data_4I2C
# 
_entry.id   4I2C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4I2C         
NDB   NA2133       
RCSB  RCSB076215   
WWPDB D_1000076215 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4I27 . unspecified 
PDB 4I28 . unspecified 
PDB 4I29 . unspecified 
PDB 4I2A . unspecified 
PDB 4I2B . unspecified 
PDB 4I2D . unspecified 
PDB 4I2E . unspecified 
PDB 4I2F . unspecified 
PDB 4I2G . unspecified 
PDB 4I2H . unspecified 
PDB 4I2I . unspecified 
PDB 4I2J . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4I2C 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gouge, J.'   1 
'Delarue, M.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structures of Intermediates along the Catalytic Cycle of Terminal Deoxynucleotidyltransferase: Dynamical Aspects of the Two-Metal Ion Mechanism.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            425 
_citation.page_first                4334 
_citation.page_last                 4352 
_citation.year                      2013 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23856622 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2013.07.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gouge, J.'   1 
primary 'Rosario, S.' 2 
primary 'Romain, F.'  3 
primary 'Beguin, P.'  4 
primary 'Delarue, M.' 5 
# 
_cell.entry_id           4I2C 
_cell.length_a           46.875 
_cell.length_b           84.763 
_cell.length_c           116.482 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4I2C 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA nucleotidylexotransferase'                 45704.008 1   2.7.7.31 ? 'SEE REMARK 999' ? 
2 polymer     syn "5'-D(*AP*AP*AP*AP*A)-3'"                       1521.077  1   ?        ? ?                ? 
3 non-polymer syn 'SODIUM ION'                                    22.990    1   ?        ? ?                ? 
4 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 505.208   1   ?        ? ?                ? 
5 non-polymer syn 'MANGANESE (II) ION'                            54.938    2   ?        ? ?                ? 
6 water       nat water                                           18.015    349 ?        ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Terminal addition enzyme, Terminal deoxynucleotidyltransferase, TDT, Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMSPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLA
FMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMG
FRTLSKIQSDKSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITS
PEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKA
IRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
;
;MGSSHHHHHHSSGLVPRGSHMSPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLA
FMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMG
FRTLSKIQSDKSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITS
PEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKA
IRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DA)(DA)(DA)(DA)' AAAAA C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  PRO n 
1 24  SER n 
1 25  PRO n 
1 26  VAL n 
1 27  PRO n 
1 28  GLY n 
1 29  SER n 
1 30  GLN n 
1 31  ASN n 
1 32  VAL n 
1 33  PRO n 
1 34  ALA n 
1 35  PRO n 
1 36  ALA n 
1 37  VAL n 
1 38  LYS n 
1 39  LYS n 
1 40  ILE n 
1 41  SER n 
1 42  GLN n 
1 43  TYR n 
1 44  ALA n 
1 45  CYS n 
1 46  GLN n 
1 47  ARG n 
1 48  ARG n 
1 49  THR n 
1 50  THR n 
1 51  LEU n 
1 52  ASN n 
1 53  ASN n 
1 54  TYR n 
1 55  ASN n 
1 56  GLN n 
1 57  LEU n 
1 58  PHE n 
1 59  THR n 
1 60  ASP n 
1 61  ALA n 
1 62  LEU n 
1 63  ASP n 
1 64  ILE n 
1 65  LEU n 
1 66  ALA n 
1 67  GLU n 
1 68  ASN n 
1 69  ASP n 
1 70  GLU n 
1 71  LEU n 
1 72  ARG n 
1 73  GLU n 
1 74  ASN n 
1 75  GLU n 
1 76  GLY n 
1 77  SER n 
1 78  CYS n 
1 79  LEU n 
1 80  ALA n 
1 81  PHE n 
1 82  MET n 
1 83  ARG n 
1 84  ALA n 
1 85  SER n 
1 86  SER n 
1 87  VAL n 
1 88  LEU n 
1 89  LYS n 
1 90  SER n 
1 91  LEU n 
1 92  PRO n 
1 93  PHE n 
1 94  PRO n 
1 95  ILE n 
1 96  THR n 
1 97  SER n 
1 98  MET n 
1 99  LYS n 
1 100 ASP n 
1 101 THR n 
1 102 GLU n 
1 103 GLY n 
1 104 ILE n 
1 105 PRO n 
1 106 CYS n 
1 107 LEU n 
1 108 GLY n 
1 109 ASP n 
1 110 LYS n 
1 111 VAL n 
1 112 LYS n 
1 113 SER n 
1 114 ILE n 
1 115 ILE n 
1 116 GLU n 
1 117 GLY n 
1 118 ILE n 
1 119 ILE n 
1 120 GLU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 SER n 
1 125 SER n 
1 126 GLU n 
1 127 ALA n 
1 128 LYS n 
1 129 ALA n 
1 130 VAL n 
1 131 LEU n 
1 132 ASN n 
1 133 ASP n 
1 134 GLU n 
1 135 ARG n 
1 136 TYR n 
1 137 LYS n 
1 138 SER n 
1 139 PHE n 
1 140 LYS n 
1 141 LEU n 
1 142 PHE n 
1 143 THR n 
1 144 SER n 
1 145 VAL n 
1 146 PHE n 
1 147 GLY n 
1 148 VAL n 
1 149 GLY n 
1 150 LEU n 
1 151 LYS n 
1 152 THR n 
1 153 ALA n 
1 154 GLU n 
1 155 LYS n 
1 156 TRP n 
1 157 PHE n 
1 158 ARG n 
1 159 MET n 
1 160 GLY n 
1 161 PHE n 
1 162 ARG n 
1 163 THR n 
1 164 LEU n 
1 165 SER n 
1 166 LYS n 
1 167 ILE n 
1 168 GLN n 
1 169 SER n 
1 170 ASP n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ARG n 
1 175 PHE n 
1 176 THR n 
1 177 GLN n 
1 178 MET n 
1 179 GLN n 
1 180 LYS n 
1 181 ALA n 
1 182 GLY n 
1 183 PHE n 
1 184 LEU n 
1 185 TYR n 
1 186 TYR n 
1 187 GLU n 
1 188 ASP n 
1 189 LEU n 
1 190 VAL n 
1 191 SER n 
1 192 CYS n 
1 193 VAL n 
1 194 ASN n 
1 195 ARG n 
1 196 PRO n 
1 197 GLU n 
1 198 ALA n 
1 199 GLU n 
1 200 ALA n 
1 201 VAL n 
1 202 SER n 
1 203 MET n 
1 204 LEU n 
1 205 VAL n 
1 206 LYS n 
1 207 GLU n 
1 208 ALA n 
1 209 VAL n 
1 210 VAL n 
1 211 THR n 
1 212 PHE n 
1 213 LEU n 
1 214 PRO n 
1 215 ASP n 
1 216 ALA n 
1 217 LEU n 
1 218 VAL n 
1 219 THR n 
1 220 MET n 
1 221 THR n 
1 222 GLY n 
1 223 GLY n 
1 224 PHE n 
1 225 ARG n 
1 226 ARG n 
1 227 GLY n 
1 228 LYS n 
1 229 MET n 
1 230 THR n 
1 231 GLY n 
1 232 HIS n 
1 233 ASP n 
1 234 VAL n 
1 235 ASP n 
1 236 PHE n 
1 237 LEU n 
1 238 ILE n 
1 239 THR n 
1 240 SER n 
1 241 PRO n 
1 242 GLU n 
1 243 ALA n 
1 244 THR n 
1 245 GLU n 
1 246 ASP n 
1 247 GLU n 
1 248 GLU n 
1 249 GLN n 
1 250 GLN n 
1 251 LEU n 
1 252 LEU n 
1 253 HIS n 
1 254 LYS n 
1 255 VAL n 
1 256 THR n 
1 257 ASP n 
1 258 PHE n 
1 259 TRP n 
1 260 LYS n 
1 261 GLN n 
1 262 GLN n 
1 263 GLY n 
1 264 LEU n 
1 265 LEU n 
1 266 LEU n 
1 267 TYR n 
1 268 CYS n 
1 269 ASP n 
1 270 ILE n 
1 271 LEU n 
1 272 GLU n 
1 273 SER n 
1 274 THR n 
1 275 PHE n 
1 276 GLU n 
1 277 LYS n 
1 278 PHE n 
1 279 LYS n 
1 280 GLN n 
1 281 PRO n 
1 282 SER n 
1 283 ARG n 
1 284 LYS n 
1 285 VAL n 
1 286 ASP n 
1 287 ALA n 
1 288 LEU n 
1 289 ASP n 
1 290 HIS n 
1 291 PHE n 
1 292 GLN n 
1 293 LYS n 
1 294 CYS n 
1 295 PHE n 
1 296 LEU n 
1 297 ILE n 
1 298 LEU n 
1 299 LYS n 
1 300 LEU n 
1 301 ASP n 
1 302 HIS n 
1 303 GLY n 
1 304 ARG n 
1 305 VAL n 
1 306 HIS n 
1 307 SER n 
1 308 GLU n 
1 309 LYS n 
1 310 SER n 
1 311 GLY n 
1 312 GLN n 
1 313 GLN n 
1 314 GLU n 
1 315 GLY n 
1 316 LYS n 
1 317 GLY n 
1 318 TRP n 
1 319 LYS n 
1 320 ALA n 
1 321 ILE n 
1 322 ARG n 
1 323 VAL n 
1 324 ASP n 
1 325 LEU n 
1 326 VAL n 
1 327 MET n 
1 328 CYS n 
1 329 PRO n 
1 330 TYR n 
1 331 ASP n 
1 332 ARG n 
1 333 ARG n 
1 334 ALA n 
1 335 PHE n 
1 336 ALA n 
1 337 LEU n 
1 338 LEU n 
1 339 GLY n 
1 340 TRP n 
1 341 THR n 
1 342 GLY n 
1 343 SER n 
1 344 ARG n 
1 345 GLN n 
1 346 PHE n 
1 347 GLU n 
1 348 ARG n 
1 349 ASP n 
1 350 LEU n 
1 351 ARG n 
1 352 ARG n 
1 353 TYR n 
1 354 ALA n 
1 355 THR n 
1 356 HIS n 
1 357 GLU n 
1 358 ARG n 
1 359 LYS n 
1 360 MET n 
1 361 MET n 
1 362 LEU n 
1 363 ASP n 
1 364 ASN n 
1 365 HIS n 
1 366 ALA n 
1 367 LEU n 
1 368 TYR n 
1 369 ASP n 
1 370 ARG n 
1 371 THR n 
1 372 LYS n 
1 373 ARG n 
1 374 VAL n 
1 375 PHE n 
1 376 LEU n 
1 377 GLU n 
1 378 ALA n 
1 379 GLU n 
1 380 SER n 
1 381 GLU n 
1 382 GLU n 
1 383 GLU n 
1 384 ILE n 
1 385 PHE n 
1 386 ALA n 
1 387 HIS n 
1 388 LEU n 
1 389 GLY n 
1 390 LEU n 
1 391 ASP n 
1 392 TYR n 
1 393 ILE n 
1 394 GLU n 
1 395 PRO n 
1 396 TRP n 
1 397 GLU n 
1 398 ARG n 
1 399 ASN n 
1 400 ALA n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DA  n 
2 5   DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 22  372 mouse ? 'Dntt, Tdt' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 373 400 mouse ? 'Dntt, Tdt' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TDT_MOUSE P09838 1 
;SPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASSVLKSLPFPITSMKDT
EGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKA
GFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITSPEATEDEEQQLLHKVTDFWKQ
QGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKAIRVDLVMCPYDRRAFALLGWT
GSRQFERDLRRYATHERKMMLDNHALYDRTK
;
132 ? 
2 UNP TDT_MOUSE P09838 1 RVFLEAESEEEIFAHLGLDYIEPWERNA 503 ? 
3 PDB 4I2C      4I2C   2 AAAAA 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4I2C A 22  ? 372 ? P09838 132 ? 482 ? 132 482 
2 2 4I2C A 373 ? 400 ? P09838 503 ? 530 ? 483 510 
3 3 4I2C C 1   ? 5   ? 4I2C   2   ? 6   ? 2   6   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4I2C MET A 1  ? UNP P09838 ? ? 'EXPRESSION TAG' 111 1  
1 4I2C GLY A 2  ? UNP P09838 ? ? 'EXPRESSION TAG' 112 2  
1 4I2C SER A 3  ? UNP P09838 ? ? 'EXPRESSION TAG' 113 3  
1 4I2C SER A 4  ? UNP P09838 ? ? 'EXPRESSION TAG' 114 4  
1 4I2C HIS A 5  ? UNP P09838 ? ? 'EXPRESSION TAG' 115 5  
1 4I2C HIS A 6  ? UNP P09838 ? ? 'EXPRESSION TAG' 116 6  
1 4I2C HIS A 7  ? UNP P09838 ? ? 'EXPRESSION TAG' 117 7  
1 4I2C HIS A 8  ? UNP P09838 ? ? 'EXPRESSION TAG' 118 8  
1 4I2C HIS A 9  ? UNP P09838 ? ? 'EXPRESSION TAG' 119 9  
1 4I2C HIS A 10 ? UNP P09838 ? ? 'EXPRESSION TAG' 120 10 
1 4I2C SER A 11 ? UNP P09838 ? ? 'EXPRESSION TAG' 121 11 
1 4I2C SER A 12 ? UNP P09838 ? ? 'EXPRESSION TAG' 122 12 
1 4I2C GLY A 13 ? UNP P09838 ? ? 'EXPRESSION TAG' 123 13 
1 4I2C LEU A 14 ? UNP P09838 ? ? 'EXPRESSION TAG' 124 14 
1 4I2C VAL A 15 ? UNP P09838 ? ? 'EXPRESSION TAG' 125 15 
1 4I2C PRO A 16 ? UNP P09838 ? ? 'EXPRESSION TAG' 126 16 
1 4I2C ARG A 17 ? UNP P09838 ? ? 'EXPRESSION TAG' 127 17 
1 4I2C GLY A 18 ? UNP P09838 ? ? 'EXPRESSION TAG' 128 18 
1 4I2C SER A 19 ? UNP P09838 ? ? 'EXPRESSION TAG' 129 19 
1 4I2C HIS A 20 ? UNP P09838 ? ? 'EXPRESSION TAG' 130 20 
1 4I2C MET A 21 ? UNP P09838 ? ? 'EXPRESSION TAG' 131 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O6 P'   331.222 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ?                                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                            ?                                               'Mn 2' 
54.938  
NA  non-polymer         . 'SODIUM ION'                                    ?                                               'Na 1' 
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4I2C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.80 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    
'20-26% PEG4000, 100 mM HEPES, 200 mM ammonium formate, pH 6.0-7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   6.0-7.5 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-09-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9725 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9725 
# 
_reflns.entry_id                     4I2C 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   27460 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.107 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        30.41 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.706 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3993 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4I2C 
_refine.ls_number_reflns_obs                     27412 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.45 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    98.50 
_refine.ls_R_factor_obs                          0.1832 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1814 
_refine.ls_R_factor_R_free                       0.2172 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  1386 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9379 
_refine.correlation_coeff_Fo_to_Fc_free          0.9154 
_refine.B_iso_mean                               35.94 
_refine.aniso_B[1][1]                            4.4423 
_refine.aniso_B[2][2]                            1.0403 
_refine.aniso_B[3][3]                            -5.4827 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JMS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.184 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.1580 
_refine.pdbx_overall_SU_R_Blow_DPI               0.2040 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.1650 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.entry_id                        4I2C 
_refine_analyze.Luzzati_coordinate_error_obs    0.246 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2873 
_refine_hist.pdbx_number_atoms_nucleic_acid   33 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             349 
_refine_hist.number_atoms_total               3289 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        25.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  2975 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.00  ? 2.00  4014 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  1397 SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  78   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  459  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 2975 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? 5.00  28   SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_omega_torsion           2.99  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           2.72  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  379  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  3509 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   14 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.18 
_refine_ls_shell.number_reflns_R_work             2705 
_refine_ls_shell.R_factor_R_work                  0.2175 
_refine_ls_shell.percent_reflns_obs               98.50 
_refine_ls_shell.R_factor_R_free                  0.2453 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.92 
_refine_ls_shell.number_reflns_R_free             140 
_refine_ls_shell.number_reflns_all                2845 
_refine_ls_shell.R_factor_all                     0.2188 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4I2C 
_struct.title                     'Ternary complex of mouse TdT with ssDNA and AMPcPP' 
_struct.pdbx_descriptor           'DNA nucleotidylexotransferase (E.C.2.7.7.31)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4I2C 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'Terminal transferase, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 43  ? ARG A 47  ? TYR A 153 ARG A 157 5 ? 5  
HELX_P HELX_P2  2  ASN A 55  ? ARG A 72  ? ASN A 165 ARG A 182 1 ? 18 
HELX_P HELX_P3  3  ASN A 74  ? SER A 90  ? ASN A 184 SER A 200 1 ? 17 
HELX_P HELX_P4  4  SER A 97  ? GLU A 102 ? SER A 207 GLU A 212 5 ? 6  
HELX_P HELX_P5  5  GLY A 108 ? GLY A 122 ? GLY A 218 GLY A 232 1 ? 15 
HELX_P HELX_P6  6  SER A 124 ? ASP A 133 ? SER A 234 ASP A 243 1 ? 10 
HELX_P HELX_P7  7  ASP A 133 ? SER A 144 ? ASP A 243 SER A 254 1 ? 12 
HELX_P HELX_P8  8  GLY A 149 ? MET A 159 ? GLY A 259 MET A 269 1 ? 11 
HELX_P HELX_P9  9  THR A 163 ? ASP A 170 ? THR A 273 ASP A 280 1 ? 8  
HELX_P HELX_P10 10 THR A 176 ? TYR A 185 ? THR A 286 TYR A 295 1 ? 10 
HELX_P HELX_P11 11 TYR A 185 ? SER A 191 ? TYR A 295 SER A 301 1 ? 7  
HELX_P HELX_P12 12 ARG A 195 ? LEU A 213 ? ARG A 305 LEU A 323 1 ? 19 
HELX_P HELX_P13 13 THR A 221 ? ARG A 226 ? THR A 331 ARG A 336 1 ? 6  
HELX_P HELX_P14 14 THR A 244 ? GLY A 263 ? THR A 354 GLY A 373 1 ? 20 
HELX_P HELX_P15 15 GLY A 303 ? VAL A 305 ? GLY A 413 VAL A 415 5 ? 3  
HELX_P HELX_P16 16 PRO A 329 ? ASP A 331 ? PRO A 439 ASP A 441 5 ? 3  
HELX_P HELX_P17 17 ARG A 332 ? GLY A 342 ? ARG A 442 GLY A 452 1 ? 11 
HELX_P HELX_P18 18 SER A 343 ? LYS A 359 ? SER A 453 LYS A 469 1 ? 17 
HELX_P HELX_P19 19 SER A 380 ? GLY A 389 ? SER A 490 GLY A 499 1 ? 10 
HELX_P HELX_P20 20 GLU A 394 ? ARG A 398 ? GLU A 504 ARG A 508 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 233 OD2 ? ? ? 1_555 E MN  . MN ? ? A ASP 343 A MN  603 1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc2  metalc ? ? A ASP 235 OD1 ? ? ? 1_555 E MN  . MN ? ? A ASP 345 A MN  603 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc3  metalc ? ? A ASP 233 OD1 ? ? ? 1_555 F MN  . MN ? ? A ASP 343 A MN  604 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc4  metalc ? ? A ASP 324 OD2 ? ? ? 1_555 E MN  . MN ? ? A ASP 434 A MN  603 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc5  metalc ? ? B DA  3   OP2 ? ? ? 1_555 C NA  . NA ? ? C DA  4   A NA  601 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc6  metalc ? ? D APC .   N7  ? ? ? 1_555 E MN  . MN ? ? A APC 602 A MN  603 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc7  metalc ? ? D APC .   O1B ? ? ? 1_555 F MN  . MN ? ? A APC 602 A MN  604 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc8  metalc ? ? A ASP 235 OD2 ? ? ? 1_555 F MN  . MN ? ? A ASP 345 A MN  604 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc9  metalc ? ? D APC .   O2G ? ? ? 1_555 F MN  . MN ? ? A APC 602 A MN  604 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc10 metalc ? ? D APC .   O1A ? ? ? 1_555 E MN  . MN ? ? A APC 602 A MN  603 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc11 metalc ? ? A THR 143 O   ? ? ? 1_555 C NA  . NA ? ? A THR 253 A NA  601 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc12 metalc ? ? A VAL 148 O   ? ? ? 1_555 C NA  . NA ? ? A VAL 258 A NA  601 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc13 metalc ? ? D APC .   O1A ? ? ? 1_555 F MN  . MN ? ? A APC 602 A MN  604 1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc14 metalc ? ? A VAL 145 O   ? ? ? 1_555 C NA  . NA ? ? A VAL 255 A NA  601 1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc15 metalc ? ? F MN  .   MN  ? ? ? 1_555 G HOH . O  ? ? A MN  604 A HOH 981 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc16 metalc ? ? E MN  .   MN  ? ? ? 1_555 G HOH . O  ? ? A MN  603 A HOH 962 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc17 metalc ? ? C NA  .   NA  ? ? ? 1_555 H HOH . O  ? ? A NA  601 C HOH 101 1_555 ? ? ? ? ? ? ? 2.896 ? 
metalc18 metalc ? ? C NA  .   NA  ? ? ? 1_555 G HOH . O  ? ? A NA  601 A HOH 922 1_555 ? ? ? ? ? ? ? 3.068 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           342 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            452 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    343 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     453 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 193 ? ASN A 194 ? VAL A 303 ASN A 304 
A 2 THR A 230 ? GLY A 231 ? THR A 340 GLY A 341 
B 1 LEU A 217 ? MET A 220 ? LEU A 327 MET A 330 
B 2 VAL A 234 ? THR A 239 ? VAL A 344 THR A 349 
B 3 TRP A 318 ? MET A 327 ? TRP A 428 MET A 437 
B 4 GLN A 292 ? ASP A 301 ? GLN A 402 ASP A 411 
B 5 LEU A 265 ? LEU A 271 ? LEU A 375 LEU A 381 
C 1 MET A 360 ? LEU A 362 ? MET A 470 LEU A 472 
C 2 LEU A 367 ? ASP A 369 ? LEU A 477 ASP A 479 
C 3 VAL A 374 ? PHE A 375 ? VAL A 484 PHE A 485 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 193 ? N VAL A 303 O GLY A 231 ? O GLY A 341 
B 1 2 N LEU A 217 ? N LEU A 327 O THR A 239 ? O THR A 349 
B 2 3 N ILE A 238 ? N ILE A 348 O VAL A 326 ? O VAL A 436 
B 3 4 O VAL A 323 ? O VAL A 433 N LEU A 296 ? N LEU A 406 
B 4 5 O LYS A 293 ? O LYS A 403 N LEU A 271 ? N LEU A 381 
C 1 2 N MET A 361 ? N MET A 471 O TYR A 368 ? O TYR A 478 
C 2 3 N ASP A 369 ? N ASP A 479 O VAL A 374 ? O VAL A 484 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NA A 601'  
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE APC A 602' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 603'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 604'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  THR A 143 ? THR A 253 . ? 1_555 ? 
2  AC1 6  VAL A 145 ? VAL A 255 . ? 1_555 ? 
3  AC1 6  VAL A 148 ? VAL A 258 . ? 1_555 ? 
4  AC1 6  HOH G .   ? HOH A 922 . ? 1_555 ? 
5  AC1 6  DA  B 3   ? DA  C 4   . ? 1_555 ? 
6  AC1 6  HOH H .   ? HOH C 101 . ? 1_555 ? 
7  AC2 21 GLY A 222 ? GLY A 332 . ? 1_555 ? 
8  AC2 21 GLY A 223 ? GLY A 333 . ? 1_555 ? 
9  AC2 21 ARG A 226 ? ARG A 336 . ? 1_555 ? 
10 AC2 21 GLY A 231 ? GLY A 341 . ? 1_555 ? 
11 AC2 21 HIS A 232 ? HIS A 342 . ? 1_555 ? 
12 AC2 21 ASP A 233 ? ASP A 343 . ? 1_555 ? 
13 AC2 21 ASP A 235 ? ASP A 345 . ? 1_555 ? 
14 AC2 21 PHE A 295 ? PHE A 405 . ? 1_555 ? 
15 AC2 21 ASP A 324 ? ASP A 434 . ? 1_555 ? 
16 AC2 21 GLY A 339 ? GLY A 449 . ? 1_555 ? 
17 AC2 21 TRP A 340 ? TRP A 450 . ? 1_555 ? 
18 AC2 21 GLY A 342 ? GLY A 452 . ? 1_555 ? 
19 AC2 21 MN  E .   ? MN  A 603 . ? 1_555 ? 
20 AC2 21 MN  F .   ? MN  A 604 . ? 1_555 ? 
21 AC2 21 HOH G .   ? HOH A 859 . ? 1_555 ? 
22 AC2 21 HOH G .   ? HOH A 874 . ? 1_555 ? 
23 AC2 21 HOH G .   ? HOH A 884 . ? 1_555 ? 
24 AC2 21 HOH G .   ? HOH A 962 . ? 1_555 ? 
25 AC2 21 HOH G .   ? HOH A 981 . ? 1_555 ? 
26 AC2 21 HOH G .   ? HOH A 991 . ? 1_555 ? 
27 AC2 21 DA  B 3   ? DA  C 4   . ? 1_555 ? 
28 AC3 6  ASP A 233 ? ASP A 343 . ? 1_555 ? 
29 AC3 6  ASP A 235 ? ASP A 345 . ? 1_555 ? 
30 AC3 6  ASP A 324 ? ASP A 434 . ? 1_555 ? 
31 AC3 6  APC D .   ? APC A 602 . ? 1_555 ? 
32 AC3 6  MN  F .   ? MN  A 604 . ? 1_555 ? 
33 AC3 6  HOH G .   ? HOH A 962 . ? 1_555 ? 
34 AC4 5  ASP A 233 ? ASP A 343 . ? 1_555 ? 
35 AC4 5  ASP A 235 ? ASP A 345 . ? 1_555 ? 
36 AC4 5  APC D .   ? APC A 602 . ? 1_555 ? 
37 AC4 5  MN  E .   ? MN  A 603 . ? 1_555 ? 
38 AC4 5  HOH G .   ? HOH A 981 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4I2C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4I2C 
_atom_sites.fract_transf_matrix[1][1]   0.021333 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011798 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008585 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 39  ? -24.409 -3.321  3.442   1.00 44.21  ? 149  LYS A N     1 
ATOM   2    C  CA    . LYS A 1 39  ? -23.776 -2.010  3.589   1.00 43.24  ? 149  LYS A CA    1 
ATOM   3    C  C     . LYS A 1 39  ? -23.064 -1.588  2.293   1.00 44.26  ? 149  LYS A C     1 
ATOM   4    O  O     . LYS A 1 39  ? -22.052 -2.179  1.891   1.00 46.40  ? 149  LYS A O     1 
ATOM   5    C  CB    . LYS A 1 39  ? -22.795 -1.990  4.767   1.00 47.42  ? 149  LYS A CB    1 
ATOM   6    N  N     . ILE A 1 40  ? -23.632 -0.576  1.631   1.00 35.19  ? 150  ILE A N     1 
ATOM   7    C  CA    . ILE A 1 40  ? -23.132 0.011   0.379   1.00 30.98  ? 150  ILE A CA    1 
ATOM   8    C  C     . ILE A 1 40  ? -21.801 0.706   0.652   1.00 30.59  ? 150  ILE A C     1 
ATOM   9    O  O     . ILE A 1 40  ? -21.698 1.524   1.572   1.00 29.98  ? 150  ILE A O     1 
ATOM   10   C  CB    . ILE A 1 40  ? -24.178 0.981   -0.252  1.00 32.03  ? 150  ILE A CB    1 
ATOM   11   C  CG1   . ILE A 1 40  ? -25.544 0.257   -0.516  1.00 31.70  ? 150  ILE A CG1   1 
ATOM   12   C  CG2   . ILE A 1 40  ? -23.633 1.641   -1.531  1.00 29.34  ? 150  ILE A CG2   1 
ATOM   13   C  CD1   . ILE A 1 40  ? -26.747 1.198   -0.571  1.00 33.59  ? 150  ILE A CD1   1 
ATOM   14   N  N     . SER A 1 41  ? -20.789 0.373   -0.145  1.00 25.16  ? 151  SER A N     1 
ATOM   15   C  CA    . SER A 1 41  ? -19.471 0.986   -0.020  1.00 24.34  ? 151  SER A CA    1 
ATOM   16   C  C     . SER A 1 41  ? -19.466 2.424   -0.540  1.00 25.91  ? 151  SER A C     1 
ATOM   17   O  O     . SER A 1 41  ? -20.197 2.753   -1.472  1.00 23.14  ? 151  SER A O     1 
ATOM   18   C  CB    . SER A 1 41  ? -18.413 0.167   -0.755  1.00 26.03  ? 151  SER A CB    1 
ATOM   19   O  OG    . SER A 1 41  ? -17.191 0.880   -0.862  1.00 27.68  ? 151  SER A OG    1 
ATOM   20   N  N     . GLN A 1 42  ? -18.575 3.265   0.030   1.00 24.65  ? 152  GLN A N     1 
ATOM   21   C  CA    . GLN A 1 42  ? -18.389 4.643   -0.430  1.00 23.82  ? 152  GLN A CA    1 
ATOM   22   C  C     . GLN A 1 42  ? -17.640 4.661   -1.772  1.00 28.33  ? 152  GLN A C     1 
ATOM   23   O  O     . GLN A 1 42  ? -17.596 5.713   -2.418  1.00 27.81  ? 152  GLN A O     1 
ATOM   24   C  CB    . GLN A 1 42  ? -17.634 5.480   0.616   1.00 25.70  ? 152  GLN A CB    1 
ATOM   25   C  CG    . GLN A 1 42  ? -16.156 5.062   0.788   1.00 39.22  ? 152  GLN A CG    1 
ATOM   26   C  CD    . GLN A 1 42  ? -15.335 5.995   1.654   1.00 64.69  ? 152  GLN A CD    1 
ATOM   27   O  OE1   . GLN A 1 42  ? -15.194 7.199   1.384   1.00 57.64  ? 152  GLN A OE1   1 
ATOM   28   N  NE2   . GLN A 1 42  ? -14.690 5.433   2.668   1.00 60.48  ? 152  GLN A NE2   1 
ATOM   29   N  N     . TYR A 1 43  ? -17.015 3.510   -2.167  1.00 23.71  ? 153  TYR A N     1 
ATOM   30   C  CA    . TYR A 1 43  ? -16.219 3.415   -3.399  1.00 23.05  ? 153  TYR A CA    1 
ATOM   31   C  C     . TYR A 1 43  ? -17.015 2.825   -4.555  1.00 23.34  ? 153  TYR A C     1 
ATOM   32   O  O     . TYR A 1 43  ? -17.571 1.759   -4.408  1.00 22.01  ? 153  TYR A O     1 
ATOM   33   C  CB    . TYR A 1 43  ? -14.964 2.558   -3.166  1.00 24.68  ? 153  TYR A CB    1 
ATOM   34   C  CG    . TYR A 1 43  ? -13.990 3.147   -2.177  1.00 29.28  ? 153  TYR A CG    1 
ATOM   35   C  CD1   . TYR A 1 43  ? -13.881 2.634   -0.890  1.00 32.70  ? 153  TYR A CD1   1 
ATOM   36   C  CD2   . TYR A 1 43  ? -13.091 4.140   -2.562  1.00 30.23  ? 153  TYR A CD2   1 
ATOM   37   C  CE1   . TYR A 1 43  ? -12.934 3.125   0.007   1.00 32.26  ? 153  TYR A CE1   1 
ATOM   38   C  CE2   . TYR A 1 43  ? -12.139 4.640   -1.673  1.00 32.15  ? 153  TYR A CE2   1 
ATOM   39   C  CZ    . TYR A 1 43  ? -12.071 4.137   -0.387  1.00 36.73  ? 153  TYR A CZ    1 
ATOM   40   O  OH    . TYR A 1 43  ? -11.119 4.610   0.475   1.00 31.46  ? 153  TYR A OH    1 
ATOM   41   N  N     . ALA A 1 44  ? -17.015 3.487   -5.714  1.00 22.04  ? 154  ALA A N     1 
ATOM   42   C  CA    . ALA A 1 44  ? -17.693 3.015   -6.934  1.00 21.67  ? 154  ALA A CA    1 
ATOM   43   C  C     . ALA A 1 44  ? -17.126 1.672   -7.408  1.00 24.33  ? 154  ALA A C     1 
ATOM   44   O  O     . ALA A 1 44  ? -17.867 0.876   -7.965  1.00 24.15  ? 154  ALA A O     1 
ATOM   45   C  CB    . ALA A 1 44  ? -17.551 4.056   -8.042  1.00 22.71  ? 154  ALA A CB    1 
ATOM   46   N  N     . CYS A 1 45  ? -15.820 1.408   -7.159  1.00 20.50  ? 155  CYS A N     1 
ATOM   47   C  CA    . CYS A 1 45  ? -15.155 0.177   -7.543  1.00 20.60  ? 155  CYS A CA    1 
ATOM   48   C  C     . CYS A 1 45  ? -15.609 -1.003  -6.659  1.00 24.56  ? 155  CYS A C     1 
ATOM   49   O  O     . CYS A 1 45  ? -15.261 -2.129  -6.974  1.00 26.49  ? 155  CYS A O     1 
ATOM   50   C  CB    . CYS A 1 45  ? -13.629 0.339   -7.552  1.00 21.22  ? 155  CYS A CB    1 
ATOM   51   S  SG    . CYS A 1 45  ? -12.918 0.771   -5.945  1.00 24.74  ? 155  CYS A SG    1 
ATOM   52   N  N     . GLN A 1 46  ? -16.388 -0.754  -5.582  1.00 22.10  ? 156  GLN A N     1 
ATOM   53   C  CA    . GLN A 1 46  ? -16.967 -1.807  -4.721  1.00 23.47  ? 156  GLN A CA    1 
ATOM   54   C  C     . GLN A 1 46  ? -18.511 -1.837  -4.872  1.00 25.43  ? 156  GLN A C     1 
ATOM   55   O  O     . GLN A 1 46  ? -19.228 -2.358  -4.015  1.00 23.45  ? 156  GLN A O     1 
ATOM   56   C  CB    . GLN A 1 46  ? -16.559 -1.625  -3.250  1.00 25.56  ? 156  GLN A CB    1 
ATOM   57   C  CG    . GLN A 1 46  ? -15.100 -1.933  -2.956  1.00 28.76  ? 156  GLN A CG    1 
ATOM   58   C  CD    . GLN A 1 46  ? -14.781 -1.822  -1.492  1.00 39.47  ? 156  GLN A CD    1 
ATOM   59   O  OE1   . GLN A 1 46  ? -15.054 -0.810  -0.826  1.00 34.46  ? 156  GLN A OE1   1 
ATOM   60   N  NE2   . GLN A 1 46  ? -14.154 -2.849  -0.966  1.00 35.12  ? 156  GLN A NE2   1 
ATOM   61   N  N     . ARG A 1 47  ? -19.010 -1.236  -5.956  1.00 21.86  ? 157  ARG A N     1 
ATOM   62   C  CA    . ARG A 1 47  ? -20.437 -1.175  -6.286  1.00 20.52  ? 157  ARG A CA    1 
ATOM   63   C  C     . ARG A 1 47  ? -20.629 -1.633  -7.712  1.00 24.19  ? 157  ARG A C     1 
ATOM   64   O  O     . ARG A 1 47  ? -19.726 -1.487  -8.536  1.00 23.10  ? 157  ARG A O     1 
ATOM   65   C  CB    . ARG A 1 47  ? -21.010 0.268   -6.121  1.00 17.65  ? 157  ARG A CB    1 
ATOM   66   C  CG    . ARG A 1 47  ? -20.894 0.881   -4.727  1.00 20.61  ? 157  ARG A CG    1 
ATOM   67   C  CD    . ARG A 1 47  ? -21.700 2.162   -4.593  1.00 21.44  ? 157  ARG A CD    1 
ATOM   68   N  NE    . ARG A 1 47  ? -21.294 3.224   -5.530  1.00 20.61  ? 157  ARG A NE    1 
ATOM   69   C  CZ    . ARG A 1 47  ? -20.608 4.314   -5.197  1.00 31.95  ? 157  ARG A CZ    1 
ATOM   70   N  NH1   . ARG A 1 47  ? -20.196 4.492   -3.951  1.00 19.43  ? 157  ARG A NH1   1 
ATOM   71   N  NH2   . ARG A 1 47  ? -20.314 5.226   -6.114  1.00 18.18  ? 157  ARG A NH2   1 
ATOM   72   N  N     . ARG A 1 48  ? -21.785 -2.195  -8.008  1.00 22.26  ? 158  ARG A N     1 
ATOM   73   C  CA    . ARG A 1 48  ? -22.131 -2.581  -9.370  1.00 22.37  ? 158  ARG A CA    1 
ATOM   74   C  C     . ARG A 1 48  ? -23.084 -1.518  -9.837  1.00 24.04  ? 158  ARG A C     1 
ATOM   75   O  O     . ARG A 1 48  ? -24.053 -1.268  -9.144  1.00 23.74  ? 158  ARG A O     1 
ATOM   76   C  CB    . ARG A 1 48  ? -22.718 -4.010  -9.435  1.00 23.70  ? 158  ARG A CB    1 
ATOM   77   C  CG    . ARG A 1 48  ? -21.696 -5.054  -8.983  1.00 25.59  ? 158  ARG A CG    1 
ATOM   78   C  CD    . ARG A 1 48  ? -22.193 -6.484  -9.047  1.00 30.40  ? 158  ARG A CD    1 
ATOM   79   N  NE    . ARG A 1 48  ? -21.322 -7.357  -8.253  1.00 40.20  ? 158  ARG A NE    1 
ATOM   80   C  CZ    . ARG A 1 48  ? -20.173 -7.896  -8.660  1.00 49.75  ? 158  ARG A CZ    1 
ATOM   81   N  NH1   . ARG A 1 48  ? -19.724 -7.678  -9.897  1.00 35.83  ? 158  ARG A NH1   1 
ATOM   82   N  NH2   . ARG A 1 48  ? -19.473 -8.675  -7.842  1.00 40.51  ? 158  ARG A NH2   1 
ATOM   83   N  N     . THR A 1 49  ? -22.738 -0.778  -10.910 1.00 19.83  ? 159  THR A N     1 
ATOM   84   C  CA    . THR A 1 49  ? -23.573 0.310   -11.398 1.00 18.44  ? 159  THR A CA    1 
ATOM   85   C  C     . THR A 1 49  ? -23.929 0.024   -12.842 1.00 20.70  ? 159  THR A C     1 
ATOM   86   O  O     . THR A 1 49  ? -23.103 0.185   -13.729 1.00 19.28  ? 159  THR A O     1 
ATOM   87   C  CB    . THR A 1 49  ? -22.916 1.696   -11.193 1.00 20.51  ? 159  THR A CB    1 
ATOM   88   O  OG1   . THR A 1 49  ? -22.274 1.745   -9.917  1.00 25.46  ? 159  THR A OG1   1 
ATOM   89   C  CG2   . THR A 1 49  ? -23.948 2.829   -11.273 1.00 15.48  ? 159  THR A CG2   1 
ATOM   90   N  N     . THR A 1 50  ? -25.174 -0.395  -13.059 1.00 18.48  ? 160  THR A N     1 
ATOM   91   C  CA    . THR A 1 50  ? -25.681 -0.792  -14.371 1.00 19.07  ? 160  THR A CA    1 
ATOM   92   C  C     . THR A 1 50  ? -26.539 0.352   -14.949 1.00 22.39  ? 160  THR A C     1 
ATOM   93   O  O     . THR A 1 50  ? -26.891 1.289   -14.237 1.00 20.82  ? 160  THR A O     1 
ATOM   94   C  CB    . THR A 1 50  ? -26.431 -2.146  -14.268 1.00 26.98  ? 160  THR A CB    1 
ATOM   95   O  OG1   . THR A 1 50  ? -27.340 -2.081  -13.180 1.00 26.17  ? 160  THR A OG1   1 
ATOM   96   C  CG2   . THR A 1 50  ? -25.508 -3.315  -14.041 1.00 28.91  ? 160  THR A CG2   1 
ATOM   97   N  N     . LEU A 1 51  ? -26.869 0.271   -16.236 1.00 21.07  ? 161  LEU A N     1 
ATOM   98   C  CA    . LEU A 1 51  ? -27.584 1.320   -16.974 1.00 20.51  ? 161  LEU A CA    1 
ATOM   99   C  C     . LEU A 1 51  ? -29.080 1.423   -16.616 1.00 25.80  ? 161  LEU A C     1 
ATOM   100  O  O     . LEU A 1 51  ? -29.709 2.417   -16.975 1.00 26.20  ? 161  LEU A O     1 
ATOM   101  C  CB    . LEU A 1 51  ? -27.373 1.132   -18.497 1.00 20.85  ? 161  LEU A CB    1 
ATOM   102  C  CG    . LEU A 1 51  ? -25.905 1.387   -18.923 1.00 23.42  ? 161  LEU A CG    1 
ATOM   103  C  CD1   . LEU A 1 51  ? -25.665 0.925   -20.344 1.00 23.73  ? 161  LEU A CD1   1 
ATOM   104  C  CD2   . LEU A 1 51  ? -25.533 2.871   -18.748 1.00 22.27  ? 161  LEU A CD2   1 
ATOM   105  N  N     . ASN A 1 52  ? -29.630 0.460   -15.857 1.00 21.60  ? 162  ASN A N     1 
ATOM   106  C  CA    . ASN A 1 52  ? -30.999 0.571   -15.375 1.00 21.46  ? 162  ASN A CA    1 
ATOM   107  C  C     . ASN A 1 52  ? -30.965 1.479   -14.121 1.00 24.46  ? 162  ASN A C     1 
ATOM   108  O  O     . ASN A 1 52  ? -30.906 0.998   -12.990 1.00 25.88  ? 162  ASN A O     1 
ATOM   109  C  CB    . ASN A 1 52  ? -31.645 -0.823  -15.097 1.00 18.32  ? 162  ASN A CB    1 
ATOM   110  C  CG    . ASN A 1 52  ? -30.780 -1.728  -14.237 1.00 35.55  ? 162  ASN A CG    1 
ATOM   111  O  OD1   . ASN A 1 52  ? -29.547 -1.681  -14.296 1.00 31.44  ? 162  ASN A OD1   1 
ATOM   112  N  ND2   . ASN A 1 52  ? -31.383 -2.546  -13.402 1.00 24.34  ? 162  ASN A ND2   1 
ATOM   113  N  N     . ASN A 1 53  ? -30.913 2.795   -14.336 1.00 19.59  ? 163  ASN A N     1 
ATOM   114  C  CA    . ASN A 1 53  ? -30.887 3.771   -13.261 1.00 18.87  ? 163  ASN A CA    1 
ATOM   115  C  C     . ASN A 1 53  ? -32.313 4.046   -12.819 1.00 22.24  ? 163  ASN A C     1 
ATOM   116  O  O     . ASN A 1 53  ? -33.083 4.643   -13.572 1.00 21.37  ? 163  ASN A O     1 
ATOM   117  C  CB    . ASN A 1 53  ? -30.188 5.083   -13.704 1.00 18.56  ? 163  ASN A CB    1 
ATOM   118  C  CG    . ASN A 1 53  ? -30.105 6.157   -12.630 1.00 25.60  ? 163  ASN A CG    1 
ATOM   119  O  OD1   . ASN A 1 53  ? -30.370 5.934   -11.456 1.00 18.29  ? 163  ASN A OD1   1 
ATOM   120  N  ND2   . ASN A 1 53  ? -29.688 7.346   -13.002 1.00 20.55  ? 163  ASN A ND2   1 
ATOM   121  N  N     . TYR A 1 54  ? -32.648 3.644   -11.587 1.00 18.88  ? 164  TYR A N     1 
ATOM   122  C  CA    . TYR A 1 54  ? -33.991 3.825   -11.025 1.00 19.91  ? 164  TYR A CA    1 
ATOM   123  C  C     . TYR A 1 54  ? -34.172 5.198   -10.379 1.00 25.29  ? 164  TYR A C     1 
ATOM   124  O  O     . TYR A 1 54  ? -35.280 5.520   -9.930  1.00 25.78  ? 164  TYR A O     1 
ATOM   125  C  CB    . TYR A 1 54  ? -34.280 2.737   -9.980  1.00 20.49  ? 164  TYR A CB    1 
ATOM   126  C  CG    . TYR A 1 54  ? -34.305 1.344   -10.557 1.00 22.64  ? 164  TYR A CG    1 
ATOM   127  C  CD1   . TYR A 1 54  ? -33.218 0.496   -10.419 1.00 23.24  ? 164  TYR A CD1   1 
ATOM   128  C  CD2   . TYR A 1 54  ? -35.424 0.869   -11.244 1.00 25.06  ? 164  TYR A CD2   1 
ATOM   129  C  CE1   . TYR A 1 54  ? -33.221 -0.778  -10.969 1.00 23.30  ? 164  TYR A CE1   1 
ATOM   130  C  CE2   . TYR A 1 54  ? -35.444 -0.417  -11.789 1.00 26.06  ? 164  TYR A CE2   1 
ATOM   131  C  CZ    . TYR A 1 54  ? -34.327 -1.229  -11.665 1.00 28.71  ? 164  TYR A CZ    1 
ATOM   132  O  OH    . TYR A 1 54  ? -34.299 -2.501  -12.200 1.00 31.09  ? 164  TYR A OH    1 
ATOM   133  N  N     . ASN A 1 55  ? -33.090 5.994   -10.316 1.00 20.75  ? 165  ASN A N     1 
ATOM   134  C  CA    . ASN A 1 55  ? -33.103 7.278   -9.610  1.00 20.44  ? 165  ASN A CA    1 
ATOM   135  C  C     . ASN A 1 55  ? -32.723 8.459   -10.480 1.00 21.48  ? 165  ASN A C     1 
ATOM   136  O  O     . ASN A 1 55  ? -32.204 9.424   -9.954  1.00 19.83  ? 165  ASN A O     1 
ATOM   137  C  CB    . ASN A 1 55  ? -32.141 7.164   -8.413  1.00 19.72  ? 165  ASN A CB    1 
ATOM   138  C  CG    . ASN A 1 55  ? -32.692 6.221   -7.376  1.00 30.60  ? 165  ASN A CG    1 
ATOM   139  O  OD1   . ASN A 1 55  ? -33.586 6.588   -6.618  1.00 28.13  ? 165  ASN A OD1   1 
ATOM   140  N  ND2   . ASN A 1 55  ? -32.266 4.949   -7.388  1.00 18.64  ? 165  ASN A ND2   1 
ATOM   141  N  N     . GLN A 1 56  ? -33.038 8.416   -11.788 1.00 21.31  ? 166  GLN A N     1 
ATOM   142  C  CA    . GLN A 1 56  ? -32.687 9.473   -12.748 1.00 22.72  ? 166  GLN A CA    1 
ATOM   143  C  C     . GLN A 1 56  ? -33.245 10.844  -12.336 1.00 29.95  ? 166  GLN A C     1 
ATOM   144  O  O     . GLN A 1 56  ? -32.591 11.845  -12.597 1.00 29.27  ? 166  GLN A O     1 
ATOM   145  C  CB    . GLN A 1 56  ? -33.133 9.123   -14.171 1.00 24.75  ? 166  GLN A CB    1 
ATOM   146  C  CG    . GLN A 1 56  ? -32.204 9.720   -15.223 1.00 42.70  ? 166  GLN A CG    1 
ATOM   147  C  CD    . GLN A 1 56  ? -32.673 9.546   -16.648 1.00 56.18  ? 166  GLN A CD    1 
ATOM   148  O  OE1   . GLN A 1 56  ? -32.996 8.444   -17.095 1.00 48.61  ? 166  GLN A OE1   1 
ATOM   149  N  NE2   . GLN A 1 56  ? -32.638 10.628  -17.418 1.00 48.96  ? 166  GLN A NE2   1 
ATOM   150  N  N     . LEU A 1 57  ? -34.418 10.889  -11.675 1.00 29.33  ? 167  LEU A N     1 
ATOM   151  C  CA    . LEU A 1 57  ? -35.012 12.142  -11.189 1.00 31.58  ? 167  LEU A CA    1 
ATOM   152  C  C     . LEU A 1 57  ? -34.032 12.876  -10.215 1.00 34.72  ? 167  LEU A C     1 
ATOM   153  O  O     . LEU A 1 57  ? -33.792 14.078  -10.351 1.00 36.56  ? 167  LEU A O     1 
ATOM   154  C  CB    . LEU A 1 57  ? -36.365 11.845  -10.510 1.00 32.94  ? 167  LEU A CB    1 
ATOM   155  C  CG    . LEU A 1 57  ? -37.456 12.936  -10.610 1.00 40.06  ? 167  LEU A CG    1 
ATOM   156  C  CD1   . LEU A 1 57  ? -37.769 13.315  -12.070 1.00 41.32  ? 167  LEU A CD1   1 
ATOM   157  C  CD2   . LEU A 1 57  ? -38.711 12.489  -9.924  1.00 43.21  ? 167  LEU A CD2   1 
ATOM   158  N  N     . PHE A 1 58  ? -33.394 12.109  -9.316  1.00 27.79  ? 168  PHE A N     1 
ATOM   159  C  CA    . PHE A 1 58  ? -32.432 12.631  -8.354  1.00 24.57  ? 168  PHE A CA    1 
ATOM   160  C  C     . PHE A 1 58  ? -31.082 12.868  -8.979  1.00 25.39  ? 168  PHE A C     1 
ATOM   161  O  O     . PHE A 1 58  ? -30.509 13.931  -8.750  1.00 22.86  ? 168  PHE A O     1 
ATOM   162  C  CB    . PHE A 1 58  ? -32.277 11.655  -7.171  1.00 24.94  ? 168  PHE A CB    1 
ATOM   163  C  CG    . PHE A 1 58  ? -33.589 11.344  -6.490  1.00 24.43  ? 168  PHE A CG    1 
ATOM   164  C  CD1   . PHE A 1 58  ? -34.198 10.107  -6.655  1.00 26.98  ? 168  PHE A CD1   1 
ATOM   165  C  CD2   . PHE A 1 58  ? -34.247 12.311  -5.732  1.00 25.62  ? 168  PHE A CD2   1 
ATOM   166  C  CE1   . PHE A 1 58  ? -35.430 9.823   -6.038  1.00 27.84  ? 168  PHE A CE1   1 
ATOM   167  C  CE2   . PHE A 1 58  ? -35.466 12.030  -5.108  1.00 28.91  ? 168  PHE A CE2   1 
ATOM   168  C  CZ    . PHE A 1 58  ? -36.058 10.789  -5.272  1.00 26.44  ? 168  PHE A CZ    1 
ATOM   169  N  N     . THR A 1 59  ? -30.554 11.876  -9.758  1.00 21.43  ? 169  THR A N     1 
ATOM   170  C  CA    . THR A 1 59  ? -29.192 11.953  -10.303 1.00 20.40  ? 169  THR A CA    1 
ATOM   171  C  C     . THR A 1 59  ? -29.071 12.981  -11.428 1.00 20.59  ? 169  THR A C     1 
ATOM   172  O  O     . THR A 1 59  ? -28.010 13.591  -11.527 1.00 16.57  ? 169  THR A O     1 
ATOM   173  C  CB    . THR A 1 59  ? -28.643 10.570  -10.724 1.00 26.36  ? 169  THR A CB    1 
ATOM   174  O  OG1   . THR A 1 59  ? -29.325 10.092  -11.889 1.00 22.32  ? 169  THR A OG1   1 
ATOM   175  C  CG2   . THR A 1 59  ? -28.718 9.536   -9.588  1.00 22.58  ? 169  THR A CG2   1 
ATOM   176  N  N     . ASP A 1 60  ? -30.125 13.195  -12.255 1.00 18.35  ? 170  ASP A N     1 
ATOM   177  C  CA    . ASP A 1 60  ? -30.036 14.236  -13.280 1.00 19.52  ? 170  ASP A CA    1 
ATOM   178  C  C     . ASP A 1 60  ? -29.850 15.604  -12.626 1.00 24.12  ? 170  ASP A C     1 
ATOM   179  O  O     . ASP A 1 60  ? -29.024 16.389  -13.083 1.00 23.75  ? 170  ASP A O     1 
ATOM   180  C  CB    . ASP A 1 60  ? -31.274 14.249  -14.185 1.00 22.56  ? 170  ASP A CB    1 
ATOM   181  C  CG    . ASP A 1 60  ? -31.240 13.207  -15.281 1.00 31.76  ? 170  ASP A CG    1 
ATOM   182  O  OD1   . ASP A 1 60  ? -30.212 12.502  -15.398 1.00 31.51  ? 170  ASP A OD1   1 
ATOM   183  O  OD2   . ASP A 1 60  ? -32.258 13.070  -16.000 1.00 40.11  ? 170  ASP A OD2   1 
ATOM   184  N  N     . ALA A 1 61  ? -30.580 15.850  -11.514 1.00 21.81  ? 171  ALA A N     1 
ATOM   185  C  CA    . ALA A 1 61  ? -30.503 17.093  -10.757 1.00 21.64  ? 171  ALA A CA    1 
ATOM   186  C  C     . ALA A 1 61  ? -29.128 17.251  -10.114 1.00 25.13  ? 171  ALA A C     1 
ATOM   187  O  O     . ALA A 1 61  ? -28.522 18.298  -10.280 1.00 25.29  ? 171  ALA A O     1 
ATOM   188  C  CB    . ALA A 1 61  ? -31.595 17.149  -9.710  1.00 21.83  ? 171  ALA A CB    1 
ATOM   189  N  N     . LEU A 1 62  ? -28.604 16.189  -9.461  1.00 22.52  ? 172  LEU A N     1 
ATOM   190  C  CA    . LEU A 1 62  ? -27.276 16.184  -8.833  1.00 22.44  ? 172  LEU A CA    1 
ATOM   191  C  C     . LEU A 1 62  ? -26.161 16.377  -9.859  1.00 25.46  ? 172  LEU A C     1 
ATOM   192  O  O     . LEU A 1 62  ? -25.195 17.076  -9.554  1.00 24.22  ? 172  LEU A O     1 
ATOM   193  C  CB    . LEU A 1 62  ? -27.033 14.900  -8.009  1.00 22.00  ? 172  LEU A CB    1 
ATOM   194  C  CG    . LEU A 1 62  ? -27.944 14.714  -6.781  1.00 26.73  ? 172  LEU A CG    1 
ATOM   195  C  CD1   . LEU A 1 62  ? -27.758 13.326  -6.183  1.00 27.85  ? 172  LEU A CD1   1 
ATOM   196  C  CD2   . LEU A 1 62  ? -27.730 15.827  -5.730  1.00 27.40  ? 172  LEU A CD2   1 
ATOM   197  N  N     . ASP A 1 63  ? -26.296 15.785  -11.076 1.00 22.28  ? 173  ASP A N     1 
ATOM   198  C  CA    . ASP A 1 63  ? -25.315 15.935  -12.170 1.00 21.98  ? 173  ASP A CA    1 
ATOM   199  C  C     . ASP A 1 63  ? -25.271 17.397  -12.663 1.00 25.79  ? 173  ASP A C     1 
ATOM   200  O  O     . ASP A 1 63  ? -24.207 17.907  -12.981 1.00 26.03  ? 173  ASP A O     1 
ATOM   201  C  CB    . ASP A 1 63  ? -25.617 14.967  -13.345 1.00 22.85  ? 173  ASP A CB    1 
ATOM   202  C  CG    . ASP A 1 63  ? -25.360 13.478  -13.048 1.00 30.19  ? 173  ASP A CG    1 
ATOM   203  O  OD1   . ASP A 1 63  ? -24.703 13.178  -12.026 1.00 29.75  ? 173  ASP A OD1   1 
ATOM   204  O  OD2   . ASP A 1 63  ? -25.831 12.616  -13.839 1.00 28.82  ? 173  ASP A OD2   1 
ATOM   205  N  N     . ILE A 1 64  ? -26.426 18.065  -12.741 1.00 24.23  ? 174  ILE A N     1 
ATOM   206  C  CA    . ILE A 1 64  ? -26.515 19.476  -13.156 1.00 23.45  ? 174  ILE A CA    1 
ATOM   207  C  C     . ILE A 1 64  ? -25.816 20.362  -12.105 1.00 25.05  ? 174  ILE A C     1 
ATOM   208  O  O     . ILE A 1 64  ? -25.055 21.258  -12.469 1.00 24.39  ? 174  ILE A O     1 
ATOM   209  C  CB    . ILE A 1 64  ? -27.999 19.889  -13.381 1.00 26.62  ? 174  ILE A CB    1 
ATOM   210  C  CG1   . ILE A 1 64  ? -28.561 19.252  -14.667 1.00 27.59  ? 174  ILE A CG1   1 
ATOM   211  C  CG2   . ILE A 1 64  ? -28.191 21.417  -13.389 1.00 26.91  ? 174  ILE A CG2   1 
ATOM   212  C  CD1   . ILE A 1 64  ? -30.067 19.200  -14.750 1.00 26.59  ? 174  ILE A CD1   1 
ATOM   213  N  N     . LEU A 1 65  ? -26.083 20.094  -10.810 1.00 21.64  ? 175  LEU A N     1 
ATOM   214  C  CA    . LEU A 1 65  ? -25.498 20.859  -9.710  1.00 23.22  ? 175  LEU A CA    1 
ATOM   215  C  C     . LEU A 1 65  ? -23.996 20.670  -9.654  1.00 27.50  ? 175  LEU A C     1 
ATOM   216  O  O     . LEU A 1 65  ? -23.277 21.649  -9.428  1.00 28.21  ? 175  LEU A O     1 
ATOM   217  C  CB    . LEU A 1 65  ? -26.172 20.507  -8.365  1.00 23.17  ? 175  LEU A CB    1 
ATOM   218  C  CG    . LEU A 1 65  ? -27.664 20.895  -8.260  1.00 26.29  ? 175  LEU A CG    1 
ATOM   219  C  CD1   . LEU A 1 65  ? -28.323 20.180  -7.114  1.00 26.16  ? 175  LEU A CD1   1 
ATOM   220  C  CD2   . LEU A 1 65  ? -27.865 22.392  -8.149  1.00 31.14  ? 175  LEU A CD2   1 
ATOM   221  N  N     . ALA A 1 66  ? -23.515 19.445  -9.924  1.00 24.64  ? 176  ALA A N     1 
ATOM   222  C  CA    . ALA A 1 66  ? -22.082 19.146  -9.970  1.00 25.10  ? 176  ALA A CA    1 
ATOM   223  C  C     . ALA A 1 66  ? -21.406 19.899  -11.131 1.00 30.94  ? 176  ALA A C     1 
ATOM   224  O  O     . ALA A 1 66  ? -20.328 20.483  -10.946 1.00 31.21  ? 176  ALA A O     1 
ATOM   225  C  CB    . ALA A 1 66  ? -21.854 17.653  -10.114 1.00 24.95  ? 176  ALA A CB    1 
ATOM   226  N  N     . GLU A 1 67  ? -22.060 19.914  -12.308 1.00 26.70  ? 177  GLU A N     1 
ATOM   227  C  CA    . GLU A 1 67  ? -21.568 20.583  -13.519 1.00 28.23  ? 177  GLU A CA    1 
ATOM   228  C  C     . GLU A 1 67  ? -21.440 22.095  -13.301 1.00 34.03  ? 177  GLU A C     1 
ATOM   229  O  O     . GLU A 1 67  ? -20.448 22.697  -13.710 1.00 34.57  ? 177  GLU A O     1 
ATOM   230  C  CB    . GLU A 1 67  ? -22.495 20.269  -14.700 1.00 29.64  ? 177  GLU A CB    1 
ATOM   231  C  CG    . GLU A 1 67  ? -21.920 20.633  -16.052 1.00 46.54  ? 177  GLU A CG    1 
ATOM   232  C  CD    . GLU A 1 67  ? -22.512 19.884  -17.230 1.00 69.40  ? 177  GLU A CD    1 
ATOM   233  O  OE1   . GLU A 1 67  ? -21.725 19.488  -18.121 1.00 76.24  ? 177  GLU A OE1   1 
ATOM   234  O  OE2   . GLU A 1 67  ? -23.755 19.725  -17.286 1.00 53.99  ? 177  GLU A OE2   1 
ATOM   235  N  N     . ASN A 1 68  ? -22.423 22.694  -12.621 1.00 30.74  ? 178  ASN A N     1 
ATOM   236  C  CA    . ASN A 1 68  ? -22.419 24.102  -12.287 1.00 31.37  ? 178  ASN A CA    1 
ATOM   237  C  C     . ASN A 1 68  ? -21.264 24.424  -11.326 1.00 37.80  ? 178  ASN A C     1 
ATOM   238  O  O     . ASN A 1 68  ? -20.574 25.419  -11.527 1.00 38.37  ? 178  ASN A O     1 
ATOM   239  C  CB    . ASN A 1 68  ? -23.754 24.499  -11.679 1.00 28.31  ? 178  ASN A CB    1 
ATOM   240  C  CG    . ASN A 1 68  ? -23.883 25.973  -11.469 1.00 42.68  ? 178  ASN A CG    1 
ATOM   241  O  OD1   . ASN A 1 68  ? -24.089 26.443  -10.341 1.00 41.53  ? 178  ASN A OD1   1 
ATOM   242  N  ND2   . ASN A 1 68  ? -23.719 26.729  -12.542 1.00 27.18  ? 178  ASN A ND2   1 
ATOM   243  N  N     . ASP A 1 69  ? -21.023 23.560  -10.320 1.00 34.83  ? 179  ASP A N     1 
ATOM   244  C  CA    . ASP A 1 69  ? -19.911 23.747  -9.387  1.00 36.21  ? 179  ASP A CA    1 
ATOM   245  C  C     . ASP A 1 69  ? -18.559 23.642  -10.095 1.00 42.88  ? 179  ASP A C     1 
ATOM   246  O  O     . ASP A 1 69  ? -17.612 24.275  -9.652  1.00 44.09  ? 179  ASP A O     1 
ATOM   247  C  CB    . ASP A 1 69  ? -19.966 22.737  -8.240  1.00 36.79  ? 179  ASP A CB    1 
ATOM   248  C  CG    . ASP A 1 69  ? -21.056 23.009  -7.245  1.00 41.73  ? 179  ASP A CG    1 
ATOM   249  O  OD1   . ASP A 1 69  ? -21.498 24.173  -7.152  1.00 40.44  ? 179  ASP A OD1   1 
ATOM   250  O  OD2   . ASP A 1 69  ? -21.461 22.066  -6.553  1.00 50.73  ? 179  ASP A OD2   1 
ATOM   251  N  N     . GLU A 1 70  ? -18.474 22.860  -11.189 1.00 40.42  ? 180  GLU A N     1 
ATOM   252  C  CA    . GLU A 1 70  ? -17.264 22.718  -12.002 1.00 41.88  ? 180  GLU A CA    1 
ATOM   253  C  C     . GLU A 1 70  ? -17.019 24.034  -12.729 1.00 48.04  ? 180  GLU A C     1 
ATOM   254  O  O     . GLU A 1 70  ? -15.903 24.557  -12.702 1.00 49.35  ? 180  GLU A O     1 
ATOM   255  C  CB    . GLU A 1 70  ? -17.410 21.547  -12.990 1.00 42.78  ? 180  GLU A CB    1 
ATOM   256  C  CG    . GLU A 1 70  ? -16.110 21.110  -13.643 1.00 59.98  ? 180  GLU A CG    1 
ATOM   257  C  CD    . GLU A 1 70  ? -16.319 20.185  -14.826 1.00 94.39  ? 180  GLU A CD    1 
ATOM   258  O  OE1   . GLU A 1 70  ? -16.223 18.950  -14.644 1.00 98.40  ? 180  GLU A OE1   1 
ATOM   259  O  OE2   . GLU A 1 70  ? -16.625 20.696  -15.927 1.00 93.48  ? 180  GLU A OE2   1 
ATOM   260  N  N     . LEU A 1 71  ? -18.086 24.606  -13.311 1.00 45.14  ? 181  LEU A N     1 
ATOM   261  C  CA    . LEU A 1 71  ? -18.060 25.898  -14.004 1.00 46.46  ? 181  LEU A CA    1 
ATOM   262  C  C     . LEU A 1 71  ? -17.703 27.042  -13.047 1.00 50.72  ? 181  LEU A C     1 
ATOM   263  O  O     . LEU A 1 71  ? -16.944 27.928  -13.435 1.00 52.97  ? 181  LEU A O     1 
ATOM   264  C  CB    . LEU A 1 71  ? -19.439 26.147  -14.662 1.00 46.60  ? 181  LEU A CB    1 
ATOM   265  C  CG    . LEU A 1 71  ? -19.747 27.536  -15.237 1.00 52.87  ? 181  LEU A CG    1 
ATOM   266  C  CD1   . LEU A 1 71  ? -18.821 27.880  -16.402 1.00 54.26  ? 181  LEU A CD1   1 
ATOM   267  C  CD2   . LEU A 1 71  ? -21.180 27.624  -15.656 1.00 55.09  ? 181  LEU A CD2   1 
ATOM   268  N  N     . ARG A 1 72  ? -18.238 27.021  -11.808 1.00 46.21  ? 182  ARG A N     1 
ATOM   269  C  CA    . ARG A 1 72  ? -18.001 28.057  -10.785 1.00 47.24  ? 182  ARG A CA    1 
ATOM   270  C  C     . ARG A 1 72  ? -16.667 27.813  -10.021 1.00 51.24  ? 182  ARG A C     1 
ATOM   271  O  O     . ARG A 1 72  ? -16.375 28.517  -9.051  1.00 52.02  ? 182  ARG A O     1 
ATOM   272  C  CB    . ARG A 1 72  ? -19.191 28.121  -9.803  1.00 46.89  ? 182  ARG A CB    1 
ATOM   273  C  CG    . ARG A 1 72  ? -20.524 28.501  -10.456 1.00 57.62  ? 182  ARG A CG    1 
ATOM   274  C  CD    . ARG A 1 72  ? -20.899 29.950  -10.228 1.00 73.15  ? 182  ARG A CD    1 
ATOM   275  N  N     . GLU A 1 73  ? -15.868 26.810  -10.474 1.00 46.66  ? 183  GLU A N     1 
ATOM   276  C  CA    . GLU A 1 73  ? -14.565 26.416  -9.927  1.00 47.24  ? 183  GLU A CA    1 
ATOM   277  C  C     . GLU A 1 73  ? -14.658 25.968  -8.454  1.00 50.14  ? 183  GLU A C     1 
ATOM   278  O  O     . GLU A 1 73  ? -13.677 26.073  -7.704  1.00 50.72  ? 183  GLU A O     1 
ATOM   279  C  CB    . GLU A 1 73  ? -13.531 27.551  -10.078 1.00 50.95  ? 183  GLU A CB    1 
ATOM   280  C  CG    . GLU A 1 73  ? -13.062 27.778  -11.501 1.00 66.04  ? 183  GLU A CG    1 
ATOM   281  C  CD    . GLU A 1 73  ? -11.997 28.851  -11.606 1.00 84.17  ? 183  GLU A CD    1 
ATOM   282  O  OE1   . GLU A 1 73  ? -12.348 30.050  -11.527 1.00 77.52  ? 183  GLU A OE1   1 
ATOM   283  O  OE2   . GLU A 1 73  ? -10.804 28.492  -11.727 1.00 81.50  ? 183  GLU A OE2   1 
ATOM   284  N  N     . ASN A 1 74  ? -15.830 25.460  -8.045  1.00 44.80  ? 184  ASN A N     1 
ATOM   285  C  CA    . ASN A 1 74  ? -16.034 24.946  -6.698  1.00 43.70  ? 184  ASN A CA    1 
ATOM   286  C  C     . ASN A 1 74  ? -15.845 23.422  -6.737  1.00 46.08  ? 184  ASN A C     1 
ATOM   287  O  O     . ASN A 1 74  ? -16.812 22.661  -6.808  1.00 45.19  ? 184  ASN A O     1 
ATOM   288  C  CB    . ASN A 1 74  ? -17.397 25.362  -6.155  1.00 40.60  ? 184  ASN A CB    1 
ATOM   289  C  CG    . ASN A 1 74  ? -17.570 25.107  -4.668  1.00 58.59  ? 184  ASN A CG    1 
ATOM   290  O  OD1   . ASN A 1 74  ? -16.945 24.218  -4.058  1.00 42.91  ? 184  ASN A OD1   1 
ATOM   291  N  ND2   . ASN A 1 74  ? -18.452 25.885  -4.048  1.00 53.09  ? 184  ASN A ND2   1 
ATOM   292  N  N     . GLU A 1 75  ? -14.572 22.998  -6.735  1.00 42.81  ? 185  GLU A N     1 
ATOM   293  C  CA    . GLU A 1 75  ? -14.107 21.609  -6.838  1.00 41.02  ? 185  GLU A CA    1 
ATOM   294  C  C     . GLU A 1 75  ? -14.682 20.711  -5.719  1.00 42.85  ? 185  GLU A C     1 
ATOM   295  O  O     . GLU A 1 75  ? -15.088 19.581  -6.002  1.00 40.91  ? 185  GLU A O     1 
ATOM   296  C  CB    . GLU A 1 75  ? -12.570 21.601  -6.818  1.00 43.29  ? 185  GLU A CB    1 
ATOM   297  C  CG    . GLU A 1 75  ? -11.884 20.247  -6.889  1.00 55.51  ? 185  GLU A CG    1 
ATOM   298  C  CD    . GLU A 1 75  ? -10.412 20.346  -6.533  1.00 74.93  ? 185  GLU A CD    1 
ATOM   299  O  OE1   . GLU A 1 75  ? -9.612  20.712  -7.423  1.00 51.73  ? 185  GLU A OE1   1 
ATOM   300  O  OE2   . GLU A 1 75  ? -10.071 20.130  -5.347  1.00 72.84  ? 185  GLU A OE2   1 
ATOM   301  N  N     . GLY A 1 76  ? -14.715 21.227  -4.486  1.00 39.21  ? 186  GLY A N     1 
ATOM   302  C  CA    . GLY A 1 76  ? -15.227 20.506  -3.322  1.00 38.24  ? 186  GLY A CA    1 
ATOM   303  C  C     . GLY A 1 76  ? -16.693 20.150  -3.406  1.00 39.13  ? 186  GLY A C     1 
ATOM   304  O  O     . GLY A 1 76  ? -17.064 18.993  -3.192  1.00 38.83  ? 186  GLY A O     1 
ATOM   305  N  N     . SER A 1 77  ? -17.536 21.146  -3.725  1.00 34.48  ? 187  SER A N     1 
ATOM   306  C  CA    . SER A 1 77  ? -18.973 20.959  -3.849  1.00 32.64  ? 187  SER A CA    1 
ATOM   307  C  C     . SER A 1 77  ? -19.274 20.059  -5.064  1.00 36.06  ? 187  SER A C     1 
ATOM   308  O  O     . SER A 1 77  ? -20.193 19.234  -5.004  1.00 32.57  ? 187  SER A O     1 
ATOM   309  C  CB    . SER A 1 77  ? -19.682 22.305  -3.947  1.00 36.99  ? 187  SER A CB    1 
ATOM   310  O  OG    . SER A 1 77  ? -21.091 22.156  -3.857  1.00 47.04  ? 187  SER A OG    1 
ATOM   311  N  N     . CYS A 1 78  ? -18.459 20.197  -6.145  1.00 34.56  ? 188  CYS A N     1 
ATOM   312  C  CA    . CYS A 1 78  ? -18.581 19.388  -7.358  1.00 33.73  ? 188  CYS A CA    1 
ATOM   313  C  C     . CYS A 1 78  ? -18.400 17.912  -7.008  1.00 38.04  ? 188  CYS A C     1 
ATOM   314  O  O     . CYS A 1 78  ? -19.263 17.098  -7.351  1.00 36.77  ? 188  CYS A O     1 
ATOM   315  C  CB    . CYS A 1 78  ? -17.578 19.836  -8.416  1.00 34.31  ? 188  CYS A CB    1 
ATOM   316  S  SG    . CYS A 1 78  ? -17.633 18.871  -9.949  1.00 37.10  ? 188  CYS A SG    1 
ATOM   317  N  N     . LEU A 1 79  ? -17.307 17.586  -6.282  1.00 34.43  ? 189  LEU A N     1 
ATOM   318  C  CA    . LEU A 1 79  ? -16.979 16.235  -5.845  1.00 33.49  ? 189  LEU A CA    1 
ATOM   319  C  C     . LEU A 1 79  ? -18.086 15.638  -4.956  1.00 32.47  ? 189  LEU A C     1 
ATOM   320  O  O     . LEU A 1 79  ? -18.448 14.483  -5.171  1.00 29.44  ? 189  LEU A O     1 
ATOM   321  C  CB    . LEU A 1 79  ? -15.629 16.213  -5.117  1.00 35.85  ? 189  LEU A CB    1 
ATOM   322  C  CG    . LEU A 1 79  ? -15.062 14.842  -4.690  1.00 43.96  ? 189  LEU A CG    1 
ATOM   323  C  CD1   . LEU A 1 79  ? -14.881 13.893  -5.892  1.00 45.41  ? 189  LEU A CD1   1 
ATOM   324  C  CD2   . LEU A 1 79  ? -13.706 15.008  -4.019  1.00 50.20  ? 189  LEU A CD2   1 
ATOM   325  N  N     . ALA A 1 80  ? -18.616 16.405  -3.974  1.00 27.53  ? 190  ALA A N     1 
ATOM   326  C  CA    . ALA A 1 80  ? -19.680 15.925  -3.091  1.00 27.06  ? 190  ALA A CA    1 
ATOM   327  C  C     . ALA A 1 80  ? -20.945 15.562  -3.881  1.00 29.73  ? 190  ALA A C     1 
ATOM   328  O  O     . ALA A 1 80  ? -21.508 14.494  -3.622  1.00 28.93  ? 190  ALA A O     1 
ATOM   329  C  CB    . ALA A 1 80  ? -20.007 16.950  -2.021  1.00 28.91  ? 190  ALA A CB    1 
ATOM   330  N  N     . PHE A 1 81  ? -21.361 16.401  -4.867  1.00 25.62  ? 191  PHE A N     1 
ATOM   331  C  CA    . PHE A 1 81  ? -22.533 16.092  -5.700  1.00 24.29  ? 191  PHE A CA    1 
ATOM   332  C  C     . PHE A 1 81  ? -22.241 14.911  -6.634  1.00 30.23  ? 191  PHE A C     1 
ATOM   333  O  O     . PHE A 1 81  ? -23.142 14.118  -6.875  1.00 29.47  ? 191  PHE A O     1 
ATOM   334  C  CB    . PHE A 1 81  ? -23.023 17.292  -6.515  1.00 25.27  ? 191  PHE A CB    1 
ATOM   335  C  CG    . PHE A 1 81  ? -23.714 18.407  -5.755  1.00 27.12  ? 191  PHE A CG    1 
ATOM   336  C  CD1   . PHE A 1 81  ? -24.803 18.143  -4.932  1.00 28.95  ? 191  PHE A CD1   1 
ATOM   337  C  CD2   . PHE A 1 81  ? -23.328 19.736  -5.929  1.00 29.65  ? 191  PHE A CD2   1 
ATOM   338  C  CE1   . PHE A 1 81  ? -25.456 19.177  -4.245  1.00 30.26  ? 191  PHE A CE1   1 
ATOM   339  C  CE2   . PHE A 1 81  ? -23.974 20.767  -5.237  1.00 32.39  ? 191  PHE A CE2   1 
ATOM   340  C  CZ    . PHE A 1 81  ? -25.039 20.482  -4.402  1.00 29.97  ? 191  PHE A CZ    1 
ATOM   341  N  N     . MET A 1 82  ? -20.993 14.774  -7.162  1.00 29.44  ? 192  MET A N     1 
ATOM   342  C  CA    . MET A 1 82  ? -20.670 13.646  -8.058  1.00 28.02  ? 192  MET A CA    1 
ATOM   343  C  C     . MET A 1 82  ? -20.710 12.302  -7.332  1.00 29.03  ? 192  MET A C     1 
ATOM   344  O  O     . MET A 1 82  ? -21.160 11.320  -7.919  1.00 28.90  ? 192  MET A O     1 
ATOM   345  C  CB    . MET A 1 82  ? -19.306 13.816  -8.730  1.00 31.09  ? 192  MET A CB    1 
ATOM   346  C  CG    . MET A 1 82  ? -19.323 14.760  -9.918  1.00 35.31  ? 192  MET A CG    1 
ATOM   347  S  SD    . MET A 1 82  ? -17.750 14.760  -10.834 1.00 40.96  ? 192  MET A SD    1 
ATOM   348  C  CE    . MET A 1 82  ? -16.613 15.163  -9.519  1.00 38.93  ? 192  MET A CE    1 
ATOM   349  N  N     . ARG A 1 83  ? -20.246 12.259  -6.072  1.00 24.26  ? 193  ARG A N     1 
ATOM   350  C  CA    . ARG A 1 83  ? -20.213 11.043  -5.260  1.00 23.85  ? 193  ARG A CA    1 
ATOM   351  C  C     . ARG A 1 83  ? -21.629 10.636  -4.849  1.00 24.10  ? 193  ARG A C     1 
ATOM   352  O  O     . ARG A 1 83  ? -21.945 9.452   -4.837  1.00 22.79  ? 193  ARG A O     1 
ATOM   353  C  CB    . ARG A 1 83  ? -19.303 11.215  -4.029  1.00 25.38  ? 193  ARG A CB    1 
ATOM   354  C  CG    . ARG A 1 83  ? -17.812 11.261  -4.385  1.00 36.42  ? 193  ARG A CG    1 
ATOM   355  C  CD    . ARG A 1 83  ? -16.913 11.401  -3.179  1.00 47.14  ? 193  ARG A CD    1 
ATOM   356  N  NE    . ARG A 1 83  ? -15.493 11.363  -3.557  1.00 65.33  ? 193  ARG A NE    1 
ATOM   357  C  CZ    . ARG A 1 83  ? -14.483 11.632  -2.734  1.00 85.34  ? 193  ARG A CZ    1 
ATOM   358  N  NH1   . ARG A 1 83  ? -13.232 11.570  -3.168  1.00 74.76  ? 193  ARG A NH1   1 
ATOM   359  N  NH2   . ARG A 1 83  ? -14.717 11.967  -1.470  1.00 75.48  ? 193  ARG A NH2   1 
ATOM   360  N  N     . ALA A 1 84  ? -22.489 11.628  -4.534  1.00 20.06  ? 194  ALA A N     1 
ATOM   361  C  CA    . ALA A 1 84  ? -23.878 11.387  -4.166  1.00 18.31  ? 194  ALA A CA    1 
ATOM   362  C  C     . ALA A 1 84  ? -24.618 10.838  -5.363  1.00 20.39  ? 194  ALA A C     1 
ATOM   363  O  O     . ALA A 1 84  ? -25.346 9.872   -5.231  1.00 19.85  ? 194  ALA A O     1 
ATOM   364  C  CB    . ALA A 1 84  ? -24.534 12.682  -3.678  1.00 19.40  ? 194  ALA A CB    1 
ATOM   365  N  N     . SER A 1 85  ? -24.445 11.462  -6.530  1.00 18.91  ? 195  SER A N     1 
ATOM   366  C  CA    . SER A 1 85  ? -25.108 11.015  -7.761  1.00 18.66  ? 195  SER A CA    1 
ATOM   367  C  C     . SER A 1 85  ? -24.678 9.578   -8.094  1.00 20.76  ? 195  SER A C     1 
ATOM   368  O  O     . SER A 1 85  ? -25.529 8.742   -8.366  1.00 21.02  ? 195  SER A O     1 
ATOM   369  C  CB    . SER A 1 85  ? -24.768 11.951  -8.919  1.00 20.70  ? 195  SER A CB    1 
ATOM   370  O  OG    . SER A 1 85  ? -25.450 11.539  -10.090 1.00 29.62  ? 195  SER A OG    1 
ATOM   371  N  N     . SER A 1 86  ? -23.358 9.300   -8.033  1.00 17.23  ? 196  SER A N     1 
ATOM   372  C  CA    . SER A 1 86  ? -22.773 7.982   -8.292  1.00 15.63  ? 196  SER A CA    1 
ATOM   373  C  C     . SER A 1 86  ? -23.383 6.898   -7.410  1.00 20.01  ? 196  SER A C     1 
ATOM   374  O  O     . SER A 1 86  ? -23.788 5.848   -7.933  1.00 19.35  ? 196  SER A O     1 
ATOM   375  C  CB    . SER A 1 86  ? -21.255 8.016   -8.101  1.00 19.26  ? 196  SER A CB    1 
ATOM   376  O  OG    . SER A 1 86  ? -20.669 6.785   -8.494  1.00 22.81  ? 196  SER A OG    1 
ATOM   377  N  N     . VAL A 1 87  ? -23.459 7.129   -6.083  1.00 18.26  ? 197  VAL A N     1 
ATOM   378  C  CA    . VAL A 1 87  ? -24.002 6.091   -5.199  1.00 20.18  ? 197  VAL A CA    1 
ATOM   379  C  C     . VAL A 1 87  ? -25.516 5.824   -5.508  1.00 24.48  ? 197  VAL A C     1 
ATOM   380  O  O     . VAL A 1 87  ? -25.929 4.660   -5.509  1.00 25.39  ? 197  VAL A O     1 
ATOM   381  C  CB    . VAL A 1 87  ? -23.722 6.354   -3.686  1.00 26.22  ? 197  VAL A CB    1 
ATOM   382  C  CG1   . VAL A 1 87  ? -24.484 7.567   -3.154  1.00 26.55  ? 197  VAL A CG1   1 
ATOM   383  C  CG2   . VAL A 1 87  ? -24.030 5.109   -2.850  1.00 26.59  ? 197  VAL A CG2   1 
ATOM   384  N  N     . LEU A 1 88  ? -26.309 6.873   -5.841  1.00 19.51  ? 198  LEU A N     1 
ATOM   385  C  CA    . LEU A 1 88  ? -27.729 6.676   -6.146  1.00 18.50  ? 198  LEU A CA    1 
ATOM   386  C  C     . LEU A 1 88  ? -27.905 5.899   -7.454  1.00 20.45  ? 198  LEU A C     1 
ATOM   387  O  O     . LEU A 1 88  ? -28.814 5.080   -7.548  1.00 18.93  ? 198  LEU A O     1 
ATOM   388  C  CB    . LEU A 1 88  ? -28.494 8.016   -6.200  1.00 17.89  ? 198  LEU A CB    1 
ATOM   389  C  CG    . LEU A 1 88  ? -28.494 8.873   -4.944  1.00 22.42  ? 198  LEU A CG    1 
ATOM   390  C  CD1   . LEU A 1 88  ? -29.351 10.100  -5.148  1.00 23.69  ? 198  LEU A CD1   1 
ATOM   391  C  CD2   . LEU A 1 88  ? -29.047 8.116   -3.740  1.00 26.91  ? 198  LEU A CD2   1 
ATOM   392  N  N     . LYS A 1 89  ? -26.966 6.081   -8.415  1.00 16.91  ? 199  LYS A N     1 
ATOM   393  C  CA    . LYS A 1 89  ? -26.983 5.346   -9.697  1.00 15.81  ? 199  LYS A CA    1 
ATOM   394  C  C     . LYS A 1 89  ? -26.831 3.839   -9.473  1.00 21.25  ? 199  LYS A C     1 
ATOM   395  O  O     . LYS A 1 89  ? -27.306 3.079   -10.298 1.00 21.45  ? 199  LYS A O     1 
ATOM   396  C  CB    . LYS A 1 89  ? -25.882 5.843   -10.647 1.00 16.70  ? 199  LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 89  ? -26.195 7.230   -11.212 1.00 19.12  ? 199  LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 89  ? -25.119 7.759   -12.141 1.00 21.13  ? 199  LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 89  ? -25.597 9.117   -12.629 1.00 22.26  ? 199  LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 89  ? -24.505 9.895   -13.259 1.00 27.52  ? 199  LYS A NZ    1 
ATOM   401  N  N     . SER A 1 90  ? -26.185 3.416   -8.360  1.00 18.29  ? 200  SER A N     1 
ATOM   402  C  CA    . SER A 1 90  ? -25.938 2.001   -8.042  1.00 18.81  ? 200  SER A CA    1 
ATOM   403  C  C     . SER A 1 90  ? -27.145 1.311   -7.395  1.00 22.17  ? 200  SER A C     1 
ATOM   404  O  O     . SER A 1 90  ? -27.137 0.084   -7.240  1.00 21.03  ? 200  SER A O     1 
ATOM   405  C  CB    . SER A 1 90  ? -24.735 1.870   -7.104  1.00 21.98  ? 200  SER A CB    1 
ATOM   406  O  OG    . SER A 1 90  ? -25.057 2.181   -5.754  1.00 24.25  ? 200  SER A OG    1 
ATOM   407  N  N     . LEU A 1 91  ? -28.141 2.072   -6.954  1.00 20.92  ? 201  LEU A N     1 
ATOM   408  C  CA    . LEU A 1 91  ? -29.287 1.461   -6.255  1.00 22.42  ? 201  LEU A CA    1 
ATOM   409  C  C     . LEU A 1 91  ? -30.123 0.547   -7.147  1.00 25.46  ? 201  LEU A C     1 
ATOM   410  O  O     . LEU A 1 91  ? -30.335 0.860   -8.320  1.00 24.44  ? 201  LEU A O     1 
ATOM   411  C  CB    . LEU A 1 91  ? -30.193 2.517   -5.595  1.00 22.88  ? 201  LEU A CB    1 
ATOM   412  C  CG    . LEU A 1 91  ? -29.547 3.327   -4.456  1.00 27.87  ? 201  LEU A CG    1 
ATOM   413  C  CD1   . LEU A 1 91  ? -30.492 4.374   -3.934  1.00 27.35  ? 201  LEU A CD1   1 
ATOM   414  C  CD2   . LEU A 1 91  ? -29.055 2.420   -3.292  1.00 27.77  ? 201  LEU A CD2   1 
ATOM   415  N  N     . PRO A 1 92  ? -30.594 -0.606  -6.599  1.00 22.39  ? 202  PRO A N     1 
ATOM   416  C  CA    . PRO A 1 92  ? -31.430 -1.514  -7.406  1.00 22.66  ? 202  PRO A CA    1 
ATOM   417  C  C     . PRO A 1 92  ? -32.945 -1.162  -7.329  1.00 28.49  ? 202  PRO A C     1 
ATOM   418  O  O     . PRO A 1 92  ? -33.780 -1.905  -7.824  1.00 27.80  ? 202  PRO A O     1 
ATOM   419  C  CB    . PRO A 1 92  ? -31.138 -2.885  -6.767  1.00 24.40  ? 202  PRO A CB    1 
ATOM   420  C  CG    . PRO A 1 92  ? -30.928 -2.578  -5.295  1.00 27.33  ? 202  PRO A CG    1 
ATOM   421  C  CD    . PRO A 1 92  ? -30.379 -1.146  -5.231  1.00 23.78  ? 202  PRO A CD    1 
ATOM   422  N  N     . PHE A 1 93  ? -33.287 -0.052  -6.678  1.00 24.78  ? 203  PHE A N     1 
ATOM   423  C  CA    . PHE A 1 93  ? -34.665 0.396   -6.487  1.00 24.13  ? 203  PHE A CA    1 
ATOM   424  C  C     . PHE A 1 93  ? -34.729 1.943   -6.484  1.00 25.82  ? 203  PHE A C     1 
ATOM   425  O  O     . PHE A 1 93  ? -33.739 2.573   -6.145  1.00 24.94  ? 203  PHE A O     1 
ATOM   426  C  CB    . PHE A 1 93  ? -35.227 -0.174  -5.151  1.00 25.83  ? 203  PHE A CB    1 
ATOM   427  C  CG    . PHE A 1 93  ? -34.642 0.472   -3.916  1.00 26.74  ? 203  PHE A CG    1 
ATOM   428  C  CD1   . PHE A 1 93  ? -33.429 0.038   -3.389  1.00 30.17  ? 203  PHE A CD1   1 
ATOM   429  C  CD2   . PHE A 1 93  ? -35.275 1.552   -3.310  1.00 28.62  ? 203  PHE A CD2   1 
ATOM   430  C  CE1   . PHE A 1 93  ? -32.863 0.672   -2.277  1.00 30.79  ? 203  PHE A CE1   1 
ATOM   431  C  CE2   . PHE A 1 93  ? -34.701 2.193   -2.209  1.00 30.90  ? 203  PHE A CE2   1 
ATOM   432  C  CZ    . PHE A 1 93  ? -33.488 1.762   -1.717  1.00 29.60  ? 203  PHE A CZ    1 
ATOM   433  N  N     . PRO A 1 94  ? -35.896 2.565   -6.818  1.00 23.15  ? 204  PRO A N     1 
ATOM   434  C  CA    . PRO A 1 94  ? -35.998 4.032   -6.743  1.00 21.55  ? 204  PRO A CA    1 
ATOM   435  C  C     . PRO A 1 94  ? -36.255 4.546   -5.321  1.00 26.73  ? 204  PRO A C     1 
ATOM   436  O  O     . PRO A 1 94  ? -37.063 3.955   -4.595  1.00 26.88  ? 204  PRO A O     1 
ATOM   437  C  CB    . PRO A 1 94  ? -37.223 4.351   -7.615  1.00 23.64  ? 204  PRO A CB    1 
ATOM   438  C  CG    . PRO A 1 94  ? -38.081 3.125   -7.561  1.00 29.25  ? 204  PRO A CG    1 
ATOM   439  C  CD    . PRO A 1 94  ? -37.168 1.943   -7.261  1.00 24.89  ? 204  PRO A CD    1 
ATOM   440  N  N     . ILE A 1 95  ? -35.622 5.664   -4.938  1.00 23.39  ? 205  ILE A N     1 
ATOM   441  C  CA    . ILE A 1 95  ? -35.906 6.329   -3.652  1.00 23.68  ? 205  ILE A CA    1 
ATOM   442  C  C     . ILE A 1 95  ? -37.329 6.905   -3.746  1.00 26.31  ? 205  ILE A C     1 
