASN A N   1 
ATOM   1582 C CA  . ASN A 1 211 ? 9.311   24.313  38.876  1.00 40.65  ? 228 ASN A CA  1 
ATOM   1583 C C   . ASN A 1 211 ? 10.741  24.453  39.325  1.00 42.98  ? 228 ASN A C   1 
ATOM   1584 O O   . ASN A 1 211 ? 11.356  23.453  39.647  1.00 49.99  ? 228 ASN A O   1 
ATOM   1585 C CB  . ASN A 1 211 ? 9.217   24.310  37.377  1.00 41.47  ? 228 ASN A CB  1 
ATOM   1586 C CG  . ASN A 1 211 ? 9.570   22.979  36.809  1.00 47.71  ? 228 ASN A CG  1 
ATOM   1587 O OD1 . ASN A 1 211 ? 9.005   21.945  37.212  1.00 55.73  ? 228 ASN A OD1 1 
ATOM   1588 N ND2 . ASN A 1 211 ? 10.507  22.970  35.871  1.00 48.16  ? 228 ASN A ND2 1 
ATOM   1589 N N   . HIS A 1 212 ? 11.253  25.686  39.422  1.00 45.36  ? 229 HIS A N   1 
ATOM   1590 C CA  . HIS A 1 212 ? 12.614  25.889  39.945  1.00 44.01  ? 229 HIS A CA  1 
ATOM   1591 C C   . HIS A 1 212 ? 12.735  25.534  41.396  1.00 41.68  ? 229 HIS A C   1 
ATOM   1592 O O   . HIS A 1 212 ? 13.682  24.856  41.758  1.00 45.71  ? 229 HIS A O   1 
ATOM   1593 C CB  . HIS A 1 212 ? 13.185  27.308  39.713  1.00 47.93  ? 229 HIS A CB  1 
ATOM   1594 C CG  . HIS A 1 212 ? 13.865  27.454  38.394  1.00 64.63  ? 229 HIS A CG  1 
ATOM   1595 N ND1 . HIS A 1 212 ? 13.661  28.537  37.562  1.00 72.82  ? 229 HIS A ND1 1 
ATOM   1596 C CD2 . HIS A 1 212 ? 14.695  26.616  37.724  1.00 75.30  ? 229 HIS A CD2 1 
ATOM   1597 C CE1 . HIS A 1 212 ? 14.361  28.374  36.451  1.00 78.93  ? 229 HIS A CE1 1 
ATOM   1598 N NE2 . HIS A 1 212 ? 14.993  27.215  36.521  1.00 77.13  ? 229 HIS A NE2 1 
ATOM   1599 N N   . ASN A 1 213 ? 11.817  26.012  42.228  1.00 34.37  ? 230 ASN A N   1 
ATOM   1600 C CA  . ASN A 1 213 ? 11.882  25.701  43.643  1.00 37.03  ? 230 ASN A CA  1 
ATOM   1601 C C   . ASN A 1 213 ? 11.967  24.199  43.830  1.00 38.63  ? 230 ASN A C   1 
ATOM   1602 O O   . ASN A 1 213 ? 12.657  23.726  44.706  1.00 43.00  ? 230 ASN A O   1 
ATOM   1603 C CB  . ASN A 1 213 ? 10.598  26.172  44.351  1.00 43.80  ? 230 ASN A CB  1 
ATOM   1604 C CG  . ASN A 1 213 ? 10.435  27.682  44.330  1.00 45.57  ? 230 ASN A CG  1 
ATOM   1605 O OD1 . ASN A 1 213 ? 11.411  28.410  44.224  1.00 43.69  ? 230 ASN A OD1 1 
ATOM   1606 N ND2 . ASN A 1 213 ? 9.200   28.152  44.438  1.00 47.32  ? 230 ASN A ND2 1 
ATOM   1607 N N   . LEU A 1 214 ? 11.235  23.458  42.996  1.00 41.19  ? 231 LEU A N   1 
ATOM   1608 C CA  . LEU A 1 214 ? 11.155  22.024  43.095  1.00 44.02  ? 231 LEU A CA  1 
ATOM   1609 C C   . LEU A 1 214 ? 12.520  21.475  42.780  1.00 41.55  ? 231 LEU A C   1 
ATOM   1610 O O   . LEU A 1 214 ? 13.013  20.610  43.508  1.00 43.90  ? 231 LEU A O   1 
ATOM   1611 C CB  . LEU A 1 214 ? 10.111  21.450  42.112  1.00 50.75  ? 231 LEU A CB  1 
ATOM   1612 C CG  . LEU A 1 214 ? 10.084  19.910  42.056  1.00 53.54  ? 231 LEU A CG  1 
ATOM   1613 C CD1 . LEU A 1 214 ? 9.917   19.340  43.460  1.00 51.28  ? 231 LEU A CD1 1 
ATOM   1614 C CD2 . LEU A 1 214 ? 9.010   19.378  41.116  1.00 54.23  ? 231 LEU A CD2 1 
ATOM   1615 N N   . TYR A 1 215 ? 13.132  21.985  41.707  1.00 36.97  ? 232 TYR A N   1 
ATOM   1616 C CA  . TYR A 1 215 ? 14.458  21.538  41.313  1.00 40.31  ? 232 TYR A CA  1 
ATOM   1617 C C   . TYR A 1 215 ? 15.453  21.719  42.456  1.00 44.81  ? 232 TYR A C   1 
ATOM   1618 O O   . TYR A 1 215 ? 16.342  20.887  42.659  1.00 44.93  ? 232 TYR A O   1 
ATOM   1619 C CB  . TYR A 1 215 ? 14.964  22.285  40.092  1.00 41.87  ? 232 TYR A CB  1 
ATOM   1620 C CG  . TYR A 1 215 ? 16.353  21.832  39.698  1.00 37.38  ? 232 TYR A CG  1 
ATOM   1621 C CD1 . TYR A 1 215 ? 17.479  22.349  40.355  1.00 38.10  ? 232 TYR A CD1 1 
ATOM   1622 C CD2 . TYR A 1 215 ? 16.545  20.884  38.695  1.00 34.51  ? 232 TYR A CD2 1 
ATOM   1623 C CE1 . TYR A 1 215 ? 18.757  21.949  40.020  1.00 37.40  ? 232 TYR A CE1 1 
ATOM   1624 C CE2 . TYR A 1 215 ? 17.830  20.449  38.359  1.00 38.91  ? 232 TYR A CE2 1 
ATOM   1625 C CZ  . TYR A 1 215 ? 18.926  20.991  39.028  1.00 39.75  ? 232 TYR A CZ  1 
ATOM   1626 O OH  . TYR A 1 215 ? 20.202  20.627  38.717  1.00 41.30  ? 232 TYR A OH  1 
ATOM   1627 N N   . GLU A 1 216 ? 15.254  22.776  43.235  1.00 43.59  ? 233 GLU A N   1 
ATOM   1628 C CA  . GLU A 1 216 ? 16.193  23.125  44.284  1.00 47.17  ? 233 GLU A CA  1 
ATOM   1629 C C   . GLU A 1 216 ? 15.961  22.306  45.503  1.00 44.02  ? 233 GLU A C   1 
ATOM   1630 O O   . GLU A 1 216 ? 16.916  21.877  46.181  1.00 40.30  ? 233 GLU A O   1 
ATOM   1631 C CB  . GLU A 1 216 ? 16.106  24.612  44.609  1.00 47.88  ? 233 GLU A CB  1 
ATOM   1632 C CG  . GLU A 1 216 ? 16.979  25.408  43.643  1.00 55.92  ? 233 GLU A CG  1 
ATOM   1633 C CD  . GLU A 1 216 ? 16.396  26.767  43.339  1.00 74.55  ? 233 GLU A CD  1 
ATOM   1634 O OE1 . GLU A 1 216 ? 15.844  27.381  44.294  1.00 75.42  ? 233 GLU A OE1 1 
ATOM   1635 O OE2 . GLU A 1 216 ? 16.479  27.206  42.155  1.00 76.18  ? 233 GLU A OE2 1 
ATOM   1636 N N   . VAL A 1 217 ? 14.680  22.107  45.770  1.00 38.28  ? 234 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 217 ? 14.219  21.363  46.913  1.00 36.55  ? 234 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 217 ? 14.642  19.875  46.712  1.00 43.37  ? 234 VAL A C   1 
ATOM   1639 O O   . VAL A 1 217 ? 15.144  19.231  47.641  1.00 43.88  ? 234 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 217 ? 12.708  21.661  47.128  1.00 35.49  ? 234 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 217 ? 11.812  20.554  46.613  1.00 35.74  ? 234 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 217 ? 12.399  21.980  48.576  1.00 39.42  ? 234 VAL A CG2 1 
ATOM   1643 N N   . MET A 1 218 ? 14.526  19.343  45.495  1.00 40.80  ? 235 MET A N   1 
ATOM   1644 C CA  . MET A 1 218 ? 15.011  17.980  45.263  1.00 43.25  ? 235 MET A CA  1 
ATOM   1645 C C   . MET A 1 218 ? 16.567  17.835  45.245  1.00 45.59  ? 235 MET A C   1 
ATOM   1646 O O   . MET A 1 218 ? 17.084  16.749  45.465  1.00 46.69  ? 235 MET A O   1 
ATOM   1647 C CB  . MET A 1 218 ? 14.422  17.397  43.962  1.00 46.26  ? 235 MET A CB  1 
ATOM   1648 C CG  . MET A 1 218 ? 12.917  17.140  43.970  1.00 44.15  ? 235 MET A CG  1 
ATOM   1649 S SD  . MET A 1 218 ? 12.310  16.282  45.443  1.00 49.07  ? 235 MET A SD  1 
ATOM   1650 C CE  . MET A 1 218 ? 13.062  14.711  45.062  1.00 37.57  ? 235 MET A CE  1 
ATOM   1651 N N   . SER A 1 219 ? 17.305  18.903  44.949  1.00 42.67  ? 236 SER A N   1 
ATOM   1652 C CA  . SER A 1 219 ? 18.745  18.802  44.819  1.00 42.92  ? 236 SER A CA  1 
ATOM   1653 C C   . SER A 1 219 ? 19.486  18.888  46.180  1.00 43.01  ? 236 SER A C   1 
ATOM   1654 O O   . SER A 1 219 ? 20.697  18.696  46.231  1.00 56.44  ? 236 SER A O   1 
ATOM   1655 C CB  . SER A 1 219 ? 19.259  19.841  43.819  1.00 44.35  ? 236 SER A CB  1 
ATOM   1656 O OG  . SER A 1 219 ? 19.340  21.095  44.445  1.00 49.88  ? 236 SER A OG  1 
ATOM   1657 N N   . LYS A 1 220 ? 18.741  19.130  47.258  1.00 39.22  ? 237 LYS A N   1 
ATOM   1658 C CA  . LYS A 1 220 ? 19.174  19.045  48.663  1.00 39.11  ? 237 LYS A CA  1 
ATOM   1659 C C   . LYS A 1 220 ? 19.151  17.635  49.236  1.00 43.97  ? 237 LYS A C   1 
ATOM   1660 O O   . LYS A 1 220 ? 19.786  17.372  50.259  1.00 53.09  ? 237 LYS A O   1 
ATOM   1661 C CB  . LYS A 1 220 ? 18.172  19.780  49.562  1.00 41.39  ? 237 LYS A CB  1 
ATOM   1662 C CG  . LYS A 1 220 ? 17.965  21.264  49.311  1.00 50.08  ? 237 LYS A CG  1 
ATOM   1663 C CD  . LYS A 1 220 ? 16.958  21.743  50.353  1.00 48.10  ? 237 LYS A CD  1 
ATOM   1664 C CE  . LYS A 1 220 ? 16.979  23.250  50.535  1.00 45.84  ? 237 LYS A CE  1 
ATOM   1665 N NZ  . LYS A 1 220 ? 15.812  23.887  49.858  1.00 55.25  ? 237 LYS A NZ  1 
ATOM   1666 N N   . LEU A 1 221 ? 18.327  16.767  48.656  1.00 43.69  ? 238 LEU A N   1 
ATOM   1667 C CA  . LEU A 1 221 ? 18.214  15.383  49.077  1.00 47.40  ? 238 LEU A CA  1 
ATOM   1668 C C   . LEU A 1 221 ? 19.439  14.532  48.707  1.00 47.30  ? 238 LEU A C   1 
ATOM   1669 O O   . LEU A 1 221 ? 19.787  13.548  49.360  1.00 46.35  ? 238 LEU A O   1 
ATOM   1670 C CB  . LEU A 1 221 ? 16.926  14.777  48.496  1.00 46.65  ? 238 LEU A CB  1 
ATOM   1671 C CG  . LEU A 1 221 ? 15.778  14.514  49.477  1.00 43.18  ? 238 LEU A CG  1 
ATOM   1672 C CD1 . LEU A 1 221 ? 15.626  15.646  50.463  1.00 41.06  ? 238 LEU A CD1 1 
ATOM   1673 C CD2 . LEU A 1 221 ? 14.505  14.358  48.686  1.00 42.78  ? 238 LEU A CD2 1 
ATOM   1674 O OXT . LEU A 1 221 ? 20.122  14.817  47.724  1.00 53.22  ? 238 LEU A OXT 1 
ATOM   1675 N N   . GLU B 1 24  ? 14.495  -13.428 60.959  1.00 63.28  ? 41  GLU B N   1 
ATOM   1676 C CA  . GLU B 1 24  ? 14.375  -12.101 61.669  1.00 79.43  ? 41  GLU B CA  1 
ATOM   1677 C C   . GLU B 1 24  ? 15.080  -10.918 60.961  1.00 89.15  ? 41  GLU B C   1 
ATOM   1678 O O   . GLU B 1 24  ? 14.454  -9.855  60.721  1.00 77.48  ? 41  GLU B O   1 
ATOM   1679 C CB  . GLU B 1 24  ? 14.865  -12.208 63.127  1.00 74.02  ? 41  GLU B CB  1 
ATOM   1680 C CG  . GLU B 1 24  ? 13.757  -12.429 64.168  1.00 70.69  ? 41  GLU B CG  1 
ATOM   1681 C CD  . GLU B 1 24  ? 12.669  -11.336 64.123  1.00 71.31  ? 41  GLU B CD  1 
ATOM   1682 O OE1 . GLU B 1 24  ? 11.458  -11.692 63.902  1.00 49.87  ? 41  GLU B OE1 1 
ATOM   1683 O OE2 . GLU B 1 24  ? 13.035  -10.121 64.289  1.00 57.83  ? 41  GLU B OE2 1 
ATOM   1684 N N   . ARG B 1 25  ? 16.370  -11.122 60.651  1.00 92.25  ? 42  ARG B N   1 
ATOM   1685 C CA  . ARG B 1 25  ? 17.243  -10.144 59.977  1.00 91.86  ? 42  ARG B CA  1 
ATOM   1686 C C   . ARG B 1 25  ? 16.842  -9.892  58.500  1.00 101.35 ? 42  ARG B C   1 
ATOM   1687 O O   . ARG B 1 25  ? 16.816  -8.741  58.000  1.00 97.36  ? 42  ARG B O   1 
ATOM   1688 C CB  . ARG B 1 25  ? 18.696  -10.632 60.088  1.00 87.46  ? 42  ARG B CB  1 
ATOM   1689 C CG  . ARG B 1 25  ? 19.576  -10.244 58.917  1.00 88.46  ? 42  ARG B CG  1 
ATOM   1690 C CD  . ARG B 1 25  ? 21.044  -10.515 59.182  1.00 89.46  ? 42  ARG B CD  1 
ATOM   1691 N NE  . ARG B 1 25  ? 21.847  -10.019 58.060  1.00 96.96  ? 42  ARG B NE  1 
ATOM   1692 C CZ  . ARG B 1 25  ? 23.168  -9.840  58.074  1.00 93.56  ? 42  ARG B CZ  1 
ATOM   1693 N NH1 . ARG B 1 25  ? 23.875  -10.114 59.162  1.00 93.26  ? 42  ARG B NH1 1 
ATOM   1694 N NH2 . ARG B 1 25  ? 23.789  -9.377  56.994  1.00 86.70  ? 42  ARG B NH2 1 
ATOM   1695 N N   . PHE B 1 26  ? 16.542  -11.000 57.823  1.00 104.28 ? 43  PHE B N   1 
ATOM   1696 C CA  . PHE B 1 26  ? 16.011  -11.026 56.476  1.00 89.46  ? 43  PHE B CA  1 
ATOM   1697 C C   . PHE B 1 26  ? 14.571  -10.517 56.536  1.00 94.28  ? 43  PHE B C   1 
ATOM   1698 O O   . PHE B 1 26  ? 14.260  -9.433  56.041  1.00 87.40  ? 43  PHE B O   1 
ATOM   1699 C CB  . PHE B 1 26  ? 16.009  -12.475 56.005  1.00 91.75  ? 43  PHE B CB  1 
ATOM   1700 C CG  . PHE B 1 26  ? 16.784  -12.737 54.735  1.00 93.74  ? 43  PHE B CG  1 
ATOM   1701 C CD1 . PHE B 1 26  ? 18.174  -12.580 54.691  1.00 92.04  ? 43  PHE B CD1 1 
ATOM   1702 C CD2 . PHE B 1 26  ? 16.128  -13.224 53.598  1.00 90.49  ? 43  PHE B CD2 1 
ATOM   1703 C CE1 . PHE B 1 26  ? 18.883  -12.861 53.527  1.00 87.72  ? 43  PHE B CE1 1 
ATOM   1704 C CE2 . PHE B 1 26  ? 16.832  -13.500 52.433  1.00 88.88  ? 43  PHE B CE2 1 
ATOM   1705 C CZ  . PHE B 1 26  ? 18.212  -13.317 52.397  1.00 89.85  ? 43  PHE B CZ  1 
ATOM   1706 N N   . GLU B 1 27  ? 13.693  -11.285 57.179  1.00 98.44  ? 44  GLU B N   1 
ATOM   1707 C CA  . GLU B 1 27  ? 12.249  -10.985 57.171  1.00 102.21 ? 44  GLU B CA  1 
ATOM   1708 C C   . GLU B 1 27  ? 11.922  -9.478  57.286  1.00 96.13  ? 44  GLU B C   1 
ATOM   1709 O O   . GLU B 1 27  ? 10.974  -8.993  56.666  1.00 93.92  ? 44  GLU B O   1 
ATOM   1710 C CB  . GLU B 1 27  ? 11.481  -11.825 58.219  1.00 106.46 ? 44  GLU B CB  1 
ATOM   1711 C CG  . GLU B 1 27  ? 11.864  -13.314 58.320  1.00 108.64 ? 44  GLU B CG  1 
ATOM   1712 C CD  . GLU B 1 27  ? 11.922  -14.073 56.985  1.00 104.01 ? 44  GLU B CD  1 
ATOM   1713 O OE1 . GLU B 1 27  ? 10.996  -13.946 56.145  1.00 94.02  ? 44  GLU B OE1 1 
ATOM   1714 O OE2 . GLU B 1 27  ? 12.902  -14.828 56.782  1.00 91.44  ? 44  GLU B OE2 1 
ATOM   1715 N N   . GLN B 1 28  ? 12.719  -8.740  58.054  1.00 92.24  ? 45  GLN B N   1 
ATOM   1716 C CA  . GLN B 1 28  ? 12.561  -7.281  58.122  1.00 89.27  ? 45  GLN B CA  1 
ATOM   1717 C C   . GLN B 1 28  ? 13.317  -6.547  56.985  1.00 88.31  ? 45  GLN B C   1 
ATOM   1718 O O   . GLN B 1 28  ? 12.864  -5.500  56.512  1.00 100.00 ? 45  GLN B O   1 
ATOM   1719 C CB  . GLN B 1 28  ? 12.854  -6.739  59.543  1.00 79.15  ? 45  GLN B CB  1 
ATOM   1720 C CG  . GLN B 1 28  ? 13.112  -5.239  59.676  1.00 76.37  ? 45  GLN B CG  1 
ATOM   1721 C CD  . GLN B 1 28  ? 14.545  -4.866  59.299  1.00 73.02  ? 45  GLN B CD  1 
ATOM   1722 O OE1 . GLN B 1 28  ? 15.424  -5.729  59.218  1.00 69.85  ? 45  GLN B OE1 1 
ATOM   1723 N NE2 . GLN B 1 28  ? 14.779  -3.586  59.048  1.00 67.81  ? 45  GLN B NE2 1 
ATOM   1724 N N   . SER B 1 29  ? 14.441  -7.093  56.530  1.00 73.07  ? 46  SER B N   1 
ATOM   1725 C CA  . SER B 1 29  ? 15.095  -6.555  55.337  1.00 65.38  ? 46  SER B CA  1 
ATOM   1726 C C   . SER B 1 29  ? 14.263  -6.752  54.019  1.00 74.36  ? 46  SER B C   1 
ATOM   1727 O O   . SER B 1 29  ? 14.033  -5.808  53.236  1.00 72.69  ? 46  SER B O   1 
ATOM   1728 C CB  . SER B 1 29  ? 16.480  -7.172  55.227  1.00 59.92  ? 46  SER B CB  1 
ATOM   1729 O OG  . SER B 1 29  ? 17.151  -6.670  54.104  1.00 65.22  ? 46  SER B OG  1 
ATOM   1730 N N   . ALA B 1 30  ? 13.827  -7.984  53.775  1.00 71.08  ? 47  ALA B N   1 
ATOM   1731 C CA  . ALA B 1 30  ? 12.821  -8.252  52.778  1.00 64.33  ? 47  ALA B CA  1 
ATOM   1732 C C   . ALA B 1 30  ? 11.662  -7.303  53.005  1.00 65.25  ? 47  ALA B C   1 
ATOM   1733 O O   . ALA B 1 30  ? 11.088  -6.741  52.052  1.00 77.09  ? 47  ALA B O   1 
ATOM   1734 C CB  . ALA B 1 30  ? 12.343  -9.681  52.902  1.00 66.26  ? 47  ALA B CB  1 
ATOM   1735 N N   . ASN B 1 31  ? 11.313  -7.113  54.270  1.00 59.06  ? 48  ASN B N   1 
ATOM   1736 C CA  . ASN B 1 31  ? 10.234  -6.200  54.610  1.00 59.87  ? 48  ASN B CA  1 
ATOM   1737 C C   . ASN B 1 31  ? 10.604  -4.826  54.031  1.00 57.64  ? 48  ASN B C   1 
ATOM   1738 O O   . ASN B 1 31  ? 9.748   -4.119  53.511  1.00 65.07  ? 48  ASN B O   1 
ATOM   1739 C CB  . ASN B 1 31  ? 9.979   -6.186  56.138  1.00 59.71  ? 48  ASN B CB  1 
ATOM   1740 C CG  . ASN B 1 31  ? 9.032   -5.061  56.592  1.00 67.09  ? 48  ASN B CG  1 
ATOM   1741 O OD1 . ASN B 1 31  ? 9.364   -3.875  56.512  1.00 70.15  ? 48  ASN B OD1 1 
ATOM   1742 N ND2 . ASN B 1 31  ? 7.869   -5.438  57.119  1.00 66.44  ? 48  ASN B ND2 1 
ATOM   1743 N N   . ASN B 1 32  ? 11.887  -4.478  54.093  1.00 52.23  ? 49  ASN B N   1 
ATOM   1744 C CA  . ASN B 1 32  ? 12.367  -3.210  53.574  1.00 53.94  ? 49  ASN B CA  1 
ATOM   1745 C C   . ASN B 1 32  ? 12.106  -3.193  52.082  1.00 53.44  ? 49  ASN B C   1 
ATOM   1746 O O   . ASN B 1 32  ? 11.527  -2.241  51.539  1.00 48.36  ? 49  ASN B O   1 
ATOM   1747 C CB  . ASN B 1 32  ? 13.888  -3.078  53.777  1.00 54.92  ? 49  ASN B CB  1 
ATOM   1748 C CG  . ASN B 1 32  ? 14.290  -2.548  55.157  1.00 51.74  ? 49  ASN B CG  1 
ATOM   1749 O OD1 . ASN B 1 32  ? 15.497  -2.442  55.414  1.00 47.62  ? 49  ASN B OD1 1 
ATOM   1750 N ND2 . ASN B 1 32  ? 13.316  -2.199  56.032  1.00 39.77  ? 49  ASN B ND2 1 
ATOM   1751 N N   . PHE B 1 33  ? 12.548  -4.266  51.429  1.00 53.47  ? 50  PHE B N   1 
ATOM   1752 C CA  . PHE B 1 33  ? 12.461  -4.359  50.002  1.00 50.99  ? 50  PHE B CA  1 
ATOM   1753 C C   . PHE B 1 33  ? 11.031  -4.281  49.500  1.00 52.33  ? 50  PHE B C   1 
ATOM   1754 O O   . PHE B 1 33  ? 10.809  -3.676  48.448  1.00 55.04  ? 50  PHE B O   1 
ATOM   1755 C CB  . PHE B 1 33  ? 13.144  -5.604  49.490  1.00 53.54  ? 50  PHE B CB  1 
ATOM   1756 C CG  . PHE B 1 33  ? 12.689  -6.004  48.114  1.00 63.13  ? 50  PHE B CG  1 
ATOM   1757 C CD1 . PHE B 1 33  ? 13.185  -5.354  46.981  1.00 61.24  ? 50  PHE B CD1 1 
ATOM   1758 C CD2 . PHE B 1 33  ? 11.744  -7.027  47.940  1.00 59.82  ? 50  PHE B CD2 1 
ATOM   1759 C CE1 . PHE B 1 33  ? 12.759  -5.725  45.715  1.00 61.35  ? 50  PHE B CE1 1 
ATOM   1760 C CE2 . PHE B 1 33  ? 11.304  -7.388  46.671  1.00 58.43  ? 50  PHE B CE2 1 
ATOM   1761 C CZ  . PHE B 1 33  ? 11.814  -6.741  45.557  1.00 59.88  ? 50  PHE B CZ  1 
ATOM   1762 N N   . TYR B 1 34  ? 10.068  -4.874  50.225  1.00 57.73  ? 51  TYR B N   1 
ATOM   1763 C CA  . TYR B 1 34  ? 8.631   -4.794  49.811  1.00 57.93  ? 51  TYR B CA  1 
ATOM   1764 C C   . TYR B 1 34  ? 8.050   -3.390  49.860  1.00 60.54  ? 51  TYR B C   1 
ATOM   1765 O O   . TYR B 1 34  ? 7.381   -2.977  48.910  1.00 70.67  ? 51  TYR B O   1 
ATOM   1766 C CB  . TYR B 1 34  ? 7.705   -5.761  50.579  1.00 63.65  ? 51  TYR B CB  1 
ATOM   1767 C CG  . TYR B 1 34  ? 8.001   -7.229  50.302  1.00 71.01  ? 51  TYR B CG  1 
ATOM   1768 C CD1 . TYR B 1 34  ? 8.138   -7.694  48.986  1.00 71.54  ? 51  TYR B CD1 1 
ATOM   1769 C CD2 . TYR B 1 34  ? 8.164   -8.141  51.348  1.00 64.20  ? 51  TYR B CD2 1 
ATOM   1770 C CE1 . TYR B 1 34  ? 8.431   -9.019  48.717  1.00 76.30  ? 51  TYR B CE1 1 
ATOM   1771 C CE2 . TYR B 1 34  ? 8.455   -9.470  51.091  1.00 73.88  ? 51  TYR B CE2 1 
ATOM   1772 C CZ  . TYR B 1 34  ? 8.590   -9.904  49.777  1.00 81.82  ? 51  TYR B CZ  1 
ATOM   1773 O OH  . TYR B 1 34  ? 8.879   -11.220 49.503  1.00 89.54  ? 51  TYR B OH  1 
ATOM   1774 N N   . GLN B 1 35  ? 8.301   -2.654  50.947  1.00 59.25  ? 52  GLN B N   1 
ATOM   1775 C CA  . GLN B 1 35  ? 7.846   -1.257  51.051  1.00 55.58  ? 52  GLN B CA  1 
ATOM   1776 C C   . GLN B 1 35  ? 8.491   -0.470  49.925  1.00 45.49  ? 52  GLN B C   1 
ATOM   1777 O O   . GLN B 1 35  ? 7.820   0.295   49.198  1.00 37.46  ? 52  GLN B O   1 
ATOM   1778 C CB  . GLN B 1 35  ? 8.197   -0.653  52.408  1.00 66.11  ? 52  GLN B CB  1 
ATOM   1779 C CG  . GLN B 1 35  ? 7.436   -1.282  53.568  1.00 80.36  ? 52  GLN B CG  1 
ATOM   1780 C CD  . GLN B 1 35  ? 8.222   -1.243  54.870  1.00 88.22  ? 52  GLN B CD  1 
ATOM   1781 O OE1 . GLN B 1 35  ? 7.705   -0.830  55.915  1.00 80.33  ? 52  GLN B OE1 1 
ATOM   1782 N NE2 . GLN B 1 35  ? 9.484   -1.677  54.812  1.00 93.96  ? 52  GLN B NE2 1 
ATOM   1783 N N   . GLN B 1 36  ? 9.778   -0.741  49.714  1.00 40.46  ? 53  GLN B N   1 
ATOM   1784 C CA  . GLN B 1 36  ? 10.466  -0.177  48.553  1.00 41.61  ? 53  GLN B CA  1 
ATOM   1785 C C   . GLN B 1 36  ? 9.800   -0.490  47.216  1.00 47.42  ? 53  GLN B C   1 
ATOM   1786 O O   . GLN B 1 36  ? 9.694   0.382   46.360  1.00 45.23  ? 53  GLN B O   1 
ATOM   1787 C CB  . GLN B 1 36  ? 11.868  -0.654  48.505  1.00 39.95  ? 53  GLN B CB  1 
ATOM   1788 C CG  . GLN B 1 36  ? 12.669  0.236   47.619  1.00 47.97  ? 53  GLN B CG  1 
ATOM   1789 C CD  . GLN B 1 36  ? 14.020  -0.334  47.346  1.00 44.69  ? 53  GLN B CD  1 
ATOM   1790 O OE1 . GLN B 1 36  ? 14.377  -1.385  47.879  1.00 51.26  ? 53  GLN B OE1 1 
ATOM   1791 N NE2 . GLN B 1 36  ? 14.787  0.357   46.531  1.00 39.91  ? 53  GLN B NE2 1 
ATOM   1792 N N   . GLN B 1 37  ? 9.346   -1.738  47.047  1.00 55.44  ? 54  GLN B N   1 
ATOM   1793 C CA  . GLN B 1 37  ? 8.652   -2.162  45.828  1.00 51.24  ? 54  GLN B CA  1 
ATOM   1794 C C   . GLN B 1 37  ? 7.320   -1.444  45.665  1.00 49.87  ? 54  GLN B C   1 
ATOM   1795 O O   . GLN B 1 37  ? 6.988   -0.906  44.582  1.00 55.71  ? 54  GLN B O   1 
ATOM   1796 C CB  . GLN B 1 37  ? 8.515   -3.690  45.781  1.00 53.43  ? 54  GLN B CB  1 
ATOM   1797 C CG  . GLN B 1 37  ? 7.338   -4.248  44.968  1.00 62.32  ? 54  GLN B CG  1 
ATOM   1798 C CD  . GLN B 1 37  ? 7.349   -5.781  44.918  1.00 71.65  ? 54  GLN B CD  1 
ATOM   1799 O OE1 . GLN B 1 37  ? 7.164   -6.452  45.944  1.00 72.93  ? 54  GLN B OE1 1 
ATOM   1800 N NE2 . GLN B 1 37  ? 7.569   -6.343  43.721  1.00 60.44  ? 54  GLN B NE2 1 
ATOM   1801 N N   . ALA B 1 38  ? 6.561   -1.403  46.744  1.00 49.10  ? 55  ALA B N   1 
ATOM   1802 C CA  . ALA B 1 38  ? 5.219   -0.795  46.699  1.00 47.00  ? 55  ALA B CA  1 
ATOM   1803 C C   . ALA B 1 38  ? 5.280   0.691   46.437  1.00 45.04  ? 55  ALA B C   1 
ATOM   1804 O O   . ALA B 1 38  ? 4.446   1.254   45.708  1.00 50.75  ? 55  ALA B O   1 
ATOM   1805 C CB  . ALA B 1 38  ? 4.488   -1.057  48.004  1.00 44.58  ? 55  ALA B CB  1 
ATOM   1806 N N   . GLU B 1 39  ? 6.264   1.324   47.072  1.00 46.42  ? 56  GLU B N   1 
ATOM   1807 C CA  . GLU B 1 39  ? 6.557   2.744   46.856  1.00 41.19  ? 56  GLU B CA  1 
ATOM   1808 C C   . GLU B 1 39  ? 7.014   3.063   45.445  1.00 38.73  ? 56  GLU B C   1 
ATOM   1809 O O   . GLU B 1 39  ? 6.479   4.024   44.830  1.00 39.58  ? 56  GLU B O   1 
ATOM   1810 C CB  . GLU B 1 39  ? 7.623   3.233   47.822  1.00 38.44  ? 56  GLU B CB  1 
ATOM   1811 C CG  . GLU B 1 39  ? 7.765   4.729   47.775  1.00 43.08  ? 56  GLU B CG  1 
ATOM   1812 C CD  . GLU B 1 39  ? 8.826   5.166   48.716  1.00 45.78  ? 56  GLU B CD  1 
ATOM   1813 O OE1 . GLU B 1 39  ? 8.480   5.497   49.882  1.00 50.96  ? 56  GLU B OE1 1 
ATOM   1814 O OE2 . GLU B 1 39  ? 9.993   5.120   48.290  1.00 41.79  ? 56  GLU B OE2 1 
ATOM   1815 N N   . GLY B 1 40  ? 8.016   2.318   44.951  1.00 31.06  ? 57  GLY B N   1 
ATOM   1816 C CA  . GLY B 1 40  ? 8.441   2.480   43.548  1.00 30.43  ? 57  GLY B CA  1 
ATOM   1817 C C   . GLY B 1 40  ? 7.260   2.278   42.616  1.00 33.83  ? 57  GLY B C   1 
ATOM   1818 O O   . GLY B 1 40  ? 7.091   3.029   41.658  1.00 37.31  ? 57  GLY B O   1 
ATOM   1819 N N   . HIS B 1 41  ? 6.421   1.276   42.913  1.00 34.26  ? 58  HIS B N   1 
ATOM   1820 C CA  . HIS B 1 41  ? 5.269   0.950   42.064  1.00 35.87  ? 58  HIS B CA  1 
ATOM   1821 C C   . HIS B 1 41  ? 4.179   2.022   42.124  1.00 34.10  ? 58  HIS B C   1 
ATOM   1822 O O   . HIS B 1 41  ? 3.521   2.352   41.108  1.00 38.07  ? 58  HIS B O   1 
ATOM   1823 C CB  . HIS B 1 41  ? 4.691   -0.454  42.391  1.00 38.94  ? 58  HIS B CB  1 
ATOM   1824 C CG  . HIS B 1 41  ? 3.449   -0.789  41.620  1.00 42.45  ? 58  HIS B CG  1 
ATOM   1825 N ND1 . HIS B 1 41  ? 3.478   -1.162  40.290  1.00 39.36  ? 58  HIS B ND1 1 
ATOM   1826 C CD2 . HIS B 1 41  ? 2.135   -0.748  41.971  1.00 41.36  ? 58  HIS B CD2 1 
ATOM   1827 C CE1 . HIS B 1 41  ? 2.239   -1.376  39.868  1.00 36.81  ? 58  HIS B CE1 1 
ATOM   1828 N NE2 . HIS B 1 41  ? 1.406   -1.128  40.864  1.00 36.20  ? 58  HIS B NE2 1 
ATOM   1829 N N   . LYS B 1 42  ? 3.962   2.602   43.290  1.00 33.36  ? 59  LYS B N   1 
ATOM   1830 C CA  . LYS B 1 42  ? 3.042   3.762   43.281  1.00 32.28  ? 59  LYS B CA  1 
ATOM   1831 C C   . LYS B 1 42  ? 3.633   4.955   42.474  1.00 35.84  ? 59  LYS B C   1 
ATOM   1832 O O   . LYS B 1 42  ? 2.920   5.567   41.678  1.00 35.98  ? 59  LYS B O   1 
ATOM   1833 C CB  . LYS B 1 42  ? 2.702   4.144   44.677  1.00 34.67  ? 59  LYS B CB  1 
ATOM   1834 C CG  . LYS B 1 42  ? 1.343   4.751   44.805  1.00 44.11  ? 59  LYS B CG  1 
ATOM   1835 C CD  . LYS B 1 42  ? 1.150   5.304   46.203  1.00 46.77  ? 59  LYS B CD  1 
ATOM   1836 C CE  . LYS B 1 42  ? 0.215   6.483   46.056  1.00 53.54  ? 59  LYS B CE  1 
ATOM   1837 N NZ  . LYS B 1 42  ? 0.679   7.586   46.941  1.00 63.63  ? 59  LYS B NZ  1 
ATOM   1838 N N   . LEU B 1 43  ? 4.932   5.242   42.628  1.00 31.93  ? 60  LEU B N   1 
ATOM   1839 C CA  . LEU B 1 43  ? 5.558   6.355   41.890  1.00 33.09  ? 60  LEU B CA  1 
ATOM   1840 C C   . LEU B 1 43  ? 5.505   6.133   40.379  1.00 37.97  ? 60  LEU B C   1 
ATOM   1841 O O   . LEU B 1 43  ? 5.107   7.038   39.589  1.00 42.81  ? 60  LEU B O   1 
ATOM   1842 C CB  . LEU B 1 43  ? 7.035   6.631   42.326  1.00 26.89  ? 60  LEU B CB  1 
ATOM   1843 C CG  . LEU B 1 43  ? 7.656   7.885   41.683  1.00 28.68  ? 60  LEU B CG  1 
ATOM   1844 C CD1 . LEU B 1 43  ? 6.688   9.107   41.700  1.00 26.52  ? 60  LEU B CD1 1 
ATOM   1845 C CD2 . LEU B 1 43  ? 8.993   8.287   42.288  1.00 29.97  ? 60  LEU B CD2 1 
ATOM   1846 N N   . TYR B 1 44  ? 5.941   4.945   39.971  1.00 39.63  ? 61  TYR B N   1 
ATOM   1847 C CA  . TYR B 1 44  ? 5.939   4.572   38.572  1.00 37.49  ? 61  TYR B CA  1 
ATOM   1848 C C   . TYR B 1 44  ? 4.546   4.779   38.004  1.00 40.84  ? 61  TYR B C   1 
ATOM   1849 O O   . TYR B 1 44  ? 4.395   5.440   36.988  1.00 41.97  ? 61  TYR B O   1 
ATOM   1850 C CB  . TYR B 1 44  ? 6.389   3.130   38.437  1.00 42.84  ? 61  TYR B CB  1 
ATOM   1851 C CG  . TYR B 1 44  ? 6.067   2.492   37.115  1.00 41.06  ? 61  TYR B CG  1 
ATOM   1852 C CD1 . TYR B 1 44  ? 6.622   2.988   35.951  1.00 37.04  ? 61  TYR B CD1 1 
ATOM   1853 C CD2 . TYR B 1 44  ? 5.202   1.384   37.039  1.00 42.63  ? 61  TYR B CD2 1 
ATOM   1854 C CE1 . TYR B 1 44  ? 6.358   2.426   34.733  1.00 41.90  ? 61  TYR B CE1 1 
ATOM   1855 C CE2 . TYR B 1 44  ? 4.910   0.797   35.812  1.00 45.59  ? 61  TYR B CE2 1 
ATOM   1856 C CZ  . TYR B 1 44  ? 5.495   1.319   34.644  1.00 49.81  ? 61  TYR B CZ  1 
ATOM   1857 O OH  . TYR B 1 44  ? 5.219   0.775   33.369  1.00 44.39  ? 61  TYR B OH  1 
ATOM   1858 N N   . LYS B 1 45  ? 3.517   4.262   38.681  1.00 41.17  ? 62  LYS B N   1 
ATOM   1859 C CA  . LYS B 1 45  ? 2.163   4.443   38.211  1.00 38.94  ? 62  LYS B CA  1 
ATOM   1860 C C   . LYS B 1 45  ? 1.774   5.917   38.095  1.00 40.57  ? 62  LYS B C   1 
ATOM   1861 O O   . LYS B 1 45  ? 1.141   6.322   37.122  1.00 46.64  ? 62  LYS B O   1 
ATOM   1862 C CB  . LYS B 1 45  ? 1.183   3.684   39.104  1.00 50.69  ? 62  LYS B CB  1 
ATOM   1863 C CG  . LYS B 1 45  ? 1.194   2.164   38.911  1.00 56.17  ? 62  LYS B CG  1 
ATOM   1864 C CD  . LYS B 1 45  ? 1.058   1.760   37.434  1.00 61.39  ? 62  LYS B CD  1 
ATOM   1865 C CE  . LYS B 1 45  ? -0.388  1.474   37.040  1.00 65.30  ? 62  LYS B CE  1 
ATOM   1866 N NZ  . LYS B 1 45  ? -0.772  0.070   37.377  1.00 73.32  ? 62  LYS B NZ  1 
ATOM   1867 N N   . ASP B 1 46  ? 2.164   6.739   39.067  1.00 42.83  ? 63  ASP B N   1 
ATOM   1868 C CA  . ASP B 1 46  ? 1.807   8.171   39.059  1.00 37.74  ? 63  ASP B CA  1 
ATOM   1869 C C   . ASP B 1 46  ? 2.475   8.844   37.898  1.00 40.26  ? 63  ASP B C   1 
ATOM   1870 O O   . ASP B 1 46  ? 1.878   9.750   37.280  1.00 37.49  ? 63  ASP B O   1 
ATOM   1871 C CB  . ASP B 1 46  ? 2.285   8.884   40.305  1.00 37.72  ? 63  ASP B CB  1 
ATOM   1872 C CG  . ASP B 1 46  ? 1.504   8.516   41.514  1.00 39.15  ? 63  ASP B CG  1 
ATOM   1873 O OD1 . ASP B 1 46  ? 0.422   7.944   41.364  1.00 41.25  ? 63  ASP B OD1 1 
ATOM   1874 O OD2 . ASP B 1 46  ? 1.978   8.797   42.624  1.00 42.74  ? 63  ASP B OD2 1 
ATOM   1875 N N   . LEU B 1 47  ? 3.704   8.416   37.594  1.00 33.37  ? 64  LEU B N   1 
ATOM   1876 C CA  . LEU B 1 47  ? 4.423   9.058   36.493  1.00 37.96  ? 64  LEU B CA  1 
ATOM   1877 C C   . LEU B 1 47  ? 3.732   8.705   35.170  1.00 37.35  ? 64  LEU B C   1 
ATOM   1878 O O   . LEU B 1 47  ? 3.646   9.508   34.245  1.00 44.42  ? 64  LEU B O   1 
ATOM   1879 C CB  . LEU B 1 47  ? 5.936   8.709   36.483  1.00 29.87  ? 64  LEU B CB  1 
ATOM   1880 C CG  . LEU B 1 47  ? 6.649   9.289   37.698  1.00 30.46  ? 64  LEU B CG  1 
ATOM   1881 C CD1 . LEU B 1 47  ? 8.127   8.923   37.842  1.00 30.18  ? 64  LEU B CD1 1 
ATOM   1882 C CD2 . LEU B 1 47  ? 6.481   10.797  37.702  1.00 29.47  ? 64  LEU B CD2 1 
ATOM   1883 N N   . LYS B 1 48  ? 3.220   7.494   35.121  1.00 43.30  ? 65  LYS B N   1 
ATOM   1884 C CA  . LYS B 1 48  ? 2.637   6.918   33.920  1.00 42.76  ? 65  LYS B CA  1 
ATOM   1885 C C   . LYS B 1 48  ? 1.370   7.663   33.677  1.00 35.22  ? 65  LYS B C   1 
ATOM   1886 O O   . LYS B 1 48  ? 1.140   8.119   32.589  1.00 36.88  ? 65  LYS B O   1 
ATOM   1887 C CB  . LYS B 1 48  ? 2.384   5.426   34.148  1.00 44.71  ? 65  LYS B CB  1 
ATOM   1888 C CG  . LYS B 1 48  ? 2.184   4.610   32.891  1.00 62.56  ? 65  LYS B CG  1 
ATOM   1889 C CD  . LYS B 1 48  ? 3.496   4.116   32.299  1.00 68.37  ? 65  LYS B CD  1 
ATOM   1890 C CE  . LYS B 1 48  ? 3.268   3.572   30.889  1.00 71.87  ? 65  LYS B CE  1 
ATOM   1891 N NZ  . LYS B 1 48  ? 4.184   2.424   30.636  1.00 80.41  ? 65  LYS B NZ  1 
ATOM   1892 N N   . ASN B 1 49  ? 0.558   7.819   34.709  1.00 34.73  ? 66  ASN B N   1 
ATOM   1893 C CA  . ASN B 1 49  ? -0.612  8.686   34.622  1.00 38.83  ? 66  ASN B CA  1 
ATOM   1894 C C   . ASN B 1 49  ? -0.307  10.134  34.132  1.00 39.91  ? 66  ASN B C   1 
ATOM   1895 O O   . ASN B 1 49  ? -0.962  10.640  33.236  1.00 40.55  ? 66  ASN B O   1 
ATOM   1896 C CB  . ASN B 1 49  ? -1.272  8.730   35.979  1.00 46.97  ? 66  ASN B CB  1 
ATOM   1897 C CG  . ASN B 1 49  ? -2.705  9.232   35.915  1.00 55.96  ? 66  ASN B CG  1 
ATOM   1898 O OD1 . ASN B 1 49  ? -3.005  10.366  36.312  1.00 50.22  ? 66  ASN B OD1 1 
ATOM   1899 N ND2 . ASN B 1 49  ? -3.609  8.371   35.436  1.00 57.90  ? 66  ASN B ND2 1 
ATOM   1900 N N   . PHE B 1 50  ? 0.714   10.769  34.698  1.00 38.52  ? 67  PHE B N   1 
ATOM   1901 C CA  . PHE B 1 50  ? 1.135   12.112  34.309  1.00 41.49  ? 67  PHE B CA  1 
ATOM   1902 C C   . PHE B 1 50  ? 1.454   12.176  32.817  1.00 40.92  ? 67  PHE B C   1 
ATOM   1903 O O   . PHE B 1 50  ? 0.798   12.941  32.089  1.00 40.63  ? 67  PHE B O   1 
ATOM   1904 C CB  . PHE B 1 50  ? 2.323   12.532  35.189  1.00 41.47  ? 67  PHE B CB  1 
ATOM   1905 C CG  . PHE B 1 50  ? 2.901   13.881  34.886  1.00 45.45  ? 67  PHE B CG  1 
ATOM   1906 C CD1 . PHE B 1 50  ? 2.398   15.030  35.499  1.00 49.84  ? 67  PHE B CD1 1 
ATOM   1907 C CD2 . PHE B 1 50  ? 4.030   14.004  34.076  1.00 43.77  ? 67  PHE B CD2 1 
ATOM   1908 C CE1 . PHE B 1 50  ? 2.987   16.266  35.255  1.00 47.41  ? 67  PHE B CE1 1 
ATOM   1909 C CE2 . PHE B 1 50  ? 4.615   15.232  33.834  1.00 39.03  ? 67  PHE B CE2 1 
ATOM   1910 C CZ  . PHE B 1 50  ? 4.093   16.363  34.412  1.00 40.97  ? 67  PHE B CZ  1 
ATOM   1911 N N   . LEU B 1 51  ? 2.430   11.380  32.358  1.00 37.07  ? 68  LEU B N   1 
ATOM   1912 C CA  . LEU B 1 51  ? 2.715   11.268  30.901  1.00 40.11  ? 68  LEU B CA  1 
ATOM   1913 C C   . LEU B 1 51  ? 1.485   11.332  30.076  1.00 38.73  ? 68  LEU B C   1 
ATOM   1914 O O   . LEU B 1 51  ? 1.397   12.096  29.133  1.00 46.55  ? 68  LEU B O   1 
ATOM   1915 C CB  . LEU B 1 51  ? 3.361   9.953   30.498  1.00 39.51  ? 68  LEU B CB  1 
ATOM   1916 C CG  . LEU B 1 51  ? 3.787   9.911   29.018  1.00 40.27  ? 68  LEU B CG  1 
ATOM   1917 C CD1 . LEU B 1 51  ? 4.749   11.058  28.655  1.00 41.46  ? 68  LEU B CD1 1 
ATOM   1918 C CD2 . LEU B 1 51  ? 4.414   8.551   28.706  1.00 38.22  ? 68  LEU B CD2 1 
ATOM   1919 N N   . SER B 1 52  ? 0.511   10.545  30.461  1.00 37.03  ? 69  SER B N   1 
ATOM   1920 C CA  . SER B 1 52  ? -0.589  10.349  29.624  1.00 34.72  ? 69  SER B CA  1 
ATOM   1921 C C   . SER B 1 52  ? -1.601  11.461  29.828  1.00 33.17  ? 69  SER B C   1 
ATOM   1922 O O   . SER B 1 52  ? -2.411  11.771  28.953  1.00 42.04  ? 69  SER B O   1 
ATOM   1923 C CB  . SER B 1 52  ? -1.104  8.940   29.888  1.00 37.18  ? 69  SER B CB  1 
ATOM   1924 O OG  . SER B 1 52  ? -2.255  8.968   30.641  1.00 30.05  ? 69  SER B OG  1 
ATOM   1925 N N   . ALA B 1 53  ? -1.538  12.142  30.946  1.00 33.25  ? 70  ALA B N   1 
ATOM   1926 C CA  . ALA B 1 53  ? -2.259  13.460  31.007  1.00 31.90  ? 70  ALA B CA  1 
ATOM   1927 C C   . ALA B 1 53  ? -1.583  14.491  30.094  1.00 31.62  ? 70  ALA B C   1 
ATOM   1928 O O   . ALA B 1 53  ? -2.279  15.297  29.492  1.00 33.30  ? 70  ALA B O   1 
ATOM   1929 C CB  . ALA B 1 53  ? -2.357  13.991  32.417  1.00 29.41  ? 70  ALA B CB  1 
ATOM   1930 N N   . VAL B 1 54  ? -0.245  14.453  29.975  1.00 29.28  ? 71  VAL B N   1 
ATOM   1931 C CA  . VAL B 1 54  ? 0.439   15.301  28.987  1.00 30.95  ? 71  VAL B CA  1 
ATOM   1932 C C   . VAL B 1 54  ? -0.066  15.051  27.547  1.00 35.80  ? 71  VAL B C   1 
ATOM   1933 O O   . VAL B 1 54  ? -0.337  16.003  26.848  1.00 37.25  ? 71  VAL B O   1 
ATOM   1934 C CB  . VAL B 1 54  ? 1.987   15.240  29.063  1.00 28.76  ? 71  VAL B CB  1 
ATOM   1935 C CG1 . VAL B 1 54  ? 2.644   15.789  27.787  1.00 26.76  ? 71  VAL B CG1 1 
ATOM   1936 C CG2 . VAL B 1 54  ? 2.477   16.038  30.240  1.00 24.99  ? 71  VAL B CG2 1 
ATOM   1937 N N   . LYS B 1 55  ? -0.189  13.786  27.112  1.00 36.94  ? 72  LYS B N   1 
ATOM   1938 C CA  . LYS B 1 55  ? -0.826  13.438  25.819  1.00 31.52  ? 72  LYS B CA  1 
ATOM   1939 C C   . LYS B 1 55  ? -2.249  13.970  25.651  1.00 32.87  ? 72  LYS B C   1 
ATOM   1940 O O   . LYS B 1 55  ? -2.632  14.378  24.557  1.00 31.05  ? 72  LYS B O   1 
ATOM   1941 C CB  . LYS B 1 55  ? -0.794  11.936  25.590  1.00 31.62  ? 72  LYS B CB  1 
ATOM   1942 C CG  . LYS B 1 55  ? 0.632   11.399  25.530  1.00 36.10  ? 72  LYS B CG  1 
ATOM   1943 C CD  . LYS B 1 55  ? 0.697   9.903   25.290  1.00 34.01  ? 72  LYS B CD  1 
ATOM   1944 C CE  . LYS B 1 55  ? 2.094   9.506   24.803  1.00 39.36  ? 72  LYS B CE  1 
ATOM   1945 N NZ  . LYS B 1 55  ? 2.719   8.351   25.509  1.00 39.03  ? 72  LYS B NZ  1 
ATOM   1946 N N   . VAL B 1 56  ? -3.034  13.982  26.727  1.00 33.06  ? 73  VAL B N   1 
ATOM   1947 C CA  . VAL B 1 56  ? -4.409  14.445  26.608  1.00 31.38  ? 73  VAL B CA  1 
ATOM   1948 C C   . VAL B 1 56  ? -4.435  15.968  26.433  1.00 32.37  ? 73  VAL B C   1 
ATOM   1949 O O   . VAL B 1 56  ? -5.152  16.494  25.591  1.00 33.78  ? 73  VAL B O   1 
ATOM   1950 C CB  . VAL B 1 56  ? -5.306  13.848  27.738  1.00 32.54  ? 73  VAL B CB  1 
ATOM   1951 C CG1 . VAL B 1 56  ? -6.695  14.471  27.770  1.00 29.52  ? 73  VAL B CG1 1 
ATOM   1952 C CG2 . VAL B 1 56  ? -5.461  12.338  27.546  1.00 28.10  ? 73  VAL B CG2 1 
ATOM   1953 N N   . MET B 1 57  ? -3.589  16.658  27.203  1.00 39.13  ? 74  MET B N   1 
ATOM   1954 C CA  . MET B 1 57  ? -3.293  18.106  27.070  1.00 34.36  ? 74  MET B CA  1 
ATOM   1955 C C   . MET B 1 57  ? -2.726  18.474  25.718  1.00 34.94  ? 74  MET B C   1 
ATOM   1956 O O   . MET B 1 57  ? -3.135  19.426  25.107  1.00 37.16  ? 74  MET B O   1 
ATOM   1957 C CB  . MET B 1 57  ? -2.297  18.497  28.112  1.00 36.63  ? 74  MET B CB  1 
ATOM   1958 C CG  . MET B 1 57  ? -2.337  19.958  28.524  1.00 44.63  ? 74  MET B CG  1 
ATOM   1959 S SD  . MET B 1 57  ? -3.934  20.600  29.066  1.00 38.74  ? 74  MET B SD  1 
ATOM   1960 C CE  . MET B 1 57  ? -4.517  21.259  27.502  1.00 38.88  ? 74  MET B CE  1 
ATOM   1961 N N   . HIS B 1 58  ? -1.825  17.668  25.199  1.00 38.71  ? 75  HIS B N   1 
ATOM   1962 C CA  . HIS B 1 58  ? -1.316  17.856  23.852  1.00 38.31  ? 75  HIS B CA  1 
ATOM   1963 C C   . HIS B 1 58  ? -2.429  17.797  22.815  1.00 38.53  ? 75  HIS B C   1 
ATOM   1964 O O   . HIS B 1 58  ? -2.620  18.743  22.011  1.00 40.33  ? 75  HIS B O   1 
ATOM   1965 C CB  . HIS B 1 58  ? -0.265  16.825  23.545  1.00 37.93  ? 75  HIS B CB  1 
ATOM   1966 C CG  . HIS B 1 58  ? 0.255   16.914  22.151  1.00 40.35  ? 75  HIS B CG  1 
ATOM   1967 N ND1 . HIS B 1 58  ? 1.125   15.985  21.629  1.00 37.78  ? 75  HIS B ND1 1 
ATOM   1968 C CD2 . HIS B 1 58  ? 0.049   17.835  21.177  1.00 39.62  ? 75  HIS B CD2 1 
ATOM   1969 C CE1 . HIS B 1 58  ? 1.409   16.309  20.380  1.00 43.99  ? 75  HIS B CE1 1 
ATOM   1970 N NE2 . HIS B 1 58  ? 0.770   17.430  20.083  1.00 48.44  ? 75  HIS B NE2 1 
ATOM   1971 N N   . GLU B 1 59  ? -3.203  16.718  22.892  1.00 36.55  ? 76  GLU B N   1 
ATOM   1972 C CA  . GLU B 1 59  ? -4.291  16.459  21.974  1.00 35.14  ? 76  GLU B CA  1 
ATOM   1973 C C   . GLU B 1 59  ? -5.275  17.599  21.975  1.00 40.28  ? 76  GLU B C   1 
ATOM   1974 O O   . GLU B 1 59  ? -5.742  18.028  20.903  1.00 46.28  ? 76  GLU B O   1 
ATOM   1975 C CB  . GLU B 1 59  ? -5.001  15.157  22.374  1.00 42.45  ? 76  GLU B CB  1 
ATOM   1976 C CG  . GLU B 1 59  ? -6.191  14.719  21.529  1.00 44.22  ? 76  GLU B CG  1 
ATOM   1977 C CD  . GLU B 1 59  ? -5.834  14.602  20.048  1.00 57.65  ? 76  GLU B CD  1 
ATOM   1978 O OE1 . GLU B 1 59  ? -4.701  14.137  19.706  1.00 53.51  ? 76  GLU B OE1 1 
ATOM   1979 O OE2 . GLU B 1 59  ? -6.694  14.998  19.221  1.00 63.51  ? 76  GLU B OE2 1 
ATOM   1980 N N   . SER B 1 60  ? -5.623  18.092  23.158  1.00 37.01  ? 77  SER B N   1 
ATOM   1981 C CA  . SER B 1 60  ? -6.677  19.072  23.217  1.00 39.71  ? 77  SER B CA  1 
ATOM   1982 C C   . SER B 1 60  ? -6.200  20.428  22.644  1.00 38.83  ? 77  SER B C   1 
ATOM   1983 O O   . SER B 1 60  ? -6.943  21.140  21.992  1.00 33.84  ? 77  SER B O   1 
ATOM   1984 C CB  . SER B 1 60  ? -7.163  19.239  24.641  1.00 45.21  ? 77  SER B CB  1 
ATOM   1985 O OG  . SER B 1 60  ? -7.791  20.510  24.722  1.00 49.99  ? 77  SER B OG  1 
ATOM   1986 N N   . SER B 1 61  ? -4.956  20.772  22.922  1.00 40.49  ? 78  SER B N   1 
ATOM   1987 C CA  . SER B 1 61  ? -4.270  21.895  22.300  1.00 41.61  ? 78  SER B CA  1 
ATOM   1988 C C   . SER B 1 61  ? -4.146  21.735  20.759  1.00 42.07  ? 78  SER B C   1 
ATOM   1989 O O   . SER B 1 61  ? -4.356  22.674  20.019  1.00 43.55  ? 78  SER B O   1 
ATOM   1990 C CB  . SER B 1 61  ? -2.890  22.036  22.968  1.00 44.61  ? 78  SER B CB  1 
ATOM   1991 O OG  . SER B 1 61  ? -2.272  23.307  22.744  1.00 55.13  ? 78  SER B OG  1 
ATOM   1992 N N   . LYS B 1 62  ? -3.830  20.550  20.244  1.00 45.30  ? 79  LYS B N   1 
ATOM   1993 C CA  . LYS B 1 62  ? -3.807  20.382  18.775  1.00 40.36  ? 79  LYS B CA  1 
ATOM   1994 C C   . LYS B 1 62  ? -5.170  20.688  18.134  1.00 38.57  ? 79  LYS B C   1 
ATOM   1995 O O   . LYS B 1 62  ? -5.243  21.280  17.049  1.00 45.03  ? 79  LYS B O   1 
ATOM   1996 C CB  . LYS B 1 62  ? -3.402  18.954  18.446  1.00 44.59  ? 79  LYS B CB  1 
ATOM   1997 C CG  . LYS B 1 62  ? -2.951  18.667  17.039  1.00 44.90  ? 79  LYS B CG  1 
ATOM   1998 C CD  . LYS B 1 62  ? -2.079  17.427  17.110  1.00 50.79  ? 79  LYS B CD  1 
ATOM   1999 C CE  . LYS B 1 62  ? -2.147  16.598  15.826  1.00 66.40  ? 79  LYS B CE  1 
ATOM   2000 N NZ  . LYS B 1 62  ? -1.426  17.188  14.651  1.00 63.15  ? 79  LYS B NZ  1 
ATOM   2001 N N   . ARG B 1 63  ? -6.253  20.309  18.802  1.00 34.12  ? 80  ARG B N   1 
ATOM   2002 C CA  . ARG B 1 63  ? -7.586  20.464  18.234  1.00 36.86  ? 80  ARG B CA  1 
ATOM   2003 C C   . ARG B 1 63  ? -8.015  21.909  18.125  1.00 38.55  ? 80  ARG B C   1 
ATOM   2004 O O   . ARG B 1 63  ? -8.523  22.370  17.080  1.00 40.02  ? 80  ARG B O   1 
ATOM   2005 C CB  . ARG B 1 63  ? -8.611  19.636  19.011  1.00 39.96  ? 80  ARG B CB  1 
ATOM   2006 C CG  . ARG B 1 63  ? -8.530  18.147  18.654  1.00 52.55  ? 80  ARG B CG  1 
ATOM   2007 C CD  . ARG B 1 63  ? -9.585  17.350  19.402  1.00 65.48  ? 80  ARG B CD  1 
ATOM   2008 N NE  . ARG B 1 63  ? -10.682 18.247  19.788  1.00 75.14  ? 80  ARG B NE  1 
ATOM   2009 C CZ  . ARG B 1 63  ? -11.596 17.971  20.712  1.00 76.79  ? 80  ARG B CZ  1 
ATOM   2010 N NH1 . ARG B 1 63  ? -11.565 16.813  21.372  1.00 76.49  ? 80  ARG B NH1 1 
ATOM   2011 N NH2 . ARG B 1 63  ? -12.543 18.863  20.970  1.00 76.19  ? 80  ARG B NH2 1 
ATOM   2012 N N   . VAL B 1 64  ? -7.776  22.618  19.217  1.00 37.83  ? 81  VAL B N   1 
ATOM   2013 C CA  . VAL B 1 64  ? -7.986  24.037  19.328  1.00 38.27  ? 81  VAL B CA  1 
ATOM   2014 C C   . VAL B 1 64  ? -7.230  24.826  18.248  1.00 37.48  ? 81  VAL B C   1 
ATOM   2015 O O   . VAL B 1 64  ? -7.816  25.681  17.549  1.00 34.25  ? 81  VAL B O   1 
ATOM   2016 C CB  . VAL B 1 64  ? -7.619  24.497  20.759  1.00 40.48  ? 81  VAL B CB  1 
ATOM   2017 C CG1 . VAL B 1 64  ? -7.032  25.892  20.765  1.00 40.68  ? 81  VAL B CG1 1 
ATOM   2018 C CG2 . VAL B 1 64  ? -8.836  24.400  21.677  1.00 36.30  ? 81  VAL B CG2 1 
ATOM   2019 N N   . SER B 1 65  ? -5.945  24.559  18.089  1.00 40.62  ? 82  SER B N   1 
ATOM   2020 C CA  . SER B 1 65  ? -5.190  25.354  17.108  1.00 43.71  ? 82  SER B CA  1 
ATOM   2021 C C   . SER B 1 65  ? -5.622  25.013  15.702  1.00 44.10  ? 82  SER B C   1 
ATOM   2022 O O   . SER B 1 65  ? -5.380  25.781  14.784  1.00 48.79  ? 82  SER B O   1 
ATOM   2023 C CB  . SER B 1 65  ? -3.687  25.193  17.278  1.00 41.26  ? 82  SER B CB  1 
ATOM   2024 O OG  . SER B 1 65  ? -3.434  23.967  17.899  1.00 37.06  ? 82  SER B OG  1 
ATOM   2025 N N   . GLU B 1 66  ? -6.295  23.881  15.528  1.00 39.65  ? 83  GLU B N   1 
ATOM   2026 C CA  . GLU B 1 66  ? -6.767  23.540  14.199  1.00 38.65  ? 83  GLU B CA  1 
ATOM   2027 C C   . GLU B 1 66  ? -8.079  24.243  13.920  1.00 43.43  ? 83  GLU B C   1 
ATOM   2028 O O   . GLU B 1 66  ? -8.278  24.803  12.798  1.00 47.10  ? 83  GLU B O   1 
ATOM   2029 C CB  . GLU B 1 66  ? -6.714  22.025  13.915  1.00 39.95  ? 83  GLU B CB  1 
ATOM   2030 C CG  . GLU B 1 66  ? -5.215  21.623  13.796  1.00 50.24  ? 83  GLU B CG  1 
ATOM   2031 C CD  . GLU B 1 66  ? -4.855  20.137  13.922  1.00 57.08  ? 83  GLU B CD  1 
ATOM   2032 O OE1 . GLU B 1 66  ? -3.629  19.846  14.118  1.00 58.46  ? 83  GLU B OE1 1 
ATOM   2033 O OE2 . GLU B 1 66  ? -5.763  19.265  13.800  1.00 53.60  ? 83  GLU B OE2 1 
ATOM   2034 N N   . THR B 1 67  ? -8.951  24.287  14.932  1.00 37.55  ? 84  THR B N   1 
ATOM   2035 C CA  . THR B 1 67  ? -10.145 25.073  14.773  1.00 35.20  ? 84  THR B CA  1 
ATOM   2036 C C   . THR B 1 67  ? -9.727  26.526  14.476  1.00 35.16  ? 84  THR B C   1 
ATOM   2037 O O   . THR B 1 67  ? -10.244 27.146  13.517  1.00 33.75  ? 84  THR B O   1 
ATOM   2038 C CB  . THR B 1 67  ? -11.091 24.962  15.975  1.00 37.08  ? 84  THR B CB  1 
ATOM   2039 O OG1 . THR B 1 67  ? -11.667 23.666  15.977  1.00 38.87  ? 84  THR B OG1 1 
ATOM   2040 C CG2 . THR B 1 67  ? -12.244 25.971  15.858  1.00 37.35  ? 84  THR B CG2 1 
ATOM   2041 N N   . LEU B 1 68  ? -8.808  27.049  15.287  1.00 32.78  ? 85  LEU B N   1 
ATOM   2042 C CA  . LEU B 1 68  ? -8.264  28.390  15.049  1.00 39.68  ? 85  LEU B CA  1 
ATOM   2043 C C   . LEU B 1 68  ? -7.699  28.515  13.636  1.00 44.48  ? 85  LEU B C   1 
ATOM   2044 O O   . LEU B 1 68  ? -7.997  29.472  12.914  1.00 42.92  ? 85  LEU B O   1 
ATOM   2045 C CB  . LEU B 1 68  ? -7.159  28.740  16.035  1.00 34.45  ? 85  LEU B CB  1 
ATOM   2046 C CG  . LEU B 1 68  ? -6.416  30.089  15.930  1.00 36.53  ? 85  LEU B CG  1 
ATOM   2047 C CD1 . LEU B 1 68  ? -7.315  31.326  15.965  1.00 35.46  ? 85  LEU B CD1 1 
ATOM   2048 C CD2 . LEU B 1 68  ? -5.374  30.216  17.036  1.00 32.20  ? 85  LEU B CD2 1 
ATOM   2049 N N   . GLN B 1 69  ? -6.912  27.529  13.225  1.00 45.29  ? 86  GLN B N   1 
ATOM   2050 C CA  . GLN B 1 69  ? -6.303  27.587  11.899  1.00 45.72  ? 86  GLN B CA  1 
ATOM   2051 C C   . GLN B 1 69  ? -7.387  27.659  10.850  1.00 42.09  ? 86  GLN B C   1 
ATOM   2052 O O   . GLN B 1 69  ? -7.198  28.294  9.830   1.00 43.84  ? 86  GLN B O   1 
ATOM   2053 C CB  . GLN B 1 69  ? -5.397  26.394  11.665  1.00 49.43  ? 86  GLN B CB  1 
ATOM   2054 C CG  . GLN B 1 69  ? -4.359  26.505  10.550  1.00 51.58  ? 86  GLN B CG  1 
ATOM   2055 C CD  . GLN B 1 69  ? -3.341  25.368  10.660  1.00 57.87  ? 86  GLN B CD  1 
ATOM   2056 O OE1 . GLN B 1 69  ? -3.709  24.195  10.832  1.00 65.44  ? 86  GLN B OE1 1 
ATOM   2057 N NE2 . GLN B 1 69  ? -2.076  25.705  10.615  1.00 55.18  ? 86  GLN B NE2 1 
ATOM   2058 N N   . GLU B 1 70  ? -8.531  27.037  11.122  1.00 43.69  ? 87  GLU B N   1 
ATOM   2059 C CA  . GLU B 1 70  ? -9.667  27.049  10.191  1.00 41.82  ? 87  GLU B CA  1 
ATOM   2060 C C   . GLU B 1 70  ? -10.464 28.352  10.212  1.00 40.02  ? 87  GLU B C   1 
ATOM   2061 O O   . GLU B 1 70  ? -10.838 28.846  9.184   1.00 43.13  ? 87  GLU B O   1 
ATOM   2062 C CB  . GLU B 1 70  ? -10.641 25.878  10.476  1.00 47.38  ? 87  GLU B CB  1 
ATOM   2063 C CG  . GLU B 1 70  ? -10.198 24.505  9.987   1.00 51.58  ? 87  GLU B CG  1 
ATOM   2064 C CD  . GLU B 1 70  ? -11.091 23.339  10.455  1.00 57.12  ? 87  GLU B CD  1 
ATOM   2065 O OE1 . GLU B 1 70  ? -12.215 23.527  10.991  1.00 52.26  ? 87  GLU B OE1 1 
ATOM   2066 O OE2 . GLU B 1 70  ? -10.643 22.190  10.270  1.00 67.51  ? 87  GLU B OE2 1 
ATOM   2067 N N   . ILE B 1 71  ? -10.783 28.881  11.386  1.00 38.45  ? 88  ILE B N   1 
ATOM   2068 C CA  . ILE B 1 71  ? -11.660 30.060  11.459  1.00 36.73  ? 88  ILE B CA  1 
ATOM   2069 C C   . ILE B 1 71  ? -10.955 31.382  11.004  1.00 43.30  ? 88  ILE B C   1 
ATOM   2070 O O   . ILE B 1 71  ? -11.626 32.388  10.699  1.00 41.79  ? 88  ILE B O   1 
ATOM   2071 C CB  . ILE B 1 71  ? -12.324 30.192  12.865  1.00 37.90  ? 88  ILE B CB  1 
ATOM   2072 C CG1 . ILE B 1 71  ? -11.315 30.525  13.963  1.00 34.49  ? 88  ILE B CG1 1 
ATOM   2073 C CG2 . ILE B 1 71  ? -13.023 28.900  13.267  1.00 38.01  ? 88  ILE B CG2 1 
ATOM   2074 C CD1 . ILE B 1 71  ? -11.897 30.443  15.361  1.00 28.83  ? 88  ILE B CD1 1 
ATOM   2075 N N   . TYR B 1 72  ? -9.616  31.338  10.900  1.00 39.30  ? 89  TYR B N   1 
ATOM   2076 C CA  . TYR B 1 72  ? -8.784  32.437  10.450  1.00 37.58  ? 89  TYR B CA  1 
ATOM   2077 C C   . TYR B 1 72  ? -8.492  32.415  8.948   1.00 41.61  ? 89  TYR B C   1 
ATOM   2078 O O   . TYR B 1 72  ? -7.686  31.598  8.472   1.00 50.37  ? 89  TYR B O   1 
ATOM   2079 C CB  . TYR B 1 72  ? -7.460  32.334  11.178  1.00 36.56  ? 89  TYR B CB  1 
ATOM   2080 C CG  . TYR B 1 72  ? -6.599  33.584  11.281  1.00 38.98  ? 89  TYR B CG  1 
ATOM   2081 C CD1 . TYR B 1 72  ? -5.884  34.116  10.172  1.00 40.52  ? 89  TYR B CD1 1 
ATOM   2082 C CD2 . TYR B 1 72  ? -6.429  34.193  12.505  1.00 38.86  ? 89  TYR B CD2 1 
ATOM   2083 C CE1 . TYR B 1 72  ? -5.050  35.237  10.314  1.00 34.26  ? 89  TYR B CE1 1 
ATOM   2084 C CE2 . TYR B 1 72  ? -5.597  35.302  12.640  1.00 39.50  ? 89  TYR B CE2 1 
ATOM   2085 C CZ  . TYR B 1 72  ? -4.914  35.817  11.566  1.00 34.39  ? 89  TYR B CZ  1 
ATOM   2086 O OH  . TYR B 1 72  ? -4.117  36.935  11.830  1.00 41.50  ? 89  TYR B OH  1 
ATOM   2087 N N   . SER B 1 73  ? -9.080  33.350  8.203   1.00 40.57  ? 90  SER B N   1 
ATOM   2088 C CA  . SER B 1 73  ? -8.935  33.360  6.750   1.00 41.40  ? 90  SER B CA  1 
ATOM   2089 C C   . SER B 1 73  ? -7.459  33.407  6.239   1.00 41.80  ? 90  SER B C   1 
ATOM   2090 O O   . SER B 1 73  ? -6.600  34.018  6.846   1.00 44.22  ? 90  SER B O   1 
ATOM   2091 C CB  . SER B 1 73  ? -9.851  34.426  6.134   1.00 40.80  ? 90  SER B CB  1 
ATOM   2092 O OG  . SER B 1 73  ? -9.935  34.273  4.717   1.00 44.62  ? 90  SER B OG  1 
ATOM   2093 N N   . SER B 1 74  ? -7.185  32.715  5.143   1.00 47.01  ? 91  SER B N   1 
ATOM   2094 C CA  . SER B 1 74  ? -5.868  32.714  4.480   1.00 53.30  ? 91  SER B CA  1 
ATOM   2095 C C   . SER B 1 74  ? -5.601  34.061  3.818   1.00 52.50  ? 91  SER B C   1 
ATOM   2096 O O   . SER B 1 74  ? -4.447  34.416  3.506   1.00 47.37  ? 91  SER B O   1 
ATOM   2097 C CB  . SER B 1 74  ? -5.757  31.564  3.439   1.00 57.79  ? 91  SER B CB  1 