ATOM   443  O  O     . ILE A 1 95  ? -37.613 7.635   -4.684  1.00 25.93  ? 205  ILE A O     1 
ATOM   444  C  CB    . ILE A 1 95  ? -34.856 7.451   -3.302  1.00 25.00  ? 205  ILE A CB    1 
ATOM   445  C  CG1   . ILE A 1 95  ? -33.377 6.913   -3.129  1.00 24.34  ? 205  ILE A CG1   1 
ATOM   446  C  CG2   . ILE A 1 95  ? -35.317 8.338   -2.114  1.00 24.93  ? 205  ILE A CG2   1 
ATOM   447  C  CD1   . ILE A 1 95  ? -33.119 6.015   -1.960  1.00 33.45  ? 205  ILE A CD1   1 
ATOM   448  N  N     . THR A 1 96  ? -38.213 6.597   -2.797  1.00 24.23  ? 206  THR A N     1 
ATOM   449  C  CA    . THR A 1 96  ? -39.581 7.157   -2.845  1.00 25.12  ? 206  THR A CA    1 
ATOM   450  C  C     . THR A 1 96  ? -39.915 7.910   -1.533  1.00 30.38  ? 206  THR A C     1 
ATOM   451  O  O     . THR A 1 96  ? -40.952 8.534   -1.441  1.00 31.43  ? 206  THR A O     1 
ATOM   452  C  CB    . THR A 1 96  ? -40.645 6.091   -3.216  1.00 28.17  ? 206  THR A CB    1 
ATOM   453  O  OG1   . THR A 1 96  ? -40.679 5.062   -2.220  1.00 27.60  ? 206  THR A OG1   1 
ATOM   454  C  CG2   . THR A 1 96  ? -40.396 5.475   -4.589  1.00 26.53  ? 206  THR A CG2   1 
ATOM   455  N  N     . SER A 1 97  ? -39.024 7.867   -0.543  1.00 28.11  ? 207  SER A N     1 
ATOM   456  C  CA    . SER A 1 97  ? -39.165 8.571   0.730   1.00 28.30  ? 207  SER A CA    1 
ATOM   457  C  C     . SER A 1 97  ? -37.777 8.816   1.312   1.00 31.86  ? 207  SER A C     1 
ATOM   458  O  O     . SER A 1 97  ? -36.821 8.139   0.922   1.00 31.64  ? 207  SER A O     1 
ATOM   459  C  CB    . SER A 1 97  ? -40.036 7.777   1.709   1.00 32.31  ? 207  SER A CB    1 
ATOM   460  O  OG    . SER A 1 97  ? -39.385 6.599   2.161   1.00 38.56  ? 207  SER A OG    1 
ATOM   461  N  N     . MET A 1 98  ? -37.661 9.748   2.259   1.00 30.08  ? 208  MET A N     1 
ATOM   462  C  CA    . MET A 1 98  ? -36.361 10.044  2.880   1.00 30.16  ? 208  MET A CA    1 
ATOM   463  C  C     . MET A 1 98  ? -35.823 8.836   3.669   1.00 33.66  ? 208  MET A C     1 
ATOM   464  O  O     . MET A 1 98  ? -34.606 8.642   3.710   1.00 31.54  ? 208  MET A O     1 
ATOM   465  C  CB    . MET A 1 98  ? -36.432 11.283  3.772   1.00 33.28  ? 208  MET A CB    1 
ATOM   466  C  CG    . MET A 1 98  ? -36.463 12.573  2.986   1.00 36.77  ? 208  MET A CG    1 
ATOM   467  S  SD    . MET A 1 98  ? -35.112 12.826  1.781   1.00 39.40  ? 208  MET A SD    1 
ATOM   468  C  CE    . MET A 1 98  ? -33.624 12.647  2.855   1.00 35.34  ? 208  MET A CE    1 
ATOM   469  N  N     . LYS A 1 99  ? -36.734 7.991   4.225   1.00 30.26  ? 209  LYS A N     1 
ATOM   470  C  CA    . LYS A 1 99  ? -36.374 6.778   4.971   1.00 30.71  ? 209  LYS A CA    1 
ATOM   471  C  C     . LYS A 1 99  ? -35.536 5.830   4.110   1.00 31.53  ? 209  LYS A C     1 
ATOM   472  O  O     . LYS A 1 99  ? -34.608 5.214   4.638   1.00 32.68  ? 209  LYS A O     1 
ATOM   473  C  CB    . LYS A 1 99  ? -37.619 6.056   5.516   1.00 33.78  ? 209  LYS A CB    1 
ATOM   474  C  CG    . LYS A 1 99  ? -37.286 5.227   6.754   1.00 48.00  ? 209  LYS A CG    1 
ATOM   475  C  CD    . LYS A 1 99  ? -38.509 4.990   7.632   1.00 66.46  ? 209  LYS A CD    1 
ATOM   476  N  N     . ASP A 1 100 ? -35.801 5.791   2.782   1.00 25.21  ? 210  ASP A N     1 
ATOM   477  C  CA    . ASP A 1 100 ? -35.036 4.979   1.818   1.00 24.25  ? 210  ASP A CA    1 
ATOM   478  C  C     . ASP A 1 100 ? -33.554 5.397   1.709   1.00 30.46  ? 210  ASP A C     1 
ATOM   479  O  O     . ASP A 1 100 ? -32.751 4.612   1.201   1.00 30.17  ? 210  ASP A O     1 
ATOM   480  C  CB    . ASP A 1 100 ? -35.667 5.047   0.407   1.00 24.19  ? 210  ASP A CB    1 
ATOM   481  C  CG    . ASP A 1 100 ? -37.014 4.395   0.290   1.00 29.69  ? 210  ASP A CG    1 
ATOM   482  O  OD1   . ASP A 1 100 ? -37.810 4.834   -0.566  1.00 30.06  ? 210  ASP A OD1   1 
ATOM   483  O  OD2   . ASP A 1 100 ? -37.262 3.426   1.026   1.00 33.87  ? 210  ASP A OD2   1 
ATOM   484  N  N     . THR A 1 101 ? -33.185 6.617   2.169   1.00 29.23  ? 211  THR A N     1 
ATOM   485  C  CA    . THR A 1 101 ? -31.788 7.081   2.077   1.00 28.62  ? 211  THR A CA    1 
ATOM   486  C  C     . THR A 1 101 ? -30.942 6.626   3.280   1.00 35.07  ? 211  THR A C     1 
ATOM   487  O  O     . THR A 1 101 ? -29.728 6.862   3.278   1.00 34.92  ? 211  THR A O     1 
ATOM   488  C  CB    . THR A 1 101 ? -31.682 8.617   1.901   1.00 32.82  ? 211  THR A CB    1 
ATOM   489  O  OG1   . THR A 1 101 ? -32.048 9.288   3.113   1.00 26.34  ? 211  THR A OG1   1 
ATOM   490  C  CG2   . THR A 1 101 ? -32.475 9.143   0.712   1.00 28.40  ? 211  THR A CG2   1 
ATOM   491  N  N     . GLU A 1 102 ? -31.577 6.000   4.308   1.00 33.89  ? 212  GLU A N     1 
ATOM   492  C  CA    . GLU A 1 102 ? -30.873 5.532   5.512   1.00 35.42  ? 212  GLU A CA    1 
ATOM   493  C  C     . GLU A 1 102 ? -29.821 4.480   5.174   1.00 39.59  ? 212  GLU A C     1 
ATOM   494  O  O     . GLU A 1 102 ? -30.095 3.542   4.421   1.00 38.97  ? 212  GLU A O     1 
ATOM   495  C  CB    . GLU A 1 102 ? -31.854 4.973   6.550   1.00 38.71  ? 212  GLU A CB    1 
ATOM   496  C  CG    . GLU A 1 102 ? -32.651 6.054   7.269   1.00 52.89  ? 212  GLU A CG    1 
ATOM   497  C  CD    . GLU A 1 102 ? -33.633 5.586   8.328   1.00 77.10  ? 212  GLU A CD    1 
ATOM   498  O  OE1   . GLU A 1 102 ? -33.405 4.511   8.929   1.00 67.29  ? 212  GLU A OE1   1 
ATOM   499  O  OE2   . GLU A 1 102 ? -34.608 6.325   8.591   1.00 72.45  ? 212  GLU A OE2   1 
ATOM   500  N  N     . GLY A 1 103 ? -28.614 4.675   5.698   1.00 36.09  ? 213  GLY A N     1 
ATOM   501  C  CA    . GLY A 1 103 ? -27.508 3.754   5.474   1.00 35.34  ? 213  GLY A CA    1 
ATOM   502  C  C     . GLY A 1 103 ? -26.779 3.945   4.163   1.00 37.87  ? 213  GLY A C     1 
ATOM   503  O  O     . GLY A 1 103 ? -25.800 3.249   3.918   1.00 39.86  ? 213  GLY A O     1 
ATOM   504  N  N     . ILE A 1 104 ? -27.237 4.874   3.299   1.00 32.06  ? 214  ILE A N     1 
ATOM   505  C  CA    . ILE A 1 104 ? -26.543 5.133   2.034   1.00 29.87  ? 214  ILE A CA    1 
ATOM   506  C  C     . ILE A 1 104 ? -25.394 6.135   2.313   1.00 31.32  ? 214  ILE A C     1 
ATOM   507  O  O     . ILE A 1 104 ? -25.641 7.214   2.863   1.00 29.60  ? 214  ILE A O     1 
ATOM   508  C  CB    . ILE A 1 104 ? -27.489 5.611   0.891   1.00 31.32  ? 214  ILE A CB    1 
ATOM   509  C  CG1   . ILE A 1 104 ? -28.649 4.611   0.658   1.00 31.69  ? 214  ILE A CG1   1 
ATOM   510  C  CG2   . ILE A 1 104 ? -26.709 5.866   -0.410  1.00 30.10  ? 214  ILE A CG2   1 
ATOM   511  C  CD1   . ILE A 1 104 ? -29.724 5.090   -0.321  1.00 37.21  ? 214  ILE A CD1   1 
ATOM   512  N  N     . PRO A 1 105 ? -24.131 5.784   1.972   1.00 27.68  ? 215  PRO A N     1 
ATOM   513  C  CA    . PRO A 1 105 ? -23.021 6.744   2.193   1.00 28.28  ? 215  PRO A CA    1 
ATOM   514  C  C     . PRO A 1 105 ? -23.037 7.877   1.150   1.00 31.65  ? 215  PRO A C     1 
ATOM   515  O  O     . PRO A 1 105 ? -23.798 7.819   0.185   1.00 29.65  ? 215  PRO A O     1 
ATOM   516  C  CB    . PRO A 1 105 ? -21.774 5.865   2.036   1.00 29.70  ? 215  PRO A CB    1 
ATOM   517  C  CG    . PRO A 1 105 ? -22.190 4.831   1.031   1.00 32.27  ? 215  PRO A CG    1 
ATOM   518  C  CD    . PRO A 1 105 ? -23.654 4.549   1.314   1.00 27.80  ? 215  PRO A CD    1 
ATOM   519  N  N     . CYS A 1 106 ? -22.179 8.893   1.338   1.00 31.73  ? 216  CYS A N     1 
ATOM   520  C  CA    . CYS A 1 106 ? -21.957 10.028  0.429   1.00 32.65  ? 216  CYS A CA    1 
ATOM   521  C  C     . CYS A 1 106 ? -23.200 10.922  0.267   1.00 34.64  ? 216  CYS A C     1 
ATOM   522  O  O     . CYS A 1 106 ? -23.327 11.612  -0.752  1.00 33.50  ? 216  CYS A O     1 
ATOM   523  C  CB    . CYS A 1 106 ? -21.446 9.545   -0.928  1.00 33.47  ? 216  CYS A CB    1 
ATOM   524  S  SG    . CYS A 1 106 ? -20.105 8.322   -0.829  1.00 38.48  ? 216  CYS A SG    1 
ATOM   525  N  N     . LEU A 1 107 ? -24.092 10.925  1.268   1.00 31.01  ? 217  LEU A N     1 
ATOM   526  C  CA    . LEU A 1 107 ? -25.299 11.750  1.244   1.00 30.24  ? 217  LEU A CA    1 
ATOM   527  C  C     . LEU A 1 107 ? -25.280 12.703  2.416   1.00 35.88  ? 217  LEU A C     1 
ATOM   528  O  O     . LEU A 1 107 ? -25.862 12.424  3.464   1.00 37.35  ? 217  LEU A O     1 
ATOM   529  C  CB    . LEU A 1 107 ? -26.617 10.928  1.228   1.00 28.89  ? 217  LEU A CB    1 
ATOM   530  C  CG    . LEU A 1 107 ? -26.838 9.854   0.146   1.00 30.24  ? 217  LEU A CG    1 
ATOM   531  C  CD1   . LEU A 1 107 ? -28.227 9.239   0.292   1.00 29.75  ? 217  LEU A CD1   1 
ATOM   532  C  CD2   . LEU A 1 107 ? -26.657 10.395  -1.263  1.00 26.76  ? 217  LEU A CD2   1 
ATOM   533  N  N     . GLY A 1 108 ? -24.615 13.829  2.217   1.00 32.82  ? 218  GLY A N     1 
ATOM   534  C  CA    . GLY A 1 108 ? -24.554 14.907  3.195   1.00 34.48  ? 218  GLY A CA    1 
ATOM   535  C  C     . GLY A 1 108 ? -25.883 15.634  3.346   1.00 38.23  ? 218  GLY A C     1 
ATOM   536  O  O     . GLY A 1 108 ? -26.837 15.358  2.619   1.00 36.62  ? 218  GLY A O     1 
ATOM   537  N  N     . ASP A 1 109 ? -25.954 16.570  4.299   1.00 37.86  ? 219  ASP A N     1 
ATOM   538  C  CA    . ASP A 1 109 ? -27.147 17.363  4.598   1.00 39.03  ? 219  ASP A CA    1 
ATOM   539  C  C     . ASP A 1 109 ? -27.636 18.179  3.398   1.00 41.11  ? 219  ASP A C     1 
ATOM   540  O  O     . ASP A 1 109 ? -28.839 18.183  3.149   1.00 40.50  ? 219  ASP A O     1 
ATOM   541  C  CB    . ASP A 1 109 ? -26.900 18.279  5.811   1.00 43.78  ? 219  ASP A CB    1 
ATOM   542  C  CG    . ASP A 1 109 ? -26.980 17.545  7.148   1.00 58.21  ? 219  ASP A CG    1 
ATOM   543  O  OD1   . ASP A 1 109 ? -27.388 16.356  7.156   1.00 55.64  ? 219  ASP A OD1   1 
ATOM   544  O  OD2   . ASP A 1 109 ? -26.622 18.155  8.183   1.00 71.74  ? 219  ASP A OD2   1 
ATOM   545  N  N     . LYS A 1 110 ? -26.726 18.834  2.644   1.00 37.16  ? 220  LYS A N     1 
ATOM   546  C  CA    . LYS A 1 110 ? -27.080 19.603  1.442   1.00 35.86  ? 220  LYS A CA    1 
ATOM   547  C  C     . LYS A 1 110 ? -27.746 18.687  0.401   1.00 35.86  ? 220  LYS A C     1 
ATOM   548  O  O     . LYS A 1 110 ? -28.804 19.032  -0.117  1.00 35.53  ? 220  LYS A O     1 
ATOM   549  C  CB    . LYS A 1 110 ? -25.840 20.294  0.837   1.00 39.23  ? 220  LYS A CB    1 
ATOM   550  C  CG    . LYS A 1 110 ? -26.106 21.197  -0.382  1.00 55.08  ? 220  LYS A CG    1 
ATOM   551  C  CD    . LYS A 1 110 ? -26.774 22.528  -0.013  1.00 72.77  ? 220  LYS A CD    1 
ATOM   552  C  CE    . LYS A 1 110 ? -28.103 22.754  -0.712  1.00 79.18  ? 220  LYS A CE    1 
ATOM   553  N  NZ    . LYS A 1 110 ? -29.169 21.826  -0.233  1.00 84.34  ? 220  LYS A NZ    1 
ATOM   554  N  N     . VAL A 1 111 ? -27.156 17.506  0.144   1.00 29.24  ? 221  VAL A N     1 
ATOM   555  C  CA    . VAL A 1 111 ? -27.668 16.531  -0.824  1.00 25.66  ? 221  VAL A CA    1 
ATOM   556  C  C     . VAL A 1 111 ? -29.060 16.032  -0.386  1.00 30.58  ? 221  VAL A C     1 
ATOM   557  O  O     . VAL A 1 111 ? -29.970 15.970  -1.220  1.00 29.97  ? 221  VAL A O     1 
ATOM   558  C  CB    . VAL A 1 111 ? -26.663 15.357  -1.046  1.00 25.56  ? 221  VAL A CB    1 
ATOM   559  C  CG1   . VAL A 1 111 ? -27.320 14.188  -1.763  1.00 22.66  ? 221  VAL A CG1   1 
ATOM   560  C  CG2   . VAL A 1 111 ? -25.446 15.834  -1.829  1.00 24.93  ? 221  VAL A CG2   1 
ATOM   561  N  N     . LYS A 1 112 ? -29.226 15.700  0.904   1.00 28.19  ? 222  LYS A N     1 
ATOM   562  C  CA    . LYS A 1 112 ? -30.498 15.211  1.430   1.00 27.76  ? 222  LYS A CA    1 
ATOM   563  C  C     . LYS A 1 112 ? -31.608 16.267  1.303   1.00 31.95  ? 222  LYS A C     1 
ATOM   564  O  O     . LYS A 1 112 ? -32.761 15.887  1.059   1.00 30.91  ? 222  LYS A O     1 
ATOM   565  C  CB    . LYS A 1 112 ? -30.353 14.720  2.877   1.00 30.94  ? 222  LYS A CB    1 
ATOM   566  C  CG    . LYS A 1 112 ? -29.655 13.369  2.915   1.00 35.35  ? 222  LYS A CG    1 
ATOM   567  C  CD    . LYS A 1 112 ? -29.716 12.702  4.256   1.00 41.34  ? 222  LYS A CD    1 
ATOM   568  C  CE    . LYS A 1 112 ? -29.103 11.332  4.124   1.00 53.89  ? 222  LYS A CE    1 
ATOM   569  N  NZ    . LYS A 1 112 ? -28.515 10.862  5.398   1.00 66.75  ? 222  LYS A NZ    1 
ATOM   570  N  N     . SER A 1 113 ? -31.261 17.575  1.379   1.00 29.03  ? 223  SER A N     1 
ATOM   571  C  CA    . SER A 1 113 ? -32.251 18.645  1.183   1.00 30.38  ? 223  SER A CA    1 
ATOM   572  C  C     . SER A 1 113 ? -32.736 18.625  -0.266  1.00 32.49  ? 223  SER A C     1 
ATOM   573  O  O     . SER A 1 113 ? -33.923 18.792  -0.509  1.00 31.78  ? 223  SER A O     1 
ATOM   574  C  CB    . SER A 1 113 ? -31.667 20.017  1.519   1.00 36.62  ? 223  SER A CB    1 
ATOM   575  O  OG    . SER A 1 113 ? -31.094 20.042  2.813   1.00 50.14  ? 223  SER A OG    1 
ATOM   576  N  N     . ILE A 1 114 ? -31.819 18.399  -1.220  1.00 28.90  ? 224  ILE A N     1 
ATOM   577  C  CA    . ILE A 1 114 ? -32.155 18.337  -2.645  1.00 28.51  ? 224  ILE A CA    1 
ATOM   578  C  C     . ILE A 1 114 ? -33.072 17.121  -2.918  1.00 29.46  ? 224  ILE A C     1 
ATOM   579  O  O     . ILE A 1 114 ? -34.077 17.272  -3.615  1.00 28.42  ? 224  ILE A O     1 
ATOM   580  C  CB    . ILE A 1 114 ? -30.880 18.351  -3.536  1.00 30.76  ? 224  ILE A CB    1 
ATOM   581  C  CG1   . ILE A 1 114 ? -30.296 19.791  -3.571  1.00 32.69  ? 224  ILE A CG1   1 
ATOM   582  C  CG2   . ILE A 1 114 ? -31.167 17.840  -4.976  1.00 28.54  ? 224  ILE A CG2   1 
ATOM   583  C  CD1   . ILE A 1 114 ? -28.813 19.840  -3.397  1.00 43.96  ? 224  ILE A CD1   1 
ATOM   584  N  N     . ILE A 1 115 ? -32.746 15.949  -2.337  1.00 24.92  ? 225  ILE A N     1 
ATOM   585  C  CA    . ILE A 1 115 ? -33.552 14.720  -2.488  1.00 22.99  ? 225  ILE A CA    1 
ATOM   586  C  C     . ILE A 1 115 ? -34.972 14.975  -1.940  1.00 25.03  ? 225  ILE A C     1 
ATOM   587  O  O     . ILE A 1 115 ? -35.956 14.645  -2.615  1.00 25.11  ? 225  ILE A O     1 
ATOM   588  C  CB    . ILE A 1 115 ? -32.843 13.523  -1.800  1.00 25.11  ? 225  ILE A CB    1 
ATOM   589  C  CG1   . ILE A 1 115 ? -31.504 13.187  -2.517  1.00 25.01  ? 225  ILE A CG1   1 
ATOM   590  C  CG2   . ILE A 1 115 ? -33.780 12.288  -1.708  1.00 25.59  ? 225  ILE A CG2   1 
ATOM   591  C  CD1   . ILE A 1 115 ? -30.533 12.119  -1.763  1.00 24.75  ? 225  ILE A CD1   1 
ATOM   592  N  N     . GLU A 1 116 ? -35.066 15.597  -0.743  1.00 21.88  ? 226  GLU A N     1 
ATOM   593  C  CA    . GLU A 1 116 ? -36.333 15.917  -0.073  1.00 23.58  ? 226  GLU A CA    1 
ATOM   594  C  C     . GLU A 1 116 ? -37.248 16.788  -0.963  1.00 29.81  ? 226  GLU A C     1 
ATOM   595  O  O     . GLU A 1 116 ? -38.448 16.513  -1.052  1.00 29.59  ? 226  GLU A O     1 
ATOM   596  C  CB    . GLU A 1 116 ? -36.049 16.611  1.266   1.00 25.50  ? 226  GLU A CB    1 
ATOM   597  C  CG    . GLU A 1 116 ? -37.263 17.050  2.056   1.00 34.69  ? 226  GLU A CG    1 
ATOM   598  C  CD    . GLU A 1 116 ? -36.855 17.873  3.256   1.00 54.48  ? 226  GLU A CD    1 
ATOM   599  O  OE1   . GLU A 1 116 ? -36.636 19.096  3.097   1.00 48.67  ? 226  GLU A OE1   1 
ATOM   600  O  OE2   . GLU A 1 116 ? -36.646 17.271  4.333   1.00 49.51  ? 226  GLU A OE2   1 
ATOM   601  N  N     . GLY A 1 117 ? -36.668 17.818  -1.592  1.00 27.02  ? 227  GLY A N     1 
ATOM   602  C  CA    . GLY A 1 117 ? -37.370 18.714  -2.506  1.00 26.59  ? 227  GLY A CA    1 
ATOM   603  C  C     . GLY A 1 117 ? -37.907 18.016  -3.748  1.00 30.63  ? 227  GLY A C     1 
ATOM   604  O  O     . GLY A 1 117 ? -38.991 18.354  -4.217  1.00 32.31  ? 227  GLY A O     1 
ATOM   605  N  N     . ILE A 1 118 ? -37.160 17.048  -4.298  1.00 27.87  ? 228  ILE A N     1 
ATOM   606  C  CA    . ILE A 1 118 ? -37.579 16.257  -5.479  1.00 26.91  ? 228  ILE A CA    1 
ATOM   607  C  C     . ILE A 1 118 ? -38.726 15.301  -5.067  1.00 33.06  ? 228  ILE A C     1 
ATOM   608  O  O     . ILE A 1 118 ? -39.671 15.148  -5.824  1.00 35.59  ? 228  ILE A O     1 
ATOM   609  C  CB    . ILE A 1 118 ? -36.387 15.507  -6.158  1.00 27.02  ? 228  ILE A CB    1 
ATOM   610  C  CG1   . ILE A 1 118 ? -35.375 16.519  -6.719  1.00 26.19  ? 228  ILE A CG1   1 
ATOM   611  C  CG2   . ILE A 1 118 ? -36.891 14.576  -7.302  1.00 26.61  ? 228  ILE A CG2   1 
ATOM   612  C  CD1   . ILE A 1 118 ? -33.956 15.997  -7.023  1.00 24.70  ? 228  ILE A CD1   1 
ATOM   613  N  N     . ILE A 1 119 ? -38.659 14.691  -3.864  1.00 29.14  ? 229  ILE A N     1 
ATOM   614  C  CA    . ILE A 1 119 ? -39.714 13.811  -3.354  1.00 29.23  ? 229  ILE A CA    1 
ATOM   615  C  C     . ILE A 1 119 ? -41.015 14.632  -3.213  1.00 40.05  ? 229  ILE A C     1 
ATOM   616  O  O     . ILE A 1 119 ? -42.095 14.131  -3.555  1.00 40.98  ? 229  ILE A O     1 
ATOM   617  C  CB    . ILE A 1 119 ? -39.307 13.118  -2.018  1.00 30.92  ? 229  ILE A CB    1 
ATOM   618  C  CG1   . ILE A 1 119 ? -38.175 12.083  -2.244  1.00 28.97  ? 229  ILE A CG1   1 
ATOM   619  C  CG2   . ILE A 1 119 ? -40.542 12.461  -1.302  1.00 30.16  ? 229  ILE A CG2   1 
ATOM   620  C  CD1   . ILE A 1 119 ? -37.503 11.614  -1.003  1.00 29.01  ? 229  ILE A CD1   1 
ATOM   621  N  N     . GLU A 1 120 ? -40.891 15.898  -2.747  1.00 39.26  ? 230  GLU A N     1 
ATOM   622  C  CA    . GLU A 1 120 ? -42.003 16.831  -2.525  1.00 41.30  ? 230  GLU A CA    1 
ATOM   623  C  C     . GLU A 1 120 ? -42.888 17.061  -3.774  1.00 44.90  ? 230  GLU A C     1 
ATOM   624  O  O     . GLU A 1 120 ? -44.093 16.809  -3.701  1.00 45.36  ? 230  GLU A O     1 
ATOM   625  C  CB    . GLU A 1 120 ? -41.479 18.179  -2.015  1.00 43.72  ? 230  GLU A CB    1 
ATOM   626  C  CG    . GLU A 1 120 ? -41.766 18.412  -0.541  1.00 63.74  ? 230  GLU A CG    1 
ATOM   627  C  CD    . GLU A 1 120 ? -41.669 19.851  -0.068  1.00 103.74 ? 230  GLU A CD    1 
ATOM   628  O  OE1   . GLU A 1 120 ? -40.671 20.538  -0.392  1.00 102.51 ? 230  GLU A OE1   1 
ATOM   629  O  OE2   . GLU A 1 120 ? -42.619 20.299  0.613   1.00 108.02 ? 230  GLU A OE2   1 
ATOM   630  N  N     . ASP A 1 121 ? -42.309 17.516  -4.910  1.00 41.32  ? 231  ASP A N     1 
ATOM   631  C  CA    . ASP A 1 121 ? -43.123 17.822  -6.100  1.00 41.62  ? 231  ASP A CA    1 
ATOM   632  C  C     . ASP A 1 121 ? -42.532 17.293  -7.443  1.00 41.70  ? 231  ASP A C     1 
ATOM   633  O  O     . ASP A 1 121 ? -42.917 17.768  -8.510  1.00 41.57  ? 231  ASP A O     1 
ATOM   634  C  CB    . ASP A 1 121 ? -43.338 19.356  -6.181  1.00 44.44  ? 231  ASP A CB    1 
ATOM   635  C  CG    . ASP A 1 121 ? -42.059 20.176  -6.390  1.00 50.57  ? 231  ASP A CG    1 
ATOM   636  O  OD1   . ASP A 1 121 ? -40.956 19.570  -6.440  1.00 48.19  ? 231  ASP A OD1   1 
ATOM   637  O  OD2   . ASP A 1 121 ? -42.165 21.412  -6.539  1.00 53.39  ? 231  ASP A OD2   1 
ATOM   638  N  N     . GLY A 1 122 ? -41.607 16.343  -7.374  1.00 36.70  ? 232  GLY A N     1 
ATOM   639  C  CA    . GLY A 1 122 ? -41.006 15.738  -8.558  1.00 35.43  ? 232  GLY A CA    1 
ATOM   640  C  C     . GLY A 1 122 ? -39.979 16.565  -9.299  1.00 39.04  ? 232  GLY A C     1 
ATOM   641  O  O     . GLY A 1 122 ? -39.504 16.132  -10.353 1.00 39.44  ? 232  GLY A O     1 
ATOM   642  N  N     . GLU A 1 123 ? -39.611 17.739  -8.753  1.00 34.27  ? 233  GLU A N     1 
ATOM   643  C  CA    . GLU A 1 123 ? -38.642 18.669  -9.348  1.00 33.02  ? 233  GLU A CA    1 
ATOM   644  C  C     . GLU A 1 123 ? -37.598 19.143  -8.352  1.00 34.26  ? 233  GLU A C     1 
ATOM   645  O  O     . GLU A 1 123 ? -37.863 19.213  -7.160  1.00 36.63  ? 233  GLU A O     1 
ATOM   646  C  CB    . GLU A 1 123 ? -39.374 19.924  -9.883  1.00 35.71  ? 233  GLU A CB    1 
ATOM   647  C  CG    . GLU A 1 123 ? -40.157 19.720  -11.169 1.00 48.73  ? 233  GLU A CG    1 
ATOM   648  C  CD    . GLU A 1 123 ? -40.853 20.976  -11.651 1.00 76.78  ? 233  GLU A CD    1 
ATOM   649  O  OE1   . GLU A 1 123 ? -40.197 21.797  -12.332 1.00 80.98  ? 233  GLU A OE1   1 
ATOM   650  O  OE2   . GLU A 1 123 ? -42.045 21.160  -11.313 1.00 72.28  ? 233  GLU A OE2   1 
ATOM   651  N  N     . SER A 1 124 ? -36.445 19.557  -8.850  1.00 28.26  ? 234  SER A N     1 
ATOM   652  C  CA    . SER A 1 124 ? -35.403 20.183  -8.055  1.00 27.40  ? 234  SER A CA    1 
ATOM   653  C  C     . SER A 1 124 ? -35.391 21.662  -8.381  1.00 33.12  ? 234  SER A C     1 
ATOM   654  O  O     . SER A 1 124 ? -35.076 22.023  -9.522  1.00 33.26  ? 234  SER A O     1 
ATOM   655  C  CB    . SER A 1 124 ? -34.036 19.569  -8.339  1.00 28.63  ? 234  SER A CB    1 
ATOM   656  O  OG    . SER A 1 124 ? -33.020 20.291  -7.659  1.00 33.56  ? 234  SER A OG    1 
ATOM   657  N  N     . SER A 1 125 ? -35.771 22.518  -7.411  1.00 29.94  ? 235  SER A N     1 
ATOM   658  C  CA    . SER A 1 125 ? -35.757 23.971  -7.604  1.00 31.17  ? 235  SER A CA    1 
ATOM   659  C  C     . SER A 1 125 ? -34.311 24.463  -7.836  1.00 34.75  ? 235  SER A C     1 
ATOM   660  O  O     . SER A 1 125 ? -34.086 25.366  -8.646  1.00 34.69  ? 235  SER A O     1 
ATOM   661  C  CB    . SER A 1 125 ? -36.380 24.685  -6.408  1.00 35.41  ? 235  SER A CB    1 
ATOM   662  O  OG    . SER A 1 125 ? -35.609 24.520  -5.230  1.00 42.33  ? 235  SER A OG    1 
ATOM   663  N  N     . GLU A 1 126 ? -33.343 23.849  -7.131  1.00 30.35  ? 236  GLU A N     1 
ATOM   664  C  CA    . GLU A 1 126 ? -31.909 24.169  -7.223  1.00 30.78  ? 236  GLU A CA    1 
ATOM   665  C  C     . GLU A 1 126 ? -31.381 23.869  -8.629  1.00 33.28  ? 236  GLU A C     1 
ATOM   666  O  O     . GLU A 1 126 ? -30.702 24.724  -9.200  1.00 33.55  ? 236  GLU A O     1 
ATOM   667  C  CB    . GLU A 1 126 ? -31.076 23.400  -6.165  1.00 31.76  ? 236  GLU A CB    1 
ATOM   668  C  CG    . GLU A 1 126 ? -31.528 23.558  -4.714  1.00 36.16  ? 236  GLU A CG    1 
ATOM   669  C  CD    . GLU A 1 126 ? -32.653 22.647  -4.230  1.00 50.47  ? 236  GLU A CD    1 
ATOM   670  O  OE1   . GLU A 1 126 ? -33.022 22.747  -3.038  1.00 54.25  ? 236  GLU A OE1   1 
ATOM   671  O  OE2   . GLU A 1 126 ? -33.149 21.817  -5.026  1.00 36.24  ? 236  GLU A OE2   1 
ATOM   672  N  N     . ALA A 1 127 ? -31.697 22.662  -9.191  1.00 28.08  ? 237  ALA A N     1 
ATOM   673  C  CA    . ALA A 1 127 ? -31.236 22.296  -10.545 1.00 26.94  ? 237  ALA A CA    1 
ATOM   674  C  C     . ALA A 1 127 ? -31.963 23.150  -11.618 1.00 31.06  ? 237  ALA A C     1 
ATOM   675  O  O     . ALA A 1 127 ? -31.354 23.517  -12.620 1.00 30.02  ? 237  ALA A O     1 
ATOM   676  C  CB    . ALA A 1 127 ? -31.447 20.809  -10.808 1.00 25.91  ? 237  ALA A CB    1 
ATOM   677  N  N     . LYS A 1 128 ? -33.253 23.477  -11.378 1.00 28.61  ? 238  LYS A N     1 
ATOM   678  C  CA    . LYS A 1 128 ? -34.076 24.316  -12.259 1.00 29.19  ? 238  LYS A CA    1 
ATOM   679  C  C     . LYS A 1 128 ? -33.455 25.720  -12.381 1.00 32.61  ? 238  LYS A C     1 
ATOM   680  O  O     . LYS A 1 128 ? -33.379 26.243  -13.485 1.00 30.10  ? 238  LYS A O     1 
ATOM   681  C  CB    . LYS A 1 128 ? -35.520 24.404  -11.735 1.00 33.20  ? 238  LYS A CB    1 
ATOM   682  C  CG    . LYS A 1 128 ? -36.519 24.942  -12.750 1.00 54.65  ? 238  LYS A CG    1 
ATOM   683  C  CD    . LYS A 1 128 ? -37.953 24.698  -12.305 1.00 67.95  ? 238  LYS A CD    1 
ATOM   684  N  N     . ALA A 1 129 ? -32.959 26.287  -11.258 1.00 31.29  ? 239  ALA A N     1 
ATOM   685  C  CA    . ALA A 1 129 ? -32.311 27.596  -11.240 1.00 33.64  ? 239  ALA A CA    1 
ATOM   686  C  C     . ALA A 1 129 ? -30.991 27.570  -12.026 1.00 34.61  ? 239  ALA A C     1 
ATOM   687  O  O     . ALA A 1 129 ? -30.682 28.540  -12.723 1.00 34.02  ? 239  ALA A O     1 
ATOM   688  C  CB    . ALA A 1 129 ? -32.083 28.062  -9.805  1.00 35.48  ? 239  ALA A CB    1 
ATOM   689  N  N     . VAL A 1 130 ? -30.246 26.451  -11.968 1.00 30.20  ? 240  VAL A N     1 
ATOM   690  C  CA    . VAL A 1 130 ? -28.999 26.297  -12.733 1.00 28.87  ? 240  VAL A CA    1 
ATOM   691  C  C     . VAL A 1 130 ? -29.331 26.249  -14.257 1.00 30.30  ? 240  VAL A C     1 
ATOM   692  O  O     . VAL A 1 130 ? -28.671 26.918  -15.062 1.00 29.71  ? 240  VAL A O     1 
ATOM   693  C  CB    . VAL A 1 130 ? -28.182 25.049  -12.273 1.00 31.34  ? 240  VAL A CB    1 
ATOM   694  C  CG1   . VAL A 1 130 ? -27.031 24.765  -13.213 1.00 29.96  ? 240  VAL A CG1   1 
ATOM   695  C  CG2   . VAL A 1 130 ? -27.666 25.208  -10.844 1.00 31.63  ? 240  VAL A CG2   1 
ATOM   696  N  N     . LEU A 1 131 ? -30.362 25.481  -14.635 1.00 26.39  ? 241  LEU A N     1 
ATOM   697  C  CA    . LEU A 1 131 ? -30.799 25.319  -16.028 1.00 25.68  ? 241  LEU A CA    1 
ATOM   698  C  C     . LEU A 1 131 ? -31.272 26.640  -16.658 1.00 32.77  ? 241  LEU A C     1 
ATOM   699  O  O     . LEU A 1 131 ? -31.196 26.797  -17.883 1.00 34.08  ? 241  LEU A O     1 
ATOM   700  C  CB    . LEU A 1 131 ? -31.911 24.272  -16.126 1.00 24.18  ? 241  LEU A CB    1 
ATOM   701  C  CG    . LEU A 1 131 ? -31.501 22.806  -15.948 1.00 26.20  ? 241  LEU A CG    1 
ATOM   702  C  CD1   . LEU A 1 131 ? -32.728 21.884  -16.054 1.00 25.62  ? 241  LEU A CD1   1 
ATOM   703  C  CD2   . LEU A 1 131 ? -30.385 22.384  -16.953 1.00 24.29  ? 241  LEU A CD2   1 
ATOM   704  N  N     . ASN A 1 132 ? -31.730 27.585  -15.820 1.00 30.49  ? 242  ASN A N     1 
ATOM   705  C  CA    . ASN A 1 132 ? -32.183 28.904  -16.247 1.00 33.97  ? 242  ASN A CA    1 
ATOM   706  C  C     . ASN A 1 132 ? -31.078 29.979  -16.118 1.00 39.18  ? 242  ASN A C     1 
ATOM   707  O  O     . ASN A 1 132 ? -31.266 31.090  -16.603 1.00 41.36  ? 242  ASN A O     1 
ATOM   708  C  CB    . ASN A 1 132 ? -33.435 29.317  -15.468 1.00 36.78  ? 242  ASN A CB    1 
ATOM   709  C  CG    . ASN A 1 132 ? -34.645 28.496  -15.857 1.00 65.37  ? 242  ASN A CG    1 
ATOM   710  O  OD1   . ASN A 1 132 ? -35.020 28.408  -17.040 1.00 56.35  ? 242  ASN A OD1   1 
ATOM   711  N  ND2   . ASN A 1 132 ? -35.268 27.854  -14.874 1.00 60.30  ? 242  ASN A ND2   1 
ATOM   712  N  N     . ASP A 1 133 ? -29.939 29.648  -15.495 1.00 34.28  ? 243  ASP A N     1 
ATOM   713  C  CA    . ASP A 1 133 ? -28.814 30.583  -15.329 1.00 34.98  ? 243  ASP A CA    1 
ATOM   714  C  C     . ASP A 1 133 ? -28.140 30.844  -16.677 1.00 39.03  ? 243  ASP A C     1 
ATOM   715  O  O     . ASP A 1 133 ? -27.849 29.901  -17.410 1.00 37.00  ? 243  ASP A O     1 
ATOM   716  C  CB    . ASP A 1 133 ? -27.804 30.030  -14.309 1.00 35.06  ? 243  ASP A CB    1 
ATOM   717  C  CG    . ASP A 1 133 ? -26.602 30.913  -14.092 1.00 42.88  ? 243  ASP A CG    1 
ATOM   718  O  OD1   . ASP A 1 133 ? -26.757 31.979  -13.456 1.00 47.11  ? 243  ASP A OD1   1 
ATOM   719  O  OD2   . ASP A 1 133 ? -25.506 30.541  -14.556 1.00 41.77  ? 243  ASP A OD2   1 
ATOM   720  N  N     . GLU A 1 134 ? -27.904 32.116  -17.003 1.00 32.87  ? 244  GLU A N     1 
ATOM   721  C  CA    . GLU A 1 134 ? -27.319 32.533  -18.285 1.00 30.75  ? 244  GLU A CA    1 
ATOM   722  C  C     . GLU A 1 134 ? -25.895 32.065  -18.475 1.00 30.93  ? 244  GLU A C     1 
ATOM   723  O  O     . GLU A 1 134 ? -25.567 31.656  -19.583 1.00 28.78  ? 244  GLU A O     1 
ATOM   724  C  CB    . GLU A 1 134 ? -27.410 34.047  -18.477 1.00 31.91  ? 244  GLU A CB    1 
ATOM   725  C  CG    . GLU A 1 134 ? -28.851 34.496  -18.642 1.00 45.65  ? 244  GLU A CG    1 
ATOM   726  C  CD    . GLU A 1 134 ? -29.630 33.970  -19.841 1.00 66.73  ? 244  GLU A CD    1 
ATOM   727  O  OE1   . GLU A 1 134 ? -29.111 34.016  -20.983 1.00 63.36  ? 244  GLU A OE1   1 
ATOM   728  O  OE2   . GLU A 1 134 ? -30.806 33.591  -19.638 1.00 58.31  ? 244  GLU A OE2   1 
ATOM   729  N  N     . ARG A 1 135 ? -25.058 32.105  -17.422 1.00 28.26  ? 245  ARG A N     1 
ATOM   730  C  CA    . ARG A 1 135 ? -23.679 31.635  -17.502 1.00 28.48  ? 245  ARG A CA    1 
ATOM   731  C  C     . ARG A 1 135 ? -23.661 30.116  -17.744 1.00 31.69  ? 245  ARG A C     1 
ATOM   732  O  O     . ARG A 1 135 ? -22.912 29.643  -18.606 1.00 31.78  ? 245  ARG A O     1 
ATOM   733  C  CB    . ARG A 1 135 ? -22.897 32.004  -16.232 1.00 30.63  ? 245  ARG A CB    1 
ATOM   734  C  CG    . ARG A 1 135 ? -21.405 31.697  -16.300 1.00 32.57  ? 245  ARG A CG    1 
ATOM   735  C  CD    . ARG A 1 135 ? -20.639 32.445  -15.227 1.00 46.15  ? 245  ARG A CD    1 
ATOM   736  N  NE    . ARG A 1 135 ? -19.470 31.697  -14.755 1.00 57.61  ? 245  ARG A NE    1 
ATOM   737  C  CZ    . ARG A 1 135 ? -18.247 31.808  -15.265 1.00 77.44  ? 245  ARG A CZ    1 
ATOM   738  N  NH1   . ARG A 1 135 ? -18.012 32.641  -16.271 1.00 75.69  ? 245  ARG A NH1   1 
ATOM   739  N  NH2   . ARG A 1 135 ? -17.249 31.087  -14.772 1.00 58.46  ? 245  ARG A NH2   1 
ATOM   740  N  N     . TYR A 1 136 ? -24.511 29.368  -17.025 1.00 26.04  ? 246  TYR A N     1 
ATOM   741  C  CA    . TYR A 1 136 ? -24.565 27.910  -17.174 1.00 24.44  ? 246  TYR A CA    1 
ATOM   742  C  C     . TYR A 1 136 ? -25.024 27.536  -18.583 1.00 27.63  ? 246  TYR A C     1 
ATOM   743  O  O     . TYR A 1 136 ? -24.404 26.688  -19.198 1.00 26.02  ? 246  TYR A O     1 
ATOM   744  C  CB    . TYR A 1 136 ? -25.453 27.260  -16.107 1.00 25.94  ? 246  TYR A CB    1 
ATOM   745  C  CG    . TYR A 1 136 ? -25.597 25.767  -16.289 1.00 28.55  ? 246  TYR A CG    1 
ATOM   746  C  CD1   . TYR A 1 136 ? -24.626 24.889  -15.810 1.00 31.26  ? 246  TYR A CD1   1 
ATOM   747  C  CD2   . TYR A 1 136 ? -26.693 25.230  -16.964 1.00 28.66  ? 246  TYR A CD2   1 
ATOM   748  C  CE1   . TYR A 1 136 ? -24.751 23.510  -15.980 1.00 33.84  ? 246  TYR A CE1   1 
ATOM   749  C  CE2   . TYR A 1 136 ? -26.822 23.853  -17.155 1.00 30.32  ? 246  TYR A CE2   1 
ATOM   750  C  CZ    . TYR A 1 136 ? -25.851 22.997  -16.659 1.00 37.57  ? 246  TYR A CZ    1 
ATOM   751  O  OH    . TYR A 1 136 ? -25.984 21.649  -16.855 1.00 36.47  ? 246  TYR A OH    1 
ATOM   752  N  N     . LYS A 1 137 ? -26.085 28.177  -19.097 1.00 26.83  ? 247  LYS A N     1 
ATOM   753  C  CA    . LYS A 1 137 ? -26.617 27.927  -20.450 1.00 25.89  ? 247  LYS A CA    1 
ATOM   754  C  C     . LYS A 1 137 ? -25.566 28.176  -21.517 1.00 28.06  ? 247  LYS A C     1 
ATOM   755  O  O     . LYS A 1 137 ? -25.396 27.331  -22.403 1.00 26.11  ? 247  LYS A O     1 
ATOM   756  C  CB    . LYS A 1 137 ? -27.845 28.791  -20.730 1.00 26.47  ? 247  LYS A CB    1 
ATOM   757  C  CG    . LYS A 1 137 ? -29.124 28.248  -20.090 1.00 36.88  ? 247  LYS A CG    1 
ATOM   758  C  CD    . LYS A 1 137 ? -30.357 29.031  -20.584 1.00 43.18  ? 247  LYS A CD    1 
ATOM   759  C  CE    . LYS A 1 137 ? -30.577 30.328  -19.838 1.00 52.14  ? 247  LYS A CE    1 
ATOM   760  N  NZ    . LYS A 1 137 ? -31.726 31.096  -20.388 1.00 53.83  ? 247  LYS A NZ    1 
ATOM   761  N  N     . SER A 1 138 ? -24.840 29.316  -21.408 1.00 24.74  ? 248  SER A N     1 
ATOM   762  C  CA    . SER A 1 138 ? -23.762 29.681  -22.335 1.00 24.12  ? 248  SER A CA    1 
ATOM   763  C  C     . SER A 1 138 ? -22.616 28.687  -22.291 1.00 25.79  ? 248  SER A C     1 
ATOM   764  O  O     . SER A 1 138 ? -22.153 28.290  -23.349 1.00 23.74  ? 248  SER A O     1 
ATOM   765  C  CB    . SER A 1 138 ? -23.230 31.074  -22.035 1.00 25.93  ? 248  SER A CB    1 
ATOM   766  O  OG    . SER A 1 138 ? -24.249 31.981  -22.387 1.00 38.57  ? 248  SER A OG    1 
ATOM   767  N  N     . PHE A 1 139 ? -22.172 28.277  -21.091 1.00 25.77  ? 249  PHE A N     1 
ATOM   768  C  CA    . PHE A 1 139 ? -21.064 27.315  -20.953 1.00 27.73  ? 249  PHE A CA    1 
ATOM   769  C  C     . PHE A 1 139 ? -21.420 25.977  -21.594 1.00 31.28  ? 249  PHE A C     1 
ATOM   770  O  O     . PHE A 1 139 ? -20.583 25.417  -22.298 1.00 31.67  ? 249  PHE A O     1 
ATOM   771  C  CB    . PHE A 1 139 ? -20.665 27.128  -19.473 1.00 32.10  ? 249  PHE A CB    1 
ATOM   772  C  CG    . PHE A 1 139 ? -19.998 25.809  -19.116 1.00 36.60  ? 249  PHE A CG    1 
ATOM   773  C  CD1   . PHE A 1 139 ? -18.674 25.557  -19.470 1.00 40.96  ? 249  PHE A CD1   1 
ATOM   774  C  CD2   . PHE A 1 139 ? -20.681 24.837  -18.384 1.00 41.54  ? 249  PHE A CD2   1 
ATOM   775  C  CE1   . PHE A 1 139 ? -18.063 24.338  -19.140 1.00 44.06  ? 249  PHE A CE1   1 
ATOM   776  C  CE2   . PHE A 1 139 ? -20.065 23.619  -18.054 1.00 45.36  ? 249  PHE A CE2   1 
ATOM   777  C  CZ    . PHE A 1 139 ? -18.760 23.381  -18.427 1.00 43.45  ? 249  PHE A CZ    1 
ATOM   778  N  N     . LYS A 1 140 ? -22.641 25.467  -21.356 1.00 27.33  ? 250  LYS A N     1 
ATOM   779  C  CA    . LYS A 1 140 ? -23.082 24.198  -21.931 1.00 28.09  ? 250  LYS A CA    1 
ATOM   780  C  C     . LYS A 1 140 ? -23.116 24.284  -23.453 1.00 29.74  ? 250  LYS A C     1 
ATOM   781  O  O     . LYS A 1 140 ? -22.622 23.389  -24.133 1.00 29.92  ? 250  LYS A O     1 
ATOM   782  C  CB    . LYS A 1 140 ? -24.484 23.796  -21.393 1.00 31.53  ? 250  LYS A CB    1 
ATOM   783  C  CG    . LYS A 1 140 ? -24.486 23.210  -19.982 1.00 43.97  ? 250  LYS A CG    1 
ATOM   784  C  CD    . LYS A 1 140 ? -23.542 22.021  -19.826 1.00 57.43  ? 250  LYS A CD    1 
ATOM   785  C  CE    . LYS A 1 140 ? -24.055 20.742  -20.449 1.00 72.52  ? 250  LYS A CE    1 
ATOM   786  N  NZ    . LYS A 1 140 ? -22.978 19.717  -20.526 1.00 88.28  ? 250  LYS A NZ    1 
ATOM   787  N  N     . LEU A 1 141 ? -23.691 25.371  -23.976 1.00 24.34  ? 251  LEU A N     1 
ATOM   788  C  CA    . LEU A 1 141 ? -23.838 25.575  -25.404 1.00 23.32  ? 251  LEU A CA    1 
ATOM   789  C  C     . LEU A 1 141 ? -22.488 25.719  -26.100 1.00 26.03  ? 251  LEU A C     1 
ATOM   790  O  O     . LEU A 1 141 ? -22.255 25.038  -27.100 1.00 26.11  ? 251  LEU A O     1 
ATOM   791  C  CB    . LEU A 1 141 ? -24.722 26.792  -25.675 1.00 23.11  ? 251  LEU A CB    1 
ATOM   792  C  CG    . LEU A 1 141 ? -24.978 27.162  -27.140 1.00 27.11  ? 251  LEU A CG    1 
ATOM   793  C  CD1   . LEU A 1 141 ? -25.780 26.045  -27.890 1.00 26.33  ? 251  LEU A CD1   1 
ATOM   794  C  CD2   . LEU A 1 141 ? -25.718 28.477  -27.225 1.00 28.88  ? 251  LEU A CD2   1 
ATOM   795  N  N     . PHE A 1 142 ? -21.593 26.563  -25.566 1.00 21.65  ? 252  PHE A N     1 
ATOM   796  C  CA    . PHE A 1 142 ? -20.294 26.810  -26.195 1.00 21.09  ? 252  PHE A CA    1 
ATOM   797  C  C     . PHE A 1 142 ? -19.375 25.589  -26.127 1.00 25.93  ? 252  PHE A C     1 
ATOM   798  O  O     . PHE A 1 142 ? -18.787 25.244  -27.147 1.00 24.64  ? 252  PHE A O     1 
ATOM   799  C  CB    . PHE A 1 142 ? -19.588 28.064  -25.620 1.00 22.44  ? 252  PHE A CB    1 
ATOM   800  C  CG    . PHE A 1 142 ? -20.343 29.380  -25.720 1.00 23.79  ? 252  PHE A CG    1 
ATOM   801  C  CD1   . PHE A 1 142 ? -19.946 30.486  -24.970 1.00 26.12  ? 252  PHE A CD1   1 
ATOM   802  C  CD2   . PHE A 1 142 ? -21.486 29.497  -26.519 1.00 25.45  ? 252  PHE A CD2   1 
ATOM   803  C  CE1   . PHE A 1 142 ? -20.642 31.696  -25.059 1.00 27.05  ? 252  PHE A CE1   1 
ATOM   804  C  CE2   . PHE A 1 142 ? -22.209 30.693  -26.566 1.00 28.37  ? 252  PHE A CE2   1 
ATOM   805  C  CZ    . PHE A 1 142 ? -21.774 31.785  -25.847 1.00 26.97  ? 252  PHE A CZ    1 
ATOM   806  N  N     . THR A 1 143 ? -19.286 24.913  -24.976 1.00 24.75  ? 253  THR A N     1 
ATOM   807  C  CA    . THR A 1 143 ? -18.427 23.731  -24.858 1.00 26.28  ? 253  THR A CA    1 
ATOM   808  C  C     . THR A 1 143 ? -19.013 22.497  -25.610 1.00 32.50  ? 253  THR A C     1 
ATOM   809  O  O     . THR A 1 143 ? -18.304 21.502  -25.757 1.00 32.41  ? 253  THR A O     1 
ATOM   810  C  CB    . THR A 1 143 ? -18.141 23.390  -23.400 1.00 30.50  ? 253  THR A CB    1 
ATOM   811  O  OG1   . THR A 1 143 ? -19.382 23.062  -22.753 1.00 28.67  ? 253  THR A OG1   1 
ATOM   812  C  CG2   . THR A 1 143 ? -17.383 24.526  -22.666 1.00 22.20  ? 253  THR A CG2   1 
ATOM   813  N  N     . SER A 1 144 ? -20.261 22.584  -26.140 1.00 29.19  ? 254  SER A N     1 
ATOM   814  C  CA    . SER A 1 144 ? -20.853 21.508  -26.953 1.00 29.28  ? 254  SER A CA    1 
ATOM   815  C  C     . SER A 1 144 ? -20.146 21.457  -28.338 1.00 31.99  ? 254  SER A C     1 
ATOM   816  O  O     . SER A 1 144 ? -20.340 20.508  -29.103 1.00 32.44  ? 254  SER A O     1 
ATOM   817  C  CB    . SER A 1 144 ? -22.367 21.687  -27.111 1.00 30.04  ? 254  SER A CB    1 
ATOM   818  O  OG    . SER A 1 144 ? -22.716 22.642  -28.109 1.00 26.38  ? 254  SER A OG    1 
ATOM   819  N  N     . VAL A 1 145 ? -19.325 22.477  -28.635 1.00 26.32  ? 255  VAL A N     1 
ATOM   820  C  CA    . VAL A 1 145 ? -18.521 22.565  -29.861 1.00 25.15  ? 255  VAL A CA    1 
ATOM   821  C  C     . VAL A 1 145 ? -17.172 21.868  -29.609 1.00 28.05  ? 255  VAL A C     1 
ATOM   822  O  O     . VAL A 1 145 ? -16.513 22.150  -28.604 1.00 25.88  ? 255  VAL A O     1 
ATOM   823  C  CB    . VAL A 1 145 ? -18.326 24.044  -30.329 1.00 26.42  ? 255  VAL A CB    1 
ATOM   824  C  CG1   . VAL A 1 145 ? -17.504 24.127  -31.616 1.00 25.19  ? 255  VAL A CG1   1 
ATOM   825  C  CG2   . VAL A 1 145 ? -19.665 24.748  -30.522 1.00 26.29  ? 255  VAL A CG2   1 
ATOM   826  N  N     . PHE A 1 146 ? -16.768 20.954  -30.522 1.00 25.38  ? 256  PHE A N     1 
ATOM   827  C  CA    . PHE A 1 146 ? -15.476 20.292  -30.437 1.00 25.86  ? 256  PHE A CA    1 
ATOM   828  C  C     . PHE A 1 146 ? -14.366 21.376  -30.586 1.00 29.74  ? 256  PHE A C     1 
ATOM   829  O  O     . PHE A 1 146 ? -14.409 22.188  -31.513 1.00 27.49  ? 256  PHE A O     1 
ATOM   830  C  CB    . PHE A 1 146 ? -15.366 19.180  -31.506 1.00 28.13  ? 256  PHE A CB    1 
ATOM   831  C  CG    . PHE A 1 146 ? -14.019 18.510  -31.676 1.00 30.59  ? 256  PHE A CG    1 
ATOM   832  C  CD1   . PHE A 1 146 ? -13.519 17.653  -30.699 1.00 33.01  ? 256  PHE A CD1   1 
ATOM   833  C  CD2   . PHE A 1 146 ? -13.279 18.680  -32.843 1.00 33.39  ? 256  PHE A CD2   1 
ATOM   834  C  CE1   . PHE A 1 146 ? -12.295 17.008  -30.874 1.00 34.39  ? 256  PHE A CE1   1 
ATOM   835  C  CE2   . PHE A 1 146 ? -12.060 18.000  -33.025 1.00 36.41  ? 256  PHE A CE2   1 
ATOM   836  C  CZ    . PHE A 1 146 ? -11.580 17.179  -32.037 1.00 34.29  ? 256  PHE A CZ    1 
ATOM   837  N  N     . GLY A 1 147 ? -13.463 21.432  -29.611 1.00 28.05  ? 257  GLY A N     1 
ATOM   838  C  CA    . GLY A 1 147 ? -12.374 22.410  -29.589 1.00 28.55  ? 257  GLY A CA    1 
ATOM   839  C  C     . GLY A 1 147 ? -12.602 23.583  -28.650 1.00 29.88  ? 257  GLY A C     1 
ATOM   840  O  O     . GLY A 1 147 ? -11.716 24.423  -28.487 1.00 28.44  ? 257  GLY A O     1 
ATOM   841  N  N     . VAL A 1 148 ? -13.790 23.648  -28.020 1.00 25.34  ? 258  VAL A N     1 
ATOM   842  C  CA    . VAL A 1 148 ? -14.120 24.729  -27.091 1.00 24.73  ? 258  VAL A CA    1 
ATOM   843  C  C     . VAL A 1 148 ? -14.185 24.153  -25.660 1.00 30.85  ? 258  VAL A C     1 
ATOM   844  O  O     . VAL A 1 148 ? -15.033 23.313  -25.372 1.00 29.96  ? 258  VAL A O     1 
ATOM   845  C  CB    . VAL A 1 148 ? -15.441 25.464  -27.476 1.00 24.89  ? 258  VAL A CB    1 
ATOM   846  C  CG1   . VAL A 1 148 ? -15.754 26.609  -26.489 1.00 23.60  ? 258  VAL A CG1   1 
ATOM   847  C  CG2   . VAL A 1 148 ? -15.381 25.976  -28.912 1.00 23.79  ? 258  VAL A CG2   1 
ATOM   848  N  N     . GLY A 1 149 ? -13.325 24.673  -24.788 1.00 29.39  ? 259  GLY A N     1 
ATOM   849  C  CA    . GLY A 1 149 ? -13.281 24.320  -23.376 1.00 29.64  ? 259  GLY A CA    1 
ATOM   850  C  C     . GLY A 1 149 ? -13.759 25.475  -22.513 1.00 33.20  ? 259  GLY A C     1 
ATOM   851  O  O     . GLY A 1 149 ? -14.240 26.489  -23.031 1.00 28.47  ? 259  GLY A O     1 
ATOM   852  N  N     . LEU A 1 150 ? -13.608 25.325  -21.186 1.00 32.59  ? 260  LEU A N     1 
ATOM   853  C  CA    . LEU A 1 150 ? -13.987 26.283  -20.149 1.00 32.81  ? 260  LEU A CA    1 
ATOM   854  C  C     . LEU A 1 150 ? -13.470 27.717  -20.382 1.00 34.50  ? 260  LEU A C     1 
ATOM   855  O  O     . LEU A 1 150 ? -14.245 28.659  -20.236 1.00 34.10  ? 260  LEU A O     1 
ATOM   856  C  CB    . LEU A 1 150 ? -13.474 25.793  -18.793 1.00 35.31  ? 260  LEU A CB    1 
ATOM   857  C  CG    . LEU A 1 150 ? -14.398 24.873  -18.021 1.00 42.82  ? 260  LEU A CG    1 
ATOM   858  C  CD1   . LEU A 1 150 ? -13.604 23.924  -17.161 1.00 45.27  ? 260  LEU A CD1   1 
ATOM   859  C  CD2   . LEU A 1 150 ? -15.313 25.672  -17.150 1.00 48.97  ? 260  LEU A CD2   1 
ATOM   860  N  N     . LYS A 1 151 ? -12.184 27.890  -20.719 1.00 30.70  ? 261  LYS A N     1 
ATOM   861  C  CA    . LYS A 1 151 ? -11.540 29.199  -20.918 1.00 29.95  ? 261  LYS A CA    1 
ATOM   862  C  C     . LYS A 1 151 ? -12.105 29.945  -22.120 1.00 30.85  ? 261  LYS A C     1 
ATOM   863  O  O     . LYS A 1 151 ? -12.406 31.132  -21.986 1.00 27.88  ? 261  LYS A O     1 
ATOM   864  C  CB    . LYS A 1 151 ? -10.015 29.065  -21.058 1.00 35.06  ? 261  LYS A CB    1 
ATOM   865  C  CG    . LYS A 1 151 ? -9.288  29.101  -19.725 1.00 60.94  ? 261  LYS A CG    1 
ATOM   866  C  CD    . LYS A 1 151 ? -7.837  28.688  -19.888 1.00 77.88  ? 261  LYS A CD    1 
ATOM   867  C  CE    . LYS A 1 151 ? -7.177  28.350  -18.568 1.00 87.19  ? 261  LYS A CE    1 
ATOM   868  N  NZ    . LYS A 1 151 ? -5.788  27.849  -18.754 1.00 95.45  ? 261  LYS A NZ    1 
ATOM   869  N  N     . THR A 1 152 ? -12.242 29.273  -23.292 1.00 27.43  ? 262  THR A N     1 
ATOM   870  C  CA    . THR A 1 152 ? -12.798 29.919  -24.497 1.00 26.16  ? 262  THR A CA    1 
ATOM   871  C  C     . THR A 1 152 ? -14.301 30.229  -24.292 1.00 28.65  ? 262  THR A C     1 
ATOM   872  O  O     . THR A 1 152 ? -14.760 31.283  -24.701 1.00 28.15  ? 262  THR A O     1 
ATOM   873  C  CB    . THR A 1 152 ? -12.550 29.040  -25.748 1.00 31.41  ? 262  THR A CB    1 
ATOM   874  O  OG1   . THR A 1 152 ? -11.150 28.782  -25.852 1.00 33.07  ? 262  THR A OG1   1 
ATOM   875  C  CG2   . THR A 1 152 ? -13.049 29.691  -27.033 1.00 26.24  ? 262  THR A CG2   1 
ATOM   876  N  N     . ALA A 1 153 ? -15.047 29.328  -23.636 1.00 26.46  ? 263  ALA A N     1 
ATOM   877  C  CA    . ALA A 1 153 ? -16.472 29.538  -23.365 1.00 25.19  ? 263  ALA A CA    1 
ATOM   878  C  C     . ALA A 1 153 ? -16.666 30.780  -22.459 1.00 29.04  ? 263  ALA A C     1 
ATOM   879  O  O     . ALA A 1 153 ? -17.558 31.578  -22.708 1.00 25.77  ? 263  ALA A O     1 
ATOM   880  C  CB    . ALA A 1 153 ? -17.069 28.304  -22.711 1.00 25.98  ? 263  ALA A CB    1 
ATOM   881  N  N     . GLU A 1 154 ? -15.796 30.944  -21.436 1.00 28.73  ? 264  GLU A N     1 
ATOM   882  C  CA    . GLU A 1 154 ? -15.812 32.077  -20.500 1.00 29.63  ? 264  GLU A CA    1 
ATOM   883  C  C     . GLU A 1 154 ? -15.487 33.364  -21.240 1.00 31.69  ? 264  GLU A C     1 
ATOM   884  O  O     . GLU A 1 154 ? -16.163 34.358  -21.024 1.00 29.41  ? 264  GLU A O     1 
ATOM   885  C  CB    . GLU A 1 154 ? -14.818 31.836  -19.366 1.00 32.99  ? 264  GLU A CB    1 
ATOM   886  C  CG    . GLU A 1 154 ? -14.840 32.856  -18.244 1.00 49.79  ? 264  GLU A CG    1 
ATOM   887  C  CD    . GLU A 1 154 ? -13.763 32.563  -17.215 1.00 93.43  ? 264  GLU A CD    1 
ATOM   888  O  OE1   . GLU A 1 154 ? -12.656 33.135  -17.340 1.00 97.33  ? 264  GLU A OE1   1 
ATOM   889  O  OE2   . GLU A 1 154 ? -13.998 31.713  -16.326 1.00 97.63  ? 264  GLU A OE2   1 
ATOM   890  N  N     . LYS A 1 155 ? -14.487 33.325  -22.140 1.00 28.85  ? 265  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 155 ? -14.074 34.456  -22.965 1.00 28.59  ? 265  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 155 ? -15.238 34.952  -23.823 1.00 30.29  ? 265  LYS A C     1 
ATOM   893  O  O     . LYS A 1 155 ? -15.519 36.144  -23.826 1.00 30.28  ? 265  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 155 ? -12.888 34.055  -23.850 1.00 31.72  ? 265  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 155 ? -12.472 35.111  -24.874 1.00 37.95  ? 265  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 155 ? -11.349 34.599  -25.772 1.00 54.97  ? 265  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 155 ? -11.257 35.359  -27.072 1.00 73.13  ? 265  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 155 ? -10.075 34.927  -27.865 1.00 83.47  ? 265  LYS A NZ    1 
ATOM   899  N  N     . TRP A 1 156 ? -15.929 34.044  -24.524 1.00 26.13  ? 266  TRP A N     1 
ATOM   900  C  CA    . TRP A 1 156 ? -17.025 34.399  -25.416 1.00 23.77  ? 266  TRP A CA    1 
ATOM   901  C  C     . TRP A 1 156 ? -18.194 34.969  -24.645 1.00 27.30  ? 266  TRP A C     1 
ATOM   902  O  O     . TRP A 1 156 ? -18.786 35.931  -25.115 1.00 27.07  ? 266  TRP A O     1 
ATOM   903  C  CB    . TRP A 1 156 ? -17.446 33.199  -26.277 1.00 22.03  ? 266  TRP A CB    1 
ATOM   904  C  CG    . TRP A 1 156 ? -16.425 32.831  -27.328 1.00 23.52  ? 266  TRP A CG    1 
ATOM   905  C  CD1   . TRP A 1 156 ? -15.365 33.587  -27.753 1.00 26.53  ? 266  TRP A CD1   1 
ATOM   906  C  CD2   . TRP A 1 156 ? -16.373 31.611  -28.080 1.00 22.97  ? 266  TRP A CD2   1 
ATOM   907  N  NE1   . TRP A 1 156 ? -14.661 32.912  -28.720 1.00 25.57  ? 266  TRP A NE1   1 
ATOM   908  C  CE2   . TRP A 1 156 ? -15.261 31.698  -28.946 1.00 26.12  ? 266  TRP A CE2   1 
ATOM   909  C  CE3   . TRP A 1 156 ? -17.166 30.443  -28.109 1.00 23.90  ? 266  TRP A CE3   1 
ATOM   910  C  CZ2   . TRP A 1 156 ? -14.916 30.663  -29.832 1.00 24.58  ? 266  TRP A CZ2   1 
ATOM   911  C  CZ3   . TRP A 1 156 ? -16.820 29.420  -28.991 1.00 24.64  ? 266  TRP A CZ3   1 
ATOM   912  C  CH2   . TRP A 1 156 ? -15.709 29.539  -29.837 1.00 24.93  ? 266  TRP A CH2   1 
ATOM   913  N  N     . PHE A 1 157 ? -18.491 34.421  -23.448 1.00 23.37  ? 267  PHE A N     1 
ATOM   914  C  CA    . PHE A 1 157 ? -19.555 34.907  -22.569 1.00 21.95  ? 267  PHE A CA    1 
ATOM   915  C  C     . PHE A 1 157 ? -19.261 36.355  -22.141 1.00 26.67  ? 267  PHE A C     1 
ATOM   916  O  O     . PHE A 1 157 ? -20.144 37.206  -22.216 1.00 25.58  ? 267  PHE A O     1 
ATOM   917  C  CB    . PHE A 1 157 ? -19.715 33.975  -21.333 1.00 23.17  ? 267  PHE A CB    1 
ATOM   918  C  CG    . PHE A 1 157 ? -20.735 34.435  -20.311 1.00 24.38  ? 267  PHE A CG    1 
ATOM   919  C  CD1   . PHE A 1 157 ? -22.097 34.217  -20.512 1.00 25.14  ? 267  PHE A CD1   1 
ATOM   920  C  CD2   . PHE A 1 157 ? -20.336 35.106  -19.155 1.00 26.80  ? 267  PHE A CD2   1 
ATOM   921  C  CE1   . PHE A 1 157 ? -23.042 34.625  -19.559 1.00 26.68  ? 267  PHE A CE1   1 
ATOM   922  C  CE2   . PHE A 1 157 ? -21.281 35.514  -18.202 1.00 29.29  ? 267  PHE A CE2   1 
ATOM   923  C  CZ    . PHE A 1 157 ? -22.631 35.282  -18.418 1.00 26.99  ? 267  PHE A CZ    1 
ATOM   924  N  N     . ARG A 1 158 ? -18.024 36.634  -21.697 1.00 25.77  ? 268  ARG A N     1 
ATOM   925  C  CA    . ARG A 1 158 ? -17.623 37.977  -21.252 1.00 26.91  ? 268  ARG A CA    1 
ATOM   926  C  C     . ARG A 1 158 ? -17.536 38.981  -22.427 1.00 29.63  ? 268  ARG A C     1 
ATOM   927  O  O     . ARG A 1 158 ? -17.548 40.192  -22.196 1.00 28.83  ? 268  ARG A O     1 
ATOM   928  C  CB    . ARG A 1 158 ? -16.313 37.918  -20.477 1.00 30.16  ? 268  ARG A CB    1 
ATOM   929  C  CG    . ARG A 1 158 ? -16.510 37.320  -19.088 1.00 39.80  ? 268  ARG A CG    1 
ATOM   930  C  CD    . ARG A 1 158 ? -15.202 37.245  -18.337 1.00 65.48  ? 268  ARG A CD    1 
ATOM   931  N  NE    . ARG A 1 158 ? -15.364 36.572  -17.050 1.00 91.12  ? 268  ARG A NE    1 
ATOM   932  C  CZ    . ARG A 1 158 ? -14.406 35.889  -16.433 1.00 116.81 ? 268  ARG A CZ    1 
ATOM   933  N  NH1   . ARG A 1 158 ? -14.647 35.297  -15.271 1.00 108.75 ? 268  ARG A NH1   1 
ATOM   934  N  NH2   . ARG A 1 158 ? -13.201 35.777  -16.983 1.00 109.12 ? 268  ARG A NH2   1 
ATOM   935  N  N     . MET A 1 159 ? -17.493 38.480  -23.675 1.00 25.85  ? 269  MET A N     1 
ATOM   936  C  CA    . MET A 1 159 ? -17.545 39.327  -24.863 1.00 25.63  ? 269  MET A CA    1 
ATOM   937  C  C     . MET A 1 159 ? -19.014 39.648  -25.221 1.00 30.06  ? 269  MET A C     1 
ATOM   938  O  O     . MET A 1 159 ? -19.263 40.492  -26.077 1.00 32.59  ? 269  MET A O     1 
ATOM   939  C  CB    . MET A 1 159 ? -16.835 38.664  -26.039 1.00 27.33  ? 269  MET A CB    1 
ATOM   940  C  CG    . MET A 1 159 ? -15.328 38.761  -25.950 1.00 31.69  ? 269  MET A CG    1 
ATOM   941  S  SD    . MET A 1 159 ? -14.535 37.851  -27.299 1.00 35.57  ? 269  MET A SD    1 
ATOM   942  C  CE    . MET A 1 159 ? -14.620 39.110  -28.645 1.00 32.89  ? 269  MET A CE    1 
ATOM   943  N  N     . GLY A 1 160 ? -19.962 38.991  -24.557 1.00 24.20  ? 270  GLY A N     1 
ATOM   944  C  CA    . GLY A 1 160 ? -21.386 39.213  -24.786 1.00 23.61  ? 270  GLY A CA    1 
ATOM   945  C  C     . GLY A 1 160 ? -22.057 38.213  -25.708 1.00 26.21  ? 270  GLY A C     1 
ATOM   946  O  O     . GLY A 1 160 ? -23.225 38.399  -26.034 1.00 25.65  ? 270  GLY A O     1 
ATOM   947  N  N     . PHE A 1 161 ? -21.335 37.163  -26.166 1.00 22.92  ? 271  PHE A N     1 
ATOM   948  C  CA    . PHE A 1 161 ? -21.941 36.142  -27.037 1.00 23.47  ? 271  PHE A CA    1 
ATOM   949  C  C     . PHE A 1 161 ? -22.853 35.217  -26.248 1.00 27.75  ? 271  PHE A C     1 
ATOM   950  O  O     . PHE A 1 161 ? -22.546 34.885  -25.097 1.00 26.36  ? 271  PHE A O     1 
ATOM   951  C  CB    . PHE A 1 161 ? -20.885 35.299  -27.770 1.00 24.99  ? 271  PHE A CB    1 
ATOM   952  C  CG    . PHE A 1 161 ? -20.060 36.082  -28.761 1.00 26.37  ? 271  PHE A CG    1 
ATOM   953  C  CD1   . PHE A 1 161 ? -20.566 36.397  -30.021 1.00 28.91  ? 271  PHE A CD1   1 
ATOM   954  C  CD2   . PHE A 1 161 ? -18.754 36.473  -28.450 1.00 27.44  ? 271  PHE A CD2   1 
ATOM   955  C  CE1   . PHE A 1 161 ? -19.786 37.113  -30.945 1.00 30.59  ? 271  PHE A CE1   1 
ATOM   956  C  CE2   . PHE A 1 161 ? -17.985 37.190  -29.369 1.00 30.54  ? 271  PHE A CE2   1 
ATOM   957  C  CZ    . PHE A 1 161 ? -18.498 37.502  -30.610 1.00 29.10  ? 271  PHE A CZ    1 
ATOM   958  N  N     . ARG A 1 162 ? -23.981 34.818  -26.862 1.00 23.92  ? 272  ARG A N     1 
ATOM   959  C  CA    . ARG A 1 162 ? -24.943 33.914  -26.231 1.00 24.51  ? 272  ARG A CA    1 
ATOM   960  C  C     . ARG A 1 162 ? -25.368 32.789  -27.175 1.00 29.47  ? 272  ARG A C     1 
ATOM   961  O  O     . ARG A 1 162 ? -25.997 31.824  -26.723 1.00 31.70  ? 272  ARG A O     1 
ATOM   962  C  CB    . ARG A 1 162 ? -26.215 34.693  -25.741 1.00 23.11  ? 272  ARG A CB    1 
ATOM   963  C  CG    . ARG A 1 162 ? -25.948 35.688  -24.614 1.00 27.47  ? 272  ARG A CG    1 
ATOM   964  C  CD    . ARG A 1 162 ? -25.381 35.040  -23.352 1.00 25.68  ? 272  ARG A CD    1 
ATOM   965  N  NE    . ARG A 1 162 ? -25.180 36.013  -22.279 1.00 26.17  ? 272  ARG A NE    1 
ATOM   966  C  CZ    . ARG A 1 162 ? -24.059 36.700  -22.056 1.00 31.57  ? 272  ARG A CZ    1 
ATOM   967  N  NH1   . ARG A 1 162 ? -23.988 37.553  -21.043 1.00 25.70  ? 272  ARG A NH1   1 
ATOM   968  N  NH2   . ARG A 1 162 ? -22.994 36.520  -22.826 1.00 21.02  ? 272  ARG A NH2   1 
ATOM   969  N  N     . THR A 1 163 ? -25.101 32.928  -28.491 1.00 24.21  ? 273  THR A N     1 
ATOM   970  C  CA    . THR A 1 163 ? -25.558 31.926  -29.453 1.00 23.66  ? 273  THR A CA    1 
ATOM   971  C  C     . THR A 1 163 ? -24.407 31.496  -30.353 1.00 27.13  ? 273  THR A C     1 
ATOM   972  O  O     . THR A 1 163 ? -23.505 32.281  -30.614 1.00 26.61  ? 273  THR A O     1 
ATOM   973  C  CB    . THR A 1 163 ? -26.755 32.429  -30.302 1.00 27.59  ? 273  THR A CB    1 
ATOM   974  O  OG1   . THR A 1 163 ? -26.287 33.446  -31.169 1.00 27.32  ? 273  THR A OG1   1 
ATOM   975  C  CG2   . THR A 1 163 ? -27.919 32.996  -29.473 1.00 26.66  ? 273  THR A CG2   1 
ATOM   976  N  N     . LEU A 1 164 ? -24.471 30.253  -30.862 1.00 22.97  ? 274  LEU A N     1 
ATOM   977  C  CA    . LEU A 1 164 ? -23.453 29.715  -31.762 1.00 22.64  ? 274  LEU A CA    1 
ATOM   978  C  C     . LEU A 1 164 ? -23.503 30.412  -33.114 1.00 25.07  ? 274  LEU A C     1 
ATOM   979  O  O     . LEU A 1 164 ? -22.452 30.636  -33.707 1.00 25.10  ? 274  LEU A O     1 
ATOM   980  C  CB    . LEU A 1 164 ? -23.584 28.192  -31.918 1.00 22.60  ? 274  LEU A CB    1 
ATOM   981  C  CG    . LEU A 1 164 ? -23.258 27.356  -30.650 1.00 26.70  ? 274  LEU A CG    1 
ATOM   982  C  CD1   . LEU A 1 164 ? -23.418 25.852  -30.941 1.00 26.66  ? 274  LEU A CD1   1 
ATOM   983  C  CD2   . LEU A 1 164 ? -21.845 27.693  -30.092 1.00 25.41  ? 274  LEU A CD2   1 
ATOM   984  N  N     . SER A 1 165 ? -24.696 30.784  -33.578 1.00 20.56  ? 275  SER A N     1 
ATOM   985  C  CA    . SER A 1 165 ? -24.897 31.546  -34.827 1.00 21.78  ? 275  SER A CA    1 
ATOM   986  C  C     . SER A 1 165 ? -24.087 32.873  -34.818 1.00 25.34  ? 275  SER A C     1 
ATOM   987  O  O     . SER A 1 165 ? -23.407 33.186  -35.804 1.00 24.69  ? 275  SER A O     1 
ATOM   988  C  CB    . SER A 1 165 ? -26.381 31.855  -35.004 1.00 25.21  ? 275  SER A CB    1 
ATOM   989  O  OG    . SER A 1 165 ? -26.610 32.587  -36.191 1.00 41.68  ? 275  SER A OG    1 
ATOM   990  N  N     . LYS A 1 166 ? -24.160 33.634  -33.694 1.00 21.39  ? 276  LYS A N     1 
ATOM   991  C  CA    . LYS A 1 166 ? -23.440 34.907  -33.557 1.00 21.67  ? 276  LYS A CA    1 
ATOM   992  C  C     . LYS A 1 166 ? -21.919 34.682  -33.465 1.00 26.15  ? 276  LYS A C     1 
ATOM   993  O  O     . LYS A 1 166 ? -21.154 35.505  -33.976 1.00 26.01  ? 276  LYS A O     1 
ATOM   994  C  CB    . LYS A 1 166 ? -23.925 35.703  -32.340 1.00 24.85  ? 276  LYS A CB    1 
ATOM   995  C  CG    . LYS A 1 166 ? -25.340 36.280  -32.455 1.00 39.19  ? 276  LYS A CG    1 
ATOM   996  C  CD    . LYS A 1 166 ? -25.384 37.650  -33.139 1.00 52.94  ? 276  LYS A CD    1 
ATOM   997  C  CE    . LYS A 1 166 ? -26.737 38.310  -33.056 1.00 60.10  ? 276  LYS A CE    1 
ATOM   998  N  NZ    . LYS A 1 166 ? -27.036 38.815  -31.685 1.00 69.38  ? 276  LYS A NZ    1 
ATOM   999  N  N     . ILE A 1 167 ? -21.480 33.577  -32.848 1.00 22.03  ? 277  ILE A N     1 
ATOM   1000 C  CA    . ILE A 1 167 ? -20.062 33.258  -32.738 1.00 21.78  ? 277  ILE A CA    1 
ATOM   1001 C  C     . ILE A 1 167 ? -19.493 32.944  -34.130 1.00 26.08  ? 277  ILE A C     1 
ATOM   1002 O  O     . ILE A 1 167 ? -18.508 33.558  -34.517 1.00 26.51  ? 277  ILE A O     1 
ATOM   1003 C  CB    . ILE A 1 167 ? -19.796 32.107  -31.706 1.00 24.22  ? 277  ILE A CB    1 
ATOM   1004 C  CG1   . ILE A 1 167 ? -20.036 32.627  -30.289 1.00 25.74  ? 277  ILE A CG1   1 
ATOM   1005 C  CG2   . ILE A 1 167 ? -18.368 31.532  -31.824 1.00 22.68  ? 277  ILE A CG2   1 
ATOM   1006 C  CD1   . ILE A 1 167 ? -20.465 31.578  -29.330 1.00 30.11  ? 277  ILE A CD1   1 
ATOM   1007 N  N     . GLN A 1 168 ? -20.122 32.019  -34.863 1.00 24.90  ? 278  GLN A N     1 
ATOM   1008 C  CA    . GLN A 1 168 ? -19.689 31.531  -36.181 1.00 26.10  ? 278  GLN A CA    1 
ATOM   1009 C  C     . GLN A 1 168 ? -19.645 32.590  -37.243 1.00 29.92  ? 278  GLN A C     1 
ATOM   1010 O  O     . GLN A 1 168 ? -18.808 32.511  -38.136 1.00 30.44  ? 278  GLN A O     1 
ATOM   1011 C  CB    . GLN A 1 168 ? -20.637 30.432  -36.686 1.00 27.40  ? 278  GLN A CB    1 
ATOM   1012 C  CG    . GLN A 1 168 ? -20.325 29.071  -36.186 1.00 46.92  ? 278  GLN A CG    1 
ATOM   1013 C  CD    . GLN A 1 168 ? -21.353 28.074  -36.670 1.00 60.80  ? 278  GLN A CD    1 
ATOM   1014 O  OE1   . GLN A 1 168 ? -22.481 27.989  -36.165 1.00 58.39  ? 278  GLN A OE1   1 
ATOM   1015 N  NE2   . GLN A 1 168 ? -20.996 27.324  -37.701 1.00 43.30  ? 278  GLN A NE2   1 
ATOM   1016 N  N     . SER A 1 169 ? -20.596 33.527  -37.212 1.00 25.84  ? 279  SER A N     1 
ATOM   1017 C  CA    . SER A 1 169 ? -20.696 34.557  -38.231 1.00 24.92  ? 279  SER A CA    1 
ATOM   1018 C  C     . SER A 1 169 ? -19.862 35.795  -37.903 1.00 26.18  ? 279  SER A C     1 
ATOM   1019 O  O     . SER A 1 169 ? -19.744 36.674  -38.758 1.00 25.34  ? 279  SER A O     1 
ATOM   1020 C  CB    . SER A 1 169 ? -22.163 34.948  -38.432 1.00 27.25  ? 279  SER A CB    1 
ATOM   1021 O  OG    . SER A 1 169 ? -22.742 35.468  -37.249 1.00 21.86  ? 279  SER A OG    1 
ATOM   1022 N  N     . ASP A 1 170 ? -19.278 35.878  -36.688 1.00 22.00  ? 280  ASP A N     1 
ATOM   1023 C  CA    . ASP A 1 170 ? -18.478 37.040  -36.281 1.00 21.79  ? 280  ASP A CA    1 
ATOM   1024 C  C     . ASP A 1 170 ? -17.215 37.178  -37.166 1.00 25.82  ? 280  ASP A C     1 
ATOM   1025 O  O     . ASP A 1 170 ? -16.560 36.182  -37.454 1.00 24.62  ? 280  ASP A O     1 
ATOM   1026 C  CB    . ASP A 1 170 ? -18.088 36.933  -34.802 1.00 22.90  ? 280  ASP A CB    1 
ATOM   1027 C  CG    . ASP A 1 170 ? -17.665 38.270  -34.254 1.00 29.94  ? 280  ASP A CG    1 
ATOM   1028 O  OD1   . ASP A 1 170 ? -16.452 38.565  -34.290 1.00 32.95  ? 280  ASP A OD1   1 
ATOM   1029 O  OD2   . ASP A 1 170 ? -18.553 39.037  -33.806 1.00 32.92  ? 280  ASP A OD2   1 
ATOM   1030 N  N     . LYS A 1 171 ? -16.922 38.393  -37.639 1.00 24.00  ? 281  LYS A N     1 
ATOM   1031 C  CA    . LYS A 1 171 ? -15.804 38.614  -38.550 1.00 24.79  ? 281  LYS A CA    1 
ATOM   1032 C  C     . LYS A 1 171 ? -14.501 38.955  -37.821 1.00 29.00  ? 281  LYS A C     1 
ATOM   1033 O  O     . LYS A 1 171 ? -13.469 39.002  -38.471 1.00 29.31  ? 281  LYS A O     1 
ATOM   1034 C  CB    . LYS A 1 171 ? -16.154 39.707  -39.585 1.00 28.18  ? 281  LYS A CB    1 
ATOM   1035 C  CG    . LYS A 1 171 ? -17.291 39.295  -40.539 1.00 35.18  ? 281  LYS A CG    1 
ATOM   1036 C  CD    . LYS A 1 171 ? -16.896 38.133  -41.489 1.00 40.44  ? 281  LYS A CD    1 
ATOM   1037 C  CE    . LYS A 1 171 ? -18.106 37.448  -42.070 1.00 49.59  ? 281  LYS A CE    1 
ATOM   1038 N  NZ    . LYS A 1 171 ? -17.756 36.551  -43.205 1.00 49.44  ? 281  LYS A NZ    1 
ATOM   1039 N  N     . SER A 1 172 ? -14.541 39.170  -36.494 1.00 25.49  ? 282  SER A N     1 
ATOM   1040 C  CA    . SER A 1 172 ? -13.352 39.526  -35.717 1.00 26.56  ? 282  SER A CA    1 
ATOM   1041 C  C     . SER A 1 172 ? -12.762 38.329  -34.976 1.00 29.25  ? 282  SER A C     1 
ATOM   1042 O  O     . SER A 1 172 ? -11.557 38.311  -34.741 1.00 29.74  ? 282  SER A O     1 
ATOM   1043 C  CB    . SER A 1 172 ? -13.666 40.641  -34.733 1.00 29.26  ? 282  SER A CB    1 
ATOM   1044 O  OG    . SER A 1 172 ? -13.904 41.829  -35.466 1.00 40.75  ? 282  SER A OG    1 
ATOM   1045 N  N     . LEU A 1 173 ? -13.597 37.338  -34.608 1.00 24.74  ? 283  LEU A N     1 
ATOM   1046 C  CA    . LEU A 1 173 ? -13.142 36.141  -33.898 1.00 23.96  ? 283  LEU A CA    1 
ATOM   1047 C  C     . LEU A 1 173 ? -12.187 35.302  -34.734 1.00 32.73  ? 283  LEU A C     1 
ATOM   1048 O  O     . LEU A 1 173 ? -12.344 35.212  -35.957 1.00 34.48  ? 283  LEU A O     1 
ATOM   1049 C  CB    . LEU A 1 173 ? -14.333 35.261  -33.458 1.00 21.53  ? 283  LEU A CB    1 
ATOM   1050 C  CG    . LEU A 1 173 ? -15.203 35.754  -32.296 1.00 22.81  ? 283  LEU A CG    1 
ATOM   1051 C  CD1   . LEU A 1 173 ? -16.259 34.724  -31.955 1.00 20.16  ? 283  LEU A CD1   1 
ATOM   1052 C  CD2   . LEU A 1 173 ? -14.362 36.106  -31.044 1.00 22.19  ? 283  LEU A CD2   1 
ATOM   1053 N  N     . ARG A 1 174 ? -11.200 34.684  -34.066 1.00 30.60  ? 284  ARG A N     1 
ATOM   1054 C  CA    . ARG A 1 174 ? -10.245 33.771  -34.683 1.00 31.30  ? 284  ARG A CA    1 
ATOM   1055 C  C     . ARG A 1 174 ? -10.402 32.425  -34.013 1.00 35.37  ? 284  ARG A C     1 
ATOM   1056 O  O     . ARG A 1 174 ? -10.456 32.332  -32.785 1.00 35.90  ? 284  ARG A O     1 
ATOM   1057 C  CB    . ARG A 1 174 ? -8.795  34.286  -34.604 1.00 30.23  ? 284  ARG A CB    1 
ATOM   1058 C  CG    . ARG A 1 174 ? -8.554  35.487  -35.519 1.00 38.72  ? 284  ARG A CG    1 
ATOM   1059 C  CD    . ARG A 1 174 ? -7.069  35.851  -35.690 1.00 47.54  ? 284  ARG A CD    1 
ATOM   1060 N  NE    . ARG A 1 174 ? -6.367  36.078  -34.419 1.00 58.60  ? 284  ARG A NE    1 
ATOM   1061 C  CZ    . ARG A 1 174 ? -6.338  37.235  -33.761 1.00 75.92  ? 284  ARG A CZ    1 
ATOM   1062 N  NH1   . ARG A 1 174 ? -6.974  38.298  -34.240 1.00 67.18  ? 284  ARG A NH1   1 
ATOM   1063 N  NH2   . ARG A 1 174 ? -5.690  37.331  -32.607 1.00 62.32  ? 284  ARG A NH2   1 
ATOM   1064 N  N     . PHE A 1 175 ? -10.509 31.384  -34.824 1.00 31.93  ? 285  PHE A N     1 
ATOM   1065 C  CA    . PHE A 1 175 ? -10.768 30.040  -34.350 1.00 30.32  ? 285  PHE A CA    1 
ATOM   1066 C  C     . PHE A 1 175 ? -9.589  29.113  -34.569 1.00 33.07  ? 285  PHE A C     1 
ATOM   1067 O  O     . PHE A 1 175 ? -8.929  29.185  -35.604 1.00 33.86  ? 285  PHE A O     1 
ATOM   1068 C  CB    . PHE A 1 175 ? -12.011 29.470  -35.063 1.00 30.80  ? 285  PHE A CB    1 
ATOM   1069 C  CG    . PHE A 1 175 ? -13.262 30.302  -34.920 1.00 30.65  ? 285  PHE A CG    1 
ATOM   1070 C  CD1   . PHE A 1 175 ? -13.644 31.188  -35.919 1.00 33.83  ? 285  PHE A CD1   1 
ATOM   1071 C  CD2   . PHE A 1 175 ? -14.050 30.211  -33.782 1.00 31.43  ? 285  PHE A CD2   1 
ATOM   1072 C  CE1   . PHE A 1 175 ? -14.812 31.960  -35.790 1.00 33.69  ? 285  PHE A CE1   1 
ATOM   1073 C  CE2   . PHE A 1 175 ? -15.217 30.976  -33.657 1.00 32.89  ? 285  PHE A CE2   1 
ATOM   1074 C  CZ    . PHE A 1 175 ? -15.588 31.845  -34.662 1.00 30.90  ? 285  PHE A CZ    1 
ATOM   1075 N  N     . THR A 1 176 ? -9.379  28.180  -33.627 1.00 27.17  ? 286  THR A N     1 
ATOM   1076 C  CA    . THR A 1 176 ? -8.339  27.149  -33.755 1.00 27.37  ? 286  THR A CA    1 
ATOM   1077 C  C     . THR A 1 176 ? -8.811  26.141  -34.820 1.00 29.90  ? 286  THR A C     1 
ATOM   1078 O  O     . THR A 1 176 ? -9.994  26.133  -35.165 1.00 28.38  ? 286  THR A O     1 
ATOM   1079 C  CB    . THR A 1 176 ? -8.040  26.478  -32.405 1.00 32.56  ? 286  THR A CB    1 
ATOM   1080 O  OG1   . THR A 1 176 ? -9.160  25.672  -31.993 1.00 26.69  ? 286  THR A OG1   1 
ATOM   1081 C  CG2   . THR A 1 176 ? -7.609  27.479  -31.317 1.00 29.81  ? 286  THR A CG2   1 
ATOM   1082 N  N     . GLN A 1 177 ? -7.910  25.312  -35.336 1.00 27.39  ? 287  GLN A N     1 
ATOM   1083 C  CA    . GLN A 1 177 ? -8.252  24.305  -36.346 1.00 28.27  ? 287  GLN A CA    1 
ATOM   1084 C  C     . GLN A 1 177 ? -9.263  23.300  -35.785 1.00 32.28  ? 287  GLN A C     1 
ATOM   1085 O  O     . GLN A 1 177 ? -10.176 22.877  -36.500 1.00 30.69  ? 287  GLN A O     1 
ATOM   1086 C  CB    . GLN A 1 177 ? -6.979  23.603  -36.854 1.00 30.95  ? 287  GLN A CB    1 
ATOM   1087 C  CG    . GLN A 1 177 ? -6.923  23.430  -38.382 1.00 55.20  ? 287  GLN A CG    1 
ATOM   1088 C  CD    . GLN A 1 177 ? -7.043  24.704  -39.208 1.00 74.89  ? 287  GLN A CD    1 
ATOM   1089 O  OE1   . GLN A 1 177 ? -6.642  25.800  -38.799 1.00 68.90  ? 287  GLN A OE1   1 
ATOM   1090 N  NE2   . GLN A 1 177 ? -7.596  24.580  -40.409 1.00 69.65  ? 287  GLN A NE2   1 
ATOM   1091 N  N     . MET A 1 178 ? -9.135  22.973  -34.479 1.00 30.04  ? 288  MET A N     1 
ATOM   1092 C  CA    . MET A 1 178 ? -10.044 22.088  -33.745 1.00 28.82  ? 288  MET A CA    1 
ATOM   1093 C  C     . MET A 1 178 ? -11.480 22.685  -33.707 1.00 29.30  ? 288  MET A C     1 
ATOM   1094 O  O     . MET A 1 178 ? -12.440 21.980  -34.012 1.00 29.08  ? 288  MET A O     1 
ATOM   1095 C  CB    . MET A 1 178 ? -9.497  21.858  -32.321 1.00 31.66  ? 288  MET A CB    1 
ATOM   1096 C  CG    . MET A 1 178 ? -9.953  20.559  -31.704 1.00 35.45  ? 288  MET A CG    1 
ATOM   1097 S  SD    . MET A 1 178 ? -9.454  20.286  -29.985 1.00 40.51  ? 288  MET A SD    1 
ATOM   1098 C  CE    . MET A 1 178 ? -7.645  20.381  -30.125 1.00 40.37  ? 288  MET A CE    1 
ATOM   1099 N  N     . GLN A 1 179 ? -11.609 24.006  -33.439 1.00 25.06  ? 289  GLN A N     1 
ATOM   1100 C  CA    . GLN A 1 179 ? -12.895 24.716  -33.376 1.00 23.74  ? 289  GLN A CA    1 
ATOM   1101 C  C     . GLN A 1 179 ? -13.552 24.800  -34.754 1.00 29.32  ? 289  GLN A C     1 
ATOM   1102 O  O     . GLN A 1 179 ? -14.768 24.608  -34.859 1.00 27.80  ? 289  GLN A O     1 
ATOM   1103 C  CB    . GLN A 1 179 ? -12.719 26.108  -32.778 1.00 23.96  ? 289  GLN A CB    1 
ATOM   1104 C  CG    . GLN A 1 179 ? -12.386 26.062  -31.290 1.00 28.07  ? 289  GLN A CG    1 
ATOM   1105 C  CD    . GLN A 1 179 ? -11.714 27.323  -30.800 1.00 32.68  ? 289  GLN A CD    1 
ATOM   1106 O  OE1   . GLN A 1 179 ? -11.529 28.286  -31.539 1.00 20.50  ? 289  GLN A OE1   1 
ATOM   1107 N  NE2   . GLN A 1 179 ? -11.366 27.354  -29.525 1.00 19.33  ? 289  GLN A NE2   1 
ATOM   1108 N  N     . LYS A 1 180 ? -12.738 25.028  -35.811 1.00 26.93  ? 290  LYS A N     1 
ATOM   1109 C  CA    . LYS A 1 180 ? -13.225 25.081  -37.198 1.00 27.45  ? 290  LYS A CA    1 
ATOM   1110 C  C     . LYS A 1 180 ? -13.912 23.754  -37.555 1.00 31.42  ? 290  LYS A C     1 
ATOM   1111 O  O     . LYS A 1 180 ? -15.025 23.760  -38.080 1.00 29.99  ? 290  LYS A O     1 
ATOM   1112 C  CB    . LYS A 1 180 ? -12.082 25.397  -38.175 1.00 31.22  ? 290  LYS A CB    1 
ATOM   1113 C  CG    . LYS A 1 180 ? -11.623 26.854  -38.128 1.00 36.73  ? 290  LYS A CG    1 