ATOM   2098 O OG  . SER B 1 74  ? -7.039  30.980  3.166   1.00 59.71  ? 91  SER B OG  1 
ATOM   2099 N N   . GLU B 1 75  ? -6.663  34.838  3.633   1.00 53.96  ? 92  GLU B N   1 
ATOM   2100 C CA  . GLU B 1 75  ? -6.423  36.208  3.219   1.00 55.73  ? 92  GLU B CA  1 
ATOM   2101 C C   . GLU B 1 75  ? -5.910  37.103  4.338   1.00 52.81  ? 92  GLU B C   1 
ATOM   2102 O O   . GLU B 1 75  ? -5.147  38.025  4.058   1.00 57.03  ? 92  GLU B O   1 
ATOM   2103 C CB  . GLU B 1 75  ? -7.587  36.830  2.451   1.00 56.95  ? 92  GLU B CB  1 
ATOM   2104 C CG  . GLU B 1 75  ? -7.633  36.387  0.994   1.00 50.18  ? 92  GLU B CG  1 
ATOM   2105 C CD  . GLU B 1 75  ? -8.583  35.251  0.863   1.00 53.41  ? 92  GLU B CD  1 
ATOM   2106 O OE1 . GLU B 1 75  ? -9.423  35.151  1.772   1.00 62.05  ? 92  GLU B OE1 1 
ATOM   2107 O OE2 . GLU B 1 75  ? -8.500  34.460  -0.097  1.00 52.72  ? 92  GLU B OE2 1 
ATOM   2108 N N   . TRP B 1 76  ? -6.272  36.820  5.591   1.00 45.56  ? 93  TRP B N   1 
ATOM   2109 C CA  . TRP B 1 76  ? -5.912  37.729  6.665   1.00 38.45  ? 93  TRP B CA  1 
ATOM   2110 C C   . TRP B 1 76  ? -4.462  37.666  6.940   1.00 40.17  ? 93  TRP B C   1 
ATOM   2111 O O   . TRP B 1 76  ? -3.885  36.600  6.941   1.00 46.80  ? 93  TRP B O   1 
ATOM   2112 C CB  . TRP B 1 76  ? -6.689  37.468  7.942   1.00 37.03  ? 93  TRP B CB  1 
ATOM   2113 C CG  . TRP B 1 76  ? -8.199  37.639  7.768   1.00 36.96  ? 93  TRP B CG  1 
ATOM   2114 C CD1 . TRP B 1 76  ? -8.845  38.333  6.770   1.00 32.08  ? 93  TRP B CD1 1 
ATOM   2115 C CD2 . TRP B 1 76  ? -9.240  37.130  8.647   1.00 35.26  ? 93  TRP B CD2 1 
ATOM   2116 N NE1 . TRP B 1 76  ? -10.212 38.257  6.958   1.00 31.67  ? 93  TRP B NE1 1 
ATOM   2117 C CE2 . TRP B 1 76  ? -10.481 37.539  8.101   1.00 34.23  ? 93  TRP B CE2 1 
ATOM   2118 C CE3 . TRP B 1 76  ? -9.237  36.352  9.830   1.00 33.47  ? 93  TRP B CE3 1 
ATOM   2119 C CZ2 . TRP B 1 76  ? -11.724 37.199  8.705   1.00 36.20  ? 93  TRP B CZ2 1 
ATOM   2120 C CZ3 . TRP B 1 76  ? -10.465 36.003  10.430  1.00 32.97  ? 93  TRP B CZ3 1 
ATOM   2121 C CH2 . TRP B 1 76  ? -11.699 36.449  9.868   1.00 33.63  ? 93  TRP B CH2 1 
ATOM   2122 N N   . ASP B 1 77  ? -3.886  38.837  7.148   1.00 43.29  ? 94  ASP B N   1 
ATOM   2123 C CA  . ASP B 1 77  ? -2.534  39.031  7.622   1.00 54.02  ? 94  ASP B CA  1 
ATOM   2124 C C   . ASP B 1 77  ? -2.155  38.211  8.888   1.00 54.36  ? 94  ASP B C   1 
ATOM   2125 O O   . ASP B 1 77  ? -2.898  38.151  9.880   1.00 50.61  ? 94  ASP B O   1 
ATOM   2126 C CB  . ASP B 1 77  ? -2.363  40.516  7.908   1.00 60.42  ? 94  ASP B CB  1 
ATOM   2127 C CG  . ASP B 1 77  ? -0.944  40.985  7.757   1.00 66.04  ? 94  ASP B CG  1 
ATOM   2128 O OD1 . ASP B 1 77  ? -0.432  41.014  6.613   1.00 83.15  ? 94  ASP B OD1 1 
ATOM   2129 O OD2 . ASP B 1 77  ? -0.360  41.365  8.786   1.00 62.59  ? 94  ASP B OD2 1 
ATOM   2130 N N   . GLY B 1 78  ? -0.974  37.599  8.847   1.00 55.67  ? 95  GLY B N   1 
ATOM   2131 C CA  . GLY B 1 78  ? -0.514  36.776  9.962   1.00 54.17  ? 95  GLY B CA  1 
ATOM   2132 C C   . GLY B 1 78  ? -0.995  35.335  9.861   1.00 49.06  ? 95  GLY B C   1 
ATOM   2133 O O   . GLY B 1 78  ? -0.655  34.515  10.716  1.00 46.51  ? 95  GLY B O   1 
ATOM   2134 N N   . HIS B 1 79  ? -1.790  35.023  8.834   1.00 44.60  ? 96  HIS B N   1 
ATOM   2135 C CA  . HIS B 1 79  ? -2.183  33.654  8.608   1.00 47.94  ? 96  HIS B CA  1 
ATOM   2136 C C   . HIS B 1 79  ? -0.973  32.729  8.505   1.00 48.68  ? 96  HIS B C   1 
ATOM   2137 O O   . HIS B 1 79  ? -1.047  31.590  8.953   1.00 48.74  ? 96  HIS B O   1 
ATOM   2138 C CB  . HIS B 1 79  ? -3.016  33.489  7.367   1.00 51.15  ? 96  HIS B CB  1 
ATOM   2139 C CG  . HIS B 1 79  ? -3.466  32.087  7.156   1.00 51.78  ? 96  HIS B CG  1 
ATOM   2140 N ND1 . HIS B 1 79  ? -4.620  31.589  7.720   1.00 56.57  ? 96  HIS B ND1 1 
ATOM   2141 C CD2 . HIS B 1 79  ? -2.912  31.064  6.462   1.00 56.88  ? 96  HIS B CD2 1 
ATOM   2142 C CE1 . HIS B 1 79  ? -4.768  30.321  7.371   1.00 53.71  ? 96  HIS B CE1 1 
ATOM   2143 N NE2 . HIS B 1 79  ? -3.744  29.977  6.608   1.00 55.88  ? 96  HIS B NE2 1 
ATOM   2144 N N   . GLU B 1 80  ? 0.126   33.216  7.930   1.00 44.10  ? 97  GLU B N   1 
ATOM   2145 C CA  . GLU B 1 80  ? 1.345   32.416  7.829   1.00 43.13  ? 97  GLU B CA  1 
ATOM   2146 C C   . GLU B 1 80  ? 2.028   32.217  9.166   1.00 41.62  ? 97  GLU B C   1 
ATOM   2147 O O   . GLU B 1 80  ? 2.477   31.116  9.466   1.00 43.74  ? 97  GLU B O   1 
ATOM   2148 C CB  . GLU B 1 80  ? 2.363   32.983  6.827   1.00 44.18  ? 97  GLU B CB  1 
ATOM   2149 C CG  . GLU B 1 80  ? 2.026   32.751  5.373   1.00 56.68  ? 97  GLU B CG  1 
ATOM   2150 C CD  . GLU B 1 80  ? 2.019   31.287  4.981   1.00 64.65  ? 97  GLU B CD  1 
ATOM   2151 O OE1 . GLU B 1 80  ? 3.017   30.578  5.264   1.00 66.17  ? 97  GLU B OE1 1 
ATOM   2152 O OE2 . GLU B 1 80  ? 1.010   30.851  4.377   1.00 65.63  ? 97  GLU B OE2 1 
ATOM   2153 N N   . GLU B 1 81  ? 2.136   33.265  9.967   1.00 45.09  ? 98  GLU B N   1 
ATOM   2154 C CA  . GLU B 1 81  ? 2.764   33.105  11.256  1.00 48.89  ? 98  GLU B CA  1 
ATOM   2155 C C   . GLU B 1 81  ? 1.866   32.198  12.101  1.00 48.38  ? 98  GLU B C   1 
ATOM   2156 O O   . GLU B 1 81  ? 2.365   31.410  12.906  1.00 43.70  ? 98  GLU B O   1 
ATOM   2157 C CB  . GLU B 1 81  ? 3.057   34.446  11.937  1.00 56.62  ? 98  GLU B CB  1 
ATOM   2158 C CG  . GLU B 1 81  ? 3.992   34.363  13.175  1.00 74.30  ? 98  GLU B CG  1 
ATOM   2159 C CD  . GLU B 1 81  ? 5.374   33.690  12.958  1.00 77.75  ? 98  GLU B CD  1 
ATOM   2160 O OE1 . GLU B 1 81  ? 5.795   33.419  11.795  1.00 79.36  ? 98  GLU B OE1 1 
ATOM   2161 O OE2 . GLU B 1 81  ? 6.070   33.447  13.979  1.00 74.17  ? 98  GLU B OE2 1 
ATOM   2162 N N   . LEU B 1 82  ? 0.556   32.257  11.852  1.00 44.62  ? 99  LEU B N   1 
ATOM   2163 C CA  . LEU B 1 82  ? -0.361  31.386  12.565  1.00 44.32  ? 99  LEU B CA  1 
ATOM   2164 C C   . LEU B 1 82  ? -0.025  29.906  12.266  1.00 44.28  ? 99  LEU B C   1 
ATOM   2165 O O   . LEU B 1 82  ? 0.049   29.091  13.183  1.00 50.00  ? 99  LEU B O   1 
ATOM   2166 C CB  . LEU B 1 82  ? -1.823  31.731  12.260  1.00 38.22  ? 99  LEU B CB  1 
ATOM   2167 C CG  . LEU B 1 82  ? -2.768  30.760  12.980  1.00 40.00  ? 99  LEU B CG  1 
ATOM   2168 C CD1 . LEU B 1 82  ? -2.951  31.108  14.428  1.00 46.19  ? 99  LEU B CD1 1 
ATOM   2169 C CD2 . LEU B 1 82  ? -4.129  30.674  12.335  1.00 41.56  ? 99  LEU B CD2 1 
ATOM   2170 N N   . LYS B 1 83  ? 0.195   29.592  10.994  1.00 43.32  ? 100 LYS B N   1 
ATOM   2171 C CA  . LYS B 1 83  ? 0.638   28.261  10.535  1.00 43.78  ? 100 LYS B CA  1 
ATOM   2172 C C   . LYS B 1 83  ? 1.873   27.737  11.249  1.00 41.32  ? 100 LYS B C   1 
ATOM   2173 O O   . LYS B 1 83  ? 1.888   26.575  11.618  1.00 50.05  ? 100 LYS B O   1 
ATOM   2174 C CB  . LYS B 1 83  ? 0.837   28.216  9.013   1.00 42.63  ? 100 LYS B CB  1 
ATOM   2175 C CG  . LYS B 1 83  ? -0.499  28.284  8.251   1.00 49.97  ? 100 LYS B CG  1 
ATOM   2176 C CD  . LYS B 1 83  ? -0.515  27.455  6.974   1.00 59.89  ? 100 LYS B CD  1 
ATOM   2177 C CE  . LYS B 1 83  ? -1.880  26.779  6.785   1.00 72.14  ? 100 LYS B CE  1 
ATOM   2178 N NZ  . LYS B 1 83  ? -1.983  25.897  5.569   1.00 70.65  ? 100 LYS B NZ  1 
ATOM   2179 N N   . ALA B 1 84  ? 2.862   28.600  11.484  1.00 34.33  ? 101 ALA B N   1 
ATOM   2180 C CA  . ALA B 1 84  ? 4.076   28.249  12.179  1.00 31.66  ? 101 ALA B CA  1 
ATOM   2181 C C   . ALA B 1 84  ? 3.851   28.050  13.695  1.00 38.63  ? 101 ALA B C   1 
ATOM   2182 O O   . ALA B 1 84  ? 4.484   27.193  14.321  1.00 38.47  ? 101 ALA B O   1 
ATOM   2183 C CB  . ALA B 1 84  ? 5.145   29.293  11.927  1.00 28.10  ? 101 ALA B CB  1 
ATOM   2184 N N   . ILE B 1 85  ? 2.930   28.804  14.295  1.00 42.19  ? 102 ILE B N   1 
ATOM   2185 C CA  . ILE B 1 85  ? 2.636   28.606  15.711  1.00 40.48  ? 102 ILE B CA  1 
ATOM   2186 C C   . ILE B 1 85  ? 1.981   27.240  15.932  1.00 41.53  ? 102 ILE B C   1 
ATOM   2187 O O   . ILE B 1 85  ? 2.246   26.556  16.927  1.00 40.38  ? 102 ILE B O   1 
ATOM   2188 C CB  . ILE B 1 85  ? 1.725   29.708  16.288  1.00 42.31  ? 102 ILE B CB  1 
ATOM   2189 C CG1 . ILE B 1 85  ? 2.502   31.038  16.405  1.00 40.86  ? 102 ILE B CG1 1 
ATOM   2190 C CG2 . ILE B 1 85  ? 1.107   29.298  17.650  1.00 35.60  ? 102 ILE B CG2 1 
ATOM   2191 C CD1 . ILE B 1 85  ? 1.602   32.279  16.498  1.00 37.91  ? 102 ILE B CD1 1 
ATOM   2192 N N   . VAL B 1 86  ? 1.122   26.848  15.004  1.00 38.29  ? 103 VAL B N   1 
ATOM   2193 C CA  . VAL B 1 86  ? 0.340   25.665  15.212  1.00 34.43  ? 103 VAL B CA  1 
ATOM   2194 C C   . VAL B 1 86  ? 1.348   24.562  15.168  1.00 42.16  ? 103 VAL B C   1 
ATOM   2195 O O   . VAL B 1 86  ? 1.322   23.687  16.021  1.00 40.66  ? 103 VAL B O   1 
ATOM   2196 C CB  . VAL B 1 86  ? -0.724  25.512  14.136  1.00 30.91  ? 103 VAL B CB  1 
ATOM   2197 C CG1 . VAL B 1 86  ? -1.341  24.118  14.133  1.00 27.87  ? 103 VAL B CG1 1 
ATOM   2198 C CG2 . VAL B 1 86  ? -1.778  26.576  14.365  1.00 27.83  ? 103 VAL B CG2 1 
ATOM   2199 N N   . TRP B 1 87  ? 2.298   24.699  14.236  1.00 46.98  ? 104 TRP B N   1 
ATOM   2200 C CA  . TRP B 1 87  ? 3.304   23.695  13.943  1.00 46.28  ? 104 TRP B CA  1 
ATOM   2201 C C   . TRP B 1 87  ? 4.259   23.579  15.133  1.00 45.06  ? 104 TRP B C   1 
ATOM   2202 O O   . TRP B 1 87  ? 4.417   22.491  15.690  1.00 50.71  ? 104 TRP B O   1 
ATOM   2203 C CB  . TRP B 1 87  ? 4.051   24.054  12.627  1.00 55.56  ? 104 TRP B CB  1 
ATOM   2204 C CG  . TRP B 1 87  ? 5.026   22.973  12.124  1.00 64.85  ? 104 TRP B CG  1 
ATOM   2205 C CD1 . TRP B 1 87  ? 4.791   21.632  12.073  1.00 70.61  ? 104 TRP B CD1 1 
ATOM   2206 C CD2 . TRP B 1 87  ? 6.358   23.159  11.607  1.00 73.48  ? 104 TRP B CD2 1 
ATOM   2207 N NE1 . TRP B 1 87  ? 5.881   20.968  11.569  1.00 77.63  ? 104 TRP B NE1 1 
ATOM   2208 C CE2 . TRP B 1 87  ? 6.860   21.874  11.270  1.00 77.13  ? 104 TRP B CE2 1 
ATOM   2209 C CE3 . TRP B 1 87  ? 7.173   24.285  11.373  1.00 82.15  ? 104 TRP B CE3 1 
ATOM   2210 C CZ2 . TRP B 1 87  ? 8.144   21.678  10.720  1.00 73.80  ? 104 TRP B CZ2 1 
ATOM   2211 C CZ3 . TRP B 1 87  ? 8.458   24.087  10.813  1.00 76.11  ? 104 TRP B CZ3 1 
ATOM   2212 C CH2 . TRP B 1 87  ? 8.923   22.791  10.503  1.00 77.34  ? 104 TRP B CH2 1 
ATOM   2213 N N   . ASN B 1 88  ? 4.882   24.696  15.527  1.00 38.41  ? 105 ASN B N   1 
ATOM   2214 C CA  . ASN B 1 88  ? 5.772   24.735  16.682  1.00 35.00  ? 105 ASN B CA  1 
ATOM   2215 C C   . ASN B 1 88  ? 5.134   24.337  18.018  1.00 36.91  ? 105 ASN B C   1 
ATOM   2216 O O   . ASN B 1 88  ? 5.815   23.787  18.872  1.00 38.26  ? 105 ASN B O   1 
ATOM   2217 C CB  . ASN B 1 88  ? 6.411   26.116  16.830  1.00 36.94  ? 105 ASN B CB  1 
ATOM   2218 C CG  . ASN B 1 88  ? 7.386   26.410  15.725  1.00 40.27  ? 105 ASN B CG  1 
ATOM   2219 O OD1 . ASN B 1 88  ? 8.597   26.362  15.931  1.00 48.66  ? 105 ASN B OD1 1 
ATOM   2220 N ND2 . ASN B 1 88  ? 6.874   26.644  14.528  1.00 37.83  ? 105 ASN B ND2 1 
ATOM   2221 N N   . ASN B 1 89  ? 3.850   24.638  18.206  1.00 38.99  ? 106 ASN B N   1 
ATOM   2222 C CA  . ASN B 1 89  ? 3.088   24.161  19.382  1.00 44.25  ? 106 ASN B CA  1 
ATOM   2223 C C   . ASN B 1 89  ? 3.263   22.650  19.456  1.00 43.71  ? 106 ASN B C   1 
ATOM   2224 O O   . ASN B 1 89  ? 3.599   22.100  20.507  1.00 43.61  ? 106 ASN B O   1 
ATOM   2225 C CB  . ASN B 1 89  ? 1.567   24.504  19.239  1.00 47.20  ? 106 ASN B CB  1 
ATOM   2226 C CG  . ASN B 1 89  ? 0.743   24.200  20.496  1.00 43.34  ? 106 ASN B CG  1 
ATOM   2227 O OD1 . ASN B 1 89  ? 0.948   24.840  21.544  1.00 45.69  ? 106 ASN B OD1 1 
ATOM   2228 N ND2 . ASN B 1 89  ? -0.198  23.230  20.401  1.00 32.96  ? 106 ASN B ND2 1 
ATOM   2229 N N   . ASP B 1 90  ? 3.101   22.012  18.303  1.00 44.79  ? 107 ASP B N   1 
ATOM   2230 C CA  . ASP B 1 90  ? 2.971   20.591  18.235  1.00 48.17  ? 107 ASP B CA  1 
ATOM   2231 C C   . ASP B 1 90  ? 4.296   19.911  18.470  1.00 51.21  ? 107 ASP B C   1 
ATOM   2232 O O   . ASP B 1 90  ? 4.391   18.962  19.293  1.00 50.57  ? 107 ASP B O   1 
ATOM   2233 C CB  . ASP B 1 90  ? 2.389   20.186  16.909  1.00 50.02  ? 107 ASP B CB  1 
ATOM   2234 C CG  . ASP B 1 90  ? 1.494   18.983  17.039  1.00 65.97  ? 107 ASP B CG  1 
ATOM   2235 O OD1 . ASP B 1 90  ? 0.350   19.188  17.509  1.00 73.48  ? 107 ASP B OD1 1 
ATOM   2236 O OD2 . ASP B 1 90  ? 1.925   17.849  16.707  1.00 60.38  ? 107 ASP B OD2 1 
ATOM   2237 N N   . LEU B 1 91  ? 5.319   20.422  17.774  1.00 51.11  ? 108 LEU B N   1 
ATOM   2238 C CA  . LEU B 1 91  ? 6.681   19.891  17.899  1.00 47.21  ? 108 LEU B CA  1 
ATOM   2239 C C   . LEU B 1 91  ? 7.142   20.011  19.318  1.00 42.86  ? 108 LEU B C   1 
ATOM   2240 O O   . LEU B 1 91  ? 8.024   19.272  19.729  1.00 46.13  ? 108 LEU B O   1 
ATOM   2241 C CB  . LEU B 1 91  ? 7.728   20.643  17.041  1.00 45.62  ? 108 LEU B CB  1 
ATOM   2242 C CG  . LEU B 1 91  ? 7.769   20.844  15.533  1.00 47.00  ? 108 LEU B CG  1 
ATOM   2243 C CD1 . LEU B 1 91  ? 8.937   21.775  15.271  1.00 45.54  ? 108 LEU B CD1 1 
ATOM   2244 C CD2 . LEU B 1 91  ? 7.913   19.586  14.702  1.00 43.11  ? 108 LEU B CD2 1 
ATOM   2245 N N   . LEU B 1 92  ? 6.605   20.990  20.047  1.00 43.75  ? 109 LEU B N   1 
ATOM   2246 C CA  . LEU B 1 92  ? 6.971   21.186  21.459  1.00 44.65  ? 109 LEU B CA  1 
ATOM   2247 C C   . LEU B 1 92  ? 6.272   20.207  22.390  1.00 43.40  ? 109 LEU B C   1 
ATOM   2248 O O   . LEU B 1 92  ? 6.896   19.643  23.267  1.00 46.72  ? 109 LEU B O   1 
ATOM   2249 C CB  . LEU B 1 92  ? 6.691   22.612  21.916  1.00 50.80  ? 109 LEU B CB  1 
ATOM   2250 C CG  . LEU B 1 92  ? 7.752   23.646  21.534  1.00 50.40  ? 109 LEU B CG  1 
ATOM   2251 C CD1 . LEU B 1 92  ? 7.338   25.062  21.900  1.00 47.24  ? 109 LEU B CD1 1 
ATOM   2252 C CD2 . LEU B 1 92  ? 9.062   23.286  22.192  1.00 51.35  ? 109 LEU B CD2 1 
ATOM   2253 N N   . TRP B 1 93  ? 4.987   19.984  22.191  1.00 37.80  ? 110 TRP B N   1 
ATOM   2254 C CA  . TRP B 1 93  ? 4.326   18.930  22.918  1.00 37.37  ? 110 TRP B CA  1 
ATOM   2255 C C   . TRP B 1 93  ? 4.929   17.561  22.661  1.00 40.93  ? 110 TRP B C   1 
ATOM   2256 O O   . TRP B 1 93  ? 5.143   16.778  23.610  1.00 42.37  ? 110 TRP B O   1 
ATOM   2257 C CB  . TRP B 1 93  ? 2.884   18.883  22.536  1.00 34.75  ? 110 TRP B CB  1 
ATOM   2258 C CG  . TRP B 1 93  ? 2.049   19.921  23.196  1.00 34.36  ? 110 TRP B CG  1 
ATOM   2259 C CD1 . TRP B 1 93  ? 1.452   20.996  22.583  1.00 33.01  ? 110 TRP B CD1 1 
ATOM   2260 C CD2 . TRP B 1 93  ? 1.675   19.991  24.575  1.00 32.45  ? 110 TRP B CD2 1 
ATOM   2261 N NE1 . TRP B 1 93  ? 0.729   21.705  23.476  1.00 32.14  ? 110 TRP B NE1 1 
ATOM   2262 C CE2 . TRP B 1 93  ? 0.830   21.119  24.713  1.00 32.05  ? 110 TRP B CE2 1 
ATOM   2263 C CE3 . TRP B 1 93  ? 1.958   19.210  25.699  1.00 35.63  ? 110 TRP B CE3 1 
ATOM   2264 C CZ2 . TRP B 1 93  ? 0.272   21.503  25.940  1.00 29.55  ? 110 TRP B CZ2 1 
ATOM   2265 C CZ3 . TRP B 1 93  ? 1.412   19.591  26.948  1.00 34.93  ? 110 TRP B CZ3 1 
ATOM   2266 C CH2 . TRP B 1 93  ? 0.588   20.738  27.050  1.00 34.83  ? 110 TRP B CH2 1 
ATOM   2267 N N   . GLU B 1 94  ? 5.165   17.259  21.384  1.00 42.90  ? 111 GLU B N   1 
ATOM   2268 C CA  . GLU B 1 94  ? 5.732   15.953  20.969  1.00 43.71  ? 111 GLU B CA  1 
ATOM   2269 C C   . GLU B 1 94  ? 7.104   15.687  21.654  1.00 42.63  ? 111 GLU B C   1 
ATOM   2270 O O   . GLU B 1 94  ? 7.380   14.612  22.239  1.00 39.31  ? 111 GLU B O   1 
ATOM   2271 C CB  . GLU B 1 94  ? 5.819   15.926  19.443  1.00 44.12  ? 111 GLU B CB  1 
ATOM   2272 C CG  . GLU B 1 94  ? 5.603   14.596  18.751  1.00 58.61  ? 111 GLU B CG  1 
ATOM   2273 C CD  . GLU B 1 94  ? 4.691   13.623  19.497  1.00 72.51  ? 111 GLU B CD  1 
ATOM   2274 O OE1 . GLU B 1 94  ? 3.442   13.803  19.481  1.00 68.28  ? 111 GLU B OE1 1 
ATOM   2275 O OE2 . GLU B 1 94  ? 5.241   12.651  20.082  1.00 78.13  ? 111 GLU B OE2 1 
ATOM   2276 N N   . ASP B 1 95  ? 7.928   16.715  21.643  1.00 37.37  ? 112 ASP B N   1 
ATOM   2277 C CA  . ASP B 1 95  ? 9.243   16.621  22.139  1.00 36.09  ? 112 ASP B CA  1 
ATOM   2278 C C   . ASP B 1 95  ? 9.225   16.494  23.668  1.00 42.78  ? 112 ASP B C   1 
ATOM   2279 O O   . ASP B 1 95  ? 10.002  15.737  24.274  1.00 49.38  ? 112 ASP B O   1 
ATOM   2280 C CB  . ASP B 1 95  ? 9.939   17.887  21.727  1.00 38.73  ? 112 ASP B CB  1 
ATOM   2281 C CG  . ASP B 1 95  ? 11.385  17.888  22.071  1.00 44.84  ? 112 ASP B CG  1 
ATOM   2282 O OD1 . ASP B 1 95  ? 12.150  17.086  21.504  1.00 49.09  ? 112 ASP B OD1 1 
ATOM   2283 O OD2 . ASP B 1 95  ? 11.763  18.710  22.912  1.00 49.13  ? 112 ASP B OD2 1 
ATOM   2284 N N   . TYR B 1 96  ? 8.359   17.270  24.291  1.00 44.85  ? 113 TYR B N   1 
ATOM   2285 C CA  . TYR B 1 96  ? 8.191   17.271  25.734  1.00 43.68  ? 113 TYR B CA  1 
ATOM   2286 C C   . TYR B 1 96  ? 7.732   15.876  26.178  1.00 43.88  ? 113 TYR B C   1 
ATOM   2287 O O   . TYR B 1 96  ? 8.348   15.285  27.074  1.00 43.34  ? 113 TYR B O   1 
ATOM   2288 C CB  . TYR B 1 96  ? 7.136   18.300  26.125  1.00 38.37  ? 113 TYR B CB  1 
ATOM   2289 C CG  . TYR B 1 96  ? 6.784   18.305  27.594  1.00 37.47  ? 113 TYR B CG  1 
ATOM   2290 C CD1 . TYR B 1 96  ? 7.789   18.312  28.569  1.00 36.52  ? 113 TYR B CD1 1 
ATOM   2291 C CD2 . TYR B 1 96  ? 5.443   18.326  28.017  1.00 38.84  ? 113 TYR B CD2 1 
ATOM   2292 C CE1 . TYR B 1 96  ? 7.469   18.297  29.909  1.00 36.63  ? 113 TYR B CE1 1 
ATOM   2293 C CE2 . TYR B 1 96  ? 5.116   18.326  29.359  1.00 38.06  ? 113 TYR B CE2 1 
ATOM   2294 C CZ  . TYR B 1 96  ? 6.140   18.315  30.290  1.00 40.20  ? 113 TYR B CZ  1 
ATOM   2295 O OH  . TYR B 1 96  ? 5.852   18.342  31.636  1.00 55.54  ? 113 TYR B OH  1 
ATOM   2296 N N   . GLU B 1 97  ? 6.663   15.387  25.543  1.00 37.39  ? 114 GLU B N   1 
ATOM   2297 C CA  . GLU B 1 97  ? 6.173   14.012  25.723  1.00 39.72  ? 114 GLU B CA  1 
ATOM   2298 C C   . GLU B 1 97  ? 7.218   12.922  25.554  1.00 42.57  ? 114 GLU B C   1 
ATOM   2299 O O   . GLU B 1 97  ? 7.332   12.052  26.407  1.00 46.99  ? 114 GLU B O   1 
ATOM   2300 C CB  . GLU B 1 97  ? 5.134   13.700  24.683  1.00 35.39  ? 114 GLU B CB  1 
ATOM   2301 C CG  . GLU B 1 97  ? 3.737   14.105  25.008  1.00 39.29  ? 114 GLU B CG  1 
ATOM   2302 C CD  . GLU B 1 97  ? 2.884   14.021  23.764  1.00 51.39  ? 114 GLU B CD  1 
ATOM   2303 O OE1 . GLU B 1 97  ? 3.135   13.127  22.891  1.00 52.04  ? 114 GLU B OE1 1 
ATOM   2304 O OE2 . GLU B 1 97  ? 1.999   14.893  23.633  1.00 51.29  ? 114 GLU B OE2 1 
ATOM   2305 N N   . GLU B 1 98  ? 7.918   12.932  24.418  1.00 43.25  ? 115 GLU B N   1 
ATOM   2306 C CA  . GLU B 1 98  ? 8.960   11.958  24.166  1.00 41.78  ? 115 GLU B CA  1 
ATOM   2307 C C   . GLU B 1 98  ? 10.019  11.956  25.248  1.00 45.08  ? 115 GLU B C   1 
ATOM   2308 O O   . GLU B 1 98  ? 10.356  10.885  25.778  1.00 49.79  ? 115 GLU B O   1 
ATOM   2309 C CB  . GLU B 1 98  ? 9.616   12.189  22.826  1.00 44.86  ? 115 GLU B CB  1 
ATOM   2310 C CG  . GLU B 1 98  ? 8.757   11.757  21.653  1.00 56.91  ? 115 GLU B CG  1 
ATOM   2311 C CD  . GLU B 1 98  ? 9.230   12.379  20.347  1.00 63.45  ? 115 GLU B CD  1 
ATOM   2312 O OE1 . GLU B 1 98  ? 10.342  12.951  20.320  1.00 65.25  ? 115 GLU B OE1 1 
ATOM   2313 O OE2 . GLU B 1 98  ? 8.481   12.314  19.350  1.00 68.06  ? 115 GLU B OE2 1 
ATOM   2314 N N   . LYS B 1 99  ? 10.553  13.129  25.572  1.00 37.77  ? 116 LYS B N   1 
ATOM   2315 C CA  . LYS B 1 99  ? 11.598  13.222  26.592  1.00 35.39  ? 116 LYS B CA  1 
ATOM   2316 C C   . LYS B 1 99  ? 11.129  12.795  28.013  1.00 38.10  ? 116 LYS B C   1 
ATOM   2317 O O   . LYS B 1 99  ? 11.862  12.114  28.770  1.00 39.08  ? 116 LYS B O   1 
ATOM   2318 C CB  . LYS B 1 99  ? 12.159  14.634  26.614  1.00 36.22  ? 116 LYS B CB  1 
ATOM   2319 C CG  . LYS B 1 99  ? 12.866  15.001  25.308  1.00 41.14  ? 116 LYS B CG  1 
ATOM   2320 C CD  . LYS B 1 99  ? 14.043  15.922  25.597  1.00 42.05  ? 116 LYS B CD  1 
ATOM   2321 C CE  . LYS B 1 99  ? 14.596  16.625  24.367  1.00 45.01  ? 116 LYS B CE  1 
ATOM   2322 N NZ  . LYS B 1 99  ? 15.335  17.824  24.889  1.00 56.23  ? 116 LYS B NZ  1 
ATOM   2323 N N   . LEU B 1 100 ? 9.913   13.176  28.375  1.00 35.09  ? 117 LEU B N   1 
ATOM   2324 C CA  . LEU B 1 100 ? 9.308   12.663  29.582  1.00 37.44  ? 117 LEU B CA  1 
ATOM   2325 C C   . LEU B 1 100 ? 9.328   11.134  29.614  1.00 42.47  ? 117 LEU B C   1 
ATOM   2326 O O   . LEU B 1 100 ? 9.650   10.540  30.670  1.00 47.48  ? 117 LEU B O   1 
ATOM   2327 C CB  . LEU B 1 100 ? 7.860   13.097  29.680  1.00 36.87  ? 117 LEU B CB  1 
ATOM   2328 C CG  . LEU B 1 100 ? 7.516   14.285  30.544  1.00 36.73  ? 117 LEU B CG  1 
ATOM   2329 C CD1 . LEU B 1 100 ? 6.003   14.544  30.410  1.00 33.04  ? 117 LEU B CD1 1 
ATOM   2330 C CD2 . LEU B 1 100 ? 7.873   13.902  31.964  1.00 37.25  ? 117 LEU B CD2 1 
ATOM   2331 N N   . ALA B 1 101 ? 8.963   10.512  28.479  1.00 37.23  ? 118 ALA B N   1 
ATOM   2332 C CA  . ALA B 1 101 ? 8.861   9.066   28.342  1.00 34.17  ? 118 ALA B CA  1 
ATOM   2333 C C   . ALA B 1 101 ? 10.234  8.429   28.511  1.00 37.12  ? 118 ALA B C   1 
ATOM   2334 O O   . ALA B 1 101 ? 10.351  7.382   29.107  1.00 39.09  ? 118 ALA B O   1 
ATOM   2335 C CB  . ALA B 1 101 ? 8.267   8.692   26.980  1.00 34.56  ? 118 ALA B CB  1 
ATOM   2336 N N   . ASP B 1 102 ? 11.278  9.054   27.994  1.00 38.26  ? 119 ASP B N   1 
ATOM   2337 C CA  . ASP B 1 102 ? 12.572  8.489   28.172  1.00 44.11  ? 119 ASP B CA  1 
ATOM   2338 C C   . ASP B 1 102 ? 12.961  8.784   29.616  1.00 50.70  ? 119 ASP B C   1 
ATOM   2339 O O   . ASP B 1 102 ? 13.142  7.878   30.428  1.00 62.73  ? 119 ASP B O   1 
ATOM   2340 C CB  . ASP B 1 102 ? 13.583  9.101   27.197  1.00 50.37  ? 119 ASP B CB  1 
ATOM   2341 C CG  . ASP B 1 102 ? 15.053  8.636   27.463  1.00 60.14  ? 119 ASP B CG  1 
ATOM   2342 O OD1 . ASP B 1 102 ? 15.278  7.648   28.218  1.00 66.55  ? 119 ASP B OD1 1 
ATOM   2343 O OD2 . ASP B 1 102 ? 15.999  9.268   26.905  1.00 58.35  ? 119 ASP B OD2 1 
ATOM   2344 N N   . GLN B 1 103 ? 13.043  10.064  29.945  1.00 45.61  ? 120 GLN B N   1 
ATOM   2345 C CA  . GLN B 1 103 ? 13.744  10.505  31.127  1.00 35.02  ? 120 GLN B CA  1 
ATOM   2346 C C   . GLN B 1 103 ? 13.052  10.314  32.445  1.00 34.74  ? 120 GLN B C   1 
ATOM   2347 O O   . GLN B 1 103 ? 13.680  10.468  33.486  1.00 42.09  ? 120 GLN B O   1 
ATOM   2348 C CB  . GLN B 1 103 ? 14.103  11.980  30.940  1.00 37.90  ? 120 GLN B CB  1 
ATOM   2349 C CG  . GLN B 1 103 ? 15.211  12.244  29.902  1.00 38.03  ? 120 GLN B CG  1 
ATOM   2350 C CD  . GLN B 1 103 ? 15.614  13.722  29.889  1.00 46.18  ? 120 GLN B CD  1 
ATOM   2351 O OE1 . GLN B 1 103 ? 15.499  14.442  30.903  1.00 45.66  ? 120 GLN B OE1 1 
ATOM   2352 N NE2 . GLN B 1 103 ? 16.073  14.186  28.748  1.00 45.43  ? 120 GLN B NE2 1 
ATOM   2353 N N   . ALA B 1 104 ? 11.754  10.006  32.423  1.00 35.36  ? 121 ALA B N   1 
ATOM   2354 C CA  . ALA B 1 104 ? 11.010  9.774   33.620  1.00 30.55  ? 121 ALA B CA  1 
ATOM   2355 C C   . ALA B 1 104 ? 10.381  8.400   33.597  1.00 35.68  ? 121 ALA B C   1 
ATOM   2356 O O   . ALA B 1 104 ? 10.603  7.613   34.523  1.00 41.81  ? 121 ALA B O   1 
ATOM   2357 C CB  . ALA B 1 104 ? 9.914   10.827  33.777  1.00 38.65  ? 121 ALA B CB  1 
ATOM   2358 N N   . VAL B 1 105 ? 9.586   8.084   32.572  1.00 34.04  ? 122 VAL B N   1 
ATOM   2359 C CA  . VAL B 1 105 ? 8.847   6.835   32.611  1.00 35.75  ? 122 VAL B CA  1 
ATOM   2360 C C   . VAL B 1 105 ? 9.820   5.683   32.397  1.00 36.54  ? 122 VAL B C   1 
ATOM   2361 O O   . VAL B 1 105 ? 9.868   4.762   33.185  1.00 38.97  ? 122 VAL B O   1 
ATOM   2362 C CB  . VAL B 1 105 ? 7.628   6.818   31.661  1.00 40.52  ? 122 VAL B CB  1 
ATOM   2363 C CG1 . VAL B 1 105 ? 6.993   5.442   31.573  1.00 41.18  ? 122 VAL B CG1 1 
ATOM   2364 C CG2 . VAL B 1 105 ? 6.572   7.794   32.164  1.00 48.90  ? 122 VAL B CG2 1 
ATOM   2365 N N   . ARG B 1 106 ? 10.641  5.756   31.366  1.00 40.37  ? 123 ARG B N   1 
ATOM   2366 C CA  . ARG B 1 106 ? 11.552  4.667   31.103  1.00 40.49  ? 123 ARG B CA  1 
ATOM   2367 C C   . ARG B 1 106 ? 12.510  4.474   32.293  1.00 40.21  ? 123 ARG B C   1 
ATOM   2368 O O   . ARG B 1 106 ? 12.621  3.381   32.812  1.00 43.91  ? 123 ARG B O   1 
ATOM   2369 C CB  . ARG B 1 106 ? 12.265  4.851   29.772  1.00 39.96  ? 123 ARG B CB  1 
ATOM   2370 C CG  . ARG B 1 106 ? 13.471  3.917   29.540  1.00 44.24  ? 123 ARG B CG  1 
ATOM   2371 C CD  . ARG B 1 106 ? 13.020  2.542   29.090  1.00 43.70  ? 123 ARG B CD  1 
ATOM   2372 N NE  . ARG B 1 106 ? 11.985  2.644   28.051  1.00 48.46  ? 123 ARG B NE  1 
ATOM   2373 C CZ  . ARG B 1 106 ? 12.236  2.624   26.747  1.00 46.13  ? 123 ARG B CZ  1 
ATOM   2374 N NH1 . ARG B 1 106 ? 13.490  2.482   26.315  1.00 52.59  ? 123 ARG B NH1 1 
ATOM   2375 N NH2 . ARG B 1 106 ? 11.241  2.740   25.886  1.00 42.46  ? 123 ARG B NH2 1 
ATOM   2376 N N   . THR B 1 107 ? 13.145  5.538   32.762  1.00 39.95  ? 124 THR B N   1 
ATOM   2377 C CA  . THR B 1 107 ? 13.980  5.487   33.969  1.00 38.13  ? 124 THR B CA  1 
ATOM   2378 C C   . THR B 1 107 ? 13.315  4.774   35.167  1.00 38.13  ? 124 THR B C   1 
ATOM   2379 O O   . THR B 1 107 ? 14.002  4.061   35.897  1.00 41.32  ? 124 THR B O   1 
ATOM   2380 C CB  . THR B 1 107 ? 14.368  6.919   34.391  1.00 39.95  ? 124 THR B CB  1 
ATOM   2381 O OG1 . THR B 1 107 ? 14.866  7.616   33.239  1.00 41.52  ? 124 THR B OG1 1 
ATOM   2382 C CG2 . THR B 1 107 ? 15.411  6.929   35.568  1.00 35.81  ? 124 THR B CG2 1 
ATOM   2383 N N   . MET B 1 108 ? 12.006  4.989   35.378  1.00 38.71  ? 125 MET B N   1 
ATOM   2384 C CA  . MET B 1 108 ? 11.229  4.227   36.388  1.00 40.33  ? 125 MET B CA  1 
ATOM   2385 C C   . MET B 1 108 ? 11.123  2.746   36.015  1.00 38.91  ? 125 MET B C   1 
ATOM   2386 O O   . MET B 1 108 ? 11.225  1.879   36.882  1.00 44.49  ? 125 MET B O   1 
ATOM   2387 C CB  . MET B 1 108 ? 9.791   4.781   36.609  1.00 39.57  ? 125 MET B CB  1 
ATOM   2388 C CG  . MET B 1 108 ? 9.589   5.744   37.776  1.00 38.75  ? 125 MET B CG  1 
ATOM   2389 S SD  . MET B 1 108 ? 10.423  5.389   39.349  1.00 46.61  ? 125 MET B SD  1 
ATOM   2390 C CE  . MET B 1 108 ? 9.295   4.355   40.264  1.00 43.52  ? 125 MET B CE  1 
ATOM   2391 N N   . GLU B 1 109 ? 10.892  2.468   34.740  1.00 35.18  ? 126 GLU B N   1 
ATOM   2392 C CA  . GLU B 1 109 ? 10.796  1.093   34.272  1.00 36.79  ? 126 GLU B CA  1 
ATOM   2393 C C   . GLU B 1 109 ? 12.112  0.372   34.482  1.00 35.97  ? 126 GLU B C   1 
ATOM   2394 O O   . GLU B 1 109 ? 12.113  -0.772  34.919  1.00 37.89  ? 126 GLU B O   1 
ATOM   2395 C CB  . GLU B 1 109 ? 10.352  0.991   32.802  1.00 34.12  ? 126 GLU B CB  1 
ATOM   2396 C CG  . GLU B 1 109 ? 8.873   1.164   32.658  1.00 36.38  ? 126 GLU B CG  1 
ATOM   2397 C CD  . GLU B 1 109 ? 8.476   1.621   31.250  1.00 44.05  ? 126 GLU B CD  1 
ATOM   2398 O OE1 . GLU B 1 109 ? 9.383   1.756   30.381  1.00 33.13  ? 126 GLU B OE1 1 
ATOM   2399 O OE2 . GLU B 1 109 ? 7.237   1.843   31.042  1.00 44.01  ? 126 GLU B OE2 1 
ATOM   2400 N N   . ILE B 1 110 ? 13.232  1.029   34.203  1.00 36.97  ? 127 ILE B N   1 
ATOM   2401 C CA  . ILE B 1 110 ? 14.534  0.404   34.432  1.00 40.91  ? 127 ILE B CA  1 
ATOM   2402 C C   . ILE B 1 110 ? 14.662  0.089   35.919  1.00 45.68  ? 127 ILE B C   1 
ATOM   2403 O O   . ILE B 1 110 ? 15.194  -0.938  36.329  1.00 55.14  ? 127 ILE B O   1 
ATOM   2404 C CB  . ILE B 1 110 ? 15.672  1.349   34.052  1.00 39.75  ? 127 ILE B CB  1 
ATOM   2405 C CG1 . ILE B 1 110 ? 15.748  1.465   32.494  1.00 36.79  ? 127 ILE B CG1 1 
ATOM   2406 C CG2 . ILE B 1 110 ? 16.978  0.950   34.810  1.00 30.73  ? 127 ILE B CG2 1 
ATOM   2407 C CD1 . ILE B 1 110 ? 16.717  2.564   32.005  1.00 32.23  ? 127 ILE B CD1 1 
ATOM   2408 N N   . TYR B 1 111 ? 14.130  0.994   36.719  1.00 45.59  ? 128 TYR B N   1 
ATOM   2409 C CA  . TYR B 1 111 ? 14.358  0.966   38.137  1.00 39.25  ? 128 TYR B CA  1 
ATOM   2410 C C   . TYR B 1 111 ? 13.555  -0.157  38.769  1.00 39.08  ? 128 TYR B C   1 
ATOM   2411 O O   . TYR B 1 111 ? 14.135  -0.953  39.524  1.00 31.49  ? 128 TYR B O   1 
ATOM   2412 C CB  . TYR B 1 111 ? 14.002  2.316   38.711  1.00 31.56  ? 128 TYR B CB  1 
ATOM   2413 C CG  . TYR B 1 111 ? 13.942  2.346   40.203  1.00 30.24  ? 128 TYR B CG  1 
ATOM   2414 C CD1 . TYR B 1 111 ? 15.110  2.236   40.981  1.00 27.65  ? 128 TYR B CD1 1 
ATOM   2415 C CD2 . TYR B 1 111 ? 12.701  2.528   40.859  1.00 27.63  ? 128 TYR B CD2 1 
ATOM   2416 C CE1 . TYR B 1 111 ? 15.036  2.276   42.375  1.00 27.64  ? 128 TYR B CE1 1 
ATOM   2417 C CE2 . TYR B 1 111 ? 12.628  2.549   42.238  1.00 27.16  ? 128 TYR B CE2 1 
ATOM   2418 C CZ  . TYR B 1 111 ? 13.788  2.423   42.978  1.00 29.46  ? 128 TYR B CZ  1 
ATOM   2419 O OH  . TYR B 1 111 ? 13.670  2.476   44.344  1.00 38.97  ? 128 TYR B OH  1 
ATOM   2420 N N   . VAL B 1 112 ? 12.255  -0.225  38.414  1.00 35.98  ? 129 VAL B N   1 
ATOM   2421 C CA  . VAL B 1 112 ? 11.301  -1.200  38.972  1.00 35.18  ? 129 VAL B CA  1 
ATOM   2422 C C   . VAL B 1 112 ? 11.466  -2.641  38.448  1.00 41.38  ? 129 VAL B C   1 
ATOM   2423 O O   . VAL B 1 112 ? 10.949  -3.584  39.062  1.00 41.55  ? 129 VAL B O   1 
ATOM   2424 C CB  . VAL B 1 112 ? 9.844   -0.775  38.777  1.00 33.94  ? 129 VAL B CB  1 
ATOM   2425 C CG1 . VAL B 1 112 ? 9.581   0.580   39.453  1.00 32.34  ? 129 VAL B CG1 1 
ATOM   2426 C CG2 . VAL B 1 112 ? 9.466   -0.786  37.284  1.00 31.43  ? 129 VAL B CG2 1 
ATOM   2427 N N   . ALA B 1 113 ? 12.182  -2.791  37.333  1.00 38.49  ? 130 ALA B N   1 
ATOM   2428 C CA  . ALA B 1 113 ? 12.536  -4.087  36.766  1.00 39.49  ? 130 ALA B CA  1 
ATOM   2429 C C   . ALA B 1 113 ? 13.415  -4.823  37.760  1.00 44.13  ? 130 ALA B C   1 
ATOM   2430 O O   . ALA B 1 113 ? 13.392  -6.054  37.833  1.00 49.04  ? 130 ALA B O   1 
ATOM   2431 C CB  . ALA B 1 113 ? 13.326  -3.892  35.475  1.00 38.59  ? 130 ALA B CB  1 
ATOM   2432 N N   . GLN B 1 114 ? 14.233  -4.067  38.487  1.00 42.77  ? 131 GLN B N   1 
ATOM   2433 C CA  . GLN B 1 114 ? 15.054  -4.634  39.540  1.00 42.87  ? 131 GLN B CA  1 
ATOM   2434 C C   . GLN B 1 114 ? 14.190  -5.458  40.500  1.00 45.17  ? 131 GLN B C   1 
ATOM   2435 O O   . GLN B 1 114 ? 14.638  -6.500  40.918  1.00 47.09  ? 131 GLN B O   1 
ATOM   2436 C CB  . GLN B 1 114 ? 15.822  -3.552  40.313  1.00 37.63  ? 131 GLN B CB  1 
ATOM   2437 C CG  . GLN B 1 114 ? 16.658  -2.664  39.426  1.00 41.68  ? 131 GLN B CG  1 
ATOM   2438 C CD  . GLN B 1 114 ? 17.402  -1.628  40.208  1.00 41.12  ? 131 GLN B CD  1 
ATOM   2439 O OE1 . GLN B 1 114 ? 18.583  -1.802  40.499  1.00 43.10  ? 131 GLN B OE1 1 
ATOM   2440 N NE2 . GLN B 1 114 ? 16.699  -0.569  40.618  1.00 38.47  ? 131 GLN B NE2 1 
ATOM   2441 N N   . PHE B 1 115 ? 12.965  -5.001  40.809  1.00 43.65  ? 132 PHE B N   1 
ATOM   2442 C CA  . PHE B 1 115 ? 12.068  -5.698  41.759  1.00 43.56  ? 132 PHE B CA  1 
ATOM   2443 C C   . PHE B 1 115 ? 11.557  -7.068  41.368  1.00 44.76  ? 132 PHE B C   1 
ATOM   2444 O O   . PHE B 1 115 ? 11.235  -7.852  42.268  1.00 52.24  ? 132 PHE B O   1 
ATOM   2445 C CB  . PHE B 1 115 ? 10.801  -4.884  42.124  1.00 40.60  ? 132 PHE B CB  1 
ATOM   2446 C CG  . PHE B 1 115 ? 11.061  -3.470  42.517  1.00 40.22  ? 132 PHE B CG  1 
ATOM   2447 C CD1 . PHE B 1 115 ? 12.361  -3.040  42.914  1.00 36.50  ? 132 PHE B CD1 1 
ATOM   2448 C CD2 . PHE B 1 115 ? 10.007  -2.546  42.510  1.00 39.52  ? 132 PHE B CD2 1 
ATOM   2449 C CE1 . PHE B 1 115 ? 12.582  -1.715  43.272  1.00 33.69  ? 132 PHE B CE1 1 
ATOM   2450 C CE2 . PHE B 1 115 ? 10.237  -1.215  42.878  1.00 38.56  ? 132 PHE B CE2 1 
ATOM   2451 C CZ  . PHE B 1 115 ? 11.514  -0.811  43.268  1.00 34.55  ? 132 PHE B CZ  1 
ATOM   2452 N N   . SER B 1 116 ? 11.352  -7.326  40.074  1.00 43.25  ? 133 SER B N   1 
ATOM   2453 C CA  . SER B 1 116 ? 10.935  -8.676  39.659  1.00 47.15  ? 133 SER B CA  1 
ATOM   2454 C C   . SER B 1 116 ? 12.098  -9.651  39.743  1.00 46.15  ? 133 SER B C   1 
ATOM   2455 O O   . SER B 1 116 ? 11.909  -10.797 40.152  1.00 54.07  ? 133 SER B O   1 
ATOM   2456 C CB  . SER B 1 116 ? 10.281  -8.724  38.277  1.00 43.88  ? 133 SER B CB  1 
ATOM   2457 O OG  . SER B 1 116 ? 10.999  -7.965  37.342  1.00 45.77  ? 133 SER B OG  1 
ATOM   2458 N N   . GLU B 1 117 ? 13.294  -9.194  39.389  1.00 44.26  ? 134 GLU B N   1 
ATOM   2459 C CA  . GLU B 1 117 ? 14.489  -10.016 39.503  1.00 51.05  ? 134 GLU B CA  1 
ATOM   2460 C C   . GLU B 1 117 ? 14.751  -10.445 40.965  1.00 52.11  ? 134 GLU B C   1 
ATOM   2461 O O   . GLU B 1 117 ? 14.854  -11.633 41.244  1.00 57.64  ? 134 GLU B O   1 
ATOM   2462 C CB  . GLU B 1 117 ? 15.692  -9.299  38.859  1.00 59.33  ? 134 GLU B CB  1 
ATOM   2463 C CG  . GLU B 1 117 ? 16.959  -10.142 38.760  1.00 62.86  ? 134 GLU B CG  1 
ATOM   2464 C CD  . GLU B 1 117 ? 17.839  -9.952  39.984  1.00 76.67  ? 134 GLU B CD  1 
ATOM   2465 O OE1 . GLU B 1 117 ? 18.975  -9.423  39.856  1.00 77.67  ? 134 GLU B OE1 1 
ATOM   2466 O OE2 . GLU B 1 117 ? 17.376  -10.298 41.095  1.00 80.14  ? 134 GLU B OE2 1 
ATOM   2467 N N   . ILE B 1 118 ? 14.815  -9.479  41.883  1.00 50.88  ? 135 ILE B N   1 
ATOM   2468 C CA  . ILE B 1 118 ? 14.862  -9.712  43.330  1.00 53.64  ? 135 ILE B CA  1 
ATOM   2469 C C   . ILE B 1 118 ? 13.733  -10.598 43.935  1.00 56.99  ? 135 ILE B C   1 
ATOM   2470 O O   . ILE B 1 118 ? 14.036  -11.516 44.709  1.00 61.83  ? 135 ILE B O   1 
ATOM   2471 C CB  . ILE B 1 118 ? 15.006  -8.379  44.114  1.00 56.42  ? 135 ILE B CB  1 
ATOM   2472 C CG1 . ILE B 1 118 ? 16.459  -8.115  44.547  1.00 60.77  ? 135 ILE B CG1 1 
ATOM   2473 C CG2 . ILE B 1 118 ? 14.250  -8.464  45.419  1.00 51.80  ? 135 ILE B CG2 1 
ATOM   2474 C CD1 . ILE B 1 118 ? 17.502  -7.999  43.450  1.00 60.31  ? 135 ILE B CD1 1 
ATOM   2475 N N   . LYS B 1 119 ? 12.456  -10.338 43.619  1.00 58.75  ? 136 LYS B N   1 
ATOM   2476 C CA  . LYS B 1 119 ? 11.349  -11.234 44.038  1.00 57.02  ? 136 LYS B CA  1 
ATOM   2477 C C   . LYS B 1 119 ? 11.647  -12.723 43.724  1.00 61.65  ? 136 LYS B C   1 
ATOM   2478 O O   . LYS B 1 119 ? 11.301  -13.648 44.509  1.00 57.17  ? 136 LYS B O   1 
ATOM   2479 C CB  . LYS B 1 119 ? 10.064  -10.841 43.334  1.00 59.21  ? 136 LYS B CB  1 
ATOM   2480 C CG  . LYS B 1 119 ? 9.089   -10.009 44.156  1.00 60.74  ? 136 LYS B CG  1 
ATOM   2481 C CD  . LYS B 1 119 ? 7.812   -9.806  43.360  1.00 58.20  ? 136 LYS B CD  1 
ATOM   2482 C CE  . LYS B 1 119 ? 6.584   -10.113 44.214  1.00 72.86  ? 136 LYS B CE  1 
ATOM   2483 N NZ  . LYS B 1 119 ? 5.270   -9.916  43.512  1.00 64.86  ? 136 LYS B NZ  1 
ATOM   2484 N N   . GLU B 1 120 ? 12.296  -12.931 42.577  1.00 51.81  ? 137 GLU B N   1 
ATOM   2485 C CA  . GLU B 1 120 ? 12.630  -14.257 42.088  1.00 58.84  ? 137 GLU B CA  1 
ATOM   2486 C C   . GLU B 1 120 ? 13.908  -14.756 42.775  1.00 62.75  ? 137 GLU B C   1 
ATOM   2487 O O   . GLU B 1 120 ? 13.984  -15.933 43.158  1.00 66.95  ? 137 GLU B O   1 
ATOM   2488 C CB  . GLU B 1 120 ? 12.764  -14.260 40.543  1.00 57.22  ? 137 GLU B CB  1 
ATOM   2489 C CG  . GLU B 1 120 ? 13.478  -15.468 39.919  1.00 58.18  ? 137 GLU B CG  1 
ATOM   2490 C CD  . GLU B 1 120 ? 12.822  -16.820 40.256  1.00 67.06  ? 137 GLU B CD  1 
ATOM   2491 O OE1 . GLU B 1 120 ? 11.581  -16.868 40.383  1.00 65.73  ? 137 GLU B OE1 1 
ATOM   2492 O OE2 . GLU B 1 120 ? 13.539  -17.849 40.411  1.00 65.32  ? 137 GLU B OE2 1 
ATOM   2493 N N   . ARG B 1 121 ? 14.906  -13.874 42.925  1.00 60.12  ? 138 ARG B N   1 
ATOM   2494 C CA  . ARG B 1 121 ? 16.101  -14.215 43.697  1.00 55.68  ? 138 ARG B CA  1 
ATOM   2495 C C   . ARG B 1 121 ? 15.794  -14.613 45.117  1.00 59.09  ? 138 ARG B C   1 
ATOM   2496 O O   . ARG B 1 121 ? 16.497  -15.465 45.657  1.00 64.40  ? 138 ARG B O   1 
ATOM   2497 C CB  . ARG B 1 121 ? 17.141  -13.121 43.683  1.00 61.38  ? 138 ARG B CB  1 
ATOM   2498 C CG  . ARG B 1 121 ? 18.370  -13.547 42.901  1.00 64.09  ? 138 ARG B CG  1 
ATOM   2499 C CD  . ARG B 1 121 ? 19.448  -12.493 42.956  1.00 61.26  ? 138 ARG B CD  1 
ATOM   2500 N NE  . ARG B 1 121 ? 20.143  -12.436 41.680  1.00 70.73  ? 138 ARG B NE  1 
ATOM   2501 C CZ  . ARG B 1 121 ? 20.987  -11.471 41.313  1.00 84.36  ? 138 ARG B CZ  1 
ATOM   2502 N NH1 . ARG B 1 121 ? 21.261  -10.447 42.124  1.00 81.92  ? 138 ARG B NH1 1 
ATOM   2503 N NH2 . ARG B 1 121 ? 21.556  -11.528 40.115  1.00 90.48  ? 138 ARG B NH2 1 
ATOM   2504 N N   . ILE B 1 122 ? 14.739  -14.042 45.706  1.00 58.91  ? 139 ILE B N   1 
ATOM   2505 C CA  . ILE B 1 122 ? 14.333  -14.432 47.057  1.00 63.66  ? 139 ILE B CA  1 
ATOM   2506 C C   . ILE B 1 122 ? 13.547  -15.723 47.038  1.00 71.86  ? 139 ILE B C   1 
ATOM   2507 O O   . ILE B 1 122 ? 13.524  -16.445 48.038  1.00 78.33  ? 139 ILE B O   1 
ATOM   2508 C CB  . ILE B 1 122 ? 13.486  -13.371 47.820  1.00 70.42  ? 139 ILE B CB  1 
ATOM   2509 C CG1 . ILE B 1 122 ? 12.098  -13.203 47.174  1.00 74.54  ? 139 ILE B CG1 1 
ATOM   2510 C CG2 . ILE B 1 122 ? 14.250  -12.059 48.000  1.00 64.06  ? 139 ILE B CG2 1 
ATOM   2511 C CD1 . ILE B 1 122 ? 10.945  -13.360 48.144  1.00 77.17  ? 139 ILE B CD1 1 
ATOM   2512 N N   . ALA B 1 123 ? 12.883  -15.996 45.914  1.00 76.94  ? 140 ALA B N   1 
ATOM   2513 C CA  . ALA B 1 123 ? 12.199  -17.267 45.722  1.00 63.99  ? 140 ALA B CA  1 
ATOM   2514 C C   . ALA B 1 123 ? 13.235  -18.395 45.615  1.00 71.32  ? 140 ALA B C   1 
ATOM   2515 O O   . ALA B 1 123 ? 13.146  -19.410 46.316  1.00 71.81  ? 140 ALA B O   1 
ATOM   2516 C CB  . ALA B 1 123 ? 11.305  -17.205 44.506  1.00 60.53  ? 140 ALA B CB  1 
ATOM   2517 N N   . LYS B 1 124 ? 14.252  -18.203 44.777  1.00 77.59  ? 141 LYS B N   1 
ATOM   2518 C CA  . LYS B 1 124 ? 15.327  -19.191 44.687  1.00 74.66  ? 141 LYS B CA  1 
ATOM   2519 C C   . LYS B 1 124 ? 16.222  -19.310 45.945  1.00 82.41  ? 141 LYS B C   1 
ATOM   2520 O O   . LYS B 1 124 ? 16.887  -20.327 46.120  1.00 85.39  ? 141 LYS B O   1 
ATOM   2521 C CB  . LYS B 1 124 ? 16.187  -19.008 43.429  1.00 67.72  ? 141 LYS B CB  1 
ATOM   2522 C CG  . LYS B 1 124 ? 17.247  -20.101 43.325  1.00 64.84  ? 141 LYS B CG  1 
ATOM   2523 C CD  . LYS B 1 124 ? 17.789  -20.365 41.938  1.00 68.80  ? 141 LYS B CD  1 
ATOM   2524 C CE  . LYS B 1 124 ? 19.000  -19.513 41.620  1.00 65.47  ? 141 LYS B CE  1 
ATOM   2525 N NZ  . LYS B 1 124 ? 19.724  -20.120 40.464  1.00 66.46  ? 141 LYS B NZ  1 
ATOM   2526 N N   . ARG B 1 125 ? 16.263  -18.295 46.808  1.00 81.52  ? 142 ARG B N   1 
ATOM   2527 C CA  . ARG B 1 125 ? 17.055  -18.404 48.045  1.00 71.76  ? 142 ARG B CA  1 
ATOM   2528 C C   . ARG B 1 125 ? 16.248  -19.230 49.082  1.00 68.88  ? 142 ARG B C   1 
ATOM   2529 O O   . ARG B 1 125 ? 16.829  -19.960 49.883  1.00 66.00  ? 142 ARG B O   1 
ATOM   2530 C CB  . ARG B 1 125 ? 17.498  -17.005 48.542  1.00 65.23  ? 142 ARG B CB  1 
ATOM   2531 C CG  . ARG B 1 125 ? 18.699  -16.923 49.496  1.00 54.81  ? 142 ARG B CG  1 
ATOM   2532 C CD  . ARG B 1 125 ? 18.173  -17.107 50.913  1.00 59.11  ? 142 ARG B CD  1 
ATOM   2533 N NE  . ARG B 1 125 ? 19.002  -16.620 52.014  1.00 56.11  ? 142 ARG B NE  1 
ATOM   2534 C CZ  . ARG B 1 125 ? 18.535  -16.504 53.262  1.00 57.22  ? 142 ARG B CZ  1 
ATOM   2535 N NH1 . ARG B 1 125 ? 17.268  -16.818 53.532  1.00 63.57  ? 142 ARG B NH1 1 
ATOM   2536 N NH2 . ARG B 1 125 ? 19.306  -16.057 54.240  1.00 51.61  ? 142 ARG B NH2 1 
ATOM   2537 N N   . GLY B 1 126 ? 14.915  -19.153 49.009  1.00 75.58  ? 143 GLY B N   1 
ATOM   2538 C CA  . GLY B 1 126 ? 13.991  -19.983 49.819  1.00 76.33  ? 143 GLY B CA  1 
ATOM   2539 C C   . GLY B 1 126 ? 14.069  -21.484 49.537  1.00 85.66  ? 143 GLY B C   1 
ATOM   2540 O O   . GLY B 1 126 ? 13.850  -22.306 50.432  1.00 89.00  ? 143 GLY B O   1 
ATOM   2541 N N   . ARG B 1 127 ? 14.400  -21.836 48.294  1.00 91.24  ? 144 ARG B N   1 
ATOM   2542 C CA  . ARG B 1 127 ? 14.614  -23.225 47.879  1.00 87.03  ? 144 ARG B CA  1 
ATOM   2543 C C   . ARG B 1 127 ? 15.994  -23.712 48.308  1.00 86.26  ? 144 ARG B C   1 
ATOM   2544 O O   . ARG B 1 127 ? 16.096  -24.521 49.221  1.00 92.30  ? 144 ARG B O   1 
ATOM   2545 C CB  . ARG B 1 127 ? 14.430  -23.402 46.354  1.00 95.85  ? 144 ARG B CB  1 
ATOM   2546 C CG  . ARG B 1 127 ? 13.105  -22.878 45.792  1.00 97.65  ? 144 ARG B CG  1 
ATOM   2547 C CD  . ARG B 1 127 ? 12.741  -23.437 44.413  1.00 93.19  ? 144 ARG B CD  1 
ATOM   2548 N NE  . ARG B 1 127 ? 13.495  -22.867 43.286  1.00 88.46  ? 144 ARG B NE  1 
ATOM   2549 C CZ  . ARG B 1 127 ? 13.267  -21.677 42.719  1.00 83.10  ? 144 ARG B CZ  1 
ATOM   2550 N NH1 . ARG B 1 127 ? 12.310  -20.880 43.174  1.00 79.48  ? 144 ARG B NH1 1 
ATOM   2551 N NH2 . ARG B 1 127 ? 14.018  -21.274 41.694  1.00 78.78  ? 144 ARG B NH2 1 
ATOM   2552 N N   . LYS B 1 128 ? 17.047  -23.200 47.670  1.00 85.37  ? 145 LYS B N   1 
ATOM   2553 C CA  . LYS B 1 128 ? 18.441  -23.652 47.894  1.00 86.12  ? 145 LYS B CA  1 
ATOM   2554 C C   . LYS B 1 128 ? 18.929  -23.745 49.352  1.00 82.12  ? 145 LYS B C   1 
ATOM   2555 O O   . LYS B 1 128 ? 19.978  -24.354 49.627  1.00 81.82  ? 145 LYS B O   1 
ATOM   2556 C CB  . LYS B 1 128 ? 19.439  -22.815 47.080  1.00 89.78  ? 145 LYS B CB  1 
ATOM   2557 C CG  . LYS B 1 128 ? 19.221  -22.778 45.565  1.00 94.73  ? 145 LYS B CG  1 
ATOM   2558 C CD  . LYS B 1 128 ? 18.920  -24.118 44.903  1.00 91.91  ? 145 LYS B CD  1 
ATOM   2559 C CE  . LYS B 1 128 ? 19.064  -23.993 43.388  1.00 98.19  ? 145 LYS B CE  1 
ATOM   2560 N NZ  . LYS B 1 128 ? 17.940  -24.620 42.635  1.00 94.14  ? 145 LYS B NZ  1 
ATOM   2561 N N   . LEU B 1 129 ? 18.186  -23.127 50.264  1.00 78.41  ? 146 LEU B N   1 
ATOM   2562 C CA  . LEU B 1 129 ? 18.401  -23.318 51.694  1.00 80.00  ? 146 LEU B CA  1 
ATOM   2563 C C   . LEU B 1 129 ? 17.606  -24.540 52.220  1.00 88.82  ? 146 LEU B C   1 
ATOM   2564 O O   . LEU B 1 129 ? 18.097  -25.256 53.109  1.00 92.45  ? 146 LEU B O   1 
ATOM   2565 C CB  . LEU B 1 129 ? 18.148  -22.007 52.478  1.00 68.05  ? 146 LEU B CB  1 
ATOM   2566 C CG  . LEU B 1 129 ? 17.602  -21.912 53.914  1.00 66.43  ? 146 LEU B CG  1 
ATOM   2567 C CD1 . LEU B 1 129 ? 18.523  -21.176 54.883  1.00 57.68  ? 146 LEU B CD1 1 
ATOM   2568 C CD2 . LEU B 1 129 ? 16.211  -21.291 53.914  1.00 64.58  ? 146 LEU B CD2 1 
ATOM   2569 N N   . VAL B 1 130 ? 16.410  -24.800 51.662  1.00 85.18  ? 147 VAL B N   1 
ATOM   2570 C CA  . VAL B 1 130 ? 15.684  -26.069 51.935  1.00 83.05  ? 147 VAL B CA  1 
ATOM   2571 C C   . VAL B 1 130 ? 16.530  -27.302 51.525  1.00 88.14  ? 147 VAL B C   1 
ATOM   2572 O O   . VAL B 1 130 ? 16.516  -28.321 52.224  1.00 87.66  ? 147 VAL B O   1 
ATOM   2573 C CB  . VAL B 1 130 ? 14.234  -26.091 51.346  1.00 74.55  ? 147 VAL B CB  1 
ATOM   2574 C CG1 . VAL B 1 130 ? 13.801  -27.500 50.912  1.00 59.85  ? 147 VAL B CG1 1 
ATOM   2575 C CG2 . VAL B 1 130 ? 13.246  -25.469 52.334  1.00 64.64  ? 147 VAL B CG2 1 
ATOM   2576 N N   . ASP B 1 131 ? 17.275  -27.179 50.418  1.00 89.53  ? 148 ASP B N   1 
ATOM   2577 C CA  . ASP B 1 131 ? 18.255  -28.191 49.955  1.00 90.81  ? 148 ASP B CA  1 
ATOM   2578 C C   . ASP B 1 131 ? 19.455  -28.351 50.897  1.00 90.79  ? 148 ASP B C   1 
ATOM   2579 O O   . ASP B 1 131 ? 19.805  -29.463 51.297  1.00 79.43  ? 148 ASP B O   1 
ATOM   2580 C CB  . ASP B 1 131 ? 18.800  -27.815 48.576  1.00 87.71  ? 148 ASP B CB  1 
ATOM   2581 C CG  . ASP B 1 131 ? 17.721  -27.652 47.548  1.00 94.39  ? 148 ASP B CG  1 
ATOM   2582 O OD1 . ASP B 1 131 ? 16.531  -27.798 47.904  1.00 103.94 ? 148 ASP B OD1 1 
ATOM   2583 O OD2 . ASP B 1 131 ? 18.069  -27.373 46.379  1.00 96.73  ? 148 ASP B OD2 1 
ATOM   2584 N N   . TYR B 1 132 ? 20.107  -27.230 51.201  1.00 87.20  ? 149 TYR B N   1 
ATOM   2585 C CA  . TYR B 1 132 ? 21.170  -27.188 52.181  1.00 87.39  ? 149 TYR B CA  1 
ATOM   2586 C C   . TYR B 1 132 ? 20.731  -27.794 53.526  1.00 92.35  ? 149 TYR B C   1 
ATOM   2587 O O   . TYR B 1 132 ? 21.504  -28.525 54.153  1.00 93.40  ? 149 TYR B O   1 
ATOM   2588 C CB  . TYR B 1 132 ? 21.634  -25.747 52.343  1.00 93.67  ? 149 TYR B CB  1 
ATOM   2589 C CG  . TYR B 1 132 ? 22.666  -25.493 53.418  1.00 96.94  ? 149 TYR B CG  1 
ATOM   2590 C CD1 . TYR B 1 132 ? 22.348  -24.742 54.545  1.00 98.76  ? 149 TYR B CD1 1 
ATOM   2591 C CD2 . TYR B 1 132 ? 23.962  -25.974 53.295  1.00 100.61 ? 149 TYR B CD2 1 
ATOM   2592 C CE1 . TYR B 1 132 ? 23.290  -24.487 55.526  1.00 106.67 ? 149 TYR B CE1 1 
ATOM   2593 C CE2 . TYR B 1 132 ? 24.909  -25.726 54.270  1.00 105.19 ? 149 TYR B CE2 1 
ATOM   2594 C CZ  . TYR B 1 132 ? 24.569  -24.979 55.378  1.00 111.17 ? 149 TYR B CZ  1 
ATOM   2595 O OH  . TYR B 1 132 ? 25.513  -24.735 56.344  1.00 121.56 ? 149 TYR B OH  1 
ATOM   2596 N N   . ASP B 1 133 ? 19.492  -27.534 53.950  1.00 86.15  ? 150 ASP B N   1 
ATOM   2597 C CA  . ASP B 1 133 ? 18.989  -28.125 55.203  1.00 92.41  ? 150 ASP B CA  1 
ATOM   2598 C C   . ASP B 1 133 ? 18.649  -29.626 55.148  1.00 89.95  ? 150 ASP B C   1 
ATOM   2599 O O   . ASP B 1 133 ? 18.826  -30.349 56.143  1.00 92.32  ? 150 ASP B O   1 
ATOM   2600 C CB  . ASP B 1 133 ? 17.831  -27.299 55.765  1.00 91.20  ? 150 ASP B CB  1 
ATOM   2601 C CG  . ASP B 1 133 ? 18.271  -25.909 56.160  1.00 89.08  ? 150 ASP B CG  1 
ATOM   2602 O OD1 . ASP B 1 133 ? 19.252  -25.435 55.554  1.00 88.68  ? 150 ASP B OD1 1 
ATOM   2603 O OD2 . ASP B 1 133 ? 17.658  -25.293 57.064  1.00 81.26  ? 150 ASP B OD2 1 
ATOM   2604 N N   . SER B 1 134 ? 18.186  -30.099 53.994  1.00 83.54  ? 151 SER B N   1 
ATOM   2605 C CA  . SER B 1 134 ? 17.969  -31.531 53.814  1.00 89.56  ? 151 SER B CA  1 
ATOM   2606 C C   . SER B 1 134 ? 19.245  -32.339 53.564  1.00 93.72  ? 151 SER B C   1 
ATOM   2607 O O   . SER B 1 134 ? 19.325  -33.480 54.011  1.00 100.35 ? 151 SER B O   1 
ATOM   2608 C CB  . SER B 1 134 ? 16.923  -31.818 52.744  1.00 89.67  ? 151 SER B CB  1 
ATOM   2609 O OG  . SER B 1 134 ? 15.740  -32.297 53.359  1.00 98.49  ? 151 SER B OG  1 
ATOM   2610 N N   . ALA B 1 135 ? 20.216  -31.760 52.845  1.00 93.78  ? 152 ALA B N   1 
ATOM   2611 C CA  . ALA B 1 135 ? 21.561  -32.350 52.696  1.00 91.47  ? 152 ALA B CA  1 
ATOM   2612 C C   . ALA B 1 135 ? 22.359  -32.224 54.002  1.00 98.14  ? 152 ALA B C   1 
ATOM   2613 O O   . ALA B 1 135 ? 23.396  -32.877 54.156  1.00 95.37  ? 152 ALA B O   1 