ATOM   1114 C  CD    . LYS A 1 180 ? -10.464 27.093  -39.075 1.00 43.43  ? 290  LYS A CD    1 
ATOM   1115 C  CE    . LYS A 1 180 ? -9.923  28.497  -38.961 1.00 52.38  ? 290  LYS A CE    1 
ATOM   1116 N  NZ    . LYS A 1 180 ? -8.809  28.741  -39.919 1.00 62.94  ? 290  LYS A NZ    1 
ATOM   1117 N  N     . ALA A 1 181 ? -13.266 22.614  -37.208 1.00 29.49  ? 291  ALA A N     1 
ATOM   1118 C  CA    . ALA A 1 181 ? -13.830 21.271  -37.413 1.00 28.83  ? 291  ALA A CA    1 
ATOM   1119 C  C     . ALA A 1 181 ? -15.085 21.085  -36.543 1.00 31.15  ? 291  ALA A C     1 
ATOM   1120 O  O     . ALA A 1 181 ? -16.090 20.561  -37.020 1.00 29.91  ? 291  ALA A O     1 
ATOM   1121 C  CB    . ALA A 1 181 ? -12.788 20.216  -37.086 1.00 30.41  ? 291  ALA A CB    1 
ATOM   1122 N  N     . GLY A 1 182 ? -15.031 21.576  -35.302 1.00 28.10  ? 292  GLY A N     1 
ATOM   1123 C  CA    . GLY A 1 182 ? -16.143 21.538  -34.358 1.00 26.36  ? 292  GLY A CA    1 
ATOM   1124 C  C     . GLY A 1 182 ? -17.383 22.232  -34.887 1.00 29.99  ? 292  GLY A C     1 
ATOM   1125 O  O     . GLY A 1 182 ? -18.491 21.718  -34.715 1.00 28.06  ? 292  GLY A O     1 
ATOM   1126 N  N     . PHE A 1 183 ? -17.207 23.398  -35.568 1.00 27.38  ? 293  PHE A N     1 
ATOM   1127 C  CA    . PHE A 1 183 ? -18.329 24.122  -36.159 1.00 26.85  ? 293  PHE A CA    1 
ATOM   1128 C  C     . PHE A 1 183 ? -18.790 23.491  -37.473 1.00 33.21  ? 293  PHE A C     1 
ATOM   1129 O  O     . PHE A 1 183 ? -20.002 23.354  -37.688 1.00 32.68  ? 293  PHE A O     1 
ATOM   1130 C  CB    . PHE A 1 183 ? -17.994 25.602  -36.369 1.00 28.09  ? 293  PHE A CB    1 
ATOM   1131 C  CG    . PHE A 1 183 ? -18.082 26.426  -35.112 1.00 28.25  ? 293  PHE A CG    1 
ATOM   1132 C  CD1   . PHE A 1 183 ? -16.959 27.070  -34.604 1.00 30.77  ? 293  PHE A CD1   1 
ATOM   1133 C  CD2   . PHE A 1 183 ? -19.282 26.541  -34.419 1.00 29.81  ? 293  PHE A CD2   1 
ATOM   1134 C  CE1   . PHE A 1 183 ? -17.031 27.804  -33.422 1.00 31.27  ? 293  PHE A CE1   1 
ATOM   1135 C  CE2   . PHE A 1 183 ? -19.369 27.327  -33.263 1.00 32.36  ? 293  PHE A CE2   1 
ATOM   1136 C  CZ    . PHE A 1 183 ? -18.236 27.935  -32.764 1.00 30.67  ? 293  PHE A CZ    1 
ATOM   1137 N  N     . LEU A 1 184 ? -17.837 23.090  -38.340 1.00 31.37  ? 294  LEU A N     1 
ATOM   1138 C  CA    . LEU A 1 184 ? -18.146 22.495  -39.643 1.00 31.99  ? 294  LEU A CA    1 
ATOM   1139 C  C     . LEU A 1 184 ? -18.977 21.195  -39.535 1.00 34.98  ? 294  LEU A C     1 
ATOM   1140 O  O     . LEU A 1 184 ? -19.900 20.996  -40.328 1.00 35.37  ? 294  LEU A O     1 
ATOM   1141 C  CB    . LEU A 1 184 ? -16.853 22.229  -40.435 1.00 32.96  ? 294  LEU A CB    1 
ATOM   1142 C  CG    . LEU A 1 184 ? -17.014 21.756  -41.905 1.00 39.88  ? 294  LEU A CG    1 
ATOM   1143 C  CD1   . LEU A 1 184 ? -17.888 22.745  -42.730 1.00 40.66  ? 294  LEU A CD1   1 
ATOM   1144 C  CD2   . LEU A 1 184 ? -15.664 21.571  -42.565 1.00 42.27  ? 294  LEU A CD2   1 
ATOM   1145 N  N     . TYR A 1 185 ? -18.641 20.322  -38.565 1.00 28.81  ? 295  TYR A N     1 
ATOM   1146 C  CA    . TYR A 1 185 ? -19.314 19.040  -38.374 1.00 27.73  ? 295  TYR A CA    1 
ATOM   1147 C  C     . TYR A 1 185 ? -20.218 19.039  -37.116 1.00 30.65  ? 295  TYR A C     1 
ATOM   1148 O  O     . TYR A 1 185 ? -20.588 17.969  -36.640 1.00 32.36  ? 295  TYR A O     1 
ATOM   1149 C  CB    . TYR A 1 185 ? -18.247 17.921  -38.295 1.00 28.16  ? 295  TYR A CB    1 
ATOM   1150 C  CG    . TYR A 1 185 ? -17.292 17.928  -39.471 1.00 30.03  ? 295  TYR A CG    1 
ATOM   1151 C  CD1   . TYR A 1 185 ? -15.949 18.264  -39.304 1.00 31.82  ? 295  TYR A CD1   1 
ATOM   1152 C  CD2   . TYR A 1 185 ? -17.752 17.708  -40.769 1.00 31.56  ? 295  TYR A CD2   1 
ATOM   1153 C  CE1   . TYR A 1 185 ? -15.076 18.324  -40.392 1.00 32.96  ? 295  TYR A CE1   1 
ATOM   1154 C  CE2   . TYR A 1 185 ? -16.896 17.795  -41.867 1.00 32.95  ? 295  TYR A CE2   1 
ATOM   1155 C  CZ    . TYR A 1 185 ? -15.557 18.094  -41.674 1.00 37.91  ? 295  TYR A CZ    1 
ATOM   1156 O  OH    . TYR A 1 185 ? -14.717 18.116  -42.760 1.00 35.21  ? 295  TYR A OH    1 
ATOM   1157 N  N     . TYR A 1 186 ? -20.621 20.229  -36.625 1.00 25.05  ? 296  TYR A N     1 
ATOM   1158 C  CA    . TYR A 1 186 ? -21.398 20.392  -35.395 1.00 24.08  ? 296  TYR A CA    1 
ATOM   1159 C  C     . TYR A 1 186 ? -22.650 19.488  -35.307 1.00 27.77  ? 296  TYR A C     1 
ATOM   1160 O  O     . TYR A 1 186 ? -22.795 18.776  -34.302 1.00 26.70  ? 296  TYR A O     1 
ATOM   1161 C  CB    . TYR A 1 186 ? -21.794 21.859  -35.161 1.00 23.14  ? 296  TYR A CB    1 
ATOM   1162 C  CG    . TYR A 1 186 ? -22.483 22.068  -33.830 1.00 23.65  ? 296  TYR A CG    1 
ATOM   1163 C  CD1   . TYR A 1 186 ? -21.744 22.234  -32.661 1.00 25.03  ? 296  TYR A CD1   1 
ATOM   1164 C  CD2   . TYR A 1 186 ? -23.880 22.061  -33.730 1.00 23.17  ? 296  TYR A CD2   1 
ATOM   1165 C  CE1   . TYR A 1 186 ? -22.372 22.372  -31.424 1.00 25.38  ? 296  TYR A CE1   1 
ATOM   1166 C  CE2   . TYR A 1 186 ? -24.519 22.192  -32.495 1.00 22.06  ? 296  TYR A CE2   1 
ATOM   1167 C  CZ    . TYR A 1 186 ? -23.759 22.366  -31.349 1.00 26.85  ? 296  TYR A CZ    1 
ATOM   1168 O  OH    . TYR A 1 186 ? -24.375 22.504  -30.134 1.00 28.50  ? 296  TYR A OH    1 
ATOM   1169 N  N     . GLU A 1 187 ? -23.560 19.551  -36.304 1.00 24.95  ? 297  GLU A N     1 
ATOM   1170 C  CA    . GLU A 1 187 ? -24.825 18.794  -36.277 1.00 24.58  ? 297  GLU A CA    1 
ATOM   1171 C  C     . GLU A 1 187 ? -24.585 17.291  -36.176 1.00 28.13  ? 297  GLU A C     1 
ATOM   1172 O  O     . GLU A 1 187 ? -25.245 16.647  -35.370 1.00 27.65  ? 297  GLU A O     1 
ATOM   1173 C  CB    . GLU A 1 187 ? -25.725 19.124  -37.470 1.00 26.35  ? 297  GLU A CB    1 
ATOM   1174 C  CG    . GLU A 1 187 ? -26.326 20.534  -37.393 1.00 41.05  ? 297  GLU A CG    1 
ATOM   1175 C  CD    . GLU A 1 187 ? -27.128 20.936  -36.160 1.00 70.34  ? 297  GLU A CD    1 
ATOM   1176 O  OE1   . GLU A 1 187 ? -27.859 20.080  -35.610 1.00 74.41  ? 297  GLU A OE1   1 
ATOM   1177 O  OE2   . GLU A 1 187 ? -27.053 22.124  -35.766 1.00 66.74  ? 297  GLU A OE2   1 
ATOM   1178 N  N     . ASP A 1 188 ? -23.615 16.749  -36.931 1.00 25.87  ? 298  ASP A N     1 
ATOM   1179 C  CA    . ASP A 1 188 ? -23.261 15.332  -36.872 1.00 26.72  ? 298  ASP A CA    1 
ATOM   1180 C  C     . ASP A 1 188 ? -22.683 14.955  -35.515 1.00 29.10  ? 298  ASP A C     1 
ATOM   1181 O  O     . ASP A 1 188 ? -23.118 13.963  -34.951 1.00 28.23  ? 298  ASP A O     1 
ATOM   1182 C  CB    . ASP A 1 188 ? -22.259 14.969  -37.978 1.00 29.33  ? 298  ASP A CB    1 
ATOM   1183 C  CG    . ASP A 1 188 ? -22.868 14.709  -39.339 1.00 38.63  ? 298  ASP A CG    1 
ATOM   1184 O  OD1   . ASP A 1 188 ? -24.114 14.749  -39.453 1.00 41.96  ? 298  ASP A OD1   1 
ATOM   1185 O  OD2   . ASP A 1 188 ? -22.106 14.435  -40.283 1.00 41.13  ? 298  ASP A OD2   1 
ATOM   1186 N  N     . LEU A 1 189 ? -21.730 15.755  -34.981 1.00 26.59  ? 299  LEU A N     1 
ATOM   1187 C  CA    . LEU A 1 189 ? -21.076 15.493  -33.703 1.00 26.57  ? 299  LEU A CA    1 
ATOM   1188 C  C     . LEU A 1 189 ? -22.032 15.631  -32.505 1.00 31.14  ? 299  LEU A C     1 
ATOM   1189 O  O     . LEU A 1 189 ? -21.912 14.859  -31.546 1.00 32.20  ? 299  LEU A O     1 
ATOM   1190 C  CB    . LEU A 1 189 ? -19.852 16.398  -33.499 1.00 25.87  ? 299  LEU A CB    1 
ATOM   1191 C  CG    . LEU A 1 189 ? -18.673 16.255  -34.511 1.00 30.79  ? 299  LEU A CG    1 
ATOM   1192 C  CD1   . LEU A 1 189 ? -17.426 16.960  -33.985 1.00 30.60  ? 299  LEU A CD1   1 
ATOM   1193 C  CD2   . LEU A 1 189 ? -18.357 14.785  -34.848 1.00 27.16  ? 299  LEU A CD2   1 
ATOM   1194 N  N     . VAL A 1 190 ? -23.005 16.537  -32.581 1.00 25.61  ? 300  VAL A N     1 
ATOM   1195 C  CA    . VAL A 1 190 ? -23.938 16.743  -31.481 1.00 27.21  ? 300  VAL A CA    1 
ATOM   1196 C  C     . VAL A 1 190 ? -25.050 15.654  -31.488 1.00 34.56  ? 300  VAL A C     1 
ATOM   1197 O  O     . VAL A 1 190 ? -25.635 15.397  -30.436 1.00 34.01  ? 300  VAL A O     1 
ATOM   1198 C  CB    . VAL A 1 190 ? -24.497 18.204  -31.434 1.00 31.27  ? 300  VAL A CB    1 
ATOM   1199 C  CG1   . VAL A 1 190 ? -25.730 18.383  -32.326 1.00 30.82  ? 300  VAL A CG1   1 
ATOM   1200 C  CG2   . VAL A 1 190 ? -24.793 18.625  -29.999 1.00 31.65  ? 300  VAL A CG2   1 
ATOM   1201 N  N     . SER A 1 191 ? -25.316 15.007  -32.643 1.00 34.50  ? 301  SER A N     1 
ATOM   1202 C  CA    . SER A 1 191 ? -26.259 13.889  -32.706 1.00 37.69  ? 301  SER A CA    1 
ATOM   1203 C  C     . SER A 1 191 ? -25.556 12.654  -32.093 1.00 46.47  ? 301  SER A C     1 
ATOM   1204 O  O     . SER A 1 191 ? -24.337 12.521  -32.197 1.00 46.54  ? 301  SER A O     1 
ATOM   1205 C  CB    . SER A 1 191 ? -26.731 13.638  -34.134 1.00 41.34  ? 301  SER A CB    1 
ATOM   1206 O  OG    . SER A 1 191 ? -25.730 13.057  -34.951 1.00 52.57  ? 301  SER A OG    1 
ATOM   1207 N  N     . CYS A 1 192 ? -26.269 11.813  -31.392 1.00 48.41  ? 302  CYS A N     1 
ATOM   1208 C  CA    . CYS A 1 192 ? -25.585 10.700  -30.729 1.00 52.86  ? 302  CYS A CA    1 
ATOM   1209 C  C     . CYS A 1 192 ? -24.972 9.672   -31.734 1.00 55.54  ? 302  CYS A C     1 
ATOM   1210 O  O     . CYS A 1 192 ? -25.645 9.312   -32.714 1.00 58.21  ? 302  CYS A O     1 
ATOM   1211 C  CB    . CYS A 1 192 ? -26.572 10.012  -29.786 1.00 56.93  ? 302  CYS A CB    1 
ATOM   1212 S  SG    . CYS A 1 192 ? -27.094 11.008  -28.354 1.00 61.87  ? 302  CYS A SG    1 
ATOM   1213 N  N     . VAL A 1 193 ? -23.735 9.159   -31.460 1.00 29.54  ? 303  VAL A N     1 
ATOM   1214 C  CA    . VAL A 1 193 ? -23.204 7.978   -32.187 1.00 25.34  ? 303  VAL A CA    1 
ATOM   1215 C  C     . VAL A 1 193 ? -23.977 6.769   -31.632 1.00 25.13  ? 303  VAL A C     1 
ATOM   1216 O  O     . VAL A 1 193 ? -24.033 6.621   -30.410 1.00 23.96  ? 303  VAL A O     1 
ATOM   1217 C  CB    . VAL A 1 193 ? -21.678 7.765   -32.066 1.00 27.35  ? 303  VAL A CB    1 
ATOM   1218 C  CG1   . VAL A 1 193 ? -21.215 6.533   -32.878 1.00 25.63  ? 303  VAL A CG1   1 
ATOM   1219 C  CG2   . VAL A 1 193 ? -20.909 9.009   -32.468 1.00 27.72  ? 303  VAL A CG2   1 
ATOM   1220 N  N     . ASN A 1 194 ? -24.601 5.938   -32.487 1.00 20.48  ? 304  ASN A N     1 
ATOM   1221 C  CA    . ASN A 1 194 ? -25.355 4.784   -31.994 1.00 19.75  ? 304  ASN A CA    1 
ATOM   1222 C  C     . ASN A 1 194 ? -24.487 3.482   -32.156 1.00 23.13  ? 304  ASN A C     1 
ATOM   1223 O  O     . ASN A 1 194 ? -23.374 3.563   -32.665 1.00 21.92  ? 304  ASN A O     1 
ATOM   1224 C  CB    . ASN A 1 194 ? -26.752 4.698   -32.672 1.00 17.25  ? 304  ASN A CB    1 
ATOM   1225 C  CG    . ASN A 1 194 ? -26.714 4.498   -34.168 1.00 31.21  ? 304  ASN A CG    1 
ATOM   1226 O  OD1   . ASN A 1 194 ? -25.741 4.017   -34.756 1.00 28.00  ? 304  ASN A OD1   1 
ATOM   1227 N  ND2   . ASN A 1 194 ? -27.791 4.813   -34.820 1.00 27.50  ? 304  ASN A ND2   1 
ATOM   1228 N  N     . ARG A 1 195 ? -24.975 2.307   -31.704 1.00 22.20  ? 305  ARG A N     1 
ATOM   1229 C  CA    . ARG A 1 195 ? -24.186 1.067   -31.760 1.00 21.07  ? 305  ARG A CA    1 
ATOM   1230 C  C     . ARG A 1 195 ? -23.900 0.616   -33.205 1.00 23.53  ? 305  ARG A C     1 
ATOM   1231 O  O     . ARG A 1 195 ? -22.740 0.308   -33.472 1.00 22.16  ? 305  ARG A O     1 
ATOM   1232 C  CB    . ARG A 1 195 ? -24.824 -0.036  -30.926 1.00 21.82  ? 305  ARG A CB    1 
ATOM   1233 C  CG    . ARG A 1 195 ? -24.713 0.243   -29.427 1.00 30.48  ? 305  ARG A CG    1 
ATOM   1234 C  CD    . ARG A 1 195 ? -25.403 -0.813  -28.586 1.00 34.11  ? 305  ARG A CD    1 
ATOM   1235 N  NE    . ARG A 1 195 ? -26.868 -0.764  -28.736 1.00 27.96  ? 305  ARG A NE    1 
ATOM   1236 C  CZ    . ARG A 1 195 ? -27.718 -1.260  -27.856 1.00 34.29  ? 305  ARG A CZ    1 
ATOM   1237 N  NH1   . ARG A 1 195 ? -27.273 -1.822  -26.743 1.00 32.41  ? 305  ARG A NH1   1 
ATOM   1238 N  NH2   . ARG A 1 195 ? -29.024 -1.189  -28.075 1.00 27.84  ? 305  ARG A NH2   1 
ATOM   1239 N  N     . PRO A 1 196 ? -24.860 0.642   -34.176 1.00 22.06  ? 306  PRO A N     1 
ATOM   1240 C  CA    . PRO A 1 196 ? -24.500 0.252   -35.561 1.00 22.57  ? 306  PRO A CA    1 
ATOM   1241 C  C     . PRO A 1 196 ? -23.381 1.134   -36.129 1.00 26.60  ? 306  PRO A C     1 
ATOM   1242 O  O     . PRO A 1 196 ? -22.490 0.610   -36.803 1.00 26.13  ? 306  PRO A O     1 
ATOM   1243 C  CB    . PRO A 1 196 ? -25.820 0.423   -36.325 1.00 22.79  ? 306  PRO A CB    1 
ATOM   1244 C  CG    . PRO A 1 196 ? -26.863 0.164   -35.273 1.00 25.91  ? 306  PRO A CG    1 
ATOM   1245 C  CD    . PRO A 1 196 ? -26.318 0.901   -34.087 1.00 21.83  ? 306  PRO A CD    1 
ATOM   1246 N  N     . GLU A 1 197 ? -23.383 2.451   -35.803 1.00 23.84  ? 307  GLU A N     1 
ATOM   1247 C  CA    . GLU A 1 197 ? -22.318 3.359   -36.245 1.00 22.95  ? 307  GLU A CA    1 
ATOM   1248 C  C     . GLU A 1 197 ? -20.985 3.023   -35.561 1.00 25.50  ? 307  GLU A C     1 
ATOM   1249 O  O     . GLU A 1 197 ? -19.942 2.987   -36.229 1.00 24.41  ? 307  GLU A O     1 
ATOM   1250 C  CB    . GLU A 1 197 ? -22.690 4.825   -35.975 1.00 24.31  ? 307  GLU A CB    1 
ATOM   1251 C  CG    . GLU A 1 197 ? -23.687 5.386   -36.972 1.00 28.90  ? 307  GLU A CG    1 
ATOM   1252 C  CD    . GLU A 1 197 ? -24.501 6.570   -36.497 1.00 36.20  ? 307  GLU A CD    1 
ATOM   1253 O  OE1   . GLU A 1 197 ? -24.306 7.029   -35.343 1.00 23.18  ? 307  GLU A OE1   1 
ATOM   1254 O  OE2   . GLU A 1 197 ? -25.350 7.033   -37.291 1.00 27.50  ? 307  GLU A OE2   1 
ATOM   1255 N  N     . ALA A 1 198 ? -21.018 2.747   -34.229 1.00 21.13  ? 308  ALA A N     1 
ATOM   1256 C  CA    . ALA A 1 198 ? -19.800 2.407   -33.486 1.00 19.89  ? 308  ALA A CA    1 
ATOM   1257 C  C     . ALA A 1 198 ? -19.167 1.134   -34.064 1.00 25.09  ? 308  ALA A C     1 
ATOM   1258 O  O     . ALA A 1 198 ? -17.943 1.076   -34.221 1.00 25.03  ? 308  ALA A O     1 
ATOM   1259 C  CB    . ALA A 1 198 ? -20.110 2.237   -32.008 1.00 19.33  ? 308  ALA A CB    1 
ATOM   1260 N  N     . GLU A 1 199 ? -20.007 0.143   -34.428 1.00 21.43  ? 309  GLU A N     1 
ATOM   1261 C  CA    . GLU A 1 199 ? -19.542 -1.111  -35.002 1.00 22.07  ? 309  GLU A CA    1 
ATOM   1262 C  C     . GLU A 1 199 ? -18.936 -0.888  -36.394 1.00 24.81  ? 309  GLU A C     1 
ATOM   1263 O  O     . GLU A 1 199 ? -17.942 -1.523  -36.734 1.00 24.16  ? 309  GLU A O     1 
ATOM   1264 C  CB    . GLU A 1 199 ? -20.690 -2.168  -35.068 1.00 23.92  ? 309  GLU A CB    1 
ATOM   1265 C  CG    . GLU A 1 199 ? -21.038 -2.818  -33.731 1.00 29.08  ? 309  GLU A CG    1 
ATOM   1266 C  CD    . GLU A 1 199 ? -19.909 -3.382  -32.869 1.00 42.37  ? 309  GLU A CD    1 
ATOM   1267 O  OE1   . GLU A 1 199 ? -18.826 -3.699  -33.412 1.00 25.44  ? 309  GLU A OE1   1 
ATOM   1268 O  OE2   . GLU A 1 199 ? -20.114 -3.513  -31.637 1.00 31.79  ? 309  GLU A OE2   1 
ATOM   1269 N  N     . ALA A 1 200 ? -19.558 -0.008  -37.197 1.00 21.33  ? 310  ALA A N     1 
ATOM   1270 C  CA    . ALA A 1 200 ? -19.066 0.320   -38.526 1.00 22.19  ? 310  ALA A CA    1 
ATOM   1271 C  C     . ALA A 1 200 ? -17.677 0.990   -38.422 1.00 26.62  ? 310  ALA A C     1 
ATOM   1272 O  O     . ALA A 1 200 ? -16.791 0.668   -39.214 1.00 25.78  ? 310  ALA A O     1 
ATOM   1273 C  CB    . ALA A 1 200 ? -20.045 1.234   -39.235 1.00 23.28  ? 310  ALA A CB    1 
ATOM   1274 N  N     . VAL A 1 201 ? -17.480 1.864   -37.410 1.00 22.21  ? 311  VAL A N     1 
ATOM   1275 C  CA    . VAL A 1 201 ? -16.199 2.517   -37.125 1.00 20.33  ? 311  VAL A CA    1 
ATOM   1276 C  C     . VAL A 1 201 ? -15.187 1.438   -36.691 1.00 26.96  ? 311  VAL A C     1 
ATOM   1277 O  O     . VAL A 1 201 ? -14.055 1.449   -37.186 1.00 28.51  ? 311  VAL A O     1 
ATOM   1278 C  CB    . VAL A 1 201 ? -16.325 3.661   -36.063 1.00 22.38  ? 311  VAL A CB    1 
ATOM   1279 C  CG1   . VAL A 1 201 ? -14.943 4.173   -35.625 1.00 20.77  ? 311  VAL A CG1   1 
ATOM   1280 C  CG2   . VAL A 1 201 ? -17.163 4.812   -36.596 1.00 22.84  ? 311  VAL A CG2   1 
ATOM   1281 N  N     . SER A 1 202 ? -15.602 0.479   -35.814 1.00 23.64  ? 312  SER A N     1 
ATOM   1282 C  CA    . SER A 1 202 ? -14.714 -0.599  -35.361 1.00 25.26  ? 312  SER A CA    1 
ATOM   1283 C  C     . SER A 1 202 ? -14.119 -1.403  -36.540 1.00 31.68  ? 312  SER A C     1 
ATOM   1284 O  O     . SER A 1 202 ? -12.927 -1.704  -36.537 1.00 30.37  ? 312  SER A O     1 
ATOM   1285 C  CB    . SER A 1 202 ? -15.431 -1.549  -34.411 1.00 26.93  ? 312  SER A CB    1 
ATOM   1286 O  OG    . SER A 1 202 ? -14.469 -2.430  -33.849 1.00 28.15  ? 312  SER A OG    1 
ATOM   1287 N  N     . MET A 1 203 ? -14.953 -1.676  -37.561 1.00 29.12  ? 313  MET A N     1 
ATOM   1288 C  CA    . MET A 1 203 ? -14.558 -2.386  -38.778 1.00 30.65  ? 313  MET A CA    1 
ATOM   1289 C  C     . MET A 1 203 ? -13.506 -1.597  -39.534 1.00 33.63  ? 313  MET A C     1 
ATOM   1290 O  O     . MET A 1 203 ? -12.500 -2.174  -39.943 1.00 33.07  ? 313  MET A O     1 
ATOM   1291 C  CB    . MET A 1 203 ? -15.780 -2.627  -39.673 1.00 34.57  ? 313  MET A CB    1 
ATOM   1292 C  CG    . MET A 1 203 ? -16.745 -3.661  -39.133 1.00 39.60  ? 313  MET A CG    1 
ATOM   1293 S  SD    . MET A 1 203 ? -15.910 -5.225  -38.849 1.00 45.82  ? 313  MET A SD    1 
ATOM   1294 C  CE    . MET A 1 203 ? -15.404 -5.648  -40.582 1.00 44.50  ? 313  MET A CE    1 
ATOM   1295 N  N     . LEU A 1 204 ? -13.721 -0.259  -39.676 1.00 29.98  ? 314  LEU A N     1 
ATOM   1296 C  CA    . LEU A 1 204 ? -12.787 0.645   -40.342 1.00 29.52  ? 314  LEU A CA    1 
ATOM   1297 C  C     . LEU A 1 204 ? -11.443 0.663   -39.619 1.00 31.25  ? 314  LEU A C     1 
ATOM   1298 O  O     . LEU A 1 204 ? -10.413 0.539   -40.274 1.00 30.40  ? 314  LEU A O     1 
ATOM   1299 C  CB    . LEU A 1 204 ? -13.360 2.078   -40.435 1.00 28.91  ? 314  LEU A CB    1 
ATOM   1300 C  CG    . LEU A 1 204 ? -14.297 2.381   -41.603 1.00 35.62  ? 314  LEU A CG    1 
ATOM   1301 C  CD1   . LEU A 1 204 ? -14.956 3.761   -41.428 1.00 36.65  ? 314  LEU A CD1   1 
ATOM   1302 C  CD2   . LEU A 1 204 ? -13.545 2.359   -42.946 1.00 39.29  ? 314  LEU A CD2   1 
ATOM   1303 N  N     . VAL A 1 205 ? -11.461 0.790   -38.267 1.00 27.49  ? 315  VAL A N     1 
ATOM   1304 C  CA    . VAL A 1 205 ? -10.261 0.837   -37.428 1.00 26.86  ? 315  VAL A CA    1 
ATOM   1305 C  C     . VAL A 1 205 ? -9.472  -0.466  -37.604 1.00 31.63  ? 315  VAL A C     1 
ATOM   1306 O  O     . VAL A 1 205 ? -8.285  -0.412  -37.915 1.00 31.90  ? 315  VAL A O     1 
ATOM   1307 C  CB    . VAL A 1 205 ? -10.588 1.130   -35.925 1.00 28.75  ? 315  VAL A CB    1 
ATOM   1308 C  CG1   . VAL A 1 205 ? -9.333  1.036   -35.050 1.00 27.75  ? 315  VAL A CG1   1 
ATOM   1309 C  CG2   . VAL A 1 205 ? -11.242 2.503   -35.760 1.00 28.11  ? 315  VAL A CG2   1 
ATOM   1310 N  N     . LYS A 1 206 ? -10.141 -1.625  -37.441 1.00 28.13  ? 316  LYS A N     1 
ATOM   1311 C  CA    . LYS A 1 206 ? -9.505  -2.945  -37.541 1.00 28.29  ? 316  LYS A CA    1 
ATOM   1312 C  C     . LYS A 1 206 ? -8.896  -3.169  -38.933 1.00 33.84  ? 316  LYS A C     1 
ATOM   1313 O  O     . LYS A 1 206 ? -7.741  -3.592  -39.013 1.00 33.72  ? 316  LYS A O     1 
ATOM   1314 C  CB    . LYS A 1 206 ? -10.510 -4.056  -37.189 1.00 30.24  ? 316  LYS A CB    1 
ATOM   1315 C  CG    . LYS A 1 206 ? -10.823 -4.122  -35.693 1.00 35.45  ? 316  LYS A CG    1 
ATOM   1316 C  CD    . LYS A 1 206 ? -11.966 -5.072  -35.368 1.00 41.83  ? 316  LYS A CD    1 
ATOM   1317 C  CE    . LYS A 1 206 ? -12.244 -5.124  -33.889 1.00 34.86  ? 316  LYS A CE    1 
ATOM   1318 N  NZ    . LYS A 1 206 ? -13.413 -5.983  -33.558 1.00 40.59  ? 316  LYS A NZ    1 
ATOM   1319 N  N     . GLU A 1 207 ? -9.644  -2.835  -40.014 1.00 31.77  ? 317  GLU A N     1 
ATOM   1320 C  CA    . GLU A 1 207 ? -9.184  -2.977  -41.408 1.00 34.24  ? 317  GLU A CA    1 
ATOM   1321 C  C     . GLU A 1 207 ? -7.908  -2.167  -41.665 1.00 39.69  ? 317  GLU A C     1 
ATOM   1322 O  O     . GLU A 1 207 ? -6.990  -2.666  -42.300 1.00 41.28  ? 317  GLU A O     1 
ATOM   1323 C  CB    . GLU A 1 207 ? -10.272 -2.534  -42.399 1.00 36.38  ? 317  GLU A CB    1 
ATOM   1324 C  CG    . GLU A 1 207 ? -11.323 -3.599  -42.680 1.00 50.69  ? 317  GLU A CG    1 
ATOM   1325 C  CD    . GLU A 1 207 ? -12.515 -3.172  -43.522 1.00 76.94  ? 317  GLU A CD    1 
ATOM   1326 O  OE1   . GLU A 1 207 ? -12.520 -2.029  -44.037 1.00 66.49  ? 317  GLU A OE1   1 
ATOM   1327 O  OE2   . GLU A 1 207 ? -13.448 -3.996  -43.675 1.00 74.32  ? 317  GLU A OE2   1 
ATOM   1328 N  N     . ALA A 1 208 ? -7.849  -0.925  -41.154 1.00 34.60  ? 318  ALA A N     1 
ATOM   1329 C  CA    . ALA A 1 208 ? -6.694  -0.052  -41.304 1.00 34.56  ? 318  ALA A CA    1 
ATOM   1330 C  C     . ALA A 1 208 ? -5.488  -0.556  -40.494 1.00 39.15  ? 318  ALA A C     1 
ATOM   1331 O  O     . ALA A 1 208 ? -4.379  -0.645  -41.031 1.00 37.77  ? 318  ALA A O     1 
ATOM   1332 C  CB    . ALA A 1 208 ? -7.060  1.363   -40.880 1.00 34.15  ? 318  ALA A CB    1 
ATOM   1333 N  N     . VAL A 1 209 ? -5.718  -0.906  -39.212 1.00 36.00  ? 319  VAL A N     1 
ATOM   1334 C  CA    . VAL A 1 209 ? -4.678  -1.333  -38.278 1.00 35.98  ? 319  VAL A CA    1 
ATOM   1335 C  C     . VAL A 1 209 ? -3.975  -2.638  -38.753 1.00 41.79  ? 319  VAL A C     1 
ATOM   1336 O  O     . VAL A 1 209 ? -2.744  -2.663  -38.799 1.00 39.12  ? 319  VAL A O     1 
ATOM   1337 C  CB    . VAL A 1 209 ? -5.249  -1.443  -36.833 1.00 38.70  ? 319  VAL A CB    1 
ATOM   1338 C  CG1   . VAL A 1 209 ? -4.309  -2.201  -35.913 1.00 39.29  ? 319  VAL A CG1   1 
ATOM   1339 C  CG2   . VAL A 1 209 ? -5.545  -0.067  -36.247 1.00 36.90  ? 319  VAL A CG2   1 
ATOM   1340 N  N     . VAL A 1 210 ? -4.739  -3.697  -39.114 1.00 41.60  ? 320  VAL A N     1 
ATOM   1341 C  CA    . VAL A 1 210 ? -4.155  -4.992  -39.516 1.00 42.83  ? 320  VAL A CA    1 
ATOM   1342 C  C     . VAL A 1 210 ? -3.381  -4.894  -40.851 1.00 48.22  ? 320  VAL A C     1 
ATOM   1343 O  O     . VAL A 1 210 ? -2.513  -5.734  -41.098 1.00 49.31  ? 320  VAL A O     1 
ATOM   1344 C  CB    . VAL A 1 210 ? -5.138  -6.190  -39.523 1.00 47.52  ? 320  VAL A CB    1 
ATOM   1345 C  CG1   . VAL A 1 210 ? -5.800  -6.370  -38.154 1.00 46.16  ? 320  VAL A CG1   1 
ATOM   1346 C  CG2   . VAL A 1 210 ? -6.172  -6.084  -40.645 1.00 47.92  ? 320  VAL A CG2   1 
ATOM   1347 N  N     . THR A 1 211 ? -3.639  -3.849  -41.662 1.00 44.68  ? 321  THR A N     1 
ATOM   1348 C  CA    . THR A 1 211 ? -2.917  -3.584  -42.909 1.00 45.58  ? 321  THR A CA    1 
ATOM   1349 C  C     . THR A 1 211 ? -1.411  -3.349  -42.602 1.00 48.91  ? 321  THR A C     1 
ATOM   1350 O  O     . THR A 1 211 ? -0.545  -3.781  -43.378 1.00 48.76  ? 321  THR A O     1 
ATOM   1351 C  CB    . THR A 1 211 ? -3.553  -2.384  -43.631 1.00 51.38  ? 321  THR A CB    1 
ATOM   1352 O  OG1   . THR A 1 211 ? -4.918  -2.686  -43.923 1.00 51.24  ? 321  THR A OG1   1 
ATOM   1353 C  CG2   . THR A 1 211 ? -2.820  -1.998  -44.918 1.00 50.63  ? 321  THR A CG2   1 
ATOM   1354 N  N     . PHE A 1 212 ? -1.112  -2.693  -41.452 1.00 42.70  ? 322  PHE A N     1 
ATOM   1355 C  CA    . PHE A 1 212 ? 0.259   -2.365  -41.058 1.00 41.86  ? 322  PHE A CA    1 
ATOM   1356 C  C     . PHE A 1 212 ? 0.803   -3.292  -39.949 1.00 45.43  ? 322  PHE A C     1 
ATOM   1357 O  O     . PHE A 1 212 ? 1.994   -3.603  -39.962 1.00 45.23  ? 322  PHE A O     1 
ATOM   1358 C  CB    . PHE A 1 212 ? 0.347   -0.889  -40.648 1.00 42.05  ? 322  PHE A CB    1 
ATOM   1359 C  CG    . PHE A 1 212 ? -0.237  0.052   -41.681 1.00 42.19  ? 322  PHE A CG    1 
ATOM   1360 C  CD1   . PHE A 1 212 ? -1.484  0.631   -41.488 1.00 42.66  ? 322  PHE A CD1   1 
ATOM   1361 C  CD2   . PHE A 1 212 ? 0.458   0.345   -42.857 1.00 44.60  ? 322  PHE A CD2   1 
ATOM   1362 C  CE1   . PHE A 1 212 ? -2.038  1.486   -42.453 1.00 43.74  ? 322  PHE A CE1   1 
ATOM   1363 C  CE2   . PHE A 1 212 ? -0.092  1.203   -43.820 1.00 47.40  ? 322  PHE A CE2   1 
ATOM   1364 C  CZ    . PHE A 1 212 ? -1.338  1.771   -43.610 1.00 44.48  ? 322  PHE A CZ    1 
ATOM   1365 N  N     . LEU A 1 213 ? -0.066  -3.743  -39.016 1.00 40.98  ? 323  LEU A N     1 
ATOM   1366 C  CA    . LEU A 1 213 ? 0.254   -4.662  -37.914 1.00 40.03  ? 323  LEU A CA    1 
ATOM   1367 C  C     . LEU A 1 213 ? -0.779  -5.798  -37.892 1.00 42.39  ? 323  LEU A C     1 
ATOM   1368 O  O     . LEU A 1 213 ? -1.774  -5.670  -37.182 1.00 41.38  ? 323  LEU A O     1 
ATOM   1369 C  CB    . LEU A 1 213 ? 0.281   -3.919  -36.552 1.00 38.80  ? 323  LEU A CB    1 
ATOM   1370 C  CG    . LEU A 1 213 ? 1.540   -3.132  -36.185 1.00 44.01  ? 323  LEU A CG    1 
ATOM   1371 C  CD1   . LEU A 1 213 ? 1.355   -2.428  -34.856 1.00 43.51  ? 323  LEU A CD1   1 
ATOM   1372 C  CD2   . LEU A 1 213 ? 2.788   -4.037  -36.134 1.00 45.52  ? 323  LEU A CD2   1 
ATOM   1373 N  N     . PRO A 1 214 ? -0.574  -6.919  -38.633 1.00 40.18  ? 324  PRO A N     1 
ATOM   1374 C  CA    . PRO A 1 214 ? -1.610  -7.975  -38.674 1.00 40.01  ? 324  PRO A CA    1 
ATOM   1375 C  C     . PRO A 1 214 ? -1.890  -8.693  -37.343 1.00 42.16  ? 324  PRO A C     1 
ATOM   1376 O  O     . PRO A 1 214 ? -2.981  -9.242  -37.190 1.00 40.07  ? 324  PRO A O     1 
ATOM   1377 C  CB    . PRO A 1 214 ? -1.094  -8.958  -39.734 1.00 43.67  ? 324  PRO A CB    1 
ATOM   1378 C  CG    . PRO A 1 214 ? 0.337   -8.660  -39.887 1.00 49.12  ? 324  PRO A CG    1 
ATOM   1379 C  CD    . PRO A 1 214 ? 0.547   -7.226  -39.548 1.00 43.08  ? 324  PRO A CD    1 
ATOM   1380 N  N     . ASP A 1 215 ? -0.950  -8.661  -36.381 1.00 38.64  ? 325  ASP A N     1 
ATOM   1381 C  CA    . ASP A 1 215 ? -1.151  -9.307  -35.083 1.00 37.15  ? 325  ASP A CA    1 
ATOM   1382 C  C     . ASP A 1 215 ? -1.804  -8.371  -34.049 1.00 37.17  ? 325  ASP A C     1 
ATOM   1383 O  O     . ASP A 1 215 ? -1.967  -8.781  -32.898 1.00 35.44  ? 325  ASP A O     1 
ATOM   1384 C  CB    . ASP A 1 215 ? 0.200   -9.824  -34.535 1.00 39.86  ? 325  ASP A CB    1 
ATOM   1385 C  CG    . ASP A 1 215 ? 1.108   -8.777  -33.897 1.00 49.38  ? 325  ASP A CG    1 
ATOM   1386 O  OD1   . ASP A 1 215 ? 1.970   -9.162  -33.079 1.00 52.41  ? 325  ASP A OD1   1 
ATOM   1387 O  OD2   . ASP A 1 215 ? 0.978   -7.576  -34.241 1.00 44.69  ? 325  ASP A OD2   1 
ATOM   1388 N  N     . ALA A 1 216 ? -2.115  -7.105  -34.429 1.00 32.21  ? 326  ALA A N     1 
ATOM   1389 C  CA    . ALA A 1 216 ? -2.651  -6.133  -33.478 1.00 30.88  ? 326  ALA A CA    1 
ATOM   1390 C  C     . ALA A 1 216 ? -4.034  -6.503  -32.959 1.00 36.05  ? 326  ALA A C     1 
ATOM   1391 O  O     . ALA A 1 216 ? -4.871  -7.055  -33.687 1.00 37.12  ? 326  ALA A O     1 
ATOM   1392 C  CB    . ALA A 1 216 ? -2.691  -4.743  -34.093 1.00 30.94  ? 326  ALA A CB    1 
ATOM   1393 N  N     . LEU A 1 217 ? -4.251  -6.192  -31.682 1.00 31.88  ? 327  LEU A N     1 
ATOM   1394 C  CA    . LEU A 1 217 ? -5.510  -6.388  -30.972 1.00 30.62  ? 327  LEU A CA    1 
ATOM   1395 C  C     . LEU A 1 217 ? -6.166  -5.030  -30.816 1.00 32.31  ? 327  LEU A C     1 
ATOM   1396 O  O     . LEU A 1 217 ? -5.537  -4.090  -30.333 1.00 33.14  ? 327  LEU A O     1 
ATOM   1397 C  CB    . LEU A 1 217 ? -5.281  -7.083  -29.608 1.00 30.94  ? 327  LEU A CB    1 
ATOM   1398 C  CG    . LEU A 1 217 ? -4.461  -8.386  -29.645 1.00 38.36  ? 327  LEU A CG    1 
ATOM   1399 C  CD1   . LEU A 1 217 ? -3.996  -8.789  -28.248 1.00 39.91  ? 327  LEU A CD1   1 
ATOM   1400 C  CD2   . LEU A 1 217 ? -5.242  -9.534  -30.303 1.00 40.56  ? 327  LEU A CD2   1 
ATOM   1401 N  N     . VAL A 1 218 ? -7.392  -4.904  -31.329 1.00 27.19  ? 328  VAL A N     1 
ATOM   1402 C  CA    . VAL A 1 218 ? -8.154  -3.657  -31.316 1.00 26.21  ? 328  VAL A CA    1 
ATOM   1403 C  C     . VAL A 1 218 ? -9.398  -3.860  -30.458 1.00 27.92  ? 328  VAL A C     1 
ATOM   1404 O  O     . VAL A 1 218 ? -10.209 -4.748  -30.736 1.00 26.83  ? 328  VAL A O     1 
ATOM   1405 C  CB    . VAL A 1 218 ? -8.501  -3.160  -32.748 1.00 30.80  ? 328  VAL A CB    1 
ATOM   1406 C  CG1   . VAL A 1 218 ? -9.289  -1.850  -32.697 1.00 29.75  ? 328  VAL A CG1   1 
ATOM   1407 C  CG2   . VAL A 1 218 ? -7.240  -3.000  -33.614 1.00 31.45  ? 328  VAL A CG2   1 
ATOM   1408 N  N     . THR A 1 219 ? -9.536  -3.062  -29.395 1.00 24.93  ? 329  THR A N     1 
ATOM   1409 C  CA    . THR A 1 219 ? -10.684 -3.187  -28.496 1.00 23.39  ? 329  THR A CA    1 
ATOM   1410 C  C     . THR A 1 219 ? -11.436 -1.876  -28.401 1.00 23.80  ? 329  THR A C     1 
ATOM   1411 O  O     . THR A 1 219 ? -10.826 -0.853  -28.112 1.00 22.33  ? 329  THR A O     1 
ATOM   1412 C  CB    . THR A 1 219 ? -10.230 -3.653  -27.097 1.00 29.07  ? 329  THR A CB    1 
ATOM   1413 O  OG1   . THR A 1 219 ? -9.400  -4.803  -27.229 1.00 32.41  ? 329  THR A OG1   1 
ATOM   1414 C  CG2   . THR A 1 219 ? -11.412 -3.962  -26.153 1.00 24.64  ? 329  THR A CG2   1 
ATOM   1415 N  N     . MET A 1 220 ? -12.785 -1.921  -28.575 1.00 21.03  ? 330  MET A N     1 
ATOM   1416 C  CA    . MET A 1 220 ? -13.638 -0.752  -28.377 1.00 19.49  ? 330  MET A CA    1 
ATOM   1417 C  C     . MET A 1 220 ? -13.739 -0.534  -26.875 1.00 23.83  ? 330  MET A C     1 
ATOM   1418 O  O     . MET A 1 220 ? -14.043 -1.478  -26.152 1.00 24.52  ? 330  MET A O     1 
ATOM   1419 C  CB    . MET A 1 220 ? -15.035 -0.950  -28.990 1.00 21.38  ? 330  MET A CB    1 
ATOM   1420 C  CG    . MET A 1 220 ? -15.846 0.334   -29.070 1.00 23.68  ? 330  MET A CG    1 
ATOM   1421 S  SD    . MET A 1 220 ? -17.564 0.056   -29.599 1.00 27.93  ? 330  MET A SD    1 
ATOM   1422 C  CE    . MET A 1 220 ? -17.309 -0.349  -31.305 1.00 24.31  ? 330  MET A CE    1 
ATOM   1423 N  N     . THR A 1 221 ? -13.432 0.667   -26.401 1.00 20.58  ? 331  THR A N     1 
ATOM   1424 C  CA    . THR A 1 221 ? -13.457 0.955   -24.951 1.00 20.84  ? 331  THR A CA    1 
ATOM   1425 C  C     . THR A 1 221 ? -14.553 1.991   -24.674 1.00 23.23  ? 331  THR A C     1 
ATOM   1426 O  O     . THR A 1 221 ? -15.536 2.041   -25.427 1.00 23.60  ? 331  THR A O     1 
ATOM   1427 C  CB    . THR A 1 221 ? -12.060 1.406   -24.472 1.00 29.98  ? 331  THR A CB    1 
ATOM   1428 O  OG1   . THR A 1 221 ? -11.707 2.580   -25.179 1.00 23.54  ? 331  THR A OG1   1 
ATOM   1429 C  CG2   . THR A 1 221 ? -10.993 0.375   -24.715 1.00 30.30  ? 331  THR A CG2   1 
ATOM   1430 N  N     . GLY A 1 222 ? -14.394 2.798   -23.609 1.00 19.72  ? 332  GLY A N     1 
ATOM   1431 C  CA    . GLY A 1 222 ? -15.327 3.874   -23.259 1.00 17.77  ? 332  GLY A CA    1 
ATOM   1432 C  C     . GLY A 1 222 ? -16.740 3.405   -23.003 1.00 21.67  ? 332  GLY A C     1 
ATOM   1433 O  O     . GLY A 1 222 ? -16.932 2.226   -22.697 1.00 19.68  ? 332  GLY A O     1 
ATOM   1434 N  N     . GLY A 1 223 ? -17.718 4.325   -23.125 1.00 20.04  ? 333  GLY A N     1 
ATOM   1435 C  CA    . GLY A 1 223 ? -19.156 4.075   -22.900 1.00 19.18  ? 333  GLY A CA    1 
ATOM   1436 C  C     . GLY A 1 223 ? -19.757 2.844   -23.566 1.00 22.31  ? 333  GLY A C     1 
ATOM   1437 O  O     . GLY A 1 223 ? -20.542 2.113   -22.947 1.00 20.78  ? 333  GLY A O     1 
ATOM   1438 N  N     . PHE A 1 224 ? -19.419 2.620   -24.851 1.00 18.57  ? 334  PHE A N     1 
ATOM   1439 C  CA    . PHE A 1 224 ? -19.934 1.471   -25.604 1.00 16.14  ? 334  PHE A CA    1 
ATOM   1440 C  C     . PHE A 1 224 ? -19.493 0.146   -24.999 1.00 20.47  ? 334  PHE A C     1 
ATOM   1441 O  O     . PHE A 1 224 ? -20.290 -0.784  -24.994 1.00 18.26  ? 334  PHE A O     1 
ATOM   1442 C  CB    . PHE A 1 224 ? -19.526 1.519   -27.083 1.00 16.75  ? 334  PHE A CB    1 
ATOM   1443 C  CG    . PHE A 1 224 ? -20.285 2.579   -27.837 1.00 17.74  ? 334  PHE A CG    1 
ATOM   1444 C  CD1   . PHE A 1 224 ? -19.635 3.726   -28.299 1.00 18.70  ? 334  PHE A CD1   1 
ATOM   1445 C  CD2   . PHE A 1 224 ? -21.653 2.446   -28.068 1.00 16.75  ? 334  PHE A CD2   1 
ATOM   1446 C  CE1   . PHE A 1 224 ? -20.327 4.714   -28.998 1.00 19.06  ? 334  PHE A CE1   1 
ATOM   1447 C  CE2   . PHE A 1 224 ? -22.363 3.459   -28.743 1.00 20.97  ? 334  PHE A CE2   1 
ATOM   1448 C  CZ    . PHE A 1 224 ? -21.693 4.586   -29.202 1.00 19.87  ? 334  PHE A CZ    1 
ATOM   1449 N  N     . ARG A 1 225 ? -18.255 0.064   -24.454 1.00 18.62  ? 335  ARG A N     1 
ATOM   1450 C  CA    . ARG A 1 225 ? -17.801 -1.153  -23.773 1.00 18.65  ? 335  ARG A CA    1 
ATOM   1451 C  C     . ARG A 1 225 ? -18.580 -1.334  -22.470 1.00 18.75  ? 335  ARG A C     1 
ATOM   1452 O  O     . ARG A 1 225 ? -18.796 -2.451  -22.059 1.00 17.24  ? 335  ARG A O     1 
ATOM   1453 C  CB    . ARG A 1 225 ? -16.282 -1.141  -23.512 1.00 19.28  ? 335  ARG A CB    1 
ATOM   1454 C  CG    . ARG A 1 225 ? -15.767 -2.518  -23.006 1.00 23.51  ? 335  ARG A CG    1 
ATOM   1455 C  CD    . ARG A 1 225 ? -14.242 -2.635  -22.980 1.00 25.07  ? 335  ARG A CD    1 
ATOM   1456 N  NE    . ARG A 1 225 ? -13.880 -4.010  -22.616 1.00 22.68  ? 335  ARG A NE    1 
ATOM   1457 C  CZ    . ARG A 1 225 ? -13.361 -4.373  -21.449 1.00 23.01  ? 335  ARG A CZ    1 
ATOM   1458 N  NH1   . ARG A 1 225 ? -13.047 -3.461  -20.538 1.00 19.67  ? 335  ARG A NH1   1 
ATOM   1459 N  NH2   . ARG A 1 225 ? -13.126 -5.648  -21.193 1.00 17.24  ? 335  ARG A NH2   1 
ATOM   1460 N  N     . ARG A 1 226 ? -19.083 -0.245  -21.865 1.00 16.71  ? 336  ARG A N     1 
ATOM   1461 C  CA    . ARG A 1 226 ? -19.897 -0.323  -20.637 1.00 16.29  ? 336  ARG A CA    1 
ATOM   1462 C  C     . ARG A 1 226 ? -21.384 -0.613  -20.936 1.00 20.96  ? 336  ARG A C     1 
ATOM   1463 O  O     . ARG A 1 226 ? -22.219 -0.563  -20.021 1.00 20.45  ? 336  ARG A O     1 
ATOM   1464 C  CB    . ARG A 1 226 ? -19.764 0.963   -19.802 1.00 13.01  ? 336  ARG A CB    1 
ATOM   1465 C  CG    . ARG A 1 226 ? -18.333 1.274   -19.327 1.00 15.18  ? 336  ARG A CG    1 
ATOM   1466 C  CD    . ARG A 1 226 ? -18.307 2.350   -18.244 1.00 15.27  ? 336  ARG A CD    1 
ATOM   1467 N  NE    . ARG A 1 226 ? -19.098 3.544   -18.574 1.00 20.14  ? 336  ARG A NE    1 
ATOM   1468 C  CZ    . ARG A 1 226 ? -18.626 4.613   -19.218 1.00 27.49  ? 336  ARG A CZ    1 
ATOM   1469 N  NH1   . ARG A 1 226 ? -19.411 5.646   -19.462 1.00 22.61  ? 336  ARG A NH1   1 
ATOM   1470 N  NH2   . ARG A 1 226 ? -17.363 4.657   -19.611 1.00 20.74  ? 336  ARG A NH2   1 
ATOM   1471 N  N     . GLY A 1 227 ? -21.705 -0.906  -22.199 1.00 17.70  ? 337  GLY A N     1 
ATOM   1472 C  CA    . GLY A 1 227 ? -23.058 -1.276  -22.613 1.00 17.96  ? 337  GLY A CA    1 
ATOM   1473 C  C     . GLY A 1 227 ? -23.946 -0.156  -23.110 1.00 22.57  ? 337  GLY A C     1 
ATOM   1474 O  O     . GLY A 1 227 ? -25.118 -0.399  -23.358 1.00 19.61  ? 337  GLY A O     1 
ATOM   1475 N  N     . LYS A 1 228 ? -23.422 1.097   -23.205 1.00 21.18  ? 338  LYS A N     1 
ATOM   1476 C  CA    . LYS A 1 228 ? -24.269 2.231   -23.621 1.00 20.54  ? 338  LYS A CA    1 
ATOM   1477 C  C     . LYS A 1 228 ? -24.780 2.080   -25.049 1.00 24.74  ? 338  LYS A C     1 
ATOM   1478 O  O     . LYS A 1 228 ? -24.093 1.545   -25.907 1.00 23.99  ? 338  LYS A O     1 
ATOM   1479 C  CB    . LYS A 1 228 ? -23.541 3.570   -23.474 1.00 19.05  ? 338  LYS A CB    1 
ATOM   1480 C  CG    . LYS A 1 228 ? -23.338 3.979   -22.026 1.00 27.99  ? 338  LYS A CG    1 
ATOM   1481 C  CD    . LYS A 1 228 ? -22.515 5.289   -21.889 1.00 40.07  ? 338  LYS A CD    1 
ATOM   1482 C  CE    . LYS A 1 228 ? -23.301 6.542   -22.251 1.00 49.69  ? 338  LYS A CE    1 
ATOM   1483 N  NZ    . LYS A 1 228 ? -24.413 6.794   -21.299 1.00 62.69  ? 338  LYS A NZ    1 
ATOM   1484 N  N     . MET A 1 229 ? -25.989 2.569   -25.281 1.00 22.60  ? 339  MET A N     1 
ATOM   1485 C  CA    . MET A 1 229 ? -26.639 2.540   -26.581 1.00 24.39  ? 339  MET A CA    1 
ATOM   1486 C  C     . MET A 1 229 ? -26.112 3.646   -27.468 1.00 26.69  ? 339  MET A C     1 
ATOM   1487 O  O     . MET A 1 229 ? -26.176 3.543   -28.689 1.00 26.35  ? 339  MET A O     1 
ATOM   1488 C  CB    . MET A 1 229 ? -28.151 2.697   -26.408 1.00 28.44  ? 339  MET A CB    1 
ATOM   1489 C  CG    . MET A 1 229 ? -28.838 1.470   -25.813 1.00 34.21  ? 339  MET A CG    1 
ATOM   1490 S  SD    . MET A 1 229 ? -30.639 1.803   -25.585 1.00 41.12  ? 339  MET A SD    1 
ATOM   1491 C  CE    . MET A 1 229 ? -31.147 2.064   -27.321 1.00 38.13  ? 339  MET A CE    1 
ATOM   1492 N  N     . THR A 1 230 ? -25.646 4.731   -26.856 1.00 24.47  ? 340  THR A N     1 
ATOM   1493 C  CA    . THR A 1 230 ? -25.130 5.901   -27.576 1.00 24.13  ? 340  THR A CA    1 
ATOM   1494 C  C     . THR A 1 230 ? -23.880 6.441   -26.903 1.00 26.60  ? 340  THR A C     1 
ATOM   1495 O  O     . THR A 1 230 ? -23.585 6.108   -25.762 1.00 27.54  ? 340  THR A O     1 
ATOM   1496 C  CB    . THR A 1 230 ? -26.198 7.022   -27.678 1.00 24.15  ? 340  THR A CB    1 
ATOM   1497 O  OG1   . THR A 1 230 ? -26.532 7.458   -26.365 1.00 26.84  ? 340  THR A OG1   1 
ATOM   1498 C  CG2   . THR A 1 230 ? -27.430 6.602   -28.440 1.00 25.77  ? 340  THR A CG2   1 
ATOM   1499 N  N     . GLY A 1 231 ? -23.183 7.305   -27.611 1.00 23.86  ? 341  GLY A N     1 
ATOM   1500 C  CA    . GLY A 1 231 ? -21.978 7.969   -27.130 1.00 22.22  ? 341  GLY A CA    1 
ATOM   1501 C  C     . GLY A 1 231 ? -21.640 9.175   -27.962 1.00 27.34  ? 341  GLY A C     1 
ATOM   1502 O  O     . GLY A 1 231 ? -22.145 9.318   -29.089 1.00 27.37  ? 341  GLY A O     1 
ATOM   1503 N  N     A HIS A 1 232 ? -20.811 10.071  -27.403 0.50 23.51  ? 342  HIS A N     1 
ATOM   1504 N  N     B HIS A 1 232 ? -20.816 10.075  -27.404 0.50 25.48  ? 342  HIS A N     1 
ATOM   1505 C  CA    A HIS A 1 232 ? -20.369 11.285  -28.096 0.50 22.72  ? 342  HIS A CA    1 
ATOM   1506 C  CA    B HIS A 1 232 ? -20.365 11.277  -28.113 0.50 25.74  ? 342  HIS A CA    1 
ATOM   1507 C  C     A HIS A 1 232 ? -19.245 10.940  -29.081 0.50 24.36  ? 342  HIS A C     1 
ATOM   1508 C  C     B HIS A 1 232 ? -19.264 10.921  -29.104 0.50 25.74  ? 342  HIS A C     1 
ATOM   1509 O  O     A HIS A 1 232 ? -19.026 11.683  -30.045 0.50 23.91  ? 342  HIS A O     1 
ATOM   1510 O  O     B HIS A 1 232 ? -19.069 11.641  -30.090 0.50 25.37  ? 342  HIS A O     1 
ATOM   1511 C  CB    A HIS A 1 232 ? -19.923 12.371  -27.091 0.50 23.34  ? 342  HIS A CB    1 
ATOM   1512 C  CB    B HIS A 1 232 ? -19.839 12.340  -27.137 0.50 27.54  ? 342  HIS A CB    1 
ATOM   1513 C  CG    A HIS A 1 232 ? -18.442 12.433  -26.823 0.50 26.01  ? 342  HIS A CG    1 
ATOM   1514 C  CG    B HIS A 1 232 ? -20.847 12.870  -26.175 0.50 32.10  ? 342  HIS A CG    1 
ATOM   1515 N  ND1   A HIS A 1 232 ? -17.849 11.654  -25.851 0.50 27.11  ? 342  HIS A ND1   1 
ATOM   1516 N  ND1   B HIS A 1 232 ? -21.923 13.624  -26.600 0.50 35.22  ? 342  HIS A ND1   1 
ATOM   1517 C  CD2   A HIS A 1 232 ? -17.498 13.240  -27.367 0.50 28.04  ? 342  HIS A CD2   1 
ATOM   1518 C  CD2   B HIS A 1 232 ? -20.860 12.809  -24.825 0.50 34.79  ? 342  HIS A CD2   1 
ATOM   1519 C  CE1   A HIS A 1 232 ? -16.568 11.987  -25.848 0.50 26.39  ? 342  HIS A CE1   1 
ATOM   1520 C  CE1   B HIS A 1 232 ? -22.583 13.958  -25.503 0.50 35.43  ? 342  HIS A CE1   1 
ATOM   1521 N  NE2   A HIS A 1 232 ? -16.307 12.937  -26.748 0.50 27.25  ? 342  HIS A NE2   1 
ATOM   1522 N  NE2   B HIS A 1 232 ? -21.973 13.503  -24.408 0.50 35.62  ? 342  HIS A NE2   1 
ATOM   1523 N  N     . ASP A 1 233 ? -18.536 9.813   -28.831 1.00 18.63  ? 343  ASP A N     1 
ATOM   1524 C  CA    . ASP A 1 233 ? -17.424 9.360   -29.636 1.00 16.99  ? 343  ASP A CA    1 
ATOM   1525 C  C     . ASP A 1 233 ? -17.292 7.831   -29.578 1.00 21.26  ? 343  ASP A C     1 
ATOM   1526 O  O     . ASP A 1 233 ? -18.089 7.179   -28.900 1.00 18.67  ? 343  ASP A O     1 
ATOM   1527 C  CB    . ASP A 1 233 ? -16.116 10.049  -29.113 1.00 18.89  ? 343  ASP A CB    1 
ATOM   1528 C  CG    . ASP A 1 233 ? -15.556 9.626   -27.761 1.00 21.00  ? 343  ASP A CG    1 
ATOM   1529 O  OD1   . ASP A 1 233 ? -16.050 8.603   -27.178 1.00 17.21  ? 343  ASP A OD1   1 
ATOM   1530 O  OD2   . ASP A 1 233 ? -14.483 10.131  -27.396 1.00 21.63  ? 343  ASP A OD2   1 
ATOM   1531 N  N     . VAL A 1 234 ? -16.292 7.274   -30.289 1.00 17.90  ? 344  VAL A N     1 
ATOM   1532 C  CA    . VAL A 1 234 ? -15.970 5.857   -30.266 1.00 19.44  ? 344  VAL A CA    1 
ATOM   1533 C  C     . VAL A 1 234 ? -14.482 5.784   -29.945 1.00 23.81  ? 344  VAL A C     1 
ATOM   1534 O  O     . VAL A 1 234 ? -13.679 6.386   -30.653 1.00 22.26  ? 344  VAL A O     1 
ATOM   1535 C  CB    . VAL A 1 234 ? -16.356 5.057   -31.552 1.00 24.87  ? 344  VAL A CB    1 
ATOM   1536 C  CG1   . VAL A 1 234 ? -16.485 3.565   -31.227 1.00 25.13  ? 344  VAL A CG1   1 
ATOM   1537 C  CG2   . VAL A 1 234 ? -17.651 5.575   -32.175 1.00 23.90  ? 344  VAL A CG2   1 
ATOM   1538 N  N     . ASP A 1 235 ? -14.125 5.082   -28.858 1.00 21.08  ? 345  ASP A N     1 
ATOM   1539 C  CA    . ASP A 1 235 ? -12.741 4.939   -28.404 1.00 20.19  ? 345  ASP A CA    1 
ATOM   1540 C  C     . ASP A 1 235 ? -12.252 3.537   -28.605 1.00 24.39  ? 345  ASP A C     1 
ATOM   1541 O  O     . ASP A 1 235 ? -13.029 2.601   -28.452 1.00 23.15  ? 345  ASP A O     1 
ATOM   1542 C  CB    . ASP A 1 235 ? -12.607 5.295   -26.911 1.00 21.38  ? 345  ASP A CB    1 
ATOM   1543 C  CG    . ASP A 1 235 ? -13.305 6.573   -26.478 1.00 24.94  ? 345  ASP A CG    1 
ATOM   1544 O  OD1   . ASP A 1 235 ? -12.922 7.644   -26.975 1.00 23.77  ? 345  ASP A OD1   1 
ATOM   1545 O  OD2   . ASP A 1 235 ? -14.275 6.478   -25.655 1.00 25.91  ? 345  ASP A OD2   1 
ATOM   1546 N  N     . PHE A 1 236 ? -10.956 3.400   -28.946 1.00 21.85  ? 346  PHE A N     1 
ATOM   1547 C  CA    . PHE A 1 236 ? -10.302 2.129   -29.188 1.00 21.64  ? 346  PHE A CA    1 
ATOM   1548 C  C     . PHE A 1 236 ? -8.923  2.077   -28.553 1.00 27.42  ? 346  PHE A C     1 
ATOM   1549 O  O     . PHE A 1 236 ? -8.188  3.062   -28.536 1.00 25.92  ? 346  PHE A O     1 
ATOM   1550 C  CB    . PHE A 1 236 ? -10.159 1.870   -30.698 1.00 22.71  ? 346  PHE A CB    1 
ATOM   1551 C  CG    . PHE A 1 236 ? -11.469 1.787   -31.426 1.00 23.15  ? 346  PHE A CG    1 
ATOM   1552 C  CD1   . PHE A 1 236 ? -12.055 2.924   -31.961 1.00 25.55  ? 346  PHE A CD1   1 
ATOM   1553 C  CD2   . PHE A 1 236 ? -12.122 0.566   -31.587 1.00 23.06  ? 346  PHE A CD2   1 
ATOM   1554 C  CE1   . PHE A 1 236 ? -13.275 2.856   -32.620 1.00 25.99  ? 346  PHE A CE1   1 
ATOM   1555 C  CE2   . PHE A 1 236 ? -13.354 0.498   -32.247 1.00 25.62  ? 346  PHE A CE2   1 
ATOM   1556 C  CZ    . PHE A 1 236 ? -13.920 1.644   -32.762 1.00 23.73  ? 346  PHE A CZ    1 
ATOM   1557 N  N     . LEU A 1 237 ? -8.590  0.908   -28.041 1.00 25.80  ? 347  LEU A N     1 
ATOM   1558 C  CA    . LEU A 1 237 ? -7.273  0.586   -27.542 1.00 25.21  ? 347  LEU A CA    1 
ATOM   1559 C  C     . LEU A 1 237 ? -6.645  -0.361  -28.552 1.00 28.18  ? 347  LEU A C     1 
ATOM   1560 O  O     . LEU A 1 237 ? -7.282  -1.313  -28.999 1.00 26.37  ? 347  LEU A O     1 
ATOM   1561 C  CB    . LEU A 1 237 ? -7.333  -0.026  -26.149 1.00 25.39  ? 347  LEU A CB    1 
ATOM   1562 C  CG    . LEU A 1 237 ? -5.999  -0.512  -25.550 1.00 29.90  ? 347  LEU A CG    1 
ATOM   1563 C  CD1   . LEU A 1 237 ? -5.030  0.656   -25.301 1.00 29.05  ? 347  LEU A CD1   1 
ATOM   1564 C  CD2   . LEU A 1 237 ? -6.245  -1.356  -24.295 1.00 28.84  ? 347  LEU A CD2   1 
ATOM   1565 N  N     . ILE A 1 238 ? -5.438  -0.017  -29.002 1.00 25.42  ? 348  ILE A N     1 
ATOM   1566 C  CA    . ILE A 1 238 ? -4.690  -0.821  -29.958 1.00 25.46  ? 348  ILE A CA    1 
ATOM   1567 C  C     . ILE A 1 238 ? -3.400  -1.270  -29.276 1.00 28.35  ? 348  ILE A C     1 
ATOM   1568 O  O     . ILE A 1 238 ? -2.736  -0.467  -28.617 1.00 26.60  ? 348  ILE A O     1 
ATOM   1569 C  CB    . ILE A 1 238 ? -4.405  -0.055  -31.291 1.00 28.87  ? 348  ILE A CB    1 
ATOM   1570 C  CG1   . ILE A 1 238 ? -5.696  0.576   -31.910 1.00 28.80  ? 348  ILE A CG1   1 
ATOM   1571 C  CG2   . ILE A 1 238 ? -3.668  -0.972  -32.304 1.00 29.08  ? 348  ILE A CG2   1 
ATOM   1572 C  CD1   . ILE A 1 238 ? -5.415  1.801   -32.852 1.00 35.15  ? 348  ILE A CD1   1 
ATOM   1573 N  N     . THR A 1 239 ? -3.076  -2.563  -29.403 1.00 27.23  ? 349  THR A N     1 
ATOM   1574 C  CA    . THR A 1 239 ? -1.846  -3.115  -28.855 1.00 27.22  ? 349  THR A CA    1 
ATOM   1575 C  C     . THR A 1 239 ? -1.368  -4.257  -29.753 1.00 31.17  ? 349  THR A C     1 
ATOM   1576 O  O     . THR A 1 239 ? -2.180  -4.913  -30.411 1.00 29.15  ? 349  THR A O     1 
ATOM   1577 C  CB    . THR A 1 239 ? -1.991  -3.518  -27.370 1.00 30.85  ? 349  THR A CB    1 
ATOM   1578 O  OG1   . THR A 1 239 ? -0.681  -3.681  -26.818 1.00 28.80  ? 349  THR A OG1   1 
ATOM   1579 C  CG2   . THR A 1 239 ? -2.846  -4.791  -27.164 1.00 25.48  ? 349  THR A CG2   1 
ATOM   1580 N  N     . SER A 1 240 ? -0.041  -4.468  -29.810 1.00 29.64  ? 350  SER A N     1 
ATOM   1581 C  CA    . SER A 1 240 ? 0.509   -5.533  -30.631 1.00 31.82  ? 350  SER A CA    1 
ATOM   1582 C  C     . SER A 1 240 ? 1.542   -6.360  -29.858 1.00 36.65  ? 350  SER A C     1 
ATOM   1583 O  O     . SER A 1 240 ? 2.530   -5.801  -29.380 1.00 35.12  ? 350  SER A O     1 
ATOM   1584 C  CB    . SER A 1 240 ? 1.118   -4.965  -31.906 1.00 36.64  ? 350  SER A CB    1 
ATOM   1585 O  OG    . SER A 1 240 ? 1.930   -5.931  -32.550 1.00 41.77  ? 350  SER A OG    1 
ATOM   1586 N  N     . PRO A 1 241 ? 1.358   -7.692  -29.749 1.00 37.38  ? 351  PRO A N     1 
ATOM   1587 C  CA    . PRO A 1 241 ? 2.355   -8.502  -29.006 1.00 38.23  ? 351  PRO A CA    1 
ATOM   1588 C  C     . PRO A 1 241 ? 3.750   -8.559  -29.625 1.00 43.02  ? 351  PRO A C     1 
ATOM   1589 O  O     . PRO A 1 241 ? 4.713   -8.690  -28.865 1.00 44.27  ? 351  PRO A O     1 
ATOM   1590 C  CB    . PRO A 1 241 ? 1.728   -9.898  -28.938 1.00 40.42  ? 351  PRO A CB    1 
ATOM   1591 C  CG    . PRO A 1 241 ? 0.702   -9.927  -29.989 1.00 44.62  ? 351  PRO A CG    1 
ATOM   1592 C  CD    . PRO A 1 241 ? 0.224   -8.520  -30.223 1.00 38.45  ? 351  PRO A CD    1 
ATOM   1593 N  N     . GLU A 1 242 ? 3.888   -8.411  -30.958 1.00 40.00  ? 352  GLU A N     1 
ATOM   1594 C  CA    . GLU A 1 242 ? 5.213   -8.537  -31.565 1.00 41.83  ? 352  GLU A CA    1 
ATOM   1595 C  C     . GLU A 1 242 ? 5.834   -7.236  -32.106 1.00 46.69  ? 352  GLU A C     1 
ATOM   1596 O  O     . GLU A 1 242 ? 7.033   -7.244  -32.395 1.00 48.46  ? 352  GLU A O     1 
ATOM   1597 C  CB    . GLU A 1 242 ? 5.202   -9.613  -32.668 1.00 44.79  ? 352  GLU A CB    1 
ATOM   1598 C  CG    . GLU A 1 242 ? 5.368   -11.036 -32.134 1.00 57.23  ? 352  GLU A CG    1 
ATOM   1599 C  CD    . GLU A 1 242 ? 6.596   -11.312 -31.280 1.00 86.98  ? 352  GLU A CD    1 
ATOM   1600 O  OE1   . GLU A 1 242 ? 7.721   -10.969 -31.715 1.00 91.91  ? 352  GLU A OE1   1 
ATOM   1601 O  OE2   . GLU A 1 242 ? 6.433   -11.873 -30.173 1.00 83.78  ? 352  GLU A OE2   1 
ATOM   1602 N  N     . ALA A 1 243 ? 5.070   -6.127  -32.207 1.00 42.16  ? 353  ALA A N     1 
ATOM   1603 C  CA    . ALA A 1 243 ? 5.596   -4.855  -32.719 1.00 42.16  ? 353  ALA A CA    1 
ATOM   1604 C  C     . ALA A 1 243 ? 6.783   -4.317  -31.900 1.00 45.24  ? 353  ALA A C     1 
ATOM   1605 O  O     . ALA A 1 243 ? 6.814   -4.444  -30.676 1.00 42.69  ? 353  ALA A O     1 
ATOM   1606 C  CB    . ALA A 1 243 ? 4.494   -3.801  -32.754 1.00 41.28  ? 353  ALA A CB    1 
ATOM   1607 N  N     . THR A 1 244 ? 7.730   -3.674  -32.585 1.00 43.76  ? 354  THR A N     1 
ATOM   1608 C  CA    . THR A 1 244 ? 8.879   -3.015  -31.945 1.00 44.76  ? 354  THR A CA    1 
ATOM   1609 C  C     . THR A 1 244 ? 8.431   -1.641  -31.382 1.00 49.31  ? 354  THR A C     1 
ATOM   1610 O  O     . THR A 1 244 ? 7.290   -1.228  -31.627 1.00 45.53  ? 354  THR A O     1 
ATOM   1611 C  CB    . THR A 1 244 ? 10.015  -2.847  -32.950 1.00 50.37  ? 354  THR A CB    1 
ATOM   1612 O  OG1   . THR A 1 244 ? 9.561   -1.992  -33.994 1.00 46.72  ? 354  THR A OG1   1 
ATOM   1613 C  CG2   . THR A 1 244 ? 10.495  -4.168  -33.529 1.00 52.90  ? 354  THR A CG2   1 
ATOM   1614 N  N     . GLU A 1 245 ? 9.338   -0.920  -30.666 1.00 48.43  ? 355  GLU A N     1 
ATOM   1615 C  CA    . GLU A 1 245 ? 9.050   0.406   -30.104 1.00 47.53  ? 355  GLU A CA    1 
ATOM   1616 C  C     . GLU A 1 245 ? 8.756   1.393   -31.231 1.00 51.70  ? 355  GLU A C     1 
ATOM   1617 O  O     . GLU A 1 245 ? 7.834   2.213   -31.109 1.00 50.36  ? 355  GLU A O     1 
ATOM   1618 C  CB    . GLU A 1 245 ? 10.213  0.907   -29.237 1.00 49.79  ? 355  GLU A CB    1 
ATOM   1619 N  N     . ASP A 1 246 ? 9.511   1.279   -32.346 1.00 48.10  ? 356  ASP A N     1 
ATOM   1620 C  CA    . ASP A 1 246 ? 9.350   2.123   -33.531 1.00 47.85  ? 356  ASP A CA    1 
ATOM   1621 C  C     . ASP A 1 246 ? 8.064   1.789   -34.284 1.00 47.86  ? 356  ASP A C     1 
ATOM   1622 O  O     . ASP A 1 246 ? 7.370   2.713   -34.696 1.00 45.55  ? 356  ASP A O     1 
ATOM   1623 C  CB    . ASP A 1 246 ? 10.566  2.016   -34.469 1.00 51.73  ? 356  ASP A CB    1 
ATOM   1624 C  CG    . ASP A 1 246 ? 11.697  2.935   -34.058 1.00 68.34  ? 356  ASP A CG    1 
ATOM   1625 O  OD1   . ASP A 1 246 ? 11.575  4.163   -34.277 1.00 70.96  ? 356  ASP A OD1   1 
ATOM   1626 O  OD2   . ASP A 1 246 ? 12.697  2.433   -33.506 1.00 74.67  ? 356  ASP A OD2   1 
ATOM   1627 N  N     . GLU A 1 247 ? 7.750   0.484   -34.468 1.00 44.31  ? 357  GLU A N     1 
ATOM   1628 C  CA    . GLU A 1 247 ? 6.522   0.039   -35.141 1.00 43.28  ? 357  GLU A CA    1 
ATOM   1629 C  C     . GLU A 1 247 ? 5.285   0.541   -34.392 1.00 43.73  ? 357  GLU A C     1 
ATOM   1630 O  O     . GLU A 1 247 ? 4.354   1.023   -35.026 1.00 40.13  ? 357  GLU A O     1 
ATOM   1631 C  CB    . GLU A 1 247 ? 6.473   -1.483  -35.279 1.00 45.45  ? 357  GLU A CB    1 
ATOM   1632 C  CG    . GLU A 1 247 ? 7.238   -2.024  -36.480 1.00 58.76  ? 357  GLU A CG    1 
ATOM   1633 C  CD    . GLU A 1 247 ? 7.113   -3.524  -36.688 1.00 74.57  ? 357  GLU A CD    1 
ATOM   1634 O  OE1   . GLU A 1 247 ? 7.278   -4.282  -35.703 1.00 48.63  ? 357  GLU A OE1   1 
ATOM   1635 O  OE2   . GLU A 1 247 ? 6.863   -3.940  -37.842 1.00 72.90  ? 357  GLU A OE2   1 
ATOM   1636 N  N     . GLU A 1 248 ? 5.314   0.464   -33.043 1.00 40.68  ? 358  GLU A N     1 
ATOM   1637 C  CA    . GLU A 1 248 ? 4.278   0.947   -32.129 1.00 39.28  ? 358  GLU A CA    1 
ATOM   1638 C  C     . GLU A 1 248 ? 4.072   2.441   -32.277 1.00 41.93  ? 358  GLU A C     1 
ATOM   1639 O  O     . GLU A 1 248 ? 2.944   2.903   -32.147 1.00 41.42  ? 358  GLU A O     1 
ATOM   1640 C  CB    . GLU A 1 248 ? 4.658   0.656   -30.664 1.00 40.63  ? 358  GLU A CB    1 
ATOM   1641 C  CG    . GLU A 1 248 ? 4.241   -0.717  -30.162 1.00 51.86  ? 358  GLU A CG    1 
ATOM   1642 C  CD    . GLU A 1 248 ? 4.651   -1.045  -28.737 1.00 72.36  ? 358  GLU A CD    1 
ATOM   1643 O  OE1   . GLU A 1 248 ? 4.669   -0.127  -27.883 1.00 45.54  ? 358  GLU A OE1   1 
ATOM   1644 O  OE2   . GLU A 1 248 ? 4.927   -2.237  -28.468 1.00 75.02  ? 358  GLU A OE2   1 
ATOM   1645 N  N     . GLN A 1 249 ? 5.159   3.196   -32.506 1.00 36.22  ? 359  GLN A N     1 
ATOM   1646 C  CA    . GLN A 1 249 ? 5.142   4.654   -32.652 1.00 35.58  ? 359  GLN A CA    1 
ATOM   1647 C  C     . GLN A 1 249 ? 4.572   5.062   -34.018 1.00 40.45  ? 359  GLN A C     1 
ATOM   1648 O  O     . GLN A 1 249 ? 3.872   6.065   -34.106 1.00 39.95  ? 359  GLN A O     1 
ATOM   1649 C  CB    . GLN A 1 249 ? 6.578   5.213   -32.476 1.00 37.83  ? 359  GLN A CB    1 
ATOM   1650 C  CG    . GLN A 1 249 ? 6.697   6.747   -32.399 1.00 56.52  ? 359  GLN A CG    1 
ATOM   1651 C  CD    . GLN A 1 249 ? 6.644   7.463   -33.745 1.00 67.68  ? 359  GLN A CD    1 
ATOM   1652 O  OE1   . GLN A 1 249 ? 7.071   6.941   -34.783 1.00 57.77  ? 359  GLN A OE1   1 
ATOM   1653 N  NE2   . GLN A 1 249 ? 6.074   8.669   -33.767 1.00 53.47  ? 359  GLN A NE2   1 
ATOM   1654 N  N     . GLN A 1 250 ? 4.872   4.299   -35.073 1.00 37.89  ? 360  GLN A N     1 
ATOM   1655 C  CA    . GLN A 1 250 ? 4.471   4.654   -36.431 1.00 37.90  ? 360  GLN A CA    1 
ATOM   1656 C  C     . GLN A 1 250 ? 3.045   4.240   -36.814 1.00 38.76  ? 360  GLN A C     1 
ATOM   1657 O  O     . GLN A 1 250 ? 2.523   4.813   -37.771 1.00 38.15  ? 360  GLN A O     1 
ATOM   1658 C  CB    . GLN A 1 250 ? 5.464   4.060   -37.443 1.00 41.21  ? 360  GLN A CB    1 
ATOM   1659 C  CG    . GLN A 1 250 ? 6.858   4.705   -37.389 1.00 58.68  ? 360  GLN A CG    1 
ATOM   1660 C  CD    . GLN A 1 250 ? 7.964   3.831   -37.952 1.00 98.15  ? 360  GLN A CD    1 
ATOM   1661 O  OE1   . GLN A 1 250 ? 7.746   2.955   -38.803 1.00 100.04 ? 360  GLN A OE1   1 
ATOM   1662 N  NE2   . GLN A 1 250 ? 9.195   4.075   -37.510 1.00 93.43  ? 360  GLN A NE2   1 
ATOM   1663 N  N     . LEU A 1 251 ? 2.428   3.249   -36.122 1.00 33.49  ? 361  LEU A N     1 
ATOM   1664 C  CA    . LEU A 1 251 ? 1.108   2.748   -36.500 1.00 33.50  ? 361  LEU A CA    1 
ATOM   1665 C  C     . LEU A 1 251 ? 0.015   3.845   -36.633 1.00 34.08  ? 361  LEU A C     1 
ATOM   1666 O  O     . LEU A 1 251 ? -0.688  3.856   -37.653 1.00 34.48  ? 361  LEU A O     1 
ATOM   1667 C  CB    . LEU A 1 251 ? 0.603   1.640   -35.559 1.00 33.38  ? 361  LEU A CB    1 
ATOM   1668 C  CG    . LEU A 1 251 ? -0.738  1.006   -35.975 1.00 37.72  ? 361  LEU A CG    1 
ATOM   1669 C  CD1   . LEU A 1 251 ? -0.565  0.054   -37.122 1.00 38.50  ? 361  LEU A CD1   1 
ATOM   1670 C  CD2   . LEU A 1 251 ? -1.389  0.339   -34.841 1.00 42.31  ? 361  LEU A CD2   1 
ATOM   1671 N  N     . LEU A 1 252 ? -0.137  4.732   -35.638 1.00 28.35  ? 362  LEU A N     1 
ATOM   1672 C  CA    . LEU A 1 252 ? -1.195  5.751   -35.711 1.00 27.50  ? 362  LEU A CA    1 
ATOM   1673 C  C     . LEU A 1 252 ? -0.972  6.725   -36.884 1.00 32.97  ? 362  LEU A C     1 
ATOM   1674 O  O     . LEU A 1 252 ? -1.954  7.142   -37.504 1.00 31.65  ? 362  LEU A O     1 
ATOM   1675 C  CB    . LEU A 1 252 ? -1.361  6.516   -34.385 1.00 26.58  ? 362  LEU A CB    1 
ATOM   1676 C  CG    . LEU A 1 252 ? -1.900  5.707   -33.174 1.00 29.26  ? 362  LEU A CG    1 
ATOM   1677 C  CD1   . LEU A 1 252 ? -2.049  6.616   -31.963 1.00 30.13  ? 362  LEU A CD1   1 
ATOM   1678 C  CD2   . LEU A 1 252 ? -3.266  5.057   -33.464 1.00 25.64  ? 362  LEU A CD2   1 
ATOM   1679 N  N     . HIS A 1 253 ? 0.314   7.017   -37.233 1.00 30.52  ? 363  HIS A N     1 
ATOM   1680 C  CA    . HIS A 1 253 ? 0.688   7.853   -38.376 1.00 30.97  ? 363  HIS A CA    1 
ATOM   1681 C  C     . HIS A 1 253 ? 0.330   7.143   -39.683 1.00 35.02  ? 363  HIS A C     1 
ATOM   1682 O  O     . HIS A 1 253 ? -0.271  7.764   -40.554 1.00 35.09  ? 363  HIS A O     1 
ATOM   1683 C  CB    . HIS A 1 253 ? 2.188   8.209   -38.346 1.00 33.06  ? 363  HIS A CB    1 
ATOM   1684 C  CG    . HIS A 1 253 ? 2.572   9.096   -37.205 1.00 36.07  ? 363  HIS A CG    1 
ATOM   1685 N  ND1   . HIS A 1 253 ? 2.363   10.469  -37.245 1.00 37.80  ? 363  HIS A ND1   1 
ATOM   1686 C  CD2   . HIS A 1 253 ? 3.099   8.773   -36.009 1.00 37.50  ? 363  HIS A CD2   1 
ATOM   1687 C  CE1   . HIS A 1 253 ? 2.784   10.933  -36.083 1.00 36.64  ? 363  HIS A CE1   1 
ATOM   1688 N  NE2   . HIS A 1 253 ? 3.245   9.956   -35.308 1.00 36.98  ? 363  HIS A NE2   1 
ATOM   1689 N  N     . LYS A 1 254 ? 0.628   5.832   -39.792 1.00 32.30  ? 364  LYS A N     1 
ATOM   1690 C  CA    . LYS A 1 254 ? 0.332   5.023   -40.981 1.00 33.36  ? 364  LYS A CA    1 
ATOM   1691 C  C     . LYS A 1 254 ? -1.182  4.904   -41.222 1.00 36.43  ? 364  LYS A C     1 
ATOM   1692 O  O     . LYS A 1 254 ? -1.647  5.077   -42.352 1.00 35.59  ? 364  LYS A O     1 
ATOM   1693 C  CB    . LYS A 1 254 ? 0.957   3.618   -40.861 1.00 36.38  ? 364  LYS A CB    1 
ATOM   1694 C  CG    . LYS A 1 254 ? 2.473   3.611   -41.010 1.00 50.61  ? 364  LYS A CG    1 
ATOM   1695 C  CD    . LYS A 1 254 ? 3.063   2.266   -40.615 1.00 58.03  ? 364  LYS A CD    1 
ATOM   1696 C  CE    . LYS A 1 254 ? 4.566   2.237   -40.788 1.00 57.21  ? 364  LYS A CE    1 
ATOM   1697 N  NZ    . LYS A 1 254 ? 5.141   0.941   -40.340 1.00 54.66  ? 364  LYS A NZ    1 
ATOM   1698 N  N     . VAL A 1 255 ? -1.941  4.624   -40.163 1.00 32.97  ? 365  VAL A N     1 
ATOM   1699 C  CA    . VAL A 1 255 ? -3.396  4.441   -40.226 1.00 32.94  ? 365  VAL A CA    1 
ATOM   1700 C  C     . VAL A 1 255 ? -4.109  5.762   -40.621 1.00 38.53  ? 365  VAL A C     1 
ATOM   1701 O  O     . VAL A 1 255 ? -5.018  5.733   -41.454 1.00 39.22  ? 365  VAL A O     1 
ATOM   1702 C  CB    . VAL A 1 255 ? -3.930  3.853   -38.888 1.00 35.02  ? 365  VAL A CB    1 
ATOM   1703 C  CG1   . VAL A 1 255 ? -5.422  4.088   -38.713 1.00 33.69  ? 365  VAL A CG1   1 
ATOM   1704 C  CG2   . VAL A 1 255 ? -3.602  2.358   -38.791 1.00 34.86  ? 365  VAL A CG2   1 
ATOM   1705 N  N     . THR A 1 256 ? -3.694  6.895   -40.043 1.00 34.34  ? 366  THR A N     1 
ATOM   1706 C  CA    . THR A 1 256 ? -4.322  8.180   -40.347 1.00 34.54  ? 366  THR A CA    1 
ATOM   1707 C  C     . THR A 1 256 ? -3.918  8.660   -41.766 1.00 41.00  ? 366  THR A C     1 
ATOM   1708 O  O     . THR A 1 256 ? -4.767  9.240   -42.450 1.00 40.24  ? 366  THR A O     1 
ATOM   1709 C  CB    . THR A 1 256 ? -4.046  9.228   -39.246 1.00 35.65  ? 366  THR A CB    1 
ATOM   1710 O  OG1   . THR A 1 256 ? -2.647  9.341   -38.995 1.00 29.91  ? 366  THR A OG1   1 
ATOM   1711 C  CG2   . THR A 1 256 ? -4.773  8.904   -37.950 1.00 29.82  ? 366  THR A CG2   1 
ATOM   1712 N  N     . ASP A 1 257 ? -2.665  8.374   -42.230 1.00 38.68  ? 367  ASP A N     1 
ATOM   1713 C  CA    . ASP A 1 257 ? -2.244  8.725   -43.602 1.00 39.73  ? 367  ASP A CA    1 
ATOM   1714 C  C     . ASP A 1 257 ? -3.077  7.918   -44.622 1.00 41.82  ? 367  ASP A C     1 
ATOM   1715 O  O     . ASP A 1 257 ? -3.509  8.470   -45.636 1.00 40.87  ? 367  ASP A O     1 
ATOM   1716 C  CB    . ASP A 1 257 ? -0.737  8.482   -43.824 1.00 43.68  ? 367  ASP A CB    1 
ATOM   1717 C  CG    . ASP A 1 257 ? 0.213   9.461   -43.143 1.00 59.93  ? 367  ASP A CG    1 
ATOM   1718 O  OD1   . ASP A 1 257 ? 1.397   9.101   -42.949 1.00 63.06  ? 367  ASP A OD1   1 
ATOM   1719 O  OD2   . ASP A 1 257 ? -0.221  10.586  -42.814 1.00 65.65  ? 367  ASP A OD2   1 
ATOM   1720 N  N     . PHE A 1 258 ? -3.341  6.628   -44.311 1.00 37.36  ? 368  PHE A N     1 
ATOM   1721 C  CA    . PHE A 1 258 ? -4.167  5.732   -45.128 1.00 38.13  ? 368  PHE A CA    1 
ATOM   1722 C  C     . PHE A 1 258 ? -5.587  6.303   -45.276 1.00 41.96  ? 368  PHE A C     1 
ATOM   1723 O  O     . PHE A 1 258 ? -6.099  6.360   -46.389 1.00 44.01  ? 368  PHE A O     1 
ATOM   1724 C  CB    . PHE A 1 258 ? -4.197  4.322   -44.518 1.00 39.89  ? 368  PHE A CB    1 
ATOM   1725 C  CG    . PHE A 1 258 ? -5.176  3.356   -45.139 1.00 42.22  ? 368  PHE A CG    1 
ATOM   1726 C  CD1   . PHE A 1 258 ? -4.956  2.836   -46.410 1.00 47.12  ? 368  PHE A CD1   1 
ATOM   1727 C  CD2   . PHE A 1 258 ? -6.314  2.953   -44.447 1.00 43.43  ? 368  PHE A CD2   1 
ATOM   1728 C  CE1   . PHE A 1 258 ? -5.867  1.947   -46.988 1.00 48.83  ? 368  PHE A CE1   1 
ATOM   1729 C  CE2   . PHE A 1 258 ? -7.225  2.062   -45.024 1.00 47.13  ? 368  PHE A CE2   1 
ATOM   1730 C  CZ    . PHE A 1 258 ? -6.996  1.569   -46.293 1.00 47.28  ? 368  PHE A CZ    1 
ATOM   1731 N  N     . TRP A 1 259 ? -6.191  6.772   -44.173 1.00 35.30  ? 369  TRP A N     1 
ATOM   1732 C  CA    . TRP A 1 259 ? -7.530  7.375   -44.182 1.00 34.00  ? 369  TRP A CA    1 
ATOM   1733 C  C     . TRP A 1 259 ? -7.524  8.735   -44.909 1.00 38.49  ? 369  TRP A C     1 
ATOM   1734 O  O     . TRP A 1 259 ? -8.501  9.068   -45.583 1.00 38.12  ? 369  TRP A O     1 
ATOM   1735 C  CB    . TRP A 1 259 ? -8.056  7.526   -42.758 1.00 30.91  ? 369  TRP A CB    1 
ATOM   1736 C  CG    . TRP A 1 259 ? -8.485  6.235   -42.132 1.00 31.44  ? 369  TRP A CG    1 
ATOM   1737 C  CD1   . TRP A 1 259 ? -8.975  5.135   -42.775 1.00 34.71  ? 369  TRP A CD1   1 
ATOM   1738 C  CD2   . TRP A 1 259 ? -8.529  5.935   -40.729 1.00 30.34  ? 369  TRP A CD2   1 
ATOM   1739 N  NE1   . TRP A 1 259 ? -9.294  4.157   -41.863 1.00 33.58  ? 369  TRP A NE1   1 
ATOM   1740 C  CE2   . TRP A 1 259 ? -9.042  4.625   -40.598 1.00 34.29  ? 369  TRP A CE2   1 
ATOM   1741 C  CE3   . TRP A 1 259 ? -8.188  6.648   -39.566 1.00 31.04  ? 369  TRP A CE3   1 
ATOM   1742 C  CZ2   . TRP A 1 259 ? -9.213  4.009   -39.350 1.00 32.77  ? 369  TRP A CZ2   1 
ATOM   1743 C  CZ3   . TRP A 1 259 ? -8.377  6.047   -38.329 1.00 31.75  ? 369  TRP A CZ3   1 
ATOM   1744 C  CH2   . TRP A 1 259 ? -8.888  4.744   -38.228 1.00 32.34  ? 369  TRP A CH2   1 
ATOM   1745 N  N     . LYS A 1 260 ? -6.420  9.506   -44.782 1.00 34.81  ? 370  LYS A N     1 
ATOM   1746 C  CA    . LYS A 1 260 ? -6.252  10.793  -45.470 1.00 35.93  ? 370  LYS A CA    1 
ATOM   1747 C  C     . LYS A 1 260 ? -6.250  10.559  -46.994 1.00 42.74  ? 370  LYS A C     1 
ATOM   1748 O  O     . LYS A 1 260 ? -6.924  11.290  -47.723 1.00 42.85  ? 370  LYS A O     1 
ATOM   1749 C  CB    . LYS A 1 260 ? -4.970  11.503  -45.017 1.00 38.31  ? 370  LYS A CB    1 
ATOM   1750 C  CG    . LYS A 1 260 ? -4.969  13.005  -45.308 1.00 49.16  ? 370  LYS A CG    1 
ATOM   1751 C  CD    . LYS A 1 260 ? -3.861  13.735  -44.547 1.00 60.43  ? 370  LYS A CD    1 
ATOM   1752 C  CE    . LYS A 1 260 ? -2.542  13.842  -45.293 1.00 77.21  ? 370  LYS A CE    1 
ATOM   1753 N  NZ    . LYS A 1 260 ? -2.575  14.844  -46.402 1.00 87.47  ? 370  LYS A NZ    1 
ATOM   1754 N  N     . GLN A 1 261 ? -5.559  9.484   -47.452 1.00 40.80  ? 371  GLN A N     1 
ATOM   1755 C  CA    . GLN A 1 261 ? -5.501  9.062   -48.859 1.00 42.82  ? 371  GLN A CA    1 
ATOM   1756 C  C     . GLN A 1 261 ? -6.889  8.635   -49.366 1.00 46.23  ? 371  GLN A C     1 
ATOM   1757 O  O     . GLN A 1 261 ? -7.226  8.896   -50.517 1.00 46.68  ? 371  GLN A O     1 
ATOM   1758 C  CB    . GLN A 1 261 ? -4.509  7.900   -49.048 1.00 45.26  ? 371  GLN A CB    1 
ATOM   1759 C  CG    . GLN A 1 261 ? -3.040  8.292   -48.941 1.00 61.91  ? 371  GLN A CG    1 
ATOM   1760 C  CD    . GLN A 1 261 ? -2.148  7.079   -48.794 1.00 85.39  ? 371  GLN A CD    1 
ATOM   1761 O  OE1   . GLN A 1 261 ? -1.755  6.441   -49.776 1.00 85.96  ? 371  GLN A OE1   1 
ATOM   1762 N  NE2   . GLN A 1 261 ? -1.804  6.732   -47.563 1.00 73.03  ? 371  GLN A NE2   1 
ATOM   1763 N  N     . GLN A 1 262 ? -7.690  8.007   -48.490 1.00 42.20  ? 372  GLN A N     1 
ATOM   1764 C  CA    . GLN A 1 262 ? -9.050  7.534   -48.780 1.00 41.68  ? 372  GLN A CA    1 
ATOM   1765 C  C     . GLN A 1 262 ? -10.066 8.681   -48.826 1.00 44.32  ? 372  GLN A C     1 
ATOM   1766 O  O     . GLN A 1 262 ? -11.135 8.525   -49.419 1.00 43.79  ? 372  GLN A O     1 
ATOM   1767 C  CB    . GLN A 1 262 ? -9.499  6.508   -47.721 1.00 42.06  ? 372  GLN A CB    1 
ATOM   1768 C  CG    . GLN A 1 262 ? -8.665  5.219   -47.629 1.00 59.67  ? 372  GLN A CG    1 
ATOM   1769 C  CD    . GLN A 1 262 ? -8.527  4.480   -48.931 1.00 85.26  ? 372  GLN A CD    1 
ATOM   1770 O  OE1   . GLN A 1 262 ? -7.523  4.613   -49.643 1.00 83.26  ? 372  GLN A OE1   1 
ATOM   1771 N  NE2   . GLN A 1 262 ? -9.521  3.667   -49.257 1.00 80.99  ? 372  GLN A NE2   1 
ATOM   1772 N  N     . GLY A 1 263 ? -9.730  9.796   -48.175 1.00 40.46  ? 373  GLY A N     1 
ATOM   1773 C  CA    . GLY A 1 263 ? -10.579 10.974  -48.055 1.00 39.74  ? 373  GLY A CA    1 
ATOM   1774 C  C     . GLY A 1 263 ? -11.557 10.838  -46.909 1.00 43.25  ? 373  GLY A C     1 
ATOM   1775 O  O     . GLY A 1 263 ? -12.663 11.392  -46.959 1.00 44.76  ? 373  GLY A O     1 
ATOM   1776 N  N     . LEU A 1 264 ? -11.149 10.104  -45.857 1.00 36.73  ? 374  LEU A N     1 
ATOM   1777 C  CA    . LEU A 1 264 ? -11.992 9.825   -44.695 1.00 34.19  ? 374  LEU A CA    1 
ATOM   1778 C  C     . LEU A 1 264 ? -11.567 10.610  -43.460 1.00 36.94  ? 374  LEU A C     1 
ATOM   1779 O  O     . LEU A 1 264 ? -12.321 10.670  -42.488 1.00 37.17  ? 374  LEU A O     1 
ATOM   1780 C  CB    . LEU A 1 264 ? -11.953 8.311   -44.381 1.00 33.95  ? 374  LEU A CB    1 
ATOM   1781 C  CG    . LEU A 1 264 ? -12.497 7.358   -45.445 1.00 39.42  ? 374  LEU A CG    1 
ATOM   1782 C  CD1   . LEU A 1 264 ? -12.349 5.912   -44.981 1.00 39.27  ? 374  LEU A CD1   1 
ATOM   1783 C  CD2   . LEU A 1 264 ? -13.974 7.650   -45.772 1.00 41.37  ? 374  LEU A CD2   1 
ATOM   1784 N  N     . LEU A 1 265 ? -10.361 11.179  -43.476 1.00 33.42  ? 375  LEU A N     1 
ATOM   1785 C  CA    . LEU A 1 265 ? -9.835  11.910  -42.343 1.00 33.18  ? 375  LEU A CA    1 
ATOM   1786 C  C     . LEU A 1 265 ? -10.288 13.376  -42.407 1.00 36.89  ? 375  LEU A C     1 