ATOM   2614 C CB  . ALA B 1 135 ? 22.324  -31.750 51.510  1.00 75.51  ? 152 ALA B CB  1 
ATOM   2615 N N   . ARG B 1 136 ? 21.875  -31.377 54.922  1.00 101.58 ? 153 ARG B N   1 
ATOM   2616 C CA  . ARG B 1 136 ? 22.267  -31.426 56.340  1.00 103.82 ? 153 ARG B CA  1 
ATOM   2617 C C   . ARG B 1 136 ? 21.569  -32.609 57.008  1.00 112.85 ? 153 ARG B C   1 
ATOM   2618 O O   . ARG B 1 136 ? 22.233  -33.482 57.570  1.00 117.09 ? 153 ARG B O   1 
ATOM   2619 C CB  . ARG B 1 136 ? 21.897  -30.138 57.090  1.00 102.15 ? 153 ARG B CB  1 
ATOM   2620 C CG  . ARG B 1 136 ? 23.024  -29.135 57.278  1.00 99.25  ? 153 ARG B CG  1 
ATOM   2621 C CD  . ARG B 1 136 ? 23.757  -29.272 58.612  1.00 92.54  ? 153 ARG B CD  1 
ATOM   2622 N NE  . ARG B 1 136 ? 24.115  -27.947 59.132  1.00 104.74 ? 153 ARG B NE  1 
ATOM   2623 C CZ  . ARG B 1 136 ? 25.331  -27.391 59.119  1.00 99.15  ? 153 ARG B CZ  1 
ATOM   2624 N NH1 . ARG B 1 136 ? 26.390  -28.036 58.644  1.00 91.36  ? 153 ARG B NH1 1 
ATOM   2625 N NH2 . ARG B 1 136 ? 25.489  -26.171 59.606  1.00 94.66  ? 153 ARG B NH2 1 
ATOM   2626 N N   . HIS B 1 137 ? 20.233  -32.634 56.945  1.00 114.79 ? 154 HIS B N   1 
ATOM   2627 C CA  . HIS B 1 137 ? 19.439  -33.725 57.537  1.00 117.52 ? 154 HIS B CA  1 
ATOM   2628 C C   . HIS B 1 137 ? 19.928  -35.143 57.138  1.00 116.30 ? 154 HIS B C   1 
ATOM   2629 O O   . HIS B 1 137 ? 19.926  -36.069 57.968  1.00 103.61 ? 154 HIS B O   1 
ATOM   2630 C CB  . HIS B 1 137 ? 17.941  -33.535 57.233  1.00 114.86 ? 154 HIS B CB  1 
ATOM   2631 C CG  . HIS B 1 137 ? 17.087  -34.701 57.631  1.00 126.32 ? 154 HIS B CG  1 
ATOM   2632 N ND1 . HIS B 1 137 ? 16.252  -35.349 56.745  1.00 128.35 ? 154 HIS B ND1 1 
ATOM   2633 C CD2 . HIS B 1 137 ? 16.956  -35.351 58.814  1.00 125.05 ? 154 HIS B CD2 1 
ATOM   2634 C CE1 . HIS B 1 137 ? 15.634  -36.339 57.367  1.00 121.77 ? 154 HIS B CE1 1 
ATOM   2635 N NE2 . HIS B 1 137 ? 16.045  -36.363 58.622  1.00 123.09 ? 154 HIS B NE2 1 
ATOM   2636 N N   . HIS B 1 138 ? 20.371  -35.275 55.884  1.00 109.66 ? 155 HIS B N   1 
ATOM   2637 C CA  . HIS B 1 138 ? 20.787  -36.542 55.265  1.00 109.20 ? 155 HIS B CA  1 
ATOM   2638 C C   . HIS B 1 138 ? 22.210  -36.987 55.609  1.00 109.01 ? 155 HIS B C   1 
ATOM   2639 O O   . HIS B 1 138 ? 22.519  -38.179 55.564  1.00 118.05 ? 155 HIS B O   1 
ATOM   2640 C CB  . HIS B 1 138 ? 20.642  -36.457 53.735  1.00 103.77 ? 155 HIS B CB  1 
ATOM   2641 C CG  . HIS B 1 138 ? 21.200  -37.645 53.007  1.00 105.56 ? 155 HIS B CG  1 
ATOM   2642 N ND1 . HIS B 1 138 ? 20.430  -38.734 52.656  1.00 107.59 ? 155 HIS B ND1 1 
ATOM   2643 C CD2 . HIS B 1 138 ? 22.453  -37.917 52.571  1.00 101.87 ? 155 HIS B CD2 1 
ATOM   2644 C CE1 . HIS B 1 138 ? 21.182  -39.624 52.034  1.00 104.90 ? 155 HIS B CE1 1 
ATOM   2645 N NE2 . HIS B 1 138 ? 22.415  -39.154 51.972  1.00 105.61 ? 155 HIS B NE2 1 
ATOM   2646 N N   . LEU B 1 139 ? 23.080  -36.036 55.923  1.00 108.13 ? 156 LEU B N   1 
ATOM   2647 C CA  . LEU B 1 139 ? 24.476  -36.352 56.229  1.00 113.18 ? 156 LEU B CA  1 
ATOM   2648 C C   . LEU B 1 139 ? 24.768  -36.623 57.706  1.00 119.68 ? 156 LEU B C   1 
ATOM   2649 O O   . LEU B 1 139 ? 25.852  -37.097 58.067  1.00 113.12 ? 156 LEU B O   1 
ATOM   2650 C CB  . LEU B 1 139 ? 25.387  -35.252 55.725  1.00 107.07 ? 156 LEU B CB  1 
ATOM   2651 C CG  . LEU B 1 139 ? 25.998  -35.526 54.370  1.00 102.22 ? 156 LEU B CG  1 
ATOM   2652 C CD1 . LEU B 1 139 ? 25.015  -35.222 53.236  1.00 89.76  ? 156 LEU B CD1 1 
ATOM   2653 C CD2 . LEU B 1 139 ? 27.245  -34.659 54.327  1.00 105.39 ? 156 LEU B CD2 1 
ATOM   2654 N N   . GLU B 1 140 ? 23.808  -36.309 58.565  1.00 125.44 ? 157 GLU B N   1 
ATOM   2655 C CA  . GLU B 1 140 ? 23.890  -36.758 59.945  1.00 127.87 ? 157 GLU B CA  1 
ATOM   2656 C C   . GLU B 1 140 ? 23.353  -38.201 60.060  1.00 129.23 ? 157 GLU B C   1 
ATOM   2657 O O   . GLU B 1 140 ? 23.700  -38.919 60.997  1.00 127.50 ? 157 GLU B O   1 
ATOM   2658 C CB  . GLU B 1 140 ? 23.226  -35.746 60.900  1.00 117.08 ? 157 GLU B CB  1 
ATOM   2659 C CG  . GLU B 1 140 ? 24.188  -34.644 61.357  1.00 106.68 ? 157 GLU B CG  1 
ATOM   2660 C CD  . GLU B 1 140 ? 23.565  -33.258 61.461  1.00 103.02 ? 157 GLU B CD  1 
ATOM   2661 O OE1 . GLU B 1 140 ? 22.368  -33.083 61.149  1.00 91.42  ? 157 GLU B OE1 1 
ATOM   2662 O OE2 . GLU B 1 140 ? 24.292  -32.325 61.851  1.00 102.41 ? 157 GLU B OE2 1 
ATOM   2663 N N   . ALA B 1 141 ? 22.569  -38.632 59.064  1.00 122.20 ? 158 ALA B N   1 
ATOM   2664 C CA  . ALA B 1 141 ? 22.006  -39.992 59.014  1.00 122.88 ? 158 ALA B CA  1 
ATOM   2665 C C   . ALA B 1 141 ? 22.697  -40.971 58.022  1.00 128.69 ? 158 ALA B C   1 
ATOM   2666 O O   . ALA B 1 141 ? 22.261  -42.121 57.865  1.00 120.86 ? 158 ALA B O   1 
ATOM   2667 C CB  . ALA B 1 141 ? 20.501  -39.932 58.766  1.00 118.32 ? 158 ALA B CB  1 
ATOM   2668 N N   . VAL B 1 142 ? 23.756  -40.511 57.353  1.00 134.67 ? 159 VAL B N   1 
ATOM   2669 C CA  . VAL B 1 142 ? 24.643  -41.394 56.573  1.00 139.91 ? 159 VAL B CA  1 
ATOM   2670 C C   . VAL B 1 142 ? 25.933  -41.676 57.371  1.00 150.97 ? 159 VAL B C   1 
ATOM   2671 O O   . VAL B 1 142 ? 26.521  -42.763 57.265  1.00 163.38 ? 159 VAL B O   1 
ATOM   2672 C CB  . VAL B 1 142 ? 24.920  -40.836 55.144  1.00 133.77 ? 159 VAL B CB  1 
ATOM   2673 C CG1 . VAL B 1 142 ? 26.334  -41.147 54.662  1.00 125.76 ? 159 VAL B CG1 1 
ATOM   2674 C CG2 . VAL B 1 142 ? 23.891  -41.370 54.156  1.00 130.32 ? 159 VAL B CG2 1 
ATOM   2675 N N   . GLN B 1 143 ? 26.335  -40.702 58.191  1.00 147.30 ? 160 GLN B N   1 
ATOM   2676 C CA  . GLN B 1 143 ? 27.537  -40.791 59.031  1.00 138.96 ? 160 GLN B CA  1 
ATOM   2677 C C   . GLN B 1 143 ? 27.267  -41.334 60.442  1.00 143.68 ? 160 GLN B C   1 
ATOM   2678 O O   . GLN B 1 143 ? 28.212  -41.675 61.160  1.00 137.45 ? 160 GLN B O   1 
ATOM   2679 C CB  . GLN B 1 143 ? 28.239  -39.432 59.106  1.00 130.84 ? 160 GLN B CB  1 
ATOM   2680 C CG  . GLN B 1 143 ? 28.738  -38.931 57.760  1.00 130.49 ? 160 GLN B CG  1 
ATOM   2681 C CD  . GLN B 1 143 ? 28.930  -37.427 57.717  1.00 130.23 ? 160 GLN B CD  1 
ATOM   2682 O OE1 . GLN B 1 143 ? 29.683  -36.860 58.511  1.00 123.60 ? 160 GLN B OE1 1 
ATOM   2683 N NE2 . GLN B 1 143 ? 28.258  -36.773 56.772  1.00 130.79 ? 160 GLN B NE2 1 
ATOM   2684 N N   . ASN B 1 144 ? 25.989  -41.402 60.833  1.00 147.08 ? 161 ASN B N   1 
ATOM   2685 C CA  . ASN B 1 144 ? 25.568  -42.136 62.040  1.00 141.34 ? 161 ASN B CA  1 
ATOM   2686 C C   . ASN B 1 144 ? 25.597  -43.644 61.814  1.00 152.45 ? 161 ASN B C   1 
ATOM   2687 O O   . ASN B 1 144 ? 24.545  -44.310 61.746  1.00 144.02 ? 161 ASN B O   1 
ATOM   2688 C CB  . ASN B 1 144 ? 24.192  -41.685 62.538  1.00 125.23 ? 161 ASN B CB  1 
ATOM   2689 C CG  . ASN B 1 144 ? 24.280  -40.862 63.808  1.00 110.65 ? 161 ASN B CG  1 
ATOM   2690 O OD1 . ASN B 1 144 ? 25.111  -39.959 63.918  1.00 94.18  ? 161 ASN B OD1 1 
ATOM   2691 N ND2 . ASN B 1 144 ? 23.427  -41.177 64.780  1.00 100.71 ? 161 ASN B ND2 1 
ATOM   2692 N N   . ALA B 1 145 ? 26.830  -44.156 61.718  1.00 163.57 ? 162 ALA B N   1 
ATOM   2693 C CA  . ALA B 1 145 ? 27.133  -45.508 61.254  1.00 156.00 ? 162 ALA B CA  1 
ATOM   2694 C C   . ALA B 1 145 ? 28.651  -45.766 61.216  1.00 149.14 ? 162 ALA B C   1 
ATOM   2695 O O   . ALA B 1 145 ? 29.244  -45.790 60.133  1.00 144.28 ? 162 ALA B O   1 
ATOM   2696 C CB  . ALA B 1 145 ? 26.531  -45.724 59.867  1.00 154.52 ? 162 ALA B CB  1 
ATOM   2697 N N   . LYS B 1 146 ? 29.280  -45.948 62.383  1.00 146.64 ? 163 LYS B N   1 
ATOM   2698 C CA  . LYS B 1 146 ? 30.697  -46.366 62.425  1.00 142.45 ? 163 LYS B CA  1 
ATOM   2699 C C   . LYS B 1 146 ? 30.824  -47.855 62.070  1.00 156.71 ? 163 LYS B C   1 
ATOM   2700 O O   . LYS B 1 146 ? 30.554  -48.732 62.900  1.00 162.62 ? 163 LYS B O   1 
ATOM   2701 C CB  . LYS B 1 146 ? 31.403  -46.021 63.757  1.00 126.09 ? 163 LYS B CB  1 
ATOM   2702 C CG  . LYS B 1 146 ? 30.670  -46.386 65.050  1.00 122.04 ? 163 LYS B CG  1 
ATOM   2703 C CD  . LYS B 1 146 ? 29.930  -45.200 65.660  1.00 109.51 ? 163 LYS B CD  1 
ATOM   2704 C CE  . LYS B 1 146 ? 30.901  -44.149 66.186  1.00 99.22  ? 163 LYS B CE  1 
ATOM   2705 N NZ  . LYS B 1 146 ? 30.306  -42.788 66.127  1.00 80.06  ? 163 LYS B NZ  1 
ATOM   2706 N N   . LYS B 1 147 ? 31.234  -48.111 60.823  1.00 161.70 ? 164 LYS B N   1 
ATOM   2707 C CA  . LYS B 1 147 ? 31.228  -49.447 60.170  1.00 158.81 ? 164 LYS B CA  1 
ATOM   2708 C C   . LYS B 1 147 ? 29.811  -49.949 59.753  1.00 155.02 ? 164 LYS B C   1 
ATOM   2709 O O   . LYS B 1 147 ? 29.685  -51.025 59.150  1.00 150.68 ? 164 LYS B O   1 
ATOM   2710 C CB  . LYS B 1 147 ? 32.012  -50.531 60.965  1.00 155.35 ? 164 LYS B CB  1 
ATOM   2711 C CG  . LYS B 1 147 ? 33.233  -50.081 61.777  1.00 139.65 ? 164 LYS B CG  1 
ATOM   2712 C CD  . LYS B 1 147 ? 34.464  -49.722 60.955  1.00 117.34 ? 164 LYS B CD  1 
ATOM   2713 C CE  . LYS B 1 147 ? 35.624  -49.403 61.889  1.00 99.40  ? 164 LYS B CE  1 
ATOM   2714 N NZ  . LYS B 1 147 ? 36.687  -48.574 61.255  1.00 76.47  ? 164 LYS B NZ  1 
ATOM   2715 N N   . LYS B 1 148 ? 28.766  -49.173 60.073  1.00 138.40 ? 165 LYS B N   1 
ATOM   2716 C CA  . LYS B 1 148 ? 27.383  -49.444 59.628  1.00 119.59 ? 165 LYS B CA  1 
ATOM   2717 C C   . LYS B 1 148 ? 27.115  -48.793 58.258  1.00 119.30 ? 165 LYS B C   1 
ATOM   2718 O O   . LYS B 1 148 ? 26.095  -49.064 57.627  1.00 116.16 ? 165 LYS B O   1 
ATOM   2719 C CB  . LYS B 1 148 ? 26.350  -49.004 60.699  1.00 111.73 ? 165 LYS B CB  1 
ATOM   2720 C CG  . LYS B 1 148 ? 24.918  -48.794 60.197  1.00 110.56 ? 165 LYS B CG  1 
ATOM   2721 C CD  . LYS B 1 148 ? 23.950  -48.238 61.240  1.00 103.62 ? 165 LYS B CD  1 
ATOM   2722 C CE  . LYS B 1 148 ? 22.714  -47.643 60.558  1.00 100.24 ? 165 LYS B CE  1 
ATOM   2723 N NZ  . LYS B 1 148 ? 21.416  -48.154 61.094  1.00 89.25  ? 165 LYS B NZ  1 
ATOM   2724 N N   . ASP B 1 149 ? 28.045  -47.946 57.808  1.00 128.96 ? 166 ASP B N   1 
ATOM   2725 C CA  . ASP B 1 149 ? 27.978  -47.312 56.479  1.00 130.69 ? 166 ASP B CA  1 
ATOM   2726 C C   . ASP B 1 149 ? 28.639  -48.184 55.409  1.00 124.90 ? 166 ASP B C   1 
ATOM   2727 O O   . ASP B 1 149 ? 29.591  -48.917 55.690  1.00 111.87 ? 166 ASP B O   1 
ATOM   2728 C CB  . ASP B 1 149 ? 28.634  -45.916 56.482  1.00 124.06 ? 166 ASP B CB  1 
ATOM   2729 C CG  . ASP B 1 149 ? 30.152  -45.976 56.304  1.00 116.92 ? 166 ASP B CG  1 
ATOM   2730 O OD1 . ASP B 1 149 ? 30.834  -46.419 57.251  1.00 105.95 ? 166 ASP B OD1 1 
ATOM   2731 O OD2 . ASP B 1 149 ? 30.658  -45.592 55.222  1.00 111.42 ? 166 ASP B OD2 1 
ATOM   2732 N N   . GLU B 1 150 ? 28.129  -48.089 54.184  1.00 124.14 ? 167 GLU B N   1 
ATOM   2733 C CA  . GLU B 1 150 ? 28.693  -48.821 53.056  1.00 126.19 ? 167 GLU B CA  1 
ATOM   2734 C C   . GLU B 1 150 ? 29.450  -47.857 52.135  1.00 134.10 ? 167 GLU B C   1 
ATOM   2735 O O   . GLU B 1 150 ? 30.222  -47.004 52.612  1.00 131.67 ? 167 GLU B O   1 
ATOM   2736 C CB  . GLU B 1 150 ? 27.602  -49.599 52.296  1.00 120.89 ? 167 GLU B CB  1 
ATOM   2737 C CG  . GLU B 1 150 ? 26.834  -50.630 53.129  1.00 119.29 ? 167 GLU B CG  1 
ATOM   2738 C CD  . GLU B 1 150 ? 25.502  -50.106 53.672  1.00 113.85 ? 167 GLU B CD  1 
ATOM   2739 O OE1 . GLU B 1 150 ? 24.553  -49.921 52.871  1.00 100.92 ? 167 GLU B OE1 1 
ATOM   2740 O OE2 . GLU B 1 150 ? 25.392  -49.898 54.902  1.00 101.39 ? 167 GLU B OE2 1 
ATOM   2741 N N   . ALA B 1 151 ? 29.220  -47.999 50.828  1.00 134.30 ? 168 ALA B N   1 
ATOM   2742 C CA  . ALA B 1 151 ? 29.827  -47.150 49.803  1.00 142.67 ? 168 ALA B CA  1 
ATOM   2743 C C   . ALA B 1 151 ? 29.348  -45.684 49.856  1.00 149.73 ? 168 ALA B C   1 
ATOM   2744 O O   . ALA B 1 151 ? 30.170  -44.761 49.835  1.00 139.03 ? 168 ALA B O   1 
ATOM   2745 C CB  . ALA B 1 151 ? 29.589  -47.750 48.419  1.00 135.06 ? 168 ALA B CB  1 
ATOM   2746 N N   . LYS B 1 152 ? 28.028  -45.486 49.936  1.00 155.51 ? 169 LYS B N   1 
ATOM   2747 C CA  . LYS B 1 152 ? 27.402  -44.150 49.913  1.00 147.50 ? 169 LYS B CA  1 
ATOM   2748 C C   . LYS B 1 152 ? 27.606  -43.371 51.220  1.00 151.09 ? 169 LYS B C   1 
ATOM   2749 O O   . LYS B 1 152 ? 26.714  -43.309 52.078  1.00 149.99 ? 169 LYS B O   1 
ATOM   2750 C CB  . LYS B 1 152 ? 25.912  -44.261 49.558  1.00 139.30 ? 169 LYS B CB  1 
ATOM   2751 C CG  . LYS B 1 152 ? 25.655  -44.808 48.159  1.00 133.55 ? 169 LYS B CG  1 
ATOM   2752 C CD  . LYS B 1 152 ? 24.193  -45.167 47.925  1.00 121.71 ? 169 LYS B CD  1 
ATOM   2753 C CE  . LYS B 1 152 ? 23.996  -45.779 46.543  1.00 107.12 ? 169 LYS B CE  1 
ATOM   2754 N NZ  . LYS B 1 152 ? 22.588  -46.199 46.317  1.00 99.14  ? 169 LYS B NZ  1 
ATOM   2755 N N   . THR B 1 153 ? 28.797  -42.779 51.341  1.00 153.53 ? 170 THR B N   1 
ATOM   2756 C CA  . THR B 1 153 ? 29.245  -42.033 52.535  1.00 141.56 ? 170 THR B CA  1 
ATOM   2757 C C   . THR B 1 153 ? 29.973  -40.719 52.142  1.00 127.27 ? 170 THR B C   1 
ATOM   2758 O O   . THR B 1 153 ? 29.721  -39.656 52.724  1.00 115.94 ? 170 THR B O   1 
ATOM   2759 C CB  . THR B 1 153 ? 30.092  -42.936 53.496  1.00 146.58 ? 170 THR B CB  1 
ATOM   2760 O OG1 . THR B 1 153 ? 30.530  -42.189 54.641  1.00 136.73 ? 170 THR B OG1 1 
ATOM   2761 C CG2 . THR B 1 153 ? 31.315  -43.597 52.789  1.00 136.50 ? 170 THR B CG2 1 
ATOM   2762 N N   . ALA B 1 154 ? 30.858  -40.809 51.145  1.00 113.91 ? 171 ALA B N   1 
ATOM   2763 C CA  . ALA B 1 154 ? 31.513  -39.649 50.543  1.00 99.95  ? 171 ALA B CA  1 
ATOM   2764 C C   . ALA B 1 154 ? 30.557  -38.939 49.569  1.00 103.12 ? 171 ALA B C   1 
ATOM   2765 O O   . ALA B 1 154 ? 30.676  -37.722 49.346  1.00 104.17 ? 171 ALA B O   1 
ATOM   2766 C CB  . ALA B 1 154 ? 32.802  -40.069 49.843  1.00 88.16  ? 171 ALA B CB  1 
ATOM   2767 N N   . LYS B 1 155 ? 29.610  -39.709 49.013  1.00 100.51 ? 172 LYS B N   1 
ATOM   2768 C CA  . LYS B 1 155 ? 28.526  -39.209 48.144  1.00 93.56  ? 172 LYS B CA  1 
ATOM   2769 C C   . LYS B 1 155 ? 27.559  -38.266 48.892  1.00 91.29  ? 172 LYS B C   1 
ATOM   2770 O O   . LYS B 1 155 ? 26.979  -37.338 48.304  1.00 91.35  ? 172 LYS B O   1 
ATOM   2771 C CB  . LYS B 1 155 ? 27.745  -40.392 47.564  1.00 91.57  ? 172 LYS B CB  1 
ATOM   2772 C CG  . LYS B 1 155 ? 26.584  -39.994 46.664  1.00 92.08  ? 172 LYS B CG  1 
ATOM   2773 C CD  . LYS B 1 155 ? 25.319  -40.802 46.956  1.00 89.20  ? 172 LYS B CD  1 
ATOM   2774 C CE  . LYS B 1 155 ? 24.257  -40.574 45.881  1.00 80.15  ? 172 LYS B CE  1 
ATOM   2775 N NZ  . LYS B 1 155 ? 24.695  -41.081 44.547  1.00 73.56  ? 172 LYS B NZ  1 
ATOM   2776 N N   . ALA B 1 156 ? 27.378  -38.532 50.185  1.00 79.72  ? 173 ALA B N   1 
ATOM   2777 C CA  . ALA B 1 156 ? 26.648  -37.642 51.081  1.00 81.21  ? 173 ALA B CA  1 
ATOM   2778 C C   . ALA B 1 156 ? 27.448  -36.353 51.388  1.00 88.29  ? 173 ALA B C   1 
ATOM   2779 O O   . ALA B 1 156 ? 26.918  -35.244 51.238  1.00 81.41  ? 173 ALA B O   1 
ATOM   2780 C CB  . ALA B 1 156 ? 26.267  -38.378 52.362  1.00 68.49  ? 173 ALA B CB  1 
ATOM   2781 N N   . GLU B 1 157 ? 28.710  -36.511 51.813  1.00 92.88  ? 174 GLU B N   1 
ATOM   2782 C CA  . GLU B 1 157 ? 29.642  -35.388 52.061  1.00 95.49  ? 174 GLU B CA  1 
ATOM   2783 C C   . GLU B 1 157 ? 29.898  -34.453 50.852  1.00 94.67  ? 174 GLU B C   1 
ATOM   2784 O O   . GLU B 1 157 ? 30.009  -33.239 51.032  1.00 94.32  ? 174 GLU B O   1 
ATOM   2785 C CB  . GLU B 1 157 ? 30.967  -35.897 52.658  1.00 90.42  ? 174 GLU B CB  1 
ATOM   2786 C CG  . GLU B 1 157 ? 30.980  -36.011 54.185  1.00 91.69  ? 174 GLU B CG  1 
ATOM   2787 C CD  . GLU B 1 157 ? 32.273  -36.611 54.747  1.00 86.21  ? 174 GLU B CD  1 
ATOM   2788 O OE1 . GLU B 1 157 ? 33.357  -36.389 54.174  1.00 81.94  ? 174 GLU B OE1 1 
ATOM   2789 O OE2 . GLU B 1 157 ? 32.215  -37.310 55.778  1.00 75.32  ? 174 GLU B OE2 1 
ATOM   2790 N N   . GLU B 1 158 ? 29.998  -35.018 49.644  1.00 90.79  ? 175 GLU B N   1 
ATOM   2791 C CA  . GLU B 1 158 ? 30.053  -34.248 48.380  1.00 89.68  ? 175 GLU B CA  1 
ATOM   2792 C C   . GLU B 1 158 ? 28.771  -33.409 48.128  1.00 89.13  ? 175 GLU B C   1 
ATOM   2793 O O   . GLU B 1 158 ? 28.841  -32.257 47.664  1.00 73.63  ? 175 GLU B O   1 
ATOM   2794 C CB  . GLU B 1 158 ? 30.261  -35.222 47.210  1.00 96.08  ? 175 GLU B CB  1 
ATOM   2795 C CG  . GLU B 1 158 ? 30.758  -34.620 45.906  1.00 95.75  ? 175 GLU B CG  1 
ATOM   2796 C CD  . GLU B 1 158 ? 32.183  -35.034 45.582  1.00 102.31 ? 175 GLU B CD  1 
ATOM   2797 O OE1 . GLU B 1 158 ? 32.346  -35.935 44.723  1.00 94.91  ? 175 GLU B OE1 1 
ATOM   2798 O OE2 . GLU B 1 158 ? 33.133  -34.468 46.184  1.00 101.73 ? 175 GLU B OE2 1 
ATOM   2799 N N   . GLU B 1 159 ? 27.616  -34.015 48.427  1.00 88.86  ? 176 GLU B N   1 
ATOM   2800 C CA  . GLU B 1 159 ? 26.283  -33.424 48.255  1.00 84.35  ? 176 GLU B CA  1 
ATOM   2801 C C   . GLU B 1 159 ? 26.028  -32.183 49.117  1.00 87.97  ? 176 GLU B C   1 
ATOM   2802 O O   . GLU B 1 159 ? 25.597  -31.125 48.606  1.00 79.20  ? 176 GLU B O   1 
ATOM   2803 C CB  . GLU B 1 159 ? 25.244  -34.449 48.654  1.00 87.85  ? 176 GLU B CB  1 
ATOM   2804 C CG  . GLU B 1 159 ? 24.695  -35.318 47.551  1.00 102.63 ? 176 GLU B CG  1 
ATOM   2805 C CD  . GLU B 1 159 ? 23.365  -35.914 47.977  1.00 112.21 ? 176 GLU B CD  1 
ATOM   2806 O OE1 . GLU B 1 159 ? 23.278  -37.152 48.144  1.00 107.26 ? 176 GLU B OE1 1 
ATOM   2807 O OE2 . GLU B 1 159 ? 22.415  -35.125 48.191  1.00 105.60 ? 176 GLU B OE2 1 
ATOM   2808 N N   . PHE B 1 160 ? 26.247  -32.349 50.430  1.00 82.22  ? 177 PHE B N   1 
ATOM   2809 C CA  . PHE B 1 160 ? 26.099  -31.290 51.429  1.00 78.71  ? 177 PHE B CA  1 
ATOM   2810 C C   . PHE B 1 160 ? 26.966  -30.094 51.061  1.00 79.18  ? 177 PHE B C   1 
ATOM   2811 O O   . PHE B 1 160 ? 26.546  -28.943 51.215  1.00 73.63  ? 177 PHE B O   1 
ATOM   2812 C CB  . PHE B 1 160 ? 26.477  -31.813 52.822  1.00 76.81  ? 177 PHE B CB  1 
ATOM   2813 C CG  . PHE B 1 160 ? 26.747  -30.731 53.847  1.00 84.25  ? 177 PHE B CG  1 
ATOM   2814 C CD1 . PHE B 1 160 ? 28.038  -30.222 54.024  1.00 85.95  ? 177 PHE B CD1 1 
ATOM   2815 C CD2 . PHE B 1 160 ? 25.724  -30.236 54.655  1.00 87.11  ? 177 PHE B CD2 1 
ATOM   2816 C CE1 . PHE B 1 160 ? 28.295  -29.234 54.964  1.00 82.74  ? 177 PHE B CE1 1 
ATOM   2817 C CE2 . PHE B 1 160 ? 25.984  -29.254 55.602  1.00 81.84  ? 177 PHE B CE2 1 
ATOM   2818 C CZ  . PHE B 1 160 ? 27.267  -28.751 55.753  1.00 78.87  ? 177 PHE B CZ  1 
ATOM   2819 N N   . ASN B 1 161 ? 28.171  -30.393 50.573  1.00 81.14  ? 178 ASN B N   1 
ATOM   2820 C CA  . ASN B 1 161 ? 29.164  -29.389 50.204  1.00 87.53  ? 178 ASN B CA  1 
ATOM   2821 C C   . ASN B 1 161 ? 28.776  -28.609 48.958  1.00 85.82  ? 178 ASN B C   1 
ATOM   2822 O O   . ASN B 1 161 ? 29.130  -27.427 48.801  1.00 80.02  ? 178 ASN B O   1 
ATOM   2823 C CB  . ASN B 1 161 ? 30.523  -30.054 50.010  1.00 85.04  ? 178 ASN B CB  1 
ATOM   2824 C CG  . ASN B 1 161 ? 31.143  -30.469 51.320  1.00 94.65  ? 178 ASN B CG  1 
ATOM   2825 O OD1 . ASN B 1 161 ? 30.907  -29.834 52.362  1.00 103.96 ? 178 ASN B OD1 1 
ATOM   2826 N ND2 . ASN B 1 161 ? 31.942  -31.538 51.288  1.00 93.06  ? 178 ASN B ND2 1 
ATOM   2827 N N   . LYS B 1 162 ? 28.052  -29.285 48.072  1.00 85.67  ? 179 LYS B N   1 
ATOM   2828 C CA  . LYS B 1 162 ? 27.513  -28.641 46.903  1.00 83.06  ? 179 LYS B CA  1 
ATOM   2829 C C   . LYS B 1 162 ? 26.268  -27.826 47.299  1.00 81.17  ? 179 LYS B C   1 
ATOM   2830 O O   . LYS B 1 162 ? 26.096  -26.703 46.812  1.00 81.90  ? 179 LYS B O   1 
ATOM   2831 C CB  . LYS B 1 162 ? 27.261  -29.660 45.787  1.00 84.26  ? 179 LYS B CB  1 
ATOM   2832 C CG  . LYS B 1 162 ? 27.773  -29.210 44.417  1.00 102.63 ? 179 LYS B CG  1 
ATOM   2833 C CD  . LYS B 1 162 ? 29.275  -28.881 44.416  1.00 107.05 ? 179 LYS B CD  1 
ATOM   2834 C CE  . LYS B 1 162 ? 29.851  -28.738 43.010  1.00 98.18  ? 179 LYS B CE  1 
ATOM   2835 N NZ  . LYS B 1 162 ? 29.076  -27.767 42.182  1.00 104.24 ? 179 LYS B NZ  1 
ATOM   2836 N N   . ALA B 1 163 ? 25.444  -28.355 48.214  1.00 77.22  ? 180 ALA B N   1 
ATOM   2837 C CA  . ALA B 1 163 ? 24.278  -27.608 48.749  1.00 79.58  ? 180 ALA B CA  1 
ATOM   2838 C C   . ALA B 1 163 ? 24.646  -26.369 49.596  1.00 87.03  ? 180 ALA B C   1 
ATOM   2839 O O   . ALA B 1 163 ? 23.878  -25.394 49.638  1.00 96.89  ? 180 ALA B O   1 
ATOM   2840 C CB  . ALA B 1 163 ? 23.330  -28.525 49.519  1.00 72.29  ? 180 ALA B CB  1 
ATOM   2841 N N   . GLN B 1 164 ? 25.805  -26.415 50.267  1.00 84.18  ? 181 GLN B N   1 
ATOM   2842 C CA  . GLN B 1 164 ? 26.312  -25.290 51.071  1.00 75.59  ? 181 GLN B CA  1 
ATOM   2843 C C   . GLN B 1 164 ? 26.894  -24.189 50.199  1.00 74.67  ? 181 GLN B C   1 
ATOM   2844 O O   . GLN B 1 164 ? 26.606  -23.026 50.425  1.00 80.94  ? 181 GLN B O   1 
ATOM   2845 C CB  . GLN B 1 164 ? 27.370  -25.756 52.086  1.00 78.46  ? 181 GLN B CB  1 
ATOM   2846 C CG  . GLN B 1 164 ? 27.851  -24.668 53.047  1.00 79.87  ? 181 GLN B CG  1 
ATOM   2847 C CD  . GLN B 1 164 ? 28.846  -25.186 54.061  1.00 79.66  ? 181 GLN B CD  1 
ATOM   2848 O OE1 . GLN B 1 164 ? 28.630  -26.219 54.683  1.00 84.48  ? 181 GLN B OE1 1 
ATOM   2849 N NE2 . GLN B 1 164 ? 29.941  -24.473 54.232  1.00 78.53  ? 181 GLN B NE2 1 
ATOM   2850 N N   . THR B 1 165 ? 27.721  -24.570 49.223  1.00 71.46  ? 182 THR B N   1 
ATOM   2851 C CA  . THR B 1 165 ? 28.370  -23.639 48.296  1.00 74.22  ? 182 THR B CA  1 
ATOM   2852 C C   . THR B 1 165 ? 27.309  -22.933 47.457  1.00 82.57  ? 182 THR B C   1 
ATOM   2853 O O   . THR B 1 165 ? 27.440  -21.737 47.203  1.00 73.97  ? 182 THR B O   1 
ATOM   2854 C CB  . THR B 1 165 ? 29.440  -24.348 47.402  1.00 68.25  ? 182 THR B CB  1 
ATOM   2855 O OG1 . THR B 1 165 ? 30.613  -24.592 48.180  1.00 64.03  ? 182 THR B OG1 1 
ATOM   2856 C CG2 . THR B 1 165 ? 29.853  -23.494 46.179  1.00 60.46  ? 182 THR B CG2 1 
ATOM   2857 N N   . VAL B 1 166 ? 26.263  -23.678 47.058  1.00 88.83  ? 183 VAL B N   1 
ATOM   2858 C CA  . VAL B 1 166 ? 25.112  -23.143 46.282  1.00 88.51  ? 183 VAL B CA  1 
ATOM   2859 C C   . VAL B 1 166 ? 24.356  -22.051 47.061  1.00 83.44  ? 183 VAL B C   1 
ATOM   2860 O O   . VAL B 1 166 ? 24.089  -20.965 46.528  1.00 76.70  ? 183 VAL B O   1 
ATOM   2861 C CB  . VAL B 1 166 ? 24.156  -24.280 45.768  1.00 89.71  ? 183 VAL B CB  1 
ATOM   2862 C CG1 . VAL B 1 166 ? 22.703  -23.807 45.611  1.00 75.35  ? 183 VAL B CG1 1 
ATOM   2863 C CG2 . VAL B 1 166 ? 24.678  -24.873 44.457  1.00 84.92  ? 183 VAL B CG2 1 
ATOM   2864 N N   . PHE B 1 167 ? 24.052  -22.340 48.325  1.00 78.88  ? 184 PHE B N   1 
ATOM   2865 C CA  . PHE B 1 167 ? 23.353  -21.402 49.184  1.00 77.73  ? 184 PHE B CA  1 
ATOM   2866 C C   . PHE B 1 167 ? 24.231  -20.247 49.712  1.00 78.76  ? 184 PHE B C   1 
ATOM   2867 O O   . PHE B 1 167 ? 23.732  -19.142 49.916  1.00 78.33  ? 184 PHE B O   1 
ATOM   2868 C CB  . PHE B 1 167 ? 22.640  -22.148 50.319  1.00 73.51  ? 184 PHE B CB  1 
ATOM   2869 C CG  . PHE B 1 167 ? 22.036  -21.237 51.339  1.00 78.77  ? 184 PHE B CG  1 
ATOM   2870 C CD1 . PHE B 1 167 ? 20.837  -20.592 51.085  1.00 79.53  ? 184 PHE B CD1 1 
ATOM   2871 C CD2 . PHE B 1 167 ? 22.686  -20.993 52.542  1.00 75.90  ? 184 PHE B CD2 1 
ATOM   2872 C CE1 . PHE B 1 167 ? 20.289  -19.735 52.015  1.00 74.11  ? 184 PHE B CE1 1 
ATOM   2873 C CE2 . PHE B 1 167 ? 22.134  -20.142 53.479  1.00 77.62  ? 184 PHE B CE2 1 
ATOM   2874 C CZ  . PHE B 1 167 ? 20.938  -19.512 53.211  1.00 75.18  ? 184 PHE B CZ  1 
ATOM   2875 N N   . GLU B 1 168 ? 25.526  -20.493 49.923  1.00 84.50  ? 185 GLU B N   1 
ATOM   2876 C CA  . GLU B 1 168 ? 26.433  -19.457 50.449  1.00 86.49  ? 185 GLU B CA  1 
ATOM   2877 C C   . GLU B 1 168 ? 26.608  -18.324 49.444  1.00 88.60  ? 185 GLU B C   1 
ATOM   2878 O O   . GLU B 1 168 ? 26.737  -17.168 49.851  1.00 93.07  ? 185 GLU B O   1 
ATOM   2879 C CB  . GLU B 1 168 ? 27.814  -20.013 50.879  1.00 83.92  ? 185 GLU B CB  1 
ATOM   2880 C CG  . GLU B 1 168 ? 27.844  -20.971 52.074  1.00 89.56  ? 185 GLU B CG  1 
ATOM   2881 C CD  . GLU B 1 168 ? 27.426  -20.341 53.397  1.00 99.32  ? 185 GLU B CD  1 
ATOM   2882 O OE1 . GLU B 1 168 ? 26.212  -20.340 53.726  1.00 93.76  ? 185 GLU B OE1 1 
ATOM   2883 O OE2 . GLU B 1 168 ? 28.325  -19.868 54.127  1.00 105.59 ? 185 GLU B OE2 1 
ATOM   2884 N N   . ASP B 1 169 ? 26.603  -18.667 48.148  1.00 85.22  ? 186 ASP B N   1 
ATOM   2885 C CA  . ASP B 1 169 ? 26.784  -17.708 47.033  1.00 91.56  ? 186 ASP B CA  1 
ATOM   2886 C C   . ASP B 1 169 ? 25.559  -16.839 46.852  1.00 79.79  ? 186 ASP B C   1 
ATOM   2887 O O   . ASP B 1 169 ? 25.646  -15.616 46.777  1.00 85.24  ? 186 ASP B O   1 
ATOM   2888 C CB  . ASP B 1 169 ? 27.010  -18.432 45.692  1.00 94.25  ? 186 ASP B CB  1 
ATOM   2889 C CG  . ASP B 1 169 ? 28.344  -19.158 45.613  1.00 99.42  ? 186 ASP B CG  1 
ATOM   2890 O OD1 . ASP B 1 169 ? 29.356  -18.657 46.159  1.00 96.30  ? 186 ASP B OD1 1 
ATOM   2891 O OD2 . ASP B 1 169 ? 28.374  -20.234 44.968  1.00 99.56  ? 186 ASP B OD2 1 
ATOM   2892 N N   . LEU B 1 170 ? 24.430  -17.520 46.736  1.00 74.56  ? 187 LEU B N   1 
ATOM   2893 C CA  . LEU B 1 170 ? 23.105  -16.939 46.602  1.00 78.68  ? 187 LEU B CA  1 
ATOM   2894 C C   . LEU B 1 170 ? 22.683  -16.090 47.822  1.00 77.91  ? 187 LEU B C   1 
ATOM   2895 O O   . LEU B 1 170 ? 22.148  -14.975 47.670  1.00 75.76  ? 187 LEU B O   1 
ATOM   2896 C CB  . LEU B 1 170 ? 22.124  -18.095 46.342  1.00 78.28  ? 187 LEU B CB  1 
ATOM   2897 C CG  . LEU B 1 170 ? 20.600  -18.033 46.323  1.00 72.26  ? 187 LEU B CG  1 
ATOM   2898 C CD1 . LEU B 1 170 ? 20.097  -16.864 45.504  1.00 63.37  ? 187 LEU B CD1 1 
ATOM   2899 C CD2 . LEU B 1 170 ? 20.151  -19.348 45.708  1.00 77.46  ? 187 LEU B CD2 1 
ATOM   2900 N N   . ASN B 1 171 ? 22.922  -16.613 49.026  1.00 75.88  ? 188 ASN B N   1 
ATOM   2901 C CA  . ASN B 1 171 ? 22.677  -15.843 50.235  1.00 71.80  ? 188 ASN B CA  1 
ATOM   2902 C C   . ASN B 1 171 ? 23.714  -14.714 50.497  1.00 80.00  ? 188 ASN B C   1 
ATOM   2903 O O   . ASN B 1 171 ? 23.330  -13.561 50.739  1.00 71.67  ? 188 ASN B O   1 
ATOM   2904 C CB  . ASN B 1 171 ? 22.515  -16.752 51.446  1.00 63.96  ? 188 ASN B CB  1 
ATOM   2905 C CG  . ASN B 1 171 ? 22.104  -15.978 52.682  1.00 62.93  ? 188 ASN B CG  1 
ATOM   2906 O OD1 . ASN B 1 171 ? 21.049  -15.331 52.692  1.00 58.61  ? 188 ASN B OD1 1 
ATOM   2907 N ND2 . ASN B 1 171 ? 22.953  -15.994 53.710  1.00 50.13  ? 188 ASN B ND2 1 
ATOM   2908 N N   . GLN B 1 172 ? 25.008  -15.041 50.426  1.00 88.60  ? 189 GLN B N   1 
ATOM   2909 C CA  . GLN B 1 172 ? 26.079  -14.040 50.566  1.00 98.05  ? 189 GLN B CA  1 
ATOM   2910 C C   . GLN B 1 172 ? 25.968  -12.900 49.540  1.00 103.69 ? 189 GLN B C   1 
ATOM   2911 O O   . GLN B 1 172 ? 26.120  -11.727 49.902  1.00 110.50 ? 189 GLN B O   1 
ATOM   2912 C CB  . GLN B 1 172 ? 27.469  -14.681 50.480  1.00 103.69 ? 189 GLN B CB  1 
ATOM   2913 C CG  . GLN B 1 172 ? 28.610  -13.710 50.778  1.00 115.97 ? 189 GLN B CG  1 
ATOM   2914 C CD  . GLN B 1 172 ? 29.774  -13.813 49.800  1.00 119.63 ? 189 GLN B CD  1 
ATOM   2915 O OE1 . GLN B 1 172 ? 30.181  -14.914 49.407  1.00 120.23 ? 189 GLN B OE1 1 
ATOM   2916 N NE2 . GLN B 1 172 ? 30.327  -12.655 49.411  1.00 101.70 ? 189 GLN B NE2 1 
ATOM   2917 N N   . GLU B 1 173 ? 25.722  -13.250 48.273  1.00 100.44 ? 190 GLU B N   1 
ATOM   2918 C CA  . GLU B 1 173 ? 25.451  -12.256 47.224  1.00 93.26  ? 190 GLU B CA  1 
ATOM   2919 C C   . GLU B 1 173 ? 24.088  -11.548 47.391  1.00 92.53  ? 190 GLU B C   1 
ATOM   2920 O O   . GLU B 1 173 ? 23.977  -10.348 47.111  1.00 79.82  ? 190 GLU B O   1 
ATOM   2921 C CB  . GLU B 1 173 ? 25.574  -12.871 45.823  1.00 94.92  ? 190 GLU B CB  1 
ATOM   2922 C CG  . GLU B 1 173 ? 26.996  -12.939 45.267  1.00 100.02 ? 190 GLU B CG  1 
ATOM   2923 C CD  . GLU B 1 173 ? 27.068  -13.626 43.903  1.00 102.15 ? 190 GLU B CD  1 
ATOM   2924 O OE1 . GLU B 1 173 ? 26.981  -14.874 43.854  1.00 112.61 ? 190 GLU B OE1 1 
ATOM   2925 O OE2 . GLU B 1 173 ? 27.219  -12.926 42.873  1.00 86.45  ? 190 GLU B OE2 1 
ATOM   2926 N N   . LEU B 1 174 ? 23.059  -12.271 47.850  1.00 87.04  ? 191 LEU B N   1 
ATOM   2927 C CA  . LEU B 1 174 ? 21.764  -11.631 48.118  1.00 82.22  ? 191 LEU B CA  1 
ATOM   2928 C C   . LEU B 1 174 ? 21.810  -10.701 49.334  1.00 83.69  ? 191 LEU B C   1 
ATOM   2929 O O   . LEU B 1 174 ? 21.103  -9.697  49.375  1.00 89.29  ? 191 LEU B O   1 
ATOM   2930 C CB  . LEU B 1 174 ? 20.616  -12.654 48.238  1.00 86.06  ? 191 LEU B CB  1 
ATOM   2931 C CG  . LEU B 1 174 ? 19.153  -12.211 47.972  1.00 83.99  ? 191 LEU B CG  1 
ATOM   2932 C CD1 . LEU B 1 174 ? 18.966  -11.572 46.597  1.00 79.56  ? 191 LEU B CD1 1 
ATOM   2933 C CD2 . LEU B 1 174 ? 18.151  -13.349 48.157  1.00 78.72  ? 191 LEU B CD2 1 
ATOM   2934 N N   . LEU B 1 175 ? 22.663  -11.022 50.305  1.00 96.93  ? 192 LEU B N   1 
ATOM   2935 C CA  . LEU B 1 175 ? 22.726  -10.287 51.583  1.00 86.84  ? 192 LEU B CA  1 
ATOM   2936 C C   . LEU B 1 175 ? 23.360  -8.892  51.462  1.00 80.44  ? 192 LEU B C   1 
ATOM   2937 O O   . LEU B 1 175 ? 23.023  -7.982  52.232  1.00 75.21  ? 192 LEU B O   1 
ATOM   2938 C CB  . LEU B 1 175 ? 23.464  -11.132 52.620  1.00 79.29  ? 192 LEU B CB  1 
ATOM   2939 C CG  . LEU B 1 175 ? 22.972  -11.111 54.066  1.00 84.94  ? 192 LEU B CG  1 
ATOM   2940 C CD1 . LEU B 1 175 ? 21.448  -10.955 54.210  1.00 76.12  ? 192 LEU B CD1 1 
ATOM   2941 C CD2 . LEU B 1 175 ? 23.499  -12.369 54.755  1.00 83.20  ? 192 LEU B CD2 1 
ATOM   2942 N N   . GLU B 1 176 ? 24.277  -8.750  50.504  1.00 66.26  ? 193 GLU B N   1 
ATOM   2943 C CA  . GLU B 1 176 ? 24.877  -7.466  50.142  1.00 78.93  ? 193 GLU B CA  1 
ATOM   2944 C C   . GLU B 1 176 ? 24.023  -6.634  49.156  1.00 85.16  ? 193 GLU B C   1 
ATOM   2945 O O   . GLU B 1 176 ? 24.018  -5.409  49.243  1.00 86.80  ? 193 GLU B O   1 
ATOM   2946 C CB  . GLU B 1 176 ? 26.276  -7.677  49.553  1.00 80.57  ? 193 GLU B CB  1 
ATOM   2947 C CG  . GLU B 1 176 ? 27.246  -8.376  50.493  1.00 95.78  ? 193 GLU B CG  1 
ATOM   2948 C CD  . GLU B 1 176 ? 28.226  -9.288  49.768  1.00 106.64 ? 193 GLU B CD  1 
ATOM   2949 O OE1 . GLU B 1 176 ? 28.855  -10.135 50.440  1.00 109.91 ? 193 GLU B OE1 1 
ATOM   2950 O OE2 . GLU B 1 176 ? 28.368  -9.170  48.529  1.00 107.52 ? 193 GLU B OE2 1 
ATOM   2951 N N   . GLU B 1 177 ? 23.315  -7.304  48.238  1.00 83.21  ? 194 GLU B N   1 
ATOM   2952 C CA  . GLU B 1 177 ? 22.485  -6.659  47.195  1.00 81.25  ? 194 GLU B CA  1 
ATOM   2953 C C   . GLU B 1 177 ? 21.184  -5.931  47.676  1.00 73.27  ? 194 GLU B C   1 
ATOM   2954 O O   . GLU B 1 177 ? 20.947  -4.782  47.317  1.00 68.25  ? 194 GLU B O   1 
ATOM   2955 C CB  . GLU B 1 177 ? 22.233  -7.632  46.016  1.00 80.19  ? 194 GLU B CB  1 
ATOM   2956 C CG  . GLU B 1 177 ? 23.339  -7.594  44.944  1.00 88.62  ? 194 GLU B CG  1 
ATOM   2957 C CD  . GLU B 1 177 ? 23.568  -8.907  44.152  1.00 97.12  ? 194 GLU B CD  1 
ATOM   2958 O OE1 . GLU B 1 177 ? 22.938  -9.947  44.468  1.00 101.29 ? 194 GLU B OE1 1 
ATOM   2959 O OE2 . GLU B 1 177 ? 24.400  -8.914  43.197  1.00 81.30  ? 194 GLU B OE2 1 
ATOM   2960 N N   . LEU B 1 178 ? 20.361  -6.562  48.502  1.00 68.34  ? 195 LEU B N   1 
ATOM   2961 C CA  . LEU B 1 178 ? 19.173  -5.872  49.054  1.00 65.42  ? 195 LEU B CA  1 
ATOM   2962 C C   . LEU B 1 178 ? 19.384  -4.450  49.657  1.00 73.41  ? 195 LEU B C   1 
ATOM   2963 O O   . LEU B 1 178 ? 18.596  -3.527  49.383  1.00 76.63  ? 195 LEU B O   1 
ATOM   2964 C CB  . LEU B 1 178 ? 18.466  -6.762  50.078  1.00 56.41  ? 195 LEU B CB  1 
ATOM   2965 C CG  . LEU B 1 178 ? 17.629  -7.911  49.516  1.00 55.50  ? 195 LEU B CG  1 
ATOM   2966 C CD1 . LEU B 1 178 ? 17.661  -9.119  50.441  1.00 52.35  ? 195 LEU B CD1 1 
ATOM   2967 C CD2 . LEU B 1 178 ? 16.197  -7.458  49.278  1.00 48.41  ? 195 LEU B CD2 1 
ATOM   2968 N N   . PRO B 1 179 ? 20.425  -4.268  50.502  1.00 77.00  ? 196 PRO B N   1 
ATOM   2969 C CA  . PRO B 1 179 ? 20.542  -2.947  51.141  1.00 71.68  ? 196 PRO B CA  1 
ATOM   2970 C C   . PRO B 1 179 ? 21.096  -1.877  50.192  1.00 63.35  ? 196 PRO B C   1 
ATOM   2971 O O   . PRO B 1 179 ? 20.629  -0.723  50.199  1.00 72.41  ? 196 PRO B O   1 
ATOM   2972 C CB  . PRO B 1 179 ? 21.511  -3.209  52.315  1.00 77.12  ? 196 PRO B CB  1 
ATOM   2973 C CG  . PRO B 1 179 ? 21.630  -4.696  52.433  1.00 69.29  ? 196 PRO B CG  1 
ATOM   2974 C CD  . PRO B 1 179 ? 21.427  -5.211  51.043  1.00 69.49  ? 196 PRO B CD  1 
ATOM   2975 N N   . ILE B 1 180 ? 22.087  -2.259  49.391  1.00 55.33  ? 197 ILE B N   1 
ATOM   2976 C CA  . ILE B 1 180 ? 22.512  -1.458  48.244  1.00 53.58  ? 197 ILE B CA  1 
ATOM   2977 C C   . ILE B 1 180 ? 21.275  -0.938  47.487  1.00 48.76  ? 197 ILE B C   1 
ATOM   2978 O O   . ILE B 1 180 ? 21.182  0.260   47.198  1.00 44.81  ? 197 ILE B O   1 
ATOM   2979 C CB  . ILE B 1 180 ? 23.413  -2.262  47.250  1.00 53.76  ? 197 ILE B CB  1 
ATOM   2980 C CG1 . ILE B 1 180 ? 24.684  -2.814  47.933  1.00 55.94  ? 197 ILE B CG1 1 
ATOM   2981 C CG2 . ILE B 1 180 ? 23.822  -1.392  46.051  1.00 43.98  ? 197 ILE B CG2 1 
ATOM   2982 C CD1 . ILE B 1 180 ? 25.525  -3.713  47.022  1.00 56.10  ? 197 ILE B CD1 1 
ATOM   2983 N N   . LEU B 1 181 ? 20.340  -1.844  47.182  1.00 43.18  ? 198 LEU B N   1 
ATOM   2984 C CA  . LEU B 1 181 ? 19.157  -1.494  46.434  1.00 45.73  ? 198 LEU B CA  1 
ATOM   2985 C C   . LEU B 1 181 ? 18.220  -0.582  47.261  1.00 48.96  ? 198 LEU B C   1 
ATOM   2986 O O   . LEU B 1 181 ? 17.736  0.459   46.744  1.00 49.32  ? 198 LEU B O   1 
ATOM   2987 C CB  . LEU B 1 181 ? 18.447  -2.734  45.851  1.00 45.11  ? 198 LEU B CB  1 
ATOM   2988 C CG  . LEU B 1 181 ? 17.113  -2.397  45.148  1.00 45.65  ? 198 LEU B CG  1 
ATOM   2989 C CD1 . LEU B 1 181 ? 17.356  -1.712  43.808  1.00 40.09  ? 198 LEU B CD1 1 
ATOM   2990 C CD2 . LEU B 1 181 ? 16.247  -3.641  44.997  1.00 38.42  ? 198 LEU B CD2 1 
ATOM   2991 N N   . TYR B 1 182 ? 18.006  -0.925  48.536  1.00 41.76  ? 199 TYR B N   1 
ATOM   2992 C CA  . TYR B 1 182 ? 17.229  -0.025  49.379  1.00 41.63  ? 199 TYR B CA  1 
ATOM   2993 C C   . TYR B 1 182 ? 17.812  1.432   49.418  1.00 42.34  ? 199 TYR B C   1 
ATOM   2994 O O   . TYR B 1 182 ? 17.060  2.406   49.333  1.00 37.23  ? 199 TYR B O   1 
ATOM   2995 C CB  . TYR B 1 182 ? 17.093  -0.560  50.792  1.00 38.79  ? 199 TYR B CB  1 
ATOM   2996 C CG  . TYR B 1 182 ? 15.919  0.086   51.508  1.00 42.99  ? 199 TYR B CG  1 
ATOM   2997 C CD1 . TYR B 1 182 ? 14.643  -0.085  51.018  1.00 48.31  ? 199 TYR B CD1 1 
ATOM   2998 C CD2 . TYR B 1 182 ? 16.080  0.895   52.661  1.00 43.65  ? 199 TYR B CD2 1 
ATOM   2999 C CE1 . TYR B 1 182 ? 13.541  0.479   51.633  1.00 50.25  ? 199 TYR B CE1 1 
ATOM   3000 C CE2 . TYR B 1 182 ? 14.973  1.459   53.289  1.00 44.14  ? 199 TYR B CE2 1 
ATOM   3001 C CZ  . TYR B 1 182 ? 13.697  1.238   52.768  1.00 49.48  ? 199 TYR B CZ  1 
ATOM   3002 O OH  . TYR B 1 182 ? 12.514  1.756   53.302  1.00 51.32  ? 199 TYR B OH  1 
ATOM   3003 N N   . ASN B 1 183 ? 19.138  1.556   49.544  1.00 39.21  ? 200 ASN B N   1 
ATOM   3004 C CA  . ASN B 1 183 ? 19.799  2.859   49.629  1.00 42.60  ? 200 ASN B CA  1 
ATOM   3005 C C   . ASN B 1 183 ? 19.774  3.612   48.305  1.00 49.39  ? 200 ASN B C   1 
ATOM   3006 O O   . ASN B 1 183 ? 19.893  4.838   48.329  1.00 56.85  ? 200 ASN B O   1 
ATOM   3007 C CB  . ASN B 1 183 ? 21.242  2.703   50.139  1.00 47.16  ? 200 ASN B CB  1 
ATOM   3008 C CG  . ASN B 1 183 ? 22.008  4.032   50.272  1.00 51.82  ? 200 ASN B CG  1 
ATOM   3009 O OD1 . ASN B 1 183 ? 22.095  4.601   51.357  1.00 54.37  ? 200 ASN B OD1 1 
ATOM   3010 N ND2 . ASN B 1 183 ? 22.620  4.489   49.182  1.00 50.71  ? 200 ASN B ND2 1 
ATOM   3011 N N   . SER B 1 184 ? 19.593  2.908   47.169  1.00 42.32  ? 201 SER B N   1 
ATOM   3012 C CA  . SER B 1 184 ? 19.503  3.585   45.870  1.00 37.60  ? 201 SER B CA  1 
ATOM   3013 C C   . SER B 1 184 ? 18.193  4.384   45.653  1.00 36.26  ? 201 SER B C   1 
ATOM   3014 O O   . SER B 1 184 ? 18.088  5.144   44.725  1.00 39.21  ? 201 SER B O   1 
ATOM   3015 C CB  . SER B 1 184 ? 19.729  2.628   44.703  1.00 33.37  ? 201 SER B CB  1 
ATOM   3016 O OG  . SER B 1 184 ? 18.592  1.748   44.568  1.00 33.28  ? 201 SER B OG  1 
ATOM   3017 N N   . ARG B 1 185 ? 17.209  4.225   46.511  1.00 34.99  ? 202 ARG B N   1 
ATOM   3018 C CA  . ARG B 1 185 ? 15.853  4.713   46.220  1.00 36.80  ? 202 ARG B CA  1 
ATOM   3019 C C   . ARG B 1 185 ? 15.772  6.276   46.088  1.00 38.33  ? 202 ARG B C   1 
ATOM   3020 O O   . ARG B 1 185 ? 15.175  6.821   45.177  1.00 35.57  ? 202 ARG B O   1 
ATOM   3021 C CB  . ARG B 1 185 ? 14.938  4.101   47.298  1.00 36.15  ? 202 ARG B CB  1 
ATOM   3022 C CG  . ARG B 1 185 ? 13.515  4.601   47.393  1.00 40.56  ? 202 ARG B CG  1 
ATOM   3023 C CD  . ARG B 1 185 ? 12.891  4.006   48.633  1.00 34.91  ? 202 ARG B CD  1 
ATOM   3024 N NE  . ARG B 1 185 ? 13.454  4.600   49.834  1.00 39.78  ? 202 ARG B NE  1 
ATOM   3025 C CZ  . ARG B 1 185 ? 12.817  5.469   50.625  1.00 45.95  ? 202 ARG B CZ  1 
ATOM   3026 N NH1 . ARG B 1 185 ? 11.564  5.869   50.364  1.00 44.23  ? 202 ARG B NH1 1 
ATOM   3027 N NH2 . ARG B 1 185 ? 13.428  5.952   51.704  1.00 48.97  ? 202 ARG B NH2 1 
ATOM   3028 N N   . ILE B 1 186 ? 16.438  6.982   46.991  1.00 41.74  ? 203 ILE B N   1 
ATOM   3029 C CA  . ILE B 1 186 ? 16.476  8.433   47.005  1.00 37.82  ? 203 ILE B CA  1 
ATOM   3030 C C   . ILE B 1 186 ? 17.171  9.073   45.801  1.00 37.14  ? 203 ILE B C   1 
ATOM   3031 O O   . ILE B 1 186 ? 16.682  10.084  45.270  1.00 41.02  ? 203 ILE B O   1 
ATOM   3032 C CB  . ILE B 1 186 ? 17.081  8.913   48.327  1.00 39.34  ? 203 ILE B CB  1 
ATOM   3033 C CG1 . ILE B 1 186 ? 16.112  8.582   49.476  1.00 40.66  ? 203 ILE B CG1 1 
ATOM   3034 C CG2 . ILE B 1 186 ? 17.327  10.411  48.326  1.00 34.43  ? 203 ILE B CG2 1 
ATOM   3035 C CD1 . ILE B 1 186 ? 16.845  8.468   50.804  1.00 47.95  ? 203 ILE B CD1 1 
ATOM   3036 N N   . GLY B 1 187 ? 18.269  8.476   45.350  1.00 37.76  ? 204 GLY B N   1 
ATOM   3037 C CA  . GLY B 1 187 ? 19.058  8.970   44.188  1.00 31.96  ? 204 GLY B CA  1 
ATOM   3038 C C   . GLY B 1 187 ? 18.248  8.886   42.914  1.00 33.28  ? 204 GLY B C   1 
ATOM   3039 O O   . GLY B 1 187 ? 18.281  9.789   42.045  1.00 43.54  ? 204 GLY B O   1 
ATOM   3040 N N   . CYS B 1 188 ? 17.507  7.806   42.797  1.00 29.91  ? 205 CYS B N   1 
ATOM   3041 C CA  . CYS B 1 188 ? 16.643  7.602   41.652  1.00 34.67  ? 205 CYS B CA  1 
ATOM   3042 C C   . CYS B 1 188 ? 15.464  8.587   41.650  1.00 33.51  ? 205 CYS B C   1 
ATOM   3043 O O   . CYS B 1 188 ? 15.199  9.197   40.637  1.00 38.09  ? 205 CYS B O   1 
ATOM   3044 C CB  . CYS B 1 188 ? 16.231  6.117   41.522  1.00 37.87  ? 205 CYS B CB  1 
ATOM   3045 S SG  . CYS B 1 188 ? 14.604  5.756   40.833  1.00 46.02  ? 205 CYS B SG  1 
ATOM   3046 N N   . TYR B 1 189 ? 14.772  8.754   42.772  1.00 33.19  ? 206 TYR B N   1 
ATOM   3047 C CA  . TYR B 1 189 ? 13.764  9.791   42.904  1.00 33.45  ? 206 TYR B CA  1 
ATOM   3048 C C   . TYR B 1 189 ? 14.338  11.181  42.606  1.00 34.89  ? 206 TYR B C   1 
ATOM   3049 O O   . TYR B 1 189 ? 13.725  11.956  41.888  1.00 39.26  ? 206 TYR B O   1 
ATOM   3050 C CB  . TYR B 1 189 ? 13.124  9.780   44.295  1.00 38.00  ? 206 TYR B CB  1 
ATOM   3051 C CG  . TYR B 1 189 ? 12.395  8.491   44.701  1.00 41.91  ? 206 TYR B CG  1 
ATOM   3052 C CD1 . TYR B 1 189 ? 11.997  7.531   43.742  1.00 37.68  ? 206 TYR B CD1 1 
ATOM   3053 C CD2 . TYR B 1 189 ? 12.045  8.264   46.043  1.00 39.96  ? 206 TYR B CD2 1 
ATOM   3054 C CE1 . TYR B 1 189 ? 11.341  6.387   44.106  1.00 34.38  ? 206 TYR B CE1 1 
ATOM   3055 C CE2 . TYR B 1 189 ? 11.365  7.103   46.415  1.00 37.59  ? 206 TYR B CE2 1 
ATOM   3056 C CZ  . TYR B 1 189 ? 11.019  6.172   45.439  1.00 39.53  ? 206 TYR B CZ  1 
ATOM   3057 O OH  . TYR B 1 189 ? 10.329  5.010   45.788  1.00 41.87  ? 206 TYR B OH  1 
ATOM   3058 N N   . VAL B 1 190 ? 15.503  11.498  43.152  1.00 34.75  ? 207 VAL B N   1 
ATOM   3059 C CA  . VAL B 1 190 ? 16.168  12.768  42.810  1.00 34.57  ? 207 VAL B CA  1 
ATOM   3060 C C   . VAL B 1 190 ? 16.427  12.899  41.274  1.00 41.22  ? 207 VAL B C   1 
ATOM   3061 O O   . VAL B 1 190 ? 15.990  13.887  40.653  1.00 47.49  ? 207 VAL B O   1 
ATOM   3062 C CB  . VAL B 1 190 ? 17.473  12.974  43.649  1.00 31.20  ? 207 VAL B CB  1 
ATOM   3063 C CG1 . VAL B 1 190 ? 18.285  14.193  43.191  1.00 23.98  ? 207 VAL B CG1 1 
ATOM   3064 C CG2 . VAL B 1 190 ? 17.120  13.075  45.137  1.00 25.37  ? 207 VAL B CG2 1 
ATOM   3065 N N   . THR B 1 191 ? 17.104  11.915  40.650  1.00 38.97  ? 208 THR B N   1 
ATOM   3066 C CA  . THR B 1 191 ? 17.369  11.987  39.206  1.00 32.46  ? 208 THR B CA  1 
ATOM   3067 C C   . THR B 1 191 ? 16.104  12.257  38.437  1.00 34.19  ? 208 THR B C   1 
ATOM   3068 O O   . THR B 1 191 ? 16.065  13.215  37.676  1.00 35.18  ? 208 THR B O   1 
ATOM   3069 C CB  . THR B 1 191 ? 17.971  10.699  38.700  1.00 35.08  ? 208 THR B CB  1 
ATOM   3070 O OG1 . THR B 1 191 ? 19.284  10.642  39.200  1.00 39.60  ? 208 THR B OG1 1 
ATOM   3071 C CG2 . THR B 1 191 ? 18.013  10.608  37.134  1.00 31.99  ? 208 THR B CG2 1 
ATOM   3072 N N   . ILE B 1 192 ? 15.081  11.426  38.672  1.00 32.62  ? 209 ILE B N   1 
ATOM   3073 C CA  . ILE B 1 192 ? 13.774  11.560  38.072  1.00 35.78  ? 209 ILE B CA  1 
ATOM   3074 C C   . ILE B 1 192 ? 13.115  12.964  38.187  1.00 38.99  ? 209 ILE B C   1 
ATOM   3075 O O   . ILE B 1 192 ? 12.668  13.527  37.183  1.00 48.84  ? 209 ILE B O   1 
ATOM   3076 C CB  . ILE B 1 192 ? 12.850  10.454  38.613  1.00 37.56  ? 209 ILE B CB  1 
ATOM   3077 C CG1 . ILE B 1 192 ? 13.309  9.106   38.076  1.00 36.54  ? 209 ILE B CG1 1 
ATOM   3078 C CG2 . ILE B 1 192 ? 11.390  10.690  38.239  1.00 36.12  ? 209 ILE B CG2 1 
ATOM   3079 C CD1 . ILE B 1 192 ? 12.396  7.990   38.489  1.00 37.83  ? 209 ILE B CD1 1 
ATOM   3080 N N   . PHE B 1 193 ? 13.067  13.537  39.374  1.00 38.95  ? 210 PHE B N   1 
ATOM   3081 C CA  . PHE B 1 193 ? 12.418  14.837  39.551  1.00 42.06  ? 210 PHE B CA  1 
ATOM   3082 C C   . PHE B 1 193 ? 13.243  16.041  39.030  1.00 43.76  ? 210 PHE B C   1 
ATOM   3083 O O   . PHE B 1 193 ? 12.679  17.080  38.636  1.00 41.24  ? 210 PHE B O   1 
ATOM   3084 C CB  . PHE B 1 193 ? 11.971  15.013  41.020  1.00 40.38  ? 210 PHE B CB  1 
ATOM   3085 C CG  . PHE B 1 193 ? 10.729  14.277  41.326  1.00 39.90  ? 210 PHE B CG  1 
ATOM   3086 C CD1 . PHE B 1 193 ? 9.486   14.855  41.023  1.00 38.79  ? 210 PHE B CD1 1 
ATOM   3087 C CD2 . PHE B 1 193 ? 10.779  12.952  41.799  1.00 38.81  ? 210 PHE B CD2 1 
ATOM   3088 C CE1 . PHE B 1 193 ? 8.296   14.143  41.225  1.00 39.91  ? 210 PHE B CE1 1 
ATOM   3089 C CE2 . PHE B 1 193 ? 9.595   12.239  41.987  1.00 37.41  ? 210 PHE B CE2 1 
ATOM   3090 C CZ  . PHE B 1 193 ? 8.355   12.839  41.712  1.00 38.24  ? 210 PHE B CZ  1 
ATOM   3091 N N   . GLN B 1 194 ? 14.563  15.925  39.011  1.00 39.22  ? 211 GLN B N   1 
ATOM   3092 C CA  . GLN B 1 194 ? 15.328  16.990  38.350  1.00 42.57  ? 211 GLN B CA  1 
ATOM   3093 C C   . GLN B 1 194 ? 15.124  16.911  36.828  1.00 44.02  ? 211 GLN B C   1 
ATOM   3094 O O   . GLN B 1 194 ? 14.934  17.944  36.144  1.00 54.52  ? 211 GLN B O   1 
ATOM   3095 C CB  . GLN B 1 194 ? 16.802  16.960  38.721  1.00 38.99  ? 211 GLN B CB  1 
ATOM   3096 C CG  . GLN B 1 194 ? 17.091  17.115  40.220  1.00 38.82  ? 211 GLN B CG  1 
ATOM   3097 C CD  . GLN B 1 194 ? 18.561  16.826  40.547  1.00 45.03  ? 211 GLN B CD  1 
ATOM   3098 O OE1 . GLN B 1 194 ? 19.195  15.970  39.910  1.00 46.46  ? 211 GLN B OE1 1 
ATOM   3099 N NE2 . GLN B 1 194 ? 19.108  17.536  41.536  1.00 40.25  ? 211 GLN B NE2 1 
ATOM   3100 N N   . ASN B 1 195 ? 15.122  15.695  36.293  1.00 40.82  ? 212 ASN B N   1 
ATOM   3101 C CA  . ASN B 1 195 ? 14.825  15.526  34.884  1.00 39.45  ? 212 ASN B CA  1 
ATOM   3102 C C   . ASN B 1 195 ? 13.492  16.155  34.477  1.00 39.97  ? 212 ASN B C   1 
ATOM   3103 O O   . ASN B 1 195 ? 13.453  16.896  33.522  1.00 43.90  ? 212 ASN B O   1 
ATOM   3104 C CB  . ASN B 1 195 ? 14.863  14.064  34.495  1.00 42.65  ? 212 ASN B CB  1 
ATOM   3105 C CG  . ASN B 1 195 ? 16.260  13.479  34.582  1.00 45.15  ? 212 ASN B CG  1 
ATOM   3106 O OD1 . ASN B 1 195 ? 17.234  14.229  34.742  1.00 42.92  ? 212 ASN B OD1 1 
ATOM   3107 N ND2 . ASN B 1 195 ? 16.372  12.127  34.464  1.00 41.16  ? 212 ASN B ND2 1 
ATOM   3108 N N   . ILE B 1 196 ? 12.417  15.870  35.202  1.00 38.13  ? 213 ILE B N   1 
ATOM   3109 C CA  . ILE B 1 196 ? 11.140  16.540  34.987  1.00 37.71  ? 213 ILE B CA  1 
ATOM   3110 C C   . ILE B 1 196 ? 11.248  18.074  35.038  1.00 41.43  ? 213 ILE B C   1 
ATOM   3111 O O   . ILE B 1 196 ? 10.734  18.763  34.128  1.00 46.30  ? 213 ILE B O   1 
ATOM   3112 C CB  . ILE B 1 196 ? 10.028  15.981  35.918  1.00 37.94  ? 213 ILE B CB  1 
ATOM   3113 C CG1 . ILE B 1 196 ? 9.807   14.509  35.565  1.00 34.83  ? 213 ILE B CG1 1 
ATOM   3114 C CG2 . ILE B 1 196 ? 8.704   16.758  35.795  1.00 32.48  ? 213 ILE B CG2 1 
ATOM   3115 C CD1 . ILE B 1 196 ? 9.140   13.677  36.634  1.00 33.18  ? 213 ILE B CD1 1 
ATOM   3116 N N   . SER B 1 197 ? 11.923  18.617  36.050  1.00 38.97  ? 214 SER B N   1 
ATOM   3117 C CA  . SER B 1 197 ? 12.013  20.092  36.180  1.00 38.19  ? 214 SER B CA  1 
ATOM   3118 C C   . SER B 1 197 ? 12.784  20.705  35.059  1.00 38.32  ? 214 SER B C   1 
ATOM   3119 O O   . SER B 1 197 ? 12.369  21.713  34.507  1.00 50.41  ? 214 SER B O   1 
ATOM   3120 C CB  . SER B 1 197 ? 12.586  20.510  37.515  1.00 39.99  ? 214 SER B CB  1 
ATOM   3121 O OG  . SER B 1 197 ? 11.767  19.919  38.501  1.00 47.23  ? 214 SER B OG  1 
ATOM   3122 N N   . ASN B 1 198 ? 13.860  20.062  34.652  1.00 38.15  ? 215 ASN B N   1 
ATOM   3123 C CA  . ASN B 1 198 ? 14.553  20.528  33.472  1.00 37.25  ? 215 ASN B CA  1 
ATOM   3124 C C   . ASN B 1 198 ? 13.762  20.587  32.210  1.00 37.32  ? 215 ASN B C   1 
ATOM   3125 O O   . ASN B 1 198 ? 13.828  21.566  31.483  1.00 42.27  ? 215 ASN B O   1 
ATOM   3126 C CB  . ASN B 1 198 ? 15.877  19.820  33.335  1.00 38.82  ? 215 ASN B CB  1 
ATOM   3127 C CG  . ASN B 1 198 ? 16.805  20.257  34.436  1.00 42.69  ? 215 ASN B CG  1 
ATOM   3128 O OD1 . ASN B 1 198 ? 16.442  21.171  35.202  1.00 47.52  ? 215 ASN B OD1 1 
ATOM   3129 N ND2 . ASN B 1 198 ? 17.963  19.637  34.553  1.00 38.23  ? 215 ASN B ND2 1 
ATOM   3130 N N   . LEU B 1 199 ? 12.958  19.553  31.986  1.00 38.91  ? 216 LEU B N   1 