ATOM   1787 O  O     . LEU A 1 265 ? -9.775  14.154  -43.204 1.00 38.54  ? 375  LEU A O     1 
ATOM   1788 C  CB    . LEU A 1 265 ? -8.304  11.775  -42.310 1.00 33.94  ? 375  LEU A CB    1 
ATOM   1789 C  CG    . LEU A 1 265 ? -7.567  12.446  -41.171 1.00 39.08  ? 375  LEU A CG    1 
ATOM   1790 C  CD1   . LEU A 1 265 ? -7.964  11.839  -39.848 1.00 38.32  ? 375  LEU A CD1   1 
ATOM   1791 C  CD2   . LEU A 1 265 ? -6.066  12.331  -41.372 1.00 43.65  ? 375  LEU A CD2   1 
ATOM   1792 N  N     . LEU A 1 266 ? -11.257 13.728  -41.564 1.00 30.64  ? 376  LEU A N     1 
ATOM   1793 C  CA    . LEU A 1 266 ? -11.841 15.059  -41.495 1.00 29.65  ? 376  LEU A CA    1 
ATOM   1794 C  C     . LEU A 1 266 ? -11.107 15.928  -40.492 1.00 32.86  ? 376  LEU A C     1 
ATOM   1795 O  O     . LEU A 1 266 ? -11.066 17.134  -40.667 1.00 34.00  ? 376  LEU A O     1 
ATOM   1796 C  CB    . LEU A 1 266 ? -13.336 14.971  -41.151 1.00 28.38  ? 376  LEU A CB    1 
ATOM   1797 C  CG    . LEU A 1 266 ? -14.190 14.159  -42.105 1.00 32.77  ? 376  LEU A CG    1 
ATOM   1798 C  CD1   . LEU A 1 266 ? -15.639 14.151  -41.655 1.00 32.97  ? 376  LEU A CD1   1 
ATOM   1799 C  CD2   . LEU A 1 266 ? -14.077 14.659  -43.551 1.00 34.49  ? 376  LEU A CD2   1 
ATOM   1800 N  N     . TYR A 1 267 ? -10.548 15.322  -39.439 1.00 28.30  ? 377  TYR A N     1 
ATOM   1801 C  CA    . TYR A 1 267 ? -9.748  16.011  -38.423 1.00 27.35  ? 377  TYR A CA    1 
ATOM   1802 C  C     . TYR A 1 267 ? -8.777  15.004  -37.818 1.00 30.82  ? 377  TYR A C     1 
ATOM   1803 O  O     . TYR A 1 267 ? -9.153  13.852  -37.640 1.00 28.58  ? 377  TYR A O     1 
ATOM   1804 C  CB    . TYR A 1 267 ? -10.609 16.696  -37.331 1.00 25.61  ? 377  TYR A CB    1 
ATOM   1805 C  CG    . TYR A 1 267 ? -9.781  17.369  -36.248 1.00 27.06  ? 377  TYR A CG    1 
ATOM   1806 C  CD1   . TYR A 1 267 ? -9.283  18.657  -36.421 1.00 29.08  ? 377  TYR A CD1   1 
ATOM   1807 C  CD2   . TYR A 1 267 ? -9.425  16.685  -35.087 1.00 27.58  ? 377  TYR A CD2   1 
ATOM   1808 C  CE1   . TYR A 1 267 ? -8.468  19.254  -35.454 1.00 31.82  ? 377  TYR A CE1   1 
ATOM   1809 C  CE2   . TYR A 1 267 ? -8.606  17.267  -34.122 1.00 28.13  ? 377  TYR A CE2   1 
ATOM   1810 C  CZ    . TYR A 1 267 ? -8.140  18.554  -34.299 1.00 35.76  ? 377  TYR A CZ    1 
ATOM   1811 O  OH    . TYR A 1 267 ? -7.351  19.110  -33.320 1.00 34.85  ? 377  TYR A OH    1 
ATOM   1812 N  N     . CYS A 1 268 ? -7.540  15.438  -37.504 1.00 29.30  ? 378  CYS A N     1 
ATOM   1813 C  CA    . CYS A 1 268 ? -6.556  14.550  -36.890 1.00 29.03  ? 378  CYS A CA    1 
ATOM   1814 C  C     . CYS A 1 268 ? -5.584  15.318  -36.013 1.00 33.35  ? 378  CYS A C     1 
ATOM   1815 O  O     . CYS A 1 268 ? -4.978  16.266  -36.475 1.00 34.39  ? 378  CYS A O     1 
ATOM   1816 C  CB    . CYS A 1 268 ? -5.803  13.751  -37.950 1.00 29.95  ? 378  CYS A CB    1 
ATOM   1817 S  SG    . CYS A 1 268 ? -4.619  12.564  -37.261 1.00 33.81  ? 378  CYS A SG    1 
ATOM   1818 N  N     . ASP A 1 269 ? -5.383  14.859  -34.771 1.00 29.35  ? 379  ASP A N     1 
ATOM   1819 C  CA    . ASP A 1 269 ? -4.399  15.388  -33.833 1.00 29.42  ? 379  ASP A CA    1 
ATOM   1820 C  C     . ASP A 1 269 ? -3.745  14.201  -33.149 1.00 31.71  ? 379  ASP A C     1 
ATOM   1821 O  O     . ASP A 1 269 ? -4.432  13.468  -32.430 1.00 29.49  ? 379  ASP A O     1 
ATOM   1822 C  CB    . ASP A 1 269 ? -5.047  16.347  -32.816 1.00 32.20  ? 379  ASP A CB    1 
ATOM   1823 C  CG    . ASP A 1 269 ? -4.096  17.006  -31.814 1.00 43.41  ? 379  ASP A CG    1 
ATOM   1824 O  OD1   . ASP A 1 269 ? -2.877  17.060  -32.093 1.00 44.93  ? 379  ASP A OD1   1 
ATOM   1825 O  OD2   . ASP A 1 269 ? -4.583  17.502  -30.764 1.00 45.38  ? 379  ASP A OD2   1 
ATOM   1826 N  N     . ILE A 1 270 ? -2.438  13.957  -33.428 1.00 26.58  ? 380  ILE A N     1 
ATOM   1827 C  CA    . ILE A 1 270 ? -1.712  12.838  -32.838 1.00 25.72  ? 380  ILE A CA    1 
ATOM   1828 C  C     . ILE A 1 270 ? -0.843  13.373  -31.720 1.00 32.23  ? 380  ILE A C     1 
ATOM   1829 O  O     . ILE A 1 270 ? -0.026  14.275  -31.950 1.00 33.20  ? 380  ILE A O     1 
ATOM   1830 C  CB    . ILE A 1 270 ? -0.884  12.055  -33.901 1.00 29.39  ? 380  ILE A CB    1 
ATOM   1831 C  CG1   . ILE A 1 270 ? -1.782  11.534  -35.046 1.00 29.36  ? 380  ILE A CG1   1 
ATOM   1832 C  CG2   . ILE A 1 270 ? -0.077  10.902  -33.255 1.00 30.27  ? 380  ILE A CG2   1 
ATOM   1833 C  CD1   . ILE A 1 270 ? -1.066  11.157  -36.337 1.00 30.10  ? 380  ILE A CD1   1 
ATOM   1834 N  N     . LEU A 1 271 ? -1.027  12.833  -30.509 1.00 29.56  ? 381  LEU A N     1 
ATOM   1835 C  CA    . LEU A 1 271 ? -0.214  13.195  -29.355 1.00 31.31  ? 381  LEU A CA    1 
ATOM   1836 C  C     . LEU A 1 271 ? 0.828   12.128  -29.174 1.00 34.51  ? 381  LEU A C     1 
ATOM   1837 O  O     . LEU A 1 271 ? 0.479   10.965  -28.921 1.00 33.07  ? 381  LEU A O     1 
ATOM   1838 C  CB    . LEU A 1 271 ? -1.043  13.377  -28.076 1.00 32.04  ? 381  LEU A CB    1 
ATOM   1839 C  CG    . LEU A 1 271 ? -1.992  14.576  -27.986 1.00 38.52  ? 381  LEU A CG    1 
ATOM   1840 C  CD1   . LEU A 1 271 ? -2.584  14.669  -26.604 1.00 39.56  ? 381  LEU A CD1   1 
ATOM   1841 C  CD2   . LEU A 1 271 ? -1.248  15.888  -28.224 1.00 42.53  ? 381  LEU A CD2   1 
ATOM   1842 N  N     . GLU A 1 272 ? 2.115   12.505  -29.322 1.00 30.47  ? 382  GLU A N     1 
ATOM   1843 C  CA    . GLU A 1 272 ? 3.220   11.559  -29.174 1.00 30.01  ? 382  GLU A CA    1 
ATOM   1844 C  C     . GLU A 1 272 ? 3.293   11.054  -27.747 1.00 31.54  ? 382  GLU A C     1 
ATOM   1845 O  O     . GLU A 1 272 ? 2.899   11.765  -26.821 1.00 31.30  ? 382  GLU A O     1 
ATOM   1846 C  CB    . GLU A 1 272 ? 4.562   12.207  -29.608 1.00 33.25  ? 382  GLU A CB    1 
ATOM   1847 C  CG    . GLU A 1 272 ? 4.710   12.343  -31.120 1.00 43.02  ? 382  GLU A CG    1 
ATOM   1848 C  CD    . GLU A 1 272 ? 4.451   11.086  -31.939 1.00 60.66  ? 382  GLU A CD    1 
ATOM   1849 O  OE1   . GLU A 1 272 ? 5.045   10.031  -31.620 1.00 59.17  ? 382  GLU A OE1   1 
ATOM   1850 O  OE2   . GLU A 1 272 ? 3.643   11.154  -32.893 1.00 48.99  ? 382  GLU A OE2   1 
ATOM   1851 N  N     . SER A 1 273 ? 3.778   9.830   -27.571 1.00 28.87  ? 383  SER A N     1 
ATOM   1852 C  CA    . SER A 1 273 ? 3.914   9.215   -26.250 1.00 28.96  ? 383  SER A CA    1 
ATOM   1853 C  C     . SER A 1 273 ? 4.940   9.934   -25.379 1.00 33.00  ? 383  SER A C     1 
ATOM   1854 O  O     . SER A 1 273 ? 5.934   10.423  -25.884 1.00 32.69  ? 383  SER A O     1 
ATOM   1855 C  CB    . SER A 1 273 ? 4.314   7.746   -26.390 1.00 31.42  ? 383  SER A CB    1 
ATOM   1856 O  OG    . SER A 1 273 ? 4.797   7.209   -25.168 1.00 35.49  ? 383  SER A OG    1 
ATOM   1857 N  N     . THR A 1 274 ? 4.658   10.029  -24.075 1.00 31.35  ? 384  THR A N     1 
ATOM   1858 C  CA    . THR A 1 274 ? 5.576   10.566  -23.068 1.00 32.34  ? 384  THR A CA    1 
ATOM   1859 C  C     . THR A 1 274 ? 5.745   9.454   -21.992 1.00 35.56  ? 384  THR A C     1 
ATOM   1860 O  O     . THR A 1 274 ? 6.231   9.709   -20.884 1.00 34.80  ? 384  THR A O     1 
ATOM   1861 C  CB    . THR A 1 274 ? 5.083   11.914  -22.512 1.00 39.47  ? 384  THR A CB    1 
ATOM   1862 O  OG1   . THR A 1 274 ? 3.782   11.735  -21.960 1.00 42.62  ? 384  THR A OG1   1 
ATOM   1863 C  CG2   . THR A 1 274 ? 5.052   13.030  -23.565 1.00 29.66  ? 384  THR A CG2   1 
ATOM   1864 N  N     . PHE A 1 275 ? 5.313   8.218   -22.343 1.00 31.53  ? 385  PHE A N     1 
ATOM   1865 C  CA    . PHE A 1 275 ? 5.331   7.029   -21.489 1.00 31.03  ? 385  PHE A CA    1 
ATOM   1866 C  C     . PHE A 1 275 ? 6.728   6.737   -20.990 1.00 37.09  ? 385  PHE A C     1 
ATOM   1867 O  O     . PHE A 1 275 ? 7.681   6.772   -21.766 1.00 38.10  ? 385  PHE A O     1 
ATOM   1868 C  CB    . PHE A 1 275 ? 4.759   5.802   -22.230 1.00 30.92  ? 385  PHE A CB    1 
ATOM   1869 C  CG    . PHE A 1 275 ? 4.967   4.455   -21.566 1.00 30.80  ? 385  PHE A CG    1 
ATOM   1870 C  CD1   . PHE A 1 275 ? 4.292   4.123   -20.394 1.00 31.17  ? 385  PHE A CD1   1 
ATOM   1871 C  CD2   . PHE A 1 275 ? 5.817   3.511   -22.127 1.00 31.88  ? 385  PHE A CD2   1 
ATOM   1872 C  CE1   . PHE A 1 275 ? 4.487   2.879   -19.781 1.00 31.23  ? 385  PHE A CE1   1 
ATOM   1873 C  CE2   . PHE A 1 275 ? 6.002   2.269   -21.522 1.00 33.99  ? 385  PHE A CE2   1 
ATOM   1874 C  CZ    . PHE A 1 275 ? 5.328   1.956   -20.359 1.00 30.46  ? 385  PHE A CZ    1 
ATOM   1875 N  N     . GLU A 1 276 ? 6.837   6.450   -19.686 1.00 35.10  ? 386  GLU A N     1 
ATOM   1876 C  CA    . GLU A 1 276 ? 8.095   6.090   -19.021 1.00 36.92  ? 386  GLU A CA    1 
ATOM   1877 C  C     . GLU A 1 276 ? 7.926   4.709   -18.405 1.00 40.09  ? 386  GLU A C     1 
ATOM   1878 O  O     . GLU A 1 276 ? 7.167   4.541   -17.447 1.00 38.91  ? 386  GLU A O     1 
ATOM   1879 C  CB    . GLU A 1 276 ? 8.491   7.142   -17.968 1.00 39.17  ? 386  GLU A CB    1 
ATOM   1880 C  CG    . GLU A 1 276 ? 8.922   8.478   -18.553 1.00 48.68  ? 386  GLU A CG    1 
ATOM   1881 C  CD    . GLU A 1 276 ? 9.090   9.607   -17.551 1.00 65.83  ? 386  GLU A CD    1 
ATOM   1882 O  OE1   . GLU A 1 276 ? 9.764   9.395   -16.519 1.00 55.27  ? 386  GLU A OE1   1 
ATOM   1883 O  OE2   . GLU A 1 276 ? 8.566   10.716  -17.808 1.00 61.82  ? 386  GLU A OE2   1 
ATOM   1884 N  N     . LYS A 1 277 ? 8.614   3.718   -18.980 1.00 36.92  ? 387  LYS A N     1 
ATOM   1885 C  CA    . LYS A 1 277 ? 8.556   2.301   -18.606 1.00 36.04  ? 387  LYS A CA    1 
ATOM   1886 C  C     . LYS A 1 277 ? 8.788   2.045   -17.103 1.00 37.53  ? 387  LYS A C     1 
ATOM   1887 O  O     . LYS A 1 277 ? 8.130   1.181   -16.540 1.00 36.99  ? 387  LYS A O     1 
ATOM   1888 C  CB    . LYS A 1 277 ? 9.591   1.515   -19.435 1.00 40.48  ? 387  LYS A CB    1 
ATOM   1889 C  CG    . LYS A 1 277 ? 9.263   0.037   -19.607 1.00 66.56  ? 387  LYS A CG    1 
ATOM   1890 C  CD    . LYS A 1 277 ? 10.328  -0.707  -20.417 1.00 79.73  ? 387  LYS A CD    1 
ATOM   1891 C  CE    . LYS A 1 277 ? 9.961   -2.159  -20.660 1.00 88.57  ? 387  LYS A CE    1 
ATOM   1892 N  NZ    . LYS A 1 277 ? 10.139  -3.005  -19.448 1.00 95.96  ? 387  LYS A NZ    1 
ATOM   1893 N  N     . PHE A 1 278 ? 9.672   2.804   -16.449 1.00 34.40  ? 388  PHE A N     1 
ATOM   1894 C  CA    . PHE A 1 278 ? 10.019  2.516   -15.054 1.00 35.23  ? 388  PHE A CA    1 
ATOM   1895 C  C     . PHE A 1 278 ? 9.598   3.613   -14.031 1.00 40.93  ? 388  PHE A C     1 
ATOM   1896 O  O     . PHE A 1 278 ? 9.968   3.515   -12.851 1.00 40.91  ? 388  PHE A O     1 
ATOM   1897 C  CB    . PHE A 1 278 ? 11.530  2.216   -14.961 1.00 38.43  ? 388  PHE A CB    1 
ATOM   1898 C  CG    . PHE A 1 278 ? 11.952  1.095   -15.886 1.00 39.92  ? 388  PHE A CG    1 
ATOM   1899 C  CD1   . PHE A 1 278 ? 12.701  1.357   -17.025 1.00 44.42  ? 388  PHE A CD1   1 
ATOM   1900 C  CD2   . PHE A 1 278 ? 11.560  -0.219  -15.640 1.00 42.16  ? 388  PHE A CD2   1 
ATOM   1901 C  CE1   . PHE A 1 278 ? 13.089  0.318   -17.884 1.00 45.59  ? 388  PHE A CE1   1 
ATOM   1902 C  CE2   . PHE A 1 278 ? 11.927  -1.253  -16.512 1.00 45.30  ? 388  PHE A CE2   1 
ATOM   1903 C  CZ    . PHE A 1 278 ? 12.690  -0.977  -17.627 1.00 43.95  ? 388  PHE A CZ    1 
ATOM   1904 N  N     . LYS A 1 279 ? 8.790   4.605   -14.450 1.00 37.57  ? 389  LYS A N     1 
ATOM   1905 C  CA    . LYS A 1 279 ? 8.296   5.626   -13.511 1.00 38.42  ? 389  LYS A CA    1 
ATOM   1906 C  C     . LYS A 1 279 ? 7.133   5.068   -12.636 1.00 39.95  ? 389  LYS A C     1 
ATOM   1907 O  O     . LYS A 1 279 ? 6.326   4.272   -13.121 1.00 37.83  ? 389  LYS A O     1 
ATOM   1908 C  CB    . LYS A 1 279 ? 7.818   6.889   -14.257 1.00 40.58  ? 389  LYS A CB    1 
ATOM   1909 C  CG    . LYS A 1 279 ? 7.530   8.089   -13.332 1.00 59.33  ? 389  LYS A CG    1 
ATOM   1910 C  CD    . LYS A 1 279 ? 6.998   9.322   -14.075 1.00 67.76  ? 389  LYS A CD    1 
ATOM   1911 C  CE    . LYS A 1 279 ? 6.224   10.273  -13.187 1.00 80.80  ? 389  LYS A CE    1 
ATOM   1912 N  NZ    . LYS A 1 279 ? 4.805   9.842   -13.012 1.00 93.88  ? 389  LYS A NZ    1 
ATOM   1913 N  N     . GLN A 1 280 ? 7.057   5.503   -11.359 1.00 36.77  ? 390  GLN A N     1 
ATOM   1914 C  CA    . GLN A 1 280 ? 5.975   5.152   -10.429 1.00 36.27  ? 390  GLN A CA    1 
ATOM   1915 C  C     . GLN A 1 280 ? 4.620   5.668   -10.984 1.00 38.38  ? 390  GLN A C     1 
ATOM   1916 O  O     . GLN A 1 280 ? 4.614   6.727   -11.616 1.00 37.55  ? 390  GLN A O     1 
ATOM   1917 C  CB    . GLN A 1 280 ? 6.247   5.747   -9.028  1.00 38.52  ? 390  GLN A CB    1 
ATOM   1918 C  CG    . GLN A 1 280 ? 6.147   7.298   -8.951  1.00 40.00  ? 390  GLN A CG    1 
ATOM   1919 C  CD    . GLN A 1 280 ? 6.619   7.898   -7.636  1.00 49.09  ? 390  GLN A CD    1 
ATOM   1920 O  OE1   . GLN A 1 280 ? 5.808   8.299   -6.794  1.00 38.43  ? 390  GLN A OE1   1 
ATOM   1921 N  NE2   . GLN A 1 280 ? 7.946   8.012   -7.437  1.00 35.64  ? 390  GLN A NE2   1 
ATOM   1922 N  N     . PRO A 1 281 ? 3.477   4.974   -10.791 1.00 34.28  ? 391  PRO A N     1 
ATOM   1923 C  CA    . PRO A 1 281 ? 2.187   5.522   -11.282 1.00 33.84  ? 391  PRO A CA    1 
ATOM   1924 C  C     . PRO A 1 281 ? 1.828   6.848   -10.599 1.00 40.34  ? 391  PRO A C     1 
ATOM   1925 O  O     . PRO A 1 281 ? 2.346   7.161   -9.519  1.00 37.70  ? 391  PRO A O     1 
ATOM   1926 C  CB    . PRO A 1 281 ? 1.174   4.411   -10.934 1.00 34.37  ? 391  PRO A CB    1 
ATOM   1927 C  CG    . PRO A 1 281 ? 2.009   3.172   -10.758 1.00 38.76  ? 391  PRO A CG    1 
ATOM   1928 C  CD    . PRO A 1 281 ? 3.265   3.691   -10.102 1.00 35.94  ? 391  PRO A CD    1 
ATOM   1929 N  N     . SER A 1 282 ? 0.973   7.646   -11.257 1.00 41.73  ? 392  SER A N     1 
ATOM   1930 C  CA    . SER A 1 282 ? 0.503   8.960   -10.798 1.00 43.58  ? 392  SER A CA    1 
ATOM   1931 C  C     . SER A 1 282 ? -0.153  8.914   -9.402  1.00 49.93  ? 392  SER A C     1 
ATOM   1932 O  O     . SER A 1 282 ? -0.818  7.939   -9.042  1.00 48.74  ? 392  SER A O     1 
ATOM   1933 C  CB    . SER A 1 282 ? -0.502  9.530   -11.799 1.00 47.98  ? 392  SER A CB    1 
ATOM   1934 O  OG    . SER A 1 282 ? -0.844  10.877  -11.500 1.00 58.90  ? 392  SER A OG    1 
ATOM   1935 N  N     . ARG A 1 283 ? 0.052   9.982   -8.635  1.00 50.71  ? 393  ARG A N     1 
ATOM   1936 C  CA    . ARG A 1 283 ? -0.516  10.197  -7.301  1.00 52.62  ? 393  ARG A CA    1 
ATOM   1937 C  C     . ARG A 1 283 ? -1.762  11.132  -7.420  1.00 57.47  ? 393  ARG A C     1 
ATOM   1938 O  O     . ARG A 1 283 ? -2.567  11.211  -6.487  1.00 57.20  ? 393  ARG A O     1 
ATOM   1939 C  CB    . ARG A 1 283 ? 0.558   10.802  -6.379  1.00 55.42  ? 393  ARG A CB    1 
ATOM   1940 C  CG    . ARG A 1 283 ? 0.281   10.673  -4.888  1.00 74.02  ? 393  ARG A CG    1 
ATOM   1941 C  CD    . ARG A 1 283 ? 1.400   11.297  -4.065  1.00 92.22  ? 393  ARG A CD    1 
ATOM   1942 N  NE    . ARG A 1 283 ? 2.406   10.312  -3.651  1.00 104.14 ? 393  ARG A NE    1 
ATOM   1943 C  CZ    . ARG A 1 283 ? 3.590   10.140  -4.235  1.00 117.15 ? 393  ARG A CZ    1 
ATOM   1944 N  NH1   . ARG A 1 283 ? 3.943   10.889  -5.274  1.00 109.28 ? 393  ARG A NH1   1 
ATOM   1945 N  NH2   . ARG A 1 283 ? 4.434   9.224   -3.779  1.00 95.15  ? 393  ARG A NH2   1 
ATOM   1946 N  N     . LYS A 1 284 ? -1.912  11.816  -8.584  1.00 54.05  ? 394  LYS A N     1 
ATOM   1947 C  CA    . LYS A 1 284 ? -3.001  12.756  -8.892  1.00 54.82  ? 394  LYS A CA    1 
ATOM   1948 C  C     . LYS A 1 284 ? -4.389  12.122  -8.768  1.00 60.63  ? 394  LYS A C     1 
ATOM   1949 O  O     . LYS A 1 284 ? -4.545  10.917  -9.033  1.00 59.46  ? 394  LYS A O     1 
ATOM   1950 C  CB    . LYS A 1 284 ? -2.855  13.320  -10.312 1.00 56.29  ? 394  LYS A CB    1 
ATOM   1951 C  CG    . LYS A 1 284 ? -1.827  14.420  -10.462 1.00 74.35  ? 394  LYS A CG    1 
ATOM   1952 C  CD    . LYS A 1 284 ? -1.854  14.987  -11.878 1.00 86.44  ? 394  LYS A CD    1 
ATOM   1953 C  CE    . LYS A 1 284 ? -0.816  16.060  -12.093 1.00 101.67 ? 394  LYS A CE    1 
ATOM   1954 N  NZ    . LYS A 1 284 ? -0.987  16.733  -13.408 1.00 111.97 ? 394  LYS A NZ    1 
ATOM   1955 N  N     . VAL A 1 285 ? -5.403  12.957  -8.389  1.00 58.07  ? 395  VAL A N     1 
ATOM   1956 C  CA    . VAL A 1 285 ? -6.813  12.561  -8.267  1.00 57.50  ? 395  VAL A CA    1 
ATOM   1957 C  C     . VAL A 1 285 ? -7.320  12.072  -9.640  1.00 59.79  ? 395  VAL A C     1 
ATOM   1958 O  O     . VAL A 1 285 ? -7.900  10.980  -9.748  1.00 57.49  ? 395  VAL A O     1 
ATOM   1959 C  CB    . VAL A 1 285 ? -7.673  13.721  -7.719  1.00 62.05  ? 395  VAL A CB    1 
ATOM   1960 N  N     . ASP A 1 286 ? -7.024  12.872  -10.682 1.00 56.41  ? 396  ASP A N     1 
ATOM   1961 C  CA    . ASP A 1 286 ? -7.324  12.623  -12.088 1.00 55.33  ? 396  ASP A CA    1 
ATOM   1962 C  C     . ASP A 1 286 ? -5.997  12.373  -12.798 1.00 59.28  ? 396  ASP A C     1 
ATOM   1963 O  O     . ASP A 1 286 ? -5.271  13.330  -13.094 1.00 58.92  ? 396  ASP A O     1 
ATOM   1964 C  CB    . ASP A 1 286 ? -8.075  13.830  -12.692 1.00 57.64  ? 396  ASP A CB    1 
ATOM   1965 N  N     . ALA A 1 287 ? -5.640  11.083  -12.991 1.00 55.39  ? 397  ALA A N     1 
ATOM   1966 C  CA    . ALA A 1 287 ? -4.369  10.677  -13.593 1.00 54.77  ? 397  ALA A CA    1 
ATOM   1967 C  C     . ALA A 1 287 ? -4.338  10.962  -15.095 1.00 55.36  ? 397  ALA A C     1 
ATOM   1968 O  O     . ALA A 1 287 ? -5.325  10.738  -15.794 1.00 53.69  ? 397  ALA A O     1 
ATOM   1969 C  CB    . ALA A 1 287 ? -4.105  9.196   -13.323 1.00 55.16  ? 397  ALA A CB    1 
ATOM   1970 N  N     . LEU A 1 288 ? -3.192  11.471  -15.576 1.00 51.38  ? 398  LEU A N     1 
ATOM   1971 C  CA    . LEU A 1 288 ? -2.929  11.761  -16.988 1.00 50.06  ? 398  LEU A CA    1 
ATOM   1972 C  C     . LEU A 1 288 ? -2.452  10.486  -17.702 1.00 48.86  ? 398  LEU A C     1 
ATOM   1973 O  O     . LEU A 1 288 ? -1.780  9.640   -17.092 1.00 48.59  ? 398  LEU A O     1 
ATOM   1974 C  CB    . LEU A 1 288 ? -1.861  12.864  -17.105 1.00 51.49  ? 398  LEU A CB    1 
ATOM   1975 N  N     . ASP A 1 289 ? -2.819  10.339  -18.981 1.00 40.59  ? 399  ASP A N     1 
ATOM   1976 C  CA    . ASP A 1 289 ? -2.420  9.191   -19.794 1.00 37.70  ? 399  ASP A CA    1 
ATOM   1977 C  C     . ASP A 1 289 ? -1.250  9.631   -20.674 1.00 36.02  ? 399  ASP A C     1 
ATOM   1978 O  O     . ASP A 1 289 ? -1.366  10.600  -21.419 1.00 31.93  ? 399  ASP A O     1 
ATOM   1979 C  CB    . ASP A 1 289 ? -3.614  8.650   -20.599 1.00 37.73  ? 399  ASP A CB    1 
ATOM   1980 C  CG    . ASP A 1 289 ? -3.313  7.453   -21.466 1.00 33.92  ? 399  ASP A CG    1 
ATOM   1981 O  OD1   . ASP A 1 289 ? -2.570  7.608   -22.444 1.00 33.94  ? 399  ASP A OD1   1 
ATOM   1982 O  OD2   . ASP A 1 289 ? -3.955  6.413   -21.274 1.00 33.79  ? 399  ASP A OD2   1 
ATOM   1983 N  N     . HIS A 1 290 ? -0.131  8.908   -20.588 1.00 33.21  ? 400  HIS A N     1 
ATOM   1984 C  CA    . HIS A 1 290 ? 1.090   9.270   -21.314 1.00 34.13  ? 400  HIS A CA    1 
ATOM   1985 C  C     . HIS A 1 290 ? 1.291   8.471   -22.611 1.00 32.83  ? 400  HIS A C     1 
ATOM   1986 O  O     . HIS A 1 290 ? 2.287   8.699   -23.299 1.00 31.02  ? 400  HIS A O     1 
ATOM   1987 C  CB    . HIS A 1 290 ? 2.300   9.113   -20.386 1.00 37.37  ? 400  HIS A CB    1 
ATOM   1988 C  CG    . HIS A 1 290 ? 2.243   10.023  -19.198 1.00 43.45  ? 400  HIS A CG    1 
ATOM   1989 N  ND1   . HIS A 1 290 ? 2.373   11.393  -19.333 1.00 46.93  ? 400  HIS A ND1   1 
ATOM   1990 C  CD2   . HIS A 1 290 ? 2.054   9.731   -17.892 1.00 46.91  ? 400  HIS A CD2   1 
ATOM   1991 C  CE1   . HIS A 1 290 ? 2.269   11.884  -18.110 1.00 47.45  ? 400  HIS A CE1   1 
ATOM   1992 N  NE2   . HIS A 1 290 ? 2.068   10.924  -17.212 1.00 47.65  ? 400  HIS A NE2   1 
ATOM   1993 N  N     . PHE A 1 291 ? 0.351   7.556   -22.957 1.00 27.29  ? 401  PHE A N     1 
ATOM   1994 C  CA    . PHE A 1 291 ? 0.485   6.752   -24.174 1.00 26.68  ? 401  PHE A CA    1 
ATOM   1995 C  C     . PHE A 1 291 ? 0.255   7.600   -25.421 1.00 28.82  ? 401  PHE A C     1 
ATOM   1996 O  O     . PHE A 1 291 ? -0.432  8.617   -25.355 1.00 26.88  ? 401  PHE A O     1 
ATOM   1997 C  CB    . PHE A 1 291 ? -0.508  5.558   -24.173 1.00 27.45  ? 401  PHE A CB    1 
ATOM   1998 C  CG    . PHE A 1 291 ? -0.294  4.533   -23.081 1.00 29.30  ? 401  PHE A CG    1 
ATOM   1999 C  CD1   . PHE A 1 291 ? 0.959   3.953   -22.880 1.00 32.18  ? 401  PHE A CD1   1 
ATOM   2000 C  CD2   . PHE A 1 291 ? -1.343  4.149   -22.244 1.00 29.29  ? 401  PHE A CD2   1 
ATOM   2001 C  CE1   . PHE A 1 291 ? 1.155   3.005   -21.863 1.00 32.84  ? 401  PHE A CE1   1 
ATOM   2002 C  CE2   . PHE A 1 291 ? -1.151  3.175   -21.253 1.00 31.73  ? 401  PHE A CE2   1 
ATOM   2003 C  CZ    . PHE A 1 291 ? 0.090   2.601   -21.076 1.00 30.50  ? 401  PHE A CZ    1 
ATOM   2004 N  N     . GLN A 1 292 ? 0.801   7.155   -26.566 1.00 25.35  ? 402  GLN A N     1 
ATOM   2005 C  CA    . GLN A 1 292 ? 0.550   7.789   -27.850 1.00 24.24  ? 402  GLN A CA    1 
ATOM   2006 C  C     . GLN A 1 292 ? -0.955  7.672   -28.171 1.00 28.56  ? 402  GLN A C     1 
ATOM   2007 O  O     . GLN A 1 292 ? -1.557  6.594   -28.020 1.00 25.62  ? 402  GLN A O     1 
ATOM   2008 C  CB    . GLN A 1 292 ? 1.390   7.136   -28.944 1.00 25.95  ? 402  GLN A CB    1 
ATOM   2009 C  CG    . GLN A 1 292 ? 1.313   7.874   -30.283 1.00 35.50  ? 402  GLN A CG    1 
ATOM   2010 C  CD    . GLN A 1 292 ? 1.842   7.028   -31.406 1.00 56.67  ? 402  GLN A CD    1 
ATOM   2011 O  OE1   . GLN A 1 292 ? 1.552   5.820   -31.510 1.00 54.69  ? 402  GLN A OE1   1 
ATOM   2012 N  NE2   . GLN A 1 292 ? 2.604   7.653   -32.294 1.00 42.50  ? 402  GLN A NE2   1 
ATOM   2013 N  N     . LYS A 1 293 ? -1.574  8.798   -28.566 1.00 25.02  ? 403  LYS A N     1 
ATOM   2014 C  CA    . LYS A 1 293 ? -2.993  8.773   -28.866 1.00 23.58  ? 403  LYS A CA    1 
ATOM   2015 C  C     . LYS A 1 293 ? -3.353  9.758   -29.972 1.00 29.06  ? 403  LYS A C     1 
ATOM   2016 O  O     . LYS A 1 293 ? -2.554  10.639  -30.312 1.00 26.94  ? 403  LYS A O     1 
ATOM   2017 C  CB    . LYS A 1 293 ? -3.813  9.072   -27.602 1.00 24.55  ? 403  LYS A CB    1 
ATOM   2018 C  CG    . LYS A 1 293 ? -3.506  10.410  -26.939 1.00 34.05  ? 403  LYS A CG    1 
ATOM   2019 C  CD    . LYS A 1 293 ? -4.292  10.630  -25.655 1.00 37.66  ? 403  LYS A CD    1 
ATOM   2020 C  CE    . LYS A 1 293 ? -3.978  9.641   -24.553 1.00 32.52  ? 403  LYS A CE    1 
ATOM   2021 N  NZ    . LYS A 1 293 ? -2.610  9.842   -23.986 1.00 33.64  ? 403  LYS A NZ    1 
ATOM   2022 N  N     . CYS A 1 294 ? -4.567  9.616   -30.526 1.00 25.29  ? 404  CYS A N     1 
ATOM   2023 C  CA    . CYS A 1 294 ? -5.022  10.552  -31.534 1.00 26.37  ? 404  CYS A CA    1 
ATOM   2024 C  C     . CYS A 1 294 ? -6.508  10.808  -31.384 1.00 28.13  ? 404  CYS A C     1 
ATOM   2025 O  O     . CYS A 1 294 ? -7.294  9.917   -31.042 1.00 26.60  ? 404  CYS A O     1 
ATOM   2026 C  CB    . CYS A 1 294 ? -4.652  10.127  -32.957 1.00 28.44  ? 404  CYS A CB    1 
ATOM   2027 S  SG    . CYS A 1 294 ? -5.347  8.550   -33.483 1.00 32.75  ? 404  CYS A SG    1 
ATOM   2028 N  N     . PHE A 1 295 ? -6.865  12.058  -31.600 1.00 26.50  ? 405  PHE A N     1 
ATOM   2029 C  CA    . PHE A 1 295 ? -8.226  12.579  -31.538 1.00 27.15  ? 405  PHE A CA    1 
ATOM   2030 C  C     . PHE A 1 295 ? -8.629  12.848  -32.963 1.00 28.75  ? 405  PHE A C     1 
ATOM   2031 O  O     . PHE A 1 295 ? -8.001  13.645  -33.648 1.00 26.74  ? 405  PHE A O     1 
ATOM   2032 C  CB    . PHE A 1 295 ? -8.292  13.842  -30.651 1.00 29.82  ? 405  PHE A CB    1 
ATOM   2033 C  CG    . PHE A 1 295 ? -7.665  13.646  -29.290 1.00 33.19  ? 405  PHE A CG    1 
ATOM   2034 C  CD1   . PHE A 1 295 ? -6.492  14.314  -28.940 1.00 38.39  ? 405  PHE A CD1   1 
ATOM   2035 C  CD2   . PHE A 1 295 ? -8.222  12.771  -28.370 1.00 36.00  ? 405  PHE A CD2   1 
ATOM   2036 C  CE1   . PHE A 1 295 ? -5.911  14.125  -27.683 1.00 40.12  ? 405  PHE A CE1   1 
ATOM   2037 C  CE2   . PHE A 1 295 ? -7.625  12.567  -27.130 1.00 39.71  ? 405  PHE A CE2   1 
ATOM   2038 C  CZ    . PHE A 1 295 ? -6.490  13.258  -26.785 1.00 39.29  ? 405  PHE A CZ    1 
ATOM   2039 N  N     . LEU A 1 296 ? -9.608  12.101  -33.446 1.00 24.87  ? 406  LEU A N     1 
ATOM   2040 C  CA    . LEU A 1 296 ? -9.992  12.182  -34.855 1.00 25.03  ? 406  LEU A CA    1 
ATOM   2041 C  C     . LEU A 1 296 ? -11.443 12.473  -35.082 1.00 24.98  ? 406  LEU A C     1 
ATOM   2042 O  O     . LEU A 1 296 ? -12.291 12.261  -34.207 1.00 22.46  ? 406  LEU A O     1 
ATOM   2043 C  CB    . LEU A 1 296 ? -9.702  10.809  -35.549 1.00 25.81  ? 406  LEU A CB    1 
ATOM   2044 C  CG    . LEU A 1 296 ? -8.402  10.099  -35.243 1.00 30.44  ? 406  LEU A CG    1 
ATOM   2045 C  CD1   . LEU A 1 296 ? -8.425  8.694   -35.811 1.00 31.48  ? 406  LEU A CD1   1 
ATOM   2046 C  CD2   . LEU A 1 296 ? -7.234  10.850  -35.812 1.00 29.12  ? 406  LEU A CD2   1 
ATOM   2047 N  N     . ILE A 1 297 ? -11.725 12.900  -36.316 1.00 21.58  ? 407  ILE A N     1 
ATOM   2048 C  CA    . ILE A 1 297 ? -13.057 13.006  -36.893 1.00 22.16  ? 407  ILE A CA    1 
ATOM   2049 C  C     . ILE A 1 297 ? -12.978 12.201  -38.192 1.00 28.71  ? 407  ILE A C     1 
ATOM   2050 O  O     . ILE A 1 297 ? -12.164 12.524  -39.073 1.00 27.76  ? 407  ILE A O     1 
ATOM   2051 C  CB    . ILE A 1 297 ? -13.637 14.420  -37.091 1.00 25.55  ? 407  ILE A CB    1 
ATOM   2052 C  CG1   . ILE A 1 297 ? -13.712 15.188  -35.741 1.00 25.89  ? 407  ILE A CG1   1 
ATOM   2053 C  CG2   . ILE A 1 297 ? -15.043 14.313  -37.735 1.00 25.98  ? 407  ILE A CG2   1 
ATOM   2054 C  CD1   . ILE A 1 297 ? -14.107 16.684  -35.842 1.00 24.33  ? 407  ILE A CD1   1 
ATOM   2055 N  N     . LEU A 1 298 ? -13.771 11.137  -38.293 1.00 26.39  ? 408  LEU A N     1 
ATOM   2056 C  CA    . LEU A 1 298 ? -13.773 10.329  -39.508 1.00 27.83  ? 408  LEU A CA    1 
ATOM   2057 C  C     . LEU A 1 298 ? -15.065 10.490  -40.287 1.00 29.43  ? 408  LEU A C     1 
ATOM   2058 O  O     . LEU A 1 298 ? -16.124 10.705  -39.693 1.00 26.89  ? 408  LEU A O     1 
ATOM   2059 C  CB    . LEU A 1 298 ? -13.568 8.835   -39.188 1.00 28.39  ? 408  LEU A CB    1 
ATOM   2060 C  CG    . LEU A 1 298 ? -12.243 8.412   -38.529 1.00 33.49  ? 408  LEU A CG    1 
ATOM   2061 C  CD1   . LEU A 1 298 ? -12.118 6.914   -38.525 1.00 32.73  ? 408  LEU A CD1   1 
ATOM   2062 C  CD2   . LEU A 1 298 ? -11.022 9.034   -39.228 1.00 37.25  ? 408  LEU A CD2   1 
ATOM   2063 N  N     . LYS A 1 299 ? -14.970 10.349  -41.617 1.00 26.10  ? 409  LYS A N     1 
ATOM   2064 C  CA    . LYS A 1 299 ? -16.106 10.356  -42.517 1.00 26.22  ? 409  LYS A CA    1 
ATOM   2065 C  C     . LYS A 1 299 ? -16.654 8.921   -42.572 1.00 31.46  ? 409  LYS A C     1 
ATOM   2066 O  O     . LYS A 1 299 ? -15.958 8.016   -43.047 1.00 32.18  ? 409  LYS A O     1 
ATOM   2067 C  CB    . LYS A 1 299 ? -15.690 10.878  -43.911 1.00 29.33  ? 409  LYS A CB    1 
ATOM   2068 C  CG    . LYS A 1 299 ? -16.800 10.849  -44.953 1.00 35.69  ? 409  LYS A CG    1 
ATOM   2069 C  CD    . LYS A 1 299 ? -16.360 11.527  -46.227 1.00 48.49  ? 409  LYS A CD    1 
ATOM   2070 C  CE    . LYS A 1 299 ? -17.374 11.353  -47.324 1.00 64.88  ? 409  LYS A CE    1 
ATOM   2071 N  NZ    . LYS A 1 299 ? -16.928 11.999  -48.582 1.00 82.71  ? 409  LYS A NZ    1 
ATOM   2072 N  N     . LEU A 1 300 ? -17.861 8.700   -42.018 1.00 27.56  ? 410  LEU A N     1 
ATOM   2073 C  CA    . LEU A 1 300 ? -18.482 7.373   -42.009 1.00 26.37  ? 410  LEU A CA    1 
ATOM   2074 C  C     . LEU A 1 300 ? -19.579 7.299   -43.067 1.00 33.59  ? 410  LEU A C     1 
ATOM   2075 O  O     . LEU A 1 300 ? -20.649 7.882   -42.885 1.00 34.00  ? 410  LEU A O     1 
ATOM   2076 C  CB    . LEU A 1 300 ? -19.029 7.025   -40.608 1.00 24.57  ? 410  LEU A CB    1 
ATOM   2077 C  CG    . LEU A 1 300 ? -19.738 5.658   -40.432 1.00 26.87  ? 410  LEU A CG    1 
ATOM   2078 C  CD1   . LEU A 1 300 ? -18.767 4.500   -40.644 1.00 26.95  ? 410  LEU A CD1   1 
ATOM   2079 C  CD2   . LEU A 1 300 ? -20.401 5.567   -39.069 1.00 25.37  ? 410  LEU A CD2   1 
ATOM   2080 N  N     . ASP A 1 301 ? -19.315 6.585   -44.174 1.00 33.42  ? 411  ASP A N     1 
ATOM   2081 C  CA    . ASP A 1 301 ? -20.293 6.422   -45.255 1.00 35.23  ? 411  ASP A CA    1 
ATOM   2082 C  C     . ASP A 1 301 ? -21.494 5.608   -44.757 1.00 38.42  ? 411  ASP A C     1 
ATOM   2083 O  O     . ASP A 1 301 ? -21.305 4.634   -44.034 1.00 35.47  ? 411  ASP A O     1 
ATOM   2084 C  CB    . ASP A 1 301 ? -19.636 5.766   -46.483 1.00 39.73  ? 411  ASP A CB    1 
ATOM   2085 C  CG    . ASP A 1 301 ? -18.688 6.700   -47.241 1.00 61.98  ? 411  ASP A CG    1 
ATOM   2086 O  OD1   . ASP A 1 301 ? -18.832 7.947   -47.106 1.00 62.56  ? 411  ASP A OD1   1 
ATOM   2087 O  OD2   . ASP A 1 301 ? -17.829 6.190   -47.999 1.00 73.69  ? 411  ASP A OD2   1 
ATOM   2088 N  N     . HIS A 1 302 ? -22.727 6.035   -45.104 1.00 37.42  ? 412  HIS A N     1 
ATOM   2089 C  CA    . HIS A 1 302 ? -23.972 5.388   -44.657 1.00 37.74  ? 412  HIS A CA    1 
ATOM   2090 C  C     . HIS A 1 302 ? -24.054 3.916   -45.056 1.00 39.50  ? 412  HIS A C     1 
ATOM   2091 O  O     . HIS A 1 302 ? -24.572 3.124   -44.276 1.00 38.02  ? 412  HIS A O     1 
ATOM   2092 C  CB    . HIS A 1 302 ? -25.227 6.146   -45.128 1.00 40.28  ? 412  HIS A CB    1 
ATOM   2093 C  CG    . HIS A 1 302 ? -25.474 7.436   -44.393 1.00 44.27  ? 412  HIS A CG    1 
ATOM   2094 N  ND1   . HIS A 1 302 ? -26.418 8.348   -44.841 1.00 47.32  ? 412  HIS A ND1   1 
ATOM   2095 C  CD2   . HIS A 1 302 ? -24.861 7.947   -43.291 1.00 45.17  ? 412  HIS A CD2   1 
ATOM   2096 C  CE1   . HIS A 1 302 ? -26.341 9.379   -44.011 1.00 46.19  ? 412  HIS A CE1   1 
ATOM   2097 N  NE2   . HIS A 1 302 ? -25.444 9.171   -43.043 1.00 45.15  ? 412  HIS A NE2   1 
ATOM   2098 N  N     . GLY A 1 303 ? -23.483 3.561   -46.208 1.00 36.71  ? 413  GLY A N     1 
ATOM   2099 C  CA    . GLY A 1 303 ? -23.435 2.193   -46.729 1.00 36.77  ? 413  GLY A CA    1 
ATOM   2100 C  C     . GLY A 1 303 ? -22.706 1.199   -45.847 1.00 38.51  ? 413  GLY A C     1 
ATOM   2101 O  O     . GLY A 1 303 ? -22.981 0.007   -45.917 1.00 40.66  ? 413  GLY A O     1 
ATOM   2102 N  N     . ARG A 1 304 ? -21.780 1.681   -44.996 1.00 31.75  ? 414  ARG A N     1 
ATOM   2103 C  CA    . ARG A 1 304 ? -21.004 0.854   -44.063 1.00 29.82  ? 414  ARG A CA    1 
ATOM   2104 C  C     . ARG A 1 304 ? -21.792 0.530   -42.765 1.00 32.05  ? 414  ARG A C     1 
ATOM   2105 O  O     . ARG A 1 304 ? -21.403 -0.362  -42.001 1.00 30.63  ? 414  ARG A O     1 
ATOM   2106 C  CB    . ARG A 1 304 ? -19.698 1.572   -43.708 1.00 28.93  ? 414  ARG A CB    1 
ATOM   2107 C  CG    . ARG A 1 304 ? -18.844 1.911   -44.931 1.00 39.11  ? 414  ARG A CG    1 
ATOM   2108 C  CD    . ARG A 1 304 ? -17.414 2.291   -44.579 1.00 44.45  ? 414  ARG A CD    1 
ATOM   2109 N  NE    . ARG A 1 304 ? -16.667 1.164   -44.021 1.00 57.49  ? 414  ARG A NE    1 
ATOM   2110 C  CZ    . ARG A 1 304 ? -15.939 0.311   -44.736 1.00 78.49  ? 414  ARG A CZ    1 
ATOM   2111 N  NH1   . ARG A 1 304 ? -15.835 0.455   -46.051 1.00 69.39  ? 414  ARG A NH1   1 
ATOM   2112 N  NH2   . ARG A 1 304 ? -15.304 -0.690  -44.141 1.00 69.64  ? 414  ARG A NH2   1 
ATOM   2113 N  N     . VAL A 1 305 ? -22.895 1.257   -42.519 1.00 28.24  ? 415  VAL A N     1 
ATOM   2114 C  CA    . VAL A 1 305 ? -23.706 1.136   -41.300 1.00 27.26  ? 415  VAL A CA    1 
ATOM   2115 C  C     . VAL A 1 305 ? -24.849 0.163   -41.537 1.00 33.00  ? 415  VAL A C     1 
ATOM   2116 O  O     . VAL A 1 305 ? -25.655 0.391   -42.434 1.00 34.45  ? 415  VAL A O     1 
ATOM   2117 C  CB    . VAL A 1 305 ? -24.212 2.523   -40.810 1.00 29.23  ? 415  VAL A CB    1 
ATOM   2118 C  CG1   . VAL A 1 305 ? -24.943 2.410   -39.474 1.00 27.97  ? 415  VAL A CG1   1 
ATOM   2119 C  CG2   . VAL A 1 305 ? -23.052 3.518   -40.697 1.00 28.34  ? 415  VAL A CG2   1 
ATOM   2120 N  N     . HIS A 1 306 ? -24.910 -0.930  -40.746 1.00 29.90  ? 416  HIS A N     1 
ATOM   2121 C  CA    . HIS A 1 306 ? -25.985 -1.931  -40.877 1.00 32.28  ? 416  HIS A CA    1 
ATOM   2122 C  C     . HIS A 1 306 ? -26.952 -1.733  -39.724 1.00 34.22  ? 416  HIS A C     1 
ATOM   2123 O  O     . HIS A 1 306 ? -26.773 -2.294  -38.642 1.00 33.53  ? 416  HIS A O     1 
ATOM   2124 C  CB    . HIS A 1 306 ? -25.417 -3.370  -40.959 1.00 34.93  ? 416  HIS A CB    1 
ATOM   2125 C  CG    . HIS A 1 306 ? -24.344 -3.489  -41.999 1.00 40.54  ? 416  HIS A CG    1 
ATOM   2126 N  ND1   . HIS A 1 306 ? -23.029 -3.784  -41.656 1.00 42.32  ? 416  HIS A ND1   1 
ATOM   2127 C  CD2   . HIS A 1 306 ? -24.397 -3.211  -43.327 1.00 44.64  ? 416  HIS A CD2   1 
ATOM   2128 C  CE1   . HIS A 1 306 ? -22.347 -3.734  -42.789 1.00 43.31  ? 416  HIS A CE1   1 
ATOM   2129 N  NE2   . HIS A 1 306 ? -23.122 -3.382  -43.819 1.00 44.88  ? 416  HIS A NE2   1 
ATOM   2130 N  N     . SER A 1 307 ? -27.922 -0.842  -39.936 1.00 30.90  ? 417  SER A N     1 
ATOM   2131 C  CA    . SER A 1 307 ? -28.921 -0.492  -38.928 1.00 31.54  ? 417  SER A CA    1 
ATOM   2132 C  C     . SER A 1 307 ? -30.327 -0.802  -39.422 1.00 37.87  ? 417  SER A C     1 
ATOM   2133 O  O     . SER A 1 307 ? -30.503 -1.414  -40.488 1.00 36.56  ? 417  SER A O     1 
ATOM   2134 C  CB    . SER A 1 307 ? -28.803 0.988   -38.555 1.00 35.09  ? 417  SER A CB    1 
ATOM   2135 O  OG    . SER A 1 307 ? -29.240 1.822   -39.613 1.00 42.69  ? 417  SER A OG    1 
ATOM   2136 N  N     . GLU A 1 308 ? -31.333 -0.381  -38.647 1.00 38.69  ? 418  GLU A N     1 
ATOM   2137 C  CA    . GLU A 1 308 ? -32.741 -0.587  -39.031 1.00 42.46  ? 418  GLU A CA    1 
ATOM   2138 C  C     . GLU A 1 308 ? -33.113 0.376   -40.170 1.00 49.64  ? 418  GLU A C     1 
ATOM   2139 O  O     . GLU A 1 308 ? -33.896 0.015   -41.050 1.00 51.50  ? 418  GLU A O     1 
ATOM   2140 C  CB    . GLU A 1 308 ? -33.680 -0.413  -37.828 1.00 43.74  ? 418  GLU A CB    1 
ATOM   2141 C  CG    . GLU A 1 308 ? -33.423 -1.420  -36.720 1.00 51.45  ? 418  GLU A CG    1 
ATOM   2142 C  CD    . GLU A 1 308 ? -34.314 -1.250  -35.509 1.00 70.02  ? 418  GLU A CD    1 
ATOM   2143 O  OE1   . GLU A 1 308 ? -33.779 -1.156  -34.380 1.00 52.89  ? 418  GLU A OE1   1 
ATOM   2144 O  OE2   . GLU A 1 308 ? -35.552 -1.210  -35.693 1.00 66.59  ? 418  GLU A OE2   1 
ATOM   2145 N  N     . LYS A 1 309 ? -32.502 1.584   -40.162 1.00 45.79  ? 419  LYS A N     1 
ATOM   2146 C  CA    . LYS A 1 309 ? -32.677 2.633   -41.172 1.00 72.81  ? 419  LYS A CA    1 
ATOM   2147 C  C     . LYS A 1 309 ? -31.508 2.621   -42.150 1.00 102.03 ? 419  LYS A C     1 
ATOM   2148 O  O     . LYS A 1 309 ? -31.676 2.322   -43.326 1.00 74.26  ? 419  LYS A O     1 
ATOM   2149 C  CB    . LYS A 1 309 ? -32.793 4.015   -40.504 1.00 74.50  ? 419  LYS A CB    1 
ATOM   2150 C  CG    . LYS A 1 309 ? -34.153 4.289   -39.856 1.00 86.73  ? 419  LYS A CG    1 
ATOM   2151 C  CD    . LYS A 1 309 ? -35.040 5.214   -40.703 1.00 91.64  ? 419  LYS A CD    1 
ATOM   2152 C  CE    . LYS A 1 309 ? -36.111 4.462   -41.452 1.00 98.93  ? 419  LYS A CE    1 
ATOM   2153 N  NZ    . LYS A 1 309 ? -36.894 5.361   -42.338 1.00 106.97 ? 419  LYS A NZ    1 
ATOM   2154 N  N     . GLN A 1 313 ? -28.393 8.912   -49.390 1.00 73.29  ? 423  GLN A N     1 
ATOM   2155 C  CA    . GLN A 1 313 ? -29.374 8.077   -48.691 1.00 72.66  ? 423  GLN A CA    1 
ATOM   2156 C  C     . GLN A 1 313 ? -30.469 8.944   -48.020 1.00 74.92  ? 423  GLN A C     1 
ATOM   2157 O  O     . GLN A 1 313 ? -31.514 9.180   -48.631 1.00 75.65  ? 423  GLN A O     1 
ATOM   2158 C  CB    . GLN A 1 313 ? -28.672 7.196   -47.663 1.00 72.23  ? 423  GLN A CB    1 
ATOM   2159 N  N     . GLU A 1 314 ? -30.223 9.417   -46.778 1.00 68.51  ? 424  GLU A N     1 
ATOM   2160 C  CA    . GLU A 1 314 ? -31.117 10.294  -46.019 1.00 66.73  ? 424  GLU A CA    1 
ATOM   2161 C  C     . GLU A 1 314 ? -30.787 11.766  -46.332 1.00 66.58  ? 424  GLU A C     1 
ATOM   2162 O  O     . GLU A 1 314 ? -31.692 12.556  -46.610 1.00 67.84  ? 424  GLU A O     1 
ATOM   2163 C  CB    . GLU A 1 314 ? -30.979 10.013  -44.525 1.00 66.18  ? 424  GLU A CB    1 
ATOM   2164 N  N     . GLY A 1 315 ? -29.496 12.096  -46.319 1.00 57.71  ? 425  GLY A N     1 
ATOM   2165 C  CA    . GLY A 1 315 ? -28.976 13.426  -46.613 1.00 55.52  ? 425  GLY A CA    1 
ATOM   2166 C  C     . GLY A 1 315 ? -27.770 13.358  -47.526 1.00 55.48  ? 425  GLY A C     1 
ATOM   2167 O  O     . GLY A 1 315 ? -27.873 12.849  -48.644 1.00 55.69  ? 425  GLY A O     1 
ATOM   2168 N  N     . LYS A 1 316 ? -26.605 13.837  -47.034 1.00 48.58  ? 426  LYS A N     1 
ATOM   2169 C  CA    . LYS A 1 316 ? -25.303 13.843  -47.732 1.00 46.97  ? 426  LYS A CA    1 
ATOM   2170 C  C     . LYS A 1 316 ? -24.731 12.417  -47.971 1.00 47.61  ? 426  LYS A C     1 
ATOM   2171 O  O     . LYS A 1 316 ? -23.829 12.262  -48.796 1.00 47.56  ? 426  LYS A O     1 
ATOM   2172 C  CB    . LYS A 1 316 ? -24.260 14.702  -46.980 1.00 48.25  ? 426  LYS A CB    1 
ATOM   2173 C  CG    . LYS A 1 316 ? -24.289 14.579  -45.454 1.00 49.58  ? 426  LYS A CG    1 
ATOM   2174 C  CD    . LYS A 1 316 ? -23.113 15.283  -44.802 1.00 43.96  ? 426  LYS A CD    1 
ATOM   2175 C  CE    . LYS A 1 316 ? -23.269 15.584  -43.327 1.00 39.87  ? 426  LYS A CE    1 
ATOM   2176 N  NZ    . LYS A 1 316 ? -23.676 14.405  -42.530 1.00 45.72  ? 426  LYS A NZ    1 
ATOM   2177 N  N     . GLY A 1 317 ? -25.252 11.412  -47.265 1.00 40.99  ? 427  GLY A N     1 
ATOM   2178 C  CA    . GLY A 1 317 ? -24.828 10.021  -47.411 1.00 39.93  ? 427  GLY A CA    1 
ATOM   2179 C  C     . GLY A 1 317 ? -23.679 9.581   -46.528 1.00 41.13  ? 427  GLY A C     1 
ATOM   2180 O  O     . GLY A 1 317 ? -23.138 8.489   -46.721 1.00 40.88  ? 427  GLY A O     1 
ATOM   2181 N  N     . TRP A 1 318 ? -23.288 10.428  -45.551 1.00 36.27  ? 428  TRP A N     1 
ATOM   2182 C  CA    . TRP A 1 318 ? -22.204 10.139  -44.607 1.00 33.77  ? 428  TRP A CA    1 
ATOM   2183 C  C     . TRP A 1 318 ? -22.406 10.926  -43.316 1.00 34.47  ? 428  TRP A C     1 
ATOM   2184 O  O     . TRP A 1 318 ? -23.181 11.883  -43.285 1.00 32.99  ? 428  TRP A O     1 
ATOM   2185 C  CB    . TRP A 1 318 ? -20.810 10.414  -45.216 1.00 32.94  ? 428  TRP A CB    1 
ATOM   2186 C  CG    . TRP A 1 318 ? -20.591 11.823  -45.680 1.00 34.61  ? 428  TRP A CG    1 
ATOM   2187 C  CD1   . TRP A 1 318 ? -20.869 12.335  -46.915 1.00 38.63  ? 428  TRP A CD1   1 
ATOM   2188 C  CD2   . TRP A 1 318 ? -20.032 12.904  -44.913 1.00 33.83  ? 428  TRP A CD2   1 
ATOM   2189 N  NE1   . TRP A 1 318 ? -20.544 13.671  -46.961 1.00 37.95  ? 428  TRP A NE1   1 
ATOM   2190 C  CE2   . TRP A 1 318 ? -20.002 14.041  -45.754 1.00 38.59  ? 428  TRP A CE2   1 
ATOM   2191 C  CE3   . TRP A 1 318 ? -19.581 13.030  -43.584 1.00 33.86  ? 428  TRP A CE3   1 
ATOM   2192 C  CZ2   . TRP A 1 318 ? -19.532 15.287  -45.313 1.00 37.54  ? 428  TRP A CZ2   1 
ATOM   2193 C  CZ3   . TRP A 1 318 ? -19.116 14.260  -43.149 1.00 35.10  ? 428  TRP A CZ3   1 
ATOM   2194 C  CH2   . TRP A 1 318 ? -19.103 15.374  -44.005 1.00 36.65  ? 428  TRP A CH2   1 
ATOM   2195 N  N     . LYS A 1 319 ? -21.720 10.502  -42.241 1.00 29.30  ? 429  LYS A N     1 
ATOM   2196 C  CA    . LYS A 1 319 ? -21.806 11.149  -40.931 1.00 27.48  ? 429  LYS A CA    1 
ATOM   2197 C  C     . LYS A 1 319 ? -20.403 11.316  -40.348 1.00 28.01  ? 429  LYS A C     1 
ATOM   2198 O  O     . LYS A 1 319 ? -19.588 10.392  -40.447 1.00 26.14  ? 429  LYS A O     1 
ATOM   2199 C  CB    . LYS A 1 319 ? -22.700 10.317  -39.993 1.00 28.78  ? 429  LYS A CB    1 
ATOM   2200 C  CG    . LYS A 1 319 ? -22.975 10.960  -38.641 1.00 26.41  ? 429  LYS A CG    1 
ATOM   2201 C  CD    . LYS A 1 319 ? -23.887 10.111  -37.777 1.00 30.29  ? 429  LYS A CD    1 
ATOM   2202 C  CE    . LYS A 1 319 ? -23.861 10.570  -36.339 1.00 26.24  ? 429  LYS A CE    1 
ATOM   2203 N  NZ    . LYS A 1 319 ? -24.972 9.988   -35.560 1.00 22.41  ? 429  LYS A NZ    1 
ATOM   2204 N  N     . ALA A 1 320 ? -20.117 12.512  -39.794 1.00 23.14  ? 430  ALA A N     1 
ATOM   2205 C  CA    . ALA A 1 320 ? -18.852 12.794  -39.125 1.00 22.01  ? 430  ALA A CA    1 
ATOM   2206 C  C     . ALA A 1 320 ? -18.921 12.162  -37.748 1.00 24.43  ? 430  ALA A C     1 
ATOM   2207 O  O     . ALA A 1 320 ? -19.949 12.271  -37.078 1.00 21.64  ? 430  ALA A O     1 
ATOM   2208 C  CB    . ALA A 1 320 ? -18.613 14.297  -39.033 1.00 22.46  ? 430  ALA A CB    1 
ATOM   2209 N  N     . ILE A 1 321 ? -17.867 11.395  -37.381 1.00 23.17  ? 431  ILE A N     1 
ATOM   2210 C  CA    . ILE A 1 321 ? -17.797 10.659  -36.122 1.00 21.34  ? 431  ILE A CA    1 
ATOM   2211 C  C     . ILE A 1 321 ? -16.500 10.973  -35.393 1.00 22.80  ? 431  ILE A C     1 
ATOM   2212 O  O     . ILE A 1 321 ? -15.418 10.834  -35.972 1.00 20.60  ? 431  ILE A O     1 
ATOM   2213 C  CB    . ILE A 1 321 ? -17.923 9.112   -36.347 1.00 24.78  ? 431  ILE A CB    1 
ATOM   2214 C  CG1   . ILE A 1 321 ? -19.081 8.688   -37.296 1.00 25.33  ? 431  ILE A CG1   1 
ATOM   2215 C  CG2   . ILE A 1 321 ? -17.903 8.330   -35.012 1.00 26.27  ? 431  ILE A CG2   1 
ATOM   2216 C  CD1   . ILE A 1 321 ? -20.521 8.699   -36.732 1.00 23.11  ? 431  ILE A CD1   1 
ATOM   2217 N  N     . ARG A 1 322 ? -16.608 11.315  -34.096 1.00 20.08  ? 432  ARG A N     1 
ATOM   2218 C  CA    . ARG A 1 322 ? -15.437 11.522  -33.252 1.00 19.92  ? 432  ARG A CA    1 
ATOM   2219 C  C     . ARG A 1 322 ? -14.893 10.145  -32.869 1.00 22.21  ? 432  ARG A C     1 
ATOM   2220 O  O     . ARG A 1 322 ? -15.654 9.293   -32.407 1.00 20.71  ? 432  ARG A O     1 
ATOM   2221 C  CB    . ARG A 1 322 ? -15.779 12.362  -32.001 1.00 20.75  ? 432  ARG A CB    1 
ATOM   2222 C  CG    . ARG A 1 322 ? -15.711 13.874  -32.232 1.00 22.25  ? 432  ARG A CG    1 
ATOM   2223 C  CD    . ARG A 1 322 ? -14.269 14.360  -32.112 1.00 33.60  ? 432  ARG A CD    1 
ATOM   2224 N  NE    . ARG A 1 322 ? -13.749 14.167  -30.754 1.00 33.96  ? 432  ARG A NE    1 
ATOM   2225 C  CZ    . ARG A 1 322 ? -12.793 13.310  -30.407 1.00 40.74  ? 432  ARG A CZ    1 
ATOM   2226 N  NH1   . ARG A 1 322 ? -12.193 12.562  -31.325 1.00 27.30  ? 432  ARG A NH1   1 
ATOM   2227 N  NH2   . ARG A 1 322 ? -12.435 13.189  -29.140 1.00 26.44  ? 432  ARG A NH2   1 
ATOM   2228 N  N     . VAL A 1 323 ? -13.603 9.914   -33.115 1.00 18.97  ? 433  VAL A N     1 
ATOM   2229 C  CA    . VAL A 1 323 ? -12.916 8.662   -32.822 1.00 18.76  ? 433  VAL A CA    1 
ATOM   2230 C  C     . VAL A 1 323 ? -11.622 8.954   -32.063 1.00 22.19  ? 433  VAL A C     1 
ATOM   2231 O  O     . VAL A 1 323 ? -10.867 9.819   -32.481 1.00 19.06  ? 433  VAL A O     1 
ATOM   2232 C  CB    . VAL A 1 323 ? -12.629 7.855   -34.143 1.00 21.87  ? 433  VAL A CB    1 
ATOM   2233 C  CG1   . VAL A 1 323 ? -11.867 6.558   -33.871 1.00 21.67  ? 433  VAL A CG1   1 
ATOM   2234 C  CG2   . VAL A 1 323 ? -13.904 7.562   -34.923 1.00 21.23  ? 433  VAL A CG2   1 
ATOM   2235 N  N     . ASP A 1 324 ? -11.364 8.222   -30.964 1.00 21.03  ? 434  ASP A N     1 
ATOM   2236 C  CA    . ASP A 1 324 ? -10.098 8.323   -30.239 1.00 20.29  ? 434  ASP A CA    1 
ATOM   2237 C  C     . ASP A 1 324 ? -9.402  6.997   -30.286 1.00 24.05  ? 434  ASP A C     1 
ATOM   2238 O  O     . ASP A 1 324 ? -10.031 5.965   -30.039 1.00 22.87  ? 434  ASP A O     1 
ATOM   2239 C  CB    . ASP A 1 324 ? -10.265 8.766   -28.786 1.00 20.57  ? 434  ASP A CB    1 
ATOM   2240 C  CG    . ASP A 1 324 ? -10.909 10.121  -28.607 1.00 25.06  ? 434  ASP A CG    1 
ATOM   2241 O  OD1   . ASP A 1 324 ? -10.692 10.997  -29.457 1.00 24.24  ? 434  ASP A OD1   1 
ATOM   2242 O  OD2   . ASP A 1 324 ? -11.622 10.305  -27.610 1.00 30.58  ? 434  ASP A OD2   1 
ATOM   2243 N  N     . LEU A 1 325 ? -8.111  7.013   -30.652 1.00 23.38  ? 435  LEU A N     1 
ATOM   2244 C  CA    . LEU A 1 325 ? -7.288  5.799   -30.723 1.00 22.89  ? 435  LEU A CA    1 
ATOM   2245 C  C     . LEU A 1 325 ? -6.146  5.959   -29.780 1.00 27.50  ? 435  LEU A C     1 
ATOM   2246 O  O     . LEU A 1 325 ? -5.556  7.048   -29.710 1.00 26.79  ? 435  LEU A O     1 
ATOM   2247 C  CB    . LEU A 1 325 ? -6.754  5.507   -32.151 1.00 23.01  ? 435  LEU A CB    1 
ATOM   2248 C  CG    . LEU A 1 325 ? -7.744  5.518   -33.335 1.00 27.17  ? 435  LEU A CG    1 
ATOM   2249 C  CD1   . LEU A 1 325 ? -7.006  5.347   -34.654 1.00 28.81  ? 435  LEU A CD1   1 
ATOM   2250 C  CD2   . LEU A 1 325 ? -8.820  4.451   -33.195 1.00 28.46  ? 435  LEU A CD2   1 
ATOM   2251 N  N     . VAL A 1 326 ? -5.856  4.895   -29.021 1.00 25.21  ? 436  VAL A N     1 
ATOM   2252 C  CA    . VAL A 1 326 ? -4.736  4.821   -28.075 1.00 25.95  ? 436  VAL A CA    1 
ATOM   2253 C  C     . VAL A 1 326 ? -3.907  3.603   -28.396 1.00 28.89  ? 436  VAL A C     1 
ATOM   2254 O  O     . VAL A 1 326 ? -4.469  2.513   -28.555 1.00 26.90  ? 436  VAL A O     1 
ATOM   2255 C  CB    . VAL A 1 326 ? -5.210  4.754   -26.606 1.00 31.01  ? 436  VAL A CB    1 
ATOM   2256 C  CG1   . VAL A 1 326 ? -4.040  4.983   -25.635 1.00 30.71  ? 436  VAL A CG1   1 
ATOM   2257 C  CG2   . VAL A 1 326 ? -6.283  5.770   -26.372 1.00 31.51  ? 436  VAL A CG2   1 
ATOM   2258 N  N     . MET A 1 327 ? -2.574  3.786   -28.456 1.00 26.73  ? 437  MET A N     1 
ATOM   2259 C  CA    . MET A 1 327 ? -1.601  2.724   -28.694 1.00 27.76  ? 437  MET A CA    1 
ATOM   2260 C  C     . MET A 1 327 ? -0.790  2.513   -27.426 1.00 30.04  ? 437  MET A C     1 
ATOM   2261 O  O     . MET A 1 327 ? -0.184  3.460   -26.916 1.00 27.95  ? 437  MET A O     1 
ATOM   2262 C  CB    . MET A 1 327 ? -0.675  3.081   -29.881 1.00 31.74  ? 437  MET A CB    1 
ATOM   2263 C  CG    . MET A 1 327 ? 0.311   1.973   -30.243 1.00 36.76  ? 437  MET A CG    1 
ATOM   2264 S  SD    . MET A 1 327 ? -0.495  0.726   -31.272 1.00 41.81  ? 437  MET A SD    1 
ATOM   2265 C  CE    . MET A 1 327 ? 0.649   -0.590  -31.186 1.00 39.11  ? 437  MET A CE    1 
ATOM   2266 N  N     . CYS A 1 328 ? -0.759  1.283   -26.919 1.00 28.85  ? 438  CYS A N     1 
ATOM   2267 C  CA    . CYS A 1 328 ? 0.012   1.035   -25.712 1.00 29.00  ? 438  CYS A CA    1 
ATOM   2268 C  C     . CYS A 1 328 ? 0.917   -0.178  -25.846 1.00 31.82  ? 438  CYS A C     1 
ATOM   2269 O  O     . CYS A 1 328 ? 0.624   -1.067  -26.656 1.00 29.94  ? 438  CYS A O     1 
ATOM   2270 C  CB    . CYS A 1 328 ? -0.907  0.906   -24.502 1.00 29.14  ? 438  CYS A CB    1 
ATOM   2271 S  SG    . CYS A 1 328 ? -1.680  -0.704  -24.326 1.00 33.12  ? 438  CYS A SG    1 
ATOM   2272 N  N     . PRO A 1 329 ? 2.041   -0.231  -25.064 1.00 28.63  ? 439  PRO A N     1 
ATOM   2273 C  CA    . PRO A 1 329 ? 2.879   -1.436  -25.076 1.00 29.05  ? 439  PRO A CA    1 
ATOM   2274 C  C     . PRO A 1 329 ? 2.083   -2.656  -24.629 1.00 31.90  ? 439  PRO A C     1 
ATOM   2275 O  O     . PRO A 1 329 ? 1.221   -2.568  -23.743 1.00 30.30  ? 439  PRO A O     1 
ATOM   2276 C  CB    . PRO A 1 329 ? 4.005   -1.097  -24.085 1.00 31.60  ? 439  PRO A CB    1 
ATOM   2277 C  CG    . PRO A 1 329 ? 3.956   0.398   -23.917 1.00 34.25  ? 439  PRO A CG    1 
ATOM   2278 C  CD    . PRO A 1 329 ? 2.533   0.743   -24.067 1.00 28.92  ? 439  PRO A CD    1 
ATOM   2279 N  N     . TYR A 1 330 ? 2.346   -3.801  -25.257 1.00 30.33  ? 440  TYR A N     1 
ATOM   2280 C  CA    . TYR A 1 330 ? 1.622   -5.042  -24.989 1.00 29.80  ? 440  TYR A CA    1 
ATOM   2281 C  C     . TYR A 1 330 ? 1.501   -5.418  -23.507 1.00 32.33  ? 440  TYR A C     1 
ATOM   2282 O  O     . TYR A 1 330 ? 0.430   -5.862  -23.103 1.00 30.86  ? 440  TYR A O     1 
ATOM   2283 C  CB    . TYR A 1 330 ? 2.254   -6.218  -25.735 1.00 32.08  ? 440  TYR A CB    1 
ATOM   2284 C  CG    . TYR A 1 330 ? 1.366   -7.445  -25.727 1.00 33.30  ? 440  TYR A CG    1 
ATOM   2285 C  CD1   . TYR A 1 330 ? 0.148   -7.452  -26.401 1.00 34.64  ? 440  TYR A CD1   1 
ATOM   2286 C  CD2   . TYR A 1 330 ? 1.748   -8.604  -25.054 1.00 35.42  ? 440  TYR A CD2   1 
ATOM   2287 C  CE1   . TYR A 1 330 ? -0.664  -8.583  -26.417 1.00 36.22  ? 440  TYR A CE1   1 
ATOM   2288 C  CE2   . TYR A 1 330 ? 0.931   -9.739  -25.047 1.00 37.22  ? 440  TYR A CE2   1 
ATOM   2289 C  CZ    . TYR A 1 330 ? -0.271  -9.723  -25.737 1.00 43.73  ? 440  TYR A CZ    1 
ATOM   2290 O  OH    . TYR A 1 330 ? -1.092  -10.820 -25.746 1.00 47.07  ? 440  TYR A OH    1 
ATOM   2291 N  N     . ASP A 1 331 ? 2.582   -5.263  -22.712 1.00 29.09  ? 441  ASP A N     1 
ATOM   2292 C  CA    . ASP A 1 331 ? 2.584   -5.649  -21.293 1.00 28.25  ? 441  ASP A CA    1 
ATOM   2293 C  C     . ASP A 1 331 ? 1.716   -4.747  -20.414 1.00 29.97  ? 441  ASP A C     1 
ATOM   2294 O  O     . ASP A 1 331 ? 1.408   -5.154  -19.297 1.00 29.82  ? 441  ASP A O     1 
ATOM   2295 C  CB    . ASP A 1 331 ? 4.021   -5.700  -20.735 1.00 30.76  ? 441  ASP A CB    1 
ATOM   2296 C  CG    . ASP A 1 331 ? 4.740   -4.365  -20.704 1.00 36.08  ? 441  ASP A CG    1 
ATOM   2297 O  OD1   . ASP A 1 331 ? 5.480   -4.114  -19.731 1.00 41.24  ? 441  ASP A OD1   1 
ATOM   2298 O  OD2   . ASP A 1 331 ? 4.650   -3.621  -21.698 1.00 31.92  ? 441  ASP A OD2   1 
ATOM   2299 N  N     . ARG A 1 332 ? 1.295   -3.560  -20.914 1.00 25.46  ? 442  ARG A N     1 
ATOM   2300 C  CA    . ARG A 1 332 ? 0.460   -2.619  -20.140 1.00 24.34  ? 442  ARG A CA    1 
ATOM   2301 C  C     . ARG A 1 332 ? -1.000  -2.620  -20.617 1.00 26.27  ? 442  ARG A C     1 
ATOM   2302 O  O     . ARG A 1 332 ? -1.804  -1.820  -20.119 1.00 22.92  ? 442  ARG A O     1 
ATOM   2303 C  CB    . ARG A 1 332 ? 1.040   -1.178  -20.194 1.00 23.20  ? 442  ARG A CB    1 
ATOM   2304 C  CG    . ARG A 1 332 ? 2.572   -1.086  -19.937 1.00 25.90  ? 442  ARG A CG    1 
ATOM   2305 C  CD    . ARG A 1 332 ? 3.016   -1.784  -18.661 1.00 30.09  ? 442  ARG A CD    1 
ATOM   2306 N  NE    . ARG A 1 332 ? 4.459   -1.644  -18.463 1.00 36.01  ? 442  ARG A NE    1 
ATOM   2307 C  CZ    . ARG A 1 332 ? 5.021   -0.629  -17.808 1.00 45.45  ? 442  ARG A CZ    1 
ATOM   2308 N  NH1   . ARG A 1 332 ? 4.269   0.325   -17.273 1.00 33.00  ? 442  ARG A NH1   1 
ATOM   2309 N  NH2   . ARG A 1 332 ? 6.334   -0.564  -17.679 1.00 30.68  ? 442  ARG A NH2   1 
ATOM   2310 N  N     . ARG A 1 333 ? -1.351  -3.528  -21.563 1.00 23.34  ? 443  ARG A N     1 
ATOM   2311 C  CA    . ARG A 1 333 ? -2.692  -3.556  -22.159 1.00 23.32  ? 443  ARG A CA    1 
ATOM   2312 C  C     . ARG A 1 333 ? -3.845  -3.675  -21.146 1.00 25.18  ? 443  ARG A C     1 
ATOM   2313 O  O     . ARG A 1 333 ? -4.886  -3.062  -21.377 1.00 26.50  ? 443  ARG A O     1 
ATOM   2314 C  CB    . ARG A 1 333 ? -2.817  -4.643  -23.233 1.00 24.29  ? 443  ARG A CB    1 
ATOM   2315 C  CG    . ARG A 1 333 ? -2.904  -6.069  -22.723 1.00 32.68  ? 443  ARG A CG    1 
ATOM   2316 C  CD    . ARG A 1 333 ? -2.585  -7.049  -23.836 1.00 28.16  ? 443  ARG A CD    1 
ATOM   2317 N  NE    . ARG A 1 333 ? -2.674  -8.433  -23.375 1.00 26.62  ? 443  ARG A NE    1 
ATOM   2318 C  CZ    . ARG A 1 333 ? -1.745  -9.050  -22.653 1.00 45.30  ? 443  ARG A CZ    1 
ATOM   2319 N  NH1   . ARG A 1 333 ? -0.630  -8.411  -22.300 1.00 30.17  ? 443  ARG A NH1   1 
ATOM   2320 N  NH2   . ARG A 1 333 ? -1.918  -10.313 -22.281 1.00 38.08  ? 443  ARG A NH2   1 
ATOM   2321 N  N     . ALA A 1 334 ? -3.656  -4.373  -20.020 1.00 19.83  ? 444  ALA A N     1 
ATOM   2322 C  CA    . ALA A 1 334 ? -4.744  -4.514  -19.044 1.00 20.48  ? 444  ALA A CA    1 
ATOM   2323 C  C     . ALA A 1 334 ? -4.981  -3.207  -18.275 1.00 24.85  ? 444  ALA A C     1 
ATOM   2324 O  O     . ALA A 1 334 ? -6.125  -2.874  -17.981 1.00 25.16  ? 444  ALA A O     1 
ATOM   2325 C  CB    . ALA A 1 334 ? -4.472  -5.672  -18.083 1.00 20.70  ? 444  ALA A CB    1 
ATOM   2326 N  N     . PHE A 1 335 ? -3.908  -2.473  -17.947 1.00 24.13  ? 445  PHE A N     1 
ATOM   2327 C  CA    . PHE A 1 335 ? -4.004  -1.194  -17.225 1.00 22.13  ? 445  PHE A CA    1 
ATOM   2328 C  C     . PHE A 1 335 ? -4.629  -0.143  -18.126 1.00 23.86  ? 445  PHE A C     1 
ATOM   2329 O  O     . PHE A 1 335 ? -5.445  0.662   -17.670 1.00 21.56  ? 445  PHE A O     1 
ATOM   2330 C  CB    . PHE A 1 335 ? -2.613  -0.750  -16.708 1.00 24.19  ? 445  PHE A CB    1 
ATOM   2331 C  CG    . PHE A 1 335 ? -1.938  -1.798  -15.848 1.00 25.43  ? 445  PHE A CG    1 
ATOM   2332 C  CD1   . PHE A 1 335 ? -0.995  -2.669  -16.391 1.00 28.78  ? 445  PHE A CD1   1 
ATOM   2333 C  CD2   . PHE A 1 335 ? -2.300  -1.968  -14.516 1.00 25.14  ? 445  PHE A CD2   1 
ATOM   2334 C  CE1   . PHE A 1 335 ? -0.430  -3.691  -15.620 1.00 29.62  ? 445  PHE A CE1   1 
ATOM   2335 C  CE2   . PHE A 1 335 ? -1.732  -2.988  -13.748 1.00 28.25  ? 445  PHE A CE2   1 
ATOM   2336 C  CZ    . PHE A 1 335 ? -0.791  -3.838  -14.301 1.00 27.36  ? 445  PHE A CZ    1 
ATOM   2337 N  N     . ALA A 1 336 ? -4.253  -0.145  -19.413 1.00 22.19  ? 446  ALA A N     1 
ATOM   2338 C  CA    . ALA A 1 336 ? -4.782  0.806   -20.393 1.00 21.60  ? 446  ALA A CA    1 
ATOM   2339 C  C     . ALA A 1 336 ? -6.274  0.533   -20.644 1.00 23.63  ? 446  ALA A C     1 
ATOM   2340 O  O     . ALA A 1 336 ? -7.051  1.466   -20.627 1.00 22.82  ? 446  ALA A O     1 
ATOM   2341 C  CB    . ALA A 1 336 ? -3.982  0.715   -21.702 1.00 22.21  ? 446  ALA A CB    1 
ATOM   2342 N  N     . LEU A 1 337 ? -6.664  -0.746  -20.851 1.00 21.35  ? 447  LEU A N     1 
ATOM   2343 C  CA    . LEU A 1 337 ? -8.058  -1.171  -21.046 1.00 20.43  ? 447  LEU A CA    1 
ATOM   2344 C  C     . LEU A 1 337 ? -8.935  -0.729  -19.863 1.00 25.17  ? 447  LEU A C     1 
ATOM   2345 O  O     . LEU A 1 337 ? -10.004 -0.163  -20.071 1.00 23.46  ? 447  LEU A O     1 
ATOM   2346 C  CB    . LEU A 1 337 ? -8.148  -2.688  -21.240 1.00 20.22  ? 447  LEU A CB    1 
ATOM   2347 C  CG    . LEU A 1 337 ? -9.554  -3.279  -21.478 1.00 23.42  ? 447  LEU A CG    1 
ATOM   2348 C  CD1   . LEU A 1 337 ? -10.275 -2.596  -22.652 1.00 21.31  ? 447  LEU A CD1   1 
ATOM   2349 C  CD2   . LEU A 1 337 ? -9.477  -4.800  -21.676 1.00 24.62  ? 447  LEU A CD2   1 
ATOM   2350 N  N     . LEU A 1 338 ? -8.463  -0.971  -18.641 1.00 23.38  ? 448  LEU A N     1 
ATOM   2351 C  CA    . LEU A 1 338 ? -9.154  -0.601  -17.411 1.00 22.24  ? 448  LEU A CA    1 
ATOM   2352 C  C     . LEU A 1 338 ? -9.344  0.905   -17.327 1.00 25.41  ? 448  LEU A C     1 
ATOM   2353 O  O     . LEU A 1 338 ? -10.457 1.347   -17.075 1.00 23.18  ? 448  LEU A O     1 
ATOM   2354 C  CB    . LEU A 1 338 ? -8.386  -1.139  -16.196 1.00 22.68  ? 448  LEU A CB    1 
ATOM   2355 C  CG    . LEU A 1 338 ? -9.005  -0.915  -14.826 1.00 26.44  ? 448  LEU A CG    1 
ATOM   2356 C  CD1   . LEU A 1 338 ? -10.361 -1.634  -14.684 1.00 25.92  ? 448  LEU A CD1   1 
ATOM   2357 C  CD2   . LEU A 1 338 ? -8.079  -1.418  -13.750 1.00 25.13  ? 448  LEU A CD2   1 
ATOM   2358 N  N     . GLY A 1 339 ? -8.305  1.678   -17.614 1.00 22.97  ? 449  GLY A N     1 
ATOM   2359 C  CA    . GLY A 1 339 ? -8.385  3.137   -17.604 1.00 23.09  ? 449  GLY A CA    1 
ATOM   2360 C  C     . GLY A 1 339 ? -9.254  3.720   -18.699 1.00 28.22  ? 449  GLY A C     1 
ATOM   2361 O  O     . GLY A 1 339 ? -9.957  4.692   -18.452 1.00 31.54  ? 449  GLY A O     1 
ATOM   2362 N  N     . TRP A 1 340 ? -9.247  3.113   -19.905 1.00 24.77  ? 450  TRP A N     1 
ATOM   2363 C  CA    . TRP A 1 340 ? -10.016 3.611   -21.049 1.00 25.54  ? 450  TRP A CA    1 
ATOM   2364 C  C     . TRP A 1 340 ? -11.470 3.119   -21.066 1.00 25.24  ? 450  TRP A C     1 
ATOM   2365 O  O     . TRP A 1 340 ? -12.269 3.667   -21.820 1.00 23.96  ? 450  TRP A O     1 
ATOM   2366 C  CB    . TRP A 1 340 ? -9.294  3.299   -22.377 1.00 26.02  ? 450  TRP A CB    1 
ATOM   2367 C  CG    . TRP A 1 340 ? -8.198  4.306   -22.592 1.00 29.16  ? 450  TRP A CG    1 
ATOM   2368 C  CD1   . TRP A 1 340 ? -6.964  4.323   -22.001 1.00 32.89  ? 450  TRP A CD1   1 
ATOM   2369 C  CD2   . TRP A 1 340 ? -8.309  5.526   -23.305 1.00 29.65  ? 450  TRP A CD2   1 
ATOM   2370 N  NE1   . TRP A 1 340 ? -6.300  5.480   -22.316 1.00 33.34  ? 450  TRP A NE1   1 
ATOM   2371 C  CE2   . TRP A 1 340 ? -7.105  6.249   -23.099 1.00 34.44  ? 450  TRP A CE2   1 
ATOM   2372 C  CE3   . TRP A 1 340 ? -9.255  6.035   -24.200 1.00 31.45  ? 450  TRP A CE3   1 
ATOM   2373 C  CZ2   . TRP A 1 340 ? -6.858  7.479   -23.696 1.00 34.30  ? 450  TRP A CZ2   1 
ATOM   2374 C  CZ3   . TRP A 1 340 ? -8.967  7.220   -24.858 1.00 34.05  ? 450  TRP A CZ3   1 
ATOM   2375 C  CH2   . TRP A 1 340 ? -7.806  7.952   -24.568 1.00 35.01  ? 450  TRP A CH2   1 
ATOM   2376 N  N     . THR A 1 341 ? -11.835 2.157   -20.205 1.00 19.43  ? 451  THR A N     1 
ATOM   2377 C  CA    . THR A 1 341 ? -13.211 1.652   -20.178 1.00 18.21  ? 451  THR A CA    1 
ATOM   2378 C  C     . THR A 1 341 ? -14.093 2.616   -19.366 1.00 21.74  ? 451  THR A C     1 
ATOM   2379 O  O     . THR A 1 341 ? -15.274 2.778   -19.679 1.00 19.46  ? 451  THR A O     1 
ATOM   2380 C  CB    . THR A 1 341 ? -13.264 0.199   -19.659 1.00 19.99  ? 451  THR A CB    1 
ATOM   2381 O  OG1   . THR A 1 341 ? -12.582 -0.635  -20.603 1.00 21.16  ? 451  THR A OG1   1 
ATOM   2382 C  CG2   . THR A 1 341 ? -14.724 -0.322  -19.464 1.00 20.12  ? 451  THR A CG2   1 
ATOM   2383 N  N     . GLY A 1 342 ? -13.514 3.230   -18.335 1.00 19.16  ? 452  GLY A N     1 
ATOM   2384 C  CA    . GLY A 1 342 ? -14.227 4.157   -17.457 1.00 17.54  ? 452  GLY A CA    1 
ATOM   2385 C  C     . GLY A 1 342 ? -15.239 3.455   -16.534 1.00 22.24  ? 452  GLY A C     1 
ATOM   2386 O  O     . GLY A 1 342 ? -15.086 2.271   -16.259 1.00 21.96  ? 452  GLY A O     1 
ATOM   2387 N  N     . SER A 1 343 ? -16.283 4.154   -16.018 1.00 16.06  ? 453  SER A N     1 
ATOM   2388 C  CA    . SER A 1 343 ? -16.569 5.577   -16.233 1.00 16.79  ? 453  SER A CA    1 
ATOM   2389 C  C     . SER A 1 343 ? -15.511 6.422   -15.530 1.00 21.95  ? 453  SER A C     1 
ATOM   2390 O  O     . SER A 1 343 ? -14.702 5.867   -14.772 1.00 21.39  ? 453  SER A O     1 
ATOM   2391 C  CB    . SER A 1 343 ? -17.959 5.922   -15.683 1.00 18.61  ? 453  SER A CB    1 
ATOM   2392 O  OG    . SER A 1 343 ? -17.950 5.805   -14.265 1.00 22.92  ? 453  SER A OG    1 
ATOM   2393 N  N     . ARG A 1 344 ? -15.527 7.752   -15.723 1.00 21.24  ? 454  ARG A N     1 
ATOM   2394 C  CA    . ARG A 1 344 ? -14.578 8.641   -15.025 1.00 22.05  ? 454  ARG A CA    1 
ATOM   2395 C  C     . ARG A 1 344 ? -14.699 8.457   -13.491 1.00 25.68  ? 454  ARG A C     1 
ATOM   2396 O  O     . ARG A 1 344 ? -13.668 8.340   -12.841 1.00 25.76  ? 454  ARG A O     1 
ATOM   2397 C  CB    . ARG A 1 344 ? -14.799 10.121  -15.418 1.00 21.73  ? 454  ARG A CB    1 
ATOM   2398 N  N     . GLN A 1 345 ? -15.937 8.386   -12.925 1.00 21.52  ? 455  GLN A N     1 
ATOM   2399 C  CA    . GLN A 1 345 ? -16.111 8.191   -11.466 1.00 21.28  ? 455  GLN A CA    1 
ATOM   2400 C  C     . GLN A 1 345 ? -15.563 6.833   -10.995 1.00 24.42  ? 455  GLN A C     1 
ATOM   2401 O  O     . GLN A 1 345 ? -14.983 6.743   -9.906  1.00 22.34  ? 455  GLN A O     1 
ATOM   2402 C  CB    . GLN A 1 345 ? -17.588 8.347   -11.030 1.00 22.12  ? 455  GLN A CB    1 
ATOM   2403 C  CG    . GLN A 1 345 ? -17.771 8.438   -9.505  1.00 31.28  ? 455  GLN A CG    1 
ATOM   2404 C  CD    . GLN A 1 345 ? -17.147 9.669   -8.860  1.00 44.72  ? 455  GLN A CD    1 
ATOM   2405 O  OE1   . GLN A 1 345 ? -16.854 10.682  -9.503  1.00 36.99  ? 455  GLN A OE1   1 
ATOM   2406 N  NE2   . GLN A 1 345 ? -16.904 9.590   -7.568  1.00 41.95  ? 455  GLN A NE2   1 
ATOM   2407 N  N     . PHE A 1 346 ? -15.796 5.768   -11.792 1.00 21.20  ? 456  PHE A N     1 
ATOM   2408 C  CA    . PHE A 1 346 ? -15.291 4.443   -11.468 1.00 20.29  ? 456  PHE A CA    1 
ATOM   2409 C  C     . PHE A 1 346 ? -13.755 4.472   -11.392 1.00 24.07  ? 456  PHE A C     1 
ATOM   2410 O  O     . PHE A 1 346 ? -13.202 3.918   -10.452 1.00 22.95  ? 456  PHE A O     1 
ATOM   2411 C  CB    . PHE A 1 346 ? -15.753 3.399   -12.502 1.00 20.42  ? 456  PHE A CB    1 
ATOM   2412 C  CG    . PHE A 1 346 ? -15.468 1.985   -12.055 1.00 21.05  ? 456  PHE A CG    1 
ATOM   2413 C  CD1   . PHE A 1 346 ? -16.400 1.276   -11.301 1.00 23.11  ? 456  PHE A CD1   1 
ATOM   2414 C  CD2   . PHE A 1 346 ? -14.273 1.360   -12.386 1.00 22.35  ? 456  PHE A CD2   1 
ATOM   2415 C  CE1   . PHE A 1 346 ? -16.151 -0.037  -10.913 1.00 24.17  ? 456  PHE A CE1   1 
ATOM   2416 C  CE2   . PHE A 1 346 ? -14.018 0.037   -11.981 1.00 24.85  ? 456  PHE A CE2   1 
ATOM   2417 C  CZ    . PHE A 1 346 ? -14.952 -0.646  -11.240 1.00 22.88  ? 456  PHE A CZ    1 
ATOM   2418 N  N     . GLU A 1 347 ? -13.088 5.122   -12.374 1.00 23.68  ? 457  GLU A N     1 
ATOM   2419 C  CA    . GLU A 1 347 ? -11.614 5.268   -12.423 1.00 24.90  ? 457  GLU A CA    1 
ATOM   2420 C  C     . GLU A 1 347 ? -11.089 6.042   -11.207 1.00 27.37  ? 457  GLU A C     1 
ATOM   2421 O  O     . GLU A 1 347 ? -10.114 5.608   -10.607 1.00 25.69  ? 457  GLU A O     1 
ATOM   2422 C  CB    . GLU A 1 347 ? -11.168 6.006   -13.705 1.00 27.66  ? 457  GLU A CB    1 
ATOM   2423 C  CG    . GLU A 1 347 ? -11.492 5.320   -15.019 1.00 40.40  ? 457  GLU A CG    1 
ATOM   2424 C  CD    . GLU A 1 347 ? -10.967 3.909   -15.143 1.00 66.19  ? 457  GLU A CD    1 
ATOM   2425 O  OE1   . GLU A 1 347 ? -11.772 3.023   -15.501 1.00 83.09  ? 457  GLU A OE1   1 
ATOM   2426 O  OE2   . GLU A 1 347 ? -9.796  3.666   -14.773 1.00 64.98  ? 457  GLU A OE2   1 
ATOM   2427 N  N     . ARG A 1 348 ? -11.737 7.197   -10.861 1.00 24.38  ? 458  ARG A N     1 
ATOM   2428 C  CA    . ARG A 1 348 ? -11.370 8.028   -9.702  1.00 25.30  ? 458  ARG A CA    1 
ATOM   2429 C  C     . ARG A 1 348 ? -11.394 7.198   -8.415  1.00 29.46  ? 458  ARG A C     1 
ATOM   2430 O  O     . ARG A 1 348 ? -10.409 7.221   -7.674  1.00 31.47  ? 458  ARG A O     1 
ATOM   2431 C  CB    . ARG A 1 348 ? -12.313 9.232   -9.559  1.00 26.58  ? 458  ARG A CB    1 
ATOM   2432 C  CG    . ARG A 1 348 ? -11.950 10.451  -10.407 1.00 39.98  ? 458  ARG A CG    1 
ATOM   2433 C  CD    . ARG A 1 348 ? -12.796 11.672  -10.060 1.00 43.80  ? 458  ARG A CD    1 
ATOM   2434 N  NE    . ARG A 1 348 ? -14.192 11.489  -10.464 1.00 69.89  ? 458  ARG A NE    1 
ATOM   2435 C  CZ    . ARG A 1 348 ? -14.734 12.015  -11.559 1.00 82.46  ? 458  ARG A CZ    1 
ATOM   2436 N  NH1   . ARG A 1 348 ? -14.010 12.787  -12.362 1.00 76.41  ? 458  ARG A NH1   1 
ATOM   2437 N  NH2   . ARG A 1 348 ? -16.006 11.777  -11.856 1.00 50.09  ? 458  ARG A NH2   1 
ATOM   2438 N  N     . ASP A 1 349 ? -12.495 6.442   -8.174  1.00 24.67  ? 459  ASP A N     1 
ATOM   2439 C  CA    . ASP A 1 349 ? -12.637 5.620   -6.966  1.00 24.69  ? 459  ASP A CA    1 
ATOM   2440 C  C     . ASP A 1 349 ? -11.695 4.409   -6.938  1.00 25.47  ? 459  ASP A C     1 
ATOM   2441 O  O     . ASP A 1 349 ? -11.216 4.059   -5.858  1.00 24.09  ? 459  ASP A O     1 
ATOM   2442 C  CB    . ASP A 1 349 ? -14.078 5.191   -6.731  1.00 25.85  ? 459  ASP A CB    1 
ATOM   2443 C  CG    . ASP A 1 349 ? -14.896 6.273   -6.037  1.00 34.24  ? 459  ASP A CG    1 
ATOM   2444 O  OD1   . ASP A 1 349 ? -16.113 6.065   -5.852  1.00 31.71  ? 459  ASP A OD1   1 
ATOM   2445 O  OD2   . ASP A 1 349 ? -14.308 7.315   -5.652  1.00 36.42  ? 459  ASP A OD2   1 
ATOM   2446 N  N     . LEU A 1 350 ? -11.422 3.790   -8.096  1.00 22.05  ? 460  LEU A N     1 
ATOM   2447 C  CA    . LEU A 1 350 ? -10.447 2.702   -8.203  1.00 23.13  ? 460  LEU A CA    1 
ATOM   2448 C  C     . LEU A 1 350 ? -9.069  3.161   -7.672  1.00 27.29  ? 460  LEU A C     1 
ATOM   2449 O  O     . LEU A 1 350 ? -8.440  2.482   -6.854  1.00 26.71  ? 460  LEU A O     1 
ATOM   2450 C  CB    . LEU A 1 350 ? -10.282 2.345   -9.690  1.00 23.61  ? 460  LEU A CB    1 
ATOM   2451 C  CG    . LEU A 1 350 ? -10.868 1.100   -10.268 1.00 29.89  ? 460  LEU A CG    1 
ATOM   2452 C  CD1   . LEU A 1 350 ? -10.485 0.994   -11.757 1.00 30.41  ? 460  LEU A CD1   1 
ATOM   2453 C  CD2   . LEU A 1 350 ? -10.406 -0.154  -9.505  1.00 28.32  ? 460  LEU A CD2   1 
ATOM   2454 N  N     . ARG A 1 351 ? -8.622  4.339   -8.150  1.00 23.57  ? 461  ARG A N     1 
ATOM   2455 C  CA    . ARG A 1 351 ? -7.312  4.895   -7.798  1.00 24.13  ? 461  ARG A CA    1 
ATOM   2456 C  C     . ARG A 1 351 ? -7.296  5.323   -6.340  1.00 28.22  ? 461  ARG A C     1 
ATOM   2457 O  O     . ARG A 1 351 ? -6.304  5.074   -5.657  1.00 26.29  ? 461  ARG A O     1 
ATOM   2458 C  CB    . ARG A 1 351 ? -6.938  6.070   -8.724  1.00 24.51  ? 461  ARG A CB    1 