ATOM   3131 C CA  . LEU B 1 199 ? 12.092  19.446  30.810  1.00 33.50  ? 216 LEU B CA  1 
ATOM   3132 C C   . LEU B 1 199 ? 11.016  20.494  30.915  1.00 35.43  ? 216 LEU B C   1 
ATOM   3133 O O   . LEU B 1 199 ? 10.615  21.084  29.918  1.00 31.16  ? 216 LEU B O   1 
ATOM   3134 C CB  . LEU B 1 199 ? 11.394  18.054  30.752  1.00 31.52  ? 216 LEU B CB  1 
ATOM   3135 C CG  . LEU B 1 199 ? 12.393  16.891  30.609  1.00 34.89  ? 216 LEU B CG  1 
ATOM   3136 C CD1 . LEU B 1 199 ? 11.783  15.479  30.528  1.00 28.63  ? 216 LEU B CD1 1 
ATOM   3137 C CD2 . LEU B 1 199 ? 13.318  17.235  29.417  1.00 31.16  ? 216 LEU B CD2 1 
ATOM   3138 N N   . ARG B 1 200 ? 10.500  20.702  32.118  1.00 35.10  ? 217 ARG B N   1 
ATOM   3139 C CA  . ARG B 1 200 ? 9.373   21.617  32.236  1.00 40.41  ? 217 ARG B CA  1 
ATOM   3140 C C   . ARG B 1 200 ? 9.835   23.039  32.093  1.00 37.88  ? 217 ARG B C   1 
ATOM   3141 O O   . ARG B 1 200 ? 9.176   23.853  31.463  1.00 38.23  ? 217 ARG B O   1 
ATOM   3142 C CB  . ARG B 1 200 ? 8.610   21.397  33.534  1.00 39.81  ? 217 ARG B CB  1 
ATOM   3143 C CG  . ARG B 1 200 ? 7.493   20.431  33.309  1.00 45.98  ? 217 ARG B CG  1 
ATOM   3144 C CD  . ARG B 1 200 ? 7.284   19.505  34.487  1.00 59.13  ? 217 ARG B CD  1 
ATOM   3145 N NE  . ARG B 1 200 ? 7.024   20.234  35.711  1.00 55.26  ? 217 ARG B NE  1 
ATOM   3146 C CZ  . ARG B 1 200 ? 5.893   20.867  35.956  1.00 61.34  ? 217 ARG B CZ  1 
ATOM   3147 N NH1 . ARG B 1 200 ? 4.903   20.870  35.056  1.00 61.89  ? 217 ARG B NH1 1 
ATOM   3148 N NH2 . ARG B 1 200 ? 5.763   21.511  37.100  1.00 62.55  ? 217 ARG B NH2 1 
ATOM   3149 N N   . ASP B 1 201 ? 11.010  23.298  32.636  1.00 39.80  ? 218 ASP B N   1 
ATOM   3150 C CA  . ASP B 1 201 ? 11.641  24.605  32.504  1.00 44.35  ? 218 ASP B CA  1 
ATOM   3151 C C   . ASP B 1 201 ? 11.728  25.047  31.072  1.00 40.54  ? 218 ASP B C   1 
ATOM   3152 O O   . ASP B 1 201 ? 11.374  26.159  30.709  1.00 40.64  ? 218 ASP B O   1 
ATOM   3153 C CB  . ASP B 1 201 ? 13.055  24.583  33.078  1.00 47.78  ? 218 ASP B CB  1 
ATOM   3154 C CG  . ASP B 1 201 ? 13.678  25.948  33.077  1.00 56.59  ? 218 ASP B CG  1 
ATOM   3155 O OD1 . ASP B 1 201 ? 13.165  26.815  33.817  1.00 60.18  ? 218 ASP B OD1 1 
ATOM   3156 O OD2 . ASP B 1 201 ? 14.667  26.159  32.342  1.00 64.75  ? 218 ASP B OD2 1 
ATOM   3157 N N   . VAL B 1 202 ? 12.245  24.158  30.253  1.00 42.80  ? 219 VAL B N   1 
ATOM   3158 C CA  . VAL B 1 202 ? 12.438  24.461  28.861  1.00 42.34  ? 219 VAL B CA  1 
ATOM   3159 C C   . VAL B 1 202 ? 11.098  24.611  28.153  1.00 37.71  ? 219 VAL B C   1 
ATOM   3160 O O   . VAL B 1 202 ? 10.916  25.522  27.338  1.00 40.60  ? 219 VAL B O   1 
ATOM   3161 C CB  . VAL B 1 202 ? 13.378  23.400  28.258  1.00 46.77  ? 219 VAL B CB  1 
ATOM   3162 C CG1 . VAL B 1 202 ? 13.051  23.052  26.806  1.00 48.75  ? 219 VAL B CG1 1 
ATOM   3163 C CG2 . VAL B 1 202 ? 14.817  23.875  28.418  1.00 45.96  ? 219 VAL B CG2 1 
ATOM   3164 N N   . PHE B 1 203 ? 10.169  23.720  28.500  1.00 36.59  ? 220 PHE B N   1 
ATOM   3165 C CA  . PHE B 1 203 ? 8.886   23.578  27.837  1.00 36.88  ? 220 PHE B CA  1 
ATOM   3166 C C   . PHE B 1 203 ? 8.110   24.863  28.095  1.00 42.74  ? 220 PHE B C   1 
ATOM   3167 O O   . PHE B 1 203 ? 7.736   25.555  27.144  1.00 44.86  ? 220 PHE B O   1 
ATOM   3168 C CB  . PHE B 1 203 ? 8.148   22.325  28.336  1.00 33.88  ? 220 PHE B CB  1 
ATOM   3169 C CG  . PHE B 1 203 ? 6.694   22.242  27.915  1.00 34.49  ? 220 PHE B CG  1 
ATOM   3170 C CD1 . PHE B 1 203 ? 6.338   21.762  26.655  1.00 35.15  ? 220 PHE B CD1 1 
ATOM   3171 C CD2 . PHE B 1 203 ? 5.671   22.666  28.769  1.00 34.83  ? 220 PHE B CD2 1 
ATOM   3172 C CE1 . PHE B 1 203 ? 5.002   21.671  26.258  1.00 34.15  ? 220 PHE B CE1 1 
ATOM   3173 C CE2 . PHE B 1 203 ? 4.333   22.607  28.374  1.00 33.90  ? 220 PHE B CE2 1 
ATOM   3174 C CZ  . PHE B 1 203 ? 3.998   22.082  27.126  1.00 37.44  ? 220 PHE B CZ  1 
ATOM   3175 N N   . TYR B 1 204 ? 7.902   25.205  29.366  1.00 43.27  ? 221 TYR B N   1 
ATOM   3176 C CA  . TYR B 1 204 ? 7.346   26.529  29.691  1.00 53.62  ? 221 TYR B CA  1 
ATOM   3177 C C   . TYR B 1 204 ? 8.008   27.754  28.974  1.00 49.10  ? 221 TYR B C   1 
ATOM   3178 O O   . TYR B 1 204 ? 7.322   28.572  28.391  1.00 46.28  ? 221 TYR B O   1 
ATOM   3179 C CB  . TYR B 1 204 ? 7.403   26.770  31.192  1.00 50.25  ? 221 TYR B CB  1 
ATOM   3180 C CG  . TYR B 1 204 ? 6.537   25.876  31.988  1.00 51.96  ? 221 TYR B CG  1 
ATOM   3181 C CD1 . TYR B 1 204 ? 5.282   25.502  31.532  1.00 55.10  ? 221 TYR B CD1 1 
ATOM   3182 C CD2 . TYR B 1 204 ? 6.956   25.434  33.243  1.00 57.57  ? 221 TYR B CD2 1 
ATOM   3183 C CE1 . TYR B 1 204 ? 4.467   24.674  32.290  1.00 63.44  ? 221 TYR B CE1 1 
ATOM   3184 C CE2 . TYR B 1 204 ? 6.152   24.615  34.014  1.00 63.33  ? 221 TYR B CE2 1 
ATOM   3185 C CZ  . TYR B 1 204 ? 4.913   24.237  33.536  1.00 64.70  ? 221 TYR B CZ  1 
ATOM   3186 O OH  . TYR B 1 204 ? 4.132   23.420  34.315  1.00 75.60  ? 221 TYR B OH  1 
ATOM   3187 N N   . ARG B 1 205 ? 9.324   27.883  29.058  1.00 43.02  ? 222 ARG B N   1 
ATOM   3188 C CA  . ARG B 1 205 ? 9.991   28.992  28.405  1.00 47.52  ? 222 ARG B CA  1 
ATOM   3189 C C   . ARG B 1 205 ? 9.632   28.989  26.917  1.00 47.88  ? 222 ARG B C   1 
ATOM   3190 O O   . ARG B 1 205 ? 9.209   30.026  26.382  1.00 48.66  ? 222 ARG B O   1 
ATOM   3191 C CB  . ARG B 1 205 ? 11.513  28.996  28.622  1.00 43.84  ? 222 ARG B CB  1 
ATOM   3192 C CG  . ARG B 1 205 ? 12.238  29.904  27.643  1.00 51.15  ? 222 ARG B CG  1 
ATOM   3193 C CD  . ARG B 1 205 ? 13.700  30.141  27.971  1.00 51.75  ? 222 ARG B CD  1 
ATOM   3194 N NE  . ARG B 1 205 ? 14.452  28.908  27.874  1.00 57.95  ? 222 ARG B NE  1 
ATOM   3195 C CZ  . ARG B 1 205 ? 14.801  28.171  28.922  1.00 66.01  ? 222 ARG B CZ  1 
ATOM   3196 N NH1 . ARG B 1 205 ? 14.464  28.575  30.156  1.00 65.62  ? 222 ARG B NH1 1 
ATOM   3197 N NH2 . ARG B 1 205 ? 15.486  27.034  28.732  1.00 63.07  ? 222 ARG B NH2 1 
ATOM   3198 N N   . GLU B 1 206 ? 9.739   27.829  26.266  1.00 44.87  ? 223 GLU B N   1 
ATOM   3199 C CA  . GLU B 1 206 ? 9.437   27.790  24.836  1.00 43.90  ? 223 GLU B CA  1 
ATOM   3200 C C   . GLU B 1 206 ? 8.004   28.114  24.529  1.00 40.00  ? 223 GLU B C   1 
ATOM   3201 O O   . GLU B 1 206 ? 7.734   28.789  23.536  1.00 43.20  ? 223 GLU B O   1 
ATOM   3202 C CB  . GLU B 1 206 ? 9.845   26.484  24.177  1.00 46.45  ? 223 GLU B CB  1 
ATOM   3203 C CG  . GLU B 1 206 ? 11.347  26.309  23.956  1.00 50.44  ? 223 GLU B CG  1 
ATOM   3204 C CD  . GLU B 1 206 ? 12.017  27.506  23.318  1.00 50.23  ? 223 GLU B CD  1 
ATOM   3205 O OE1 . GLU B 1 206 ? 11.879  27.683  22.078  1.00 58.31  ? 223 GLU B OE1 1 
ATOM   3206 O OE2 . GLU B 1 206 ? 12.702  28.254  24.061  1.00 48.61  ? 223 GLU B OE2 1 
ATOM   3207 N N   . MET B 1 207 ? 7.102   27.647  25.393  1.00 39.49  ? 224 MET B N   1 
ATOM   3208 C CA  . MET B 1 207 ? 5.665   27.788  25.194  1.00 38.20  ? 224 MET B CA  1 
ATOM   3209 C C   . MET B 1 207 ? 5.266   29.228  25.435  1.00 38.07  ? 224 MET B C   1 
ATOM   3210 O O   . MET B 1 207 ? 4.298   29.739  24.874  1.00 42.12  ? 224 MET B O   1 
ATOM   3211 C CB  . MET B 1 207 ? 4.880   26.880  26.127  1.00 35.74  ? 224 MET B CB  1 
ATOM   3212 C CG  . MET B 1 207 ? 4.678   25.477  25.601  1.00 40.52  ? 224 MET B CG  1 
ATOM   3213 S SD  . MET B 1 207 ? 3.486   25.198  24.252  1.00 45.34  ? 224 MET B SD  1 
ATOM   3214 C CE  . MET B 1 207 ? 4.366   23.860  23.475  1.00 44.29  ? 224 MET B CE  1 
ATOM   3215 N N   . SER B 1 208 ? 6.052   29.875  26.263  1.00 40.86  ? 225 SER B N   1 
ATOM   3216 C CA  . SER B 1 208 ? 5.844   31.253  26.628  1.00 41.73  ? 225 SER B CA  1 
ATOM   3217 C C   . SER B 1 208 ? 6.026   32.135  25.391  1.00 40.68  ? 225 SER B C   1 
ATOM   3218 O O   . SER B 1 208 ? 5.139   32.941  25.079  1.00 45.35  ? 225 SER B O   1 
ATOM   3219 C CB  . SER B 1 208 ? 6.834   31.616  27.718  1.00 42.47  ? 225 SER B CB  1 
ATOM   3220 O OG  . SER B 1 208 ? 6.307   32.618  28.556  1.00 53.70  ? 225 SER B OG  1 
ATOM   3221 N N   . LYS B 1 209 ? 7.154   31.967  24.687  1.00 38.42  ? 226 LYS B N   1 
ATOM   3222 C CA  . LYS B 1 209 ? 7.424   32.637  23.402  1.00 38.32  ? 226 LYS B CA  1 
ATOM   3223 C C   . LYS B 1 209 ? 6.265   32.488  22.432  1.00 39.86  ? 226 LYS B C   1 
ATOM   3224 O O   . LYS B 1 209 ? 5.707   33.514  21.984  1.00 44.59  ? 226 LYS B O   1 
ATOM   3225 C CB  . LYS B 1 209 ? 8.700   32.111  22.729  1.00 43.66  ? 226 LYS B CB  1 
ATOM   3226 C CG  . LYS B 1 209 ? 9.987   32.224  23.554  1.00 46.42  ? 226 LYS B CG  1 
ATOM   3227 C CD  . LYS B 1 209 ? 11.151  31.925  22.633  1.00 48.36  ? 226 LYS B CD  1 
ATOM   3228 C CE  . LYS B 1 209 ? 12.345  31.313  23.348  1.00 52.65  ? 226 LYS B CE  1 
ATOM   3229 N NZ  . LYS B 1 209 ? 13.072  30.473  22.329  1.00 57.41  ? 226 LYS B NZ  1 
ATOM   3230 N N   . LEU B 1 210 ? 5.895   31.238  22.102  1.00 34.16  ? 227 LEU B N   1 
ATOM   3231 C CA  . LEU B 1 210 ? 4.680   30.990  21.304  1.00 33.58  ? 227 LEU B CA  1 
ATOM   3232 C C   . LEU B 1 210 ? 3.424   31.657  21.859  1.00 33.89  ? 227 LEU B C   1 
ATOM   3233 O O   . LEU B 1 210 ? 2.570   32.096  21.079  1.00 37.54  ? 227 LEU B O   1 
ATOM   3234 C CB  . LEU B 1 210 ? 4.370   29.507  21.156  1.00 37.87  ? 227 LEU B CB  1 
ATOM   3235 C CG  . LEU B 1 210 ? 5.371   28.580  20.471  1.00 41.67  ? 227 LEU B CG  1 
ATOM   3236 C CD1 . LEU B 1 210 ? 4.606   27.338  20.054  1.00 44.43  ? 227 LEU B CD1 1 
ATOM   3237 C CD2 . LEU B 1 210 ? 5.994   29.258  19.261  1.00 38.92  ? 227 LEU B CD2 1 
ATOM   3238 N N   . ASN B 1 211 ? 3.269   31.717  23.181  1.00 33.66  ? 228 ASN B N   1 
ATOM   3239 C CA  . ASN B 1 211 ? 2.067   32.358  23.726  1.00 35.50  ? 228 ASN B CA  1 
ATOM   3240 C C   . ASN B 1 211 ? 2.028   33.831  23.327  1.00 39.09  ? 228 ASN B C   1 
ATOM   3241 O O   . ASN B 1 211 ? 0.967   34.331  22.992  1.00 45.23  ? 228 ASN B O   1 
ATOM   3242 C CB  . ASN B 1 211 ? 1.964   32.223  25.236  1.00 35.13  ? 228 ASN B CB  1 
ATOM   3243 C CG  . ASN B 1 211 ? 0.572   32.533  25.731  1.00 44.54  ? 228 ASN B CG  1 
ATOM   3244 O OD1 . ASN B 1 211 ? -0.383  32.334  24.992  1.00 54.90  ? 228 ASN B OD1 1 
ATOM   3245 N ND2 . ASN B 1 211 ? 0.432   33.005  26.974  1.00 45.56  ? 228 ASN B ND2 1 
ATOM   3246 N N   . HIS B 1 212 ? 3.198   34.495  23.315  1.00 40.30  ? 229 HIS B N   1 
ATOM   3247 C CA  . HIS B 1 212 ? 3.314   35.893  22.926  1.00 39.23  ? 229 HIS B CA  1 
ATOM   3248 C C   . HIS B 1 212 ? 3.037   36.004  21.480  1.00 37.54  ? 229 HIS B C   1 
ATOM   3249 O O   . HIS B 1 212 ? 2.249   36.869  21.085  1.00 38.59  ? 229 HIS B O   1 
ATOM   3250 C CB  . HIS B 1 212 ? 4.707   36.502  23.178  1.00 46.04  ? 229 HIS B CB  1 
ATOM   3251 C CG  . HIS B 1 212 ? 5.069   36.637  24.622  1.00 59.92  ? 229 HIS B CG  1 
ATOM   3252 N ND1 . HIS B 1 212 ? 4.131   36.871  25.611  1.00 69.34  ? 229 HIS B ND1 1 
ATOM   3253 C CD2 . HIS B 1 212 ? 6.272   36.596  25.247  1.00 62.21  ? 229 HIS B CD2 1 
ATOM   3254 C CE1 . HIS B 1 212 ? 4.740   36.963  26.781  1.00 67.00  ? 229 HIS B CE1 1 
ATOM   3255 N NE2 . HIS B 1 212 ? 6.038   36.807  26.587  1.00 69.96  ? 229 HIS B NE2 1 
ATOM   3256 N N   . ASN B 1 213 ? 3.684   35.160  20.668  1.00 38.41  ? 230 ASN B N   1 
ATOM   3257 C CA  . ASN B 1 213 ? 3.419   35.205  19.215  1.00 38.68  ? 230 ASN B CA  1 
ATOM   3258 C C   . ASN B 1 213 ? 1.971   35.069  18.941  1.00 37.61  ? 230 ASN B C   1 
ATOM   3259 O O   . ASN B 1 213 ? 1.451   35.817  18.107  1.00 44.36  ? 230 ASN B O   1 
ATOM   3260 C CB  . ASN B 1 213 ? 4.120   34.116  18.451  1.00 48.70  ? 230 ASN B CB  1 
ATOM   3261 C CG  . ASN B 1 213 ? 5.608   34.125  18.660  1.00 56.63  ? 230 ASN B CG  1 
ATOM   3262 O OD1 . ASN B 1 213 ? 6.155   34.907  19.459  1.00 63.35  ? 230 ASN B OD1 1 
ATOM   3263 N ND2 . ASN B 1 213 ? 6.279   33.249  17.941  1.00 52.69  ? 230 ASN B ND2 1 
ATOM   3264 N N   . LEU B 1 214 ? 1.299   34.131  19.626  1.00 33.90  ? 231 LEU B N   1 
ATOM   3265 C CA  . LEU B 1 214 ? -0.160  34.003  19.438  1.00 37.33  ? 231 LEU B CA  1 
ATOM   3266 C C   . LEU B 1 214 ? -0.931  35.322  19.639  1.00 39.77  ? 231 LEU B C   1 
ATOM   3267 O O   . LEU B 1 214 ? -1.739  35.695  18.806  1.00 47.01  ? 231 LEU B O   1 
ATOM   3268 C CB  . LEU B 1 214 ? -0.761  32.836  20.248  1.00 36.36  ? 231 LEU B CB  1 
ATOM   3269 C CG  . LEU B 1 214 ? -2.262  32.731  20.523  1.00 40.61  ? 231 LEU B CG  1 
ATOM   3270 C CD1 . LEU B 1 214 ? -3.055  32.457  19.251  1.00 41.85  ? 231 LEU B CD1 1 
ATOM   3271 C CD2 . LEU B 1 214 ? -2.576  31.701  21.626  1.00 41.71  ? 231 LEU B CD2 1 
ATOM   3272 N N   . TYR B 1 215 ? -0.679  36.016  20.742  1.00 40.67  ? 232 TYR B N   1 
ATOM   3273 C CA  . TYR B 1 215 ? -1.312  37.307  21.026  1.00 40.50  ? 232 TYR B CA  1 
ATOM   3274 C C   . TYR B 1 215 ? -1.084  38.379  19.915  1.00 45.15  ? 232 TYR B C   1 
ATOM   3275 O O   . TYR B 1 215 ? -2.037  39.041  19.458  1.00 53.31  ? 232 TYR B O   1 
ATOM   3276 C CB  . TYR B 1 215 ? -0.767  37.791  22.363  1.00 41.03  ? 232 TYR B CB  1 
ATOM   3277 C CG  . TYR B 1 215 ? -1.381  39.055  22.868  1.00 37.67  ? 232 TYR B CG  1 
ATOM   3278 C CD1 . TYR B 1 215 ? -0.913  40.327  22.429  1.00 40.43  ? 232 TYR B CD1 1 
ATOM   3279 C CD2 . TYR B 1 215 ? -2.401  39.003  23.788  1.00 35.32  ? 232 TYR B CD2 1 
ATOM   3280 C CE1 . TYR B 1 215 ? -1.480  41.508  22.892  1.00 32.51  ? 232 TYR B CE1 1 
ATOM   3281 C CE2 . TYR B 1 215 ? -2.982  40.167  24.264  1.00 40.18  ? 232 TYR B CE2 1 
ATOM   3282 C CZ  . TYR B 1 215 ? -2.512  41.410  23.808  1.00 36.47  ? 232 TYR B CZ  1 
ATOM   3283 O OH  . TYR B 1 215 ? -3.103  42.517  24.321  1.00 35.68  ? 232 TYR B OH  1 
ATOM   3284 N N   . GLU B 1 216 ? 0.168   38.545  19.489  1.00 42.13  ? 233 GLU B N   1 
ATOM   3285 C CA  . GLU B 1 216 ? 0.505   39.455  18.392  1.00 44.26  ? 233 GLU B CA  1 
ATOM   3286 C C   . GLU B 1 216 ? -0.219  39.150  17.081  1.00 47.44  ? 233 GLU B C   1 
ATOM   3287 O O   . GLU B 1 216 ? -0.837  40.040  16.495  1.00 50.06  ? 233 GLU B O   1 
ATOM   3288 C CB  . GLU B 1 216 ? 1.999   39.473  18.165  1.00 46.32  ? 233 GLU B CB  1 
ATOM   3289 C CG  . GLU B 1 216 ? 2.764   39.960  19.390  1.00 61.82  ? 233 GLU B CG  1 
ATOM   3290 C CD  . GLU B 1 216 ? 4.183   39.416  19.433  1.00 72.62  ? 233 GLU B CD  1 
ATOM   3291 O OE1 . GLU B 1 216 ? 4.670   38.931  18.377  1.00 72.99  ? 233 GLU B OE1 1 
ATOM   3292 O OE2 . GLU B 1 216 ? 4.809   39.460  20.522  1.00 77.36  ? 233 GLU B OE2 1 
ATOM   3293 N N   . VAL B 1 217 ? -0.158  37.899  16.618  1.00 43.66  ? 234 VAL B N   1 
ATOM   3294 C CA  . VAL B 1 217 ? -0.944  37.503  15.455  1.00 41.05  ? 234 VAL B CA  1 
ATOM   3295 C C   . VAL B 1 217 ? -2.411  37.944  15.668  1.00 45.22  ? 234 VAL B C   1 
ATOM   3296 O O   . VAL B 1 217 ? -2.964  38.690  14.861  1.00 51.69  ? 234 VAL B O   1 
ATOM   3297 C CB  . VAL B 1 217 ? -0.794  35.985  15.194  1.00 41.76  ? 234 VAL B CB  1 
ATOM   3298 C CG1 . VAL B 1 217 ? -2.138  35.292  15.045  1.00 41.77  ? 234 VAL B CG1 1 
ATOM   3299 C CG2 . VAL B 1 217 ? 0.113   35.699  14.023  1.00 37.25  ? 234 VAL B CG2 1 
ATOM   3300 N N   . MET B 1 218 ? -3.051  37.525  16.758  1.00 42.26  ? 235 MET B N   1 
ATOM   3301 C CA  . MET B 1 218 ? -4.437  37.944  16.963  1.00 42.35  ? 235 MET B CA  1 
ATOM   3302 C C   . MET B 1 218 ? -4.629  39.459  16.898  1.00 44.19  ? 235 MET B C   1 
ATOM   3303 O O   . MET B 1 218 ? -5.457  39.954  16.154  1.00 49.01  ? 235 MET B O   1 
ATOM   3304 C CB  . MET B 1 218 ? -4.998  37.381  18.265  1.00 42.51  ? 235 MET B CB  1 
ATOM   3305 C CG  . MET B 1 218 ? -5.129  35.867  18.282  1.00 42.69  ? 235 MET B CG  1 
ATOM   3306 S SD  . MET B 1 218 ? -6.082  35.279  16.878  1.00 41.72  ? 235 MET B SD  1 
ATOM   3307 C CE  . MET B 1 218 ? -5.083  33.870  16.447  1.00 56.84  ? 235 MET B CE  1 
ATOM   3308 N N   . SER B 1 219 ? -3.857  40.206  17.671  1.00 50.43  ? 236 SER B N   1 
ATOM   3309 C CA  . SER B 1 219 ? -3.938  41.688  17.647  1.00 55.26  ? 236 SER B CA  1 
ATOM   3310 C C   . SER B 1 219 ? -3.917  42.388  16.237  1.00 56.70  ? 236 SER B C   1 
ATOM   3311 O O   . SER B 1 219 ? -4.159  43.601  16.104  1.00 54.11  ? 236 SER B O   1 
ATOM   3312 C CB  . SER B 1 219 ? -2.770  42.215  18.455  1.00 54.22  ? 236 SER B CB  1 
ATOM   3313 O OG  . SER B 1 219 ? -1.626  42.078  17.641  1.00 49.21  ? 236 SER B OG  1 
ATOM   3314 N N   . LYS B 1 220 ? -3.611  41.618  15.202  1.00 54.23  ? 237 LYS B N   1 
ATOM   3315 C CA  . LYS B 1 220 ? -3.505  42.136  13.854  1.00 49.11  ? 237 LYS B CA  1 
ATOM   3316 C C   . LYS B 1 220 ? -4.790  41.956  13.075  1.00 51.37  ? 237 LYS B C   1 
ATOM   3317 O O   . LYS B 1 220 ? -4.904  42.452  11.981  1.00 55.60  ? 237 LYS B O   1 
ATOM   3318 C CB  . LYS B 1 220 ? -2.382  41.405  13.126  1.00 51.87  ? 237 LYS B CB  1 
ATOM   3319 C CG  . LYS B 1 220 ? -1.004  41.813  13.625  1.00 58.01  ? 237 LYS B CG  1 
ATOM   3320 C CD  . LYS B 1 220 ? 0.090   40.860  13.160  1.00 66.73  ? 237 LYS B CD  1 
ATOM   3321 C CE  . LYS B 1 220 ? -0.325  39.972  11.989  1.00 67.52  ? 237 LYS B CE  1 
ATOM   3322 N NZ  . LYS B 1 220 ? -0.966  40.717  10.879  1.00 65.73  ? 237 LYS B NZ  1 
ATOM   3323 N N   . LEU B 1 221 ? -5.754  41.210  13.589  1.00 50.13  ? 238 LEU B N   1 
ATOM   3324 C CA  . LEU B 1 221 ? -7.054  41.262  12.969  1.00 49.27  ? 238 LEU B CA  1 
ATOM   3325 C C   . LEU B 1 221 ? -7.710  42.580  13.411  1.00 51.61  ? 238 LEU B C   1 
ATOM   3326 O O   . LEU B 1 221 ? -8.521  43.207  12.711  1.00 44.85  ? 238 LEU B O   1 
ATOM   3327 C CB  . LEU B 1 221 ? -7.896  40.071  13.389  1.00 47.47  ? 238 LEU B CB  1 
ATOM   3328 C CG  . LEU B 1 221 ? -7.463  38.730  12.827  1.00 50.89  ? 238 LEU B CG  1 
ATOM   3329 C CD1 . LEU B 1 221 ? -8.581  37.726  13.054  1.00 42.55  ? 238 LEU B CD1 1 
ATOM   3330 C CD2 . LEU B 1 221 ? -7.149  38.889  11.344  1.00 54.34  ? 238 LEU B CD2 1 
ATOM   3331 O OXT . LEU B 1 221 ? -7.432  43.025  14.532  1.00 51.58  ? 238 LEU B OXT 1 
HETATM 3332 O O   . HOH C 2 .   ? -16.270 19.576  24.551  1.00 53.00  ? 301 HOH A O   1 
HETATM 3333 O O   . HOH C 2 .   ? -8.858  19.910  43.017  1.00 53.89  ? 302 HOH A O   1 
HETATM 3334 O O   . HOH C 2 .   ? 1.384   20.874  50.730  1.00 48.04  ? 303 HOH A O   1 
HETATM 3335 O O   . HOH C 2 .   ? 6.115   12.515  54.632  1.00 51.28  ? 304 HOH A O   1 
HETATM 3336 O O   . HOH C 2 .   ? 4.398   15.072  55.543  1.00 48.27  ? 305 HOH A O   1 
HETATM 3337 O O   . HOH C 2 .   ? -1.596  10.470  51.629  1.00 64.89  ? 306 HOH A O   1 
HETATM 3338 O O   . HOH C 2 .   ? -28.344 23.177  18.051  1.00 51.75  ? 307 HOH A O   1 
HETATM 3339 O O   . HOH C 2 .   ? -7.119  29.460  43.398  1.00 43.25  ? 308 HOH A O   1 
HETATM 3340 O O   . HOH C 2 .   ? -11.081 33.554  38.691  1.00 67.75  ? 309 HOH A O   1 
HETATM 3341 O O   . HOH C 2 .   ? -7.649  37.345  29.718  1.00 40.28  ? 310 HOH A O   1 
HETATM 3342 O O   . HOH C 2 .   ? 0.402   37.266  25.857  1.00 51.74  ? 311 HOH A O   1 
HETATM 3343 O O   . HOH C 2 .   ? -29.322 36.526  18.419  1.00 56.30  ? 312 HOH A O   1 
HETATM 3344 O O   . HOH C 2 .   ? -15.924 41.595  15.635  1.00 56.12  ? 313 HOH A O   1 
HETATM 3345 O O   . HOH C 2 .   ? -15.603 40.591  22.164  1.00 43.20  ? 314 HOH A O   1 
HETATM 3346 O O   . HOH C 2 .   ? -15.129 42.880  20.439  1.00 55.44  ? 315 HOH A O   1 
HETATM 3347 O O   . HOH C 2 .   ? -11.727 40.744  27.504  1.00 50.69  ? 316 HOH A O   1 
HETATM 3348 O O   . HOH C 2 .   ? 9.933   32.501  43.461  1.00 63.70  ? 317 HOH A O   1 
HETATM 3349 O O   . HOH C 2 .   ? -11.484 16.682  33.215  1.00 41.60  ? 318 HOH A O   1 
HETATM 3350 O O   . HOH C 2 .   ? 7.459   12.743  57.605  1.00 41.97  ? 319 HOH A O   1 
HETATM 3351 O O   . HOH C 2 .   ? 16.127  18.345  58.819  1.00 45.69  ? 320 HOH A O   1 
HETATM 3352 O O   . HOH C 2 .   ? -18.304 31.654  15.102  1.00 54.02  ? 321 HOH A O   1 
HETATM 3353 O O   . HOH C 2 .   ? 3.105   34.025  27.283  1.00 48.69  ? 322 HOH A O   1 
HETATM 3354 O O   . HOH C 2 .   ? -1.412  24.837  28.574  1.00 43.88  ? 323 HOH A O   1 
HETATM 3355 O O   . HOH C 2 .   ? 4.564   17.976  39.884  1.00 42.77  ? 324 HOH A O   1 
HETATM 3356 O O   . HOH C 2 .   ? -26.004 35.388  24.862  1.00 39.07  ? 325 HOH A O   1 
HETATM 3357 O O   . HOH C 2 .   ? -28.094 34.710  23.523  1.00 47.11  ? 326 HOH A O   1 
HETATM 3358 O O   . HOH C 2 .   ? -20.805 39.780  5.890   1.00 43.93  ? 327 HOH A O   1 
HETATM 3359 O O   . HOH C 2 .   ? 16.581  15.337  60.889  1.00 51.73  ? 328 HOH A O   1 
HETATM 3360 O O   . HOH C 2 .   ? -12.114 35.134  35.781  1.00 47.70  ? 329 HOH A O   1 
HETATM 3361 O O   . HOH C 2 .   ? -17.488 37.287  22.259  1.00 40.23  ? 330 HOH A O   1 
HETATM 3362 O O   . HOH C 2 .   ? -18.945 37.287  24.944  1.00 52.74  ? 331 HOH A O   1 
HETATM 3363 O O   . HOH C 2 .   ? -24.286 35.993  7.879   1.00 41.36  ? 332 HOH A O   1 
HETATM 3364 O O   . HOH C 2 .   ? -16.969 35.748  4.646   1.00 42.38  ? 333 HOH A O   1 
HETATM 3365 O O   . HOH C 2 .   ? -24.244 35.454  10.498  1.00 36.93  ? 334 HOH A O   1 
HETATM 3366 O O   . HOH C 2 .   ? 20.621  15.778  45.278  1.00 53.49  ? 335 HOH A O   1 
HETATM 3367 O O   . HOH C 2 .   ? -17.137 38.615  7.884   1.00 43.12  ? 336 HOH A O   1 
HETATM 3368 O O   . HOH C 2 .   ? -5.622  15.786  30.022  1.00 49.96  ? 337 HOH A O   1 
HETATM 3369 O O   . HOH C 2 .   ? -20.688 24.904  27.618  1.00 45.27  ? 338 HOH A O   1 
HETATM 3370 O O   . HOH D 2 .   ? 24.043  -18.384 56.779  1.00 46.67  ? 301 HOH B O   1 
HETATM 3371 O O   . HOH D 2 .   ? 11.413  7.842   52.205  1.00 54.88  ? 302 HOH B O   1 
HETATM 3372 O O   . HOH D 2 .   ? -1.216  23.528  7.547   1.00 55.16  ? 303 HOH B O   1 
HETATM 3373 O O   . HOH D 2 .   ? -8.635  29.184  7.699   1.00 44.40  ? 304 HOH B O   1 
HETATM 3374 O O   . HOH D 2 .   ? 8.249   31.639  14.915  1.00 44.41  ? 305 HOH B O   1 
HETATM 3375 O O   . HOH D 2 .   ? 9.163   29.925  18.553  1.00 43.32  ? 306 HOH B O   1 
HETATM 3376 O O   . HOH D 2 .   ? -1.012  22.955  17.621  1.00 44.52  ? 307 HOH B O   1 
HETATM 3377 O O   . HOH D 2 .   ? 9.325   17.849  17.633  1.00 49.45  ? 308 HOH B O   1 
HETATM 3378 O O   . HOH D 2 .   ? 18.782  1.323   41.992  1.00 35.23  ? 309 HOH B O   1 
HETATM 3379 O O   . HOH D 2 .   ? -9.157  29.579  5.107   1.00 44.80  ? 310 HOH B O   1 
HETATM 3380 O O   . HOH D 2 .   ? 5.743   -1.635  39.526  1.00 36.43  ? 311 HOH B O   1 
HETATM 3381 O O   . HOH D 2 .   ? 2.812   -1.492  36.966  1.00 40.51  ? 312 HOH B O   1 
HETATM 3382 O O   . HOH D 2 .   ? 11.196  2.618   45.521  1.00 32.18  ? 313 HOH B O   1 
HETATM 3383 O O   . HOH D 2 .   ? 0.559   22.644  31.092  1.00 35.21  ? 314 HOH B O   1 
HETATM 3384 O O   . HOH D 2 .   ? 20.115  6.964   46.459  1.00 50.53  ? 315 HOH B O   1 
HETATM 3385 O O   . HOH D 2 .   ? 9.700   2.888   52.834  1.00 50.95  ? 316 HOH B O   1 
HETATM 3386 O O   . HOH D 2 .   ? -9.459  20.909  22.641  1.00 46.72  ? 317 HOH B O   1 
HETATM 3387 O O   . HOH D 2 .   ? -5.055  11.227  31.537  1.00 45.74  ? 318 HOH B O   1 
HETATM 3388 O O   . HOH D 2 .   ? -10.147 20.652  15.453  1.00 53.74  ? 319 HOH B O   1 