ATOM   2459 C  CG    . ARG A 1 351 ? -6.719  5.596   -10.138 1.00 37.06  ? 461  ARG A CG    1 
ATOM   2460 C  CD    . ARG A 1 351 ? -6.216  6.637   -11.112 1.00 55.27  ? 461  ARG A CD    1 
ATOM   2461 N  NE    . ARG A 1 351 ? -5.997  5.884   -12.339 1.00 64.20  ? 461  ARG A NE    1 
ATOM   2462 C  CZ    . ARG A 1 351 ? -6.636  6.078   -13.485 1.00 73.25  ? 461  ARG A CZ    1 
ATOM   2463 N  NH1   . ARG A 1 351 ? -6.411  5.269   -14.519 1.00 37.54  ? 461  ARG A NH1   1 
ATOM   2464 N  NH2   . ARG A 1 351 ? -7.501  7.084   -13.612 1.00 65.94  ? 461  ARG A NH2   1 
ATOM   2465 N  N     . ARG A 1 352 ? -8.415  5.921   -5.852  1.00 24.81  ? 462  ARG A N     1 
ATOM   2466 C  CA    . ARG A 1 352 ? -8.551  6.356   -4.460  1.00 25.17  ? 462  ARG A CA    1 
ATOM   2467 C  C     . ARG A 1 352 ? -8.508  5.145   -3.510  1.00 29.46  ? 462  ARG A C     1 
ATOM   2468 O  O     . ARG A 1 352 ? -7.791  5.200   -2.514  1.00 30.36  ? 462  ARG A O     1 
ATOM   2469 C  CB    . ARG A 1 352 ? -9.841  7.156   -4.287  1.00 23.29  ? 462  ARG A CB    1 
ATOM   2470 C  CG    . ARG A 1 352 ? -9.994  7.814   -2.922  1.00 35.56  ? 462  ARG A CG    1 
ATOM   2471 C  CD    . ARG A 1 352 ? -11.171 8.779   -2.885  1.00 47.02  ? 462  ARG A CD    1 
ATOM   2472 N  NE    . ARG A 1 352 ? -12.450 8.156   -3.252  1.00 48.51  ? 462  ARG A NE    1 
ATOM   2473 C  CZ    . ARG A 1 352 ? -13.478 7.974   -2.423  1.00 62.58  ? 462  ARG A CZ    1 
ATOM   2474 N  NH1   . ARG A 1 352 ? -13.382 8.322   -1.145  1.00 52.14  ? 462  ARG A NH1   1 
ATOM   2475 N  NH2   . ARG A 1 352 ? -14.609 7.449   -2.867  1.00 49.76  ? 462  ARG A NH2   1 
ATOM   2476 N  N     . TYR A 1 353 ? -9.272  4.072   -3.817  1.00 24.69  ? 463  TYR A N     1 
ATOM   2477 C  CA    . TYR A 1 353 ? -9.270  2.805   -3.071  1.00 24.73  ? 463  TYR A CA    1 
ATOM   2478 C  C     . TYR A 1 353 ? -7.852  2.216   -3.063  1.00 26.20  ? 463  TYR A C     1 
ATOM   2479 O  O     . TYR A 1 353 ? -7.357  1.865   -1.992  1.00 24.59  ? 463  TYR A O     1 
ATOM   2480 C  CB    . TYR A 1 353 ? -10.273 1.791   -3.692  1.00 24.40  ? 463  TYR A CB    1 
ATOM   2481 C  CG    . TYR A 1 353 ? -10.265 0.431   -3.025  1.00 26.84  ? 463  TYR A CG    1 
ATOM   2482 C  CD1   . TYR A 1 353 ? -11.124 0.146   -1.967  1.00 30.03  ? 463  TYR A CD1   1 
ATOM   2483 C  CD2   . TYR A 1 353 ? -9.417  -0.585  -3.469  1.00 26.62  ? 463  TYR A CD2   1 
ATOM   2484 C  CE1   . TYR A 1 353 ? -11.096 -1.092  -1.325  1.00 31.14  ? 463  TYR A CE1   1 
ATOM   2485 C  CE2   . TYR A 1 353 ? -9.367  -1.819  -2.821  1.00 27.74  ? 463  TYR A CE2   1 
ATOM   2486 C  CZ    . TYR A 1 353 ? -10.226 -2.076  -1.767  1.00 36.97  ? 463  TYR A CZ    1 
ATOM   2487 O  OH    . TYR A 1 353 ? -10.220 -3.300  -1.155  1.00 41.49  ? 463  TYR A OH    1 
ATOM   2488 N  N     . ALA A 1 354 ? -7.199  2.098   -4.241  1.00 23.85  ? 464  ALA A N     1 
ATOM   2489 C  CA    . ALA A 1 354 ? -5.812  1.564   -4.315  1.00 25.24  ? 464  ALA A CA    1 
ATOM   2490 C  C     . ALA A 1 354 ? -4.855  2.309   -3.352  1.00 29.41  ? 464  ALA A C     1 
ATOM   2491 O  O     . ALA A 1 354 ? -4.141  1.666   -2.577  1.00 29.66  ? 464  ALA A O     1 
ATOM   2492 C  CB    . ALA A 1 354 ? -5.277  1.650   -5.735  1.00 25.49  ? 464  ALA A CB    1 
ATOM   2493 N  N     . THR A 1 355 ? -4.912  3.641   -3.337  1.00 28.06  ? 465  THR A N     1 
ATOM   2494 C  CA    . THR A 1 355 ? -4.043  4.478   -2.489  1.00 30.32  ? 465  THR A CA    1 
ATOM   2495 C  C     . THR A 1 355 ? -4.394  4.365   -0.993  1.00 37.39  ? 465  THR A C     1 
ATOM   2496 O  O     . THR A 1 355 ? -3.534  4.007   -0.199  1.00 37.94  ? 465  THR A O     1 
ATOM   2497 C  CB    . THR A 1 355 ? -4.110  5.948   -2.944  1.00 40.31  ? 465  THR A CB    1 
ATOM   2498 O  OG1   . THR A 1 355 ? -3.711  6.004   -4.304  1.00 39.77  ? 465  THR A OG1   1 
ATOM   2499 C  CG2   . THR A 1 355 ? -3.208  6.875   -2.114  1.00 44.41  ? 465  THR A CG2   1 
ATOM   2500 N  N     . HIS A 1 356 ? -5.632  4.690   -0.620  1.00 35.71  ? 466  HIS A N     1 
ATOM   2501 C  CA    . HIS A 1 356 ? -6.055  4.764   0.778   1.00 37.93  ? 466  HIS A CA    1 
ATOM   2502 C  C     . HIS A 1 356 ? -6.268  3.430   1.457   1.00 37.96  ? 466  HIS A C     1 
ATOM   2503 O  O     . HIS A 1 356 ? -5.995  3.330   2.656   1.00 39.84  ? 466  HIS A O     1 
ATOM   2504 C  CB    . HIS A 1 356 ? -7.327  5.612   0.901   1.00 40.68  ? 466  HIS A CB    1 
ATOM   2505 C  CG    . HIS A 1 356 ? -7.093  7.029   0.463   1.00 45.81  ? 466  HIS A CG    1 
ATOM   2506 N  ND1   . HIS A 1 356 ? -8.055  7.737   -0.234  1.00 48.26  ? 466  HIS A ND1   1 
ATOM   2507 C  CD2   . HIS A 1 356 ? -5.975  7.794   0.562   1.00 49.22  ? 466  HIS A CD2   1 
ATOM   2508 C  CE1   . HIS A 1 356 ? -7.510  8.912   -0.511  1.00 48.43  ? 466  HIS A CE1   1 
ATOM   2509 N  NE2   . HIS A 1 356 ? -6.252  8.990   -0.062  1.00 49.19  ? 466  HIS A NE2   1 
ATOM   2510 N  N     . GLU A 1 357 ? -6.747  2.414   0.734   1.00 28.89  ? 467  GLU A N     1 
ATOM   2511 C  CA    . GLU A 1 357 ? -7.049  1.120   1.359   1.00 27.68  ? 467  GLU A CA    1 
ATOM   2512 C  C     . GLU A 1 357 ? -5.963  0.074   1.176   1.00 31.88  ? 467  GLU A C     1 
ATOM   2513 O  O     . GLU A 1 357 ? -5.858  -0.802  2.042   1.00 35.23  ? 467  GLU A O     1 
ATOM   2514 C  CB    . GLU A 1 357 ? -8.392  0.518   0.844   1.00 27.74  ? 467  GLU A CB    1 
ATOM   2515 C  CG    . GLU A 1 357 ? -9.607  1.422   0.967   1.00 32.56  ? 467  GLU A CG    1 
ATOM   2516 C  CD    . GLU A 1 357 ? -9.957  1.878   2.361   1.00 44.72  ? 467  GLU A CD    1 
ATOM   2517 O  OE1   . GLU A 1 357 ? -10.432 3.027   2.491   1.00 42.33  ? 467  GLU A OE1   1 
ATOM   2518 O  OE2   . GLU A 1 357 ? -9.730  1.110   3.324   1.00 39.27  ? 467  GLU A OE2   1 
ATOM   2519 N  N     . ARG A 1 358 ? -5.199  0.109   0.066   0.70 24.60  ? 468  ARG A N     1 
ATOM   2520 C  CA    . ARG A 1 358 ? -4.216  -0.939  -0.212  0.70 24.50  ? 468  ARG A CA    1 
ATOM   2521 C  C     . ARG A 1 358 ? -2.767  -0.454  -0.248  0.70 30.97  ? 468  ARG A C     1 
ATOM   2522 O  O     . ARG A 1 358 ? -1.875  -1.276  -0.413  0.70 28.44  ? 468  ARG A O     1 
ATOM   2523 C  CB    . ARG A 1 358 ? -4.541  -1.623  -1.559  0.70 20.97  ? 468  ARG A CB    1 
ATOM   2524 C  CG    . ARG A 1 358 ? -5.878  -2.337  -1.605  0.70 28.77  ? 468  ARG A CG    1 
ATOM   2525 C  CD    . ARG A 1 358 ? -5.810  -3.641  -0.862  0.70 43.58  ? 468  ARG A CD    1 
ATOM   2526 N  NE    . ARG A 1 358 ? -7.017  -3.882  -0.087  0.70 55.99  ? 468  ARG A NE    1 
ATOM   2527 C  CZ    . ARG A 1 358 ? -7.190  -4.932  0.707   0.70 68.30  ? 468  ARG A CZ    1 
ATOM   2528 N  NH1   . ARG A 1 358 ? -6.232  -5.846  0.829   0.70 55.56  ? 468  ARG A NH1   1 
ATOM   2529 N  NH2   . ARG A 1 358 ? -8.317  -5.078  1.386   0.70 52.49  ? 468  ARG A NH2   1 
ATOM   2530 N  N     . LYS A 1 359 ? -2.533  0.868   -0.123  1.00 31.88  ? 469  LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 359 ? -1.203  1.489   -0.208  1.00 32.45  ? 469  LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 359 ? -0.557  1.075   -1.546  1.00 34.83  ? 469  LYS A C     1 
ATOM   2533 O  O     . LYS A 1 359 ? 0.618   0.709   -1.616  1.00 34.01  ? 469  LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 359 ? -0.318  1.161   1.024   1.00 36.92  ? 469  LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 359 ? -0.885  1.731   2.327   1.00 57.92  ? 469  LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 359 ? -0.098  1.281   3.555   1.00 73.98  ? 469  LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 359 ? -0.858  1.438   4.858   1.00 88.85  ? 469  LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 359 ? -1.095  2.865   5.223   1.00 98.23  ? 469  LYS A NZ    1 
ATOM   2539 N  N     . MET A 1 360 ? -1.380  1.106   -2.603  1.00 30.25  ? 470  MET A N     1 
ATOM   2540 C  CA    . MET A 1 360 ? -0.989  0.804   -3.971  1.00 29.02  ? 470  MET A CA    1 
ATOM   2541 C  C     . MET A 1 360 ? -1.175  2.038   -4.830  1.00 32.36  ? 470  MET A C     1 
ATOM   2542 O  O     . MET A 1 360 ? -1.925  2.934   -4.468  1.00 32.13  ? 470  MET A O     1 
ATOM   2543 C  CB    . MET A 1 360 ? -1.760  -0.396  -4.528  1.00 31.02  ? 470  MET A CB    1 
ATOM   2544 C  CG    . MET A 1 360 ? -1.278  -1.717  -3.947  1.00 35.92  ? 470  MET A CG    1 
ATOM   2545 S  SD    . MET A 1 360 ? -2.236  -3.121  -4.543  1.00 40.36  ? 470  MET A SD    1 
ATOM   2546 C  CE    . MET A 1 360 ? -1.690  -4.396  -3.399  1.00 38.62  ? 470  MET A CE    1 
ATOM   2547 N  N     . MET A 1 361 ? -0.437  2.121   -5.930  1.00 28.71  ? 471  MET A N     1 
ATOM   2548 C  CA    . MET A 1 361 ? -0.510  3.272   -6.835  1.00 27.40  ? 471  MET A CA    1 
ATOM   2549 C  C     . MET A 1 361 ? -0.926  2.765   -8.187  1.00 28.99  ? 471  MET A C     1 
ATOM   2550 O  O     . MET A 1 361 ? -0.225  1.951   -8.771  1.00 29.02  ? 471  MET A O     1 
ATOM   2551 C  CB    . MET A 1 361 ? 0.837   4.021   -6.886  1.00 29.60  ? 471  MET A CB    1 
ATOM   2552 C  CG    . MET A 1 361 ? 1.316   4.493   -5.523  1.00 33.27  ? 471  MET A CG    1 
ATOM   2553 S  SD    . MET A 1 361 ? 2.971   5.215   -5.600  1.00 37.49  ? 471  MET A SD    1 
ATOM   2554 C  CE    . MET A 1 361 ? 2.542   6.923   -6.082  1.00 34.58  ? 471  MET A CE    1 
ATOM   2555 N  N     . LEU A 1 362 ? -2.110  3.150   -8.634  1.00 25.67  ? 472  LEU A N     1 
ATOM   2556 C  CA    . LEU A 1 362 ? -2.663  2.681   -9.897  1.00 25.48  ? 472  LEU A CA    1 
ATOM   2557 C  C     . LEU A 1 362 ? -2.900  3.834   -10.877 1.00 28.88  ? 472  LEU A C     1 
ATOM   2558 O  O     . LEU A 1 362 ? -3.365  4.897   -10.465 1.00 27.13  ? 472  LEU A O     1 
ATOM   2559 C  CB    . LEU A 1 362 ? -4.010  1.960   -9.603  1.00 25.17  ? 472  LEU A CB    1 
ATOM   2560 C  CG    . LEU A 1 362 ? -4.856  1.466   -10.793 1.00 28.44  ? 472  LEU A CG    1 
ATOM   2561 C  CD1   . LEU A 1 362 ? -4.209  0.249   -11.477 1.00 26.25  ? 472  LEU A CD1   1 
ATOM   2562 C  CD2   . LEU A 1 362 ? -6.294  1.124   -10.334 1.00 30.83  ? 472  LEU A CD2   1 
ATOM   2563 N  N     . ASP A 1 363 ? -2.650  3.578   -12.180 1.00 24.42  ? 473  ASP A N     1 
ATOM   2564 C  CA    . ASP A 1 363 ? -2.934  4.515   -13.281 1.00 22.78  ? 473  ASP A CA    1 
ATOM   2565 C  C     . ASP A 1 363 ? -3.123  3.705   -14.574 1.00 24.14  ? 473  ASP A C     1 
ATOM   2566 O  O     . ASP A 1 363 ? -3.117  2.470   -14.514 1.00 24.86  ? 473  ASP A O     1 
ATOM   2567 C  CB    . ASP A 1 363 ? -1.833  5.587   -13.391 1.00 25.21  ? 473  ASP A CB    1 
ATOM   2568 C  CG    . ASP A 1 363 ? -0.454  5.076   -13.729 1.00 31.27  ? 473  ASP A CG    1 
ATOM   2569 O  OD1   . ASP A 1 363 ? -0.277  3.851   -13.829 1.00 33.52  ? 473  ASP A OD1   1 
ATOM   2570 O  OD2   . ASP A 1 363 ? 0.449   5.899   -13.848 1.00 45.13  ? 473  ASP A OD2   1 
ATOM   2571 N  N     . ASN A 1 364 ? -3.267  4.365   -15.730 1.00 20.52  ? 474  ASN A N     1 
ATOM   2572 C  CA    . ASN A 1 364 ? -3.468  3.673   -17.016 1.00 20.79  ? 474  ASN A CA    1 
ATOM   2573 C  C     . ASN A 1 364 ? -2.278  2.843   -17.485 1.00 26.14  ? 474  ASN A C     1 
ATOM   2574 O  O     . ASN A 1 364 ? -2.420  2.095   -18.456 1.00 26.39  ? 474  ASN A O     1 
ATOM   2575 C  CB    . ASN A 1 364 ? -3.788  4.694   -18.114 1.00 17.28  ? 474  ASN A CB    1 
ATOM   2576 C  CG    . ASN A 1 364 ? -5.181  5.268   -18.025 1.00 29.13  ? 474  ASN A CG    1 
ATOM   2577 O  OD1   . ASN A 1 364 ? -5.909  5.102   -17.055 1.00 23.90  ? 474  ASN A OD1   1 
ATOM   2578 N  ND2   . ASN A 1 364 ? -5.596  5.942   -19.049 1.00 21.65  ? 474  ASN A ND2   1 
ATOM   2579 N  N     . HIS A 1 365 ? -1.097  3.039   -16.881 1.00 23.70  ? 475  HIS A N     1 
ATOM   2580 C  CA    . HIS A 1 365 ? 0.127   2.378   -17.325 1.00 24.62  ? 475  HIS A CA    1 
ATOM   2581 C  C     . HIS A 1 365 ? 0.613   1.269   -16.372 1.00 27.35  ? 475  HIS A C     1 
ATOM   2582 O  O     . HIS A 1 365 ? 1.346   0.372   -16.820 1.00 26.75  ? 475  HIS A O     1 
ATOM   2583 C  CB    . HIS A 1 365 ? 1.274   3.418   -17.513 1.00 26.98  ? 475  HIS A CB    1 
ATOM   2584 C  CG    . HIS A 1 365 ? 0.809   4.800   -17.909 1.00 31.94  ? 475  HIS A CG    1 
ATOM   2585 N  ND1   . HIS A 1 365 ? 0.512   5.763   -16.954 1.00 34.19  ? 475  HIS A ND1   1 
ATOM   2586 C  CD2   . HIS A 1 365 ? 0.603   5.337   -19.138 1.00 35.60  ? 475  HIS A CD2   1 
ATOM   2587 C  CE1   . HIS A 1 365 ? 0.129   6.838   -17.625 1.00 34.41  ? 475  HIS A CE1   1 
ATOM   2588 N  NE2   . HIS A 1 365 ? 0.151   6.627   -18.940 1.00 35.68  ? 475  HIS A NE2   1 
ATOM   2589 N  N     . ALA A 1 366 ? 0.283   1.344   -15.061 1.00 22.09  ? 476  ALA A N     1 
ATOM   2590 C  CA    . ALA A 1 366 ? 0.855   0.371   -14.131 1.00 21.68  ? 476  ALA A CA    1 
ATOM   2591 C  C     . ALA A 1 366 ? 0.161   0.337   -12.779 1.00 24.31  ? 476  ALA A C     1 
ATOM   2592 O  O     . ALA A 1 366 ? -0.672  1.182   -12.487 1.00 23.11  ? 476  ALA A O     1 
ATOM   2593 C  CB    . ALA A 1 366 ? 2.355   0.677   -13.910 1.00 22.75  ? 476  ALA A CB    1 
ATOM   2594 N  N     . LEU A 1 367 ? 0.553   -0.669  -11.954 1.00 21.87  ? 477  LEU A N     1 
ATOM   2595 C  CA    . LEU A 1 367 ? 0.145   -0.912  -10.565 1.00 22.03  ? 477  LEU A CA    1 
ATOM   2596 C  C     . LEU A 1 367 ? 1.370   -1.173  -9.713  1.00 26.40  ? 477  LEU A C     1 
ATOM   2597 O  O     . LEU A 1 367 ? 2.125   -2.120  -9.962  1.00 25.50  ? 477  LEU A O     1 
ATOM   2598 C  CB    . LEU A 1 367 ? -0.870  -2.071  -10.428 1.00 21.97  ? 477  LEU A CB    1 
ATOM   2599 C  CG    . LEU A 1 367 ? -1.363  -2.386  -9.003  1.00 25.20  ? 477  LEU A CG    1 
ATOM   2600 C  CD1   . LEU A 1 367 ? -2.084  -1.175  -8.369  1.00 21.87  ? 477  LEU A CD1   1 
ATOM   2601 C  CD2   . LEU A 1 367 ? -2.292  -3.578  -9.014  1.00 25.79  ? 477  LEU A CD2   1 
ATOM   2602 N  N     . TYR A 1 368 ? 1.584   -0.317  -8.725  1.00 24.40  ? 478  TYR A N     1 
ATOM   2603 C  CA    . TYR A 1 368 ? 2.760   -0.418  -7.867  1.00 24.07  ? 478  TYR A CA    1 
ATOM   2604 C  C     . TYR A 1 368 ? 2.351   -0.623  -6.421  1.00 26.37  ? 478  TYR A C     1 
ATOM   2605 O  O     . TYR A 1 368 ? 1.514   0.114   -5.907  1.00 25.55  ? 478  TYR A O     1 
ATOM   2606 C  CB    . TYR A 1 368 ? 3.647   0.835   -8.018  1.00 23.94  ? 478  TYR A CB    1 
ATOM   2607 C  CG    . TYR A 1 368 ? 4.840   0.835   -7.093  1.00 26.02  ? 478  TYR A CG    1 
ATOM   2608 C  CD1   . TYR A 1 368 ? 5.908   -0.035  -7.301  1.00 28.34  ? 478  TYR A CD1   1 
ATOM   2609 C  CD2   . TYR A 1 368 ? 4.879   1.662   -5.977  1.00 26.92  ? 478  TYR A CD2   1 
ATOM   2610 C  CE1   . TYR A 1 368 ? 6.986   -0.078  -6.424  1.00 28.66  ? 478  TYR A CE1   1 
ATOM   2611 C  CE2   . TYR A 1 368 ? 5.951   1.626   -5.089  1.00 28.65  ? 478  TYR A CE2   1 
ATOM   2612 C  CZ    . TYR A 1 368 ? 7.003   0.756   -5.317  1.00 32.59  ? 478  TYR A CZ    1 
ATOM   2613 O  OH    . TYR A 1 368 ? 8.081   0.767   -4.472  1.00 24.04  ? 478  TYR A OH    1 
ATOM   2614 N  N     . ASP A 1 369 ? 2.977   -1.607  -5.766  1.00 22.62  ? 479  ASP A N     1 
ATOM   2615 C  CA    . ASP A 1 369 ? 2.751   -1.949  -4.369  1.00 23.15  ? 479  ASP A CA    1 
ATOM   2616 C  C     . ASP A 1 369 ? 3.837   -1.276  -3.534  1.00 27.34  ? 479  ASP A C     1 
ATOM   2617 O  O     . ASP A 1 369 ? 4.987   -1.672  -3.616  1.00 26.68  ? 479  ASP A O     1 
ATOM   2618 C  CB    . ASP A 1 369 ? 2.762   -3.489  -4.208  1.00 26.01  ? 479  ASP A CB    1 
ATOM   2619 C  CG    . ASP A 1 369 ? 2.351   -4.025  -2.849  1.00 35.66  ? 479  ASP A CG    1 
ATOM   2620 O  OD1   . ASP A 1 369 ? 2.613   -3.344  -1.834  1.00 38.39  ? 479  ASP A OD1   1 
ATOM   2621 O  OD2   . ASP A 1 369 ? 1.832   -5.154  -2.794  1.00 40.39  ? 479  ASP A OD2   1 
ATOM   2622 N  N     . ARG A 1 370 ? 3.473   -0.244  -2.758  1.00 26.07  ? 480  ARG A N     1 
ATOM   2623 C  CA    . ARG A 1 370 ? 4.410   0.515   -1.927  1.00 27.60  ? 480  ARG A CA    1 
ATOM   2624 C  C     . ARG A 1 370 ? 4.969   -0.312  -0.728  1.00 34.06  ? 480  ARG A C     1 
ATOM   2625 O  O     . ARG A 1 370 ? 6.065   -0.013  -0.251  1.00 34.53  ? 480  ARG A O     1 
ATOM   2626 C  CB    . ARG A 1 370 ? 3.737   1.790   -1.415  1.00 27.70  ? 480  ARG A CB    1 
ATOM   2627 C  CG    . ARG A 1 370 ? 3.347   2.777   -2.517  1.00 36.56  ? 480  ARG A CG    1 
ATOM   2628 C  CD    . ARG A 1 370 ? 2.648   4.000   -1.958  1.00 34.84  ? 480  ARG A CD    1 
ATOM   2629 N  NE    . ARG A 1 370 ? 3.491   4.726   -1.012  1.00 39.69  ? 480  ARG A NE    1 
ATOM   2630 C  CZ    . ARG A 1 370 ? 3.065   5.218   0.142   1.00 52.08  ? 480  ARG A CZ    1 
ATOM   2631 N  NH1   . ARG A 1 370 ? 3.901   5.862   0.943   1.00 36.17  ? 480  ARG A NH1   1 
ATOM   2632 N  NH2   . ARG A 1 370 ? 1.796   5.069   0.508   1.00 42.67  ? 480  ARG A NH2   1 
ATOM   2633 N  N     . THR A 1 371 ? 4.215   -1.312  -0.243  1.00 31.70  ? 481  THR A N     1 
ATOM   2634 C  CA    . THR A 1 371 ? 4.637   -2.161  0.877   1.00 33.40  ? 481  THR A CA    1 
ATOM   2635 C  C     . THR A 1 371 ? 5.643   -3.220  0.380   1.00 38.54  ? 481  THR A C     1 
ATOM   2636 O  O     . THR A 1 371 ? 6.695   -3.389  0.987   1.00 37.37  ? 481  THR A O     1 
ATOM   2637 C  CB    . THR A 1 371 ? 3.427   -2.807  1.592   1.00 38.32  ? 481  THR A CB    1 
ATOM   2638 O  OG1   . THR A 1 371 ? 2.482   -1.793  1.958   1.00 39.79  ? 481  THR A OG1   1 
ATOM   2639 C  CG2   . THR A 1 371 ? 3.839   -3.582  2.855   1.00 38.33  ? 481  THR A CG2   1 
ATOM   2640 N  N     . LYS A 1 372 ? 5.303   -3.935  -0.704  1.00 35.84  ? 482  LYS A N     1 
ATOM   2641 C  CA    . LYS A 1 372 ? 6.171   -4.962  -1.280  1.00 35.65  ? 482  LYS A CA    1 
ATOM   2642 C  C     . LYS A 1 372 ? 7.301   -4.345  -2.114  1.00 38.65  ? 482  LYS A C     1 
ATOM   2643 O  O     . LYS A 1 372 ? 8.289   -5.039  -2.411  1.00 39.04  ? 482  LYS A O     1 
ATOM   2644 C  CB    . LYS A 1 372 ? 5.337   -5.925  -2.133  1.00 38.78  ? 482  LYS A CB    1 
ATOM   2645 C  CG    . LYS A 1 372 ? 4.441   -6.841  -1.309  1.00 52.94  ? 482  LYS A CG    1 
ATOM   2646 C  CD    . LYS A 1 372 ? 3.833   -7.936  -2.150  1.00 60.02  ? 482  LYS A CD    1 
ATOM   2647 C  CE    . LYS A 1 372 ? 2.808   -8.706  -1.363  1.00 72.20  ? 482  LYS A CE    1 
ATOM   2648 N  NZ    . LYS A 1 372 ? 2.034   -9.629  -2.233  1.00 82.23  ? 482  LYS A NZ    1 
ATOM   2649 N  N     . ARG A 1 373 ? 7.168   -3.034  -2.483  1.00 32.69  ? 483  ARG A N     1 
ATOM   2650 C  CA    . ARG A 1 373 ? 8.144   -2.289  -3.287  1.00 31.91  ? 483  ARG A CA    1 
ATOM   2651 C  C     . ARG A 1 373 ? 8.343   -2.958  -4.650  1.00 35.68  ? 483  ARG A C     1 
ATOM   2652 O  O     . ARG A 1 373 ? 9.468   -3.037  -5.166  1.00 35.21  ? 483  ARG A O     1 
ATOM   2653 C  CB    . ARG A 1 373 ? 9.483   -2.108  -2.549  1.00 30.58  ? 483  ARG A CB    1 
ATOM   2654 C  CG    . ARG A 1 373 ? 9.401   -1.038  -1.487  1.00 32.70  ? 483  ARG A CG    1 
ATOM   2655 C  CD    . ARG A 1 373 ? 10.632  -1.065  -0.627  1.00 32.95  ? 483  ARG A CD    1 
ATOM   2656 N  NE    . ARG A 1 373 ? 10.669  0.091   0.255   1.00 32.73  ? 483  ARG A NE    1 
ATOM   2657 C  CZ    . ARG A 1 373 ? 11.609  0.315   1.162   1.00 50.02  ? 483  ARG A CZ    1 
ATOM   2658 N  NH1   . ARG A 1 373 ? 12.611  -0.544  1.319   1.00 44.85  ? 483  ARG A NH1   1 
ATOM   2659 N  NH2   . ARG A 1 373 ? 11.559  1.401   1.920   1.00 44.37  ? 483  ARG A NH2   1 
ATOM   2660 N  N     . VAL A 1 374 ? 7.225   -3.413  -5.245  1.00 32.17  ? 484  VAL A N     1 
ATOM   2661 C  CA    . VAL A 1 374 ? 7.252   -4.087  -6.545  1.00 31.32  ? 484  VAL A CA    1 
ATOM   2662 C  C     . VAL A 1 374 ? 6.120   -3.609  -7.432  1.00 31.47  ? 484  VAL A C     1 
ATOM   2663 O  O     . VAL A 1 374 ? 5.036   -3.278  -6.944  1.00 29.93  ? 484  VAL A O     1 
ATOM   2664 C  CB    . VAL A 1 374 ? 7.243   -5.658  -6.464  1.00 35.39  ? 484  VAL A CB    1 
ATOM   2665 C  CG1   . VAL A 1 374 ? 8.491   -6.212  -5.785  1.00 36.04  ? 484  VAL A CG1   1 
ATOM   2666 C  CG2   . VAL A 1 374 ? 5.983   -6.198  -5.805  1.00 35.50  ? 484  VAL A CG2   1 
ATOM   2667 N  N     . PHE A 1 375 ? 6.364   -3.627  -8.758  1.00 28.62  ? 485  PHE A N     1 
ATOM   2668 C  CA    . PHE A 1 375 ? 5.313   -3.367  -9.740  1.00 27.44  ? 485  PHE A CA    1 
ATOM   2669 C  C     . PHE A 1 375 ? 4.576   -4.681  -9.907  1.00 29.61  ? 485  PHE A C     1 
ATOM   2670 O  O     . PHE A 1 375 ? 5.204   -5.738  -9.921  1.00 28.97  ? 485  PHE A O     1 
ATOM   2671 C  CB    . PHE A 1 375 ? 5.879   -2.857  -11.067 1.00 28.83  ? 485  PHE A CB    1 
ATOM   2672 C  CG    . PHE A 1 375 ? 6.203   -1.389  -11.078 1.00 29.32  ? 485  PHE A CG    1 
ATOM   2673 C  CD1   . PHE A 1 375 ? 5.249   -0.452  -11.470 1.00 31.76  ? 485  PHE A CD1   1 
ATOM   2674 C  CD2   . PHE A 1 375 ? 7.462   -0.934  -10.698 1.00 29.63  ? 485  PHE A CD2   1 
ATOM   2675 C  CE1   . PHE A 1 375 ? 5.558   0.916   -11.500 1.00 31.69  ? 485  PHE A CE1   1 
ATOM   2676 C  CE2   . PHE A 1 375 ? 7.770   0.430   -10.719 1.00 31.63  ? 485  PHE A CE2   1 
ATOM   2677 C  CZ    . PHE A 1 375 ? 6.818   1.344   -11.105 1.00 30.90  ? 485  PHE A CZ    1 
ATOM   2678 N  N     . LEU A 1 376 ? 3.260   -4.630  -9.965  1.00 27.30  ? 486  LEU A N     1 
ATOM   2679 C  CA    . LEU A 1 376 ? 2.459   -5.838  -10.100 1.00 26.94  ? 486  LEU A CA    1 
ATOM   2680 C  C     . LEU A 1 376 ? 2.048   -5.995  -11.552 1.00 30.79  ? 486  LEU A C     1 
ATOM   2681 O  O     . LEU A 1 376 ? 1.553   -5.046  -12.159 1.00 30.22  ? 486  LEU A O     1 
ATOM   2682 C  CB    . LEU A 1 376 ? 1.250   -5.784  -9.154  1.00 25.86  ? 486  LEU A CB    1 
ATOM   2683 C  CG    . LEU A 1 376 ? 1.582   -5.670  -7.661  1.00 29.40  ? 486  LEU A CG    1 
ATOM   2684 C  CD1   . LEU A 1 376 ? 0.330   -5.393  -6.853  1.00 28.33  ? 486  LEU A CD1   1 
ATOM   2685 C  CD2   . LEU A 1 376 ? 2.315   -6.927  -7.138  1.00 30.70  ? 486  LEU A CD2   1 
ATOM   2686 N  N     . GLU A 1 377 ? 2.288   -7.183  -12.106 1.00 25.79  ? 487  GLU A N     1 
ATOM   2687 C  CA    . GLU A 1 377 ? 1.953   -7.505  -13.491 1.00 25.65  ? 487  GLU A CA    1 
ATOM   2688 C  C     . GLU A 1 377 ? 0.517   -8.014  -13.618 1.00 30.05  ? 487  GLU A C     1 
ATOM   2689 O  O     . GLU A 1 377 ? 0.007   -8.686  -12.711 1.00 28.91  ? 487  GLU A O     1 
ATOM   2690 C  CB    . GLU A 1 377 ? 2.929   -8.585  -14.032 1.00 28.07  ? 487  GLU A CB    1 
ATOM   2691 C  CG    . GLU A 1 377 ? 4.360   -8.078  -14.193 1.00 36.89  ? 487  GLU A CG    1 
ATOM   2692 N  N     . ALA A 1 378 ? -0.111  -7.743  -14.774 1.00 25.83  ? 488  ALA A N     1 
ATOM   2693 C  CA    . ALA A 1 378 ? -1.465  -8.219  -15.071 1.00 25.62  ? 488  ALA A CA    1 
ATOM   2694 C  C     . ALA A 1 378 ? -1.627  -8.464  -16.568 1.00 31.97  ? 488  ALA A C     1 
ATOM   2695 O  O     . ALA A 1 378 ? -1.212  -7.647  -17.378 1.00 30.73  ? 488  ALA A O     1 
ATOM   2696 C  CB    . ALA A 1 378 ? -2.502  -7.200  -14.586 1.00 24.19  ? 488  ALA A CB    1 
ATOM   2697 N  N     . GLU A 1 379 ? -2.249  -9.574  -16.932 1.00 32.33  ? 489  GLU A N     1 
ATOM   2698 C  CA    . GLU A 1 379 ? -2.544  -9.899  -18.335 1.00 32.87  ? 489  GLU A CA    1 
ATOM   2699 C  C     . GLU A 1 379 ? -4.021  -9.591  -18.654 1.00 34.00  ? 489  GLU A C     1 
ATOM   2700 O  O     . GLU A 1 379 ? -4.431  -9.643  -19.818 1.00 35.32  ? 489  GLU A O     1 
ATOM   2701 C  CB    . GLU A 1 379 ? -2.224  -11.375 -18.629 1.00 36.44  ? 489  GLU A CB    1 
ATOM   2702 C  CG    . GLU A 1 379 ? -0.731  -11.683 -18.620 1.00 51.40  ? 489  GLU A CG    1 
ATOM   2703 C  CD    . GLU A 1 379 ? -0.001  -11.354 -19.909 1.00 80.36  ? 489  GLU A CD    1 
ATOM   2704 O  OE1   . GLU A 1 379 ? -0.081  -12.176 -20.851 1.00 76.92  ? 489  GLU A OE1   1 
ATOM   2705 O  OE2   . GLU A 1 379 ? 0.641   -10.279 -19.985 1.00 78.48  ? 489  GLU A OE2   1 
ATOM   2706 N  N     . SER A 1 380 ? -4.819  -9.288  -17.617 1.00 25.65  ? 490  SER A N     1 
ATOM   2707 C  CA    . SER A 1 380 ? -6.252  -8.998  -17.741 1.00 22.86  ? 490  SER A CA    1 
ATOM   2708 C  C     . SER A 1 380 ? -6.713  -8.042  -16.649 1.00 26.18  ? 490  SER A C     1 
ATOM   2709 O  O     . SER A 1 380 ? -5.994  -7.849  -15.660 1.00 24.36  ? 490  SER A O     1 
ATOM   2710 C  CB    . SER A 1 380 ? -7.059  -10.293 -17.643 1.00 26.50  ? 490  SER A CB    1 
ATOM   2711 O  OG    . SER A 1 380 ? -6.869  -10.892 -16.369 1.00 31.68  ? 490  SER A OG    1 
ATOM   2712 N  N     . GLU A 1 381 ? -7.927  -7.473  -16.797 1.00 23.09  ? 491  GLU A N     1 
ATOM   2713 C  CA    . GLU A 1 381 ? -8.524  -6.594  -15.794 1.00 22.37  ? 491  GLU A CA    1 
ATOM   2714 C  C     . GLU A 1 381 ? -8.801  -7.380  -14.519 1.00 26.54  ? 491  GLU A C     1 
ATOM   2715 O  O     . GLU A 1 381 ? -8.595  -6.855  -13.426 1.00 24.39  ? 491  GLU A O     1 
ATOM   2716 C  CB    . GLU A 1 381 ? -9.840  -5.970  -16.325 1.00 23.50  ? 491  GLU A CB    1 
ATOM   2717 C  CG    . GLU A 1 381 ? -9.634  -4.901  -17.393 1.00 25.60  ? 491  GLU A CG    1 
ATOM   2718 C  CD    . GLU A 1 381 ? -10.949 -4.343  -17.912 1.00 43.19  ? 491  GLU A CD    1 
ATOM   2719 O  OE1   . GLU A 1 381 ? -11.856 -5.141  -18.229 1.00 36.67  ? 491  GLU A OE1   1 
ATOM   2720 O  OE2   . GLU A 1 381 ? -11.067 -3.105  -18.033 1.00 36.71  ? 491  GLU A OE2   1 
ATOM   2721 N  N     . GLU A 1 382 ? -9.251  -8.647  -14.664 1.00 25.84  ? 492  GLU A N     1 
ATOM   2722 C  CA    . GLU A 1 382 ? -9.545  -9.558  -13.554 1.00 27.33  ? 492  GLU A CA    1 
ATOM   2723 C  C     . GLU A 1 382 ? -8.323  -9.674  -12.611 1.00 30.02  ? 492  GLU A C     1 
ATOM   2724 O  O     . GLU A 1 382 ? -8.487  -9.599  -11.390 1.00 30.15  ? 492  GLU A O     1 
ATOM   2725 C  CB    . GLU A 1 382 ? -9.962  -10.963 -14.076 1.00 30.03  ? 492  GLU A CB    1 
ATOM   2726 C  CG    . GLU A 1 382 ? -11.331 -10.999 -14.751 1.00 35.50  ? 492  GLU A CG    1 
ATOM   2727 C  CD    . GLU A 1 382 ? -11.409 -10.693 -16.238 1.00 47.80  ? 492  GLU A CD    1 
ATOM   2728 O  OE1   . GLU A 1 382 ? -10.459 -10.102 -16.803 1.00 40.19  ? 492  GLU A OE1   1 
ATOM   2729 O  OE2   . GLU A 1 382 ? -12.456 -11.025 -16.838 1.00 44.22  ? 492  GLU A OE2   1 
ATOM   2730 N  N     . GLU A 1 383 ? -7.102  -9.822  -13.175 1.00 24.87  ? 493  GLU A N     1 
ATOM   2731 C  CA    . GLU A 1 383 ? -5.867  -9.889  -12.390 1.00 24.18  ? 493  GLU A CA    1 
ATOM   2732 C  C     . GLU A 1 383 ? -5.603  -8.570  -11.636 1.00 28.31  ? 493  GLU A C     1 
ATOM   2733 O  O     . GLU A 1 383 ? -5.077  -8.627  -10.514 1.00 27.82  ? 493  GLU A O     1 
ATOM   2734 C  CB    . GLU A 1 383 ? -4.659  -10.259 -13.269 1.00 26.17  ? 493  GLU A CB    1 
ATOM   2735 C  CG    . GLU A 1 383 ? -4.705  -11.704 -13.750 1.00 37.61  ? 493  GLU A CG    1 
ATOM   2736 C  CD    . GLU A 1 383 ? -3.511  -12.235 -14.526 1.00 61.62  ? 493  GLU A CD    1 
ATOM   2737 O  OE1   . GLU A 1 383 ? -3.469  -13.468 -14.750 1.00 67.30  ? 493  GLU A OE1   1 
ATOM   2738 O  OE2   . GLU A 1 383 ? -2.602  -11.443 -14.870 1.00 41.39  ? 493  GLU A OE2   1 
ATOM   2739 N  N     . ILE A 1 384 ? -5.992  -7.389  -12.226 1.00 23.40  ? 494  ILE A N     1 
ATOM   2740 C  CA    . ILE A 1 384 ? -5.808  -6.090  -11.555 1.00 23.15  ? 494  ILE A CA    1 
ATOM   2741 C  C     . ILE A 1 384 ? -6.736  -6.045  -10.337 1.00 26.37  ? 494  ILE A C     1 
ATOM   2742 O  O     . ILE A 1 384 ? -6.287  -5.687  -9.246  1.00 27.39  ? 494  ILE A O     1 
ATOM   2743 C  CB    . ILE A 1 384 ? -6.014  -4.843  -12.487 1.00 25.44  ? 494  ILE A CB    1 
ATOM   2744 C  CG1   . ILE A 1 384 ? -5.038  -4.885  -13.695 1.00 27.02  ? 494  ILE A CG1   1 
ATOM   2745 C  CG2   . ILE A 1 384 ? -5.855  -3.517  -11.688 1.00 24.27  ? 494  ILE A CG2   1 
ATOM   2746 C  CD1   . ILE A 1 384 ? -5.353  -3.875  -14.827 1.00 32.97  ? 494  ILE A CD1   1 
ATOM   2747 N  N     . PHE A 1 385 ? -8.021  -6.396  -10.528 1.00 21.60  ? 495  PHE A N     1 
ATOM   2748 C  CA    . PHE A 1 385 ? -9.000  -6.425  -9.446  1.00 22.36  ? 495  PHE A CA    1 
ATOM   2749 C  C     . PHE A 1 385 ? -8.520  -7.379  -8.346  1.00 28.32  ? 495  PHE A C     1 
ATOM   2750 O  O     . PHE A 1 385 ? -8.559  -6.992  -7.175  1.00 27.63  ? 495  PHE A O     1 
ATOM   2751 C  CB    . PHE A 1 385 ? -10.396 -6.833  -9.971  1.00 23.91  ? 495  PHE A CB    1 
ATOM   2752 C  CG    . PHE A 1 385 ? -11.186 -5.701  -10.598 1.00 24.53  ? 495  PHE A CG    1 
ATOM   2753 C  CD1   . PHE A 1 385 ? -10.996 -5.350  -11.928 1.00 28.10  ? 495  PHE A CD1   1 
ATOM   2754 C  CD2   . PHE A 1 385 ? -12.150 -5.016  -9.871  1.00 26.77  ? 495  PHE A CD2   1 
ATOM   2755 C  CE1   . PHE A 1 385 ? -11.745 -4.316  -12.516 1.00 28.53  ? 495  PHE A CE1   1 
ATOM   2756 C  CE2   . PHE A 1 385 ? -12.908 -3.988  -10.462 1.00 28.29  ? 495  PHE A CE2   1 
ATOM   2757 C  CZ    . PHE A 1 385 ? -12.701 -3.646  -11.779 1.00 26.07  ? 495  PHE A CZ    1 
ATOM   2758 N  N     . ALA A 1 386 ? -8.021  -8.594  -8.717  1.00 25.73  ? 496  ALA A N     1 
ATOM   2759 C  CA    . ALA A 1 386 ? -7.507  -9.563  -7.734  1.00 27.54  ? 496  ALA A CA    1 
ATOM   2760 C  C     . ALA A 1 386 ? -6.291  -8.986  -6.948  1.00 31.57  ? 496  ALA A C     1 
ATOM   2761 O  O     . ALA A 1 386 ? -6.254  -9.165  -5.725  1.00 31.39  ? 496  ALA A O     1 
ATOM   2762 C  CB    . ALA A 1 386 ? -7.135  -10.882 -8.400  1.00 29.14  ? 496  ALA A CB    1 
ATOM   2763 N  N     . HIS A 1 387 ? -5.348  -8.254  -7.621  1.00 27.36  ? 497  HIS A N     1 
ATOM   2764 C  CA    . HIS A 1 387 ? -4.207  -7.621  -6.928  1.00 28.29  ? 497  HIS A CA    1 
ATOM   2765 C  C     . HIS A 1 387 ? -4.674  -6.593  -5.878  1.00 32.00  ? 497  HIS A C     1 
ATOM   2766 O  O     . HIS A 1 387 ? -4.016  -6.415  -4.852  1.00 30.78  ? 497  HIS A O     1 
ATOM   2767 C  CB    . HIS A 1 387 ? -3.245  -6.883  -7.901  1.00 28.37  ? 497  HIS A CB    1 
ATOM   2768 C  CG    . HIS A 1 387 ? -2.299  -7.746  -8.680  1.00 32.47  ? 497  HIS A CG    1 
ATOM   2769 N  ND1   . HIS A 1 387 ? -1.441  -8.636  -8.054  1.00 36.15  ? 497  HIS A ND1   1 
ATOM   2770 C  CD2   . HIS A 1 387 ? -2.049  -7.759  -10.010 1.00 33.81  ? 497  HIS A CD2   1 
ATOM   2771 C  CE1   . HIS A 1 387 ? -0.733  -9.184  -9.024  1.00 35.94  ? 497  HIS A CE1   1 
ATOM   2772 N  NE2   . HIS A 1 387 ? -1.079  -8.689  -10.222 1.00 35.19  ? 497  HIS A NE2   1 
ATOM   2773 N  N     . LEU A 1 388 ? -5.803  -5.917  -6.157  1.00 28.42  ? 498  LEU A N     1 
ATOM   2774 C  CA    . LEU A 1 388 ? -6.380  -4.879  -5.307  1.00 29.03  ? 498  LEU A CA    1 
ATOM   2775 C  C     . LEU A 1 388 ? -7.283  -5.430  -4.191  1.00 33.08  ? 498  LEU A C     1 
ATOM   2776 O  O     . LEU A 1 388 ? -7.705  -4.681  -3.312  1.00 32.18  ? 498  LEU A O     1 
ATOM   2777 C  CB    . LEU A 1 388 ? -7.187  -3.887  -6.171  1.00 28.40  ? 498  LEU A CB    1 
ATOM   2778 C  CG    . LEU A 1 388 ? -6.406  -2.986  -7.139  1.00 32.11  ? 498  LEU A CG    1 
ATOM   2779 C  CD1   . LEU A 1 388 ? -7.348  -2.241  -8.062  1.00 30.84  ? 498  LEU A CD1   1 
ATOM   2780 C  CD2   . LEU A 1 388 ? -5.542  -2.004  -6.407  1.00 35.02  ? 498  LEU A CD2   1 
ATOM   2781 N  N     . GLY A 1 389 ? -7.572  -6.720  -4.234  1.00 31.37  ? 499  GLY A N     1 
ATOM   2782 C  CA    . GLY A 1 389 ? -8.439  -7.357  -3.253  1.00 32.77  ? 499  GLY A CA    1 
ATOM   2783 C  C     . GLY A 1 389 ? -9.902  -6.998  -3.485  1.00 35.18  ? 499  GLY A C     1 
ATOM   2784 O  O     . GLY A 1 389 ? -10.688 -6.966  -2.539  1.00 36.87  ? 499  GLY A O     1 
ATOM   2785 N  N     . LEU A 1 390 ? -10.267 -6.698  -4.744  1.00 26.92  ? 500  LEU A N     1 
ATOM   2786 C  CA    . LEU A 1 390 ? -11.627 -6.349  -5.134  1.00 24.85  ? 500  LEU A CA    1 
ATOM   2787 C  C     . LEU A 1 390 ? -12.296 -7.456  -5.902  1.00 29.84  ? 500  LEU A C     1 
ATOM   2788 O  O     . LEU A 1 390 ? -11.654 -8.092  -6.746  1.00 29.64  ? 500  LEU A O     1 
ATOM   2789 C  CB    . LEU A 1 390 ? -11.639 -5.088  -6.039  1.00 22.81  ? 500  LEU A CB    1 
ATOM   2790 C  CG    . LEU A 1 390 ? -11.189 -3.751  -5.454  1.00 27.02  ? 500  LEU A CG    1 
ATOM   2791 C  CD1   . LEU A 1 390 ? -10.979 -2.708  -6.561  1.00 23.90  ? 500  LEU A CD1   1 
ATOM   2792 C  CD2   . LEU A 1 390 ? -12.237 -3.204  -4.519  1.00 28.54  ? 500  LEU A CD2   1 
ATOM   2793 N  N     . ASP A 1 391 ? -13.619 -7.641  -5.674  1.00 27.60  ? 501  ASP A N     1 
ATOM   2794 C  CA    . ASP A 1 391 ? -14.446 -8.532  -6.474  1.00 27.75  ? 501  ASP A CA    1 
ATOM   2795 C  C     . ASP A 1 391 ? -14.476 -7.924  -7.871  1.00 28.95  ? 501  ASP A C     1 
ATOM   2796 O  O     . ASP A 1 391 ? -14.529 -6.679  -8.001  1.00 26.08  ? 501  ASP A O     1 
ATOM   2797 C  CB    . ASP A 1 391 ? -15.873 -8.629  -5.889  1.00 30.68  ? 501  ASP A CB    1 
ATOM   2798 C  CG    . ASP A 1 391 ? -15.973 -9.363  -4.569  1.00 42.55  ? 501  ASP A CG    1 
ATOM   2799 O  OD1   . ASP A 1 391 ? -15.146 -10.259 -4.325  1.00 43.63  ? 501  ASP A OD1   1 
ATOM   2800 O  OD2   . ASP A 1 391 ? -16.885 -9.042  -3.781  1.00 50.47  ? 501  ASP A OD2   1 
ATOM   2801 N  N     . TYR A 1 392 ? -14.404 -8.764  -8.902  1.00 24.43  ? 502  TYR A N     1 
ATOM   2802 C  CA    . TYR A 1 392 ? -14.400 -8.275  -10.269 1.00 23.52  ? 502  TYR A CA    1 
ATOM   2803 C  C     . TYR A 1 392 ? -15.726 -7.574  -10.630 1.00 25.45  ? 502  TYR A C     1 
ATOM   2804 O  O     . TYR A 1 392 ? -16.780 -8.101  -10.364 1.00 25.52  ? 502  TYR A O     1 
ATOM   2805 C  CB    . TYR A 1 392 ? -14.120 -9.400  -11.269 1.00 24.94  ? 502  TYR A CB    1 
ATOM   2806 C  CG    . TYR A 1 392 ? -13.983 -8.887  -12.687 1.00 25.51  ? 502  TYR A CG    1 
ATOM   2807 C  CD1   . TYR A 1 392 ? -12.964 -8.007  -13.033 1.00 24.64  ? 502  TYR A CD1   1 
ATOM   2808 C  CD2   . TYR A 1 392 ? -14.889 -9.268  -13.682 1.00 26.27  ? 502  TYR A CD2   1 
ATOM   2809 C  CE1   . TYR A 1 392 ? -12.830 -7.528  -14.333 1.00 24.34  ? 502  TYR A CE1   1 
ATOM   2810 C  CE2   . TYR A 1 392 ? -14.764 -8.791  -14.991 1.00 26.23  ? 502  TYR A CE2   1 
ATOM   2811 C  CZ    . TYR A 1 392 ? -13.713 -7.941  -15.313 1.00 31.62  ? 502  TYR A CZ    1 
ATOM   2812 O  OH    . TYR A 1 392 ? -13.547 -7.458  -16.586 1.00 30.39  ? 502  TYR A OH    1 
ATOM   2813 N  N     . ILE A 1 393 ? -15.629 -6.373  -11.179 1.00 21.43  ? 503  ILE A N     1 
ATOM   2814 C  CA    . ILE A 1 393 ? -16.767 -5.577  -11.631 1.00 20.32  ? 503  ILE A CA    1 
ATOM   2815 C  C     . ILE A 1 393 ? -16.733 -5.630  -13.158 1.00 23.97  ? 503  ILE A C     1 
ATOM   2816 O  O     . ILE A 1 393 ? -15.750 -5.197  -13.761 1.00 22.55  ? 503  ILE A O     1 
ATOM   2817 C  CB    . ILE A 1 393 ? -16.742 -4.119  -11.077 1.00 21.91  ? 503  ILE A CB    1 
ATOM   2818 C  CG1   . ILE A 1 393 ? -16.592 -4.031  -9.514  1.00 22.38  ? 503  ILE A CG1   1 
ATOM   2819 C  CG2   . ILE A 1 393 ? -17.942 -3.293  -11.584 1.00 21.32  ? 503  ILE A CG2   1 
ATOM   2820 C  CD1   . ILE A 1 393 ? -17.694 -4.750  -8.644  1.00 22.23  ? 503  ILE A CD1   1 
ATOM   2821 N  N     . GLU A 1 394 ? -17.777 -6.184  -13.774 1.00 21.60  ? 504  GLU A N     1 
ATOM   2822 C  CA    . GLU A 1 394 ? -17.895 -6.272  -15.237 1.00 22.78  ? 504  GLU A CA    1 
ATOM   2823 C  C     . GLU A 1 394 ? -17.931 -4.881  -15.880 1.00 25.53  ? 504  GLU A C     1 
ATOM   2824 O  O     . GLU A 1 394 ? -18.368 -3.936  -15.216 1.00 25.30  ? 504  GLU A O     1 
ATOM   2825 C  CB    . GLU A 1 394 ? -19.173 -7.039  -15.627 1.00 25.01  ? 504  GLU A CB    1 
ATOM   2826 C  CG    . GLU A 1 394 ? -19.229 -8.465  -15.085 1.00 34.39  ? 504  GLU A CG    1 
ATOM   2827 C  CD    . GLU A 1 394 ? -18.301 -9.476  -15.737 1.00 46.55  ? 504  GLU A CD    1 
ATOM   2828 O  OE1   . GLU A 1 394 ? -17.653 -9.143  -16.759 1.00 33.89  ? 504  GLU A OE1   1 
ATOM   2829 O  OE2   . GLU A 1 394 ? -18.223 -10.611 -15.215 1.00 47.17  ? 504  GLU A OE2   1 
ATOM   2830 N  N     . PRO A 1 395 ? -17.476 -4.702  -17.146 1.00 22.62  ? 505  PRO A N     1 
ATOM   2831 C  CA    . PRO A 1 395 ? -17.493 -3.354  -17.748 1.00 22.06  ? 505  PRO A CA    1 
ATOM   2832 C  C     . PRO A 1 395 ? -18.872 -2.684  -17.717 1.00 27.28  ? 505  PRO A C     1 
ATOM   2833 O  O     . PRO A 1 395 ? -18.945 -1.492  -17.396 1.00 26.49  ? 505  PRO A O     1 
ATOM   2834 C  CB    . PRO A 1 395 ? -17.019 -3.620  -19.179 1.00 23.69  ? 505  PRO A CB    1 
ATOM   2835 C  CG    . PRO A 1 395 ? -16.131 -4.811  -19.039 1.00 28.57  ? 505  PRO A CG    1 
ATOM   2836 C  CD    . PRO A 1 395 ? -16.875 -5.682  -18.077 1.00 24.54  ? 505  PRO A CD    1 
ATOM   2837 N  N     . TRP A 1 396 ? -19.975 -3.454  -17.952 1.00 24.17  ? 506  TRP A N     1 
ATOM   2838 C  CA    . TRP A 1 396 ? -21.337 -2.901  -17.930 1.00 23.36  ? 506  TRP A CA    1 
ATOM   2839 C  C     . TRP A 1 396 ? -21.804 -2.553  -16.508 1.00 23.17  ? 506  TRP A C     1 
ATOM   2840 O  O     . TRP A 1 396 ? -22.890 -1.987  -16.342 1.00 21.00  ? 506  TRP A O     1 
ATOM   2841 C  CB    . TRP A 1 396 ? -22.352 -3.851  -18.597 1.00 23.79  ? 506  TRP A CB    1 
ATOM   2842 C  CG    . TRP A 1 396 ? -22.413 -5.225  -17.999 1.00 26.34  ? 506  TRP A CG    1 
ATOM   2843 C  CD1   . TRP A 1 396 ? -23.258 -5.661  -17.021 1.00 29.33  ? 506  TRP A CD1   1 
ATOM   2844 C  CD2   . TRP A 1 396 ? -21.628 -6.362  -18.392 1.00 27.74  ? 506  TRP A CD2   1 
ATOM   2845 N  NE1   . TRP A 1 396 ? -23.043 -6.999  -16.773 1.00 30.62  ? 506  TRP A NE1   1 
ATOM   2846 C  CE2   . TRP A 1 396 ? -22.060 -7.459  -17.613 1.00 32.58  ? 506  TRP A CE2   1 
ATOM   2847 C  CE3   . TRP A 1 396 ? -20.646 -6.572  -19.369 1.00 29.98  ? 506  TRP A CE3   1 
ATOM   2848 C  CZ2   . TRP A 1 396 ? -21.520 -8.741  -17.759 1.00 33.57  ? 506  TRP A CZ2   1 
ATOM   2849 C  CZ3   . TRP A 1 396 ? -20.078 -7.834  -19.484 1.00 33.61  ? 506  TRP A CZ3   1 
ATOM   2850 C  CH2   . TRP A 1 396 ? -20.518 -8.903  -18.689 1.00 34.94  ? 506  TRP A CH2   1 
ATOM   2851 N  N     . GLU A 1 397 ? -20.989 -2.894  -15.492 1.00 17.97  ? 507  GLU A N     1 
ATOM   2852 C  CA    . GLU A 1 397 ? -21.290 -2.594  -14.096 1.00 17.19  ? 507  GLU A CA    1 
ATOM   2853 C  C     . GLU A 1 397 ? -20.424 -1.414  -13.612 1.00 20.99  ? 507  GLU A C     1 
ATOM   2854 O  O     . GLU A 1 397 ? -20.387 -1.131  -12.416 1.00 19.70  ? 507  GLU A O     1 
ATOM   2855 C  CB    . GLU A 1 397 ? -21.052 -3.825  -13.231 1.00 18.85  ? 507  GLU A CB    1 
ATOM   2856 C  CG    . GLU A 1 397 ? -21.990 -5.003  -13.460 1.00 26.97  ? 507  GLU A CG    1 
ATOM   2857 C  CD    . GLU A 1 397 ? -21.548 -6.259  -12.735 1.00 26.61  ? 507  GLU A CD    1 
ATOM   2858 O  OE1   . GLU A 1 397 ? -20.329 -6.424  -12.502 1.00 27.38  ? 507  GLU A OE1   1 
ATOM   2859 O  OE2   . GLU A 1 397 ? -22.425 -7.078  -12.391 1.00 29.10  ? 507  GLU A OE2   1 
ATOM   2860 N  N     . ARG A 1 398 ? -19.711 -0.735  -14.545 1.00 19.10  ? 508  ARG A N     1 
ATOM   2861 C  CA    . ARG A 1 398 ? -18.834 0.378   -14.176 1.00 19.76  ? 508  ARG A CA    1 
ATOM   2862 C  C     . ARG A 1 398 ? -19.439 1.728   -14.586 1.00 21.75  ? 508  ARG A C     1 
ATOM   2863 O  O     . ARG A 1 398 ? -18.719 2.702   -14.740 1.00 19.44  ? 508  ARG A O     1 
ATOM   2864 C  CB    . ARG A 1 398 ? -17.427 0.191   -14.806 1.00 20.25  ? 508  ARG A CB    1 
ATOM   2865 C  CG    . ARG A 1 398 ? -16.763 -1.111  -14.406 1.00 25.97  ? 508  ARG A CG    1 
ATOM   2866 C  CD    . ARG A 1 398 ? -15.415 -1.274  -15.096 1.00 22.04  ? 508  ARG A CD    1 
ATOM   2867 N  NE    . ARG A 1 398 ? -14.978 -2.670  -15.093 1.00 24.74  ? 508  ARG A NE    1 
ATOM   2868 C  CZ    . ARG A 1 398 ? -14.005 -3.142  -15.860 1.00 27.70  ? 508  ARG A CZ    1 
ATOM   2869 N  NH1   . ARG A 1 398 ? -13.356 -2.337  -16.683 1.00 19.99  ? 508  ARG A NH1   1 
ATOM   2870 N  NH2   . ARG A 1 398 ? -13.699 -4.432  -15.837 1.00 20.37  ? 508  ARG A NH2   1 
ATOM   2871 N  N     . ASN A 1 399 ? -20.758 1.798   -14.721 1.00 20.39  ? 509  ASN A N     1 
ATOM   2872 C  CA    . ASN A 1 399 ? -21.433 3.041   -15.104 1.00 20.14  ? 509  ASN A CA    1 
ATOM   2873 C  C     . ASN A 1 399 ? -21.682 3.979   -13.883 1.00 22.62  ? 509  ASN A C     1 
ATOM   2874 O  O     . ASN A 1 399 ? -22.753 4.553   -13.738 1.00 22.92  ? 509  ASN A O     1 
ATOM   2875 C  CB    . ASN A 1 399 ? -22.722 2.701   -15.847 1.00 18.85  ? 509  ASN A CB    1 
ATOM   2876 C  CG    . ASN A 1 399 ? -22.426 2.094   -17.191 1.00 23.72  ? 509  ASN A CG    1 
ATOM   2877 O  OD1   . ASN A 1 399 ? -21.928 2.780   -18.087 1.00 16.87  ? 509  ASN A OD1   1 
ATOM   2878 N  ND2   . ASN A 1 399 ? -22.685 0.790   -17.367 1.00 17.59  ? 509  ASN A ND2   1 
ATOM   2879 N  N     . ALA A 1 400 ? -20.651 4.165   -13.047 1.00 18.80  ? 510  ALA A N     1 
ATOM   2880 C  CA    . ALA A 1 400 ? -20.695 4.972   -11.826 1.00 20.20  ? 510  ALA A CA    1 
ATOM   2881 C  C     . ALA A 1 400 ? -20.832 6.480   -12.113 1.00 29.15  ? 510  ALA A C     1 
ATOM   2882 O  O     . ALA A 1 400 ? -20.242 6.937   -13.089 1.00 25.89  ? 510  ALA A O     1 
ATOM   2883 C  CB    . ALA A 1 400 ? -19.450 4.705   -10.996 1.00 20.05  ? 510  ALA A CB    1 
ATOM   2884 O  "O5'" . DA  B 2 1   ? -5.102  29.154  -21.790 1.00 115.53 ? 2    DA  C "O5'" 1 
ATOM   2885 C  "C5'" . DA  B 2 1   ? -5.688  27.841  -21.858 1.00 68.40  ? 2    DA  C "C5'" 1 
ATOM   2886 C  "C4'" . DA  B 2 1   ? -6.594  27.737  -23.065 1.00 133.47 ? 2    DA  C "C4'" 1 
ATOM   2887 O  "O4'" . DA  B 2 1   ? -5.784  27.771  -24.271 1.00 103.85 ? 2    DA  C "O4'" 1 
ATOM   2888 C  "C3'" . DA  B 2 1   ? -7.407  26.452  -23.172 1.00 84.30  ? 2    DA  C "C3'" 1 
ATOM   2889 O  "O3'" . DA  B 2 1   ? -8.581  26.779  -23.920 1.00 196.88 ? 2    DA  C "O3'" 1 
ATOM   2890 C  "C2'" . DA  B 2 1   ? -6.422  25.528  -23.891 1.00 55.66  ? 2    DA  C "C2'" 1 
ATOM   2891 C  "C1'" . DA  B 2 1   ? -5.779  26.497  -24.882 1.00 83.52  ? 2    DA  C "C1'" 1 
ATOM   2892 N  N9    . DA  B 2 1   ? -4.404  26.166  -25.260 1.00 52.04  ? 2    DA  C N9    1 
ATOM   2893 P  P     . DA  B 2 2   ? -9.942  25.992  -23.702 1.00 62.89  ? 3    DA  C P     1 
ATOM   2894 O  OP1   . DA  B 2 2   ? -11.032 26.839  -24.124 1.00 123.58 ? 3    DA  C OP1   1 
ATOM   2895 O  OP2   . DA  B 2 2   ? -9.946  25.446  -22.336 1.00 133.52 ? 3    DA  C OP2   1 
ATOM   2896 O  "O5'" . DA  B 2 2   ? -9.815  24.802  -24.746 1.00 222.42 ? 3    DA  C "O5'" 1 
ATOM   2897 C  "C5'" . DA  B 2 2   ? -9.666  23.442  -24.320 1.00 88.39  ? 3    DA  C "C5'" 1 
ATOM   2898 C  "C4'" . DA  B 2 2   ? -10.513 22.537  -25.176 1.00 46.47  ? 3    DA  C "C4'" 1 
ATOM   2899 O  "O4'" . DA  B 2 2   ? -9.684  22.054  -26.237 1.00 246.27 ? 3    DA  C "O4'" 1 
ATOM   2900 C  "C3'" . DA  B 2 2   ? -10.978 21.249  -24.493 1.00 103.50 ? 3    DA  C "C3'" 1 
ATOM   2901 O  "O3'" . DA  B 2 2   ? -12.276 20.795  -24.894 1.00 91.11  ? 3    DA  C "O3'" 1 
ATOM   2902 C  "C2'" . DA  B 2 2   ? -9.870  20.235  -24.817 1.00 160.07 ? 3    DA  C "C2'" 1 
ATOM   2903 C  "C1'" . DA  B 2 2   ? -8.912  21.025  -25.712 1.00 108.47 ? 3    DA  C "C1'" 1 
ATOM   2904 N  N9    . DA  B 2 2   ? -7.818  21.639  -24.967 1.00 83.91  ? 3    DA  C N9    1 
ATOM   2905 P  P     . DA  B 2 3   ? -12.557 20.506  -26.412 1.00 58.79  ? 4    DA  C P     1 
ATOM   2906 O  OP1   . DA  B 2 3   ? -11.663 21.364  -27.175 1.00 85.48  ? 4    DA  C OP1   1 
ATOM   2907 O  OP2   . DA  B 2 3   ? -13.984 20.512  -26.651 1.00 166.71 ? 4    DA  C OP2   1 
ATOM   2908 O  "O5'" . DA  B 2 3   ? -12.038 19.013  -26.620 1.00 245.55 ? 4    DA  C "O5'" 1 
ATOM   2909 C  "C5'" . DA  B 2 3   ? -10.772 18.551  -26.085 1.00 121.12 ? 4    DA  C "C5'" 1 
ATOM   2910 C  "C4'" . DA  B 2 3   ? -10.124 17.512  -26.972 1.00 44.35  ? 4    DA  C "C4'" 1 
ATOM   2911 O  "O4'" . DA  B 2 3   ? -8.681  17.583  -26.823 1.00 77.74  ? 4    DA  C "O4'" 1 
ATOM   2912 C  "C3'" . DA  B 2 3   ? -10.475 16.051  -26.695 1.00 58.75  ? 4    DA  C "C3'" 1 
ATOM   2913 O  "O3'" . DA  B 2 3   ? -10.138 15.287  -27.831 1.00 69.66  ? 4    DA  C "O3'" 1 
ATOM   2914 C  "C2'" . DA  B 2 3   ? -9.421  15.643  -25.686 1.00 51.06  ? 4    DA  C "C2'" 1 
ATOM   2915 C  "C1'" . DA  B 2 3   ? -8.203  16.402  -26.208 1.00 46.26  ? 4    DA  C "C1'" 1 
ATOM   2916 N  N9    . DA  B 2 3   ? -7.256  16.777  -25.159 1.00 81.54  ? 4    DA  C N9    1 
HETATM 2917 NA NA    . NA  C 3 .   ? -15.991 21.206  -26.177 1.00 39.73  1 601  NA  A NA    1 
HETATM 2918 P  PG    . APC D 4 .   ? -19.167 8.695   -24.224 1.00 35.65  ? 602  APC A PG    1 
HETATM 2919 O  O1G   . APC D 4 .   ? -19.702 7.598   -25.074 1.00 41.97  ? 602  APC A O1G   1 
HETATM 2920 O  O2G   . APC D 4 .   ? -17.893 9.283   -24.994 1.00 17.99  ? 602  APC A O2G   1 
HETATM 2921 O  O3G   . APC D 4 .   ? -20.293 9.805   -24.067 1.00 42.41  ? 602  APC A O3G   1 
HETATM 2922 P  PB    . APC D 4 .   ? -17.240 7.919   -22.402 1.00 29.58  ? 602  APC A PB    1 
HETATM 2923 O  O1B   . APC D 4 .   ? -16.579 6.891   -23.171 1.00 17.88  ? 602  APC A O1B   1 
HETATM 2924 O  O2B   . APC D 4 .   ? -17.077 7.550   -20.835 1.00 29.17  ? 602  APC A O2B   1 
HETATM 2925 O  O3B   . APC D 4 .   ? -18.792 7.918   -22.827 1.00 35.69  ? 602  APC A O3B   1 
HETATM 2926 P  PA    . APC D 4 .   ? -14.675 9.580   -22.792 1.00 29.77  ? 602  APC A PA    1 
HETATM 2927 O  O1A   . APC D 4 .   ? -14.273 9.293   -24.197 1.00 21.84  ? 602  APC A O1A   1 
HETATM 2928 O  O2A   . APC D 4 .   ? -14.204 11.090  -22.491 1.00 31.46  ? 602  APC A O2A   1 
HETATM 2929 C  C3A   . APC D 4 .   ? -16.429 9.404   -23.023 1.00 32.85  ? 602  APC A C3A   1 
HETATM 2930 O  "O5'" . APC D 4 .   ? -13.748 8.588   -21.942 1.00 31.52  ? 602  APC A "O5'" 1 
HETATM 2931 C  "C5'" . APC D 4 .   ? -13.888 7.196   -22.005 1.00 31.43  ? 602  APC A "C5'" 1 
HETATM 2932 C  "C4'" . APC D 4 .   ? -12.899 6.573   -21.016 1.00 36.23  ? 602  APC A "C4'" 1 
HETATM 2933 O  "O4'" . APC D 4 .   ? -11.658 6.359   -21.757 1.00 39.33  ? 602  APC A "O4'" 1 
HETATM 2934 C  "C3'" . APC D 4 .   ? -12.471 7.535   -19.886 1.00 37.82  ? 602  APC A "C3'" 1 
HETATM 2935 O  "O3'" . APC D 4 .   ? -12.324 6.796   -18.672 1.00 40.22  ? 602  APC A "O3'" 1 
HETATM 2936 C  "C2'" . APC D 4 .   ? -11.142 8.207   -20.280 1.00 37.48  ? 602  APC A "C2'" 1 
HETATM 2937 O  "O2'" . APC D 4 .   ? -10.123 8.026   -19.300 1.00 37.87  ? 602  APC A "O2'" 1 
HETATM 2938 C  "C1'" . APC D 4 .   ? -10.769 7.516   -21.597 1.00 37.97  ? 602  APC A "C1'" 1 
HETATM 2939 N  N9    . APC D 4 .   ? -10.813 8.483   -22.697 1.00 39.95  ? 602  APC A N9    1 
HETATM 2940 C  C8    . APC D 4 .   ? -11.660 8.487   -23.765 1.00 41.60  ? 602  APC A C8    1 
HETATM 2941 N  N7    . APC D 4 .   ? -11.422 9.505   -24.533 1.00 42.73  ? 602  APC A N7    1 
HETATM 2942 C  C5    . APC D 4 .   ? -10.385 10.216  -24.023 1.00 43.55  ? 602  APC A C5    1 
HETATM 2943 C  C6    . APC D 4 .   ? -9.689  11.377  -24.417 1.00 41.43  ? 602  APC A C6    1 
HETATM 2944 N  N6    . APC D 4 .   ? -10.064 12.061  -25.557 1.00 38.30  ? 602  APC A N6    1 
HETATM 2945 N  N1    . APC D 4 .   ? -8.661  11.792  -23.667 1.00 44.45  ? 602  APC A N1    1 
HETATM 2946 C  C2    . APC D 4 .   ? -8.311  11.147  -22.558 1.00 45.11  ? 602  APC A C2    1 
HETATM 2947 N  N3    . APC D 4 .   ? -8.950  10.066  -22.136 1.00 45.20  ? 602  APC A N3    1 
HETATM 2948 C  C4    . APC D 4 .   ? -9.979  9.566   -22.838 1.00 43.59  ? 602  APC A C4    1 
HETATM 2949 MN MN    . MN  E 5 .   ? -13.023 9.568   -26.164 1.00 23.47  ? 603  MN  A MN    1 
HETATM 2950 MN MN    . MN  F 5 .   ? -16.123 7.794   -25.243 1.00 21.90  ? 604  MN  A MN    1 
HETATM 2951 O  O     . HOH G 6 .   ? -30.674 3.461   -9.471  1.00 14.94  ? 701  HOH A O     1 
HETATM 2952 O  O     . HOH G 6 .   ? -23.011 -1.328  -38.642 1.00 18.01  ? 702  HOH A O     1 
HETATM 2953 O  O     . HOH G 6 .   ? -12.972 0.548   -16.251 1.00 17.79  ? 703  HOH A O     1 
HETATM 2954 O  O     . HOH G 6 .   ? 2.622   -2.814  -13.443 1.00 22.79  ? 704  HOH A O     1 
HETATM 2955 O  O     . HOH G 6 .   ? -19.826 0.771   -10.159 1.00 14.16  ? 705  HOH A O     1 
HETATM 2956 O  O     . HOH G 6 .   ? -19.059 11.787  -32.792 1.00 14.61  ? 706  HOH A O     1 
HETATM 2957 O  O     . HOH G 6 .   ? -21.817 3.716   -8.150  1.00 19.01  ? 707  HOH A O     1 
HETATM 2958 O  O     . HOH G 6 .   ? -25.478 -1.997  -17.507 1.00 18.89  ? 708  HOH A O     1 
HETATM 2959 O  O     . HOH G 6 .   ? -1.283  -5.622  -19.044 1.00 24.37  ? 709  HOH A O     1 
HETATM 2960 O  O     . HOH G 6 .   ? -29.715 -0.257  -10.977 1.00 15.18  ? 710  HOH A O     1 
HETATM 2961 O  O     . HOH G 6 .   ? -22.674 -0.852  -26.026 1.00 21.18  ? 711  HOH A O     1 
HETATM 2962 O  O     . HOH G 6 .   ? -6.557  -3.903  -27.476 1.00 20.17  ? 712  HOH A O     1 
HETATM 2963 O  O     . HOH G 6 .   ? -16.374 3.904   -27.288 1.00 14.08  ? 713  HOH A O     1 
HETATM 2964 O  O     . HOH G 6 .   ? -27.046 0.194   -10.851 1.00 21.52  ? 714  HOH A O     1 
HETATM 2965 O  O     . HOH G 6 .   ? -13.987 -4.538  -29.291 1.00 19.24  ? 715  HOH A O     1 
HETATM 2966 O  O     . HOH G 6 .   ? -26.500 31.059  -24.191 1.00 28.71  ? 716  HOH A O     1 
HETATM 2967 O  O     . HOH G 6 .   ? -38.696 2.867   -2.776  1.00 18.41  ? 717  HOH A O     1 
HETATM 2968 O  O     . HOH G 6 .   ? -27.521 2.049   -30.580 1.00 25.76  ? 718  HOH A O     1 
HETATM 2969 O  O     . HOH G 6 .   ? -9.240  24.467  -29.649 1.00 25.47  ? 719  HOH A O     1 
HETATM 2970 O  O     . HOH G 6 .   ? -27.016 28.760  -30.414 1.00 20.23  ? 720  HOH A O     1 
HETATM 2971 O  O     . HOH G 6 .   ? -15.266 -4.819  -6.223  1.00 22.40  ? 721  HOH A O     1 
HETATM 2972 O  O     . HOH G 6 .   ? -21.146 -1.532  -2.107  1.00 22.22  ? 722  HOH A O     1 
HETATM 2973 O  O     . HOH G 6 .   ? -21.053 11.855  -34.670 1.00 27.96  ? 723  HOH A O     1 
HETATM 2974 O  O     . HOH G 6 .   ? -21.594 7.035   -15.700 1.00 30.95  ? 724  HOH A O     1 
HETATM 2975 O  O     . HOH G 6 .   ? -10.973 -10.525 -7.976  1.00 22.98  ? 725  HOH A O     1 
HETATM 2976 O  O     . HOH G 6 .   ? -8.975  -8.000  -19.829 1.00 29.26  ? 726  HOH A O     1 
HETATM 2977 O  O     . HOH G 6 .   ? -5.556  1.085   -14.880 1.00 21.99  ? 727  HOH A O     1 
HETATM 2978 O  O     . HOH G 6 .   ? 2.196   4.618   -26.803 1.00 33.85  ? 728  HOH A O     1 
HETATM 2979 O  O     . HOH G 6 .   ? 6.373   4.627   0.664   1.00 35.27  ? 729  HOH A O     1 
HETATM 2980 O  O     . HOH G 6 .   ? -35.071 6.448   -13.283 1.00 23.88  ? 730  HOH A O     1 
HETATM 2981 O  O     . HOH G 6 .   ? -22.056 9.681   -11.813 1.00 35.96  ? 731  HOH A O     1 
HETATM 2982 O  O     . HOH G 6 .   ? 5.857   -2.943  -14.476 1.00 49.76  ? 732  HOH A O     1 
HETATM 2983 O  O     . HOH G 6 .   ? -34.645 19.617  -4.830  1.00 35.19  ? 733  HOH A O     1 
HETATM 2984 O  O     . HOH G 6 .   ? -10.003 1.475   -42.771 1.00 28.83  ? 734  HOH A O     1 
HETATM 2985 O  O     . HOH G 6 .   ? -24.983 -2.921  -36.914 1.00 25.14  ? 735  HOH A O     1 
HETATM 2986 O  O     . HOH G 6 .   ? 12.115  -4.389  -4.323  1.00 43.66  ? 736  HOH A O     1 
HETATM 2987 O  O     . HOH G 6 .   ? -27.245 25.573  -22.929 1.00 21.03  ? 737  HOH A O     1 
HETATM 2988 O  O     . HOH G 6 .   ? -29.146 -0.159  -30.724 1.00 33.02  ? 738  HOH A O     1 
HETATM 2989 O  O     . HOH G 6 .   ? -20.686 -2.643  -39.409 1.00 26.00  ? 739  HOH A O     1 
HETATM 2990 O  O     . HOH G 6 .   ? 1.910   -6.401  -16.838 1.00 26.43  ? 740  HOH A O     1 
HETATM 2991 O  O     . HOH G 6 .   ? -17.565 -10.514 -9.185  1.00 37.01  ? 741  HOH A O     1 
HETATM 2992 O  O     . HOH G 6 .   ? -21.444 38.104  -34.312 1.00 21.83  ? 742  HOH A O     1 
HETATM 2993 O  O     . HOH G 6 .   ? -21.989 5.639   -18.002 1.00 24.35  ? 743  HOH A O     1 
HETATM 2994 O  O     . HOH G 6 .   ? 9.241   -3.969  -9.753  1.00 20.16  ? 744  HOH A O     1 
HETATM 2995 O  O     . HOH G 6 .   ? -22.656 18.250  -39.374 1.00 28.50  ? 745  HOH A O     1 
HETATM 2996 O  O     . HOH G 6 .   ? -37.583 7.230   -9.846  1.00 37.89  ? 746  HOH A O     1 
HETATM 2997 O  O     . HOH G 6 .   ? -26.504 37.106  -18.780 1.00 28.30  ? 747  HOH A O     1 
HETATM 2998 O  O     . HOH G 6 .   ? -17.306 -0.214  -41.569 1.00 28.43  ? 748  HOH A O     1 
HETATM 2999 O  O     . HOH G 6 .   ? -3.346  7.306   -16.107 1.00 29.76  ? 749  HOH A O     1 
HETATM 3000 O  O     . HOH G 6 .   ? -18.522 9.090   -14.141 1.00 28.15  ? 750  HOH A O     1 
HETATM 3001 O  O     . HOH G 6 .   ? -36.229 8.472   -11.939 1.00 26.79  ? 751  HOH A O     1 
HETATM 3002 O  O     . HOH G 6 .   ? 1.708   -2.519  -28.776 1.00 38.20  ? 752  HOH A O     1 
HETATM 3003 O  O     . HOH G 6 .   ? -26.900 6.090   -23.880 1.00 41.97  ? 753  HOH A O     1 
HETATM 3004 O  O     . HOH G 6 .   ? -27.556 3.864   -23.020 1.00 27.90  ? 754  HOH A O     1 
HETATM 3005 O  O     . HOH G 6 .   ? -28.367 15.894  -15.697 1.00 29.52  ? 755  HOH A O     1 
HETATM 3006 O  O     . HOH G 6 .   ? -15.560 26.046  -39.646 1.00 37.63  ? 756  HOH A O     1 
HETATM 3007 O  O     . HOH G 6 .   ? -12.119 33.314  -30.022 1.00 32.05  ? 757  HOH A O     1 
HETATM 3008 O  O     . HOH G 6 .   ? -23.624 -2.635  -5.853  1.00 28.18  ? 758  HOH A O     1 
HETATM 3009 O  O     . HOH G 6 .   ? -24.085 23.906  -8.142  1.00 33.01  ? 759  HOH A O     1 
HETATM 3010 O  O     . HOH G 6 .   ? -3.800  4.982   -6.957  1.00 28.72  ? 760  HOH A O     1 
HETATM 3011 O  O     . HOH G 6 .   ? -25.644 -0.272  -4.423  1.00 31.46  ? 761  HOH A O     1 
HETATM 3012 O  O     . HOH G 6 .   ? -1.041  9.130   -0.525  1.00 61.06  ? 762  HOH A O     1 
HETATM 3013 O  O     . HOH G 6 .   ? 10.186  -2.395  -7.962  1.00 27.31  ? 763  HOH A O     1 
HETATM 3014 O  O     . HOH G 6 .   ? -15.508 -3.967  -31.607 1.00 37.93  ? 764  HOH A O     1 
HETATM 3015 O  O     . HOH G 6 .   ? -10.606 35.533  -31.090 1.00 38.61  ? 765  HOH A O     1 
HETATM 3016 O  O     . HOH G 6 .   ? -4.968  -9.114  -35.425 1.00 40.38  ? 766  HOH A O     1 
HETATM 3017 O  O     . HOH G 6 .   ? 5.420   2.696   -16.477 1.00 31.10  ? 767  HOH A O     1 
HETATM 3018 O  O     . HOH G 6 .   ? -27.489 29.633  -32.494 1.00 24.42  ? 768  HOH A O     1 
HETATM 3019 O  O     . HOH G 6 .   ? -16.414 42.547  -22.672 1.00 40.26  ? 769  HOH A O     1 
HETATM 3020 O  O     . HOH G 6 .   ? -18.886 40.462  -37.456 1.00 20.38  ? 770  HOH A O     1 
HETATM 3021 O  O     . HOH G 6 .   ? -19.866 7.812   -4.575  1.00 29.40  ? 771  HOH A O     1 
HETATM 3022 O  O     . HOH G 6 .   ? -24.487 10.418  -25.940 1.00 40.60  ? 772  HOH A O     1 
HETATM 3023 O  O     . HOH G 6 .   ? -41.461 12.863  -6.661  1.00 46.28  ? 773  HOH A O     1 
HETATM 3024 O  O     . HOH G 6 .   ? 4.361   6.589   -17.068 1.00 29.52  ? 774  HOH A O     1 
HETATM 3025 O  O     . HOH G 6 .   ? 11.610  4.756   -17.547 1.00 34.42  ? 775  HOH A O     1 
HETATM 3026 O  O     . HOH G 6 .   ? -26.903 -2.222  -45.250 1.00 55.05  ? 776  HOH A O     1 
HETATM 3027 O  O     . HOH G 6 .   ? 0.366   12.356  -14.097 1.00 47.10  ? 777  HOH A O     1 
HETATM 3028 O  O     . HOH G 6 .   ? -25.527 4.781   -14.591 1.00 33.08  ? 778  HOH A O     1 
HETATM 3029 O  O     . HOH G 6 .   ? -21.126 39.145  -38.360 1.00 32.12  ? 779  HOH A O     1 
HETATM 3030 O  O     . HOH G 6 .   ? -14.833 -5.930  -3.674  1.00 34.77  ? 780  HOH A O     1 
HETATM 3031 O  O     . HOH G 6 .   ? -22.418 20.779  -23.445 1.00 35.35  ? 781  HOH A O     1 
HETATM 3032 O  O     . HOH G 6 .   ? -20.887 19.273  -31.465 1.00 37.88  ? 782  HOH A O     1 
HETATM 3033 O  O     . HOH G 6 .   ? -39.993 11.217  2.842   1.00 29.57  ? 783  HOH A O     1 
HETATM 3034 O  O     . HOH G 6 .   ? 6.596   -1.524  -22.005 1.00 48.00  ? 784  HOH A O     1 
HETATM 3035 O  O     . HOH G 6 .   ? -6.418  23.388  -32.937 1.00 36.69  ? 785  HOH A O     1 
HETATM 3036 O  O     . HOH G 6 .   ? -36.813 21.561  -4.602  1.00 29.08  ? 786  HOH A O     1 
HETATM 3037 O  O     . HOH G 6 .   ? -6.630  18.027  -38.682 1.00 39.92  ? 787  HOH A O     1 
HETATM 3038 O  O     . HOH G 6 .   ? -34.819 18.725  -11.565 1.00 47.21  ? 788  HOH A O     1 
HETATM 3039 O  O     . HOH G 6 .   ? -10.088 37.547  -29.426 1.00 50.41  ? 789  HOH A O     1 
HETATM 3040 O  O     . HOH G 6 .   ? -31.277 31.021  -12.584 1.00 39.31  ? 790  HOH A O     1 
HETATM 3041 O  O     . HOH G 6 .   ? -13.887 -11.681 -8.106  1.00 38.73  ? 791  HOH A O     1 
HETATM 3042 O  O     . HOH G 6 .   ? 7.509   0.005   -24.343 1.00 36.73  ? 792  HOH A O     1 
HETATM 3043 O  O     . HOH G 6 .   ? -32.705 4.643   -16.491 1.00 32.23  ? 793  HOH A O     1 
HETATM 3044 O  O     . HOH G 6 .   ? -14.687 -6.115  -24.604 1.00 39.47  ? 794  HOH A O     1 
HETATM 3045 O  O     . HOH G 6 .   ? -28.549 8.051   -15.371 1.00 33.61  ? 795  HOH A O     1 
HETATM 3046 O  O     . HOH G 6 .   ? -28.849 26.217  -7.215  1.00 44.72  ? 796  HOH A O     1 
HETATM 3047 O  O     . HOH G 6 .   ? -0.479  4.817   -1.091  1.00 41.30  ? 797  HOH A O     1 
HETATM 3048 O  O     . HOH G 6 .   ? -18.339 16.605  -29.451 1.00 57.95  ? 798  HOH A O     1 
HETATM 3049 O  O     . HOH G 6 .   ? -1.415  12.607  -24.158 1.00 45.03  ? 799  HOH A O     1 
HETATM 3050 O  O     . HOH G 6 .   ? -17.780 -15.020 -15.423 1.00 50.03  ? 800  HOH A O     1 
HETATM 3051 O  O     . HOH G 6 .   ? -23.904 8.280   -15.464 1.00 34.63  ? 801  HOH A O     1 
HETATM 3052 O  O     . HOH G 6 .   ? -12.229 37.091  -20.693 1.00 49.17  ? 802  HOH A O     1 
HETATM 3053 O  O     . HOH G 6 .   ? -19.653 30.299  -19.603 1.00 48.97  ? 803  HOH A O     1 
HETATM 3054 O  O     . HOH G 6 .   ? -27.743 20.647  -18.869 1.00 38.91  ? 804  HOH A O     1 
HETATM 3055 O  O     . HOH G 6 .   ? -9.836  40.682  -34.257 1.00 53.04  ? 805  HOH A O     1 
HETATM 3056 O  O     . HOH G 6 .   ? -18.574 20.140  -32.507 1.00 18.88  ? 806  HOH A O     1 
HETATM 3057 O  O     . HOH G 6 .   ? -27.365 3.452   -12.913 1.00 20.26  ? 807  HOH A O     1 
HETATM 3058 O  O     . HOH G 6 .   ? -28.276 11.156  -14.139 1.00 24.02  ? 808  HOH A O     1 
HETATM 3059 O  O     . HOH G 6 .   ? -10.740 -10.484 -10.512 1.00 22.38  ? 809  HOH A O     1 
HETATM 3060 O  O     . HOH G 6 .   ? -27.874 8.365   4.127   1.00 33.46  ? 810  HOH A O     1 
HETATM 3061 O  O     . HOH G 6 .   ? -24.904 35.939  -29.041 1.00 18.11  ? 811  HOH A O     1 
HETATM 3062 O  O     . HOH G 6 .   ? 0.987   11.504  -24.793 1.00 43.07  ? 812  HOH A O     1 
HETATM 3063 O  O     . HOH G 6 .   ? -22.927 37.997  -36.424 1.00 29.58  ? 813  HOH A O     1 
HETATM 3064 O  O     . HOH G 6 .   ? -16.618 5.707   -44.307 1.00 30.18  ? 814  HOH A O     1 
HETATM 3065 O  O     . HOH G 6 .   ? -27.113 32.271  -21.722 1.00 34.40  ? 815  HOH A O     1 
HETATM 3066 O  O     . HOH G 6 .   ? -8.819  9.432   -7.602  1.00 40.22  ? 816  HOH A O     1 
HETATM 3067 O  O     . HOH G 6 .   ? -10.703 0.016   -44.845 1.00 56.22  ? 817  HOH A O     1 
HETATM 3068 O  O     . HOH G 6 .   ? 11.548  7.047   -15.833 1.00 26.60  ? 818  HOH A O     1 
HETATM 3069 O  O     . HOH G 6 .   ? -16.061 39.818  -31.812 1.00 32.97  ? 819  HOH A O     1 
HETATM 3070 O  O     . HOH G 6 .   ? -34.508 17.708  6.191   1.00 50.65  ? 820  HOH A O     1 
HETATM 3071 O  O     . HOH G 6 .   ? -24.512 9.890   4.053   1.00 38.64  ? 821  HOH A O     1 
HETATM 3072 O  O     . HOH G 6 .   ? -14.941 -8.572  -18.479 1.00 34.77  ? 822  HOH A O     1 
HETATM 3073 O  O     . HOH G 6 .   ? -27.885 8.051   -35.440 1.00 48.20  ? 823  HOH A O     1 
HETATM 3074 O  O     . HOH G 6 .   ? -23.776 31.590  -38.216 1.00 41.56  ? 824  HOH A O     1 
HETATM 3075 O  O     . HOH G 6 .   ? -29.144 34.137  -15.169 1.00 35.92  ? 825  HOH A O     1 
HETATM 3076 O  O     . HOH G 6 .   ? -7.468  2.666   -13.811 1.00 47.00  ? 826  HOH A O     1 
HETATM 3077 O  O     . HOH G 6 .   ? -8.072  31.265  -30.636 1.00 35.24  ? 827  HOH A O     1 
HETATM 3078 O  O     . HOH G 6 .   ? -19.844 14.086  -30.168 1.00 27.21  ? 828  HOH A O     1 
HETATM 3079 O  O     . HOH G 6 .   ? 3.734   9.663   -8.485  1.00 43.11  ? 829  HOH A O     1 
HETATM 3080 O  O     . HOH G 6 .   ? -14.330 -12.517 -15.642 1.00 35.14  ? 830  HOH A O     1 
HETATM 3081 O  O     . HOH G 6 .   ? -22.353 39.503  -32.205 1.00 28.33  ? 831  HOH A O     1 
HETATM 3082 O  O     . HOH G 6 .   ? -11.311 -10.398 -2.947  1.00 51.77  ? 832  HOH A O     1 
HETATM 3083 O  O     . HOH G 6 .   ? 3.009   -9.311  -10.490 1.00 33.68  ? 833  HOH A O     1 
HETATM 3084 O  O     . HOH G 6 .   ? 9.837   -3.754  -12.327 1.00 31.98  ? 834  HOH A O     1 
HETATM 3085 O  O     . HOH G 6 .   ? -15.549 28.327  -38.011 1.00 43.70  ? 835  HOH A O     1 
HETATM 3086 O  O     . HOH G 6 .   ? -26.220 25.309  -6.557  1.00 43.56  ? 836  HOH A O     1 
HETATM 3087 O  O     . HOH G 6 .   ? -9.586  31.776  -37.940 1.00 45.25  ? 837  HOH A O     1 
HETATM 3088 O  O     . HOH G 6 .   ? -8.841  -7.814  -31.833 1.00 41.78  ? 838  HOH A O     1 
HETATM 3089 O  O     . HOH G 6 .   ? -31.223 0.473   -32.714 1.00 51.67  ? 839  HOH A O     1 
HETATM 3090 O  O     . HOH G 6 .   ? -33.428 -4.012  -9.466  1.00 40.29  ? 840  HOH A O     1 
HETATM 3091 O  O     . HOH G 6 .   ? -27.620 29.026  -9.709  1.00 50.44  ? 841  HOH A O     1 
HETATM 3092 O  O     . HOH G 6 .   ? -8.208  34.179  -29.974 1.00 38.91  ? 842  HOH A O     1 
HETATM 3093 O  O     . HOH G 6 .   ? 2.826   13.881  -33.642 1.00 42.20  ? 843  HOH A O     1 
HETATM 3094 O  O     . HOH G 6 .   ? -1.068  15.684  -35.427 1.00 39.83  ? 844  HOH A O     1 
HETATM 3095 O  O     . HOH G 6 .   ? -29.690 31.484  -32.910 1.00 39.60  ? 845  HOH A O     1 
HETATM 3096 O  O     . HOH G 6 .   ? 6.283   10.192  -36.948 1.00 48.36  ? 846  HOH A O     1 
HETATM 3097 O  O     . HOH G 6 .   ? 7.626   -0.825  3.123   1.00 48.79  ? 847  HOH A O     1 
HETATM 3098 O  O     . HOH G 6 .   ? -15.480 30.364  -39.659 1.00 75.76  ? 848  HOH A O     1 
HETATM 3099 O  O     . HOH G 6 .   ? -17.244 2.995   -48.012 1.00 52.16  ? 849  HOH A O     1 
HETATM 3100 O  O     . HOH G 6 .   ? -29.051 4.817   -18.216 1.00 39.34  ? 850  HOH A O     1 
HETATM 3101 O  O     . HOH G 6 .   ? -11.254 32.843  -19.979 1.00 46.36  ? 851  HOH A O     1 
HETATM 3102 O  O     . HOH G 6 .   ? -35.393 12.806  -14.869 1.00 42.93  ? 852  HOH A O     1 
HETATM 3103 O  O     . HOH G 6 .   ? -3.662  8.144   -9.542  1.00 55.76  ? 853  HOH A O     1 
HETATM 3104 O  O     . HOH G 6 .   ? -16.792 33.964  -38.660 1.00 43.59  ? 854  HOH A O     1 
HETATM 3105 O  O     . HOH G 6 .   ? -31.677 1.915   2.242   1.00 51.09  ? 855  HOH A O     1 
HETATM 3106 O  O     . HOH G 6 .   ? -14.510 -12.874 -12.972 1.00 35.47  ? 856  HOH A O     1 
HETATM 3107 O  O     . HOH G 6 .   ? -22.815 5.671   6.023   1.00 70.35  ? 857  HOH A O     1 
HETATM 3108 O  O     . HOH G 6 .   ? -26.052 17.300  -17.528 1.00 47.80  ? 858  HOH A O     1 
HETATM 3109 O  O     . HOH G 6 .   ? -22.900 9.718   -23.730 1.00 50.29  ? 859  HOH A O     1 
HETATM 3110 O  O     . HOH G 6 .   ? -18.299 -11.107 -12.109 1.00 52.23  ? 860  HOH A O     1 
HETATM 3111 O  O     . HOH G 6 .   ? -40.351 15.587  0.769   1.00 32.02  ? 861  HOH A O     1 
HETATM 3112 O  O     . HOH G 6 .   ? -16.431 42.519  -36.970 1.00 40.68  ? 862  HOH A O     1 
HETATM 3113 O  O     . HOH G 6 .   ? -24.438 25.542  -34.957 1.00 48.41  ? 863  HOH A O     1 
HETATM 3114 O  O     . HOH G 6 .   ? -12.300 18.970  -42.489 1.00 35.33  ? 864  HOH A O     1 
HETATM 3115 O  O     . HOH G 6 .   ? -11.682 -7.756  -24.170 1.00 54.93  ? 865  HOH A O     1 
HETATM 3116 O  O     . HOH G 6 .   ? -4.008  12.670  -20.356 1.00 53.00  ? 866  HOH A O     1 
HETATM 3117 O  O     . HOH G 6 .   ? -28.155 24.347  -20.534 1.00 39.15  ? 867  HOH A O     1 
HETATM 3118 O  O     . HOH G 6 .   ? -24.742 24.217  -37.167 1.00 58.27  ? 868  HOH A O     1 
HETATM 3119 O  O     . HOH G 6 .   ? -14.486 0.124   1.980   1.00 61.67  ? 869  HOH A O     1 
HETATM 3120 O  O     . HOH G 6 .   ? -34.179 30.188  -19.108 1.00 54.25  ? 870  HOH A O     1 
HETATM 3121 O  O     . HOH G 6 .   ? -10.667 -7.457  -27.648 1.00 43.52  ? 871  HOH A O     1 
HETATM 3122 O  O     . HOH G 6 .   ? -10.136 21.854  -39.237 1.00 48.80  ? 872  HOH A O     1 
HETATM 3123 O  O     . HOH G 6 .   ? -17.218 31.590  -10.513 1.00 41.82  ? 873  HOH A O     1 
HETATM 3124 O  O     . HOH G 6 .   ? -16.977 8.520   -17.998 1.00 34.64  ? 874  HOH A O     1 
HETATM 3125 O  O     . HOH G 6 .   ? 5.747   -7.007  -37.108 1.00 55.47  ? 875  HOH A O     1 
HETATM 3126 O  O     . HOH G 6 .   ? 5.252   -8.790  -25.466 1.00 46.67  ? 876  HOH A O     1 
HETATM 3127 O  O     . HOH G 6 .   ? -21.072 8.891   4.202   1.00 54.49  ? 877  HOH A O     1 
HETATM 3128 O  O     . HOH G 6 .   ? -25.179 17.460  -40.995 1.00 41.20  ? 878  HOH A O     1 
HETATM 3129 O  O     . HOH G 6 .   ? -9.114  -7.821  -24.166 1.00 55.67  ? 879  HOH A O     1 
HETATM 3130 O  O     . HOH G 6 .   ? -41.006 4.469   4.413   1.00 56.15  ? 880  HOH A O     1 
HETATM 3131 O  O     . HOH G 6 .   ? -26.909 15.050  -38.406 1.00 55.29  ? 881  HOH A O     1 
HETATM 3132 O  O     . HOH G 6 .   ? -23.403 31.670  -11.973 1.00 59.46  ? 882  HOH A O     1 
HETATM 3133 O  O     . HOH G 6 .   ? -4.966  25.817  -34.407 1.00 53.38  ? 883  HOH A O     1 
HETATM 3134 O  O     . HOH G 6 .   ? -11.910 11.624  -20.839 1.00 52.08  ? 884  HOH A O     1 
HETATM 3135 O  O     . HOH G 6 .   ? -13.275 22.993  -10.028 1.00 55.49  ? 885  HOH A O     1 
HETATM 3136 O  O     . HOH G 6 .   ? -42.653 10.355  0.777   1.00 57.33  ? 886  HOH A O     1 
HETATM 3137 O  O     . HOH G 6 .   ? -24.524 12.332  -28.149 1.00 32.32  ? 887  HOH A O     1 
HETATM 3138 O  O     . HOH G 6 .   ? -21.394 13.289  -1.242  1.00 31.23  ? 888  HOH A O     1 
HETATM 3139 O  O     . HOH G 6 .   ? -10.737 30.744  -30.393 1.00 37.41  ? 889  HOH A O     1 
HETATM 3140 O  O     . HOH G 6 .   ? -9.898  29.459  -28.153 1.00 39.37  ? 890  HOH A O     1 
HETATM 3141 O  O     . HOH G 6 .   ? 4.565   8.173   -29.838 1.00 31.93  ? 891  HOH A O     1 
HETATM 3142 O  O     . HOH G 6 .   ? -22.098 24.850  -37.117 1.00 42.20  ? 892  HOH A O     1 
HETATM 3143 O  O     . HOH G 6 .   ? -17.989 -4.513  -35.679 1.00 33.34  ? 893  HOH A O     1 
HETATM 3144 O  O     . HOH G 6 .   ? -20.733 8.492   -19.561 1.00 40.74  ? 894  HOH A O     1 
HETATM 3145 O  O     . HOH G 6 .   ? -0.429  5.105   -44.876 1.00 46.22  ? 895  HOH A O     1 
HETATM 3146 O  O     . HOH G 6 .   ? -35.912 27.325  -9.039  1.00 41.66  ? 896  HOH A O     1 
HETATM 3147 O  O     . HOH G 6 .   ? -29.001 29.225  -28.609 1.00 40.71  ? 897  HOH A O     1 
HETATM 3148 O  O     . HOH G 6 .   ? -20.947 16.908  -40.922 1.00 42.47  ? 898  HOH A O     1 
HETATM 3149 O  O     . HOH G 6 .   ? -29.780 -3.176  -10.319 1.00 45.02  ? 899  HOH A O     1 
HETATM 3150 O  O     . HOH G 6 .   ? -10.056 -11.389 -5.561  1.00 54.05  ? 900  HOH A O     1 
HETATM 3151 O  O     . HOH G 6 .   ? -26.777 27.881  -35.286 1.00 43.16  ? 901  HOH A O     1 
HETATM 3152 O  O     . HOH G 6 .   ? -6.278  -5.664  -23.663 1.00 46.04  ? 902  HOH A O     1 
HETATM 3153 O  O     . HOH G 6 .   ? 2.071   -8.701  -18.258 1.00 38.46  ? 903  HOH A O     1 
HETATM 3154 O  O     . HOH G 6 .   ? 8.930   11.689  -23.595 1.00 52.02  ? 904  HOH A O     1 
HETATM 3155 O  O     . HOH G 6 .   ? -27.158 23.835  -4.487  1.00 44.96  ? 905  HOH A O     1 
HETATM 3156 O  O     . HOH G 6 .   ? 2.854   15.471  -29.592 1.00 40.54  ? 906  HOH A O     1 
HETATM 3157 O  O     . HOH G 6 .   ? -4.721  -9.572  -2.640  1.00 45.87  ? 907  HOH A O     1 
HETATM 3158 O  O     . HOH G 6 .   ? -13.077 11.150  -18.116 1.00 52.07  ? 908  HOH A O     1 
HETATM 3159 O  O     . HOH G 6 .   ? -0.917  -9.252  -5.537  1.00 42.02  ? 909  HOH A O     1 
HETATM 3160 O  O     . HOH G 6 .   ? -28.136 4.677   -37.940 1.00 46.95  ? 910  HOH A O     1 
HETATM 3161 O  O     . HOH G 6 .   ? -14.905 29.327  -15.496 1.00 55.53  ? 911  HOH A O     1 
HETATM 3162 O  O     . HOH G 6 .   ? -27.278 25.887  -31.481 1.00 32.90  ? 912  HOH A O     1 
HETATM 3163 O  O     . HOH G 6 .   ? -25.665 -6.326  -7.015  1.00 46.95  ? 913  HOH A O     1 
HETATM 3164 O  O     . HOH G 6 .   ? -2.251  6.824   1.745   1.00 58.07  ? 914  HOH A O     1 
HETATM 3165 O  O     . HOH G 6 .   ? -1.918  -4.039  -0.004  1.00 48.49  ? 915  HOH A O     1 
HETATM 3166 O  O     . HOH G 6 .   ? 5.410   -5.646  -28.733 1.00 43.75  ? 916  HOH A O     1 
HETATM 3167 O  O     . HOH G 6 .   ? -8.526  11.364  -3.301  1.00 42.70  ? 917  HOH A O     1 
HETATM 3168 O  O     . HOH G 6 .   ? -5.340  9.122   -5.809  1.00 55.41  ? 918  HOH A O     1 
HETATM 3169 O  O     . HOH G 6 .   ? -18.271 26.145  -40.560 1.00 43.65  ? 919  HOH A O     1 
HETATM 3170 O  O     . HOH G 6 .   ? -23.602 38.194  -30.022 1.00 35.22  ? 920  HOH A O     1 
HETATM 3171 O  O     . HOH G 6 .   ? -20.146 20.238  -21.364 1.00 68.01  ? 921  HOH A O     1 
HETATM 3172 O  O     . HOH G 6 .   ? -17.237 18.763  -27.552 1.00 46.07  ? 922  HOH A O     1 
HETATM 3173 O  O     . HOH G 6 .   ? -35.554 28.799  -11.595 1.00 34.66  ? 923  HOH A O     1 
HETATM 3174 O  O     . HOH G 6 .   ? -21.725 16.124  -13.521 1.00 39.23  ? 924  HOH A O     1 
HETATM 3175 O  O     . HOH G 6 .   ? -4.591  15.688  -7.218  1.00 49.53  ? 925  HOH A O     1 
HETATM 3176 O  O     . HOH G 6 .   ? -8.138  17.534  -43.302 1.00 61.30  ? 926  HOH A O     1 
HETATM 3177 O  O     . HOH G 6 .   ? 0.706   -7.525  -3.766  1.00 41.23  ? 927  HOH A O     1 
HETATM 3178 O  O     . HOH G 6 .   ? -6.641  -6.971  -21.308 1.00 42.80  ? 928  HOH A O     1 
HETATM 3179 O  O     . HOH G 6 .   ? -12.751 -1.912  2.223   1.00 45.53  ? 929  HOH A O     1 
HETATM 3180 O  O     . HOH G 6 .   ? -11.466 43.533  -34.702 1.00 61.58  ? 930  HOH A O     1 
HETATM 3181 O  O     . HOH G 6 .   ? -19.008 17.758  -13.732 1.00 43.16  ? 931  HOH A O     1 
HETATM 3182 O  O     . HOH G 6 .   ? -17.812 20.680  -20.035 1.00 49.62  ? 932  HOH A O     1 
HETATM 3183 O  O     . HOH G 6 .   ? -17.518 2.088   2.515   1.00 46.50  ? 933  HOH A O     1 
HETATM 3184 O  O     . HOH G 6 .   ? -28.501 8.633   -32.138 1.00 59.38  ? 934  HOH A O     1 
HETATM 3185 O  O     . HOH G 6 .   ? 2.048   8.115   -2.089  1.00 59.22  ? 935  HOH A O     1 
HETATM 3186 O  O     . HOH G 6 .   ? -19.890 9.941   -49.959 1.00 56.94  ? 936  HOH A O     1 
HETATM 3187 O  O     . HOH G 6 .   ? -32.943 17.462  -16.264 1.00 56.70  ? 937  HOH A O     1 
HETATM 3188 O  O     . HOH G 6 .   ? -16.498 -12.305 -17.158 1.00 55.85  ? 938  HOH A O     1 
HETATM 3189 O  O     . HOH G 6 .   ? -2.242  -3.433  2.552   1.00 56.23  ? 939  HOH A O     1 
HETATM 3190 O  O     . HOH G 6 .   ? -14.056 19.248  -11.211 1.00 59.44  ? 940  HOH A O     1 
HETATM 3191 O  O     . HOH G 6 .   ? 5.345   13.784  -12.045 1.00 53.10  ? 941  HOH A O     1 
HETATM 3192 O  O     . HOH G 6 .   ? -25.300 33.862  -14.823 1.00 46.99  ? 942  HOH A O     1 
HETATM 3193 O  O     . HOH G 6 .   ? 2.295   16.871  -32.530 1.00 71.32  ? 943  HOH A O     1 
HETATM 3194 O  O     . HOH G 6 .   ? -19.027 13.183  -0.166  1.00 51.12  ? 944  HOH A O     1 
HETATM 3195 O  O     . HOH G 6 .   ? -29.303 32.708  -12.234 1.00 40.80  ? 945  HOH A O     1 
HETATM 3196 O  O     . HOH G 6 .   ? -33.047 17.946  -13.395 1.00 40.18  ? 946  HOH A O     1 
HETATM 3197 O  O     . HOH G 6 .   ? -24.387 6.652   -18.531 1.00 34.14  ? 947  HOH A O     1 
HETATM 3198 O  O     . HOH G 6 .   ? -40.074 21.485  -3.449  1.00 38.34  ? 948  HOH A O     1 
HETATM 3199 O  O     . HOH G 6 .   ? -35.065 9.216   -45.306 1.00 51.88  ? 949  HOH A O     1 
HETATM 3200 O  O     . HOH G 6 .   ? 2.061   15.282  -16.653 1.00 60.78  ? 950  HOH A O     1 
HETATM 3201 O  O     . HOH G 6 .   ? -8.743  32.627  -18.055 1.00 50.77  ? 951  HOH A O     1 
HETATM 3202 O  O     . HOH G 6 .   ? -17.877 -11.501 -19.475 1.00 54.37  ? 952  HOH A O     1 
HETATM 3203 O  O     . HOH G 6 .   ? -25.838 -16.055 -1.058  1.00 52.90  ? 953  HOH A O     1 
HETATM 3204 O  O     . HOH G 6 .   ? 3.164   1.889   3.073   1.00 60.34  ? 954  HOH A O     1 
HETATM 3205 O  O     . HOH G 6 .   ? -34.422 15.892  -12.239 1.00 50.32  ? 955  HOH A O     1 
HETATM 3206 O  O     . HOH G 6 .   ? -22.776 20.881  -38.991 1.00 47.88  ? 956  HOH A O     1 
HETATM 3207 O  O     . HOH G 6 .   ? -7.681  -15.552 -22.581 1.00 59.38  ? 957  HOH A O     1 
HETATM 3208 O  O     . HOH G 6 .   ? 0.383   -12.230 -14.888 1.00 45.50  ? 958  HOH A O     1 
HETATM 3209 O  O     . HOH G 6 .   ? -18.761 19.170  -44.877 1.00 53.45  ? 959  HOH A O     1 
HETATM 3210 O  O     . HOH G 6 .   ? -11.587 -7.358  -19.416 1.00 37.88  ? 960  HOH A O     1 
HETATM 3211 O  O     . HOH G 6 .   ? -6.451  28.172  -37.219 1.00 49.05  ? 961  HOH A O     1 
HETATM 3212 O  O     . HOH G 6 .   ? -13.357 11.635  -25.007 1.00 27.06  ? 962  HOH A O     1 
HETATM 3213 O  O     . HOH G 6 .   ? -18.939 41.597  -34.976 1.00 40.43  ? 963  HOH A O     1 
HETATM 3214 O  O     . HOH G 6 .   ? -22.193 13.994  -11.605 1.00 25.36  ? 964  HOH A O     1 
HETATM 3215 O  O     . HOH G 6 .   ? -19.372 -1.798  -41.709 1.00 38.64  ? 965  HOH A O     1 
HETATM 3216 O  O     . HOH G 6 .   ? -32.780 23.986  -30.530 1.00 58.61  ? 966  HOH A O     1 
HETATM 3217 O  O     . HOH G 6 .   ? 8.942   -0.532  -39.790 1.00 60.70  ? 967  HOH A O     1 
HETATM 3218 O  O     . HOH G 6 .   ? -28.180 17.065  -34.840 1.00 47.01  ? 968  HOH A O     1 
HETATM 3219 O  O     . HOH G 6 .   ? -16.402 -3.652  -26.166 1.00 49.77  ? 969  HOH A O     1 
HETATM 3220 O  O     . HOH G 6 .   ? -16.056 -8.533  -21.076 1.00 44.69  ? 970  HOH A O     1 
HETATM 3221 O  O     . HOH G 6 .   ? -8.472  -7.282  -34.377 1.00 54.58  ? 971  HOH A O     1 
HETATM 3222 O  O     . HOH G 6 .   ? -32.849 0.007   -30.617 1.00 60.05  ? 972  HOH A O     1 
HETATM 3223 O  O     . HOH G 6 .   ? -15.613 15.137  -28.893 1.00 46.75  ? 973  HOH A O     1 
HETATM 3224 O  O     . HOH G 6 .   ? -28.439 34.878  -32.365 1.00 39.13  ? 974  HOH A O     1 
HETATM 3225 O  O     . HOH G 6 .   ? -3.777  -12.538 -22.563 1.00 46.41  ? 975  HOH A O     1 
HETATM 3226 O  O     . HOH G 6 .   ? -39.069 23.735  -8.973  1.00 40.38  ? 976  HOH A O     1 
HETATM 3227 O  O     . HOH G 6 .   ? -10.730 12.280  -13.015 1.00 49.99  ? 977  HOH A O     1 
HETATM 3228 O  O     . HOH G 6 .   ? -25.234 -6.313  -11.928 1.00 38.11  ? 978  HOH A O     1 
HETATM 3229 O  O     . HOH G 6 .   ? 9.132   0.262   5.465   1.00 57.20  ? 979  HOH A O     1 
HETATM 3230 O  O     . HOH G 6 .   ? -1.517  10.765  -46.451 1.00 59.98  ? 980  HOH A O     1 
HETATM 3231 O  O     . HOH G 6 .   ? -17.578 6.412   -26.334 1.00 19.24  ? 981  HOH A O     1 
HETATM 3232 O  O     . HOH G 6 .   ? -27.630 36.575  -20.774 1.00 33.02  ? 982  HOH A O     1 
HETATM 3233 O  O     . HOH G 6 .   ? -26.524 36.477  -16.103 1.00 49.90  ? 983  HOH A O     1 
HETATM 3234 O  O     . HOH G 6 .   ? 3.082   6.823   -14.910 1.00 55.06  ? 984  HOH A O     1 
HETATM 3235 O  O     . HOH G 6 .   ? 3.824   -4.170  -15.354 1.00 42.25  ? 985  HOH A O     1 
HETATM 3236 O  O     . HOH G 6 .   ? -23.656 -1.960  -3.321  1.00 39.15  ? 986  HOH A O     1 
HETATM 3237 O  O     . HOH G 6 .   ? -10.502 10.349  -14.820 1.00 55.32  ? 987  HOH A O     1 
HETATM 3238 O  O     . HOH G 6 .   ? -38.694 1.725   -0.353  1.00 40.46  ? 988  HOH A O     1 
HETATM 3239 O  O     . HOH G 6 .   ? -27.776 6.897   7.254   1.00 46.90  ? 989  HOH A O     1 
HETATM 3240 O  O     . HOH G 6 .   ? -2.119  -8.074  -3.453  1.00 57.96  ? 990  HOH A O     1 
HETATM 3241 O  O     . HOH G 6 .   ? -7.453  9.081   -19.844 1.00 51.48  ? 991  HOH A O     1 
HETATM 3242 O  O     . HOH G 6 .   ? 0.894   -11.775 -11.486 1.00 48.12  ? 992  HOH A O     1 
HETATM 3243 O  O     . HOH G 6 .   ? -3.344  -11.866 -7.557  1.00 44.35  ? 993  HOH A O     1 
HETATM 3244 O  O     . HOH G 6 .   ? -16.948 -10.951 -21.982 1.00 61.16  ? 994  HOH A O     1 
HETATM 3245 O  O     . HOH G 6 .   ? -25.460 7.069   -39.899 1.00 41.66  ? 995  HOH A O     1 
HETATM 3246 O  O     . HOH G 6 .   ? -2.963  17.614  -8.680  1.00 54.53  ? 996  HOH A O     1 
HETATM 3247 O  O     . HOH G 6 .   ? -10.985 0.620   8.091   1.00 50.98  ? 997  HOH A O     1 
HETATM 3248 O  O     . HOH G 6 .   ? -27.667 -1.517  -3.216  1.00 53.98  ? 998  HOH A O     1 
HETATM 3249 O  O     . HOH G 6 .   ? -26.460 -9.440  -16.187 1.00 53.96  ? 999  HOH A O     1 
HETATM 3250 O  O     . HOH G 6 .   ? -13.970 35.432  -38.054 1.00 35.22  ? 1000 HOH A O     1 
HETATM 3251 O  O     . HOH G 6 .   ? -17.406 7.972   -3.712  1.00 42.72  ? 1001 HOH A O     1 
HETATM 3252 O  O     . HOH G 6 .   ? -4.869  -6.523  -1.608  1.00 58.93  ? 1002 HOH A O     1 
HETATM 3253 O  O     . HOH G 6 .   ? -6.455  16.297  -41.083 1.00 56.94  ? 1003 HOH A O     1 
HETATM 3254 O  O     . HOH G 6 .   ? -12.719 -11.415 -4.912  1.00 53.90  ? 1004 HOH A O     1 
HETATM 3255 O  O     . HOH G 6 .   ? -26.753 9.992   -39.930 1.00 42.63  ? 1005 HOH A O     1 
HETATM 3256 O  O     . HOH G 6 .   ? -22.364 34.926  -13.625 1.00 65.15  ? 1006 HOH A O     1 
HETATM 3257 O  O     . HOH G 6 .   ? 10.573  -3.826  1.780   1.00 65.70  ? 1007 HOH A O     1 
HETATM 3258 O  O     . HOH G 6 .   ? -24.201 -3.195  -0.059  1.00 58.71  ? 1008 HOH A O     1 
HETATM 3259 O  O     . HOH G 6 .   ? -38.343 26.315  -8.471  1.00 42.49  ? 1009 HOH A O     1 
HETATM 3260 O  O     . HOH G 6 .   ? -29.189 -2.651  -42.376 1.00 55.13  ? 1010 HOH A O     1 
HETATM 3261 O  O     . HOH G 6 .   ? -3.339  28.449  -38.672 1.00 67.25  ? 1011 HOH A O     1 
HETATM 3262 O  O     . HOH G 6 .   ? 3.004   1.654   -46.195 1.00 53.26  ? 1012 HOH A O     1 
HETATM 3263 O  O     . HOH G 6 .   ? -16.154 7.965   -49.141 1.00 58.40  ? 1013 HOH A O     1 
HETATM 3264 O  O     . HOH G 6 .   ? -14.694 2.677   2.854   1.00 58.69  ? 1014 HOH A O     1 
HETATM 3265 O  O     . HOH G 6 .   ? -29.326 26.894  -23.991 1.00 41.17  ? 1015 HOH A O     1 
HETATM 3266 O  O     . HOH G 6 .   ? -29.626 -1.306  -1.293  1.00 40.76  ? 1016 HOH A O     1 
HETATM 3267 O  O     . HOH G 6 .   ? 3.139   14.396  -26.778 1.00 46.14  ? 1017 HOH A O     1 
HETATM 3268 O  O     . HOH G 6 .   ? -25.710 12.290  -41.002 1.00 51.42  ? 1018 HOH A O     1 
HETATM 3269 O  O     . HOH G 6 .   ? -21.132 11.974  3.203   1.00 57.23  ? 1019 HOH A O     1 
HETATM 3270 O  O     . HOH G 6 .   ? -27.867 7.637   -41.431 1.00 53.06  ? 1020 HOH A O     1 
HETATM 3271 O  O     . HOH G 6 .   ? 10.154  -6.282  -13.400 1.00 43.29  ? 1021 HOH A O     1 
HETATM 3272 O  O     . HOH G 6 .   ? -26.231 -6.838  -15.395 1.00 47.15  ? 1022 HOH A O     1 
HETATM 3273 O  O     . HOH G 6 .   ? -42.246 12.271  -9.169  1.00 57.82  ? 1023 HOH A O     1 
HETATM 3274 O  O     . HOH G 6 .   ? -21.064 18.853  -43.451 1.00 57.21  ? 1024 HOH A O     1 
HETATM 3275 O  O     . HOH G 6 .   ? 7.955   -0.960  -14.698 1.00 51.20  ? 1025 HOH A O     1 
HETATM 3276 O  O     . HOH G 6 .   ? 1.582   14.387  -36.795 1.00 51.82  ? 1026 HOH A O     1 
HETATM 3277 O  O     . HOH G 6 .   ? -8.060  -13.836 -15.776 1.00 48.28  ? 1027 HOH A O     1 
HETATM 3278 O  O     . HOH G 6 .   ? -11.725 23.167  -20.129 1.00 66.78  ? 1028 HOH A O     1 
HETATM 3279 O  O     . HOH G 6 .   ? -28.178 -16.779 -3.211  1.00 55.30  ? 1029 HOH A O     1 
HETATM 3280 O  O     . HOH G 6 .   ? -14.854 9.995   -50.245 1.00 66.12  ? 1030 HOH A O     1 
HETATM 3281 O  O     . HOH G 6 .   ? -0.072  17.213  -31.187 1.00 58.64  ? 1031 HOH A O     1 
HETATM 3282 O  O     . HOH G 6 .   ? -15.260 -5.163  -35.504 1.00 42.75  ? 1032 HOH A O     1 
HETATM 3283 O  O     . HOH G 6 .   ? -44.974 12.252  -9.865  1.00 52.78  ? 1033 HOH A O     1 
HETATM 3284 O  O     . HOH G 6 .   ? -4.419  -12.652 -38.540 1.00 58.42  ? 1034 HOH A O     1 
HETATM 3285 O  O     . HOH G 6 .   ? -24.862 15.698  -27.723 1.00 44.41  ? 1035 HOH A O     1 
HETATM 3286 O  O     . HOH G 6 .   ? -20.171 17.109  -27.505 1.00 66.02  ? 1036 HOH A O     1 
HETATM 3287 O  O     . HOH G 6 .   ? -21.967 11.576  -14.373 1.00 63.01  ? 1037 HOH A O     1 
HETATM 3288 O  O     . HOH G 6 .   ? -17.294 14.780  -48.608 1.00 45.41  ? 1038 HOH A O     1 
HETATM 3289 O  O     . HOH G 6 .   ? -30.220 -16.324 6.407   1.00 50.83  ? 1039 HOH A O     1 
HETATM 3290 O  O     . HOH G 6 .   ? -26.697 -2.883  -10.760 1.00 38.79  ? 1040 HOH A O     1 
HETATM 3291 O  O     . HOH G 6 .   ? -7.360  17.488  -31.080 1.00 65.48  ? 1041 HOH A O     1 
HETATM 3292 O  O     . HOH G 6 .   ? -12.191 13.817  -22.472 1.00 55.08  ? 1042 HOH A O     1 
HETATM 3293 O  O     . HOH G 6 .   ? -30.045 0.084   1.043   1.00 55.42  ? 1043 HOH A O     1 
HETATM 3294 O  O     . HOH G 6 .   ? -15.669 16.109  -46.775 1.00 63.58  ? 1044 HOH A O     1 
HETATM 3295 O  O     . HOH G 6 .   ? -1.878  18.789  -29.494 1.00 69.93  ? 1045 HOH A O     1 
HETATM 3296 O  O     . HOH G 6 .   ? -27.835 36.968  -28.864 1.00 57.76  ? 1046 HOH A O     1 
HETATM 3297 O  O     . HOH G 6 .   ? -10.665 -6.833  -43.862 1.00 51.69  ? 1047 HOH A O     1 
HETATM 3298 O  O     . HOH H 6 .   ? -15.313 20.505  -23.450 1.00 49.03  ? 101  HOH C O     1 
HETATM 3299 O  O     . HOH H 6 .   ? -15.372 21.638  -20.965 1.00 47.65  ? 102  HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 39  ? 0.4800 0.5522 0.6477 0.0114  -0.0116 0.1215  149 LYS A N   
2    C CA  . LYS A 39  ? 0.4730 0.5520 0.6179 0.0100  -0.0174 0.1096  149 LYS A CA  
3    C C   . LYS A 39  ? 0.4823 0.5576 0.6417 0.0101  -0.0205 0.0940  149 LYS A C   
4    O O   . LYS A 39  ? 0.5027 0.5787 0.6817 0.0128  -0.0258 0.0969  149 LYS A O   
5    C CB  . LYS A 39  ? 0.5275 0.6177 0.6565 0.0109  -0.0275 0.1210  149 LYS A CB  
6    N N   . ILE A 40  ? 0.3716 0.4432 0.5222 0.0078  -0.0160 0.0785  150 ILE A N   
7    C CA  . ILE A 40  ? 0.3165 0.3847 0.4759 0.0075  -0.0168 0.0640  150 ILE A CA  
8    C C   . ILE A 40  ? 0.3107 0.3868 0.4647 0.0067  -0.0255 0.0616  150 ILE A C   
9    O O   . ILE A 40  ? 0.3083 0.3900 0.4410 0.0042  -0.0295 0.0608  150 ILE A O   
10   C CB  . ILE A 40  ? 0.3348 0.3977 0.4844 0.0054  -0.0103 0.0512  150 ILE A CB  
11   C CG1 . ILE A 40  ? 0.3292 0.3866 0.4885 0.0056  -0.0030 0.0540  150 ILE A CG1 
12   C CG2 . ILE A 40  ? 0.2997 0.3595 0.4554 0.0053  -0.0109 0.0385  150 ILE A CG2 
13   C CD1 . ILE A 40  ? 0.3574 0.4138 0.5049 0.0041  0.0032  0.0466  150 ILE A CD1 
14   N N   . SER A 41  ? 0.2350 0.3119 0.4092 0.0087  -0.0282 0.0597  151 SER A N   
15   C CA  . SER A 41  ? 0.2209 0.3069 0.3971 0.0075  -0.0362 0.0577  151 SER A CA  
16   C C   . SER A 41  ? 0.2451 0.3294 0.4100 0.0035  -0.0345 0.0434  151 SER A C   
17   O O   . SER A 41  ? 0.2132 0.2890 0.3770 0.0034  -0.0268 0.0350  151 SER A O   
18   C CB  . SER A 41  ? 0.2319 0.3203 0.4369 0.0117  -0.0373 0.0606  151 SER A CB  
19   O OG  . SER A 41  ? 0.2474 0.3453 0.4589 0.0100  -0.0431 0.0569  151 SER A OG  
20   N N   . GLN A 42  ? 0.2283 0.3209 0.3873 0.0000  -0.0427 0.0412  152 GLN A N   
21   C CA  . GLN A 42  ? 0.2207 0.3110 0.3736 -0.0045 -0.0418 0.0288  152 GLN A CA  
22   C C   . GLN A 42  ? 0.2703 0.3605 0.4454 -0.0033 -0.0377 0.0250  152 GLN A C   
23   O O   . GLN A 42  ? 0.2657 0.3521 0.4387 -0.0063 -0.0342 0.0163  152 GLN A O   
24   C CB  . GLN A 42  ? 0.2451 0.3439 0.3873 -0.0096 -0.0529 0.0268  152 GLN A CB  
25   C CG  . GLN A 42  ? 0.4047 0.5173 0.5682 -0.0098 -0.0632 0.0336  152 GLN A CG  
26   C CD  . GLN A 42  ? 0.7266 0.8484 0.8830 -0.0163 -0.0759 0.0292  152 GLN A CD  
27   O OE1 . GLN A 42  ? 0.6394 0.7573 0.7933 -0.0218 -0.0754 0.0177  152 GLN A OE1 
28   N NE2 . GLN A 42  ? 0.6691 0.8037 0.8251 -0.0160 -0.0885 0.0388  152 GLN A NE2 
29   N N   . TYR A 43  ? 0.2032 0.2976 0.4002 0.0014  -0.0373 0.0319  153 TYR A N   
30   C CA  . TYR A 43  ? 0.1874 0.2831 0.4054 0.0036  -0.0318 0.0285  153 TYR A CA  
31   C C   . TYR A 43  ? 0.1943 0.2789 0.4136 0.0077  -0.0213 0.0241  153 TYR A C   
32   O O   . TYR A 43  ? 0.1779 0.2580 0.4004 0.0111  -0.0203 0.0284  153 TYR A O   
33   C CB  . TYR A 43  ? 0.1955 0.3030 0.4392 0.0071  -0.0372 0.0373  153 TYR A CB  
34   C CG  . TYR A 43  ? 0.2481 0.3695 0.4949 0.0026  -0.0496 0.0413  153 TYR A CG  
35   C CD1 . TYR A 43  ? 0.2906 0.4194 0.5327 0.0031  -0.0608 0.0515  153 TYR A CD1 
36   C CD2 . TYR A 43  ? 0.2544 0.3829 0.5114 -0.0020 -0.0507 0.0358  153 TYR A CD2 
37   C CE1 . TYR A 43  ? 0.2793 0.4225 0.5241 -0.0012 -0.0746 0.0546  153 TYR A CE1 
38   C CE2 . TYR A 43  ? 0.2718 0.4142 0.5355 -0.0069 -0.0639 0.0385  153 TYR A CE2 
39   C CZ  . TYR A 43  ? 0.3297 0.4798 0.5862 -0.0066 -0.0767 0.0472  153 TYR A CZ  
40   O OH  . TYR A 43  ? 0.2561 0.4212 0.5182 -0.0117 -0.0918 0.0492  153 TYR A OH  
41   N N   . ALA A 44  ? 0.1797 0.2603 0.3976 0.0071  -0.0140 0.0159  154 ALA A N   
42   C CA  . ALA A 44  ? 0.1785 0.2499 0.3951 0.0106  -0.0053 0.0100  154 ALA A CA  
43   C C   . ALA A 44  ? 0.2052 0.2769 0.4422 0.0166  -0.0020 0.0116  154 ALA A C   
44   O O   . ALA A 44  ? 0.2061 0.2689 0.4424 0.0194  0.0019  0.0078  154 ALA A O   
45   C CB  . ALA A 44  ? 0.1943 0.2640 0.4048 0.0091  0.0012  0.0032  154 ALA A CB  
46   N N   . CYS A 45  ? 0.1464 0.2286 0.4039 0.0185  -0.0040 0.0168  155 CYS A N   
47   C CA  . CYS A 45  ? 0.1395 0.2226 0.4206 0.0253  -0.0003 0.0187  155 CYS A CA  
48   C C   . CYS A 45  ? 0.1889 0.2678 0.4767 0.0279  -0.0057 0.0271  155 CYS A C   
49   O O   . CYS A 45  ? 0.2076 0.2834 0.5157 0.0340  -0.0023 0.0283  155 CYS A O   
50   C CB  . CYS A 45  ? 0.1347 0.2322 0.4394 0.0269  -0.0004 0.0228  155 CYS A CB  
51   S SG  . CYS A 45  ? 0.1722 0.2849 0.4831 0.0224  -0.0160 0.0348  155 CYS A SG  
52   N N   . GLN A 46  ? 0.1633 0.2416 0.4349 0.0238  -0.0129 0.0330  156 GLN A N   
53   C CA  . GLN A 46  ? 0.1810 0.2549 0.4561 0.0256  -0.0167 0.0430  156 GLN A CA  
54   C C   . GLN A 46  ? 0.2154 0.2775 0.4733 0.0229  -0.0131 0.0383  156 GLN A C   
55   O O   . GLN A 46  ? 0.1922 0.2518 0.4470 0.0222  -0.0155 0.0470  156 GLN A O   
56   C CB  . GLN A 46  ? 0.2051 0.2901 0.4760 0.0237  -0.0275 0.0560  156 GLN A CB  
57   C CG  . GLN A 46  ? 0.2333 0.3315 0.5279 0.0272  -0.0336 0.0640  156 GLN A CG  
58   C CD  . GLN A 46  ? 0.3675 0.4771 0.6550 0.0252  -0.0464 0.0772  156 GLN A CD  
59   O OE1 . GLN A 46  ? 0.3108 0.4245 0.5741 0.0191  -0.0518 0.0747  156 GLN A OE1 
60   N NE2 . GLN A 46  ? 0.3036 0.4188 0.6122 0.0306  -0.0518 0.0911  156 GLN A NE2 
61   N N   . ARG A 47  ? 0.1755 0.2320 0.4230 0.0214  -0.0073 0.0257  157 ARG A N   
62   C CA  . ARG A 47  ? 0.1659 0.2134 0.4004 0.0189  -0.0045 0.0201  157 ARG A CA  
63   C C   . ARG A 47  ? 0.2133 0.2524 0.4532 0.0213  0.0013  0.0084  157 ARG A C   
64   O O   . ARG A 47  ? 0.1974 0.2386 0.4418 0.0240  0.0052  0.0026  157 ARG A O   
65   C CB  . ARG A 47  ? 0.1363 0.1863 0.3480 0.0143  -0.0053 0.0164  157 ARG A CB  
66   C CG  . ARG A 47  ? 0.1750 0.2322 0.3759 0.0115  -0.0108 0.0243  157 ARG A CG  
67   C CD  . ARG A 47  ? 0.1928 0.2488 0.3732 0.0078  -0.0098 0.0190  157 ARG A CD  
68   N NE  . ARG A 47  ? 0.1837 0.2392 0.3601 0.0066  -0.0075 0.0105  157 ARG A NE  
69   C CZ  . ARG A 47  ? 0.3278 0.3877 0.4984 0.0037  -0.0101 0.0090  157 ARG A CZ  
70   N NH1 . ARG A 47  ? 0.1687 0.2346 0.3349 0.0014  -0.0165 0.0137  157 ARG A NH1 
71   N NH2 . ARG A 47  ? 0.1544 0.2127 0.3237 0.0025  -0.0068 0.0030  157 ARG A NH2 
72   N N   . ARG A 48  ? 0.1921 0.2224 0.4315 0.0202  0.0022  0.0046  158 ARG A N   
73   C CA  . ARG A 48  ? 0.1959 0.2181 0.4358 0.0215  0.0059  -0.0086 158 ARG A CA  
74   C C   . ARG A 48  ? 0.2237 0.2468 0.4431 0.0179  0.0051  -0.0142 158 ARG A C   
75   O O   . ARG A 48  ? 0.2211 0.2451 0.4360 0.0147  0.0024  -0.0092 158 ARG A O   
76   C CB  . ARG A 48  ? 0.2104 0.2221 0.4681 0.0222  0.0057  -0.0099 158 ARG A CB  
77   C CG  . ARG A 48  ? 0.2272 0.2370 0.5081 0.0270  0.0068  -0.0029 158 ARG A CG  
78   C CD  . ARG A 48  ? 0.2853 0.2822 0.5876 0.0278  0.0073  -0.0039 158 ARG A CD  
79   N NE  . ARG A 48  ? 0.4018 0.3984 0.7272 0.0324  0.0072  0.0088  158 ARG A NE  
80   C CZ  . ARG A 48  ? 0.5176 0.5128 0.8600 0.0391  0.0108  0.0062  158 ARG A CZ  
81   N NH1 . ARG A 48  ? 0.3436 0.3371 0.6807 0.0419  0.0165  -0.0100 158 ARG A NH1 
82   N NH2 . ARG A 48  ? 0.3927 0.3886 0.7581 0.0435  0.0094  0.0204  158 ARG A NH2 
83   N N   . THR A 49  ? 0.1739 0.1984 0.3810 0.0189  0.0081  -0.0225 159 THR A N   
84   C CA  . THR A 49  ? 0.1622 0.1878 0.3508 0.0164  0.0071  -0.0259 159 THR A CA  
85   C C   . THR A 49  ? 0.1949 0.2156 0.3762 0.0179  0.0083  -0.0378 159 THR A C   
86   O O   . THR A 49  ? 0.1786 0.2000 0.3541 0.0207  0.0133  -0.0430 159 THR A O   
87   C CB  . THR A 49  ? 0.1896 0.2219 0.3677 0.0155  0.0085  -0.0217 159 THR A CB  
88   O OG1 . THR A 49  ? 0.2481 0.2854 0.4339 0.0145  0.0065  -0.0129 159 THR A OG1 
89   C CG2 . THR A 49  ? 0.1309 0.1633 0.2940 0.0130  0.0066  -0.0217 159 THR A CG2 
90   N N   . THR A 50  ? 0.1680 0.1845 0.3495 0.0156  0.0037  -0.0419 160 THR A N   
91   C CA  . THR A 50  ? 0.1796 0.1915 0.3536 0.0161  0.0020  -0.0545 160 THR A CA  
92   C C   . THR A 50  ? 0.2262 0.2427 0.3817 0.0146  -0.0018 -0.0548 160 THR A C   
93   O O   . THR A 50  ? 0.2055 0.2268 0.3589 0.0132  -0.0027 -0.0459 160 THR A O   
94   C CB  . THR A 50  ? 0.2765 0.2808 0.4679 0.0140  -0.0022 -0.0596 160 THR A CB  
95   O OG1 . THR A 50  ? 0.2619 0.2690 0.4636 0.0102  -0.0056 -0.0496 160 THR A OG1 
96   C CG2 . THR A 50  ? 0.2973 0.2946 0.5066 0.0169  0.0022  -0.0612 160 THR A CG2 
97   N N   . LEU A 51  ? 0.2146 0.2295 0.3567 0.0155  -0.0042 -0.0651 161 LEU A N   
98   C CA  . LEU A 51  ? 0.2120 0.2317 0.3356 0.0152  -0.0085 -0.0645 161 LEU A CA  
99   C C   . LEU A 51  ? 0.2753 0.2981 0.4069 0.0118  -0.0174 -0.0618 161 LEU A C   
100  O O   . LEU A 51  ? 0.2820 0.3101 0.4032 0.0122  -0.0209 -0.0578 161 LEU A O   
101  C CB  . LEU A 51  ? 0.2235 0.2416 0.3270 0.0177  -0.0085 -0.0761 161 LEU A CB  
102  C CG  . LEU A 51  ? 0.2593 0.2776 0.3530 0.0219  0.0029  -0.0760 161 LEU A CG  
103  C CD1 . LEU A 51  ? 0.2707 0.2864 0.3445 0.0248  0.0050  -0.0892 161 LEU A CD1 
104  C CD2 . LEU A 51  ? 0.2456 0.2699 0.3306 0.0223  0.0070  -0.0632 161 LEU A CD2 
105  N N   . ASN A 52  ? 0.2159 0.2363 0.3686 0.0087  -0.0200 -0.0621 162 ASN A N   
106  C CA  . ASN A 52  ? 0.2084 0.2335 0.3734 0.0053  -0.0262 -0.0577 162 ASN A CA  
107  C C   . ASN A 52  ? 0.2440 0.2735 0.4120 0.0059  -0.0207 -0.0446 162 ASN A C   
108  O O   . ASN A 52  ? 0.2576 0.2861 0.4395 0.0044  -0.0173 -0.0386 162 ASN A O   
109  C CB  . ASN A 52  ? 0.1623 0.1832 0.3507 0.0010  -0.0302 -0.0623 162 ASN A CB  
110  C CG  . ASN A 52  ? 0.3783 0.3920 0.5804 0.0013  -0.0234 -0.0591 162 ASN A CG  
111  O OD1 . ASN A 52  ? 0.3301 0.3407 0.5239 0.0050  -0.0174 -0.0595 162 ASN A OD1 
112  N ND2 . ASN A 52  ? 0.2292 0.2412 0.4542 -0.0023 -0.0238 -0.0540 162 ASN A ND2 
113  N N   . ASN A 53  ? 0.1858 0.2191 0.3393 0.0083  -0.0196 -0.0404 163 ASN A N   
114  C CA  . ASN A 53  ? 0.1757 0.2115 0.3297 0.0089  -0.0148 -0.0310 163 ASN A CA  
115  C C   . ASN A 53  ? 0.2127 0.2541 0.3782 0.0079  -0.0177 -0.0270 163 ASN A C   
116  O O   . ASN A 53  ? 0.2013 0.2468 0.3639 0.0092  -0.0228 -0.0275 163 ASN A O   
117  C CB  . ASN A 53  ? 0.1776 0.2130 0.3146 0.0117  -0.0117 -0.0284 163 ASN A CB  
118  C CG  . ASN A 53  ? 0.2666 0.3023 0.4038 0.0120  -0.0070 -0.0213 163 ASN A CG  
119  O OD1 . ASN A 53  ? 0.1707 0.2074 0.3167 0.0106  -0.0049 -0.0182 163 ASN A OD1 
120  N ND2 . ASN A 53  ? 0.2066 0.2408 0.3333 0.0137  -0.0049 -0.0188 163 ASN A ND2 
121  N N   . TYR A 54  ? 0.1653 0.2080 0.3442 0.0061  -0.0139 -0.0218 164 TYR A N   
122  C CA  . TYR A 54  ? 0.1713 0.2208 0.3645 0.0054  -0.0139 -0.0172 164 TYR A CA  
123  C C   . TYR A 54  ? 0.2410 0.2926 0.4273 0.0086  -0.0084 -0.0120 164 TYR A C   
124  O O   . TYR A 54  ? 0.2412 0.2990 0.4393 0.0094  -0.0066 -0.0083 164 TYR A O   
125  C CB  . TYR A 54  ? 0.1728 0.2228 0.3829 0.0022  -0.0103 -0.0127 164 TYR A CB  
126  C CG  . TYR A 54  ? 0.1970 0.2433 0.4198 -0.0014 -0.0156 -0.0180 164 TYR A CG  
127  C CD1 . TYR A 54  ? 0.2077 0.2462 0.4292 -0.0017 -0.0137 -0.0193 164 TYR A CD1 
128  C CD2 . TYR A 54  ? 0.2210 0.2714 0.4598 -0.0044 -0.0230 -0.0223 164 TYR A CD2 
129  C CE1 . TYR A 54  ? 0.2060 0.2386 0.4406 -0.0045 -0.0179 -0.0257 164 TYR A CE1 
130  C CE2 . TYR A 54  ? 0.2312 0.2762 0.4826 -0.0084 -0.0284 -0.0295 164 TYR A CE2 
131  C CZ  . TYR A 54  ? 0.2691 0.3041 0.5177 -0.0081 -0.0252 -0.0317 164 TYR A CZ  
132  O OH  . TYR A 54  ? 0.2973 0.3244 0.5595 -0.0114 -0.0296 -0.0401 164 TYR A OH  
133  N N   . ASN A 55  ? 0.1907 0.2371 0.3605 0.0104  -0.0052 -0.0122 165 ASN A N   
134  C CA  . ASN A 55  ? 0.1892 0.2346 0.3527 0.0128  0.0003  -0.0092 165 ASN A CA  
135  C C   . ASN A 55  ? 0.2073 0.2490 0.3598 0.0154  -0.0011 -0.0100 165 ASN A C   
136  O O   . ASN A 55  ? 0.1903 0.2274 0.3357 0.0163  0.0034  -0.0092 165 ASN A O   
137  C CB  . ASN A 55  ? 0.1836 0.2258 0.3400 0.0112  0.0055  -0.0078 165 ASN A CB  
138  C CG  . ASN A 55  ? 0.3167 0.3631 0.4829 0.0095  0.0086  -0.0038 165 ASN A CG  
139  O OD1 . ASN A 55  ? 0.2827 0.3328 0.4531 0.0107  0.0137  -0.0010 165 ASN A OD1 
140  N ND2 . ASN A 55  ? 0.1634 0.2092 0.3357 0.0070  0.0064  -0.0027 165 ASN A ND2 
141  N N   . GLN A 56  ? 0.2050 0.2486 0.3562 0.0166  -0.0075 -0.0112 166 GLN A N   
142  C CA  . GLN A 56  ? 0.2277 0.2682 0.3675 0.0193  -0.0088 -0.0094 166 GLN A CA  
143  C C   . GLN A 56  ? 0.3187 0.3572 0.4621 0.0228  -0.0053 -0.0047 166 GLN A C   
144  O O   . GLN A 56  ? 0.3149 0.3472 0.4501 0.0241  -0.0026 -0.0024 166 GLN A O   
145  C CB  . GLN A 56  ? 0.2534 0.2981 0.3890 0.0203  -0.0173 -0.0108 166 GLN A CB  
146  C CG  . GLN A 56  ? 0.4880 0.5287 0.6056 0.0218  -0.0167 -0.0094 166 GLN A CG  
147  C CD  . GLN A 56  ? 0.6604 0.7058 0.7683 0.0235  -0.0252 -0.0101 166 GLN A CD  
148  O OE1 . GLN A 56  ? 0.5632 0.6121 0.6716 0.0215  -0.0314 -0.0173 166 GLN A OE1 
149  N NE2 . GLN A 56  ? 0.5728 0.6174 0.6702 0.0270  -0.0258 -0.0029 166 GLN A NE2 
150  N N   . LEU A 57  ? 0.3043 0.3479 0.4621 0.0244  -0.0042 -0.0033 167 LEU A N   
151  C CA  . LEU A 57  ? 0.3316 0.3727 0.4956 0.0288  0.0008  -0.0002 167 LEU A CA  
152  C C   . LEU A 57  ? 0.3779 0.4089 0.5325 0.0277  0.0088  -0.0029 167 LEU A C   
153  O O   . LEU A 57  ? 0.4046 0.4277 0.5567 0.0300  0.0113  -0.0015 167 LEU A O   
154  C CB  . LEU A 57  ? 0.3396 0.3896 0.5225 0.0306  0.0028  0.0010  167 LEU A CB  
155  C CG  . LEU A 57  ? 0.4242 0.4767 0.6214 0.0372  0.0042  0.0054  167 LEU A CG  
156  C CD1 . LEU A 57  ? 0.4389 0.4943 0.6367 0.0401  -0.0061 0.0107  167 LEU A CD1 
157  C CD2 . LEU A 57  ? 0.4533 0.5168 0.6718 0.0385  0.0076  0.0066  167 LEU A CD2 
158  N N   . PHE A 58  ? 0.2918 0.3228 0.4412 0.0236  0.0115  -0.0064 168 PHE A N   
159  C CA  . PHE A 58  ? 0.2567 0.2804 0.3965 0.0214  0.0165  -0.0099 168 PHE A CA  
160  C C   . PHE A 58  ? 0.2719 0.2903 0.4027 0.0186  0.0141  -0.0103 168 PHE A C   
161  O O   . PHE A 58  ? 0.2436 0.2541 0.3710 0.0180  0.0168  -0.0118 168 PHE A O   
162  C CB  . PHE A 58  ? 0.2608 0.2887 0.3981 0.0184  0.0189  -0.0114 168 PHE A CB  
163  C CG  . PHE A 58  ? 0.2488 0.2832 0.3960 0.0208  0.0235  -0.0097 168 PHE A CG  
164  C CD1 . PHE A 58  ? 0.2748 0.3176 0.4328 0.0195  0.0211  -0.0063 168 PHE A CD1 
165  C CD2 . PHE A 58  ? 0.2644 0.2964 0.4126 0.0245  0.0310  -0.0119 168 PHE A CD2 
166  C CE1 . PHE A 58  ? 0.2788 0.3292 0.4498 0.0211  0.0264  -0.0034 168 PHE A CE1 
167  C CE2 . PHE A 58  ? 0.2998 0.3396 0.4592 0.0271  0.0373  -0.0097 168 PHE A CE2 
168  C CZ  . PHE A 58  ? 0.2610 0.3108 0.4326 0.0252  0.0350  -0.0046 168 PHE A CZ  
169  N N   . THR A 59  ? 0.2209 0.2435 0.3496 0.0167  0.0098  -0.0095 169 THR A N   
170  C CA  . THR A 59  ? 0.2111 0.2309 0.3332 0.0142  0.0094  -0.0096 169 THR A CA  
171  C C   . THR A 59  ? 0.2160 0.2314 0.3350 0.0162  0.0097  -0.0057 169 THR A C   
172  O O   . THR A 59  ? 0.1674 0.1783 0.2839 0.0139  0.0123  -0.0049 169 THR A O   
173  C CB  . THR A 59  ? 0.2850 0.3098 0.4067 0.0126  0.0068  -0.0109 169 THR A CB  
174  O OG1 . THR A 59  ? 0.2329 0.2608 0.3543 0.0148  0.0030  -0.0107 169 THR A OG1 
175  C CG2 . THR A 59  ? 0.2344 0.2627 0.3609 0.0108  0.0066  -0.0121 169 THR A CG2 
176  N N   . ASP A 60  ? 0.1864 0.2038 0.3069 0.0202  0.0068  -0.0021 170 ASP A N   
177  C CA  . ASP A 60  ? 0.2040 0.2171 0.3207 0.0227  0.0070  0.0043  170 ASP A CA  
178  C C   . ASP A 60  ? 0.2638 0.2669 0.3857 0.0228  0.0121  0.0056  170 ASP A C   
179  O O   . ASP A 60  ? 0.2619 0.2587 0.3817 0.0214  0.0150  0.0096  170 ASP A O   
180  C CB  . ASP A 60  ? 0.2402 0.2587 0.3583 0.0274  0.0011  0.0088  170 ASP A CB  
181  C CG  . ASP A 60  ? 0.3575 0.3833 0.4659 0.0271  -0.0048 0.0075  170 ASP A CG  
182  O OD1 . ASP A 60  ? 0.3568 0.3824 0.4580 0.0239  -0.0025 0.0033  170 ASP A OD1 
183  O OD2 . ASP A 60  ? 0.4611 0.4930 0.5702 0.0300  -0.0120 0.0098  170 ASP A OD2 
184  N N   . ALA A 61  ? 0.2327 0.2338 0.3620 0.0240  0.0142  0.0015  171 ALA A N   
185  C CA  . ALA A 61  ? 0.2326 0.2227 0.3669 0.0243  0.0193  -0.0006 171 ALA A CA  
186  C C   . ALA A 61  ? 0.2801 0.2650 0.4099 0.0179  0.0213  -0.0058 171 ALA A C   
187  O O   . ALA A 61  ? 0.2842 0.2594 0.4171 0.0162  0.0237  -0.0044 171 ALA A O   
188  C CB  . ALA A 61  ? 0.2325 0.2234 0.3734 0.0276  0.0223  -0.0053 171 ALA A CB  
189  N N   . LEU A 62  ? 0.2463 0.2382 0.3709 0.0141  0.0195  -0.0106 172 LEU A N   
190  C CA  . LEU A 62  ? 0.2467 0.2372 0.3687 0.0080  0.0192  -0.0148 172 LEU A CA  
191  C C   . LEU A 62  ? 0.2843 0.2746 0.4083 0.0052  0.0193  -0.0097 172 LEU A C   
192  O O   . LEU A 62  ? 0.2689 0.2541 0.3971 0.0004  0.0202  -0.0116 172 LEU A O   
193  C CB  . LEU A 62  ? 0.2396 0.2393 0.3572 0.0059  0.0165  -0.0181 172 LEU A CB  
194  C CG  . LEU A 62  ? 0.3003 0.3010 0.4144 0.0075  0.0182  -0.0224 172 LEU A CG  
195  C CD1 . LEU A 62  ? 0.3124 0.3226 0.4232 0.0060  0.0156  -0.0216 172 LEU A CD1 
196  C CD2 . LEU A 62  ? 0.3132 0.3049 0.4231 0.0055  0.0204  -0.0301 172 LEU A CD2 
197  N N   . ASP A 63  ? 0.2431 0.2391 0.3642 0.0080  0.0187  -0.0038 173 ASP A N   
198  C CA  . ASP A 63  ? 0.2392 0.2362 0.3598 0.0065  0.0211  0.0020  173 ASP A CA  
199  C C   . ASP A 63  ? 0.2893 0.2761 0.4143 0.0066  0.0248  0.0085  173 ASP A C   
200  O O   . ASP A 63  ? 0.2915 0.2761 0.4214 0.0027  0.0284  0.0120  173 ASP A O   
201  C CB  . ASP A 63  ? 0.2505 0.2552 0.3626 0.0102  0.0197  0.0050  173 ASP A CB  
202  C CG  . ASP A 63  ? 0.3409 0.3539 0.4521 0.0094  0.0173  -0.0008 173 ASP A CG  
203  O OD1 . ASP A 63  ? 0.3331 0.3475 0.4499 0.0059  0.0169  -0.0046 173 ASP A OD1 
204  O OD2 . ASP A 63  ? 0.3241 0.3417 0.4292 0.0123  0.0152  -0.0014 173 ASP A OD2 
205  N N   . ILE A 64  ? 0.2711 0.2520 0.3973 0.0113  0.0243  0.0110  174 ILE A N   
206  C CA  . ILE A 64  ? 0.2629 0.2321 0.3960 0.0126  0.0278  0.0183  174 ILE A CA  
207  C C   . ILE A 64  ? 0.2833 0.2416 0.4268 0.0068  0.0303  0.0116  174 ILE A C   
208  O O   . ILE A 64  ? 0.2749 0.2253 0.4266 0.0032  0.0339  0.0168  174 ILE A O   
209  C CB  . ILE A 64  ? 0.3032 0.2699 0.4385 0.0201  0.0259  0.0224  174 ILE A CB  
210  C CG1 . ILE A 64  ? 0.3153 0.2922 0.4406 0.0249  0.0217  0.0307  174 ILE A CG1 
211  C CG2 . ILE A 64  ? 0.3079 0.2593 0.4552 0.0220  0.0299  0.0278  174 ILE A CG2 
212  C CD1 . ILE A 64  ? 0.3001 0.2810 0.4293 0.0316  0.0169  0.0325  174 ILE A CD1 
213  N N   . LEU A 65  ? 0.2404 0.1985 0.3832 0.0055  0.0283  0.0000  175 LEU A N   
214  C CA  . LEU A 65  ? 0.2618 0.2100 0.4106 -0.0001 0.0289  -0.0095 175 LEU A CA  
215  C C   . LEU A 65  ? 0.3131 0.2658 0.4658 -0.0084 0.0274  -0.0104 175 LEU A C   
216  O O   . LEU A 65  ? 0.3218 0.2648 0.4854 -0.0141 0.0284  -0.0126 175 LEU A O   
217  C CB  . LEU A 65  ? 0.2630 0.2122 0.4050 0.0012  0.0275  -0.0213 175 LEU A CB  
218  C CG  . LEU A 65  ? 0.3036 0.2479 0.4473 0.0093  0.0309  -0.0214 175 LEU A CG  
219  C CD1 . LEU A 65  ? 0.3027 0.2535 0.4377 0.0110  0.0311  -0.0300 175 LEU A CD1 
220  C CD2 . LEU A 65  ? 0.3674 0.2937 0.5222 0.0106  0.0354  -0.0235 175 LEU A CD2 
221  N N   . ALA A 66  ? 0.2740 0.2410 0.4210 -0.0089 0.0251  -0.0084 176 ALA A N   
222  C CA  . ALA A 66  ? 0.2751 0.2494 0.4291 -0.0154 0.0242  -0.0078 176 ALA A CA  
223  C C   . ALA A 66  ? 0.3469 0.3178 0.5108 -0.0173 0.0301  0.0027  176 ALA A C   
224  O O   . ALA A 66  ? 0.3463 0.3154 0.5243 -0.0246 0.0308  0.0024  176 ALA A O   
225  C CB  . ALA A 66  ? 0.2705 0.2596 0.4181 -0.0135 0.0219  -0.0071 176 ALA A CB  
226  N N   . GLU A 67  ? 0.2956 0.2661 0.4526 -0.0111 0.0341  0.0125  177 GLU A N   
227  C CA  . GLU A 67  ? 0.3143 0.2822 0.4762 -0.0115 0.0410  0.0252  177 GLU A CA  
228  C C   . GLU A 67  ? 0.3880 0.3398 0.5653 -0.0155 0.0437  0.0279  177 GLU A C   
229  O O   . GLU A 67  ? 0.3910 0.3410 0.5817 -0.0211 0.0487  0.0347  177 GLU A O   
230  C CB  . GLU A 67  ? 0.3361 0.3071 0.4829 -0.0033 0.0423  0.0342  177 GLU A CB  
231  C CG  . GLU A 67  ? 0.5503 0.5230 0.6949 -0.0029 0.0498  0.0484  177 GLU A CG  
232  C CD  . GLU A 67  ? 0.8438 0.8252 0.9678 0.0042  0.0497  0.0541  177 GLU A CD  
233  O OE1 . GLU A 67  ? 0.9301 0.9195 1.0474 0.0040  0.0560  0.0595  177 GLU A OE1 
234  O OE2 . GLU A 67  ? 0.6519 0.6324 0.7670 0.0099  0.0436  0.0532  177 GLU A OE2 
235  N N   . ASN A 68  ? 0.3501 0.2902 0.5278 -0.0127 0.0411  0.0219  178 ASN A N   
236  C CA  . ASN A 68  ? 0.3590 0.2809 0.5522 -0.0157 0.0434  0.0214  178 ASN A CA  
237  C C   . ASN A 68  ? 0.4367 0.3559 0.6435 -0.0264 0.0409  0.0107  178 ASN A C   
238  O O   . ASN A 68  ? 0.4414 0.3505 0.6662 -0.0326 0.0444  0.0149  178 ASN A O   
239  C CB  . ASN A 68  ? 0.3246 0.2362 0.5147 -0.0091 0.0418  0.0149  178 ASN A CB  
240  C CG  . ASN A 68  ? 0.5080 0.3985 0.7152 -0.0103 0.0454  0.0147  178 ASN A CG  
241  O OD1 . ASN A 68  ? 0.4957 0.3754 0.7068 -0.0122 0.0440  0.0000  178 ASN A OD1 
242  N ND2 . ASN A 68  ? 0.3108 0.1942 0.5278 -0.0094 0.0505  0.0310  178 ASN A ND2 
243  N N   . ASP A 69  ? 0.3984 0.3274 0.5975 -0.0290 0.0344  -0.0021 179 ASP A N   
244  C CA  . ASP A 69  ? 0.4118 0.3417 0.6221 -0.0392 0.0293  -0.0124 179 ASP A CA  
245  C C   . ASP A 69  ? 0.4877 0.4277 0.7137 -0.0457 0.0319  -0.0030 179 ASP A C   
246  O O   . ASP A 69  ? 0.4980 0.4348 0.7426 -0.0553 0.0294  -0.0074 179 ASP A O   
247  C CB  . ASP A 69  ? 0.4202 0.3611 0.6165 -0.0393 0.0213  -0.0247 179 ASP A CB  
248  C CG  . ASP A 69  ? 0.4903 0.4211 0.6740 -0.0354 0.0195  -0.0366 179 ASP A CG  
249  O OD1 . ASP A 69  ? 0.4776 0.3906 0.6682 -0.0352 0.0228  -0.0401 179 ASP A OD1 
250  O OD2 . ASP A 69  ? 0.6063 0.5467 0.7745 -0.0324 0.0157  -0.0420 179 ASP A OD2 
251  N N   . GLU A 70  ? 0.4546 0.4070 0.6743 -0.0407 0.0371  0.0090  180 GLU A N   
252  C CA  . GLU A 70  ? 0.4648 0.4280 0.6985 -0.0450 0.0429  0.0192  180 GLU A CA  
253  C C   . GLU A 70  ? 0.5417 0.4919 0.7918 -0.0486 0.0509  0.0306  180 GLU A C   
254  O O   . GLU A 70  ? 0.5500 0.5014 0.8236 -0.0577 0.0529  0.0330  180 GLU A O   
255  C CB  . GLU A 70  ? 0.4768 0.4542 0.6947 -0.0372 0.0475  0.0270  180 GLU A CB  
256  C CG  . GLU A 70  ? 0.6854 0.6776 0.9160 -0.0404 0.0540  0.0342  180 GLU A CG  
257  C CD  . GLU A 70  ? 1.1238 1.1257 1.3369 -0.0321 0.0612  0.0417  180 GLU A CD  
258  O OE1 . GLU A 70  ? 1.1732 1.1866 1.3788 -0.0287 0.0581  0.0355  180 GLU A OE1 
259  O OE2 . GLU A 70  ? 1.1163 1.1135 1.3219 -0.0287 0.0694  0.0536  180 GLU A OE2 
260  N N   . LEU A 71  ? 0.5123 0.4499 0.7529 -0.0416 0.0548  0.0379  181 LEU A N   
261  C CA  . LEU A 71  ? 0.5292 0.4517 0.7843 -0.0433 0.0623  0.0510  181 LEU A CA  
262  C C   . LEU A 71  ? 0.5810 0.4865 0.8596 -0.0526 0.0591  0.0413  181 LEU A C   
263  O O   . LEU A 71  ? 0.6041 0.5025 0.9059 -0.0598 0.0649  0.0503  181 LEU A O   
264  C CB  . LEU A 71  ? 0.5394 0.4532 0.7781 -0.0323 0.0642  0.0596  181 LEU A CB  
265  C CG  . LEU A 71  ? 0.6205 0.5152 0.8730 -0.0315 0.0704  0.0735  181 LEU A CG  
266  C CD1 . LEU A 71  ? 0.6337 0.5325 0.8955 -0.0350 0.0809  0.0934  181 LEU A CD1 
267  C CD2 . LEU A 71  ? 0.6556 0.5449 0.8927 -0.0198 0.0689  0.0794  181 LEU A CD2 
268  N N   . ARG A 72  ? 0.5281 0.4269 0.8006 -0.0527 0.0503  0.0228  182 ARG A N   
269  C CA  . ARG A 72  ? 0.5411 0.4224 0.8312 -0.0610 0.0459  0.0090  182 ARG A CA  
270  C C   . ARG A 72  ? 0.5833 0.4755 0.8879 -0.0733 0.0386  -0.0015 182 ARG A C   
271  O O   . ARG A 72  ? 0.5932 0.4737 0.9098 -0.0816 0.0322  -0.0164 182 ARG A O   
272  C CB  . ARG A 72  ? 0.5458 0.4164 0.8196 -0.0548 0.0410  -0.0069 182 ARG A CB  
273  C CG  . ARG A 72  ? 0.6877 0.5474 0.9541 -0.0429 0.0471  0.0028  182 ARG A CG  
274  C CD  . ARG A 72  ? 0.8872 0.7201 1.1721 -0.0437 0.0506  0.0001  182 ARG A CD  
275  N N   . GLU A 73  ? 0.5181 0.4329 0.8220 -0.0742 0.0392  0.0058  183 GLU A N   
276  C CA  . GLU A 73  ? 0.5147 0.4451 0.8351 -0.0842 0.0324  -0.0001 183 GLU A CA  
277  C C   . GLU A 73  ? 0.5545 0.4882 0.8626 -0.0866 0.0183  -0.0205 183 GLU A C   
278  O O   . GLU A 73  ? 0.5542 0.4944 0.8786 -0.0970 0.0091  -0.0294 183 GLU A O   
279  C CB  . GLU A 73  ? 0.5523 0.4752 0.9085 -0.0968 0.0349  0.0037  183 GLU A CB  
280  C CG  . GLU A 73  ? 0.7372 0.6643 1.1079 -0.0962 0.0494  0.0263  183 GLU A CG  
281  C CD  . GLU A 73  ? 0.9556 0.8767 1.3658 -0.1097 0.0524  0.0312  183 GLU A CD  
282  O OE1 . GLU A 73  ? 0.8753 0.7726 1.2978 -0.1132 0.0542  0.0307  183 GLU A OE1 
283  O OE2 . GLU A 73  ? 0.9082 0.8484 1.3400 -0.1169 0.0528  0.0351  183 GLU A OE2 
284  N N   . ASN A 74  ? 0.4972 0.4278 0.7770 -0.0771 0.0165  -0.0270 184 ASN A N   
285  C CA  . ASN A 74  ? 0.4875 0.4223 0.7506 -0.0777 0.0051  -0.0438 184 ASN A CA  
286  C C   . ASN A 74  ? 0.5142 0.4720 0.7646 -0.0727 0.0023  -0.0390 184 ASN A C   
287  O O   . ASN A 74  ? 0.5094 0.4696 0.7380 -0.0631 0.0045  -0.0374 184 ASN A O   
288  C CB  . ASN A 74  ? 0.4606 0.3782 0.7039 -0.0708 0.0064  -0.0535 184 ASN A CB  
289  C CG  . ASN A 74  ? 0.6940 0.6127 0.9196 -0.0727 -0.0038 -0.0721 184 ASN A CG  
290  O OD1 . ASN A 74  ? 0.4915 0.4277 0.7110 -0.0756 -0.0128 -0.0751 184 ASN A OD1 
291  N ND2 . ASN A 74  ? 0.6337 0.5338 0.8499 -0.0703 -0.0021 -0.0845 184 ASN A ND2 
292  N N   . GLU A 75  ? 0.4613 0.4358 0.7294 -0.0794 -0.0022 -0.0359 185 GLU A N   
293  C CA  . GLU A 75  ? 0.4324 0.4289 0.6973 -0.0756 -0.0044 -0.0302 185 GLU A CA  
294  C C   . GLU A 75  ? 0.4620 0.4638 0.7025 -0.0712 -0.0138 -0.0395 185 GLU A C   
295  O O   . GLU A 75  ? 0.4386 0.4495 0.6663 -0.0630 -0.0113 -0.0337 185 GLU A O   
296  C CB  . GLU A 75  ? 0.4459 0.4579 0.7409 -0.0849 -0.0089 -0.0273 185 GLU A CB  
297  C CG  . GLU A 75  ? 0.5916 0.6267 0.8907 -0.0814 -0.0114 -0.0215 185 GLU A CG  
298  C CD  . GLU A 75  ? 0.8214 0.8726 1.1528 -0.0914 -0.0194 -0.0213 185 GLU A CD  
299  O OE1 . GLU A 75  ? 0.5170 0.5735 0.8752 -0.0951 -0.0103 -0.0117 185 GLU A OE1 
300  O OE2 . GLU A 75  ? 0.7928 0.8515 1.1232 -0.0960 -0.0348 -0.0306 185 GLU A OE2 
301  N N   . GLY A 76  ? 0.4200 0.4156 0.6540 -0.0769 -0.0241 -0.0536 186 GLY A N   
302  C CA  . GLY A 76  ? 0.4145 0.4148 0.6235 -0.0736 -0.0325 -0.0619 186 GLY A CA  
303  C C   . GLY A 76  ? 0.4368 0.4289 0.6212 -0.0631 -0.0248 -0.0613 186 GLY A C   
304  O O   . GLY A 76  ? 0.4341 0.4367 0.6046 -0.0569 -0.0258 -0.0573 186 GLY A O   
305  N N   . SER A 77  ? 0.3849 0.3583 0.5669 -0.0610 -0.0170 -0.0644 187 SER A N   
306  C CA  . SER A 77  ? 0.3703 0.3361 0.5339 -0.0511 -0.0095 -0.0636 187 SER A CA  
307  C C   . SER A 77  ? 0.4101 0.3848 0.5751 -0.0438 -0.0026 -0.0488 187 SER A C   
308  O O   . SER A 77  ? 0.3696 0.3483 0.5197 -0.0365 -0.0006 -0.0467 187 SER A O   
309  C CB  . SER A 77  ? 0.4315 0.3759 0.5979 -0.0504 -0.0033 -0.0694 187 SER A CB  
310  O OG  . SER A 77  ? 0.5660 0.5048 0.7165 -0.0409 0.0029  -0.0702 187 SER A OG  
311  N N   . CYS A 78  ? 0.3840 0.3624 0.5669 -0.0463 0.0011  -0.0390 188 CYS A N   
312  C CA  . CYS A 78  ? 0.3707 0.3575 0.5535 -0.0401 0.0077  -0.0266 188 CYS A CA  
313  C C   . CYS A 78  ? 0.4224 0.4251 0.5980 -0.0372 0.0031  -0.0259 188 CYS A C   
314  O O   . CYS A 78  ? 0.4096 0.4145 0.5731 -0.0299 0.0058  -0.0228 188 CYS A O   
315  C CB  . CYS A 78  ? 0.3707 0.3598 0.5731 -0.0440 0.0133  -0.0172 188 CYS A CB  
316  S SG  . CYS A 78  ? 0.4040 0.4035 0.6021 -0.0363 0.0223  -0.0041 188 CYS A SG  
317  N N   . LEU A 79  ? 0.3700 0.3834 0.5547 -0.0430 -0.0047 -0.0288 189 LEU A N   
318  C CA  . LEU A 79  ? 0.3541 0.3823 0.5361 -0.0406 -0.0101 -0.0268 189 LEU A CA  
319  C C   . LEU A 79  ? 0.3492 0.3754 0.5092 -0.0358 -0.0131 -0.0311 189 LEU A C   
320  O O   . LEU A 79  ? 0.3103 0.3429 0.4653 -0.0300 -0.0116 -0.0260 189 LEU A O   
321  C CB  . LEU A 79  ? 0.3749 0.4149 0.5726 -0.0481 -0.0199 -0.0288 189 LEU A CB  
322  C CG  . LEU A 79  ? 0.4708 0.5277 0.6717 -0.0455 -0.0263 -0.0244 189 LEU A CG  
323  C CD1 . LEU A 79  ? 0.4838 0.5475 0.6941 -0.0390 -0.0172 -0.0151 189 LEU A CD1 
324  C CD2 . LEU A 79  ? 0.5393 0.6088 0.7592 -0.0534 -0.0375 -0.0257 189 LEU A CD2 
325  N N   . ALA A 80  ? 0.2938 0.3107 0.4415 -0.0381 -0.0163 -0.0405 190 ALA A N   
326  C CA  . ALA A 80  ? 0.2953 0.3108 0.4221 -0.0336 -0.0168 -0.0441 190 ALA A CA  
327  C C   . ALA A 80  ? 0.3324 0.3435 0.4539 -0.0256 -0.0078 -0.0390 190 ALA A C   
328  O O   . ALA A 80  ? 0.3228 0.3402 0.4363 -0.0213 -0.0077 -0.0354 190 ALA A O   
329  C CB  . ALA A 80  ? 0.3262 0.3314 0.4408 -0.0370 -0.0194 -0.0565 190 ALA A CB  
330  N N   . PHE A 81  ? 0.2816 0.2827 0.4091 -0.0240 -0.0010 -0.0375 191 PHE A N   
331  C CA  . PHE A 81  ? 0.2668 0.2655 0.3907 -0.0167 0.0054  -0.0322 191 PHE A CA  
332  C C   . PHE A 81  ? 0.3372 0.3461 0.4655 -0.0140 0.0060  -0.0242 191 PHE A C   
333  O O   . PHE A 81  ? 0.3284 0.3399 0.4515 -0.0090 0.0075  -0.0217 191 PHE A O   
334  C CB  . PHE A 81  ? 0.2815 0.2679 0.4106 -0.0151 0.0111  -0.0309 191 PHE A CB  
335  C CG  . PHE A 81  ? 0.3105 0.2838 0.4360 -0.0148 0.0131  -0.0392 191 PHE A CG  
336  C CD1 . PHE A 81  ? 0.3376 0.3107 0.4519 -0.0103 0.0147  -0.0440 191 PHE A CD1 
337  C CD2 . PHE A 81  ? 0.3436 0.3040 0.4789 -0.0184 0.0148  -0.0418 191 PHE A CD2 
338  C CE1 . PHE A 81  ? 0.3593 0.3200 0.4706 -0.0089 0.0184  -0.0529 191 PHE A CE1 
339  C CE2 . PHE A 81  ? 0.3837 0.3299 0.5172 -0.0175 0.0174  -0.0511 191 PHE A CE2 
340  C CZ  . PHE A 81  ? 0.3571 0.3037 0.4779 -0.0123 0.0196  -0.0572 191 PHE A CZ  
341  N N   . MET A 82  ? 0.3213 0.3362 0.4610 -0.0173 0.0053  -0.0207 192 MET A N   
342  C CA  . MET A 82  ? 0.2991 0.3227 0.4428 -0.0140 0.0073  -0.0150 192 MET A CA  
343  C C   . MET A 82  ? 0.3099 0.3418 0.4513 -0.0122 0.0028  -0.0150 192 MET A C   
344  O O   . MET A 82  ? 0.3080 0.3423 0.4480 -0.0077 0.0048  -0.0127 192 MET A O   
345  C CB  . MET A 82  ? 0.3312 0.3605 0.4895 -0.0173 0.0096  -0.0113 192 MET A CB  
346  C CG  . MET A 82  ? 0.3862 0.4089 0.5464 -0.0172 0.0170  -0.0068 192 MET A CG  
347  S SD  . MET A 82  ? 0.4487 0.4808 0.6268 -0.0201 0.0231  -0.0004 192 MET A SD  
348  C CE  . MET A 82  ? 0.4153 0.4527 0.6110 -0.0288 0.0148  -0.0047 192 MET A CE  
349  N N   . ARG A 83  ? 0.2483 0.2841 0.3891 -0.0158 -0.0037 -0.0176 193 ARG A N   
350  C CA  . ARG A 83  ? 0.2412 0.2849 0.3800 -0.0141 -0.0085 -0.0151 193 ARG A CA  
351  C C   . ARG A 83  ? 0.2501 0.2897 0.3759 -0.0103 -0.0064 -0.0154 193 ARG A C   
352  O O   . ARG A 83  ? 0.2316 0.2751 0.3591 -0.0071 -0.0063 -0.0110 193 ARG A O   
353  C CB  . ARG A 83  ? 0.2582 0.3084 0.3976 -0.0191 -0.0174 -0.0166 193 ARG A CB  
354  C CG  . ARG A 83  ? 0.3885 0.4476 0.5476 -0.0227 -0.0206 -0.0143 193 ARG A CG  
355  C CD  . ARG A 83  ? 0.5207 0.5883 0.6821 -0.0280 -0.0320 -0.0157 193 ARG A CD  
356  N NE  . ARG A 83  ? 0.7393 0.8180 0.9251 -0.0312 -0.0351 -0.0122 193 ARG A NE  
357  C CZ  . ARG A 83  ? 0.9863 1.0748 1.1812 -0.0371 -0.0463 -0.0133 193 ARG A CZ  
358  N NH1 . ARG A 83  ? 0.8395 0.9398 1.0613 -0.0395 -0.0479 -0.0092 193 ARG A NH1 
359  N NH2 . ARG A 83  ? 0.8676 0.9553 1.0451 -0.0407 -0.0559 -0.0188 193 ARG A NH2 
360  N N   . ALA A 84  ? 0.2050 0.2364 0.3208 -0.0106 -0.0038 -0.0203 194 ALA A N   
361  C CA  . ALA A 84  ? 0.1867 0.2154 0.2934 -0.0068 -0.0001 -0.0204 194 ALA A CA  
362  C C   . ALA A 84  ? 0.2112 0.2394 0.3243 -0.0026 0.0037  -0.0169 194 ALA A C   
363  O O   . ALA A 84  ? 0.2031 0.2344 0.3167 -0.0002 0.0044  -0.0138 194 ALA A O   
364  C CB  . ALA A 84  ? 0.2063 0.2261 0.3046 -0.0071 0.0030  -0.0274 194 ALA A CB  
365  N N   . SER A 85  ? 0.1922 0.2164 0.3098 -0.0022 0.0058  -0.0170 195 SER A N   
366  C CA  . SER A 85  ? 0.1883 0.2124 0.3085 0.0015  0.0080  -0.0145 195 SER A CA  
367  C C   . SER A 85  ? 0.2109 0.2412 0.3366 0.0024  0.0063  -0.0125 195 SER A C   
368  O O   . SER A 85  ? 0.2134 0.2448 0.3406 0.0047  0.0061  -0.0119 195 SER A O   
369  C CB  . SER A 85  ? 0.2151 0.2349 0.3364 0.0017  0.0105  -0.0134 195 SER A CB  
370  O OG  . SER A 85  ? 0.3283 0.3489 0.4481 0.0054  0.0112  -0.0114 195 SER A OG  
371  N N   . SER A 86  ? 0.1629 0.1973 0.2943 0.0004  0.0051  -0.0116 196 SER A N   
372  C CA  . SER A 86  ? 0.1382 0.1777 0.2781 0.0020  0.0043  -0.0099 196 SER A CA  
373  C C   . SER A 86  ? 0.1925 0.2336 0.3340 0.0029  0.0018  -0.0074 196 SER A C   
374  O O   . SER A 86  ? 0.1827 0.2231 0.3296 0.0053  0.0024  -0.0074 196 SER A O   
375  C CB  . SER A 86  ? 0.1790 0.2243 0.3284 -0.0001 0.0031  -0.0083 196 SER A CB  
376  O OG  . SER A 86  ? 0.2190 0.2685 0.3792 0.0027  0.0040  -0.0068 196 SER A OG  
377  N N   . VAL A 87  ? 0.1715 0.2144 0.3078 0.0009  -0.0009 -0.0054 197 VAL A N   
378  C CA  . VAL A 87  ? 0.1947 0.2400 0.3319 0.0019  -0.0021 -0.0004 197 VAL A CA  
379  C C   . VAL A 87  ? 0.2504 0.2923 0.3873 0.0035  0.0014  -0.0010 197 VAL A C   
380  O O   . VAL A 87  ? 0.2590 0.3013 0.4046 0.0045  0.0015  0.0025  197 VAL A O   
381  C CB  . VAL A 87  ? 0.2731 0.3224 0.4008 -0.0003 -0.0056 0.0026  197 VAL A CB  
382  C CG1 . VAL A 87  ? 0.2834 0.3288 0.3967 -0.0015 -0.0029 -0.0026 197 VAL A CG1 
383  C CG2 . VAL A 87  ? 0.2758 0.3287 0.4059 0.0010  -0.0065 0.0112  197 VAL A CG2 
384  N N   . LEU A 88  ? 0.1909 0.2293 0.3213 0.0039  0.0040  -0.0051 198 LEU A N   
385  C CA  . LEU A 88  ? 0.1771 0.2149 0.3110 0.0055  0.0063  -0.0051 198 LEU A CA  
386  C C   . LEU A 88  ? 0.1991 0.2360 0.3417 0.0066  0.0044  -0.0070 198 LEU A C   
387  O O   . LEU A 88  ? 0.1767 0.2146 0.3280 0.0067  0.0040  -0.0059 198 LEU A O   
388  C CB  . LEU A 88  ? 0.1724 0.2073 0.3002 0.0067  0.0091  -0.0082 198 LEU A CB  
389  C CG  . LEU A 88  ? 0.2335 0.2673 0.3512 0.0060  0.0119  -0.0095 198 LEU A CG  
390  C CD1 . LEU A 88  ? 0.2514 0.2808 0.3677 0.0084  0.0157  -0.0130 198 LEU A CD1 
391  C CD2 . LEU A 88  ? 0.2894 0.3279 0.4052 0.0059  0.0146  -0.0050 198 LEU A CD2 
392  N N   . LYS A 89  ? 0.1555 0.1907 0.2963 0.0070  0.0036  -0.0101 199 LYS A N   
393  C CA  . LYS A 89  ? 0.1407 0.1747 0.2853 0.0084  0.0024  -0.0140 199 LYS A CA  
394  C C   . LYS A 89  ? 0.2058 0.2395 0.3622 0.0083  0.0013  -0.0135 199 LYS A C   
395  O O   . LYS A 89  ? 0.2074 0.2389 0.3689 0.0087  -0.0003 -0.0180 199 LYS A O   
396  C CB  . LYS A 89  ? 0.1541 0.1873 0.2930 0.0093  0.0042  -0.0165 199 LYS A CB  
397  C CG  . LYS A 89  ? 0.1886 0.2203 0.3177 0.0097  0.0053  -0.0162 199 LYS A CG  
398  C CD  . LYS A 89  ? 0.2158 0.2471 0.3399 0.0102  0.0088  -0.0163 199 LYS A CD  
399  C CE  . LYS A 89  ? 0.2337 0.2622 0.3499 0.0108  0.0097  -0.0136 199 LYS A CE  
400  N NZ  . LYS A 89  ? 0.3014 0.3293 0.4148 0.0101  0.0145  -0.0109 199 LYS A NZ  
401  N N   . SER A 90  ? 0.1660 0.2016 0.3273 0.0076  0.0015  -0.0078 200 SER A N   
402  C CA  . SER A 90  ? 0.1683 0.2028 0.3434 0.0081  0.0008  -0.0046 200 SER A CA  
403  C C   . SER A 90  ? 0.2085 0.2424 0.3915 0.0066  0.0007  0.0000  200 SER A C   
404  O O   . SER A 90  ? 0.1902 0.2212 0.3876 0.0066  0.0003  0.0030  200 SER A O   
405  C CB  . SER A 90  ? 0.2064 0.2447 0.3841 0.0085  -0.0001 0.0020  200 SER A CB  
406  O OG  . SER A 90  ? 0.2362 0.2782 0.4072 0.0068  -0.0010 0.0092  200 SER A OG  
407  N N   . LEU A 91  ? 0.1940 0.2306 0.3702 0.0054  0.0020  0.0016  201 LEU A N   
408  C CA  . LEU A 91  ? 0.2093 0.2475 0.3951 0.0038  0.0038  0.0075  201 LEU A CA  
409  C C   . LEU A 91  ? 0.2434 0.2785 0.4454 0.0024  0.0016  0.0032  201 LEU A C   
410  O O   . LEU A 91  ? 0.2318 0.2657 0.4313 0.0028  -0.0016 -0.0056 201 LEU A O   
411  C CB  . LEU A 91  ? 0.2166 0.2593 0.3934 0.0037  0.0075  0.0093  201 LEU A CB  
412  C CG  . LEU A 91  ? 0.2845 0.3295 0.4449 0.0042  0.0097  0.0126  201 LEU A CG  
413  C CD1 . LEU A 91  ? 0.2798 0.3273 0.4320 0.0050  0.0146  0.0115  201 LEU A CD1 
414  C CD2 . LEU A 91  ? 0.2823 0.3295 0.4435 0.0036  0.0101  0.0226  201 LEU A CD2 
415  N N   . PRO A 92  ? 0.1993 0.2332 0.4184 0.0004  0.0027  0.0098  202 PRO A N   
416  C CA  . PRO A 92  ? 0.1977 0.2280 0.4354 -0.0023 -0.0005 0.0046  202 PRO A CA  
417  C C   . PRO A 92  ? 0.2665 0.3036 0.5124 -0.0048 0.0001  0.0060  202 PRO A C   
418  O O   . PRO A 92  ? 0.2516 0.2880 0.5166 -0.0083 -0.0032 0.0030  202 PRO A O   
419  C CB  . PRO A 92  ? 0.2154 0.2404 0.4712 -0.0035 0.0012  0.0127  202 PRO A CB  
420  C CG  . PRO A 92  ? 0.2535 0.2843 0.5007 -0.0025 0.0064  0.0268  202 PRO A CG  
421  C CD  . PRO A 92  ? 0.2152 0.2508 0.4375 0.0001  0.0064  0.0229  202 PRO A CD  
422  N N   . PHE A 93  ? 0.2212 0.2652 0.4551 -0.0031 0.0044  0.0102  203 PHE A N   
423  C CA  . PHE A 93  ? 0.2072 0.2592 0.4504 -0.0041 0.0069  0.0126  203 PHE A CA  
424  C C   . PHE A 93  ? 0.2334 0.2890 0.4586 -0.0002 0.0089  0.0098  203 PHE A C   
425  O O   . PHE A 93  ? 0.2296 0.2821 0.4360 0.0020  0.0105  0.0092  203 PHE A O   
426  C CB  . PHE A 93  ? 0.2236 0.2800 0.4780 -0.0059 0.0153  0.0254  203 PHE A CB  
427  C CG  . PHE A 93  ? 0.2415 0.2998 0.4747 -0.0030 0.0224  0.0321  203 PHE A CG  
428  C CD1 . PHE A 93  ? 0.2901 0.3436 0.5125 -0.0023 0.0216  0.0364  203 PHE A CD1 
429  C CD2 . PHE A 93  ? 0.2663 0.3310 0.4899 -0.0005 0.0292  0.0330  203 PHE A CD2 
430  C CE1 . PHE A 93  ? 0.3043 0.3605 0.5051 -0.0002 0.0257  0.0412  203 PHE A CE1 
431  C CE2 . PHE A 93  ? 0.3026 0.3679 0.5034 0.0018  0.0347  0.0361  203 PHE A CE2 
432  C CZ  . PHE A 93  ? 0.2916 0.3529 0.4800 0.0015  0.0320  0.0399  203 PHE A CZ  
433  N N   . PRO A 94  ? 0.1944 0.2569 0.4283 0.0006  0.0087  0.0086  204 PRO A N   
434  C CA  . PRO A 94  ? 0.1781 0.2423 0.3984 0.0049  0.0116  0.0069  204 PRO A CA  
435  C C   . PRO A 94  ? 0.2444 0.3119 0.4591 0.0068  0.0226  0.0128  204 PRO A C   
436  O O   . PRO A 94  ? 0.2396 0.3133 0.4683 0.0054  0.0288  0.0197  204 PRO A O   
437  C CB  . PRO A 94  ? 0.1969 0.2683 0.4332 0.0057  0.0067  0.0047  204 PRO A CB  
438  C CG  . PRO A 94  ? 0.2575 0.3344 0.5194 0.0010  0.0052  0.0078  204 PRO A CG  
439  C CD  . PRO A 94  ? 0.2056 0.2747 0.4655 -0.0025 0.0053  0.0089  204 PRO A CD  
440  N N   . ILE A 95  ? 0.2103 0.2736 0.4049 0.0099  0.0257  0.0099  205 ILE A N   
441  C CA  . ILE A 95  ? 0.2164 0.2818 0.4017 0.0123  0.0362  0.0122  205 ILE A CA  
442  C C   . ILE A 95  ? 0.2417 0.3145 0.4436 0.0156  0.0414  0.0128  205 ILE A C   
443  O O   . ILE A 95  ? 0.2355 0.3074 0.4424 0.0181  0.0366  0.0088  205 ILE A O   
444  C CB  . ILE A 95  ? 0.2438 0.3013 0.4049 0.0140  0.0366  0.0062  205 ILE A CB  
445  C CG1 . ILE A 95  ? 0.2413 0.2943 0.3891 0.0108  0.0309  0.0065  205 ILE A CG1 
446  C CG2 . ILE A 95  ? 0.2461 0.3045 0.3968 0.0172  0.0473  0.0048  205 ILE A CG2 
447  C CD1 . ILE A 95  ? 0.3574 0.4137 0.4999 0.0089  0.0341  0.0139  205 ILE A CD1 
448  N N   . THR A 96  ? 0.2095 0.2902 0.4209 0.0161  0.0517  0.0189  206 THR A N   
449  C CA  . THR A 96  ? 0.2112 0.3007 0.4425 0.0200  0.0580  0.0200  206 THR A CA  
450  C C   . THR A 96  ? 0.2811 0.3722 0.5009 0.0246  0.0735  0.0199  206 THR A C   
451  O O   . THR A 96  ? 0.2873 0.3849 0.5219 0.0293  0.0812  0.0198  206 THR A O   
452  C CB  . THR A 96  ? 0.2354 0.3362 0.4987 0.0164  0.0563  0.0267  206 THR A CB  
453  O OG1 . THR A 96  ? 0.2264 0.3304 0.4918 0.0127  0.0641  0.0353  206 THR A OG1 
454  C CG2 . THR A 96  ? 0.2124 0.3107 0.4850 0.0124  0.0404  0.0233  206 THR A CG2 
455  N N   . SER A 97  ? 0.2631 0.3486 0.4562 0.0235  0.0776  0.0194  207 SER A N   
456  C CA  . SER A 97  ? 0.2719 0.3572 0.4463 0.0274  0.0913  0.0168  207 SER A CA  
457  C C   . SER A 97  ? 0.3313 0.4068 0.4726 0.0255  0.0870  0.0116  207 SER A C   
458  O O   . SER A 97  ? 0.3310 0.4031 0.4681 0.0210  0.0760  0.0139  207 SER A O   
459  C CB  . SER A 97  ? 0.3160 0.4131 0.4987 0.0272  0.1048  0.0273  207 SER A CB  
460  O OG  . SER A 97  ? 0.3979 0.4954 0.5719 0.0219  0.1017  0.0363  207 SER A OG  
461  N N   . MET A 98  ? 0.3175 0.3888 0.4364 0.0288  0.0955  0.0040  208 MET A N   
462  C CA  . MET A 98  ? 0.3315 0.3948 0.4195 0.0262  0.0900  -0.0021 208 MET A CA  
463  C C   . MET A 98  ? 0.3782 0.4474 0.4533 0.0222  0.0884  0.0086  208 MET A C   
464  O O   . MET A 98  ? 0.3575 0.4225 0.4184 0.0185  0.0775  0.0078  208 MET A O   
465  C CB  . MET A 98  ? 0.3803 0.4375 0.4467 0.0302  0.0992  -0.0145 208 MET A CB  
466  C CG  . MET A 98  ? 0.4251 0.4715 0.5003 0.0333  0.0969  -0.0258 208 MET A CG  
467  S SD  . MET A 98  ? 0.4612 0.4974 0.5386 0.0282  0.0785  -0.0289 208 MET A SD  
468  C CE  . MET A 98  ? 0.4217 0.4550 0.4659 0.0222  0.0715  -0.0332 208 MET A CE  
469  N N   . LYS A 99  ? 0.3288 0.4083 0.4129 0.0228  0.0989  0.0203  209 LYS A N   
470  C CA  . LYS A 99  ? 0.3353 0.4205 0.4110 0.0195  0.0989  0.0340  209 LYS A CA  
471  C C   . LYS A 99  ? 0.3421 0.4242 0.4316 0.0149  0.0840  0.0396  209 LYS A C   
472  O O   . LYS A 99  ? 0.3616 0.4436 0.4366 0.0126  0.0780  0.0461  209 LYS A O   
473  C CB  . LYS A 99  ? 0.3654 0.4619 0.4561 0.0206  0.1139  0.0469  209 LYS A CB  
474  C CG  . LYS A 99  ? 0.5510 0.6528 0.6198 0.0192  0.1189  0.0603  209 LYS A CG  
475  C CD  . LYS A 99  ? 0.7800 0.8930 0.8520 0.0218  0.1392  0.0703  209 LYS A CD  
476  N N   . ASP A 100 ? 0.2542 0.3337 0.3698 0.0142  0.0775  0.0361  210 ASP A N   
477  C CA  . ASP A 100 ? 0.2391 0.3145 0.3677 0.0106  0.0644  0.0381  210 ASP A CA  
478  C C   . ASP A 100 ? 0.3265 0.3948 0.4359 0.0095  0.0538  0.0314  210 ASP A C   
479  O O   . ASP A 100 ? 0.3212 0.3872 0.4379 0.0072  0.0449  0.0347  210 ASP A O   
480  C CB  . ASP A 100 ? 0.2299 0.3044 0.3846 0.0105  0.0598  0.0332  210 ASP A CB  
481  C CG  . ASP A 100 ? 0.2878 0.3706 0.4697 0.0098  0.0662  0.0405  210 ASP A CG  
482  O OD1 . ASP A 100 ? 0.2858 0.3709 0.4854 0.0111  0.0648  0.0356  210 ASP A OD1 
483  O OD2 . ASP A 100 ? 0.3374 0.4249 0.5247 0.0077  0.0719  0.0520  210 ASP A OD2 
484  N N   . THR A 101 ? 0.3194 0.3842 0.4071 0.0111  0.0548  0.0215  211 THR A N   
485  C CA  . THR A 101 ? 0.3183 0.3775 0.3916 0.0092  0.0445  0.0149  211 THR A CA  
486  C C   . THR A 101 ? 0.4056 0.4687 0.4580 0.0075  0.0414  0.0209  211 THR A C   
487  O O   . THR A 101 ? 0.4073 0.4683 0.4511 0.0053  0.0314  0.0172  211 THR A O   
488  C CB  . THR A 101 ? 0.3771 0.4290 0.4408 0.0105  0.0450  0.0008  211 THR A CB  
489  O OG1 . THR A 101 ? 0.3020 0.3542 0.3446 0.0124  0.0535  -0.0040 211 THR A OG1 
490  C CG2 . THR A 101 ? 0.3157 0.3642 0.3993 0.0130  0.0469  -0.0032 211 THR A CG2 
491  N N   . GLU A 102 ? 0.3911 0.4609 0.4356 0.0085  0.0498  0.0312  212 GLU A N   
492  C CA  . GLU A 102 ? 0.4164 0.4914 0.4381 0.0075  0.0468  0.0395  212 GLU A CA  
493  C C   . GLU A 102 ? 0.4648 0.5408 0.4985 0.0054  0.0349  0.0493  212 GLU A C   
494  O O   . GLU A 102 ? 0.4486 0.5236 0.5083 0.0051  0.0349  0.0565  212 GLU A O   
495  C CB  . GLU A 102 ? 0.4582 0.5407 0.4717 0.0093  0.0599  0.0515  212 GLU A CB  
496  C CG  . GLU A 102 ? 0.6446 0.7275 0.6375 0.0124  0.0725  0.0414  212 GLU A CG  
497  C CD  . GLU A 102 ? 0.9516 1.0433 0.9347 0.0147  0.0883  0.0532  212 GLU A CD  
498  O OE1 . GLU A 102 ? 0.8266 0.9243 0.8057 0.0135  0.0875  0.0704  212 GLU A OE1 
499  O OE2 . GLU A 102 ? 0.8936 0.9861 0.8729 0.0182  0.1022  0.0457  212 GLU A OE2 
500  N N   . GLY A 103 ? 0.4257 0.5035 0.4422 0.0039  0.0244  0.0481  213 GLY A N   
501  C CA  . GLY A 103 ? 0.4113 0.4914 0.4399 0.0029  0.0130  0.0575  213 GLY A CA  
502  C C   . GLY A 103 ? 0.4382 0.5130 0.4877 0.0018  0.0056  0.0488  213 GLY A C   
503  O O   . GLY A 103 ? 0.4587 0.5356 0.5202 0.0016  -0.0030 0.0550  213 GLY A O   
504  N N   . ILE A 104 ? 0.3650 0.4334 0.4197 0.0016  0.0094  0.0356  214 ILE A N   
505  C CA  . ILE A 104 ? 0.3332 0.3970 0.4045 0.0008  0.0037  0.0281  214 ILE A CA  
506  C C   . ILE A 104 ? 0.3557 0.4201 0.4144 -0.0019 -0.0045 0.0195  214 ILE A C   
507  O O   . ILE A 104 ? 0.3407 0.4026 0.3815 -0.0030 -0.0024 0.0103  214 ILE A O   
508  C CB  . ILE A 104 ? 0.3497 0.4072 0.4332 0.0019  0.0101  0.0204  214 ILE A CB  
509  C CG1 . ILE A 104 ? 0.3490 0.4074 0.4477 0.0034  0.0166  0.0282  214 ILE A CG1 
510  C CG2 . ILE A 104 ? 0.3313 0.3847 0.4277 0.0012  0.0049  0.0141  214 ILE A CG2 
511  C CD1 . ILE A 104 ? 0.4163 0.4712 0.5264 0.0045  0.0215  0.0215  214 ILE A CD1 
512  N N   . PRO A 105 ? 0.3047 0.3724 0.3746 -0.0032 -0.0137 0.0219  215 PRO A N   
513  C CA  . PRO A 105 ? 0.3139 0.3835 0.3770 -0.0069 -0.0222 0.0138  215 PRO A CA  
514  C C   . PRO A 105 ? 0.3571 0.4185 0.4271 -0.0084 -0.0191 0.0017  215 PRO A C   
515  O O   . PRO A 105 ? 0.3304 0.3861 0.4102 -0.0060 -0.0120 0.0007  215 PRO A O   
516  C CB  . PRO A 105 ? 0.3237 0.4012 0.4036 -0.0068 -0.0312 0.0225  215 PRO A CB  
517  C CG  . PRO A 105 ? 0.3505 0.4245 0.4511 -0.0031 -0.0252 0.0283  215 PRO A CG  
518  C CD  . PRO A 105 ? 0.2981 0.3678 0.3905 -0.0013 -0.0161 0.0309  215 PRO A CD  
519  N N   . CYS A 106 ? 0.3596 0.4207 0.4255 -0.0127 -0.0253 -0.0067 216 CYS A N   
520  C CA  . CYS A 106 ? 0.3709 0.4243 0.4452 -0.0150 -0.0234 -0.0161 216 CYS A CA  
521  C C   . CYS A 106 ? 0.4027 0.4451 0.4683 -0.0130 -0.0140 -0.0236 216 CYS A C   
522  O O   . CYS A 106 ? 0.3873 0.4226 0.4630 -0.0129 -0.0101 -0.0273 216 CYS A O   
523  C CB  . CYS A 106 ? 0.3734 0.4279 0.4703 -0.0136 -0.0221 -0.0117 216 CYS A CB  
524  S SG  . CYS A 106 ? 0.4272 0.4946 0.5401 -0.0135 -0.0305 -0.0017 216 CYS A SG  
525  N N   . LEU A 107 ? 0.3629 0.4048 0.4106 -0.0112 -0.0099 -0.0250 217 LEU A N   
526  C CA  . LEU A 107 ? 0.3581 0.3910 0.3997 -0.0083 -0.0001 -0.0319 217 LEU A CA  
527  C C   . LEU A 107 ? 0.4381 0.4669 0.4584 -0.0104 -0.0004 -0.0432 217 LEU A C   
528  O O   . LEU A 107 ? 0.4617 0.4939 0.4634 -0.0085 0.0035  -0.0427 217 LEU A O   
529  C CB  . LEU A 107 ? 0.3394 0.3753 0.3829 -0.0032 0.0088  -0.0243 217 LEU A CB  
530  C CG  . LEU A 107 ? 0.3488 0.3881 0.4121 -0.0012 0.0091  -0.0148 217 LEU A CG  
531  C CD1 . LEU A 107 ? 0.3407 0.3825 0.4071 0.0025  0.0176  -0.0092 217 LEU A CD1 
532  C CD2 . LEU A 107 ? 0.3018 0.3354 0.3796 -0.0011 0.0086  -0.0180 217 LEU A CD2 
533  N N   . GLY A 108 ? 0.4010 0.4219 0.4239 -0.0146 -0.0045 -0.0535 218 GLY A N   
534  C CA  . GLY A 108 ? 0.4306 0.4442 0.4353 -0.0173 -0.0054 -0.0680 218 GLY A CA  
535  C C   . GLY A 108 ? 0.4837 0.4867 0.4820 -0.0119 0.0077  -0.0756 218 GLY A C   
536  O O   . GLY A 108 ? 0.4592 0.4619 0.4701 -0.0064 0.0163  -0.0686 218 GLY A O   
537  N N   . ASP A 109 ? 0.4879 0.4828 0.4678 -0.0133 0.0091  -0.0906 219 ASP A N   
538  C CA  . ASP A 109 ? 0.5084 0.4927 0.4819 -0.0075 0.0225  -0.1001 219 ASP A CA  
539  C C   . ASP A 109 ? 0.5302 0.5026 0.5293 -0.0043 0.0287  -0.1004 219 ASP A C   
540  O O   . ASP A 109 ? 0.5205 0.4919 0.5263 0.0030  0.0400  -0.0971 219 ASP A O   
541  C CB  . ASP A 109 ? 0.5798 0.5556 0.5281 -0.0104 0.0214  -0.1193 219 ASP A CB  
542  C CG  . ASP A 109 ? 0.7694 0.7568 0.6853 -0.0101 0.0207  -0.1188 219 ASP A CG  
543  O OD1 . ASP A 109 ? 0.7325 0.7333 0.6481 -0.0067 0.0238  -0.1025 219 ASP A OD1 
544  O OD2 . ASP A 109 ? 0.9508 0.9338 0.8414 -0.0136 0.0166  -0.1344 219 ASP A OD2 
545  N N   . LYS A 110 ? 0.4775 0.4422 0.4923 -0.0096 0.0213  -0.1025 220 LYS A N   
546  C CA  . LYS A 110 ? 0.4568 0.4105 0.4951 -0.0068 0.0262  -0.0998 220 LYS A CA  
547  C C   . LYS A 110 ? 0.4489 0.4126 0.5011 -0.0014 0.0294  -0.0834 220 LYS A C   
548  O O   . LYS A 110 ? 0.4426 0.4020 0.5053 0.0052  0.0376  -0.0808 220 LYS A O   
549  C CB  . LYS A 110 ? 0.4972 0.4437 0.5497 -0.0145 0.0178  -0.1019 220 LYS A CB  
550  C CG  . LYS A 110 ? 0.6944 0.6284 0.7699 -0.0121 0.0228  -0.0975 220 LYS A CG  
551  C CD  . LYS A 110 ? 0.9243 0.8390 1.0017 -0.0089 0.0307  -0.1104 220 LYS A CD  
552  C CE  . LYS A 110 ? 1.0027 0.9136 1.0923 0.0014  0.0411  -0.1029 220 LYS A CE  
553  N NZ  . LYS A 110 ? 1.0674 0.9912 1.1458 0.0082  0.0470  -0.0998 220 LYS A NZ  
554  N N   . VAL A 111 ? 0.3604 0.3377 0.4130 -0.0041 0.0226  -0.0732 221 VAL A N   
555  C CA  . VAL A 111 ? 0.3080 0.2943 0.3725 -0.0002 0.0240  -0.0598 221 VAL A CA  
556  C C   . VAL A 111 ? 0.3699 0.3613 0.4308 0.0063  0.0327  -0.0571 221 VAL A C   
557  O O   . VAL A 111 ? 0.3572 0.3494 0.4320 0.0111  0.0370  -0.0512 221 VAL A O   
558  C CB  . VAL A 111 ? 0.3024 0.3004 0.3684 -0.0042 0.0155  -0.0515 221 VAL A CB  
559  C CG1 . VAL A 111 ? 0.2598 0.2665 0.3345 -0.0002 0.0174  -0.0405 221 VAL A CG1 
560  C CG2 . VAL A 111 ? 0.2917 0.2866 0.3690 -0.0092 0.0095  -0.0514 221 VAL A CG2 
561  N N   . LYS A 112 ? 0.3442 0.3400 0.3869 0.0062  0.0352  -0.0608 222 LYS A N   
562  C CA  . LYS A 112 ? 0.3375 0.3396 0.3774 0.0118  0.0453  -0.0573 222 LYS A CA  