HETATM 3389 O O   . HOH D 2 .   ? 14.578  23.275  36.244  1.00 41.00  ? 320 HOH B O   1 
HETATM 3390 O O   . HOH D 2 .   ? 20.692  11.608  41.883  1.00 58.65  ? 321 HOH B O   1 
HETATM 3391 O O   . HOH D 2 .   ? -14.288 32.813  10.429  1.00 33.79  ? 322 HOH B O   1 
HETATM 3392 O O   . HOH D 2 .   ? -0.184  11.156  37.972  1.00 49.76  ? 323 HOH B O   1 
HETATM 3393 O O   . HOH D 2 .   ? 19.992  6.010   43.114  1.00 39.86  ? 324 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   18  ?   ?   ?   A . n 
A 1 2   SER 2   19  ?   ?   ?   A . n 
A 1 3   LYS 3   20  ?   ?   ?   A . n 
A 1 4   PHE 4   21  ?   ?   ?   A . n 
A 1 5   SER 5   22  ?   ?   ?   A . n 
A 1 6   ARG 6   23  ?   ?   ?   A . n 
A 1 7   ALA 7   24  ?   ?   ?   A . n 
A 1 8   GLN 8   25  ?   ?   ?   A . n 
A 1 9   GLU 9   26  ?   ?   ?   A . n 
A 1 10  LYS 10  27  ?   ?   ?   A . n 
A 1 11  VAL 11  28  ?   ?   ?   A . n 
A 1 12  LEU 12  29  ?   ?   ?   A . n 
A 1 13  GLN 13  30  ?   ?   ?   A . n 
A 1 14  LYS 14  31  ?   ?   ?   A . n 
A 1 15  LEU 15  32  ?   ?   ?   A . n 
A 1 16  GLY 16  33  ?   ?   ?   A . n 
A 1 17  LYS 17  34  ?   ?   ?   A . n 
A 1 18  ALA 18  35  ?   ?   ?   A . n 
A 1 19  VAL 19  36  ?   ?   ?   A . n 
A 1 20  GLU 20  37  ?   ?   ?   A . n 
A 1 21  THR 21  38  ?   ?   ?   A . n 
A 1 22  LYS 22  39  39  LYS LYS A . n 
A 1 23  ASP 23  40  40  ASP ASP A . n 
A 1 24  GLU 24  41  41  GLU GLU A . n 
A 1 25  ARG 25  42  42  ARG ARG A . n 
A 1 26  PHE 26  43  43  PHE PHE A . n 
A 1 27  GLU 27  44  44  GLU GLU A . n 
A 1 28  GLN 28  45  45  GLN GLN A . n 
A 1 29  SER 29  46  46  SER SER A . n 
A 1 30  ALA 30  47  47  ALA ALA A . n 
A 1 31  ASN 31  48  48  ASN ASN A . n 
A 1 32  ASN 32  49  49  ASN ASN A . n 
A 1 33  PHE 33  50  50  PHE PHE A . n 
A 1 34  TYR 34  51  51  TYR TYR A . n 
A 1 35  GLN 35  52  52  GLN GLN A . n 
A 1 36  GLN 36  53  53  GLN GLN A . n 
A 1 37  GLN 37  54  54  GLN GLN A . n 
A 1 38  ALA 38  55  55  ALA ALA A . n 
A 1 39  GLU 39  56  56  GLU GLU A . n 
A 1 40  GLY 40  57  57  GLY GLY A . n 
A 1 41  HIS 41  58  58  HIS HIS A . n 
A 1 42  LYS 42  59  59  LYS LYS A . n 
A 1 43  LEU 43  60  60  LEU LEU A . n 
A 1 44  TYR 44  61  61  TYR TYR A . n 
A 1 45  LYS 45  62  62  LYS LYS A . n 
A 1 46  ASP 46  63  63  ASP ASP A . n 
A 1 47  LEU 47  64  64  LEU LEU A . n 
A 1 48  LYS 48  65  65  LYS LYS A . n 
A 1 49  ASN 49  66  66  ASN ASN A . n 
A 1 50  PHE 50  67  67  PHE PHE A . n 
A 1 51  LEU 51  68  68  LEU LEU A . n 
A 1 52  SER 52  69  69  SER SER A . n 
A 1 53  ALA 53  70  70  ALA ALA A . n 
A 1 54  VAL 54  71  71  VAL VAL A . n 
A 1 55  LYS 55  72  72  LYS LYS A . n 
A 1 56  VAL 56  73  73  VAL VAL A . n 
A 1 57  MET 57  74  74  MET MET A . n 
A 1 58  HIS 58  75  75  HIS HIS A . n 
A 1 59  GLU 59  76  76  GLU GLU A . n 
A 1 60  SER 60  77  77  SER SER A . n 
A 1 61  SER 61  78  78  SER SER A . n 
A 1 62  LYS 62  79  79  LYS LYS A . n 
A 1 63  ARG 63  80  80  ARG ARG A . n 
A 1 64  VAL 64  81  81  VAL VAL A . n 
A 1 65  SER 65  82  82  SER SER A . n 
A 1 66  GLU 66  83  83  GLU GLU A . n 
A 1 67  THR 67  84  84  THR THR A . n 
A 1 68  LEU 68  85  85  LEU LEU A . n 
A 1 69  GLN 69  86  86  GLN GLN A . n 
A 1 70  GLU 70  87  87  GLU GLU A . n 
A 1 71  ILE 71  88  88  ILE ILE A . n 
A 1 72  TYR 72  89  89  TYR TYR A . n 
A 1 73  SER 73  90  90  SER SER A . n 
A 1 74  SER 74  91  91  SER SER A . n 
A 1 75  GLU 75  92  92  GLU GLU A . n 
A 1 76  TRP 76  93  93  TRP TRP A . n 
A 1 77  ASP 77  94  94  ASP ASP A . n 
A 1 78  GLY 78  95  95  GLY GLY A . n 
A 1 79  HIS 79  96  96  HIS HIS A . n 
A 1 80  GLU 80  97  97  GLU GLU A . n 
A 1 81  GLU 81  98  98  GLU GLU A . n 
A 1 82  LEU 82  99  99  LEU LEU A . n 
A 1 83  LYS 83  100 100 LYS LYS A . n 
A 1 84  ALA 84  101 101 ALA ALA A . n 
A 1 85  ILE 85  102 102 ILE ILE A . n 
A 1 86  VAL 86  103 103 VAL VAL A . n 
A 1 87  TRP 87  104 104 TRP TRP A . n 
A 1 88  ASN 88  105 105 ASN ASN A . n 
A 1 89  ASN 89  106 106 ASN ASN A . n 
A 1 90  ASP 90  107 107 ASP ASP A . n 
A 1 91  LEU 91  108 108 LEU LEU A . n 
A 1 92  LEU 92  109 109 LEU LEU A . n 
A 1 93  TRP 93  110 110 TRP TRP A . n 
A 1 94  GLU 94  111 111 GLU GLU A . n 
A 1 95  ASP 95  112 112 ASP ASP A . n 
A 1 96  TYR 96  113 113 TYR TYR A . n 
A 1 97  GLU 97  114 114 GLU GLU A . n 
A 1 98  GLU 98  115 115 GLU GLU A . n 
A 1 99  LYS 99  116 116 LYS LYS A . n 
A 1 100 LEU 100 117 117 LEU LEU A . n 
A 1 101 ALA 101 118 118 ALA ALA A . n 
A 1 102 ASP 102 119 119 ASP ASP A . n 
A 1 103 GLN 103 120 120 GLN GLN A . n 
A 1 104 ALA 104 121 121 ALA ALA A . n 
A 1 105 VAL 105 122 122 VAL VAL A . n 
A 1 106 ARG 106 123 123 ARG ARG A . n 
A 1 107 THR 107 124 124 THR THR A . n 
A 1 108 MET 108 125 125 MET MET A . n 
A 1 109 GLU 109 126 126 GLU GLU A . n 
A 1 110 ILE 110 127 127 ILE ILE A . n 
A 1 111 TYR 111 128 128 TYR TYR A . n 
A 1 112 VAL 112 129 129 VAL VAL A . n 
A 1 113 ALA 113 130 130 ALA ALA A . n 
A 1 114 GLN 114 131 131 GLN GLN A . n 
A 1 115 PHE 115 132 132 PHE PHE A . n 
A 1 116 SER 116 133 133 SER SER A . n 
A 1 117 GLU 117 134 134 GLU GLU A . n 
A 1 118 ILE 118 135 135 ILE ILE A . n 
A 1 119 LYS 119 136 136 LYS LYS A . n 
A 1 120 GLU 120 137 137 GLU GLU A . n 
A 1 121 ARG 121 138 138 ARG ARG A . n 
A 1 122 ILE 122 139 139 ILE ILE A . n 
A 1 123 ALA 123 140 140 ALA ALA A . n 
A 1 124 LYS 124 141 141 LYS LYS A . n 
A 1 125 ARG 125 142 142 ARG ARG A . n 
A 1 126 GLY 126 143 143 GLY GLY A . n 
A 1 127 ARG 127 144 144 ARG ARG A . n 
A 1 128 LYS 128 145 145 LYS LYS A . n 
A 1 129 LEU 129 146 146 LEU LEU A . n 
A 1 130 VAL 130 147 147 VAL VAL A . n 
A 1 131 ASP 131 148 148 ASP ASP A . n 
A 1 132 TYR 132 149 149 TYR TYR A . n 
A 1 133 ASP 133 150 150 ASP ASP A . n 
A 1 134 SER 134 151 151 SER SER A . n 
A 1 135 ALA 135 152 152 ALA ALA A . n 
A 1 136 ARG 136 153 153 ARG ARG A . n 
A 1 137 HIS 137 154 154 HIS HIS A . n 
A 1 138 HIS 138 155 155 HIS HIS A . n 
A 1 139 LEU 139 156 156 LEU LEU A . n 
A 1 140 GLU 140 157 157 GLU GLU A . n 
A 1 141 ALA 141 158 158 ALA ALA A . n 
A 1 142 VAL 142 159 159 VAL VAL A . n 
A 1 143 GLN 143 160 160 GLN GLN A . n 
A 1 144 ASN 144 161 161 ASN ASN A . n 
A 1 145 ALA 145 162 162 ALA ALA A . n 
A 1 146 LYS 146 163 163 LYS LYS A . n 
A 1 147 LYS 147 164 164 LYS LYS A . n 
A 1 148 LYS 148 165 165 LYS LYS A . n 
A 1 149 ASP 149 166 166 ASP ASP A . n 
A 1 150 GLU 150 167 167 GLU GLU A . n 
A 1 151 ALA 151 168 168 ALA ALA A . n 
A 1 152 LYS 152 169 169 LYS LYS A . n 
A 1 153 THR 153 170 170 THR THR A . n 
A 1 154 ALA 154 171 171 ALA ALA A . n 
A 1 155 LYS 155 172 172 LYS LYS A . n 
A 1 156 ALA 156 173 173 ALA ALA A . n 
A 1 157 GLU 157 174 174 GLU GLU A . n 
A 1 158 GLU 158 175 175 GLU GLU A . n 
A 1 159 GLU 159 176 176 GLU GLU A . n 
A 1 160 PHE 160 177 177 PHE PHE A . n 
A 1 161 ASN 161 178 178 ASN ASN A . n 
A 1 162 LYS 162 179 179 LYS LYS A . n 
A 1 163 ALA 163 180 180 ALA ALA A . n 
A 1 164 GLN 164 181 181 GLN GLN A . n 
A 1 165 THR 165 182 182 THR THR A . n 
A 1 166 VAL 166 183 183 VAL VAL A . n 
A 1 167 PHE 167 184 184 PHE PHE A . n 
A 1 168 GLU 168 185 185 GLU GLU A . n 
A 1 169 ASP 169 186 186 ASP ASP A . n 
A 1 170 LEU 170 187 187 LEU LEU A . n 
A 1 171 ASN 171 188 188 ASN ASN A . n 
A 1 172 GLN 172 189 189 GLN GLN A . n 
A 1 173 GLU 173 190 190 GLU GLU A . n 
A 1 174 LEU 174 191 191 LEU LEU A . n 
A 1 175 LEU 175 192 192 LEU LEU A . n 
A 1 176 GLU 176 193 193 GLU GLU A . n 
A 1 177 GLU 177 194 194 GLU GLU A . n 
A 1 178 LEU 178 195 195 LEU LEU A . n 
A 1 179 PRO 179 196 196 PRO PRO A . n 
A 1 180 ILE 180 197 197 ILE ILE A . n 
A 1 181 LEU 181 198 198 LEU LEU A . n 
A 1 182 TYR 182 199 199 TYR TYR A . n 
A 1 183 ASN 183 200 200 ASN ASN A . n 
A 1 184 SER 184 201 201 SER SER A . n 
A 1 185 ARG 185 202 202 ARG ARG A . n 
A 1 186 ILE 186 203 203 ILE ILE A . n 
A 1 187 GLY 187 204 204 GLY GLY A . n 
A 1 188 CYS 188 205 205 CYS CYS A . n 
A 1 189 TYR 189 206 206 TYR TYR A . n 
A 1 190 VAL 190 207 207 VAL VAL A . n 
A 1 191 THR 191 208 208 THR THR A . n 
A 1 192 ILE 192 209 209 ILE ILE A . n 
A 1 193 PHE 193 210 210 PHE PHE A . n 
A 1 194 GLN 194 211 211 GLN GLN A . n 
A 1 195 ASN 195 212 212 ASN ASN A . n 
A 1 196 ILE 196 213 213 ILE ILE A . n 
A 1 197 SER 197 214 214 SER SER A . n 
A 1 198 ASN 198 215 215 ASN ASN A . n 
A 1 199 LEU 199 216 216 LEU LEU A . n 
A 1 200 ARG 200 217 217 ARG ARG A . n 
A 1 201 ASP 201 218 218 ASP ASP A . n 
A 1 202 VAL 202 219 219 VAL VAL A . n 
A 1 203 PHE 203 220 220 PHE PHE A . n 
A 1 204 TYR 204 221 221 TYR TYR A . n 
A 1 205 ARG 205 222 222 ARG ARG A . n 
A 1 206 GLU 206 223 223 GLU GLU A . n 
A 1 207 MET 207 224 224 MET MET A . n 
A 1 208 SER 208 225 225 SER SER A . n 
A 1 209 LYS 209 226 226 LYS LYS A . n 
A 1 210 LEU 210 227 227 LEU LEU A . n 
A 1 211 ASN 211 228 228 ASN ASN A . n 
A 1 212 HIS 212 229 229 HIS HIS A . n 
A 1 213 ASN 213 230 230 ASN ASN A . n 
A 1 214 LEU 214 231 231 LEU LEU A . n 
A 1 215 TYR 215 232 232 TYR TYR A . n 
A 1 216 GLU 216 233 233 GLU GLU A . n 
A 1 217 VAL 217 234 234 VAL VAL A . n 
A 1 218 MET 218 235 235 MET MET A . n 
A 1 219 SER 219 236 236 SER SER A . n 
A 1 220 LYS 220 237 237 LYS LYS A . n 
A 1 221 LEU 221 238 238 LEU LEU A . n 
B 1 1   GLY 1   18  ?   ?   ?   B . n 
B 1 2   SER 2   19  ?   ?   ?   B . n 
B 1 3   LYS 3   20  ?   ?   ?   B . n 
B 1 4   PHE 4   21  ?   ?   ?   B . n 
B 1 5   SER 5   22  ?   ?   ?   B . n 
B 1 6   ARG 6   23  ?   ?   ?   B . n 
B 1 7   ALA 7   24  ?   ?   ?   B . n 
B 1 8   GLN 8   25  ?   ?   ?   B . n 
B 1 9   GLU 9   26  ?   ?   ?   B . n 
B 1 10  LYS 10  27  ?   ?   ?   B . n 
B 1 11  VAL 11  28  ?   ?   ?   B . n 
B 1 12  LEU 12  29  ?   ?   ?   B . n 
B 1 13  GLN 13  30  ?   ?   ?   B . n 
B 1 14  LYS 14  31  ?   ?   ?   B . n 
B 1 15  LEU 15  32  ?   ?   ?   B . n 
B 1 16  GLY 16  33  ?   ?   ?   B . n 
B 1 17  LYS 17  34  ?   ?   ?   B . n 
B 1 18  ALA 18  35  ?   ?   ?   B . n 
B 1 19  VAL 19  36  ?   ?   ?   B . n 
B 1 20  GLU 20  37  ?   ?   ?   B . n 
B 1 21  THR 21  38  ?   ?   ?   B . n 
B 1 22  LYS 22  39  ?   ?   ?   B . n 
B 1 23  ASP 23  40  ?   ?   ?   B . n 
B 1 24  GLU 24  41  41  GLU GLU B . n 
B 1 25  ARG 25  42  42  ARG ARG B . n 
B 1 26  PHE 26  43  43  PHE PHE B . n 
B 1 27  GLU 27  44  44  GLU GLU B . n 
B 1 28  GLN 28  45  45  GLN GLN B . n 
B 1 29  SER 29  46  46  SER SER B . n 
B 1 30  ALA 30  47  47  ALA ALA B . n 
B 1 31  ASN 31  48  48  ASN ASN B . n 
B 1 32  ASN 32  49  49  ASN ASN B . n 
B 1 33  PHE 33  50  50  PHE PHE B . n 
B 1 34  TYR 34  51  51  TYR TYR B . n 
B 1 35  GLN 35  52  52  GLN GLN B . n 
B 1 36  GLN 36  53  53  GLN GLN B . n 
B 1 37  GLN 37  54  54  GLN GLN B . n 
B 1 38  ALA 38  55  55  ALA ALA B . n 
B 1 39  GLU 39  56  56  GLU GLU B . n 
B 1 40  GLY 40  57  57  GLY GLY B . n 
B 1 41  HIS 41  58  58  HIS HIS B . n 
B 1 42  LYS 42  59  59  LYS LYS B . n 
B 1 43  LEU 43  60  60  LEU LEU B . n 
B 1 44  TYR 44  61  61  TYR TYR B . n 
B 1 45  LYS 45  62  62  LYS LYS B . n 
B 1 46  ASP 46  63  63  ASP ASP B . n 
B 1 47  LEU 47  64  64  LEU LEU B . n 
B 1 48  LYS 48  65  65  LYS LYS B . n 
B 1 49  ASN 49  66  66  ASN ASN B . n 
B 1 50  PHE 50  67  67  PHE PHE B . n 
B 1 51  LEU 51  68  68  LEU LEU B . n 
B 1 52  SER 52  69  69  SER SER B . n 
B 1 53  ALA 53  70  70  ALA ALA B . n 
B 1 54  VAL 54  71  71  VAL VAL B . n 
B 1 55  LYS 55  72  72  LYS LYS B . n 
B 1 56  VAL 56  73  73  VAL VAL B . n 
B 1 57  MET 57  74  74  MET MET B . n 
B 1 58  HIS 58  75  75  HIS HIS B . n 
B 1 59  GLU 59  76  76  GLU GLU B . n 
B 1 60  SER 60  77  77  SER SER B . n 
B 1 61  SER 61  78  78  SER SER B . n 
B 1 62  LYS 62  79  79  LYS LYS B . n 
B 1 63  ARG 63  80  80  ARG ARG B . n 
B 1 64  VAL 64  81  81  VAL VAL B . n 
B 1 65  SER 65  82  82  SER SER B . n 
B 1 66  GLU 66  83  83  GLU GLU B . n 
B 1 67  THR 67  84  84  THR THR B . n 
B 1 68  LEU 68  85  85  LEU LEU B . n 
B 1 69  GLN 69  86  86  GLN GLN B . n 
B 1 70  GLU 70  87  87  GLU GLU B . n 
B 1 71  ILE 71  88  88  ILE ILE B . n 
B 1 72  TYR 72  89  89  TYR TYR B . n 
B 1 73  SER 73  90  90  SER SER B . n 
B 1 74  SER 74  91  91  SER SER B . n 
B 1 75  GLU 75  92  92  GLU GLU B . n 
B 1 76  TRP 76  93  93  TRP TRP B . n 
B 1 77  ASP 77  94  94  ASP ASP B . n 
B 1 78  GLY 78  95  95  GLY GLY B . n 
B 1 79  HIS 79  96  96  HIS HIS B . n 
B 1 80  GLU 80  97  97  GLU GLU B . n 
B 1 81  GLU 81  98  98  GLU GLU B . n 
B 1 82  LEU 82  99  99  LEU LEU B . n 
B 1 83  LYS 83  100 100 LYS LYS B . n 
B 1 84  ALA 84  101 101 ALA ALA B . n 
B 1 85  ILE 85  102 102 ILE ILE B . n 
B 1 86  VAL 86  103 103 VAL VAL B . n 
B 1 87  TRP 87  104 104 TRP TRP B . n 
B 1 88  ASN 88  105 105 ASN ASN B . n 
B 1 89  ASN 89  106 106 ASN ASN B . n 
B 1 90  ASP 90  107 107 ASP ASP B . n 
B 1 91  LEU 91  108 108 LEU LEU B . n 
B 1 92  LEU 92  109 109 LEU LEU B . n 
B 1 93  TRP 93  110 110 TRP TRP B . n 
B 1 94  GLU 94  111 111 GLU GLU B . n 
B 1 95  ASP 95  112 112 ASP ASP B . n 
B 1 96  TYR 96  113 113 TYR TYR B . n 
B 1 97  GLU 97  114 114 GLU GLU B . n 
B 1 98  GLU 98  115 115 GLU GLU B . n 
B 1 99  LYS 99  116 116 LYS LYS B . n 
B 1 100 LEU 100 117 117 LEU LEU B . n 
B 1 101 ALA 101 118 118 ALA ALA B . n 
B 1 102 ASP 102 119 119 ASP ASP B . n 
B 1 103 GLN 103 120 120 GLN GLN B . n 
B 1 104 ALA 104 121 121 ALA ALA B . n 
B 1 105 VAL 105 122 122 VAL VAL B . n 
B 1 106 ARG 106 123 123 ARG ARG B . n 
B 1 107 THR 107 124 124 THR THR B . n 
B 1 108 MET 108 125 125 MET MET B . n 
B 1 109 GLU 109 126 126 GLU GLU B . n 
B 1 110 ILE 110 127 127 ILE ILE B . n 
B 1 111 TYR 111 128 128 TYR TYR B . n 
B 1 112 VAL 112 129 129 VAL VAL B . n 
B 1 113 ALA 113 130 130 ALA ALA B . n 
B 1 114 GLN 114 131 131 GLN GLN B . n 
B 1 115 PHE 115 132 132 PHE PHE B . n 
B 1 116 SER 116 133 133 SER SER B . n 
B 1 117 GLU 117 134 134 GLU GLU B . n 
B 1 118 ILE 118 135 135 ILE ILE B . n 
B 1 119 LYS 119 136 136 LYS LYS B . n 
B 1 120 GLU 120 137 137 GLU GLU B . n 
B 1 121 ARG 121 138 138 ARG ARG B . n 
B 1 122 ILE 122 139 139 ILE ILE B . n 
B 1 123 ALA 123 140 140 ALA ALA B . n 
B 1 124 LYS 124 141 141 LYS LYS B . n 
B 1 125 ARG 125 142 142 ARG ARG B . n 
B 1 126 GLY 126 143 143 GLY GLY B . n 
B 1 127 ARG 127 144 144 ARG ARG B . n 
B 1 128 LYS 128 145 145 LYS LYS B . n 
B 1 129 LEU 129 146 146 LEU LEU B . n 
B 1 130 VAL 130 147 147 VAL VAL B . n 
B 1 131 ASP 131 148 148 ASP ASP B . n 
B 1 132 TYR 132 149 149 TYR TYR B . n 
B 1 133 ASP 133 150 150 ASP ASP B . n 
B 1 134 SER 134 151 151 SER SER B . n 
B 1 135 ALA 135 152 152 ALA ALA B . n 
B 1 136 ARG 136 153 153 ARG ARG B . n 
B 1 137 HIS 137 154 154 HIS HIS B . n 
B 1 138 HIS 138 155 155 HIS HIS B . n 
B 1 139 LEU 139 156 156 LEU LEU B . n 
B 1 140 GLU 140 157 157 GLU GLU B . n 
B 1 141 ALA 141 158 158 ALA ALA B . n 
B 1 142 VAL 142 159 159 VAL VAL B . n 
B 1 143 GLN 143 160 160 GLN GLN B . n 
B 1 144 ASN 144 161 161 ASN ASN B . n 
B 1 145 ALA 145 162 162 ALA ALA B . n 
B 1 146 LYS 146 163 163 LYS LYS B . n 
B 1 147 LYS 147 164 164 LYS LYS B . n 
B 1 148 LYS 148 165 165 LYS LYS B . n 
B 1 149 ASP 149 166 166 ASP ASP B . n 
B 1 150 GLU 150 167 167 GLU GLU B . n 
B 1 151 ALA 151 168 168 ALA ALA B . n 
B 1 152 LYS 152 169 169 LYS LYS B . n 
B 1 153 THR 153 170 170 THR THR B . n 
B 1 154 ALA 154 171 171 ALA ALA B . n 
B 1 155 LYS 155 172 172 LYS LYS B . n 
B 1 156 ALA 156 173 173 ALA ALA B . n 
B 1 157 GLU 157 174 174 GLU GLU B . n 
B 1 158 GLU 158 175 175 GLU GLU B . n 
B 1 159 GLU 159 176 176 GLU GLU B . n 
B 1 160 PHE 160 177 177 PHE PHE B . n 
B 1 161 ASN 161 178 178 ASN ASN B . n 
B 1 162 LYS 162 179 179 LYS LYS B . n 
B 1 163 ALA 163 180 180 ALA ALA B . n 
B 1 164 GLN 164 181 181 GLN GLN B . n 
B 1 165 THR 165 182 182 THR THR B . n 
B 1 166 VAL 166 183 183 VAL VAL B . n 
B 1 167 PHE 167 184 184 PHE PHE B . n 
B 1 168 GLU 168 185 185 GLU GLU B . n 
B 1 169 ASP 169 186 186 ASP ASP B . n 
B 1 170 LEU 170 187 187 LEU LEU B . n 
B 1 171 ASN 171 188 188 ASN ASN B . n 
B 1 172 GLN 172 189 189 GLN GLN B . n 
B 1 173 GLU 173 190 190 GLU GLU B . n 
B 1 174 LEU 174 191 191 LEU LEU B . n 
B 1 175 LEU 175 192 192 LEU LEU B . n 
B 1 176 GLU 176 193 193 GLU GLU B . n 
B 1 177 GLU 177 194 194 GLU GLU B . n 
B 1 178 LEU 178 195 195 LEU LEU B . n 
B 1 179 PRO 179 196 196 PRO PRO B . n 
B 1 180 ILE 180 197 197 ILE ILE B . n 
B 1 181 LEU 181 198 198 LEU LEU B . n 
B 1 182 TYR 182 199 199 TYR TYR B . n 
B 1 183 ASN 183 200 200 ASN ASN B . n 
B 1 184 SER 184 201 201 SER SER B . n 
B 1 185 ARG 185 202 202 ARG ARG B . n 
B 1 186 ILE 186 203 203 ILE ILE B . n 
B 1 187 GLY 187 204 204 GLY GLY B . n 
B 1 188 CYS 188 205 205 CYS CYS B . n 
B 1 189 TYR 189 206 206 TYR TYR B . n 
B 1 190 VAL 190 207 207 VAL VAL B . n 
B 1 191 THR 191 208 208 THR THR B . n 
B 1 192 ILE 192 209 209 ILE ILE B . n 
B 1 193 PHE 193 210 210 PHE PHE B . n 
B 1 194 GLN 194 211 211 GLN GLN B . n 
B 1 195 ASN 195 212 212 ASN ASN B . n 
B 1 196 ILE 196 213 213 ILE ILE B . n 
B 1 197 SER 197 214 214 SER SER B . n 
B 1 198 ASN 198 215 215 ASN ASN B . n 
B 1 199 LEU 199 216 216 LEU LEU B . n 
B 1 200 ARG 200 217 217 ARG ARG B . n 
B 1 201 ASP 201 218 218 ASP ASP B . n 
B 1 202 VAL 202 219 219 VAL VAL B . n 
B 1 203 PHE 203 220 220 PHE PHE B . n 
B 1 204 TYR 204 221 221 TYR TYR B . n 
B 1 205 ARG 205 222 222 ARG ARG B . n 
B 1 206 GLU 206 223 223 GLU GLU B . n 
B 1 207 MET 207 224 224 MET MET B . n 
B 1 208 SER 208 225 225 SER SER B . n 
B 1 209 LYS 209 226 226 LYS LYS B . n 
B 1 210 LEU 210 227 227 LEU LEU B . n 
B 1 211 ASN 211 228 228 ASN ASN B . n 
B 1 212 HIS 212 229 229 HIS HIS B . n 
B 1 213 ASN 213 230 230 ASN ASN B . n 
B 1 214 LEU 214 231 231 LEU LEU B . n 
B 1 215 TYR 215 232 232 TYR TYR B . n 
B 1 216 GLU 216 233 233 GLU GLU B . n 
B 1 217 VAL 217 234 234 VAL VAL B . n 
B 1 218 MET 218 235 235 MET MET B . n 
B 1 219 SER 219 236 236 SER SER B . n 
B 1 220 LYS 220 237 237 LYS LYS B . n 
B 1 221 LEU 221 238 238 LEU LEU B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4140  ? 
1 MORE         -26   ? 
1 'SSA (A^2)'  22510 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DNA    'data collection' .        ? 1 
SHARP  phasing           .        ? 2 
REFMAC refinement        5.7.0024 ? 3 
MOSFLM 'data reduction'  .        ? 4 
SCALA  'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             4I1Q 
_pdbx_entry_details.sequence_details     'RESIDUE 48 ASN IS NATURAL VARIANT (RS7312857).' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              108 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              108 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              108 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.15 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            13.85 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 40  ? ? -94.85  35.12   
2  1 ALA A 121 ? ? -120.99 -56.61  
3  1 ALA A 162 ? ? 56.60   17.04   
4  1 LYS A 163 ? ? -90.95  44.47   
5  1 LYS A 164 ? ? 47.25   29.40   
6  1 THR A 170 ? ? -118.13 50.76   
7  1 GLU B 44  ? ? -39.61  -35.54  
8  1 ALA B 121 ? ? -122.68 -55.92  
9  1 ARG B 144 ? ? -79.01  -70.64  
10 1 LYS B 145 ? ? -49.56  -15.16  
11 1 ALA B 162 ? ? 177.99  74.21   
12 1 LYS B 164 ? ? 73.93   -2.92   
13 1 GLU B 167 ? ? -106.68 -134.77 
14 1 THR B 170 ? ? -137.28 -44.30  
15 1 SER B 236 ? ? -48.40  -10.62  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLN 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    160 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    161 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.51 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 18 ? A GLY 1  
2  1 Y 1 A SER 19 ? A SER 2  
3  1 Y 1 A LYS 20 ? A LYS 3  
4  1 Y 1 A PHE 21 ? A PHE 4  
5  1 Y 1 A SER 22 ? A SER 5  
6  1 Y 1 A ARG 23 ? A ARG 6  
7  1 Y 1 A ALA 24 ? A ALA 7  
8  1 Y 1 A GLN 25 ? A GLN 8  
9  1 Y 1 A GLU 26 ? A GLU 9  
10 1 Y 1 A LYS 27 ? A LYS 10 
11 1 Y 1 A VAL 28 ? A VAL 11 
12 1 Y 1 A LEU 29 ? A LEU 12 
13 1 Y 1 A GLN 30 ? A GLN 13 
14 1 Y 1 A LYS 31 ? A LYS 14 
15 1 Y 1 A LEU 32 ? A LEU 15 
16 1 Y 1 A GLY 33 ? A GLY 16 
17 1 Y 1 A LYS 34 ? A LYS 17 
18 1 Y 1 A ALA 35 ? A ALA 18 
19 1 Y 1 A VAL 36 ? A VAL 19 
20 1 Y 1 A GLU 37 ? A GLU 20 
21 1 Y 1 A THR 38 ? A THR 21 
22 1 Y 1 B GLY 18 ? B GLY 1  
23 1 Y 1 B SER 19 ? B SER 2  
24 1 Y 1 B LYS 20 ? B LYS 3  
25 1 Y 1 B PHE 21 ? B PHE 4  
26 1 Y 1 B SER 22 ? B SER 5  
27 1 Y 1 B ARG 23 ? B ARG 6  
28 1 Y 1 B ALA 24 ? B ALA 7  
29 1 Y 1 B GLN 25 ? B GLN 8  
30 1 Y 1 B GLU 26 ? B GLU 9  
31 1 Y 1 B LYS 27 ? B LYS 10 
32 1 Y 1 B VAL 28 ? B VAL 11 
33 1 Y 1 B LEU 29 ? B LEU 12 
34 1 Y 1 B GLN 30 ? B GLN 13 
35 1 Y 1 B LYS 31 ? B LYS 14 
36 1 Y 1 B LEU 32 ? B LEU 15 
37 1 Y 1 B GLY 33 ? B GLY 16 
38 1 Y 1 B LYS 34 ? B LYS 17 
39 1 Y 1 B ALA 35 ? B ALA 18 
40 1 Y 1 B VAL 36 ? B VAL 19 
41 1 Y 1 B GLU 37 ? B GLU 20 
42 1 Y 1 B THR 38 ? B THR 21 
43 1 Y 1 B LYS 39 ? B LYS 22 
44 1 Y 1 B ASP 40 ? B ASP 23 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_reflns_twin.domain_id 
_pdbx_reflns_twin.crystal_id 
_pdbx_reflns_twin.diffrn_id 
_pdbx_reflns_twin.type 
_pdbx_reflns_twin.operator 
_pdbx_reflns_twin.fraction 
1 1 1 ? 'H, K, L'  0.888 
2 1 1 ? 'K, H, -L' 0.112 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  301 1   HOH HOH A . 
C 2 HOH 2  302 2   HOH HOH A . 
C 2 HOH 3  303 3   HOH HOH A . 
C 2 HOH 4  304 4   HOH HOH A . 
C 2 HOH 5  305 5   HOH HOH A . 
C 2 HOH 6  306 6   HOH HOH A . 
C 2 HOH 7  307 7   HOH HOH A . 
C 2 HOH 8  308 8   HOH HOH A . 
C 2 HOH 9  309 9   HOH HOH A . 
C 2 HOH 10 310 11  HOH HOH A . 
C 2 HOH 11 311 12  HOH HOH A . 
C 2 HOH 12 312 13  HOH HOH A . 
C 2 HOH 13 313 16  HOH HOH A . 
C 2 HOH 14 314 17  HOH HOH A . 
C 2 HOH 15 315 18  HOH HOH A . 
C 2 HOH 16 316 19  HOH HOH A . 
C 2 HOH 17 317 21  HOH HOH A . 
C 2 HOH 18 318 22  HOH HOH A . 
C 2 HOH 19 319 34  HOH HOH A . 
C 2 HOH 20 320 35  HOH HOH A . 
C 2 HOH 21 321 39  HOH HOH A . 
C 2 HOH 22 322 40  HOH HOH A . 
C 2 HOH 23 323 41  HOH HOH A . 
C 2 HOH 24 324 43  HOH HOH A . 
C 2 HOH 25 325 46  HOH HOH A . 
C 2 HOH 26 326 47  HOH HOH A . 
C 2 HOH 27 327 49  HOH HOH A . 
C 2 HOH 28 328 50  HOH HOH A . 
C 2 HOH 29 329 51  HOH HOH A . 
C 2 HOH 30 330 52  HOH HOH A . 
C 2 HOH 31 331 53  HOH HOH A . 
C 2 HOH 32 332 2   HOH HOH A . 
C 2 HOH 33 333 4   HOH HOH A . 
C 2 HOH 34 334 5   HOH HOH A . 
C 2 HOH 35 335 10  HOH HOH A . 
C 2 HOH 36 336 5   HOH HOH A . 
C 2 HOH 37 337 6   HOH HOH A . 
C 2 HOH 38 338 338 HOH HOH A . 
D 2 HOH 1  301 24  HOH HOH B . 
D 2 HOH 2  302 25  HOH HOH B . 
D 2 HOH 3  303 26  HOH HOH B . 
D 2 HOH 4  304 27  HOH HOH B . 
D 2 HOH 5  305 28  HOH HOH B . 
D 2 HOH 6  306 29  HOH HOH B . 
D 2 HOH 7  307 30  HOH HOH B . 
D 2 HOH 8  308 31  HOH HOH B . 
D 2 HOH 9  309 32  HOH HOH B . 
D 2 HOH 10 310 33  HOH HOH B . 
D 2 HOH 11 311 36  HOH HOH B . 
D 2 HOH 12 312 37  HOH HOH B . 
D 2 HOH 13 313 38  HOH HOH B . 
D 2 HOH 14 314 42  HOH HOH B . 
D 2 HOH 15 315 44  HOH HOH B . 
D 2 HOH 16 316 45  HOH HOH B . 
D 2 HOH 17 317 48  HOH HOH B . 
D 2 HOH 18 318 3   HOH HOH B . 
D 2 HOH 19 319 6   HOH HOH B . 
D 2 HOH 20 320 7   HOH HOH B . 
D 2 HOH 21 321 8   HOH HOH B . 
D 2 HOH 22 322 9   HOH HOH B . 
D 2 HOH 23 323 1   HOH HOH B . 
D 2 HOH 24 324 8   HOH HOH B . 
#