563  C C   . LYS A 112 ? 0.3906 0.3842 0.4390 0.0181  0.0560  -0.0637 222 LYS A C   
564  O O   . LYS A 112 ? 0.3712 0.3712 0.4318 0.0234  0.0632  -0.0570 222 LYS A O   
565  C CB  . LYS A 112 ? 0.3840 0.3925 0.3992 0.0104  0.0467  -0.0592 222 LYS A CB  
566  C CG  . LYS A 112 ? 0.4364 0.4563 0.4503 0.0068  0.0383  -0.0472 222 LYS A CG  
567  C CD  . LYS A 112 ? 0.5171 0.5454 0.5084 0.0066  0.0405  -0.0439 222 LYS A CD  
568  C CE  . LYS A 112 ? 0.6707 0.7092 0.6677 0.0041  0.0325  -0.0297 222 LYS A CE  
569  N NZ  . LYS A 112 ? 0.8393 0.8850 0.8117 0.0020  0.0281  -0.0264 222 LYS A NZ  
570  N N   . SER A 113 ? 0.3593 0.3383 0.4054 0.0175  0.0564  -0.0758 223 SER A N   
571  C CA  . SER A 113 ? 0.3758 0.3447 0.4340 0.0244  0.0664  -0.0814 223 SER A CA  
572  C C   . SER A 113 ? 0.3933 0.3639 0.4772 0.0278  0.0645  -0.0698 223 SER A C   
573  O O   . SER A 113 ? 0.3789 0.3516 0.4771 0.0350  0.0722  -0.0665 223 SER A O   
574  C CB  . SER A 113 ? 0.4626 0.4133 0.5155 0.0223  0.0661  -0.0967 223 SER A CB  
575  O OG  . SER A 113 ? 0.6430 0.5925 0.6695 0.0176  0.0644  -0.1087 223 SER A OG  
576  N N   . ILE A 114 ? 0.3459 0.3166 0.4354 0.0228  0.0542  -0.0635 224 ILE A N   
577  C CA  . ILE A 114 ? 0.3339 0.3068 0.4424 0.0255  0.0511  -0.0526 224 ILE A CA  
578  C C   . ILE A 114 ? 0.3385 0.3270 0.4539 0.0284  0.0517  -0.0429 224 ILE A C   
579  O O   . ILE A 114 ? 0.3188 0.3102 0.4506 0.0340  0.0537  -0.0373 224 ILE A O   
580  C CB  . ILE A 114 ? 0.3630 0.3332 0.4726 0.0194  0.0419  -0.0488 224 ILE A CB  
581  C CG1 . ILE A 114 ? 0.3920 0.3452 0.5049 0.0175  0.0426  -0.0558 224 ILE A CG1 
582  C CG2 . ILE A 114 ? 0.3286 0.3057 0.4502 0.0216  0.0378  -0.0366 224 ILE A CG2 
583  C CD1 . ILE A 114 ? 0.5377 0.4885 0.6441 0.0087  0.0357  -0.0597 224 ILE A CD1 
584  N N   . ILE A 115 ? 0.2811 0.2795 0.3862 0.0246  0.0495  -0.0408 225 ILE A N   
585  C CA  . ILE A 115 ? 0.2493 0.2612 0.3628 0.0260  0.0501  -0.0320 225 ILE A CA  
586  C C   . ILE A 115 ? 0.2709 0.2868 0.3932 0.0324  0.0611  -0.0324 225 ILE A C   
587  O O   . ILE A 115 ? 0.2629 0.2867 0.4044 0.0357  0.0614  -0.0256 225 ILE A O   
588  C CB  . ILE A 115 ? 0.2781 0.2971 0.3790 0.0209  0.0467  -0.0293 225 ILE A CB  
589  C CG1 . ILE A 115 ? 0.2781 0.2953 0.3769 0.0158  0.0363  -0.0277 225 ILE A CG1 
590  C CG2 . ILE A 115 ? 0.2767 0.3079 0.3880 0.0220  0.0496  -0.0205 225 ILE A CG2 
591  C CD1 . ILE A 115 ? 0.2765 0.2998 0.3641 0.0110  0.0315  -0.0249 225 ILE A CD1 
592  N N   . GLU A 116 ? 0.2372 0.2481 0.3461 0.0341  0.0701  -0.0411 226 GLU A N   
593  C CA  . GLU A 116 ? 0.2554 0.2698 0.3709 0.0409  0.0836  -0.0431 226 GLU A CA  
594  C C   . GLU A 116 ? 0.3269 0.3384 0.4674 0.0479  0.0860  -0.0417 226 GLU A C   
595  O O   . GLU A 116 ? 0.3141 0.3363 0.4739 0.0529  0.0922  -0.0358 226 GLU A O   
596  C CB  . GLU A 116 ? 0.2903 0.2964 0.3822 0.0415  0.0920  -0.0559 226 GLU A CB  
597  C CG  . GLU A 116 ? 0.4048 0.4133 0.5001 0.0492  0.1087  -0.0603 226 GLU A CG  
598  C CD  . GLU A 116 ? 0.6682 0.6652 0.7367 0.0497  0.1158  -0.0764 226 GLU A CD  
599  O OE1 . GLU A 116 ? 0.5991 0.5802 0.6700 0.0517  0.1163  -0.0876 226 GLU A OE1 
600  O OE2 . GLU A 116 ? 0.6114 0.6146 0.6552 0.0471  0.1194  -0.0777 226 GLU A OE2 
601  N N   . GLY A 117 ? 0.2957 0.2933 0.4375 0.0481  0.0810  -0.0458 227 GLY A N   
602  C CA  . GLY A 117 ? 0.2842 0.2774 0.4488 0.0548  0.0815  -0.0424 227 GLY A CA  
603  C C   . GLY A 117 ? 0.3249 0.3307 0.5081 0.0554  0.0727  -0.0293 227 GLY A C   
604  O O   . GLY A 117 ? 0.3369 0.3480 0.5426 0.0624  0.0748  -0.0240 227 GLY A O   
605  N N   . ILE A 118 ? 0.2911 0.3022 0.4658 0.0485  0.0623  -0.0246 228 ILE A N   
606  C CA  . ILE A 118 ? 0.2706 0.2931 0.4587 0.0480  0.0528  -0.0146 228 ILE A CA  
607  C C   . ILE A 118 ? 0.3382 0.3767 0.5411 0.0492  0.0568  -0.0106 228 ILE A C   
608  O O   . ILE A 118 ? 0.3601 0.4084 0.5839 0.0524  0.0527  -0.0041 228 ILE A O   
609  C CB  . ILE A 118 ? 0.2769 0.2986 0.4512 0.0407  0.0423  -0.0129 228 ILE A CB  
610  C CG1 . ILE A 118 ? 0.2738 0.2818 0.4396 0.0397  0.0391  -0.0145 228 ILE A CG1 
611  C CG2 . ILE A 118 ? 0.2639 0.2974 0.4496 0.0400  0.0328  -0.0055 228 ILE A CG2 
612  C CD1 . ILE A 118 ? 0.2607 0.2664 0.4114 0.0326  0.0330  -0.0153 228 ILE A CD1 
613  N N   . ILE A 119 ? 0.2909 0.3326 0.4836 0.0467  0.0647  -0.0136 229 ILE A N   
614  C CA  . ILE A 119 ? 0.2822 0.3387 0.4898 0.0474  0.0711  -0.0084 229 ILE A CA  
615  C C   . ILE A 119 ? 0.4101 0.4714 0.6402 0.0560  0.0809  -0.0079 229 ILE A C   
616  O O   . ILE A 119 ? 0.4083 0.4842 0.6644 0.0577  0.0805  -0.0008 229 ILE A O   
617  C CB  . ILE A 119 ? 0.3095 0.3673 0.4981 0.0436  0.0791  -0.0101 229 ILE A CB  
618  C CG1 . ILE A 119 ? 0.2899 0.3463 0.4645 0.0358  0.0686  -0.0077 229 ILE A CG1 
619  C CG2 . ILE A 119 ? 0.2892 0.3619 0.4947 0.0455  0.0906  -0.0039 229 ILE A CG2 
620  C CD1 . ILE A 119 ? 0.2981 0.3535 0.4504 0.0325  0.0735  -0.0088 229 ILE A CD1 
621  N N   . GLU A 120 ? 0.4067 0.4557 0.6294 0.0614  0.0889  -0.0158 230 GLU A N   
622  C CA  . GLU A 120 ? 0.4250 0.4756 0.6687 0.0711  0.1002  -0.0170 230 GLU A CA  
623  C C   . GLU A 120 ? 0.4571 0.5162 0.7326 0.0760  0.0917  -0.0076 230 GLU A C   
624  O O   . GLU A 120 ? 0.4488 0.5233 0.7514 0.0805  0.0971  -0.0021 230 GLU A O   
625  C CB  . GLU A 120 ? 0.4669 0.4980 0.6962 0.0751  0.1073  -0.0287 230 GLU A CB  
626  C CG  . GLU A 120 ? 0.7252 0.7545 0.9420 0.0784  0.1251  -0.0385 230 GLU A CG  
627  C CD  . GLU A 120 ? 1.2397 1.2505 1.4516 0.0848  0.1345  -0.0516 230 GLU A CD  
628  O OE1 . GLU A 120 ? 1.2337 1.2274 1.4338 0.0816  0.1265  -0.0574 230 GLU A OE1 
629  O OE2 . GLU A 120 ? 1.2893 1.3027 1.5120 0.0932  0.1507  -0.0562 230 GLU A OE2 
630  N N   . ASP A 121 ? 0.4154 0.4662 0.6883 0.0752  0.0784  -0.0049 231 ASP A N   
631  C CA  . ASP A 121 ? 0.4077 0.4668 0.7071 0.0804  0.0691  0.0048  231 ASP A CA  
632  C C   . ASP A 121 ? 0.4108 0.4716 0.7022 0.0746  0.0507  0.0110  231 ASP A C   
633  O O   . ASP A 121 ? 0.4038 0.4673 0.7082 0.0788  0.0413  0.0186  231 ASP A O   
634  C CB  . ASP A 121 ? 0.4442 0.4903 0.7540 0.0900  0.0749  0.0036  231 ASP A CB  
635  C CG  . ASP A 121 ? 0.5369 0.5609 0.8235 0.0873  0.0721  -0.0013 231 ASP A CG  
636  O OD1 . ASP A 121 ? 0.5164 0.5363 0.7782 0.0783  0.0660  -0.0042 231 ASP A OD1 
637  O OD2 . ASP A 121 ? 0.5737 0.5847 0.8701 0.0943  0.0759  -0.0015 231 ASP A OD2 
638  N N   . GLY A 122 ? 0.3553 0.4146 0.6248 0.0656  0.0462  0.0078  232 GLY A N   
639  C CA  . GLY A 122 ? 0.3420 0.4027 0.6016 0.0602  0.0313  0.0114  232 GLY A CA  
640  C C   . GLY A 122 ? 0.3981 0.4444 0.6408 0.0602  0.0264  0.0119  232 GLY A C   
641  O O   . GLY A 122 ? 0.4058 0.4537 0.6391 0.0567  0.0153  0.0152  232 GLY A O   
642  N N   . GLU A 123 ? 0.3441 0.3756 0.5825 0.0637  0.0352  0.0082  233 GLU A N   
643  C CA  . GLU A 123 ? 0.3373 0.3535 0.5638 0.0633  0.0326  0.0094  233 GLU A CA  
644  C C   . GLU A 123 ? 0.3635 0.3644 0.5738 0.0595  0.0409  -0.0007 233 GLU A C   
645  O O   . GLU A 123 ? 0.3941 0.3934 0.6043 0.0605  0.0506  -0.0088 233 GLU A O   
646  C CB  . GLU A 123 ? 0.3666 0.3781 0.6122 0.0725  0.0332  0.0169  233 GLU A CB  
647  C CG  . GLU A 123 ? 0.5227 0.5477 0.7809 0.0762  0.0209  0.0292  233 GLU A CG  
648  C CD  . GLU A 123 ? 0.8728 0.8934 1.1513 0.0862  0.0209  0.0387  233 GLU A CD  
649  O OE1 . GLU A 123 ? 0.9326 0.9406 1.2035 0.0870  0.0185  0.0451  233 GLU A OE1 
650  O OE2 . GLU A 123 ? 0.8043 0.8339 1.1083 0.0934  0.0244  0.0407  233 GLU A OE2 
651  N N   . SER A 124 ? 0.2954 0.2854 0.4930 0.0554  0.0374  -0.0002 234 SER A N   
652  C CA  . SER A 124 ? 0.2935 0.2684 0.4792 0.0511  0.0429  -0.0094 234 SER A CA  
653  C C   . SER A 124 ? 0.3678 0.3267 0.5640 0.0556  0.0461  -0.0072 234 SER A C   
654  O O   . SER A 124 ? 0.3698 0.3259 0.5682 0.0559  0.0405  0.0031  234 SER A O   
655  C CB  . SER A 124 ? 0.3147 0.2897 0.4835 0.0425  0.0371  -0.0100 234 SER A CB  
656  O OG  . SER A 124 ? 0.3842 0.3456 0.5455 0.0379  0.0406  -0.0182 234 SER A OG  
657  N N   . SER A 125 ? 0.3290 0.2768 0.5320 0.0595  0.0556  -0.0163 235 SER A N   
658  C CA  . SER A 125 ? 0.3464 0.2755 0.5623 0.0639  0.0598  -0.0156 235 SER A CA  
659  C C   . SER A 125 ? 0.3997 0.3149 0.6057 0.0555  0.0568  -0.0172 235 SER A C   
660  O O   . SER A 125 ? 0.3992 0.3031 0.6157 0.0571  0.0559  -0.0084 235 SER A O   
661  C CB  . SER A 125 ? 0.4010 0.3201 0.6242 0.0694  0.0716  -0.0287 235 SER A CB  
662  O OG  . SER A 125 ? 0.4972 0.4106 0.7005 0.0624  0.0752  -0.0446 235 SER A OG  
663  N N   . GLU A 126 ? 0.3494 0.2666 0.5372 0.0466  0.0553  -0.0270 236 GLU A N   
664  C CA  . GLU A 126 ? 0.3604 0.2682 0.5410 0.0374  0.0521  -0.0296 236 GLU A CA  
665  C C   . GLU A 126 ? 0.3897 0.3040 0.5707 0.0353  0.0456  -0.0141 236 GLU A C   
666  O O   . GLU A 126 ? 0.3948 0.2973 0.5827 0.0327  0.0460  -0.0086 236 GLU A O   
667  C CB  . GLU A 126 ? 0.3769 0.2904 0.5392 0.0292  0.0500  -0.0418 236 GLU A CB  
668  C CG  . GLU A 126 ? 0.4367 0.3460 0.5914 0.0307  0.0564  -0.0575 236 GLU A CG  
669  C CD  . GLU A 126 ? 0.6143 0.5385 0.7649 0.0365  0.0603  -0.0570 236 GLU A CD  
670  O OE1 . GLU A 126 ? 0.6658 0.5879 0.8077 0.0382  0.0672  -0.0690 236 GLU A OE1 
671  O OE2 . GLU A 126 ? 0.4277 0.3661 0.5834 0.0390  0.0567  -0.0450 236 GLU A OE2 
672  N N   . ALA A 127 ? 0.3203 0.2527 0.4940 0.0363  0.0405  -0.0073 237 ALA A N   
673  C CA  . ALA A 127 ? 0.3048 0.2442 0.4747 0.0350  0.0350  0.0056  237 ALA A CA  
674  C C   . ALA A 127 ? 0.3545 0.2894 0.5362 0.0425  0.0345  0.0196  237 ALA A C   
675  O O   . ALA A 127 ? 0.3429 0.2747 0.5230 0.0411  0.0332  0.0305  237 ALA A O   
676  C CB  . ALA A 127 ? 0.2891 0.2468 0.4487 0.0343  0.0295  0.0065  237 ALA A CB  
677  N N   . LYS A 128 ? 0.3191 0.2544 0.5137 0.0508  0.0361  0.0202  238 LYS A N   
678  C CA  . LYS A 128 ? 0.3226 0.2546 0.5320 0.0594  0.0349  0.0341  238 LYS A CA  
679  C C   . LYS A 128 ? 0.3697 0.2803 0.5890 0.0589  0.0402  0.0381  238 LYS A C   
680  O O   . LYS A 128 ? 0.3377 0.2455 0.5604 0.0615  0.0377  0.0541  238 LYS A O   
681  C CB  . LYS A 128 ? 0.3662 0.3031 0.5921 0.0683  0.0371  0.0317  238 LYS A CB  
682  C CG  . LYS A 128 ? 0.6311 0.5722 0.8733 0.0780  0.0323  0.0481  238 LYS A CG  
683  C CD  . LYS A 128 ? 0.7895 0.7428 1.0495 0.0859  0.0330  0.0462  238 LYS A CD  
684  N N   . ALA A 129 ? 0.3569 0.2525 0.5796 0.0548  0.0470  0.0236  239 ALA A N   
685  C CA  . ALA A 129 ? 0.3902 0.2633 0.6248 0.0526  0.0521  0.0244  239 ALA A CA  
686  C C   . ALA A 129 ? 0.4053 0.2777 0.6321 0.0439  0.0497  0.0331  239 ALA A C   
687  O O   . ALA A 129 ? 0.3982 0.2577 0.6367 0.0444  0.0520  0.0455  239 ALA A O   
688  C CB  . ALA A 129 ? 0.4173 0.2762 0.6544 0.0492  0.0584  0.0036  239 ALA A CB  
689  N N   . VAL A 130 ? 0.3507 0.2374 0.5595 0.0367  0.0459  0.0283  240 VAL A N   
690  C CA  . VAL A 130 ? 0.3350 0.2245 0.5373 0.0291  0.0450  0.0365  240 VAL A CA  
691  C C   . VAL A 130 ? 0.3520 0.2492 0.5501 0.0348  0.0425  0.0573  240 VAL A C   
692  O O   . VAL A 130 ? 0.3455 0.2356 0.5476 0.0327  0.0456  0.0705  240 VAL A O   
693  C CB  . VAL A 130 ? 0.3668 0.2707 0.5533 0.0216  0.0417  0.0261  240 VAL A CB  
694  C CG1 . VAL A 130 ? 0.3491 0.2594 0.5301 0.0160  0.0419  0.0359  240 VAL A CG1 
695  C CG2 . VAL A 130 ? 0.3723 0.2687 0.5609 0.0151  0.0428  0.0079  240 VAL A CG2 
696  N N   . LEU A 131 ? 0.3002 0.2120 0.4903 0.0417  0.0369  0.0604  241 LEU A N   
697  C CA  . LEU A 131 ? 0.2906 0.2123 0.4728 0.0473  0.0320  0.0779  241 LEU A CA  
698  C C   . LEU A 131 ? 0.3796 0.2884 0.5770 0.0541  0.0338  0.0948  241 LEU A C   
699  O O   . LEU A 131 ? 0.3975 0.3104 0.5868 0.0567  0.0316  0.1126  241 LEU A O   
700  C CB  . LEU A 131 ? 0.2680 0.2073 0.4433 0.0525  0.0241  0.0749  241 LEU A CB  
701  C CG  . LEU A 131 ? 0.2944 0.2483 0.4528 0.0469  0.0207  0.0638  241 LEU A CG  
702  C CD1 . LEU A 131 ? 0.2823 0.2517 0.4395 0.0518  0.0127  0.0617  241 LEU A CD1 
703  C CD2 . LEU A 131 ? 0.2745 0.2335 0.4151 0.0422  0.0210  0.0702  241 LEU A CD2 
704  N N   . ASN A 132 ? 0.3490 0.2419 0.5677 0.0573  0.0384  0.0893  242 ASN A N   
705  C CA  . ASN A 132 ? 0.3915 0.2690 0.6302 0.0643  0.0412  0.1042  242 ASN A CA  
706  C C   . ASN A 132 ? 0.4609 0.3163 0.7116 0.0574  0.0494  0.1063  242 ASN A C   
707  O O   . ASN A 132 ? 0.4877 0.3283 0.7555 0.0622  0.0525  0.1214  242 ASN A O   
708  C CB  . ASN A 132 ? 0.4222 0.2946 0.6809 0.0734  0.0423  0.0971  242 ASN A CB  
709  C CG  . ASN A 132 ? 0.7782 0.6722 1.0332 0.0812  0.0337  0.1013  242 ASN A CG  
710  O OD1 . ASN A 132 ? 0.6622 0.5670 0.9119 0.0861  0.0260  0.1194  242 ASN A OD1 
711  N ND2 . ASN A 132 ? 0.7107 0.6125 0.9680 0.0822  0.0345  0.0849  242 ASN A ND2 
712  N N   . ASP A 133 ? 0.4015 0.2554 0.6456 0.0463  0.0523  0.0925  243 ASP A N   
713  C CA  . ASP A 133 ? 0.4120 0.2470 0.6699 0.0377  0.0590  0.0928  243 ASP A CA  
714  C C   . ASP A 133 ? 0.4639 0.3009 0.7183 0.0359  0.0612  0.1164  243 ASP A C   
715  O O   . ASP A 133 ? 0.4390 0.2951 0.6717 0.0350  0.0584  0.1225  243 ASP A O   
716  C CB  . ASP A 133 ? 0.4143 0.2517 0.6661 0.0262  0.0592  0.0717  243 ASP A CB  
717  C CG  . ASP A 133 ? 0.5133 0.3340 0.7818 0.0157  0.0643  0.0703  243 ASP A CG  
718  O OD1 . ASP A 133 ? 0.5675 0.3662 0.8562 0.0154  0.0677  0.0631  243 ASP A OD1 
719  O OD2 . ASP A 133 ? 0.4981 0.3277 0.7612 0.0078  0.0652  0.0760  243 ASP A OD2 
720  N N   . GLU A 134 ? 0.4722 0.2569 0.5199 0.0082  0.1075  0.0439  244 GLU A N   
721  C CA  . GLU A 134 ? 0.4263 0.2407 0.5015 0.0054  0.0887  0.0415  244 GLU A CA  
722  C C   . GLU A 134 ? 0.4316 0.2512 0.4925 0.0092  0.0710  0.0433  244 GLU A C   
723  O O   . GLU A 134 ? 0.3907 0.2294 0.4736 0.0073  0.0623  0.0436  244 GLU A O   
724  C CB  . GLU A 134 ? 0.4343 0.2585 0.5195 0.0032  0.0835  0.0366  244 GLU A CB  
725  C CG  . GLU A 134 ? 0.5987 0.4254 0.7105 0.0001  0.0984  0.0341  244 GLU A CG  
726  C CD  . GLU A 134 ? 0.8456 0.6920 0.9977 -0.0035 0.0989  0.0335  244 GLU A CD  
727  O OE1 . GLU A 134 ? 0.7918 0.6570 0.9586 -0.0046 0.0833  0.0333  244 GLU A OE1 
728  O OE2 . GLU A 134 ? 0.7345 0.5768 0.9041 -0.0053 0.1154  0.0324  244 GLU A OE2 
729  N N   . ARG A 135 ? 0.4155 0.2181 0.4400 0.0151  0.0651  0.0441  245 ARG A N   
730  C CA  . ARG A 135 ? 0.4200 0.2285 0.4337 0.0200  0.0473  0.0450  245 ARG A CA  
731  C C   . ARG A 135 ? 0.4627 0.2657 0.4756 0.0234  0.0514  0.0506  245 ARG A C   
732  O O   . ARG A 135 ? 0.4527 0.2733 0.4816 0.0240  0.0403  0.0508  245 ARG A O   
733  C CB  . ARG A 135 ? 0.4666 0.2563 0.4410 0.0267  0.0386  0.0434  245 ARG A CB  
734  C CG  . ARG A 135 ? 0.4893 0.2895 0.4589 0.0324  0.0170  0.0423  245 ARG A CG  
735  C CD  . ARG A 135 ? 0.6749 0.4636 0.6149 0.0371  0.0037  0.0371  245 ARG A CD  
736  N NE  . ARG A 135 ? 0.8278 0.6124 0.7485 0.0472  -0.0135 0.0379  245 ARG A NE  
737  C CZ  . ARG A 135 ? 1.0635 0.8731 1.0056 0.0480  -0.0329 0.0335  245 ARG A CZ  
738  N NH1 . ARG A 135 ? 1.0193 0.8572 0.9994 0.0384  -0.0359 0.0286  245 ARG A NH1 
739  N NH2 . ARG A 135 ? 0.8300 0.6354 0.7559 0.0588  -0.0488 0.0339  245 ARG A NH2 
740  N N   . TYR A 136 ? 0.4054 0.1829 0.4009 0.0251  0.0694  0.0549  246 TYR A N   
741  C CA  . TYR A 136 ? 0.3895 0.1568 0.3823 0.0278  0.0757  0.0603  246 TYR A CA  
742  C C   . TYR A 136 ? 0.4076 0.1991 0.4432 0.0206  0.0766  0.0584  246 TYR A C   
743  O O   . TYR A 136 ? 0.3830 0.1813 0.4244 0.0230  0.0689  0.0599  246 TYR A O   
744  C CB  . TYR A 136 ? 0.4294 0.1613 0.3950 0.0297  0.0983  0.0653  246 TYR A CB  
745  C CG  . TYR A 136 ? 0.4671 0.1860 0.4318 0.0313  0.1073  0.0708  246 TYR A CG  
746  C CD1 . TYR A 136 ? 0.5183 0.2191 0.4504 0.0419  0.0988  0.0764  246 TYR A CD1 
747  C CD2 . TYR A 136 ? 0.4553 0.1800 0.4536 0.0225  0.1231  0.0697  246 TYR A CD2 
748  C CE1 . TYR A 136 ? 0.5566 0.2424 0.4868 0.0437  0.1079  0.0817  246 TYR A CE1 
749  C CE2 . TYR A 136 ? 0.4806 0.1919 0.4794 0.0229  0.1317  0.0738  246 TYR A CE2 
750  C CZ  . TYR A 136 ? 0.5911 0.2817 0.5546 0.0335  0.1250  0.0803  246 TYR A CZ  
751  O OH  . TYR A 136 ? 0.5825 0.2574 0.5457 0.0341  0.1344  0.0844  246 TYR A OH  
752  N N   . LYS A 137 ? 0.3838 0.1874 0.4482 0.0127  0.0848  0.0544  247 LYS A N   
753  C CA  . LYS A 137 ? 0.3515 0.1772 0.4551 0.0063  0.0833  0.0513  247 LYS A CA  
754  C C   . LYS A 137 ? 0.3677 0.2163 0.4820 0.0071  0.0639  0.0494  247 LYS A C   
755  O O   . LYS A 137 ? 0.3362 0.1925 0.4634 0.0065  0.0604  0.0493  247 LYS A O   
756  C CB  . LYS A 137 ? 0.3463 0.1819 0.4773 0.0001  0.0912  0.0466  247 LYS A CB  
757  C CG  . LYS A 137 ? 0.4816 0.3005 0.6191 -0.0032 0.1140  0.0469  247 LYS A CG  
758  C CD  . LYS A 137 ? 0.5434 0.3784 0.7188 -0.0088 0.1194  0.0409  247 LYS A CD  
759  C CE  . LYS A 137 ? 0.6619 0.4920 0.8272 -0.0072 0.1238  0.0396  247 LYS A CE  
760  N NZ  . LYS A 137 ? 0.6646 0.5115 0.8691 -0.0110 0.1272  0.0337  247 LYS A NZ  
761  N N   . SER A 138 ? 0.3249 0.1823 0.4328 0.0082  0.0528  0.0476  248 SER A N   
762  C CA  . SER A 138 ? 0.3070 0.1847 0.4247 0.0084  0.0371  0.0458  248 SER A CA  
763  C C   . SER A 138 ? 0.3326 0.2087 0.4386 0.0146  0.0296  0.0482  248 SER A C   
764  O O   . SER A 138 ? 0.2969 0.1869 0.4180 0.0140  0.0239  0.0474  248 SER A O   
765  C CB  . SER A 138 ? 0.3296 0.2131 0.4425 0.0075  0.0294  0.0429  248 SER A CB  
766  O OG  . SER A 138 ? 0.4831 0.3708 0.6118 0.0024  0.0351  0.0406  248 SER A OG  
767  N N   . PHE A 139 ? 0.3479 0.2055 0.4256 0.0214  0.0294  0.0512  249 PHE A N   
768  C CA  . PHE A 139 ? 0.3775 0.2323 0.4436 0.0296  0.0208  0.0537  249 PHE A CA  
769  C C   . PHE A 139 ? 0.4213 0.2716 0.4957 0.0300  0.0282  0.0565  249 PHE A C   
770  O O   . PHE A 139 ? 0.4195 0.2809 0.5031 0.0332  0.0205  0.0561  249 PHE A O   
771  C CB  . PHE A 139 ? 0.4534 0.2842 0.4822 0.0385  0.0184  0.0566  249 PHE A CB  
772  C CG  . PHE A 139 ? 0.5213 0.3376 0.5318 0.0490  0.0149  0.0615  249 PHE A CG  
773  C CD1 . PHE A 139 ? 0.5685 0.4007 0.5871 0.0555  -0.0015 0.0599  249 PHE A CD1 
774  C CD2 . PHE A 139 ? 0.6027 0.3879 0.5878 0.0530  0.0290  0.0678  249 PHE A CD2 
775  C CE1 . PHE A 139 ? 0.6178 0.4360 0.6202 0.0669  -0.0054 0.0645  249 PHE A CE1 
776  C CE2 . PHE A 139 ? 0.6632 0.4314 0.6287 0.0638  0.0259  0.0731  249 PHE A CE2 
777  C CZ  . PHE A 139 ? 0.6306 0.4156 0.6046 0.0714  0.0078  0.0714  249 PHE A CZ  
778  N N   . LYS A 140 ? 0.3771 0.2112 0.4503 0.0264  0.0441  0.0585  250 LYS A N   
779  C CA  . LYS A 140 ? 0.3856 0.2133 0.4684 0.0252  0.0523  0.0599  250 LYS A CA  
780  C C   . LYS A 140 ? 0.3881 0.2401 0.5017 0.0195  0.0463  0.0548  250 LYS A C   
781  O O   . LYS A 140 ? 0.3881 0.2424 0.5063 0.0220  0.0431  0.0547  250 LYS A O   
782  C CB  . LYS A 140 ? 0.4360 0.2437 0.5181 0.0201  0.0722  0.0613  250 LYS A CB  
783  C CG  . LYS A 140 ? 0.6173 0.3912 0.6622 0.0269  0.0829  0.0681  250 LYS A CG  
784  C CD  . LYS A 140 ? 0.7995 0.5587 0.8240 0.0367  0.0778  0.0732  250 LYS A CD  
785  C CE  . LYS A 140 ? 0.9885 0.7396 1.0272 0.0332  0.0886  0.0738  250 LYS A CE  
786  N NZ  . LYS A 140 ? 1.1961 0.9384 1.2199 0.0436  0.0803  0.0777  250 LYS A NZ  
787  N N   . LEU A 141 ? 0.3085 0.1760 0.4401 0.0128  0.0447  0.0507  251 LEU A N   
788  C CA  . LEU A 141 ? 0.2814 0.1679 0.4368 0.0082  0.0388  0.0461  251 LEU A CA  
789  C C   . LEU A 141 ? 0.3113 0.2117 0.4660 0.0119  0.0268  0.0456  251 LEU A C   
790  O O   . LEU A 141 ? 0.3080 0.2134 0.4708 0.0120  0.0247  0.0438  251 LEU A O   
791  C CB  . LEU A 141 ? 0.2703 0.1668 0.4409 0.0024  0.0390  0.0428  251 LEU A CB  
792  C CG  . LEU A 141 ? 0.3090 0.2219 0.4992 -0.0012 0.0314  0.0384  251 LEU A CG  
793  C CD1 . LEU A 141 ? 0.2949 0.2056 0.5000 -0.0040 0.0343  0.0349  251 LEU A CD1 
794  C CD2 . LEU A 141 ? 0.3254 0.2456 0.5263 -0.0044 0.0302  0.0363  251 LEU A CD2 
795  N N   . PHE A 142 ? 0.2569 0.1628 0.4028 0.0146  0.0199  0.0464  252 PHE A N   
796  C CA  . PHE A 142 ? 0.2430 0.1642 0.3940 0.0170  0.0104  0.0449  252 PHE A CA  
797  C C   . PHE A 142 ? 0.3075 0.2249 0.4527 0.0248  0.0081  0.0467  252 PHE A C   
798  O O   . PHE A 142 ? 0.2842 0.2118 0.4400 0.0256  0.0060  0.0448  252 PHE A O   
799  C CB  . PHE A 142 ? 0.2584 0.1875 0.4066 0.0167  0.0035  0.0437  252 PHE A CB  
800  C CG  . PHE A 142 ? 0.2727 0.2048 0.4263 0.0099  0.0054  0.0419  252 PHE A CG  
801  C CD1 . PHE A 142 ? 0.3038 0.2371 0.4517 0.0090  0.0011  0.0403  252 PHE A CD1 
802  C CD2 . PHE A 142 ? 0.2900 0.2226 0.4545 0.0052  0.0106  0.0411  252 PHE A CD2 
803  C CE1 . PHE A 142 ? 0.3138 0.2477 0.4662 0.0035  0.0036  0.0387  252 PHE A CE1 
804  C CE2 . PHE A 142 ? 0.3247 0.2589 0.4945 0.0008  0.0118  0.0397  252 PHE A CE2 
805  C CZ  . PHE A 142 ? 0.3091 0.2433 0.4724 0.0001  0.0091  0.0389  252 PHE A CZ  
806  N N   . THR A 143 ? 0.3044 0.2050 0.4311 0.0314  0.0093  0.0504  253 THR A N   
807  C CA  . THR A 143 ? 0.3280 0.2225 0.4479 0.0407  0.0064  0.0526  253 THR A CA  
808  C C   . THR A 143 ? 0.4084 0.2934 0.5330 0.0397  0.0152  0.0531  253 THR A C   
809  O O   . THR A 143 ? 0.4096 0.2903 0.5316 0.0472  0.0136  0.0543  253 THR A O   
810  C CB  . THR A 143 ? 0.3967 0.2719 0.4902 0.0497  0.0037  0.0571  253 THR A CB  
811  O OG1 . THR A 143 ? 0.3866 0.2382 0.4647 0.0468  0.0168  0.0607  253 THR A OG1 
812  C CG2 . THR A 143 ? 0.2901 0.1749 0.3787 0.0517  -0.0084 0.0547  253 THR A CG2 
813  N N   . SER A 144 ? 0.3640 0.2470 0.4981 0.0306  0.0233  0.0510  254 SER A N   
814  C CA  . SER A 144 ? 0.3649 0.2407 0.5070 0.0280  0.0298  0.0490  254 SER A CA  
815  C C   . SER A 144 ? 0.3898 0.2816 0.5441 0.0283  0.0238  0.0446  254 SER A C   
816  O O   . SER A 144 ? 0.3962 0.2821 0.5544 0.0279  0.0269  0.0420  254 SER A O   
817  C CB  . SER A 144 ? 0.3719 0.2441 0.5253 0.0185  0.0376  0.0463  254 SER A CB  
818  O OG  . SER A 144 ? 0.3142 0.2046 0.4835 0.0125  0.0319  0.0413  254 SER A OG  
819  N N   . VAL A 145 ? 0.3103 0.2201 0.4696 0.0287  0.0165  0.0435  255 VAL A N   
820  C CA  . VAL A 145 ? 0.2880 0.2114 0.4564 0.0293  0.0134  0.0400  255 VAL A CA  
821  C C   . VAL A 145 ? 0.3244 0.2497 0.4916 0.0391  0.0109  0.0413  255 VAL A C   
822  O O   . VAL A 145 ? 0.2972 0.2252 0.4608 0.0443  0.0055  0.0438  255 VAL A O   
823  C CB  . VAL A 145 ? 0.2962 0.2358 0.4719 0.0240  0.0096  0.0383  255 VAL A CB  
824  C CG1 . VAL A 145 ? 0.2752 0.2248 0.4571 0.0244  0.0100  0.0353  255 VAL A CG1 
825  C CG2 . VAL A 145 ? 0.2947 0.2319 0.4722 0.0164  0.0107  0.0372  255 VAL A CG2 
826  N N   . PHE A 146 ? 0.2901 0.2137 0.4605 0.0425  0.0139  0.0389  256 PHE A N   
827  C CA  . PHE A 146 ? 0.2938 0.2212 0.4677 0.0527  0.0120  0.0392  256 PHE A CA  
828  C C   . PHE A 146 ? 0.3304 0.2810 0.5187 0.0529  0.0072  0.0373  256 PHE A C   
829  O O   . PHE A 146 ? 0.2964 0.2568 0.4914 0.0458  0.0100  0.0344  256 PHE A O   
830  C CB  . PHE A 146 ? 0.3249 0.2445 0.4993 0.0553  0.0183  0.0359  256 PHE A CB  
831  C CG  . PHE A 146 ? 0.3516 0.2768 0.5338 0.0662  0.0182  0.0350  256 PHE A CG  
832  C CD1 . PHE A 146 ? 0.3869 0.3028 0.5644 0.0775  0.0149  0.0389  256 PHE A CD1 
833  C CD2 . PHE A 146 ? 0.3793 0.3169 0.5724 0.0662  0.0226  0.0303  256 PHE A CD2 
834  C CE1 . PHE A 146 ? 0.3989 0.3209 0.5868 0.0890  0.0141  0.0376  256 PHE A CE1 
835  C CE2 . PHE A 146 ? 0.4121 0.3553 0.6162 0.0768  0.0244  0.0287  256 PHE A CE2 
836  C CZ  . PHE A 146 ? 0.3874 0.3244 0.5910 0.0883  0.0194  0.0321  256 PHE A CZ  
837  N N   . GLY A 147 ? 0.3054 0.2627 0.4975 0.0605  -0.0005 0.0387  257 GLY A N   
838  C CA  . GLY A 147 ? 0.2980 0.2782 0.5087 0.0602  -0.0060 0.0355  257 GLY A CA  
839  C C   . GLY A 147 ? 0.3145 0.2988 0.5218 0.0553  -0.0133 0.0361  257 GLY A C   
840  O O   . GLY A 147 ? 0.2849 0.2873 0.5085 0.0543  -0.0190 0.0326  257 GLY A O   
841  N N   . VAL A 148 ? 0.2692 0.2365 0.4570 0.0519  -0.0122 0.0397  258 VAL A N   
842  C CA  . VAL A 148 ? 0.2639 0.2311 0.4447 0.0476  -0.0175 0.0400  258 VAL A CA  
843  C C   . VAL A 148 ? 0.3543 0.3043 0.5137 0.0565  -0.0236 0.0438  258 VAL A C   
844  O O   . VAL A 148 ? 0.3557 0.2847 0.4979 0.0584  -0.0170 0.0481  258 VAL A O   
845  C CB  . VAL A 148 ? 0.2696 0.2308 0.4455 0.0368  -0.0102 0.0406  258 VAL A CB  
846  C CG1 . VAL A 148 ? 0.2561 0.2160 0.4247 0.0331  -0.0145 0.0404  258 VAL A CG1 
847  C CG2 . VAL A 148 ? 0.2469 0.2199 0.4370 0.0300  -0.0052 0.0377  258 VAL A CG2 
848  N N   . GLY A 149 ? 0.3330 0.2907 0.4928 0.0613  -0.0358 0.0417  259 GLY A N   
849  C CA  . GLY A 149 ? 0.3508 0.2904 0.4848 0.0709  -0.0442 0.0448  259 GLY A CA  
850  C C   . GLY A 149 ? 0.4023 0.3367 0.5225 0.0653  -0.0473 0.0435  259 GLY A C   
851  O O   . GLY A 149 ? 0.3355 0.2791 0.4670 0.0540  -0.0418 0.0409  259 GLY A O   
852  N N   . LEU A 150 ? 0.4095 0.3265 0.5024 0.0744  -0.0564 0.0452  260 LEU A N   
853  C CA  . LEU A 150 ? 0.4231 0.3290 0.4947 0.0719  -0.0603 0.0437  260 LEU A CA  
854  C C   . LEU A 150 ? 0.4288 0.3586 0.5234 0.0630  -0.0680 0.0355  260 LEU A C   
855  O O   . LEU A 150 ? 0.4274 0.3521 0.5160 0.0542  -0.0616 0.0344  260 LEU A O   
856  C CB  . LEU A 150 ? 0.4724 0.3580 0.5111 0.0864  -0.0738 0.0456  260 LEU A CB  
857  C CG  . LEU A 150 ? 0.5936 0.4413 0.5921 0.0926  -0.0624 0.0545  260 LEU A CG  
858  C CD1 . LEU A 150 ? 0.6393 0.4693 0.6114 0.1104  -0.0760 0.0580  260 LEU A CD1 
859  C CD2 . LEU A 150 ? 0.6874 0.5150 0.6583 0.0875  -0.0554 0.0549  260 LEU A CD2 
860  N N   . LYS A 151 ? 0.3632 0.3180 0.4853 0.0652  -0.0805 0.0293  261 LYS A N   
861  C CA  . LYS A 151 ? 0.3378 0.3151 0.4851 0.0564  -0.0875 0.0206  261 LYS A CA  
862  C C   . LYS A 151 ? 0.3390 0.3267 0.5065 0.0424  -0.0722 0.0206  261 LYS A C   
863  O O   . LYS A 151 ? 0.3011 0.2891 0.4690 0.0336  -0.0710 0.0172  261 LYS A O   
864  C CB  . LYS A 151 ? 0.3837 0.3867 0.5618 0.0621  -0.1024 0.0135  261 LYS A CB  
865  C CG  . LYS A 151 ? 0.7177 0.7165 0.8814 0.0728  -0.1249 0.0085  261 LYS A CG  
866  C CD  . LYS A 151 ? 0.9119 0.9370 1.1101 0.0810  -0.1401 0.0018  261 LYS A CD  
867  C CE  . LYS A 151 ? 1.0389 1.0561 1.2179 0.0965  -0.1652 -0.0018 261 LYS A CE  
868  N NZ  . LYS A 151 ? 1.1218 1.1661 1.3386 0.1066  -0.1805 -0.0082 261 LYS A NZ  
869  N N   . THR A 152 ? 0.2890 0.2828 0.4705 0.0412  -0.0610 0.0242  262 THR A N   
870  C CA  . THR A 152 ? 0.2663 0.2663 0.4614 0.0298  -0.0477 0.0247  262 THR A CA  
871  C C   . THR A 152 ? 0.3116 0.2920 0.4851 0.0250  -0.0387 0.0290  262 THR A C   
872  O O   . THR A 152 ? 0.3028 0.2853 0.4817 0.0162  -0.0337 0.0278  262 THR A O   
873  C CB  . THR A 152 ? 0.3253 0.3331 0.5352 0.0312  -0.0394 0.0266  262 THR A CB  
874  O OG1 . THR A 152 ? 0.3322 0.3590 0.5653 0.0363  -0.0466 0.0220  262 THR A OG1 
875  C CG2 . THR A 152 ? 0.2557 0.2670 0.4745 0.0212  -0.0274 0.0271  262 THR A CG2 
876  N N   . ALA A 153 ? 0.2981 0.2588 0.4485 0.0310  -0.0360 0.0340  263 ALA A N   
877  C CA  . ALA A 153 ? 0.2931 0.2364 0.4277 0.0269  -0.0260 0.0373  263 ALA A CA  
878  C C   . ALA A 153 ? 0.3471 0.2850 0.4712 0.0233  -0.0293 0.0341  263 ALA A C   
879  O O   . ALA A 153 ? 0.3059 0.2411 0.4322 0.0163  -0.0217 0.0340  263 ALA A O   
880  C CB  . ALA A 153 ? 0.3176 0.2393 0.4303 0.0340  -0.0209 0.0427  263 ALA A CB  
881  N N   . GLU A 154 ? 0.3474 0.2837 0.4605 0.0289  -0.0419 0.0308  264 GLU A N   
882  C CA  . GLU A 154 ? 0.3653 0.2948 0.4656 0.0263  -0.0474 0.0261  264 GLU A CA  
883  C C   . GLU A 154 ? 0.3769 0.3245 0.5027 0.0160  -0.0479 0.0206  264 GLU A C   
884  O O   . GLU A 154 ? 0.3525 0.2923 0.4726 0.0101  -0.0430 0.0190  264 GLU A O   
885  C CB  . GLU A 154 ? 0.4149 0.3398 0.4987 0.0358  -0.0643 0.0225  264 GLU A CB  
886  C CG  . GLU A 154 ? 0.6387 0.5515 0.7018 0.0348  -0.0717 0.0167  264 GLU A CG  
887  C CD  . GLU A 154 ? 1.1977 1.1072 1.2450 0.0455  -0.0924 0.0121  264 GLU A CD  
888  O OE1 . GLU A 154 ? 1.2316 1.1629 1.3036 0.0433  -0.1072 0.0034  264 GLU A OE1 
889  O OE2 . GLU A 154 ? 1.2709 1.1561 1.2827 0.0565  -0.0940 0.0171  264 GLU A OE2 
890  N N   . LYS A 155 ? 0.3243 0.2940 0.4781 0.0140  -0.0518 0.0180  265 LYS A N   
891  C CA  . LYS A 155 ? 0.3075 0.2926 0.4861 0.0039  -0.0495 0.0137  265 LYS A CA  
892  C C   . LYS A 155 ? 0.3315 0.3097 0.5097 -0.0027 -0.0356 0.0181  265 LYS A C   
893  O O   . LYS A 155 ? 0.3320 0.3071 0.5116 -0.0095 -0.0330 0.0157  265 LYS A O   
894  C CB  . LYS A 155 ? 0.3303 0.3374 0.5376 0.0041  -0.0516 0.0114  265 LYS A CB  
895  C CG  . LYS A 155 ? 0.3968 0.4166 0.6287 -0.0067 -0.0446 0.0084  265 LYS A CG  
896  C CD  . LYS A 155 ? 0.5965 0.6361 0.8560 -0.0060 -0.0427 0.0066  265 LYS A CD  
897  C CE  . LYS A 155 ? 0.8199 0.8640 1.0947 -0.0157 -0.0290 0.0073  265 LYS A CE  
898  N NZ  . LYS A 155 ? 0.9350 0.9981 1.2382 -0.0158 -0.0249 0.0042  265 LYS A NZ  
899  N N   . TRP A 156 ? 0.2807 0.2555 0.4567 -0.0001 -0.0276 0.0240  266 TRP A N   
900  C CA  . TRP A 156 ? 0.2520 0.2218 0.4294 -0.0048 -0.0175 0.0275  266 TRP A CA  
901  C C   . TRP A 156 ? 0.3067 0.2611 0.4695 -0.0057 -0.0137 0.0281  266 TRP A C   
902  O O   . TRP A 156 ? 0.3029 0.2554 0.4703 -0.0107 -0.0092 0.0281  266 TRP A O   
903  C CB  . TRP A 156 ? 0.2294 0.1992 0.4085 -0.0015 -0.0124 0.0317  266 TRP A CB  
904  C CG  . TRP A 156 ? 0.2386 0.2222 0.4327 -0.0015 -0.0124 0.0309  266 TRP A CG  
905  C CD1 . TRP A 156 ? 0.2676 0.2636 0.4768 -0.0057 -0.0134 0.0275  266 TRP A CD1 
906  C CD2 . TRP A 156 ? 0.2307 0.2155 0.4266 0.0027  -0.0095 0.0330  266 TRP A CD2 
907  N NE1 . TRP A 156 ? 0.2487 0.2538 0.4690 -0.0040 -0.0100 0.0276  266 TRP A NE1 
908  C CE2 . TRP A 156 ? 0.2612 0.2591 0.4721 0.0015  -0.0081 0.0309  266 TRP A CE2 
909  C CE3 . TRP A 156 ? 0.2487 0.2237 0.4357 0.0069  -0.0067 0.0358  266 TRP A CE3 
910  C CZ2 . TRP A 156 ? 0.2395 0.2402 0.4542 0.0053  -0.0042 0.0316  266 TRP A CZ2 
911  C CZ3 . TRP A 156 ? 0.2557 0.2333 0.4470 0.0101  -0.0042 0.0362  266 TRP A CZ3 
912  C CH2 . TRP A 156 ? 0.2511 0.2411 0.4548 0.0097  -0.0031 0.0341  266 TRP A CH2 
913  N N   . PHE A 157 ? 0.2673 0.2090 0.4115 -0.0004 -0.0147 0.0288  267 PHE A N   
914  C CA  . PHE A 157 ? 0.2602 0.1851 0.3886 -0.0007 -0.0087 0.0289  267 PHE A CA  
915  C C   . PHE A 157 ? 0.3208 0.2446 0.4481 -0.0053 -0.0124 0.0236  267 PHE A C   
916  O O   . PHE A 157 ? 0.3089 0.2261 0.4371 -0.0087 -0.0054 0.0234  267 PHE A O   
917  C CB  . PHE A 157 ? 0.2898 0.1975 0.3931 0.0066  -0.0080 0.0309  267 PHE A CB  
918  C CG  . PHE A 157 ? 0.3184 0.2057 0.4021 0.0069  0.0009  0.0307  267 PHE A CG  
919  C CD1 . PHE A 157 ? 0.3287 0.2089 0.4174 0.0053  0.0151  0.0338  267 PHE A CD1 
920  C CD2 . PHE A 157 ? 0.3605 0.2357 0.4221 0.0088  -0.0048 0.0265  267 PHE A CD2 
921  C CE1 . PHE A 157 ? 0.3597 0.2212 0.4329 0.0057  0.0261  0.0333  267 PHE A CE1 
922  C CE2 . PHE A 157 ? 0.4063 0.2598 0.4468 0.0096  0.0057  0.0262  267 PHE A CE2 
923  C CZ  . PHE A 157 ? 0.3770 0.2241 0.4245 0.0080  0.0223  0.0298  267 PHE A CZ  
924  N N   . ARG A 158 ? 0.3072 0.2374 0.4345 -0.0053 -0.0238 0.0185  268 ARG A N   
925  C CA  . ARG A 158 ? 0.3221 0.2508 0.4496 -0.0106 -0.0286 0.0117  268 ARG A CA  
926  C C   . ARG A 158 ? 0.3455 0.2844 0.4958 -0.0191 -0.0239 0.0111  268 ARG A C   
927  O O   . ARG A 158 ? 0.3372 0.2704 0.4876 -0.0245 -0.0236 0.0067  268 ARG A O   
928  C CB  . ARG A 158 ? 0.3620 0.2967 0.4873 -0.0083 -0.0440 0.0050  268 ARG A CB  
929  C CG  . ARG A 158 ? 0.5016 0.4170 0.5935 0.0006  -0.0492 0.0048  268 ARG A CG  
930  C CD  . ARG A 158 ? 0.8258 0.7472 0.9148 0.0047  -0.0683 -0.0026 268 ARG A CD  
931  N NE  . ARG A 158 ? 1.1710 1.0699 1.2215 0.0153  -0.0741 -0.0016 268 ARG A NE  
932  C CZ  . ARG A 158 ? 1.4989 1.3992 1.5402 0.0245  -0.0909 -0.0041 268 ARG A CZ  
933  N NH1 . ARG A 158 ? 1.4195 1.2936 1.4190 0.0351  -0.0947 -0.0019 268 ARG A NH1 
934  N NH2 . ARG A 158 ? 1.3819 1.3087 1.4553 0.0238  -0.1034 -0.0088 268 ARG A NH2 
935  N N   . MET A 159 ? 0.2887 0.2388 0.4546 -0.0198 -0.0195 0.0158  269 MET A N   
936  C CA  . MET A 159 ? 0.2799 0.2338 0.4601 -0.0261 -0.0134 0.0171  269 MET A CA  
937  C C   . MET A 159 ? 0.3421 0.2840 0.5159 -0.0251 -0.0052 0.0217  269 MET A C   
938  O O   . MET A 159 ? 0.3730 0.3126 0.5528 -0.0287 -0.0008 0.0233  269 MET A O   
939  C CB  . MET A 159 ? 0.2918 0.2596 0.4869 -0.0264 -0.0120 0.0196  269 MET A CB  
940  C CG  . MET A 159 ? 0.3367 0.3192 0.5481 -0.0294 -0.0179 0.0139  269 MET A CG  
941  S SD  . MET A 159 ? 0.3753 0.3727 0.6035 -0.0284 -0.0129 0.0167  269 MET A SD  
942  C CE  . MET A 159 ? 0.3416 0.3328 0.5752 -0.0371 -0.0004 0.0192  269 MET A CE  
943  N N   . GLY A 160 ? 0.2744 0.2082 0.4369 -0.0200 -0.0028 0.0235  270 GLY A N   
944  C CA  . GLY A 160 ? 0.2697 0.1951 0.4322 -0.0185 0.0045  0.0263  270 GLY A CA  
945  C C   . GLY A 160 ? 0.2984 0.2289 0.4686 -0.0156 0.0069  0.0306  270 GLY A C   
946  O O   . GLY A 160 ? 0.2908 0.2175 0.4664 -0.0143 0.0110  0.0319  270 GLY A O   
947  N N   . PHE A 161 ? 0.2529 0.1923 0.4256 -0.0143 0.0036  0.0319  271 PHE A N   
948  C CA  . PHE A 161 ? 0.2568 0.1995 0.4355 -0.0119 0.0052  0.0347  271 PHE A CA  
949  C C   . PHE A 161 ? 0.3145 0.2502 0.4895 -0.0088 0.0099  0.0352  271 PHE A C   
950  O O   . PHE A 161 ? 0.3032 0.2323 0.4659 -0.0068 0.0108  0.0349  271 PHE A O   
951  C CB  . PHE A 161 ? 0.2721 0.2241 0.4535 -0.0111 0.0020  0.0353  271 PHE A CB  
952  C CG  . PHE A 161 ? 0.2859 0.2435 0.4724 -0.0147 0.0013  0.0352  271 PHE A CG  
953  C CD1 . PHE A 161 ? 0.3187 0.2736 0.5060 -0.0151 0.0028  0.0373  271 PHE A CD1 
954  C CD2 . PHE A 161 ? 0.2957 0.2604 0.4863 -0.0173 -0.0009 0.0327  271 PHE A CD2 
955  C CE1 . PHE A 161 ? 0.3397 0.2952 0.5273 -0.0182 0.0050  0.0382  271 PHE A CE1 
956  C CE2 . PHE A 161 ? 0.3315 0.3001 0.5289 -0.0218 0.0018  0.0325  271 PHE A CE2 
957  C CZ  . PHE A 161 ? 0.3166 0.2789 0.5104 -0.0222 0.0061  0.0359  271 PHE A CZ  
958  N N   . ARG A 162 ? 0.2626 0.1983 0.4478 -0.0082 0.0130  0.0358  272 ARG A N   
959  C CA  . ARG A 162 ? 0.2717 0.2009 0.4589 -0.0068 0.0201  0.0358  272 ARG A CA  
960  C C   . ARG A 162 ? 0.3291 0.2631 0.5276 -0.0065 0.0192  0.0356  272 ARG A C   
961  O O   . ARG A 162 ? 0.3582 0.2865 0.5598 -0.0063 0.0259  0.0355  272 ARG A O   
962  C CB  . ARG A 162 ? 0.2530 0.1767 0.4483 -0.0074 0.0272  0.0341  272 ARG A CB  
963  C CG  . ARG A 162 ? 0.3162 0.2306 0.4971 -0.0074 0.0303  0.0333  272 ARG A CG  
964  C CD  . ARG A 162 ? 0.3047 0.2075 0.4637 -0.0054 0.0337  0.0342  272 ARG A CD  
965  N NE  . ARG A 162 ? 0.3201 0.2118 0.4623 -0.0051 0.0353  0.0321  272 ARG A NE  
966  C CZ  . ARG A 162 ? 0.3916 0.2846 0.5233 -0.0060 0.0262  0.0301  272 ARG A CZ  
967  N NH1 . ARG A 162 ? 0.3269 0.2075 0.4422 -0.0059 0.0276  0.0268  272 ARG A NH1 
968  N NH2 . ARG A 162 ? 0.2514 0.1577 0.3895 -0.0071 0.0163  0.0304  272 ARG A NH2 
969  N N   . THR A 163 ? 0.2582 0.1999 0.4618 -0.0068 0.0120  0.0352  273 THR A N   
970  C CA  . THR A 163 ? 0.2474 0.1919 0.4597 -0.0064 0.0096  0.0335  273 THR A CA  
971  C C   . THR A 163 ? 0.2931 0.2411 0.4968 -0.0053 0.0048  0.0344  273 THR A C   
972  O O   . THR A 163 ? 0.2878 0.2385 0.4846 -0.0056 0.0026  0.0359  273 THR A O   
973  C CB  . THR A 163 ? 0.2912 0.2389 0.5184 -0.0064 0.0050  0.0306  273 THR A CB  
974  O OG1 . THR A 163 ? 0.2899 0.2387 0.5094 -0.0053 -0.0016 0.0320  273 THR A OG1 
975  C CG2 . THR A 163 ? 0.2752 0.2215 0.5163 -0.0069 0.0107  0.0289  273 THR A CG2 
976  N N   . LEU A 164 ? 0.2401 0.1872 0.4456 -0.0044 0.0044  0.0328  274 LEU A N   
977  C CA  . LEU A 164 ? 0.2378 0.1868 0.4355 -0.0027 0.0018  0.0329  274 LEU A CA  
978  C C   . LEU A 164 ? 0.2696 0.2195 0.4636 -0.0026 -0.0037 0.0320  274 LEU A C   
979  O O   . LEU A 164 ? 0.2726 0.2235 0.4576 -0.0019 -0.0031 0.0334  274 LEU A O   
980  C CB  . LEU A 164 ? 0.2384 0.1830 0.4375 -0.0015 0.0036  0.0309  274 LEU A CB  
981  C CG  . LEU A 164 ? 0.2933 0.2321 0.4889 0.0003  0.0099  0.0334  274 LEU A CG  
982  C CD1 . LEU A 164 ? 0.2950 0.2263 0.4916 0.0014  0.0126  0.0315  274 LEU A CD1 
983  C CD2 . LEU A 164 ? 0.2787 0.2215 0.4650 0.0035  0.0089  0.0366  274 LEU A CD2 
984  N N   . SER A 165 ? 0.2106 0.1591 0.4113 -0.0028 -0.0087 0.0296  275 SER A N   
985  C CA  . SER A 165 ? 0.2299 0.1750 0.4225 -0.0009 -0.0157 0.0293  275 SER A CA  
986  C C   . SER A 165 ? 0.2788 0.2224 0.4614 -0.0015 -0.0129 0.0339  275 SER A C   
987  O O   . SER A 165 ? 0.2773 0.2155 0.4452 -0.0005 -0.0128 0.0356  275 SER A O   
988  C CB  . SER A 165 ? 0.2686 0.2143 0.4748 0.0002  -0.0231 0.0257  275 SER A CB  
989  O OG  . SER A 165 ? 0.4831 0.4228 0.6778 0.0040  -0.0320 0.0259  275 SER A OG  
990  N N   . LYS A 166 ? 0.2256 0.1717 0.4153 -0.0035 -0.0093 0.0355  276 LYS A N   
991  C CA  . LYS A 166 ? 0.2321 0.1761 0.4152 -0.0053 -0.0064 0.0387  276 LYS A CA  
992  C C   . LYS A 166 ? 0.2889 0.2371 0.4676 -0.0076 -0.0013 0.0397  276 LYS A C   
993  O O   . LYS A 166 ? 0.2901 0.2355 0.4626 -0.0095 0.0018  0.0415  276 LYS A O   
994  C CB  . LYS A 166 ? 0.2697 0.2138 0.4605 -0.0068 -0.0041 0.0386  276 LYS A CB  
995  C CG  . LYS A 166 ? 0.4497 0.3906 0.6489 -0.0042 -0.0078 0.0375  276 LYS A CG  
996  C CD  . LYS A 166 ? 0.6294 0.5617 0.8206 -0.0026 -0.0104 0.0402  276 LYS A CD  
997  C CE  . LYS A 166 ? 0.7170 0.6471 0.9195 0.0014  -0.0143 0.0388  276 LYS A CE  
998  N NZ  . LYS A 166 ? 0.8313 0.7620 1.0429 -0.0006 -0.0073 0.0376  276 LYS A NZ  
999  N N   . ILE A 167 ? 0.2333 0.1874 0.4162 -0.0070 0.0001  0.0383  277 ILE A N   
1000 C CA  . ILE A 167 ? 0.2278 0.1885 0.4113 -0.0075 0.0032  0.0383  277 ILE A CA  
1001 C C   . ILE A 167 ? 0.2852 0.2438 0.4619 -0.0065 0.0059  0.0385  277 ILE A C   
1002 O O   . ILE A 167 ? 0.2900 0.2505 0.4666 -0.0088 0.0109  0.0393  277 ILE A O   
1003 C CB  . ILE A 167 ? 0.2561 0.2207 0.4434 -0.0049 0.0027  0.0374  277 ILE A CB  
1004 C CG1 . ILE A 167 ? 0.2755 0.2390 0.4634 -0.0058 0.0017  0.0374  277 ILE A CG1 
1005 C CG2 . ILE A 167 ? 0.2328 0.2054 0.4236 -0.0030 0.0042  0.0366  277 ILE A CG2 
1006 C CD1 . ILE A 167 ? 0.3336 0.2922 0.5184 -0.0025 0.0024  0.0377  277 ILE A CD1 
1007 N N   . GLN A 168 ? 0.2738 0.2273 0.4449 -0.0034 0.0036  0.0372  278 GLN A N   
1008 C CA  . GLN A 168 ? 0.2947 0.2427 0.4544 -0.0014 0.0061  0.0365  278 GLN A CA  
1009 C C   . GLN A 168 ? 0.3513 0.2891 0.4963 -0.0020 0.0081  0.0388  278 GLN A C   
1010 O O   . GLN A 168 ? 0.3630 0.2958 0.4976 -0.0015 0.0152  0.0393  278 GLN A O   
1011 C CB  . GLN A 168 ? 0.3145 0.2564 0.4700 0.0016  0.0006  0.0331  278 GLN A CB  
1012 C CG  . GLN A 168 ? 0.5581 0.5038 0.7207 0.0033  0.0025  0.0310  278 GLN A CG  
1013 C CD  . GLN A 168 ? 0.7368 0.6754 0.8979 0.0046  -0.0028 0.0266  278 GLN A CD  
1014 O OE1 . GLN A 168 ? 0.7028 0.6417 0.8739 0.0030  -0.0071 0.0251  278 GLN A OE1 
1015 N NE2 . GLN A 168 ? 0.5214 0.4530 0.6710 0.0071  -0.0018 0.0237  278 GLN A NE2 
1016 N N   . SER A 169 ? 0.3025 0.2345 0.4446 -0.0022 0.0026  0.0403  279 SER A N   
1017 C CA  . SER A 169 ? 0.3018 0.2194 0.4257 -0.0012 0.0034  0.0435  279 SER A CA  
1018 C C   . SER A 169 ? 0.3171 0.2342 0.4434 -0.0060 0.0121  0.0470  279 SER A C   
1019 O O   . SER A 169 ? 0.3173 0.2192 0.4263 -0.0057 0.0162  0.0507  279 SER A O   
1020 C CB  . SER A 169 ? 0.3347 0.2454 0.4554 0.0026  -0.0082 0.0430  279 SER A CB  
1021 O OG  . SER A 169 ? 0.2575 0.1765 0.3964 0.0006  -0.0103 0.0429  279 SER A OG  
1022 N N   . ASP A 170 ? 0.2529 0.1842 0.3988 -0.0103 0.0147  0.0456  280 ASP A N   
1023 C CA  . ASP A 170 ? 0.2479 0.1801 0.4001 -0.0161 0.0215  0.0469  280 ASP A CA  
1024 C C   . ASP A 170 ? 0.3012 0.2303 0.4495 -0.0190 0.0339  0.0480  280 ASP A C   
1025 O O   . ASP A 170 ? 0.2824 0.2186 0.4343 -0.0175 0.0375  0.0459  280 ASP A O   
1026 C CB  . ASP A 170 ? 0.2501 0.1977 0.4221 -0.0191 0.0191  0.0435  280 ASP A CB  
1027 C CG  . ASP A 170 ? 0.3377 0.2840 0.5160 -0.0251 0.0223  0.0433  280 ASP A CG  
1028 O OD1 . ASP A 170 ? 0.3703 0.3228 0.5589 -0.0301 0.0291  0.0416  280 ASP A OD1 
1029 O OD2 . ASP A 170 ? 0.3789 0.3179 0.5540 -0.0249 0.0186  0.0441  280 ASP A OD2 
1030 N N   . LYS A 171 ? 0.2851 0.2014 0.4254 -0.0229 0.0420  0.0512  281 LYS A N   
1031 C CA  . LYS A 171 ? 0.2989 0.2086 0.4345 -0.0264 0.0573  0.0527  281 LYS A CA  
1032 C C   . LYS A 171 ? 0.3367 0.2635 0.5015 -0.0347 0.0654  0.0486  281 LYS A C   
1033 O O   . LYS A 171 ? 0.3395 0.2655 0.5086 -0.0383 0.0799  0.0484  281 LYS A O   
1034 C CB  . LYS A 171 ? 0.3604 0.2423 0.4681 -0.0259 0.0641  0.0590  281 LYS A CB  
1035 C CG  . LYS A 171 ? 0.4653 0.3294 0.5421 -0.0163 0.0548  0.0620  281 LYS A CG  
1036 C CD  . LYS A 171 ? 0.5373 0.3986 0.6005 -0.0122 0.0594  0.0605  281 LYS A CD  
1037 C CE  . LYS A 171 ? 0.6637 0.5152 0.7054 -0.0032 0.0444  0.0598  281 LYS A CE  
1038 N NZ  . LYS A 171 ? 0.6730 0.5132 0.6921 0.0010  0.0499  0.0586  281 LYS A NZ  
1039 N N   . SER A 172 ? 0.2807 0.2222 0.4655 -0.0374 0.0563  0.0447  282 SER A N   
1040 C CA  . SER A 172 ? 0.2789 0.2375 0.4927 -0.0448 0.0598  0.0391  282 SER A CA  
1041 C C   . SER A 172 ? 0.2988 0.2802 0.5325 -0.0413 0.0523  0.0337  282 SER A C   
1042 O O   . SER A 172 ? 0.2911 0.2885 0.5503 -0.0453 0.0566  0.0287  282 SER A O   
1043 C CB  . SER A 172 ? 0.3119 0.2684 0.5313 -0.0497 0.0540  0.0372  282 SER A CB  
1044 O OG  . SER A 172 ? 0.4694 0.4043 0.6744 -0.0537 0.0639  0.0419  282 SER A OG  
1045 N N   . LEU A 173 ? 0.2446 0.2272 0.4683 -0.0336 0.0415  0.0346  283 LEU A N   
1046 C CA  . LEU A 173 ? 0.2247 0.2239 0.4619 -0.0286 0.0343  0.0309  283 LEU A CA  
1047 C C   . LEU A 173 ? 0.3304 0.3369 0.5763 -0.0263 0.0432  0.0297  283 LEU A C   
1048 O O   . LEU A 173 ? 0.3620 0.3559 0.5923 -0.0256 0.0531  0.0330  283 LEU A O   
1049 C CB  . LEU A 173 ? 0.2008 0.1944 0.4228 -0.0217 0.0244  0.0330  283 LEU A CB  
1050 C CG  . LEU A 173 ? 0.2197 0.2096 0.4373 -0.0221 0.0156  0.0329  283 LEU A CG  
1051 C CD1 . LEU A 173 ? 0.1914 0.1764 0.3983 -0.0159 0.0099  0.0345  283 LEU A CD1 
1052 C CD2 . LEU A 173 ? 0.2028 0.2045 0.4357 -0.0244 0.0096  0.0278  283 LEU A CD2 
1053 N N   . ARG A 174 ? 0.2891 0.3149 0.5587 -0.0240 0.0393  0.0247  284 ARG A N   
1054 C CA  . ARG A 174 ? 0.2902 0.3258 0.5732 -0.0202 0.0470  0.0225  284 ARG A CA  
1055 C C   . ARG A 174 ? 0.3401 0.3813 0.6224 -0.0106 0.0358  0.0218  284 ARG A C   
1056 O O   . ARG A 174 ? 0.3428 0.3907 0.6303 -0.0081 0.0227  0.0201  284 ARG A O   
1057 C CB  . ARG A 174 ? 0.2586 0.3133 0.5769 -0.0257 0.0539  0.0165  284 ARG A CB  
1058 C CG  . ARG A 174 ? 0.3697 0.4143 0.6872 -0.0356 0.0708  0.0180  284 ARG A CG  
1059 C CD  . ARG A 174 ? 0.4622 0.5254 0.8187 -0.0420 0.0830  0.0114  284 ARG A CD  
1060 N NE  . ARG A 174 ? 0.5829 0.6700 0.9738 -0.0440 0.0688  0.0031  284 ARG A NE  
1061 C CZ  . ARG A 174 ? 0.7986 0.8869 1.1990 -0.0528 0.0640  -0.0002 284 ARG A CZ  
1062 N NH1 . ARG A 174 ? 0.7022 0.7688 1.0815 -0.0603 0.0733  0.0048  284 ARG A NH1 
1063 N NH2 . ARG A 174 ? 0.6098 0.7191 1.0389 -0.0534 0.0485  -0.0090 284 ARG A NH2 
1064 N N   . PHE A 175 ? 0.3020 0.3370 0.5741 -0.0048 0.0415  0.0233  285 PHE A N   
1065 C CA  . PHE A 175 ? 0.2833 0.3181 0.5507 0.0043  0.0333  0.0235  285 PHE A CA  
1066 C C   . PHE A 175 ? 0.3070 0.3547 0.5946 0.0108  0.0378  0.0198  285 PHE A C   
1067 O O   . PHE A 175 ? 0.3141 0.3635 0.6088 0.0091  0.0519  0.0183  285 PHE A O   
1068 C CB  . PHE A 175 ? 0.3055 0.3202 0.5444 0.0063  0.0345  0.0271  285 PHE A CB  
1069 C CG  . PHE A 175 ? 0.3132 0.3160 0.5352 0.0014  0.0297  0.0302  285 PHE A CG  
1070 C CD1 . PHE A 175 ? 0.3617 0.3533 0.5703 -0.0034 0.0363  0.0322  285 PHE A CD1 
1071 C CD2 . PHE A 175 ? 0.3248 0.3259 0.5434 0.0025  0.0194  0.0312  285 PHE A CD2 
1072 C CE1 . PHE A 175 ? 0.3679 0.3489 0.5632 -0.0062 0.0308  0.0349  285 PHE A CE1 
1073 C CE2 . PHE A 175 ? 0.3505 0.3418 0.5573 -0.0013 0.0162  0.0334  285 PHE A CE2 
1074 C CZ  . PHE A 175 ? 0.3315 0.3140 0.5285 -0.0053 0.0211  0.0351  285 PHE A CZ  
1075 N N   . THR A 176 ? 0.2281 0.2821 0.5223 0.0194  0.0269  0.0188  286 THR A N   
1076 C CA  . THR A 176 ? 0.2207 0.2857 0.5337 0.0283  0.0292  0.0155  286 THR A CA  
1077 C C   . THR A 176 ? 0.2649 0.3132 0.5579 0.0322  0.0390  0.0174  286 THR A C   
1078 O O   . THR A 176 ? 0.2608 0.2908 0.5269 0.0291  0.0390  0.0208  286 THR A O   
1079 C CB  . THR A 176 ? 0.2817 0.3537 0.6020 0.0378  0.0129  0.0148  286 THR A CB  
1080 O OG1 . THR A 176 ? 0.2237 0.2753 0.5150 0.0422  0.0075  0.0198  286 THR A OG1 
1081 C CG2 . THR A 176 ? 0.2368 0.3230 0.5727 0.0343  0.0006  0.0116  286 THR A CG2 
1082 N N   . GLN A 177 ? 0.2264 0.2808 0.5335 0.0391  0.0468  0.0143  287 GLN A N   
1083 C CA  . GLN A 177 ? 0.2497 0.2870 0.5375 0.0434  0.0563  0.0146  287 GLN A CA  
1084 C C   . GLN A 177 ? 0.3128 0.3340 0.5795 0.0487  0.0459  0.0175  287 GLN A C   
1085 O O   . GLN A 177 ? 0.3072 0.3093 0.5496 0.0471  0.0494  0.0183  287 GLN A O   
1086 C CB  . GLN A 177 ? 0.2723 0.3205 0.5832 0.0510  0.0672  0.0100  287 GLN A CB  
1087 C CG  . GLN A 177 ? 0.5894 0.6234 0.8847 0.0493  0.0864  0.0084  287 GLN A CG  
1088 C CD  . GLN A 177 ? 0.8435 0.8726 1.1294 0.0383  0.0979  0.0095  287 GLN A CD  
1089 O OE1 . GLN A 177 ? 0.7563 0.8000 1.0617 0.0314  0.0974  0.0096  287 GLN A OE1 
1090 N NE2 . GLN A 177 ? 0.7957 0.8015 1.0491 0.0368  0.1083  0.0103  287 GLN A NE2 
1091 N N   . MET A 178 ? 0.2798 0.3071 0.5546 0.0546  0.0329  0.0189  288 MET A N   
1092 C CA  . MET A 178 ? 0.2764 0.2867 0.5318 0.0592  0.0248  0.0225  288 MET A CA  
1093 C C   . MET A 178 ? 0.2942 0.2910 0.5280 0.0497  0.0226  0.0255  288 MET A C   
1094 O O   . MET A 178 ? 0.3030 0.2822 0.5195 0.0492  0.0244  0.0263  288 MET A O   
1095 C CB  . MET A 178 ? 0.3066 0.3247 0.5717 0.0677  0.0117  0.0238  288 MET A CB  
1096 C CG  . MET A 178 ? 0.3667 0.3654 0.6148 0.0770  0.0077  0.0274  288 MET A CG  
1097 S SD  . MET A 178 ? 0.4310 0.4301 0.6782 0.0887  -0.0089 0.0305  288 MET A SD  
1098 C CE  . MET A 178 ? 0.4067 0.4350 0.6922 0.0979  -0.0132 0.0243  288 MET A CE  
1099 N N   . GLN A 179 ? 0.2364 0.2417 0.4739 0.0419  0.0198  0.0260  289 GLN A N   
1100 C CA  . GLN A 179 ? 0.2284 0.2236 0.4500 0.0338  0.0176  0.0284  289 GLN A CA  
1101 C C   . GLN A 179 ? 0.3071 0.2916 0.5156 0.0290  0.0250  0.0274  289 GLN A C   
1102 O O   . GLN A 179 ? 0.2967 0.2683 0.4913 0.0264  0.0225  0.0282  289 GLN A O   
1103 C CB  . GLN A 179 ? 0.2248 0.2309 0.4546 0.0277  0.0133  0.0287  289 GLN A CB  
1104 C CG  . GLN A 179 ? 0.2736 0.2848 0.5081 0.0324  0.0027  0.0293  289 GLN A CG  
1105 C CD  . GLN A 179 ? 0.3221 0.3483 0.5713 0.0276  -0.0018 0.0267  289 GLN A CD  
1106 O OE1 . GLN A 179 ? 0.1634 0.1954 0.4203 0.0200  0.0046  0.0252  289 GLN A OE1 
1107 N NE2 . GLN A 179 ? 0.1511 0.1811 0.4023 0.0321  -0.0131 0.0259  289 GLN A NE2 
1108 N N   . LYS A 180 ? 0.2739 0.2628 0.4867 0.0285  0.0343  0.0251  290 LYS A N   
1109 C CA  . LYS A 180 ? 0.2912 0.2663 0.4854 0.0257  0.0413  0.0240  290 LYS A CA  
1110 C C   . LYS A 180 ? 0.3512 0.3110 0.5316 0.0300  0.0398  0.0218  290 LYS A C   
1111 O O   . LYS A 180 ? 0.3430 0.2896 0.5068 0.0269  0.0362  0.0210  290 LYS A O   
1112 C CB  . LYS A 180 ? 0.3357 0.3152 0.5352 0.0257  0.0547  0.0220  290 LYS A CB  
1113 C CG  . LYS A 180 ? 0.3990 0.3880 0.6084 0.0187  0.0586  0.0236  290 LYS A CG  
1114 C CD  . LYS A 180 ? 0.4801 0.4725 0.6974 0.0181  0.0754  0.0216  290 LYS A CD  
1115 C CE  . LYS A 180 ? 0.5857 0.5873 0.8171 0.0101  0.0810  0.0226  290 LYS A CE  
1116 N NZ  . LYS A 180 ? 0.7161 0.7191 0.9564 0.0084  0.1011  0.0206  290 LYS A NZ  
1117 N N   . ALA A 181 ? 0.3233 0.2848 0.5124 0.0375  0.0415  0.0205  291 ALA A N   
1118 C CA  . ALA A 181 ? 0.3240 0.2695 0.5020 0.0415  0.0409  0.0182  291 ALA A CA  
1119 C C   . ALA A 181 ? 0.3573 0.2952 0.5310 0.0383  0.0321  0.0203  291 ALA A C   
1120 O O   . ALA A 181 ? 0.3501 0.2739 0.5126 0.0357  0.0305  0.0174  291 ALA A O   
1121 C CB  . ALA A 181 ? 0.3389 0.2877 0.5288 0.0512  0.0447  0.0174  291 ALA A CB  
1122 N N   . GLY A 182 ? 0.3126 0.2596 0.4955 0.0381  0.0268  0.0245  292 GLY A N   
1123 C CA  . GLY A 182 ? 0.2942 0.2340 0.4735 0.0350  0.0215  0.0270  292 GLY A CA  
1124 C C   . GLY A 182 ? 0.3435 0.2791 0.5169 0.0268  0.0191  0.0255  292 GLY A C   
1125 O O   . GLY A 182 ? 0.3234 0.2484 0.4943 0.0241  0.0176  0.0243  292 GLY A O   
1126 N N   . PHE A 183 ? 0.3084 0.2515 0.4806 0.0231  0.0189  0.0253  293 PHE A N   
1127 C CA  . PHE A 183 ? 0.3054 0.2439 0.4708 0.0174  0.0149  0.0240  293 PHE A CA  
1128 C C   . PHE A 183 ? 0.3943 0.3204 0.5471 0.0177  0.0145  0.0187  293 PHE A C   
1129 O O   . PHE A 183 ? 0.3904 0.3098 0.5416 0.0147  0.0083  0.0155  293 PHE A O   
1130 C CB  . PHE A 183 ? 0.3186 0.2650 0.4838 0.0142  0.0151  0.0264  293 PHE A CB  
1131 C CG  . PHE A 183 ? 0.3145 0.2693 0.4894 0.0118  0.0122  0.0299  293 PHE A CG  
1132 C CD1 . PHE A 183 ? 0.3398 0.3061 0.5232 0.0119  0.0142  0.0316  293 PHE A CD1 
1133 C CD2 . PHE A 183 ? 0.3349 0.2860 0.5116 0.0092  0.0080  0.0304  293 PHE A CD2 
1134 C CE1 . PHE A 183 ? 0.3423 0.3141 0.5317 0.0100  0.0104  0.0335  293 PHE A CE1 
1135 C CE2 . PHE A 183 ? 0.3638 0.3198 0.5457 0.0074  0.0066  0.0331  293 PHE A CE2 
1136 C CZ  . PHE A 183 ? 0.3380 0.3033 0.5241 0.0080  0.0071  0.0345  293 PHE A CZ  
1137 N N   . LEU A 184 ? 0.3747 0.2977 0.5194 0.0216  0.0210  0.0168  294 LEU A N   
1138 C CA  . LEU A 184 ? 0.3933 0.3015 0.5205 0.0228  0.0210  0.0109  294 LEU A CA  
1139 C C   . LEU A 184 ? 0.4343 0.3318 0.5628 0.0228  0.0169  0.0058  294 LEU A C   
1140 O O   . LEU A 184 ? 0.4461 0.3330 0.5647 0.0207  0.0101  -0.0002 294 LEU A O   
1141 C CB  . LEU A 184 ? 0.4092 0.3150 0.5283 0.0276  0.0321  0.0099  294 LEU A CB  
1142 C CG  . LEU A 184 ? 0.5117 0.3985 0.6052 0.0297  0.0341  0.0038  294 LEU A CG  
1143 C CD1 . LEU A 184 ? 0.5313 0.4089 0.6047 0.0266  0.0261  0.0033  294 LEU A CD1 
1144 C CD2 . LEU A 184 ? 0.5445 0.4294 0.6321 0.0344  0.0489  0.0033  294 LEU A CD2 
1145 N N   . TYR A 185 ? 0.3517 0.2507 0.4922 0.0255  0.0207  0.0076  295 TYR A N   
1146 C CA  . TYR A 185 ? 0.3415 0.2278 0.4841 0.0252  0.0200  0.0034  295 TYR A CA  
1147 C C   . TYR A 185 ? 0.3733 0.2615 0.5297 0.0210  0.0177  0.0066  295 TYR A C   
1148 O O   . TYR A 185 ? 0.3973 0.2744 0.5577 0.0209  0.0207  0.0054  295 TYR A O   
1149 C CB  . TYR A 185 ? 0.3493 0.2297 0.4909 0.0328  0.0283  0.0035  295 TYR A CB  
1150 C CG  . TYR A 185 ? 0.3776 0.2562 0.5074 0.0372  0.0341  0.0003  295 TYR A CG  
1151 C CD1 . TYR A 185 ? 0.3937 0.2847 0.5305 0.0428  0.0412  0.0043  295 TYR A CD1 
1152 C CD2 . TYR A 185 ? 0.4077 0.2723 0.5192 0.0356  0.0325  -0.0072 295 TYR A CD2 
1153 C CE1 . TYR A 185 ? 0.4118 0.3008 0.5396 0.0462  0.0499  0.0013  295 TYR A CE1 
1154 C CE2 . TYR A 185 ? 0.4323 0.2917 0.5280 0.0398  0.0401  -0.0098 295 TYR A CE2 
1155 C CZ  . TYR A 185 ? 0.4880 0.3596 0.5927 0.0448  0.0505  -0.0053 295 TYR A CZ  
1156 O OH  . TYR A 185 ? 0.4606 0.3257 0.5514 0.0487  0.0615  -0.0082 295 TYR A OH  
1157 N N   . TYR A 186 ? 0.2967 0.1961 0.4590 0.0173  0.0138  0.0104  296 TYR A N   
1158 C CA  . TYR A 186 ? 0.2802 0.1810 0.4537 0.0138  0.0140  0.0138  296 TYR A CA  
1159 C C   . TYR A 186 ? 0.3279 0.2173 0.5101 0.0088  0.0145  0.0086  296 TYR A C   
1160 O O   . TYR A 186 ? 0.3159 0.1968 0.5018 0.0090  0.0213  0.0117  296 TYR A O   
1161 C CB  . TYR A 186 ? 0.2630 0.1756 0.4408 0.0102  0.0095  0.0165  296 TYR A CB  
1162 C CG  . TYR A 186 ? 0.2663 0.1790 0.4534 0.0075  0.0121  0.0201  296 TYR A CG  
1163 C CD1 . TYR A 186 ? 0.2844 0.1987 0.4680 0.0111  0.0158  0.0265  296 TYR A CD1 
1164 C CD2 . TYR A 186 ? 0.2568 0.1672 0.4563 0.0017  0.0111  0.0164  296 TYR A CD2 
1165 C CE1 . TYR A 186 ? 0.2895 0.1992 0.4756 0.0093  0.0198  0.0298  296 TYR A CE1 
1166 C CE2 . TYR A 186 ? 0.2409 0.1490 0.4483 -0.0008 0.0171  0.0196  296 TYR A CE2 
1167 C CZ  . TYR A 186 ? 0.3054 0.2116 0.5030 0.0032  0.0220  0.0266  296 TYR A CZ  
1168 O OH  . TYR A 186 ? 0.3279 0.2278 0.5272 0.0014  0.0291  0.0298  296 TYR A OH  
1169 N N   . GLU A 187 ? 0.2913 0.1798 0.4769 0.0043  0.0072  0.0007  297 GLU A N   
1170 C CA  . GLU A 187 ? 0.2839 0.1650 0.4848 -0.0020 0.0063  -0.0063 297 GLU A CA  
1171 C C   . GLU A 187 ? 0.3352 0.1997 0.5338 -0.0011 0.0140  -0.0087 297 GLU A C   
1172 O O   . GLU A 187 ? 0.3278 0.1841 0.5388 -0.0053 0.0212  -0.0086 297 GLU A O   
1173 C CB  . GLU A 187 ? 0.3042 0.1881 0.5089 -0.0053 -0.0066 -0.0160 297 GLU A CB  
1174 C CG  . GLU A 187 ? 0.4832 0.3810 0.6957 -0.0067 -0.0139 -0.0140 297 GLU A CG  
1175 C CD  . GLU A 187 ? 0.8444 0.7493 1.0790 -0.0111 -0.0084 -0.0106 297 GLU A CD  
1176 O OE1 . GLU A 187 ? 0.8919 0.7912 1.1442 -0.0162 -0.0020 -0.0141 297 GLU A OE1 
1177 O OE2 . GLU A 187 ? 0.7959 0.7102 1.0299 -0.0097 -0.0093 -0.0049 297 GLU A OE2 
1178 N N   . ASP A 188 ? 0.3143 0.1721 0.4966 0.0047  0.0145  -0.0102 298 ASP A N   
1179 C CA  . ASP A 188 ? 0.3324 0.1726 0.5104 0.0072  0.0221  -0.0122 298 ASP A CA  
1180 C C   . ASP A 188 ? 0.3645 0.1994 0.5418 0.0120  0.0323  -0.0021 298 ASP A C   
1181 O O   . ASP A 188 ? 0.3574 0.1761 0.5389 0.0100  0.0398  -0.0023 298 ASP A O   
1182 C CB  . ASP A 188 ? 0.3730 0.2081 0.5332 0.0138  0.0215  -0.0158 298 ASP A CB  
1183 C CG  . ASP A 188 ? 0.4956 0.3231 0.6492 0.0103  0.0132  -0.0279 298 ASP A CG  
1184 O OD1 . ASP A 188 ? 0.5332 0.3611 0.7001 0.0024  0.0057  -0.0348 298 ASP A OD1 
1185 O OD2 . ASP A 188 ? 0.5357 0.3560 0.6709 0.0157  0.0141  -0.0314 298 ASP A OD2 
1186 N N   . LEU A 189 ? 0.3306 0.1777 0.5020 0.0182  0.0321  0.0062  299 LEU A N   
1187 C CA  . LEU A 189 ? 0.3335 0.1758 0.5004 0.0249  0.0381  0.0154  299 LEU A CA  
1188 C C   . LEU A 189 ? 0.3917 0.2277 0.5638 0.0197  0.0429  0.0197  299 LEU A C   
1189 O O   . LEU A 189 ? 0.4133 0.2322 0.5780 0.0238  0.0507  0.0252  299 LEU A O   
1190 C CB  . LEU A 189 ? 0.3203 0.1794 0.4832 0.0319  0.0343  0.0209  299 LEU A CB  
1191 C CG  . LEU A 189 ? 0.3818 0.2470 0.5410 0.0384  0.0337  0.0180  299 LEU A CG  
1192 C CD1 . LEU A 189 ? 0.3731 0.2545 0.5350 0.0453  0.0317  0.0235  299 LEU A CD1 
1193 C CD2 . LEU A 189 ? 0.3436 0.1907 0.4976 0.0440  0.0394  0.0150  299 LEU A CD2 
1194 N N   . VAL A 190 ? 0.3142 0.1611 0.4978 0.0116  0.0395  0.0171  300 VAL A N   
1195 C CA  . VAL A 190 ? 0.3339 0.1756 0.5243 0.0065  0.0463  0.0204  300 VAL A CA  
1196 C C   . VAL A 190 ? 0.4285 0.2534 0.6314 -0.0010 0.0549  0.0149  300 VAL A C   
1197 O O   . VAL A 190 ? 0.4252 0.2372 0.6297 -0.0037 0.0664  0.0191  300 VAL A O   
1198 C CB  . VAL A 190 ? 0.3759 0.2362 0.5759 0.0020  0.0405  0.0201  300 VAL A CB  
1199 C CG1 . VAL A 190 ? 0.3612 0.2285 0.5816 -0.0066 0.0354  0.0105  300 VAL A CG1 
1200 C CG2 . VAL A 190 ? 0.3836 0.2386 0.5802 0.0019  0.0485  0.0271  300 VAL A CG2 
1201 N N   . SER A 191 ? 0.4259 0.2487 0.6363 -0.0045 0.0505  0.0053  301 SER A N   
1202 C CA  . SER A 191 ? 0.4671 0.2734 0.6915 -0.0122 0.0582  -0.0015 301 SER A CA  
1203 C C   . SER A 191 ? 0.5927 0.3733 0.7998 -0.0058 0.0698  0.0047  301 SER A C   
1204 O O   . SER A 191 ? 0.6000 0.3796 0.7886 0.0048  0.0668  0.0094  301 SER A O   
1205 C CB  . SER A 191 ? 0.5079 0.3193 0.7434 -0.0173 0.0472  -0.0150 301 SER A CB  
1206 O OG  . SER A 191 ? 0.6588 0.4630 0.8758 -0.0103 0.0436  -0.0169 301 SER A OG  
1207 N N   . CYS A 192 ? 0.6221 0.3818 0.8354 -0.0111 0.0839  0.0054  302 CYS A N   
1208 C CA  . CYS A 192 ? 0.6947 0.4264 0.8872 -0.0033 0.0951  0.0131  302 CYS A CA  
1209 C C   . CYS A 192 ? 0.7341 0.4553 0.9207 0.0008  0.0917  0.0067  302 CYS A C   
1210 O O   . CYS A 192 ? 0.7620 0.4845 0.9651 -0.0081 0.0880  -0.0058 302 CYS A O   
1211 C CB  . CYS A 192 ? 0.7523 0.4592 0.9513 -0.0110 0.1139  0.0153  302 CYS A CB  
1212 S SG  . CYS A 192 ? 0.8155 0.5242 1.0112 -0.0125 0.1235  0.0252  302 CYS A SG  
1213 N N   . VAL A 193 ? 0.3090 0.3188 0.4944 0.0061  -0.0063 0.0017  303 VAL A N   
1214 C CA  . VAL A 193 ? 0.2615 0.2656 0.4358 -0.0012 -0.0070 -0.0003 303 VAL A CA  
1215 C C   . VAL A 193 ? 0.2551 0.2667 0.4329 -0.0035 -0.0089 0.0011  303 VAL A C   
1216 O O   . VAL A 193 ? 0.2358 0.2537 0.4209 0.0008  -0.0058 -0.0001 303 VAL A O   
1217 C CB  . VAL A 193 ? 0.2921 0.2872 0.4601 -0.0014 -0.0020 -0.0069 303 VAL A CB  
1218 C CG1 . VAL A 193 ? 0.2763 0.2649 0.4326 -0.0072 -0.0020 -0.0093 303 VAL A CG1 
1219 C CG2 . VAL A 193 ? 0.2987 0.2881 0.4663 0.0003  -0.0005 -0.0068 303 VAL A CG2 
1220 N N   . ASN A 194 ? 0.1981 0.2092 0.3708 -0.0105 -0.0145 0.0043  304 ASN A N   
1221 C CA  . ASN A 194 ? 0.1850 0.2027 0.3626 -0.0140 -0.0175 0.0070  304 ASN A CA  
1222 C C   . ASN A 194 ? 0.2354 0.2411 0.4022 -0.0187 -0.0168 0.0009  304 ASN A C   
1223 O O   . ASN A 194 ? 0.2273 0.2220 0.3838 -0.0182 -0.0132 -0.0050 304 ASN A O   
1224 C CB  . ASN A 194 ? 0.1492 0.1750 0.3313 -0.0191 -0.0257 0.0157  304 ASN A CB  
1225 C CG  . ASN A 194 ? 0.3343 0.3497 0.5018 -0.0265 -0.0319 0.0155  304 ASN A CG  
1226 O OD1 . ASN A 194 ? 0.3034 0.3047 0.4557 -0.0291 -0.0302 0.0086  304 ASN A OD1 
1227 N ND2 . ASN A 194 ? 0.2836 0.3062 0.4549 -0.0299 -0.0392 0.0235  304 ASN A ND2 
1228 N N   . ARG A 195 ? 0.2217 0.2298 0.3921 -0.0227 -0.0198 0.0028  305 ARG A N   
1229 C CA  . ARG A 195 ? 0.2143 0.2099 0.3763 -0.0259 -0.0193 -0.0028 305 ARG A CA  
1230 C C   . ARG A 195 ? 0.2566 0.2365 0.4011 -0.0315 -0.0230 -0.0071 305 ARG A C   
1231 O O   . ARG A 195 ? 0.2464 0.2146 0.3810 -0.0296 -0.0180 -0.0142 305 ARG A O   
1232 C CB  . ARG A 195 ? 0.2190 0.2202 0.3901 -0.0293 -0.0225 0.0015  305 ARG A CB  
1233 C CG  . ARG A 195 ? 0.3201 0.3343 0.5037 -0.0227 -0.0165 0.0036  305 ARG A CG  
1234 C CD  . ARG A 195 ? 0.3600 0.3825 0.5536 -0.0263 -0.0194 0.0101  305 ARG A CD  
1235 N NE  . ARG A 195 ? 0.2744 0.3102 0.4778 -0.0304 -0.0254 0.0198  305 ARG A NE  
1236 C CZ  . ARG A 195 ? 0.3450 0.3960 0.5619 -0.0319 -0.0266 0.0287  305 ARG A CZ  
1237 N NH1 . ARG A 195 ? 0.3188 0.3729 0.5396 -0.0295 -0.0224 0.0290  305 ARG A NH1 
1238 N NH2 . ARG A 195 ? 0.2552 0.3199 0.4828 -0.0358 -0.0322 0.0385  305 ARG A NH2 
1239 N N   . PRO A 196 ? 0.2397 0.2194 0.3791 -0.0378 -0.0312 -0.0030 306 PRO A N   
1240 C CA  . PRO A 196 ? 0.2585 0.2220 0.3771 -0.0425 -0.0343 -0.0083 306 PRO A CA  
1241 C C   . PRO A 196 ? 0.3144 0.2731 0.4233 -0.0372 -0.0265 -0.0130 306 PRO A C   
1242 O O   . PRO A 196 ? 0.3183 0.2632 0.4114 -0.0372 -0.0232 -0.0201 306 PRO A O   
1243 C CB  . PRO A 196 ? 0.2598 0.2284 0.3778 -0.0497 -0.0451 -0.0010 306 PRO A CB  
1244 C CG  . PRO A 196 ? 0.2873 0.2712 0.4259 -0.0510 -0.0488 0.0072  306 PRO A CG  
1245 C CD  . PRO A 196 ? 0.2279 0.2220 0.3795 -0.0412 -0.0386 0.0068  306 PRO A CD  
1246 N N   . GLU A 197 ? 0.2723 0.2420 0.3914 -0.0322 -0.0231 -0.0088 307 GLU A N   
1247 C CA  . GLU A 197 ? 0.2641 0.2305 0.3773 -0.0279 -0.0163 -0.0113 307 GLU A CA  
1248 C C   . GLU A 197 ? 0.2972 0.2594 0.4121 -0.0230 -0.0075 -0.0176 307 GLU A C   
1249 O O   . GLU A 197 ? 0.2897 0.2441 0.3938 -0.0218 -0.0022 -0.0218 307 GLU A O   
1250 C CB  . GLU A 197 ? 0.2737 0.2509 0.3991 -0.0241 -0.0160 -0.0052 307 GLU A CB  
1251 C CG  . GLU A 197 ? 0.3320 0.3123 0.4539 -0.0281 -0.0235 0.0017  307 GLU A CG  
1252 C CD  . GLU A 197 ? 0.4149 0.4072 0.5533 -0.0241 -0.0253 0.0091  307 GLU A CD  
1253 O OE1 . GLU A 197 ? 0.2440 0.2415 0.3953 -0.0176 -0.0205 0.0080  307 GLU A OE1 
1254 O OE2 . GLU A 197 ? 0.3036 0.2998 0.4414 -0.0271 -0.0319 0.0161  307 GLU A OE2 
1255 N N   . ALA A 198 ? 0.2353 0.2037 0.3639 -0.0201 -0.0060 -0.0176 308 ALA A N   
1256 C CA  . ALA A 198 ? 0.2192 0.1852 0.3512 -0.0158 0.0009  -0.0223 308 ALA A CA  
1257 C C   . ALA A 198 ? 0.2934 0.2465 0.4134 -0.0175 0.0025  -0.0279 308 ALA A C   
1258 O O   . ALA A 198 ? 0.2953 0.2438 0.4120 -0.0140 0.0093  -0.0318 308 ALA A O   
1259 C CB  . ALA A 198 ? 0.2044 0.1795 0.3507 -0.0133 0.0009  -0.0204 308 ALA A CB  
1260 N N   . GLU A 199 ? 0.2513 0.1982 0.3649 -0.0228 -0.0041 -0.0281 309 GLU A N   
1261 C CA  . GLU A 199 ? 0.2689 0.2002 0.3695 -0.0243 -0.0038 -0.0345 309 GLU A CA  
1262 C C   . GLU A 199 ? 0.3132 0.2348 0.3947 -0.0239 -0.0004 -0.0390 309 GLU A C   
1263 O O   . GLU A 199 ? 0.3113 0.2226 0.3839 -0.0204 0.0057  -0.0452 309 GLU A O   
1264 C CB  . GLU A 199 ? 0.2950 0.2205 0.3934 -0.0316 -0.0137 -0.0332 309 GLU A CB  
1265 C CG  . GLU A 199 ? 0.3525 0.2846 0.4676 -0.0319 -0.0155 -0.0293 309 GLU A CG  
1266 C CD  . GLU A 199 ? 0.5197 0.4490 0.6410 -0.0262 -0.0085 -0.0325 309 GLU A CD  
1267 O OE1 . GLU A 199 ? 0.3124 0.2302 0.4239 -0.0225 -0.0028 -0.0392 309 GLU A OE1 
1268 O OE2 . GLU A 199 ? 0.3773 0.3171 0.5135 -0.0252 -0.0086 -0.0277 309 GLU A OE2 
1269 N N   . ALA A 200 ? 0.2699 0.1954 0.3451 -0.0270 -0.0042 -0.0352 310 ALA A N   
1270 C CA  . ALA A 200 ? 0.2893 0.2081 0.3457 -0.0270 -0.0012 -0.0377 310 ALA A CA  
1271 C C   . ALA A 200 ? 0.3425 0.2657 0.4031 -0.0202 0.0102  -0.0383 310 ALA A C   
1272 O O   . ALA A 200 ? 0.3392 0.2548 0.3857 -0.0175 0.0168  -0.0430 310 ALA A O   
1273 C CB  . ALA A 200 ? 0.3022 0.2272 0.3550 -0.0318 -0.0083 -0.0312 310 ALA A CB  
1274 N N   . VAL A 201 ? 0.2761 0.2117 0.3562 -0.0173 0.0123  -0.0337 311 VAL A N   
1275 C CA  . VAL A 201 ? 0.2478 0.1886 0.3358 -0.0121 0.0210  -0.0331 311 VAL A CA  
1276 C C   . VAL A 201 ? 0.3331 0.2687 0.4226 -0.0079 0.0273  -0.0386 311 VAL A C   
1277 O O   . VAL A 201 ? 0.3545 0.2890 0.4399 -0.0041 0.0356  -0.0401 311 VAL A O   
1278 C CB  . VAL A 201 ? 0.2636 0.2160 0.3708 -0.0107 0.0196  -0.0279 311 VAL A CB  
1279 C CG1 . VAL A 201 ? 0.2385 0.1952 0.3553 -0.0066 0.0270  -0.0274 311 VAL A CG1 
1280 C CG2 . VAL A 201 ? 0.2683 0.2249 0.3748 -0.0133 0.0147  -0.0220 311 VAL A CG2 
1281 N N   . SER A 202 ? 0.2899 0.2227 0.3857 -0.0083 0.0237  -0.0408 312 SER A N   
1282 C CA  . SER A 202 ? 0.3113 0.2384 0.4099 -0.0041 0.0287  -0.0451 312 SER A CA  
1283 C C   . SER A 202 ? 0.4034 0.3169 0.4834 -0.0018 0.0339  -0.0516 312 SER A C   
1284 O O   . SER A 202 ? 0.3862 0.2990 0.4686 0.0043  0.0426  -0.0537 312 SER A O   
1285 C CB  . SER A 202 ? 0.3308 0.2556 0.4367 -0.0062 0.0226  -0.0452 312 SER A CB  
1286 O OG  . SER A 202 ? 0.3456 0.2665 0.4575 -0.0016 0.0275  -0.0478 312 SER A OG  
1287 N N   . MET A 203 ? 0.3805 0.2839 0.4418 -0.0063 0.0286  -0.0543 313 MET A N   
1288 C CA  . MET A 203 ? 0.4126 0.3010 0.4510 -0.0044 0.0326  -0.0616 313 MET A CA  
1289 C C   . MET A 203 ? 0.4499 0.3448 0.4829 0.0005  0.0431  -0.0604 313 MET A C   
1290 O O   . MET A 203 ? 0.4473 0.3363 0.4731 0.0071  0.0525  -0.0653 313 MET A O   
1291 C CB  . MET A 203 ? 0.4721 0.3502 0.4913 -0.0119 0.0225  -0.0636 313 MET A CB  
1292 C CG  . MET A 203 ? 0.5379 0.4067 0.5599 -0.0172 0.0122  -0.0653 313 MET A CG  
1293 S SD  . MET A 203 ? 0.6238 0.4744 0.6426 -0.0113 0.0170  -0.0743 313 MET A SD  
1294 C CE  . MET A 203 ? 0.6254 0.4564 0.6088 -0.0082 0.0220  -0.0851 313 MET A CE  
1295 N N   . LEU A 204 ? 0.3977 0.3055 0.4360 -0.0024 0.0418  -0.0529 314 LEU A N   
1296 C CA  . LEU A 204 ? 0.3896 0.3060 0.4260 0.0006  0.0507  -0.0489 314 LEU A CA  
1297 C C   . LEU A 204 ? 0.4027 0.3275 0.4571 0.0072  0.0602  -0.0473 314 LEU A C   
1298 O O   . LEU A 204 ? 0.3936 0.3195 0.4419 0.0125  0.0706  -0.0482 314 LEU A O   
1299 C CB  . LEU A 204 ? 0.3760 0.3035 0.4189 -0.0044 0.0455  -0.0401 314 LEU A CB  
1300 C CG  . LEU A 204 ? 0.4692 0.3922 0.4920 -0.0098 0.0394  -0.0388 314 LEU A CG  
1301 C CD1 . LEU A 204 ? 0.4747 0.4085 0.5094 -0.0140 0.0331  -0.0293 314 LEU A CD1 
1302 C CD2 . LEU A 204 ? 0.5239 0.4438 0.5250 -0.0073 0.0480  -0.0401 314 LEU A CD2 
1303 N N   . VAL A 205 ? 0.3456 0.2772 0.4217 0.0069  0.0566  -0.0447 315 VAL A N   
1304 C CA  . VAL A 205 ? 0.3282 0.2689 0.4235 0.0118  0.0631  -0.0422 315 VAL A CA  
1305 C C   . VAL A 205 ? 0.3930 0.3254 0.4834 0.0186  0.0706  -0.0483 315 VAL A C   
1306 O O   . VAL A 205 ? 0.3930 0.3316 0.4875 0.0242  0.0807  -0.0465 315 VAL A O   
1307 C CB  . VAL A 205 ? 0.3432 0.2907 0.4584 0.0097  0.0562  -0.0392 315 VAL A CB  
1308 C CG1 . VAL A 205 ? 0.3216 0.2775 0.4551 0.0141  0.0614  -0.0368 315 VAL A CG1 
1309 C CG2 . VAL A 205 ? 0.3310 0.2858 0.4513 0.0049  0.0502  -0.0338 315 VAL A CG2 
1310 N N   . LYS A 206 ? 0.3559 0.2744 0.4384 0.0182  0.0658  -0.0548 316 LYS A N   
1311 C CA  . LYS A 206 ? 0.3633 0.2704 0.4414 0.0250  0.0717  -0.0613 316 LYS A CA  
1312 C C   . LYS A 206 ? 0.4427 0.3428 0.5003 0.0305  0.0816  -0.0661 316 LYS A C   
1313 O O   . LYS A 206 ? 0.4388 0.3410 0.5013 0.0391  0.0923  -0.0670 316 LYS A O   
1314 C CB  . LYS A 206 ? 0.3951 0.2865 0.4674 0.0216  0.0624  -0.0666 316 LYS A CB  
1315 C CG  . LYS A 206 ? 0.4512 0.3505 0.5453 0.0189  0.0558  -0.0617 316 LYS A CG  
1316 C CD  . LYS A 206 ? 0.5376 0.4244 0.6273 0.0137  0.0457  -0.0644 316 LYS A CD  
1317 C CE  . LYS A 206 ? 0.4392 0.3358 0.5494 0.0115  0.0403  -0.0584 316 LYS A CE  
1318 N NZ  . LYS A 206 ? 0.5158 0.4029 0.6236 0.0055  0.0304  -0.0588 316 LYS A NZ  
1319 N N   . GLU A 207 ? 0.4260 0.3198 0.4612 0.0259  0.0784  -0.0684 317 GLU A N   
1320 C CA  . GLU A 207 ? 0.4676 0.3548 0.4786 0.0306  0.0874  -0.0730 317 GLU A CA  
1321 C C   . GLU A 207 ? 0.5272 0.4326 0.5483 0.0363  0.1003  -0.0658 317 GLU A C   
1322 O O   . GLU A 207 ? 0.5508 0.4542 0.5634 0.0451  0.1124  -0.0692 317 GLU A O   
1323 C CB  . GLU A 207 ? 0.5045 0.3856 0.4922 0.0228  0.0797  -0.0740 317 GLU A CB  
1324 C CG  . GLU A 207 ? 0.6996 0.5587 0.6677 0.0187  0.0696  -0.0833 317 GLU A CG  
1325 C CD  . GLU A 207 ? 1.0402 0.8947 0.9885 0.0095  0.0591  -0.0828 317 GLU A CD  
1326 O OE1 . GLU A 207 ? 0.9041 0.7716 0.8506 0.0070  0.0606  -0.0754 317 GLU A OE1 
1327 O OE2 . GLU A 207 ? 1.0170 0.8547 0.9522 0.0042  0.0486  -0.0889 317 GLU A OE2 
1328 N N   . ALA A 208 ? 0.4505 0.3735 0.4907 0.0314  0.0976  -0.0554 318 ALA A N   
1329 C CA  . ALA A 208 ? 0.4394 0.3807 0.4929 0.0345  0.1075  -0.0464 318 ALA A CA  
1330 C C   . ALA A 208 ? 0.4875 0.4368 0.5633 0.0421  0.1152  -0.0448 318 ALA A C   
1331 O O   . ALA A 208 ? 0.4670 0.4242 0.5440 0.0496  0.1281  -0.0424 318 ALA A O   
1332 C CB  . ALA A 208 ? 0.4251 0.3791 0.4932 0.0263  0.0999  -0.0367 318 ALA A CB  
1333 N N   . VAL A 209 ? 0.4423 0.3902 0.5354 0.0404  0.1076  -0.0453 319 VAL A N   
1334 C CA  . VAL A 209 ? 0.4315 0.3877 0.5479 0.0462  0.1120  -0.0424 319 VAL A CA  
1335 C C   . VAL A 209 ? 0.5107 0.4576 0.6194 0.0572  0.1228  -0.0492 319 VAL A C   
1336 O O   . VAL A 209 ? 0.4682 0.4276 0.5905 0.0646  0.1336  -0.0443 319 VAL A O   
1337 C CB  . VAL A 209 ? 0.4608 0.4164 0.5931 0.0412  0.1003  -0.0417 319 VAL A CB  
1338 C CG1 . VAL A 209 ? 0.4601 0.4203 0.6122 0.0475  0.1037  -0.0400 319 VAL A CG1 
1339 C CG2 . VAL A 209 ? 0.4299 0.3976 0.5744 0.0332  0.0927  -0.0342 319 VAL A CG2 
1340 N N   . VAL A 210 ? 0.5225 0.4476 0.6104 0.0586  0.1197  -0.0600 320 VAL A N   
1341 C CA  . VAL A 210 ? 0.5455 0.4571 0.6246 0.0697  0.1288  -0.0681 320 VAL A CA  
1342 C C   . VAL A 210 ? 0.6184 0.5327 0.6810 0.0780  0.1438  -0.0698 320 VAL A C   
1343 O O   . VAL A 210 ? 0.6335 0.5440 0.6959 0.0899  0.1552  -0.0736 320 VAL A O   
1344 C CB  . VAL A 210 ? 0.6197 0.5046 0.6813 0.0684  0.1204  -0.0794 320 VAL A CB  
1345 C CG1 . VAL A 210 ? 0.5963 0.4814 0.6763 0.0613  0.1074  -0.0761 320 VAL A CG1 
1346 C CG2 . VAL A 210 ? 0.6402 0.5105 0.6699 0.0626  0.1155  -0.0865 320 VAL A CG2 
1347 N N   . THR A 211 ? 0.5749 0.4974 0.6254 0.0725  0.1444  -0.0657 321 THR A N   
1348 C CA  . THR A 211 ? 0.5891 0.5183 0.6244 0.0793  0.1588  -0.0648 321 THR A CA  
1349 C C   . THR A 211 ? 0.6144 0.5667 0.6771 0.0877  0.1720  -0.0546 321 THR A C   
1350 O O   . THR A 211 ? 0.6143 0.5691 0.6691 0.0992  0.1874  -0.0564 321 THR A O   
1351 C CB  . THR A 211 ? 0.6646 0.6006 0.6868 0.0696  0.1542  -0.0593 321 THR A CB  
1352 O OG1 . THR A 211 ? 0.6776 0.5932 0.6759 0.0624  0.1418  -0.0680 321 THR A OG1 
1353 C CG2 . THR A 211 ? 0.6572 0.6030 0.6637 0.0756  0.1690  -0.0560 321 THR A CG2 
1354 N N   . PHE A 212 ? 0.5196 0.4885 0.6142 0.0821  0.1658  -0.0442 322 PHE A N   
1355 C CA  . PHE A 212 ? 0.4913 0.4840 0.6154 0.0874  0.1753  -0.0326 322 PHE A CA  
1356 C C   . PHE A 212 ? 0.5292 0.5212 0.6759 0.0936  0.1746  -0.0333 322 PHE A C   
1357 O O   . PHE A 212 ? 0.5167 0.5219 0.6799 0.1035  0.1866  -0.0280 322 PHE A O   
1358 C CB  . PHE A 212 ? 0.4807 0.4931 0.6241 0.0764  0.1686  -0.0193 322 PHE A CB  
1359 C CG  . PHE A 212 ? 0.4891 0.5019 0.6122 0.0697  0.1679  -0.0173 322 PHE A CG  
1360 C CD1 . PHE A 212 ? 0.5015 0.5044 0.6151 0.0588  0.1535  -0.0195 322 PHE A CD1 
1361 C CD2 . PHE A 212 ? 0.5189 0.5429 0.6326 0.0750  0.1820  -0.0122 322 PHE A CD2 
1362 C CE1 . PHE A 212 ? 0.5210 0.5242 0.6167 0.0529  0.1522  -0.0167 322 PHE A CE1 
1363 C CE2 . PHE A 212 ? 0.5607 0.5852 0.6550 0.0685  0.1809  -0.0092 322 PHE A CE2 
1364 C CZ  . PHE A 212 ? 0.5301 0.5439 0.6160 0.0574  0.1654  -0.0113 322 PHE A CZ  
1365 N N   . LEU A 213 ? 0.4772 0.4549 0.6251 0.0880  0.1609  -0.0387 323 LEU A N   
1366 C CA  . LEU A 213 ? 0.4599 0.4345 0.6268 0.0924  0.1579  -0.0392 323 LEU A CA  
1367 C C   . LEU A 213 ? 0.5058 0.4524 0.6525 0.0927  0.1509  -0.0522 323 LEU A C   
1368 O O   . LEU A 213 ? 0.4953 0.4354 0.6417 0.0830  0.1372  -0.0532 323 LEU A O   
1369 C CB  . LEU A 213 ? 0.4304 0.4198 0.6240 0.0831  0.1463  -0.0295 323 LEU A CB  
1370 C CG  . LEU A 213 ? 0.4779 0.4941 0.7002 0.0836  0.1510  -0.0159 323 LEU A CG  
1371 C CD1 . LEU A 213 ? 0.4622 0.4871 0.7037 0.0733  0.1371  -0.0093 323 LEU A CD1 
1372 C CD2 . LEU A 213 ? 0.4887 0.5128 0.7281 0.0967  0.1630  -0.0127 323 LEU A CD2 
1373 N N   . PRO A 214 ? 0.4891 0.4183 0.6190 0.1037  0.1599  -0.0620 324 PRO A N   
1374 C CA  . PRO A 214 ? 0.5035 0.4036 0.6130 0.1023  0.1514  -0.0743 324 PRO A CA  
1375 C C   . PRO A 214 ? 0.5265 0.4207 0.6546 0.0998  0.1408  -0.0728 324 PRO A C   
1376 O O   . PRO A 214 ? 0.5109 0.3856 0.6259 0.0936  0.1298  -0.0795 324 PRO A O   
1377 C CB  . PRO A 214 ? 0.5621 0.4457 0.6517 0.1163  0.1647  -0.0847 324 PRO A CB  
1378 C CG  . PRO A 214 ? 0.6171 0.5235 0.7257 0.1271  0.1805  -0.0762 324 PRO A CG  
1379 C CD  . PRO A 214 ? 0.5253 0.4597 0.6518 0.1176  0.1779  -0.0627 324 PRO A CD  
1380 N N   . ASP A 215 ? 0.4660 0.3779 0.6245 0.1035  0.1430  -0.0631 325 ASP A N   
1381 C CA  . ASP A 215 ? 0.4422 0.3507 0.6186 0.1010  0.1330  -0.0600 325 ASP A CA  
1382 C C   . ASP A 215 ? 0.4342 0.3562 0.6220 0.0876  0.1199  -0.0524 325 ASP A C   
1383 O O   . ASP A 215 ? 0.4072 0.3298 0.6098 0.0848  0.1116  -0.0485 325 ASP A O   
1384 C CB  . ASP A 215 ? 0.4637 0.3841 0.6668 0.1122  0.1413  -0.0530 325 ASP A CB  
1385 C CG  . ASP A 215 ? 0.5648 0.5161 0.7951 0.1097  0.1426  -0.0392 325 ASP A CG  
1386 O OD1 . ASP A 215 ? 0.5911 0.5533 0.8469 0.1148  0.1435  -0.0313 325 ASP A OD1 
1387 O OD2 . ASP A 215 ? 0.5025 0.4665 0.7289 0.1025  0.1423  -0.0358 325 ASP A OD2 
1388 N N   . ALA A 216 ? 0.3697 0.3029 0.5514 0.0801  0.1186  -0.0498 326 ALA A N   
1389 C CA  . ALA A 216 ? 0.3453 0.2908 0.5374 0.0690  0.1075  -0.0433 326 ALA A CA  
1390 C C   . ALA A 216 ? 0.4186 0.3503 0.6009 0.0612  0.0950  -0.0475 326 ALA A C   
1391 O O   . ALA A 216 ? 0.4453 0.3584 0.6065 0.0602  0.0932  -0.0558 326 ALA A O   
1392 C CB  . ALA A 216 ? 0.3436 0.3012 0.5308 0.0637  0.1090  -0.0399 326 ALA A CB  
1393 N N   . LEU A 217 ? 0.3573 0.2989 0.5551 0.0555  0.0862  -0.0413 327 LEU A N   
1394 C CA  . LEU A 217 ? 0.3451 0.2798 0.5384 0.0478  0.0747  -0.0424 327 LEU A CA  
1395 C C   . LEU A 217 ? 0.3638 0.3090 0.5549 0.0396  0.0692  -0.0398 327 LEU A C   
1396 O O   . LEU A 217 ? 0.3649 0.3257 0.5688 0.0386  0.0696  -0.0339 327 LEU A O   
1397 C CB  . LEU A 217 ? 0.3420 0.2804 0.5531 0.0484  0.0696  -0.0371 327 LEU A CB  
1398 C CG  . LEU A 217 ? 0.4367 0.3661 0.6549 0.0577  0.0751  -0.0379 327 LEU A CG  
1399 C CD1 . LEU A 217 ? 0.4459 0.3850 0.6855 0.0582  0.0704  -0.0295 327 LEU A CD1 
1400 C CD2 . LEU A 217 ? 0.4786 0.3830 0.6795 0.0587  0.0736  -0.0464 327 LEU A CD2 
1401 N N   . VAL A 218 ? 0.3075 0.2434 0.4820 0.0342  0.0642  -0.0441 328 VAL A N   
1402 C CA  . VAL A 218 ? 0.2938 0.2374 0.4648 0.0274  0.0592  -0.0421 328 VAL A CA  
1403 C C   . VAL A 218 ? 0.3159 0.2578 0.4871 0.0216  0.0493  -0.0413 328 VAL A C   
1404 O O   . VAL A 218 ? 0.3095 0.2388 0.4712 0.0197  0.0457  -0.0448 328 VAL A O   
1405 C CB  . VAL A 218 ? 0.3600 0.2977 0.5127 0.0262  0.0622  -0.0459 328 VAL A CB  
1406 C CG1 . VAL A 218 ? 0.3445 0.2900 0.4959 0.0197  0.0566  -0.0428 328 VAL A CG1 
1407 C CG2 . VAL A 218 ? 0.3672 0.3085 0.5193 0.0326  0.0735  -0.0457 328 VAL A CG2 
1408 N N   . THR A 219 ? 0.2702 0.2247 0.4522 0.0188  0.0449  -0.0365 329 THR A N   
1409 C CA  . THR A 219 ? 0.2499 0.2061 0.4329 0.0144  0.0371  -0.0347 329 THR A CA  
1410 C C   . THR A 219 ? 0.2532 0.2170 0.4340 0.0107  0.0335  -0.0334 329 THR A C   
1411 O O   . THR A 219 ? 0.2298 0.2019 0.4166 0.0113  0.0348  -0.0316 329 THR A O   
1412 C CB  . THR A 219 ? 0.3146 0.2781 0.5117 0.0158  0.0349  -0.0302 329 THR A CB  
1413 O OG1 . THR A 219 ? 0.3579 0.3143 0.5592 0.0203  0.0387  -0.0307 329 THR A OG1 
1414 C CG2 . THR A 219 ? 0.2574 0.2236 0.4552 0.0117  0.0279  -0.0273 329 THR A CG2 
1415 N N   . MET A 220 ? 0.2215 0.1825 0.3950 0.0066  0.0285  -0.0338 330 MET A N   
1416 C CA  . MET A 220 ? 0.1997 0.1682 0.3727 0.0042  0.0250  -0.0320 330 MET A CA  
1417 C C   . MET A 220 ? 0.2480 0.2267 0.4308 0.0050  0.0224  -0.0288 330 MET A C   
1418 O O   . MET A 220 ? 0.2551 0.2348 0.4416 0.0045  0.0203  -0.0266 330 MET A O   
1419 C CB  . MET A 220 ? 0.2279 0.1922 0.3925 0.0000  0.0203  -0.0319 330 MET A CB  
1420 C CG  . MET A 220 ? 0.2547 0.2261 0.4189 -0.0012 0.0179  -0.0299 330 MET A CG  
1421 S SD  . MET A 220 ? 0.3105 0.2812 0.4694 -0.0063 0.0112  -0.0274 330 MET A SD  
1422 C CE  . MET A 220 ? 0.2747 0.2312 0.4177 -0.0088 0.0118  -0.0317 330 MET A CE  
1423 N N   . THR A 221 ? 0.2033 0.1889 0.3898 0.0062  0.0224  -0.0283 331 THR A N   
1424 C CA  . THR A 221 ? 0.2016 0.1959 0.3942 0.0074  0.0199  -0.0265 331 THR A CA  
1425 C C   . THR A 221 ? 0.2313 0.2301 0.4211 0.0075  0.0173  -0.0265 331 THR A C   
1426 O O   . THR A 221 ? 0.2382 0.2350 0.4235 0.0059  0.0165  -0.0261 331 THR A O   
1427 C CB  . THR A 221 ? 0.3142 0.3114 0.5135 0.0089  0.0210  -0.0265 331 THR A CB  
1428 O OG1 . THR A 221 ? 0.2336 0.2290 0.4317 0.0085  0.0220  -0.0278 331 THR A OG1 
1429 C CG2 . THR A 221 ? 0.3174 0.3121 0.5219 0.0102  0.0243  -0.0254 331 THR A CG2 
1430 N N   . GLY A 222 ? 0.1844 0.1887 0.3762 0.0096  0.0159  -0.0271 332 GLY A N   
1431 C CA  . GLY A 222 ? 0.1596 0.1670 0.3486 0.0116  0.0143  -0.0281 332 GLY A CA  
1432 C C   . GLY A 222 ? 0.2071 0.2209 0.3953 0.0120  0.0137  -0.0251 332 GLY A C   
1433 O O   . GLY A 222 ? 0.1802 0.1970 0.3704 0.0103  0.0136  -0.0219 332 GLY A O   
1434 N N   . GLY A 223 ? 0.1861 0.2022 0.3729 0.0143  0.0133  -0.0252 333 GLY A N   
1435 C CA  . GLY A 223 ? 0.1717 0.1969 0.3602 0.0153  0.0131  -0.0210 333 GLY A CA  
1436 C C   . GLY A 223 ? 0.2104 0.2362 0.4009 0.0102  0.0116  -0.0163 333 GLY A C   
1437 O O   . GLY A 223 ? 0.1867 0.2217 0.3810 0.0095  0.0111  -0.0112 333 GLY A O   
1438 N N   . PHE A 224 ? 0.1674 0.1834 0.3547 0.0063  0.0106  -0.0177 334 PHE A N   
1439 C CA  . PHE A 224 ? 0.1381 0.1507 0.3245 0.0008  0.0079  -0.0148 334 PHE A CA  
1440 C C   . PHE A 224 ? 0.1926 0.2039 0.3813 -0.0010 0.0078  -0.0135 334 PHE A C   
1441 O O   . PHE A 224 ? 0.1630 0.1763 0.3544 -0.0049 0.0047  -0.0089 334 PHE A O   
1442 C CB  . PHE A 224 ? 0.1523 0.1529 0.3311 -0.0021 0.0074  -0.0180 334 PHE A CB  
1443 C CG  . PHE A 224 ? 0.1649 0.1672 0.3420 -0.0021 0.0056  -0.0166 334 PHE A CG  
1444 C CD1 . PHE A 224 ? 0.1792 0.1776 0.3537 0.0003  0.0077  -0.0193 334 PHE A CD1 
1445 C CD2 . PHE A 224 ? 0.1492 0.1580 0.3291 -0.0046 0.0014  -0.0113 334 PHE A CD2 
1446 C CE1 . PHE A 224 ? 0.1836 0.1831 0.3574 0.0005  0.0056  -0.0170 334 PHE A CE1 
1447 C CE2 . PHE A 224 ? 0.2018 0.2133 0.3819 -0.0040 -0.0006 -0.0089 334 PHE A CE2 
1448 C CZ  . PHE A 224 ? 0.1907 0.1969 0.3674 -0.0013 0.0016  -0.0119 334 PHE A CZ  
1449 N N   . ARG A 225 ? 0.1699 0.1786 0.3592 0.0015  0.0105  -0.0164 335 ARG A N   
1450 C CA  . ARG A 225 ? 0.1690 0.1773 0.3622 0.0005  0.0102  -0.0141 335 ARG A CA  
1451 C C   . ARG A 225 ? 0.1640 0.1859 0.3623 0.0012  0.0092  -0.0082 335 ARG A C   
1452 O O   . ARG A 225 ? 0.1431 0.1663 0.3455 -0.0014 0.0074  -0.0033 335 ARG A O   
1453 C CB  . ARG A 225 ? 0.1779 0.1822 0.3723 0.0032  0.0129  -0.0173 335 ARG A CB  
1454 C CG  . ARG A 225 ? 0.2307 0.2326 0.4301 0.0024  0.0123  -0.0143 335 ARG A CG  
1455 C CD  . ARG A 225 ? 0.2506 0.2486 0.4532 0.0052  0.0150  -0.0164 335 ARG A CD  
1456 N NE  . ARG A 225 ? 0.2198 0.2140 0.4279 0.0049  0.0141  -0.0130 335 ARG A NE  
1457 C CZ  . ARG A 225 ? 0.2193 0.2207 0.4344 0.0062  0.0130  -0.0085 335 ARG A CZ  
1458 N NH1 . ARG A 225 ? 0.1733 0.1852 0.3890 0.0077  0.0125  -0.0080 335 ARG A NH1 
1459 N NH2 . ARG A 225 ? 0.1458 0.1428 0.3666 0.0058  0.0118  -0.0044 335 ARG A NH2 
1460 N N   . ARG A 226 ? 0.1351 0.1668 0.3329 0.0050  0.0105  -0.0083 336 ARG A N   
1461 C CA  . ARG A 226 ? 0.1239 0.1703 0.3247 0.0070  0.0111  -0.0027 336 ARG A CA  
1462 C C   . ARG A 226 ? 0.1787 0.2334 0.3844 0.0044  0.0095  0.0040  336 ARG A C   
1463 O O   . ARG A 226 ? 0.1659 0.2356 0.3753 0.0067  0.0111  0.0097  336 ARG A O   
1464 C CB  . ARG A 226 ? 0.0819 0.1340 0.2784 0.0135  0.0137  -0.0067 336 ARG A CB  
1465 C CG  . ARG A 226 ? 0.1127 0.1586 0.3055 0.0151  0.0136  -0.0120 336 ARG A CG  
1466 C CD  . ARG A 226 ? 0.1142 0.1653 0.3009 0.0207  0.0147  -0.0157 336 ARG A CD  
1467 N NE  . ARG A 226 ? 0.1768 0.2276 0.3609 0.0249  0.0161  -0.0190 336 ARG A NE  
1468 C CZ  . ARG A 226 ? 0.2741 0.3146 0.4560 0.0259  0.0152  -0.0249 336 ARG A CZ  
1469 N NH1 . ARG A 226 ? 0.2129 0.2529 0.3934 0.0302  0.0162  -0.0269 336 ARG A NH1 
1470 N NH2 . ARG A 226 ? 0.1915 0.2226 0.3738 0.0227  0.0133  -0.0278 336 ARG A NH2 
1471 N N   . GLY A 227 ? 0.1403 0.1864 0.3459 -0.0004 0.0064  0.0037  337 GLY A N   
1472 C CA  . GLY A 227 ? 0.1394 0.1924 0.3506 -0.0047 0.0029  0.0108  337 GLY A CA  
1473 C C   . GLY A 227 ? 0.1953 0.2547 0.4075 -0.0020 0.0032  0.0113  337 GLY A C   
1474 O O   . GLY A 227 ? 0.1526 0.2209 0.3717 -0.0053 0.0002  0.0187  337 GLY A O   
1475 N N   . LYS A 228 ? 0.1807 0.2362 0.3876 0.0038  0.0064  0.0045  338 LYS A N   
1476 C CA  . LYS A 228 ? 0.1701 0.2312 0.3791 0.0074  0.0067  0.0055  338 LYS A CA  
1477 C C   . LYS A 228 ? 0.2255 0.2805 0.4341 0.0013  0.0014  0.0076  338 LYS A C   
1478 O O   . LYS A 228 ? 0.2229 0.2640 0.4245 -0.0038 -0.0010 0.0038  338 LYS A O   
1479 C CB  . LYS A 228 ? 0.1551 0.2100 0.3586 0.0142  0.0100  -0.0021 338 LYS A CB  
1480 C CG  . LYS A 228 ? 0.2664 0.3285 0.4688 0.0212  0.0143  -0.0042 338 LYS A CG  
1481 C CD  . LYS A 228 ? 0.4247 0.4771 0.6207 0.0266  0.0158  -0.0126 338 LYS A CD  
1482 C CE  . LYS A 228 ? 0.5455 0.5989 0.7435 0.0322  0.0164  -0.0129 338 LYS A CE  
1483 N NZ  . LYS A 228 ? 0.7039 0.7723 0.9058 0.0395  0.0202  -0.0094 338 LYS A NZ  
1484 N N   . MET A 229 ? 0.1923 0.2584 0.4081 0.0022  -0.0002 0.0137  339 MET A N   
1485 C CA  . MET A 229 ? 0.2160 0.2789 0.4319 -0.0037 -0.0064 0.0172  339 MET A CA  
1486 C C   . MET A 229 ? 0.2512 0.3034 0.4596 -0.0013 -0.0060 0.0116  339 MET A C   
1487 O O   . MET A 229 ? 0.2514 0.2956 0.4541 -0.0070 -0.0110 0.0119  339 MET A O   
1488 C CB  . MET A 229 ? 0.2564 0.3382 0.4859 -0.0031 -0.0084 0.0277  339 MET A CB  
1489 C CG  . MET A 229 ? 0.3226 0.4159 0.5612 -0.0086 -0.0108 0.0362  339 MET A CG  
1490 S SD  . MET A 229 ? 0.3947 0.5149 0.6529 -0.0066 -0.0119 0.0506  339 MET A SD  
1491 C CE  . MET A 229 ? 0.3601 0.4722 0.6164 -0.0147 -0.0222 0.0529  339 MET A CE  
1492 N N   . THR A 230 ? 0.2231 0.2754 0.4313 0.0069  -0.0008 0.0072  340 THR A N   
1493 C CA  . THR A 230 ? 0.2238 0.2662 0.4269 0.0094  -0.0005 0.0031  340 THR A CA  
1494 C C   . THR A 230 ? 0.2594 0.2938 0.4576 0.0140  0.0040  -0.0048 340 THR A C   
1495 O O   . THR A 230 ? 0.2697 0.3080 0.4687 0.0168  0.0071  -0.0069 340 THR A O   
1496 C CB  . THR A 230 ? 0.2183 0.2696 0.4298 0.0151  -0.0011 0.0081  340 THR A CB  
1497 O OG1 . THR A 230 ? 0.2472 0.3081 0.4646 0.0238  0.0041  0.0075  340 THR A OG1 
1498 C CG2 . THR A 230 ? 0.2335 0.2940 0.4516 0.0099  -0.0068 0.0173  340 THR A CG2 
1499 N N   . GLY A 231 ? 0.2297 0.2536 0.4233 0.0142  0.0038  -0.0080 341 GLY A N   
1500 C CA  . GLY A 231 ? 0.2128 0.2284 0.4031 0.0172  0.0065  -0.0144 341 GLY A CA  
1501 C C   . GLY A 231 ? 0.2810 0.2879 0.4699 0.0178  0.0052  -0.0148 341 GLY A C   
1502 O O   . GLY A 231 ? 0.2819 0.2881 0.4701 0.0146  0.0024  -0.0103 341 GLY A O   
1503 N N   A HIS A 232 ? 0.2348 0.2350 0.4235 0.0212  0.0064  -0.0194 342 HIS A N   
1504 N N   B HIS A 232 ? 0.2597 0.2599 0.4485 0.0212  0.0064  -0.0194 342 HIS A N   
1505 C CA  A HIS A 232 ? 0.2279 0.2187 0.4167 0.0212  0.0047  -0.0192 342 HIS A CA  
1506 C CA  B HIS A 232 ? 0.2661 0.2569 0.4549 0.0211  0.0047  -0.0191 342 HIS A CA  
1507 C C   A HIS A 232 ? 0.2522 0.2371 0.4363 0.0144  0.0051  -0.0186 342 HIS A C   
1508 C C   B HIS A 232 ? 0.2697 0.2547 0.4538 0.0144  0.0051  -0.0185 342 HIS A C   
1509 O O   A HIS A 232 ? 0.2484 0.2281 0.4320 0.0123  0.0037  -0.0154 342 HIS A O   
1510 O O   B HIS A 232 ? 0.2669 0.2469 0.4503 0.0122  0.0037  -0.0152 342 HIS A O   
1511 C CB  A HIS A 232 ? 0.2373 0.2215 0.4278 0.0267  0.0045  -0.0244 342 HIS A CB  
1512 C CB  B HIS A 232 ? 0.2908 0.2746 0.4810 0.0261  0.0045  -0.0244 342 HIS A CB  
1513 C CG  A HIS A 232 ? 0.2743 0.2512 0.4627 0.0232  0.0044  -0.0283 342 HIS A CG  
1514 C CG  B HIS A 232 ? 0.3464 0.3340 0.5392 0.0346  0.0052  -0.0263 342 HIS A CG  
1515 N ND1 A HIS A 232 ? 0.2877 0.2679 0.4742 0.0230  0.0059  -0.0321 342 HIS A ND1 
1516 N ND1 B HIS A 232 ? 0.3838 0.3728 0.5816 0.0392  0.0042  -0.0223 342 HIS A ND1 
1517 C CD2 A HIS A 232 ? 0.3026 0.2705 0.4923 0.0199  0.0025  -0.0276 342 HIS A CD2 
1518 C CD2 B HIS A 232 ? 0.3805 0.3704 0.5709 0.0399  0.0072  -0.0316 342 HIS A CD2 
1519 C CE1 A HIS A 232 ? 0.2806 0.2542 0.4678 0.0196  0.0046  -0.0337 342 HIS A CE1 
1520 C CE1 B HIS A 232 ? 0.3849 0.3776 0.5838 0.0479  0.0065  -0.0255 342 HIS A CE1 
1521 N NE2 A HIS A 232 ? 0.2931 0.2595 0.4826 0.0175  0.0027  -0.0309 342 HIS A NE2 
1522 N NE2 B HIS A 232 ? 0.3890 0.3820 0.5823 0.0485  0.0084  -0.0315 342 HIS A NE2 
1523 N N   . ASP A 233 ? 0.1801 0.1665 0.3614 0.0117  0.0075  -0.0210 343 ASP A N   
1524 C CA  . ASP A 233 ? 0.1620 0.1443 0.3393 0.0071  0.0096  -0.0210 343 ASP A CA  
1525 C C   . ASP A 233 ? 0.2164 0.2012 0.3902 0.0050  0.0116  -0.0224 343 ASP A C   
1526 O O   . ASP A 233 ? 0.1813 0.1713 0.3566 0.0062  0.0106  -0.0225 343 ASP A O   
1527 C CB  . ASP A 233 ? 0.1860 0.1642 0.3675 0.0075  0.0104  -0.0232 343 ASP A CB  
1528 C CG  . ASP A 233 ? 0.2110 0.1915 0.3954 0.0094  0.0108  -0.0273 343 ASP A CG  
1529 O OD1 . ASP A 233 ? 0.1616 0.1476 0.3448 0.0104  0.0117  -0.0283 343 ASP A OD1 
1530 O OD2 . ASP A 233 ? 0.2187 0.1963 0.4068 0.0085  0.0102  -0.0284 343 ASP A OD2 
1531 N N   . VAL A 234 ? 0.1765 0.1575 0.3461 0.0023  0.0147  -0.0230 344 VAL A N   
1532 C CA  . VAL A 234 ? 0.1972 0.1776 0.3637 0.0012  0.0170  -0.0251 344 VAL A CA  
1533 C C   . VAL A 234 ? 0.2514 0.2312 0.4222 0.0023  0.0209  -0.0265 344 VAL A C   
1534 O O   . VAL A 234 ? 0.2323 0.2105 0.4030 0.0014  0.0234  -0.0250 344 VAL A O   
1535 C CB  . VAL A 234 ? 0.2714 0.2466 0.4269 -0.0021 0.0170  -0.0249 344 VAL A CB  
1536 C CG1 . VAL A 234 ? 0.2760 0.2491 0.4296 -0.0029 0.0169  -0.0272 344 VAL A CG1 
1537 C CG2 . VAL A 234 ? 0.2599 0.2363 0.4119 -0.0041 0.0121  -0.0215 344 VAL A CG2 
1538 N N   . ASP A 235 ? 0.2141 0.1968 0.3901 0.0038  0.0213  -0.0281 345 ASP A N   
1539 C CA  . ASP A 235 ? 0.2001 0.1844 0.3827 0.0048  0.0240  -0.0283 345 ASP A CA  
1540 C C   . ASP A 235 ? 0.2543 0.2367 0.4358 0.0055  0.0275  -0.0292 345 ASP A C   
1541 O O   . ASP A 235 ? 0.2403 0.2208 0.4183 0.0051  0.0260  -0.0301 345 ASP A O   
1542 C CB  . ASP A 235 ? 0.2113 0.2003 0.4007 0.0063  0.0207  -0.0290 345 ASP A CB  
1543 C CG  . ASP A 235 ? 0.2566 0.2453 0.4455 0.0072  0.0169  -0.0298 345 ASP A CG  
1544 O OD1 . ASP A 235 ? 0.2425 0.2279 0.4328 0.0062  0.0162  -0.0289 345 ASP A OD1 
1545 O OD2 . ASP A 235 ? 0.2683 0.2603 0.4558 0.0094  0.0148  -0.0308 345 ASP A OD2 
1546 N N   . PHE A 236 ? 0.2205 0.2035 0.4063 0.0066  0.0322  -0.0284 346 PHE A N   
1547 C CA  . PHE A 236 ? 0.2186 0.1990 0.4045 0.0089  0.0368  -0.0293 346 PHE A CA  
1548 C C   . PHE A 236 ? 0.2854 0.2724 0.4842 0.0110  0.0392  -0.0267 346 PHE A C   
1549 O O   . PHE A 236 ? 0.2622 0.2546 0.4680 0.0100  0.0394  -0.0238 346 PHE A O   
1550 C CB  . PHE A 236 ? 0.2380 0.2120 0.4131 0.0094  0.0422  -0.0308 346 PHE A CB  
1551 C CG  . PHE A 236 ? 0.2504 0.2174 0.4119 0.0066  0.0388  -0.0330 346 PHE A CG  
1552 C CD1 . PHE A 236 ? 0.2817 0.2501 0.4390 0.0039  0.0363  -0.0310 346 PHE A CD1 
1553 C CD2 . PHE A 236 ? 0.2545 0.2133 0.4083 0.0062  0.0371  -0.0362 346 PHE A CD2 
1554 C CE1 . PHE A 236 ? 0.2925 0.2562 0.4389 0.0010  0.0322  -0.0318 346 PHE A CE1 
1555 C CE2 . PHE A 236 ? 0.2926 0.2459 0.4350 0.0024  0.0324  -0.0373 346 PHE A CE2 
1556 C CZ  . PHE A 236 ? 0.2687 0.2254 0.4077 -0.0001 0.0301  -0.0348 346 PHE A CZ  
1557 N N   . LEU A 237 ? 0.2636 0.2501 0.4667 0.0135  0.0403  -0.0269 347 LEU A N   
1558 C CA  . LEU A 237 ? 0.2495 0.2425 0.4659 0.0162  0.0429  -0.0236 347 LEU A CA  
1559 C C   . LEU A 237 ? 0.2895 0.2775 0.5038 0.0209  0.0510  -0.0247 347 LEU A C   
1560 O O   . LEU A 237 ? 0.2733 0.2509 0.4775 0.0222  0.0519  -0.0288 347 LEU A O   
1561 C CB  . LEU A 237 ? 0.2482 0.2447 0.4717 0.0164  0.0379  -0.0219 347 LEU A CB  
1562 C CG  . LEU A 237 ? 0.2978 0.3018 0.5364 0.0192  0.0393  -0.0173 347 LEU A CG  
1563 C CD1 . LEU A 237 ? 0.2804 0.2941 0.5293 0.0170  0.0378  -0.0134 347 LEU A CD1 
1564 C CD2 . LEU A 237 ? 0.2824 0.2882 0.5251 0.0193  0.0343  -0.0153 347 LEU A CD2 
1565 N N   . ILE A 238 ? 0.2493 0.2444 0.4722 0.0233  0.0570  -0.0212 348 ILE A N   
1566 C CA  . ILE A 238 ? 0.2511 0.2434 0.4727 0.0295  0.0667  -0.0221 348 ILE A CA  
1567 C C   . ILE A 238 ? 0.2779 0.2802 0.5191 0.0337  0.0693  -0.0165 348 ILE A C   
1568 O O   . ILE A 238 ? 0.2470 0.2615 0.5023 0.0308  0.0661  -0.0105 348 ILE A O   
1569 C CB  . ILE A 238 ? 0.2963 0.2902 0.5104 0.0296  0.0735  -0.0214 348 ILE A CB  
1570 C CG1 . ILE A 238 ? 0.3040 0.2899 0.5005 0.0244  0.0691  -0.0252 348 ILE A CG1 
1571 C CG2 . ILE A 238 ? 0.3017 0.2921 0.5112 0.0376  0.0850  -0.0234 348 ILE A CG2 
1572 C CD1 . ILE A 238 ? 0.3833 0.3751 0.5771 0.0219  0.0724  -0.0211 348 ILE A CD1 
1573 N N   . THR A 239 ? 0.2654 0.2615 0.5076 0.0404  0.0743  -0.0184 349 THR A N   
1574 C CA  . THR A 239 ? 0.2556 0.2612 0.5175 0.0459  0.0776  -0.0125 349 THR A CA  
1575 C C   . THR A 239 ? 0.3097 0.3068 0.5680 0.0557  0.0883  -0.0160 349 THR A C   
1576 O O   . THR A 239 ? 0.2959 0.2760 0.5356 0.0571  0.0894  -0.0241 349 THR A O   
1577 C CB  . THR A 239 ? 0.2971 0.3056 0.5694 0.0434  0.0683  -0.0092 349 THR A CB  
1578 O OG1 . THR A 239 ? 0.2593 0.2814 0.5534 0.0470  0.0701  -0.0011 349 THR A OG1 
1579 C CG2 . THR A 239 ? 0.2373 0.2305 0.5005 0.0452  0.0659  -0.0141 349 THR A CG2 
1580 N N   . SER A 240 ? 0.2805 0.2893 0.5564 0.0626  0.0960  -0.0098 350 SER A N   
1581 C CA  . SER A 240 ? 0.3115 0.3127 0.5850 0.0739  0.1075  -0.0133 350 SER A CA  
1582 C C   . SER A 240 ? 0.3621 0.3713 0.6593 0.0812  0.1094  -0.0065 350 SER A C   
1583 O O   . SER A 240 ? 0.3286 0.3581 0.6477 0.0807  0.1096  0.0036  350 SER A O   
1584 C CB  . SER A 240 ? 0.3719 0.3799 0.6403 0.0781  0.1196  -0.0128 350 SER A CB  
1585 O OG  . SER A 240 ? 0.4371 0.4423 0.7077 0.0910  0.1323  -0.0144 350 SER A OG  
1586 N N   . PRO A 241 ? 0.3776 0.3710 0.6718 0.0879  0.1103  -0.0111 351 PRO A N   
1587 C CA  . PRO A 241 ? 0.3777 0.3787 0.6962 0.0955  0.1118  -0.0035 351 PRO A CA  
1588 C C   . PRO A 241 ? 0.4282 0.4434 0.7629 0.1067  0.1256  0.0021  351 PRO A C   
1589 O O   . PRO A 241 ? 0.4298 0.4614 0.7909 0.1096  0.1248  0.0127  351 PRO A O   
1590 C CB  . PRO A 241 ? 0.4167 0.3936 0.7254 0.1001  0.1099  -0.0107 351 PRO A CB  
1591 C CG  . PRO A 241 ? 0.4863 0.4433 0.7656 0.0981  0.1115  -0.0229 351 PRO A CG  
1592 C CD  . PRO A 241 ? 0.4076 0.3752 0.6780 0.0879  0.1082  -0.0224 351 PRO A CD  
1593 N N   . GLU A 242 ? 0.3961 0.4074 0.7164 0.1127  0.1379  -0.0038 352 GLU A N   
1594 C CA  . GLU A 242 ? 0.4091 0.4352 0.7451 0.1249  0.1528  0.0021  352 GLU A CA  
1595 C C   . GLU A 242 ? 0.4605 0.5100 0.8036 0.1211  0.1585  0.0101  352 GLU A C   
1596 O O   . GLU A 242 ? 0.4700 0.5382 0.8331 0.1298  0.1697  0.0188  352 GLU A O   
1597 C CB  . GLU A 242 ? 0.4596 0.4650 0.7772 0.1389  0.1659  -0.0092 352 GLU A CB  
1598 C CG  . GLU A 242 ? 0.6193 0.6097 0.9453 0.1485  0.1652  -0.0113 352 GLU A CG  
1599 C CD  . GLU A 242 ? 0.9769 0.9885 1.3396 0.1549  0.1666  0.0026  352 GLU A CD  
1600 O OE1 . GLU A 242 ? 1.0262 1.0597 1.4064 0.1626  0.1784  0.0109  352 GLU A OE1 
1601 O OE2 . GLU A 242 ? 0.9338 0.9412 1.3084 0.1519  0.1555  0.0065  352 GLU A OE2 
1602 N N   . ALA A 243 ? 0.4076 0.4573 0.7371 0.1084  0.1509  0.0085  353 ALA A N   
1603 C CA  . ALA A 243 ? 0.3987 0.4684 0.7347 0.1036  0.1549  0.0167  353 ALA A CA  
1604 C C   . ALA A 243 ? 0.4169 0.5140 0.7881 0.1011  0.1522  0.0325  353 ALA A C   
1605 O O   . ALA A 243 ? 0.3788 0.4788 0.7645 0.0962  0.1404  0.0366  353 ALA A O   
1606 C CB  . ALA A 243 ? 0.3959 0.4588 0.7137 0.0900  0.1444  0.0127  353 ALA A CB  
1607 N N   . THR A 244 ? 0.3868 0.5047 0.7710 0.1034  0.1624  0.0420  354 THR A N   
1608 C CA  . THR A 244 ? 0.3787 0.5246 0.7972 0.0993  0.1593  0.0585  354 THR A CA  
1609 C C   . THR A 244 ? 0.4353 0.5846 0.8536 0.0821  0.1438  0.0620  354 THR A C   
1610 O O   . THR A 244 ? 0.4018 0.5337 0.7945 0.0756  0.1385  0.0522  354 THR A O   
1611 C CB  . THR A 244 ? 0.4378 0.6054 0.8705 0.1081  0.1765  0.0684  354 THR A CB  
1612 O OG1 . THR A 244 ? 0.3992 0.5644 0.8115 0.1034  0.1812  0.0657  354 THR A OG1 
1613 C CG2 . THR A 244 ? 0.4714 0.6351 0.9036 0.1268  0.1930  0.0642  354 THR A CG2 
1614 N N   . GLU A 245 ? 0.4072 0.5786 0.8544 0.0749  0.1366  0.0761  355 GLU A N   
1615 C CA  . GLU A 245 ? 0.3945 0.5683 0.8433 0.0592  0.1217  0.0797  355 GLU A CA  
1616 C C   . GLU A 245 ? 0.4519 0.6253 0.8871 0.0548  0.1272  0.0795  355 GLU A C   
1617 O O   . GLU A 245 ? 0.4448 0.6052 0.8634 0.0449  0.1171  0.0737  355 GLU A O   
1618 C CB  . GLU A 245 ? 0.4037 0.6013 0.8868 0.0529  0.1134  0.0954  355 GLU A CB  
1619 N N   . ASP A 246 ? 0.3996 0.5870 0.8410 0.0631  0.1438  0.0861  356 ASP A N   
1620 C CA  . ASP A 246 ? 0.3997 0.5895 0.8287 0.0604  0.1512  0.0879  356 ASP A CA  
1621 C C   . ASP A 246 ? 0.4209 0.5853 0.8122 0.0635  0.1547  0.0718  356 ASP A C   
1622 O O   . ASP A 246 ? 0.3991 0.5564 0.7752 0.0549  0.1498  0.0700  356 ASP A O   
1623 C CB  . ASP A 246 ? 0.4347 0.6493 0.8814 0.0694  0.1692  0.1005  356 ASP A CB  
1624 C CG  . ASP A 246 ? 0.6239 0.8662 1.1064 0.0606  0.1641  0.1198  356 ASP A CG  
1625 O OD1 . ASP A 246 ? 0.6560 0.9015 1.1388 0.0485  0.1574  0.1259  356 ASP A OD1 
1626 O OD2 . ASP A 246 ? 0.6886 0.9489 1.1996 0.0655  0.1658  0.1293  356 ASP A OD2 
1627 N N   . GLU A 247 ? 0.3855 0.5358 0.7623 0.0753  0.1621  0.0608  357 GLU A N   
1628 C CA  . GLU A 247 ? 0.3928 0.5177 0.7339 0.0777  0.1638  0.0452  357 GLU A CA  
1629 C C   . GLU A 247 ? 0.4083 0.5166 0.7366 0.0658  0.1464  0.0380  357 GLU A C   
1630 O O   . GLU A 247 ? 0.3743 0.4707 0.6798 0.0612  0.1444  0.0320  357 GLU A O   
1631 C CB  . GLU A 247 ? 0.4281 0.5393 0.7595 0.0914  0.1721  0.0352  357 GLU A CB  
1632 C CG  . GLU A 247 ? 0.5956 0.7139 0.9231 0.1055  0.1923  0.0360  357 GLU A CG  
1633 C CD  . GLU A 247 ? 0.8065 0.9062 1.1208 0.1196  0.2002  0.0240  357 GLU A CD  
1634 O OE1 . GLU A 247 ? 0.4740 0.5702 0.8034 0.1224  0.1944  0.0238  357 GLU A OE1 
1635 O OE2 . GLU A 247 ? 0.7977 0.8859 1.0862 0.1278  0.2119  0.0152  357 GLU A OE2 
1636 N N   . GLU A 248 ? 0.3642 0.4733 0.7080 0.0611  0.1340  0.0397  358 GLU A N   
1637 C CA  . GLU A 248 ? 0.3535 0.4502 0.6888 0.0508  0.1179  0.0343  358 GLU A CA  
1638 C C   . GLU A 248 ? 0.3857 0.4867 0.7209 0.0397  0.1111  0.0392  358 GLU A C   
1639 O O   . GLU A 248 ? 0.3896 0.4764 0.7076 0.0336  0.1027  0.0320  358 GLU A O   
1640 C CB  . GLU A 248 ? 0.3622 0.4643 0.7171 0.0485  0.1075  0.0381  358 GLU A CB  
1641 C CG  . GLU A 248 ? 0.5109 0.6001 0.8595 0.0555  0.1072  0.0304  358 GLU A CG  
1642 C CD  . GLU A 248 ? 0.7620 0.8579 1.1295 0.0535  0.0972  0.0355  358 GLU A CD  
1643 O OE1 . GLU A 248 ? 0.4178 0.5199 0.7928 0.0437  0.0853  0.0398  358 GLU A OE1 
1644 O OE2 . GLU A 248 ? 0.7945 0.8881 1.1679 0.0619  0.1008  0.0350  358 GLU A OE2 
1645 N N   . GLN A 249 ? 0.2998 0.4206 0.6557 0.0371  0.1142  0.0520  359 GLN A N   
1646 C CA  . GLN A 249 ? 0.2888 0.4144 0.6487 0.0261  0.1074  0.0588  359 GLN A CA  
1647 C C   . GLN A 249 ? 0.3596 0.4792 0.6983 0.0266  0.1154  0.0566  359 GLN A C   
1648 O O   . GLN A 249 ? 0.3589 0.4706 0.6886 0.0183  0.1073  0.0557  359 GLN A O   
1649 C CB  . GLN A 249 ? 0.2985 0.4486 0.6902 0.0228  0.1082  0.0752  359 GLN A CB  
1650 C CG  . GLN A 249 ? 0.5308 0.6852 0.9314 0.0097  0.0980  0.0837  359 GLN A CG  
1651 C CD  . GLN A 249 ? 0.6736 0.8317 1.0662 0.0083  0.1067  0.0891  359 GLN A CD  
1652 O OE1 . GLN A 249 ? 0.5457 0.7136 0.9357 0.0169  0.1227  0.0923  359 GLN A OE1 
1653 N NE2 . GLN A 249 ? 0.4984 0.6478 0.8854 -0.0021 0.0965  0.0899  359 GLN A NE2 
1654 N N   . GLN A 250 ? 0.3288 0.4518 0.6591 0.0368  0.1311  0.0556  360 GLN A N   
1655 C CA  . GLN A 250 ? 0.3369 0.4566 0.6465 0.0377  0.1396  0.0548  360 GLN A CA  
1656 C C   . GLN A 250 ? 0.3665 0.4623 0.6437 0.0386  0.1368  0.0401  360 GLN A C   
1657 O O   . GLN A 250 ? 0.3659 0.4578 0.6259 0.0358  0.1388  0.0401  360 GLN A O   
1658 C CB  . GLN A 250 ? 0.3729 0.5074 0.6855 0.0488  0.1585  0.0602  360 GLN A CB  
1659 C CG  . GLN A 250 ? 0.5740 0.7365 0.9190 0.0467  0.1629  0.0782  360 GLN A CG  
1660 C CD  . GLN A 250 ? 1.0649 1.2441 1.4203 0.0603  0.1812  0.0834  360 GLN A CD  
1661 O OE1 . GLN A 250 ? 1.0991 1.2697 1.4323 0.0717  0.1941  0.0743  360 GLN A OE1 
1662 N NE2 . GLN A 250 ? 0.9854 1.1895 1.3752 0.0596  0.1828  0.0985  360 GLN A NE2 
1663 N N   . LEU A 251 ? 0.3073 0.3883 0.5768 0.0422  0.1320  0.0289  361 LEU A N   
1664 C CA  . LEU A 251 ? 0.3241 0.3837 0.5649 0.0428  0.1293  0.0161  361 LEU A CA  
1665 C C   . LEU A 251 ? 0.3382 0.3900 0.5669 0.0328  0.1189  0.0152  361 LEU A C   
1666 O O   . LEU A 251 ? 0.3538 0.3966 0.5596 0.0331  0.1217  0.0108  361 LEU A O   
1667 C CB  . LEU A 251 ? 0.3275 0.3741 0.5665 0.0459  0.1234  0.0068  361 LEU A CB  
1668 C CG  . LEU A 251 ? 0.3990 0.4240 0.6100 0.0462  0.1203  -0.0056 361 LEU A CG  
1669 C CD1 . LEU A 251 ? 0.4176 0.4348 0.6104 0.0556  0.1327  -0.0118 361 LEU A CD1 
1670 C CD2 . LEU A 251 ? 0.4598 0.4747 0.6731 0.0449  0.1105  -0.0113 361 LEU A CD2 
1671 N N   . LEU A 252 ? 0.2602 0.3143 0.5029 0.0247  0.1068  0.0190  362 LEU A N   
1672 C CA  . LEU A 252 ? 0.2557 0.3012 0.4881 0.0167  0.0972  0.0178  362 LEU A CA  
1673 C C   . LEU A 252 ? 0.3239 0.3762 0.5525 0.0135  0.1021  0.0262  362 LEU A C   
1674 O O   . LEU A 252 ? 0.3162 0.3591 0.5273 0.0105  0.0989  0.0235  362 LEU A O   
1675 C CB  . LEU A 252 ? 0.2394 0.2844 0.4862 0.0099  0.0839  0.0191  362 LEU A CB  
1676 C CG  . LEU A 252 ? 0.2761 0.3131 0.5226 0.0116  0.0771  0.0109  362 LEU A CG  
1677 C CD1 . LEU A 252 ? 0.2836 0.3203 0.5409 0.0050  0.0647  0.0122  362 LEU A CD1 
1678 C CD2 . LEU A 252 ? 0.2427 0.2646 0.4669 0.0134  0.0757  0.0009  362 LEU A CD2 
1679 N N   . HIS A 253 ? 0.2816 0.3513 0.5268 0.0145  0.1102  0.0372  363 HIS A N   
1680 C CA  . HIS A 253 ? 0.2846 0.3640 0.5281 0.0119  0.1167  0.0475  363 HIS A CA  
1681 C C   . HIS A 253 ? 0.3464 0.4209 0.5631 0.0188  0.1281  0.0421  363 HIS A C   
1682 O O   . HIS A 253 ? 0.3539 0.4246 0.5550 0.0151  0.1274  0.0441  363 HIS A O   
1683 C CB  . HIS A 253 ? 0.2947 0.3963 0.5650 0.0115  0.1231  0.0616  363 HIS A CB  
1684 C CG  . HIS A 253 ? 0.3232 0.4291 0.6182 0.0027  0.1102  0.0682  363 HIS A CG  
1685 N ND1 . HIS A 253 ? 0.3438 0.4482 0.6441 -0.0074 0.1010  0.0755  363 HIS A ND1 
1686 C CD2 . HIS A 253 ? 0.3339 0.4435 0.6474 0.0025  0.1045  0.0677  363 HIS A CD2 
1687 C CE1 . HIS A 253 ? 0.3218 0.4279 0.6425 -0.0133 0.0899  0.0783  363 HIS A CE1 
1688 N NE2 . HIS A 253 ? 0.3220 0.4322 0.6510 -0.0080 0.0915  0.0741  363 HIS A NE2 
1689 N N   . LYS A 254 ? 0.3150 0.3874 0.5250 0.0287  0.1374  0.0346  364 LYS A N   
1690 C CA  . LYS A 254 ? 0.3404 0.4049 0.5223 0.0363  0.1481  0.0272  364 LYS A CA  
1691 C C   . LYS A 254 ? 0.3950 0.4387 0.5506 0.0325  0.1387  0.0165  364 LYS A C   
1692 O O   . LYS A 254 ? 0.3933 0.4328 0.5261 0.0319  0.1419  0.0158  364 LYS A O   
1693 C CB  . LYS A 254 ? 0.3789 0.4422 0.5613 0.0481  0.1583  0.0203  364 LYS A CB  
1694 C CG  . LYS A 254 ? 0.5442 0.6302 0.7486 0.0545  0.1716  0.0316  364 LYS A CG  
1695 C CD  . LYS A 254 ? 0.6368 0.7209 0.8473 0.0662  0.1793  0.0253  364 LYS A CD  
1696 C CE  . LYS A 254 ? 0.6102 0.7191 0.8446 0.0736  0.1932  0.0374  364 LYS A CE  
1697 N NZ  . LYS A 254 ? 0.5757 0.6825 0.8186 0.0858  0.2001  0.0320  364 LYS A NZ  
1698 N N   . VAL A 255 ? 0.3537 0.3860 0.5130 0.0296  0.1270  0.0093  365 VAL A N   
1699 C CA  . VAL A 255 ? 0.3661 0.3806 0.5050 0.0259  0.1173  0.0001  365 VAL A CA  
1700 C C   . VAL A 255 ? 0.4380 0.4532 0.5728 0.0172  0.1096  0.0064  365 VAL A C   
1701 O O   . VAL A 255 ? 0.4574 0.4632 0.5696 0.0155  0.1075  0.0027  365 VAL A O   
1702 C CB  . VAL A 255 ? 0.3924 0.3983 0.5402 0.0252  0.1077  -0.0069 365 VAL A CB  
1703 C CG1 . VAL A 255 ? 0.3835 0.3771 0.5193 0.0191  0.0957  -0.0118 365 VAL A CG1 
1704 C CG2 . VAL A 255 ? 0.3943 0.3930 0.5374 0.0338  0.1142  -0.0151 365 VAL A CG2 
1705 N N   . THR A 256 ? 0.3743 0.3996 0.5307 0.0118  0.1049  0.0160  366 THR A N   
1706 C CA  . THR A 256 ? 0.3775 0.4021 0.5327 0.0041  0.0972  0.0225  366 THR A CA  
1707 C C   . THR A 256 ? 0.4602 0.4930 0.6047 0.0037  0.1059  0.0312  366 THR A C   
1708 O O   . THR A 256 ? 0.4570 0.4845 0.5876 -0.0006 0.1011  0.0332  366 THR A O   
1709 C CB  . THR A 256 ? 0.3817 0.4108 0.5618 -0.0016 0.0881  0.0287  366 THR A CB  
1710 O OG1 . THR A 256 ? 0.2975 0.3411 0.4980 -0.0008 0.0942  0.0367  366 THR A OG1 
1711 C CG2 . THR A 256 ? 0.3098 0.3291 0.4940 -0.0018 0.0783  0.0197  366 THR A CG2 
1712 N N   . ASP A 257 ? 0.4243 0.4708 0.5746 0.0085  0.1189  0.0370  367 ASP A N   
1713 C CA  . ASP A 257 ? 0.4385 0.4945 0.5766 0.0092  0.1292  0.0456  367 ASP A CA  
1714 C C   . ASP A 257 ? 0.4809 0.5242 0.5841 0.0132  0.1325  0.0355  367 ASP A C   
1715 O O   . ASP A 257 ? 0.4744 0.5178 0.5608 0.0097  0.1324  0.0404  367 ASP A O   
1716 C CB  . ASP A 257 ? 0.4773 0.5524 0.6299 0.0151  0.1438  0.0536  367 ASP A CB  
1717 C CG  . ASP A 257 ? 0.6665 0.7577 0.8528 0.0093  0.1410  0.0677  367 ASP A CG  
1718 O OD1 . ASP A 257 ? 0.6952 0.8017 0.8993 0.0141  0.1503  0.0730  367 ASP A OD1 
1719 O OD2 . ASP A 257 ? 0.7369 0.8251 0.9323 -0.0001 0.1291  0.0736  367 ASP A OD2 
1720 N N   . PHE A 258 ? 0.4318 0.4630 0.5245 0.0196  0.1337  0.0217  368 PHE A N   
1721 C CA  . PHE A 258 ? 0.4579 0.4733 0.5176 0.0227  0.1345  0.0101  368 PHE A CA  
1722 C C   . PHE A 258 ? 0.5139 0.5186 0.5616 0.0141  0.1203  0.0091  368 PHE A C   
1723 O O   . PHE A 258 ? 0.5497 0.5501 0.5723 0.0127  0.1208  0.0089  368 PHE A O   
1724 C CB  . PHE A 258 ? 0.4852 0.4883 0.5422 0.0297  0.1357  -0.0034 368 PHE A CB  
1725 C CG  . PHE A 258 ? 0.5320 0.5149 0.5574 0.0311  0.1326  -0.0165 368 PHE A CG  
1726 C CD1 . PHE A 258 ? 0.6051 0.5834 0.6019 0.0368  0.1428  -0.0210 368 PHE A CD1 
1727 C CD2 . PHE A 258 ? 0.5526 0.5210 0.5764 0.0266  0.1192  -0.0242 368 PHE A CD2 
1728 C CE1 . PHE A 258 ? 0.6439 0.6014 0.6101 0.0371  0.1382  -0.0337 368 PHE A CE1 
1729 C CE2 . PHE A 258 ? 0.6151 0.5647 0.6111 0.0264  0.1147  -0.0353 368 PHE A CE2 
1730 C CZ  . PHE A 258 ? 0.6288 0.5720 0.5956 0.0313  0.1236  -0.0404 368 PHE A CZ  
1731 N N   . TRP A 259 ? 0.4245 0.4264 0.4905 0.0088  0.1080  0.0095  369 TRP A N   
1732 C CA  . TRP A 259 ? 0.4128 0.4066 0.4725 0.0017  0.0948  0.0098  369 TRP A CA  
1733 C C   . TRP A 259 ? 0.4662 0.4688 0.5273 -0.0040 0.0934  0.0231  369 TRP A C   
1734 O O   . TRP A 259 ? 0.4687 0.4657 0.5141 -0.0082 0.0867  0.0244  369 TRP A O   
1735 C CB  . TRP A 259 ? 0.3682 0.3583 0.4479 -0.0007 0.0843  0.0069  369 TRP A CB  
1736 C CG  . TRP A 259 ? 0.3800 0.3595 0.4549 0.0028  0.0822  -0.0051 369 TRP A CG  
1737 C CD1 . TRP A 259 ? 0.4332 0.4011 0.4847 0.0051  0.0834  -0.0142 369 TRP A CD1 
1738 C CD2 . TRP A 259 ? 0.3604 0.3387 0.4536 0.0036  0.0774  -0.0089 369 TRP A CD2 
1739 N NE1 . TRP A 259 ? 0.4200 0.3797 0.4761 0.0071  0.0797  -0.0226 369 TRP A NE1 
1740 C CE2 . TRP A 259 ? 0.4182 0.3851 0.4996 0.0063  0.0763  -0.0191 369 TRP A CE2 
1741 C CE3 . TRP A 259 ? 0.3589 0.3441 0.4763 0.0020  0.0734  -0.0046 369 TRP A CE3 
1742 C CZ2 . TRP A 259 ? 0.3957 0.3597 0.4898 0.0075  0.0719  -0.0238 369 TRP A CZ2 
1743 C CZ3 . TRP A 259 ? 0.3656 0.3477 0.4932 0.0035  0.0690  -0.0102 369 TRP A CZ3 
1744 C CH2 . TRP A 259 ? 0.3799 0.3524 0.4965 0.0062  0.0687  -0.0190 369 TRP A CH2 
1745 N N   . LYS A 260 ? 0.4085 0.4249 0.4893 -0.0046 0.0991  0.0339  370 LYS A N   
1746 C CA  . LYS A 260 ? 0.4184 0.4438 0.5031 -0.0102 0.0984  0.0484  370 LYS A CA  
1747 C C   . LYS A 260 ? 0.5131 0.5411 0.5696 -0.0088 0.1066  0.0510  370 LYS A C   
1748 O O   . LYS A 260 ? 0.5184 0.5453 0.5644 -0.0141 0.1010  0.0579  370 LYS A O   
1749 C CB  . LYS A 260 ? 0.4344 0.4745 0.5468 -0.0115 0.1031  0.0596  370 LYS A CB  
1750 C CG  . LYS A 260 ? 0.5660 0.6116 0.6903 -0.0194 0.0972  0.0747  370 LYS A CG  
1751 C CD  . LYS A 260 ? 0.6948 0.7510 0.8503 -0.0226 0.0970  0.0843  370 LYS A CD  
1752 C CE  . LYS A 260 ? 0.8986 0.9743 1.0607 -0.0218 0.1103  0.0971  370 LYS A CE  
1753 N NZ  . LYS A 260 ? 1.0280 1.1105 1.1848 -0.0275 0.1110  0.1122  370 LYS A NZ  
1754 N N   . GLN A 261 ? 0.4926 0.5225 0.5351 -0.0010 0.1196  0.0445  371 GLN A N   
1755 C CA  . GLN A 261 ? 0.5284 0.5589 0.5395 0.0023  0.1290  0.0438  371 GLN A CA  
1756 C C   . GLN A 261 ? 0.5869 0.6002 0.5694 -0.0005 0.1190  0.0344  371 GLN A C   
1757 O O   . GLN A 261 ? 0.6005 0.6141 0.5591 -0.0029 0.1196  0.0387  371 GLN A O   
1758 C CB  . GLN A 261 ? 0.5609 0.5941 0.5645 0.0130  0.1447  0.0362  371 GLN A CB  
1759 C CG  . GLN A 261 ? 0.7567 0.8114 0.7842 0.0164  0.1574  0.0483  371 GLN A CG  
1760 C CD  . GLN A 261 ? 1.0537 1.1099 1.0808 0.0281  0.1711  0.0396  371 GLN A CD  
1761 O OE1 . GLN A 261 ? 1.0683 1.1259 1.0720 0.0362  0.1845  0.0362  371 GLN A OE1 
1762 N NE2 . GLN A 261 ? 0.8887 0.9446 0.9413 0.0299  0.1680  0.0360  371 GLN A NE2 
1763 N N   . GLN A 262 ? 0.5394 0.5389 0.5253 -0.0009 0.1092  0.0230  372 GLN A N   
1764 C CA  . GLN A 262 ? 0.5453 0.5291 0.5092 -0.0043 0.0979  0.0144  372 GLN A CA  
1765 C C   . GLN A 262 ? 0.5763 0.5613 0.5463 -0.0130 0.0845  0.0239  372 GLN A C   
1766 O O   . GLN A 262 ? 0.5792 0.5555 0.5291 -0.0170 0.0758  0.0213  372 GLN A O   
1767 C CB  . GLN A 262 ? 0.5520 0.5234 0.5225 -0.0020 0.0925  0.0012  372 GLN A CB  
1768 C CG  . GLN A 262 ? 0.7791 0.7453 0.7429 0.0070  0.1038  -0.0096 372 GLN A CG  
1769 C CD  . GLN A 262 ? 1.1175 1.0759 1.0459 0.0113  0.1117  -0.0163 372 GLN A CD  
1770 O OE1 . GLN A 262 ? 1.0910 1.0595 1.0129 0.0167  0.1255  -0.0118 372 GLN A OE1 
1771 N NE2 . GLN A 262 ? 1.0774 1.0178 0.9820 0.0091  0.1032  -0.0270 372 GLN A NE2 
1772 N N   . GLY A 263 ? 0.5148 0.5096 0.5129 -0.0157 0.0824  0.0345  373 GLY A N   
1773 C CA  . GLY A 263 ? 0.5018 0.4972 0.5109 -0.0225 0.0704  0.0439  373 GLY A CA  
1774 C C   . GLY A 263 ? 0.5447 0.5314 0.5672 -0.0234 0.0590  0.0368  373 GLY A C   
1775 O O   . GLY A 263 ? 0.5648 0.5481 0.5877 -0.0276 0.0479  0.0404  373 GLY A O   
1776 N N   . LEU A 264 ? 0.4589 0.4433 0.4935 -0.0191 0.0619  0.0277  374 LEU A N   
1777 C CA  . LEU A 264 ? 0.4251 0.4025 0.4715 -0.0191 0.0528  0.0207  374 LEU A CA  
1778 C C   . LEU A 264 ? 0.4488 0.4308 0.5240 -0.0188 0.0509  0.0240  374 LEU A C   
1779 O O   . LEU A 264 ? 0.4495 0.4273 0.5354 -0.0189 0.0431  0.0203  374 LEU A O   
1780 C CB  . LEU A 264 ? 0.4278 0.3976 0.4644 -0.0149 0.0562  0.0076  374 LEU A CB  
1781 C CG  . LEU A 264 ? 0.5103 0.4708 0.5168 -0.0153 0.0559  0.0010  374 LEU A CG  
1782 C CD1 . LEU A 264 ? 0.5134 0.4644 0.5145 -0.0109 0.0587  -0.0117 374 LEU A CD1 
1783 C CD2 . LEU A 264 ? 0.5392 0.4951 0.5375 -0.0215 0.0427  0.0031  374 LEU A CD2 
1784 N N   . LEU A 265 ? 0.3974 0.3879 0.4845 -0.0185 0.0578  0.0311  375 LEU A N   
1785 C CA  . LEU A 265 ? 0.3848 0.3784 0.4975 -0.0190 0.0553  0.0341  375 LEU A CA  
1786 C C   . LEU A 265 ? 0.4286 0.4216 0.5515 -0.0238 0.0470  0.0439  375 LEU A C   
1787 O O   . LEU A 265 ? 0.4472 0.4460 0.5711 -0.0270 0.0496  0.0550  375 LEU A O   
1788 C CB  . LEU A 265 ? 0.3876 0.3913 0.5105 -0.0171 0.0656  0.0377  375 LEU A CB  
1789 C CG  . LEU A 265 ? 0.4427 0.4502 0.5918 -0.0185 0.0627  0.0411  375 LEU A CG  
1790 C CD1 . LEU A 265 ? 0.4332 0.4340 0.5888 -0.0158 0.0575  0.0304  375 LEU A CD1 
1791 C CD2 . LEU A 265 ? 0.4929 0.5133 0.6522 -0.0173 0.0731  0.0475  375 LEU A CD2 
1792 N N   . LEU A 266 ? 0.3493 0.3351 0.4799 -0.0238 0.0375  0.0403  376 LEU A N   
1793 C CA  . LEU A 266 ? 0.3346 0.3169 0.4751 -0.0266 0.0289  0.0478  376 LEU A CA  
1794 C C   . LEU A 266 ? 0.3685 0.3495 0.5307 -0.0274 0.0264  0.0499  376 LEU A C   
1795 O O   . LEU A 266 ? 0.3806 0.3592 0.5522 -0.0307 0.0216  0.0588  376 LEU A O   
1796 C CB  . LEU A 266 ? 0.3218 0.2977 0.4588 -0.0250 0.0206  0.0428  376 LEU A CB  
1797 C CG  . LEU A 266 ? 0.3844 0.3603 0.5005 -0.0256 0.0202  0.0410  376 LEU A CG  
1798 C CD1 . LEU A 266 ? 0.3875 0.3597 0.5056 -0.0244 0.0114  0.0381  376 LEU A CD1 
1799 C CD2 . LEU A 266 ? 0.4090 0.3884 0.5128 -0.0296 0.0214  0.0517  376 LEU A CD2 
1800 N N   . TYR A 267 ? 0.3080 0.2896 0.4779 -0.0248 0.0286  0.0420  377 TYR A N   
1801 C CA  . TYR A 267 ? 0.2900 0.2703 0.4789 -0.0262 0.0256  0.0429  377 TYR A CA  
1802 C C   . TYR A 267 ? 0.3306 0.3173 0.5232 -0.0240 0.0319  0.0374  377 TYR A C   
1803 O O   . TYR A 267 ? 0.3054 0.2922 0.4882 -0.0201 0.0350  0.0290  377 TYR A O   
1804 C CB  . TYR A 267 ? 0.2691 0.2385 0.4654 -0.0244 0.0159  0.0377  377 TYR A CB  
1805 C CG  . TYR A 267 ? 0.2832 0.2489 0.4958 -0.0261 0.0116  0.0370  377 TYR A CG  
1806 C CD1 . TYR A 267 ? 0.3064 0.2678 0.5307 -0.0311 0.0066  0.0460  377 TYR A CD1 
1807 C CD2 . TYR A 267 ? 0.2885 0.2550 0.5045 -0.0236 0.0119  0.0282  377 TYR A CD2 
1808 C CE1 . TYR A 267 ? 0.3380 0.2947 0.5764 -0.0339 0.0013  0.0453  377 TYR A CE1 
1809 C CE2 . TYR A 267 ? 0.2921 0.2553 0.5215 -0.0261 0.0070  0.0277  377 TYR A CE2 
1810 C CZ  . TYR A 267 ? 0.3870 0.3447 0.6272 -0.0314 0.0013  0.0358  377 TYR A CZ  
1811 O OH  . TYR A 267 ? 0.3729 0.3258 0.6254 -0.0347 -0.0052 0.0347  377 TYR A OH  
1812 N N   . CYS A 268 ? 0.3044 0.2966 0.5124 -0.0270 0.0331  0.0430  378 CYS A N   
1813 C CA  . CYS A 268 ? 0.2961 0.2959 0.5109 -0.0249 0.0384  0.0395  378 CYS A CA  
1814 C C   . CYS A 268 ? 0.3435 0.3448 0.5788 -0.0292 0.0332  0.0438  378 CYS A C   
1815 O O   . CYS A 268 ? 0.3523 0.3567 0.5976 -0.0346 0.0318  0.0545  378 CYS A O   
1816 C CB  . CYS A 268 ? 0.3062 0.3175 0.5144 -0.0230 0.0506  0.0437  378 CYS A CB  
1817 S SG  . CYS A 268 ? 0.3486 0.3697 0.5663 -0.0187 0.0581  0.0399  378 CYS A SG  
1818 N N   . ASP A 269 ? 0.2914 0.2911 0.5326 -0.0273 0.0300  0.0362  379 ASP A N   
1819 C CA  . ASP A 269 ? 0.2858 0.2872 0.5450 -0.0315 0.0241  0.0390  379 ASP A CA  
1820 C C   . ASP A 269 ? 0.3106 0.3206 0.5737 -0.0279 0.0285  0.0345  379 ASP A C   
1821 O O   . ASP A 269 ? 0.2871 0.2919 0.5416 -0.0234 0.0272  0.0245  379 ASP A O   
1822 C CB  . ASP A 269 ? 0.3255 0.3117 0.5862 -0.0332 0.0117  0.0334  379 ASP A CB  
1823 C CG  . ASP A 269 ? 0.4628 0.4473 0.7395 -0.0387 0.0031  0.0354  379 ASP A CG  
1824 O OD1 . ASP A 269 ? 0.4733 0.4695 0.7644 -0.0435 0.0055  0.0451  379 ASP A OD1 
1825 O OD2 . ASP A 269 ? 0.4927 0.4642 0.7673 -0.0384 -0.0062 0.0274  379 ASP A OD2 
1826 N N   . ILE A 270 ? 0.2363 0.2606 0.5129 -0.0295 0.0344  0.0431  380 ILE A N   
1827 C CA  . ILE A 270 ? 0.2200 0.2538 0.5032 -0.0256 0.0390  0.0407  380 ILE A CA  
1828 C C   . ILE A 270 ? 0.2954 0.3319 0.5973 -0.0312 0.0297  0.0440  380 ILE A C   
1829 O O   . ILE A 270 ? 0.3007 0.3431 0.6178 -0.0379 0.0268  0.0547  380 ILE A O   
1830 C CB  . ILE A 270 ? 0.2609 0.3097 0.5460 -0.0216 0.0531  0.0473  380 ILE A CB  
1831 C CG1 . ILE A 270 ? 0.2697 0.3134 0.5323 -0.0166 0.0611  0.0428  380 ILE A CG1 
1832 C CG2 . ILE A 270 ? 0.2657 0.3241 0.5604 -0.0167 0.0576  0.0456  380 ILE A CG2 
1833 C CD1 . ILE A 270 ? 0.2758 0.3320 0.5360 -0.0134 0.0747  0.0501  380 ILE A CD1 
1834 N N   . LEU A 271 ? 0.2634 0.2958 0.5641 -0.0290 0.0243  0.0357  381 LEU A N   
1835 C CA  . LEU A 271 ? 0.2797 0.3144 0.5955 -0.0342 0.0145  0.0377  381 LEU A CA  
1836 C C   . LEU A 271 ? 0.3105 0.3616 0.6391 -0.0312 0.0208  0.0421  381 LEU A C   
1837 O O   . LEU A 271 ? 0.2949 0.3463 0.6152 -0.0242 0.0258  0.0355  381 LEU A O   
1838 C CB  . LEU A 271 ? 0.2972 0.3174 0.6028 -0.0339 0.0038  0.0264  381 LEU A CB  
1839 C CG  . LEU A 271 ? 0.3883 0.3911 0.6841 -0.0363 -0.0043 0.0217  381 LEU A CG  
1840 C CD1 . LEU A 271 ? 0.4083 0.3997 0.6952 -0.0350 -0.0136 0.0110  381 LEU A CD1 
1841 C CD2 . LEU A 271 ? 0.4353 0.4359 0.7449 -0.0452 -0.0115 0.0308  381 LEU A CD2 
1842 N N   . GLU A 272 ? 0.2474 0.3126 0.5976 -0.0364 0.0205  0.0544  382 GLU A N   
1843 C CA  . GLU A 272 ? 0.2301 0.3135 0.5965 -0.0331 0.0268  0.0608  382 GLU A CA  
1844 C C   . GLU A 272 ? 0.2495 0.3307 0.6180 -0.0329 0.0178  0.0550  382 GLU A C   
1845 O O   . GLU A 272 ? 0.2522 0.3213 0.6157 -0.0384 0.0048  0.0497  382 GLU A O   
1846 C CB  . GLU A 272 ? 0.2568 0.3580 0.6487 -0.0396 0.0275  0.0771  382 GLU A CB  
1847 C CG  . GLU A 272 ? 0.3779 0.4878 0.7690 -0.0373 0.0409  0.0851  382 GLU A CG  
1848 C CD  . GLU A 272 ? 0.6044 0.7181 0.9821 -0.0255 0.0572  0.0803  382 GLU A CD  
1849 O OE1 . GLU A 272 ? 0.5795 0.7032 0.9653 -0.0189 0.0630  0.0804  382 GLU A OE1 
1850 O OE2 . GLU A 272 ? 0.4658 0.5713 0.8244 -0.0227 0.0633  0.0764  382 GLU A OE2 
1851 N N   . SER A 273 ? 0.2099 0.3022 0.5848 -0.0262 0.0249  0.0561  383 SER A N   
1852 C CA  . SER A 273 ? 0.2100 0.3026 0.5878 -0.0256 0.0171  0.0525  383 SER A CA  
1853 C C   . SER A 273 ? 0.2519 0.3525 0.6496 -0.0350 0.0042  0.0608  383 SER A C   
1854 O O   . SER A 273 ? 0.2366 0.3509 0.6544 -0.0396 0.0054  0.0730  383 SER A O   
1855 C CB  . SER A 273 ? 0.2358 0.3390 0.6189 -0.0161 0.0281  0.0538  383 SER A CB  
1856 O OG  . SER A 273 ? 0.2823 0.3909 0.6753 -0.0166 0.0204  0.0552  383 SER A OG  
1857 N N   . THR A 274 ? 0.2359 0.3280 0.6270 -0.0383 -0.0086 0.0543  384 THR A N   
1858 C CA  . THR A 274 ? 0.2415 0.3393 0.6481 -0.0473 -0.0230 0.0605  384 THR A CA  
1859 C C   . THR A 274 ? 0.2801 0.3837 0.6874 -0.0432 -0.0258 0.0587  384 THR A C   
1860 O O   . THR A 274 ? 0.2681 0.3733 0.6809 -0.0498 -0.0395 0.0605  384 THR A O   
1861 C CB  . THR A 274 ? 0.3418 0.4210 0.7368 -0.0561 -0.0376 0.0540  384 THR A CB  
1862 O OG1 . THR A 274 ? 0.3962 0.4582 0.7649 -0.0510 -0.0387 0.0394  384 THR A OG1 
1863 C CG2 . THR A 274 ? 0.2180 0.2926 0.6165 -0.0610 -0.0360 0.0585  384 THR A CG2 
1864 N N   . PHE A 275 ? 0.2306 0.3362 0.6312 -0.0327 -0.0133 0.0553  385 PHE A N   
1865 C CA  . PHE A 275 ? 0.2229 0.3328 0.6233 -0.0273 -0.0137 0.0540  385 PHE A CA  
1866 C C   . PHE A 275 ? 0.2842 0.4137 0.7116 -0.0301 -0.0184 0.0670  385 PHE A C   
1867 O O   . PHE A 275 ? 0.2846 0.4294 0.7335 -0.0298 -0.0117 0.0780  385 PHE A O   
1868 C CB  . PHE A 275 ? 0.2248 0.3330 0.6171 -0.0159 0.0015  0.0499  385 PHE A CB  
1869 C CG  . PHE A 275 ? 0.2195 0.3338 0.6170 -0.0096 0.0030  0.0515  385 PHE A CG  
1870 C CD1 . PHE A 275 ? 0.2313 0.3377 0.6152 -0.0103 -0.0055 0.0453  385 PHE A CD1 
1871 C CD2 . PHE A 275 ? 0.2227 0.3503 0.6382 -0.0022 0.0137  0.0595  385 PHE A CD2 
1872 C CE1 . PHE A 275 ? 0.2283 0.3404 0.6178 -0.0050 -0.0046 0.0483  385 PHE A CE1 
1873 C CE2 . PHE A 275 ? 0.2463 0.3779 0.6675 0.0040  0.0147  0.0614  385 PHE A CE2 
1874 C CZ  . PHE A 275 ? 0.2084 0.3321 0.6169 0.0021  0.0052  0.0562  385 PHE A CZ  
1875 N N   . GLU A 276 ? 0.2591 0.3893 0.6854 -0.0328 -0.0299 0.0665  386 GLU A N   
1876 C CA  . GLU A 276 ? 0.2676 0.4165 0.7187 -0.0357 -0.0368 0.0790  386 GLU A CA  
1877 C C   . GLU A 276 ? 0.3074 0.4594 0.7565 -0.0275 -0.0338 0.0784  386 GLU A C   
1878 O O   . GLU A 276 ? 0.3024 0.4437 0.7322 -0.0283 -0.0412 0.0704  386 GLU A O   
1879 C CB  . GLU A 276 ? 0.2966 0.4432 0.7483 -0.0486 -0.0567 0.0803  386 GLU A CB  
1880 C CG  . GLU A 276 ? 0.4144 0.5600 0.8752 -0.0580 -0.0614 0.0845  386 GLU A CG  
1881 C CD  . GLU A 276 ? 0.6363 0.7727 1.0921 -0.0709 -0.0820 0.0825  386 GLU A CD  
1882 O OE1 . GLU A 276 ? 0.4968 0.6418 0.9612 -0.0760 -0.0944 0.0880  386 GLU A OE1 
1883 O OE2 . GLU A 276 ? 0.5954 0.7150 1.0384 -0.0762 -0.0864 0.0755  386 GLU A OE2 
1884 N N   . LYS A 277 ? 0.2559 0.4223 0.7248 -0.0191 -0.0222 0.0871  387 LYS A N   
1885 C CA  . LYS A 277 ? 0.2431 0.4122 0.7141 -0.0099 -0.0173 0.0881  387 LYS A CA  
1886 C C   . LYS A 277 ? 0.2599 0.4334 0.7325 -0.0148 -0.0326 0.0918  387 LYS A C   
1887 O O   . LYS A 277 ? 0.2597 0.4261 0.7197 -0.0101 -0.0324 0.0873  387 LYS A O   
1888 C CB  . LYS A 277 ? 0.2845 0.4711 0.7826 -0.0009 -0.0041 0.0994  387 LYS A CB  
1889 C CG  . LYS A 277 ? 0.6173 0.7994 1.1125 0.0118  0.0068  0.0967  387 LYS A CG  
1890 C CD  . LYS A 277 ? 0.7698 0.9682 1.2915 0.0223  0.0205  0.1071  387 LYS A CD  
1891 C CE  . LYS A 277 ? 0.8864 1.0758 1.4032 0.0355  0.0314  0.1028  387 LYS A CE  
1892 N NZ  . LYS A 277 ? 0.9760 1.1688 1.5012 0.0363  0.0221  0.1084  387 LYS A NZ  
1893 N N   . PHE A 278 ? 0.2120 0.3965 0.6988 -0.0249 -0.0465 0.1002  388 PHE A N   
1894 C CA  . PHE A 278 ? 0.2196 0.4102 0.7088 -0.0297 -0.0615 0.1052  388 PHE A CA  
1895 C C   . PHE A 278 ? 0.3029 0.4816 0.7706 -0.0416 -0.0793 0.0975  388 PHE A C   
1896 O O   . PHE A 278 ? 0.3007 0.4849 0.7689 -0.0471 -0.0935 0.1020  388 PHE A O   
1897 C CB  . PHE A 278 ? 0.2394 0.4554 0.7655 -0.0308 -0.0647 0.1235  388 PHE A CB  
1898 C CG  . PHE A 278 ? 0.2479 0.4747 0.7941 -0.0173 -0.0467 0.1303  388 PHE A CG  
1899 C CD1 . PHE A 278 ? 0.2934 0.5330 0.8614 -0.0144 -0.0355 0.1379  388 PHE A CD1 
1900 C CD2 . PHE A 278 ? 0.2789 0.5020 0.8208 -0.0070 -0.0403 0.1288  388 PHE A CD2 
1901 C CE1 . PHE A 278 ? 0.2998 0.5483 0.8841 -0.0004 -0.0179 0.1430  388 PHE A CE1 
1902 C CE2 . PHE A 278 ? 0.3111 0.5407 0.8696 0.0063  -0.0238 0.1335  388 PHE A CE2 
1903 C CZ  . PHE A 278 ? 0.2831 0.5251 0.8618 0.0101  -0.0123 0.1399  388 PHE A CZ  
1904 N N   . LYS A 279 ? 0.2731 0.4344 0.7201 -0.0447 -0.0784 0.0856  389 LYS A N   
1905 C CA  . LYS A 279 ? 0.2964 0.4431 0.7202 -0.0538 -0.0938 0.0762  389 LYS A CA  
1906 C C   . LYS A 279 ? 0.3295 0.4643 0.7243 -0.0491 -0.0945 0.0656  389 LYS A C   
1907 O O   . LYS A 279 ? 0.3066 0.4371 0.6936 -0.0398 -0.0811 0.0611  389 LYS A O   
1908 C CB  . LYS A 279 ? 0.3324 0.4640 0.7455 -0.0578 -0.0926 0.0677  389 LYS A CB  
1909 C CG  . LYS A 279 ? 0.5820 0.6975 0.9748 -0.0677 -0.1098 0.0588  389 LYS A CG  
1910 C CD  . LYS A 279 ? 0.6978 0.7964 1.0806 -0.0707 -0.1086 0.0504  389 LYS A CD  
1911 C CE  . LYS A 279 ? 0.8803 0.9566 1.2334 -0.0749 -0.1206 0.0363  389 LYS A CE  
1912 N NZ  . LYS A 279 ? 1.0588 1.1236 1.3847 -0.0650 -0.1114 0.0237  389 LYS A NZ  
1913 N N   . GLN A 280 ? 0.2963 0.4260 0.6749 -0.0560 -0.1102 0.0619  390 GLN A N   
1914 C CA  . GLN A 280 ? 0.3030 0.4226 0.6523 -0.0525 -0.1118 0.0522  390 GLN A CA  
1915 C C   . GLN A 280 ? 0.3439 0.4447 0.6696 -0.0478 -0.1024 0.0376  390 GLN A C   
1916 O O   . GLN A 280 ? 0.3365 0.4282 0.6619 -0.0514 -0.1030 0.0330  390 GLN A O   
1917 C CB  . GLN A 280 ? 0.3375 0.4543 0.6720 -0.0616 -0.1311 0.0503  390 GLN A CB  
1918 C CG  . GLN A 280 ? 0.3667 0.4664 0.6866 -0.0698 -0.1415 0.0401  390 GLN A CG  
1919 C CD  . GLN A 280 ? 0.4874 0.5835 0.7941 -0.0797 -0.1621 0.0386  390 GLN A CD  
1920 O OE1 . GLN A 280 ? 0.3680 0.4494 0.6427 -0.0792 -0.1673 0.0261  390 GLN A OE1 
1921 N NE2 . GLN A 280 ? 0.3046 0.4143 0.6352 -0.0890 -0.1747 0.0513  390 GLN A NE2 
1922 N N   . PRO A 281 ? 0.2997 0.3954 0.6074 -0.0402 -0.0942 0.0314  391 PRO A N   
1923 C CA  . PRO A 281 ? 0.3063 0.3860 0.5933 -0.0360 -0.0864 0.0186  391 PRO A CA  
1924 C C   . PRO A 281 ? 0.4009 0.4658 0.6658 -0.0412 -0.0974 0.0077  391 PRO A C   
1925 O O   . PRO A 281 ? 0.3694 0.4351 0.6278 -0.0473 -0.1112 0.0082  391 PRO A O   
1926 C CB  . PRO A 281 ? 0.3168 0.3976 0.5915 -0.0284 -0.0784 0.0170  391 PRO A CB  
1927 C CG  . PRO A 281 ? 0.3605 0.4569 0.6555 -0.0270 -0.0778 0.0298  391 PRO A CG  
1928 C CD  . PRO A 281 ? 0.3184 0.4228 0.6245 -0.0354 -0.0922 0.0365  391 PRO A CD  
1929 N N   . SER A 282 ? 0.4271 0.4777 0.6806 -0.0388 -0.0918 -0.0020 392 SER A N   
1930 C CA  . SER A 282 ? 0.4635 0.4964 0.6960 -0.0417 -0.1001 -0.0138 392 SER A CA  
1931 C C   . SER A 282 ? 0.5546 0.5829 0.7596 -0.0396 -0.1060 -0.0215 392 SER A C   
1932 O O   . SER A 282 ? 0.5394 0.5752 0.7372 -0.0334 -0.0989 -0.0204 392 SER A O   
1933 C CB  . SER A 282 ? 0.5254 0.5461 0.7515 -0.0366 -0.0900 -0.0214 392 SER A CB  
1934 O OG  . SER A 282 ? 0.6753 0.6776 0.8851 -0.0391 -0.0979 -0.0320 392 SER A OG  
1935 N N   . ARG A 283 ? 0.5738 0.5894 0.7635 -0.0450 -0.1193 -0.0291 393 ARG A N   
1936 C CA  . ARG A 283 ? 0.6105 0.6187 0.7700 -0.0432 -0.1261 -0.0386 393 ARG A CA  
1937 C C   . ARG A 283 ? 0.6860 0.6749 0.8227 -0.0364 -0.1208 -0.0535 393 ARG A C   
1938 O O   . ARG A 283 ? 0.6933 0.6768 0.8034 -0.0310 -0.1207 -0.0623 393 ARG A O   
1939 C CB  . ARG A 283 ? 0.6487 0.6530 0.8041 -0.0536 -0.1454 -0.0384 393 ARG A CB  
1940 C CG  . ARG A 283 ? 0.8945 0.8972 1.0207 -0.0528 -0.1534 -0.0443 393 ARG A CG  
1941 C CD  . ARG A 283 ? 1.1278 1.1257 1.2503 -0.0645 -0.1742 -0.0439 393 ARG A CD  
1942 N NE  . ARG A 283 ? 1.2656 1.2852 1.4063 -0.0701 -0.1806 -0.0285 393 ARG A NE  
1943 C CZ  . ARG A 283 ? 1.4153 1.4469 1.5890 -0.0777 -0.1854 -0.0152 393 ARG A CZ  
1944 N NH1 . ARG A 283 ? 1.3118 1.3367 1.5038 -0.0814 -0.1845 -0.0148 393 ARG A NH1 
1945 N NH2 . ARG A 283 ? 1.1246 1.1764 1.3142 -0.0814 -0.1909 -0.0012 393 ARG A NH2 
1946 N N   . LYS A 284 ? 0.6419 0.6217 0.7900 -0.0362 -0.1158 -0.0552 394 LYS A N   
1947 C CA  . LYS A 284 ? 0.6629 0.6247 0.7953 -0.0299 -0.1108 -0.0673 394 LYS A CA  
1948 C C   . LYS A 284 ? 0.7394 0.7062 0.8579 -0.0184 -0.0972 -0.0710 394 LYS A C   
1949 O O   . LYS A 284 ? 0.7153 0.6992 0.8448 -0.0159 -0.0882 -0.0622 394 LYS A O   
1950 C CB  . LYS A 284 ? 0.6768 0.6333 0.8289 -0.0319 -0.1065 -0.0641 394 LYS A CB  
1951 C CG  . LYS A 284 ? 0.9065 0.8511 1.0675 -0.0423 -0.1202 -0.0637 394 LYS A CG  
1952 C CD  . LYS A 284 ? 1.0554 0.9953 1.2336 -0.0433 -0.1142 -0.0600 394 LYS A CD  
1953 C CE  . LYS A 284 ? 1.2476 1.1772 1.4379 -0.0546 -0.1277 -0.0573 394 LYS A CE  
1954 N NZ  . LYS A 284 ? 1.3759 1.2990 1.5794 -0.0550 -0.1220 -0.0543 394 LYS A NZ  
1955 N N   . VAL A 285 ? 0.7196 0.6713 0.8153 -0.0115 -0.0956 -0.0837 395 VAL A N   
1956 C CA  . VAL A 285 ? 0.7152 0.6714 0.7982 -0.0002 -0.0828 -0.0874 395 VAL A CA  
1957 C C   . VAL A 285 ? 0.7349 0.6987 0.8381 0.0025  -0.0705 -0.0804 395 VAL A C   
1958 O O   . VAL A 285 ? 0.6993 0.6783 0.8068 0.0065  -0.0610 -0.0741 395 VAL A O   
1959 C CB  . VAL A 285 ? 0.7876 0.7248 0.8453 0.0072  -0.0837 -0.1023 395 VAL A CB  
1960 N N   . ASP A 286 ? 0.6915 0.6446 0.8072 -0.0009 -0.0719 -0.0807 396 ASP A N   
1961 C CA  . ASP A 286 ? 0.6704 0.6279 0.8040 0.0001  -0.0625 -0.0745 396 ASP A CA  
1962 C C   . ASP A 286 ? 0.7109 0.6746 0.8670 -0.0090 -0.0663 -0.0647 396 ASP A C   
1963 O O   . ASP A 286 ? 0.7078 0.6610 0.8701 -0.0153 -0.0743 -0.0652 396 ASP A O   
1964 C CB  . ASP A 286 ? 0.7068 0.6475 0.8356 0.0042  -0.0609 -0.0819 396 ASP A CB  
1965 N N   . ALA A 287 ? 0.6518 0.6326 0.8203 -0.0098 -0.0611 -0.0553 397 ALA A N   
1966 C CA  . ALA A 287 ? 0.6336 0.6233 0.8242 -0.0166 -0.0630 -0.0451 397 ALA A CA  
1967 C C   . ALA A 287 ? 0.6368 0.6247 0.8417 -0.0172 -0.0562 -0.0414 397 ALA A C   
1968 O O   . ALA A 287 ? 0.6171 0.6042 0.8188 -0.0116 -0.0468 -0.0430 397 ALA A O   
1969 C CB  . ALA A 287 ? 0.6303 0.6370 0.8285 -0.0153 -0.0587 -0.0371 397 ALA A CB  
1970 N N   . LEU A 288 ? 0.5810 0.5693 0.8019 -0.0245 -0.0615 -0.0356 398 LEU A N   
1971 C CA  . LEU A 288 ? 0.5592 0.5480 0.7948 -0.0262 -0.0556 -0.0300 398 LEU A CA  
1972 C C   . LEU A 288 ? 0.5335 0.5387 0.7844 -0.0244 -0.0460 -0.0208 398 LEU A C   
1973 O O   . LEU A 288 ? 0.5239 0.5403 0.7818 -0.0252 -0.0478 -0.0159 398 LEU A O   
1974 C CB  . LEU A 288 ? 0.5753 0.5588 0.8223 -0.0353 -0.0659 -0.0265 398 LEU A CB  
1975 N N   . ASP A 289 ? 0.4270 0.4329 0.6822 -0.0216 -0.0360 -0.0186 399 ASP A N   
1976 C CA  . ASP A 289 ? 0.3824 0.4005 0.6494 -0.0188 -0.0260 -0.0115 399 ASP A CA  
1977 C C   . ASP A 289 ? 0.3529 0.3773 0.6385 -0.0237 -0.0252 -0.0027 399 ASP A C   
1978 O O   . ASP A 289 ? 0.3032 0.3210 0.5891 -0.0263 -0.0252 -0.0025 399 ASP A O   
1979 C CB  . ASP A 289 ? 0.3874 0.4020 0.6443 -0.0126 -0.0159 -0.0152 399 ASP A CB  
1980 C CG  . ASP A 289 ? 0.3336 0.3567 0.5986 -0.0091 -0.0059 -0.0101 399 ASP A CG  
1981 O OD1 . ASP A 289 ? 0.3287 0.3562 0.6047 -0.0105 -0.0013 -0.0044 399 ASP A OD1 
1982 O OD2 . ASP A 289 ? 0.3337 0.3577 0.5924 -0.0046 -0.0018 -0.0121 399 ASP A OD2 
1983 N N   . HIS A 290 ? 0.3070 0.3454 0.6093 -0.0246 -0.0241 0.0057  400 HIS A N   
1984 C CA  . HIS A 290 ? 0.3084 0.3569 0.6314 -0.0291 -0.0229 0.0160  400 HIS A CA  
1985 C C   . HIS A 290 ? 0.2865 0.3438 0.6170 -0.0233 -0.0083 0.0212  400 HIS A C   
1986 O O   . HIS A 290 ? 0.2543 0.3223 0.6022 -0.0256 -0.0049 0.0306  400 HIS A O   
1987 C CB  . HIS A 290 ? 0.3402 0.4003 0.6794 -0.0339 -0.0318 0.0234  400 HIS A CB  
1988 C CG  . HIS A 290 ? 0.4233 0.4736 0.7539 -0.0408 -0.0474 0.0184  400 HIS A CG  
1989 N ND1 . HIS A 290 ? 0.4707 0.5110 0.8016 -0.0481 -0.0556 0.0176  400 HIS A ND1 
1990 C CD2 . HIS A 290 ? 0.4714 0.5193 0.7916 -0.0409 -0.0558 0.0136  400 HIS A CD2 
1991 C CE1 . HIS A 290 ? 0.4842 0.5150 0.8039 -0.0522 -0.0689 0.0113  400 HIS A CE1 
1992 N NE2 . HIS A 290 ? 0.4875 0.5233 0.7996 -0.0480 -0.0691 0.0087  400 HIS A NE2 
1993 N N   . PHE A 291 ? 0.2223 0.2749 0.5395 -0.0159 0.0003  0.0151  401 PHE A N   
1994 C CA  . PHE A 291 ? 0.2119 0.2696 0.5321 -0.0100 0.0136  0.0180  401 PHE A CA  
1995 C C   . PHE A 291 ? 0.2417 0.2955 0.5580 -0.0116 0.0185  0.0189  401 PHE A C   
1996 O O   . PHE A 291 ? 0.2237 0.2671 0.5306 -0.0155 0.0124  0.0149  401 PHE A O   
1997 C CB  . PHE A 291 ? 0.2287 0.2798 0.5345 -0.0030 0.0192  0.0109  401 PHE A CB  
1998 C CG  . PHE A 291 ? 0.2492 0.3048 0.5593 -0.0005 0.0161  0.0116  401 PHE A CG  
1999 C CD1 . PHE A 291 ? 0.2748 0.3435 0.6043 0.0009  0.0175  0.0200  401 PHE A CD1 
2000 C CD2 . PHE A 291 ? 0.2563 0.3044 0.5522 0.0006  0.0119  0.0050  401 PHE A CD2 
2001 C CE1 . PHE A 291 ? 0.2802 0.3532 0.6143 0.0031  0.0139  0.0218  401 PHE A CE1 
2002 C CE2 . PHE A 291 ? 0.2843 0.3371 0.5841 0.0025  0.0090  0.0071  401 PHE A CE2 
2003 C CZ  . PHE A 291 ? 0.2586 0.3231 0.5771 0.0037  0.0098  0.0153  401 PHE A CZ  
2004 N N   . GLN A 292 ? 0.1929 0.2548 0.5156 -0.0078 0.0299  0.0243  402 GLN A N   
2005 C CA  . GLN A 292 ? 0.1816 0.2410 0.4984 -0.0085 0.0360  0.0259  402 GLN A CA  
2006 C C   . GLN A 292 ? 0.2491 0.2934 0.5427 -0.0060 0.0368  0.0159  402 GLN A C   
2007 O O   . GLN A 292 ? 0.2166 0.2565 0.5005 -0.0006 0.0399  0.0097  402 GLN A O   
2008 C CB  . GLN A 292 ? 0.1966 0.2680 0.5214 -0.0032 0.0495  0.0325  402 GLN A CB  
2009 C CG  . GLN A 292 ? 0.3191 0.3909 0.6388 -0.0048 0.0559  0.0365  402 GLN A CG  
2010 C CD  . GLN A 292 ? 0.5845 0.6649 0.9037 0.0029  0.0711  0.0396  402 GLN A CD  
2011 O OE1 . GLN A 292 ? 0.5641 0.6400 0.8738 0.0107  0.0774  0.0329  402 GLN A OE1 
2012 N NE2 . GLN A 292 ? 0.3979 0.4903 0.7266 0.0011  0.0774  0.0498  402 GLN A NE2 
2013 N N   . LYS A 293 ? 0.2093 0.2458 0.4957 -0.0102 0.0329  0.0151  403 LYS A N   
2014 C CA  . LYS A 293 ? 0.2015 0.2257 0.4687 -0.0081 0.0328  0.0072  403 LYS A CA  
2015 C C   . LYS A 293 ? 0.2740 0.2943 0.5358 -0.0109 0.0342  0.0103  403 LYS A C   
2016 O O   . LYS A 293 ? 0.2416 0.2671 0.5149 -0.0156 0.0332  0.0184  403 LYS A O   
2017 C CB  . LYS A 293 ? 0.2186 0.2343 0.4799 -0.0092 0.0229  0.0002  403 LYS A CB  
2018 C CG  . LYS A 293 ? 0.3379 0.3498 0.6058 -0.0152 0.0127  0.0018  403 LYS A CG  
2019 C CD  . LYS A 293 ? 0.3894 0.3927 0.6487 -0.0146 0.0042  -0.0063 403 LYS A CD  
2020 C CE  . LYS A 293 ? 0.3217 0.3309 0.5830 -0.0125 0.0027  -0.0081 403 LYS A CE  
2021 N NZ  . LYS A 293 ? 0.3280 0.3451 0.6050 -0.0172 -0.0026 -0.0021 403 LYS A NZ  
2022 N N   . CYS A 294 ? 0.2346 0.2463 0.4799 -0.0086 0.0357  0.0050  404 CYS A N   
2023 C CA  . CYS A 294 ? 0.2516 0.2592 0.4910 -0.0113 0.0358  0.0084  404 CYS A CA  
2024 C C   . CYS A 294 ? 0.2819 0.2786 0.5082 -0.0103 0.0307  0.0019  404 CYS A C   
2025 O O   . CYS A 294 ? 0.2665 0.2602 0.4839 -0.0067 0.0312  -0.0046 404 CYS A O   
2026 C CB  . CYS A 294 ? 0.2777 0.2913 0.5118 -0.0095 0.0464  0.0131  404 CYS A CB  
2027 S SG  . CYS A 294 ? 0.3395 0.3492 0.5557 -0.0029 0.0538  0.0051  404 CYS A SG  
2028 N N   . PHE A 295 ? 0.2630 0.2539 0.4900 -0.0136 0.0254  0.0048  405 PHE A N   
2029 C CA  . PHE A 295 ? 0.2774 0.2589 0.4952 -0.0124 0.0204  0.0007  405 PHE A CA  
2030 C C   . PHE A 295 ? 0.3002 0.2815 0.5104 -0.0135 0.0239  0.0060  405 PHE A C   
2031 O O   . PHE A 295 ? 0.2722 0.2556 0.4882 -0.0174 0.0245  0.0140  405 PHE A O   
2032 C CB  . PHE A 295 ? 0.3116 0.2850 0.5364 -0.0145 0.0111  -0.0002 405 PHE A CB  
2033 C CG  . PHE A 295 ? 0.3518 0.3260 0.5832 -0.0146 0.0070  -0.0044 405 PHE A CG  
2034 C CD1 . PHE A 295 ? 0.4130 0.3883 0.6572 -0.0197 0.0026  0.0001  405 PHE A CD1 
2035 C CD2 . PHE A 295 ? 0.3892 0.3640 0.6145 -0.0102 0.0070  -0.0118 405 PHE A CD2 
2036 C CE1 . PHE A 295 ? 0.4330 0.4091 0.6822 -0.0205 -0.0025 -0.0034 405 PHE A CE1 
2037 C CE2 . PHE A 295 ? 0.4342 0.4105 0.6642 -0.0106 0.0029  -0.0148 405 PHE A CE2 
2038 C CZ  . PHE A 295 ? 0.4250 0.4016 0.6662 -0.0157 -0.0022 -0.0110 405 PHE A CZ  
2039 N N   . LEU A 296 ? 0.2559 0.2359 0.4531 -0.0108 0.0262  0.0023  406 LEU A N   
2040 C CA  . LEU A 296 ? 0.2614 0.2416 0.4481 -0.0121 0.0294  0.0069  406 LEU A CA  
2041 C C   . LEU A 296 ? 0.2654 0.2398 0.4439 -0.0114 0.0242  0.0056  406 LEU A C   
2042 O O   . LEU A 296 ? 0.2344 0.2060 0.4132 -0.0087 0.0201  -0.0001 406 LEU A O   
2043 C CB  . LEU A 296 ? 0.2736 0.2577 0.4494 -0.0099 0.0377  0.0044  406 LEU A CB  
2044 C CG  . LEU A 296 ? 0.3275 0.3183 0.5110 -0.0081 0.0442  0.0042  406 LEU A CG  
2045 C CD1 . LEU A 296 ? 0.3451 0.3353 0.5156 -0.0043 0.0512  -0.0007 406 LEU A CD1 
2046 C CD2 . LEU A 296 ? 0.3051 0.3035 0.4980 -0.0108 0.0482  0.0135  406 LEU A CD2 
2047 N N   . ILE A 297 ? 0.2248 0.1992 0.3959 -0.0137 0.0248  0.0118  407 ILE A N   
2048 C CA  . ILE A 297 ? 0.2364 0.2077 0.3980 -0.0137 0.0207  0.0126  407 ILE A CA  
2049 C C   . ILE A 297 ? 0.3240 0.2978 0.4691 -0.0152 0.0260  0.0139  407 ILE A C   
2050 O O   . ILE A 297 ? 0.3117 0.2890 0.4542 -0.0173 0.0307  0.0203  407 ILE A O   
2051 C CB  . ILE A 297 ? 0.2786 0.2459 0.4462 -0.0150 0.0142  0.0192  407 ILE A CB  
2052 C CG1 . ILE A 297 ? 0.2802 0.2421 0.4615 -0.0124 0.0090  0.0157  407 ILE A CG1 
2053 C CG2 . ILE A 297 ? 0.2875 0.2541 0.4456 -0.0147 0.0100  0.0207  407 ILE A CG2 
2054 C CD1 . ILE A 297 ? 0.2601 0.2150 0.4493 -0.0129 0.0025  0.0217  407 ILE A CD1 
2055 N N   . LEU A 298 ? 0.2990 0.2709 0.4327 -0.0141 0.0253  0.0081  408 LEU A N   
2056 C CA  . LEU A 298 ? 0.3238 0.2949 0.4386 -0.0154 0.0292  0.0075  408 LEU A CA  
2057 C C   . LEU A 298 ? 0.3486 0.3175 0.4523 -0.0182 0.0224  0.0104  408 LEU A C   
2058 O O   . LEU A 298 ? 0.3143 0.2826 0.4248 -0.0179 0.0153  0.0100  408 LEU A O   
2059 C CB  . LEU A 298 ? 0.3340 0.3025 0.4421 -0.0128 0.0332  -0.0016 408 LEU A CB  
2060 C CG  . LEU A 298 ? 0.3943 0.3659 0.5121 -0.0095 0.0406  -0.0042 408 LEU A CG  
2061 C CD1 . LEU A 298 ? 0.3895 0.3565 0.4976 -0.0067 0.0445  -0.0122 408 LEU A CD1 
2062 C CD2 . LEU A 298 ? 0.4391 0.4169 0.5593 -0.0098 0.0478  0.0027  408 LEU A CD2 
2063 N N   . LYS A 299 ? 0.3124 0.2808 0.3984 -0.0207 0.0247  0.0135  409 LYS A N   
2064 C CA  . LYS A 299 ? 0.3192 0.2856 0.3913 -0.0243 0.0177  0.0164  409 LYS A CA  
2065 C C   . LYS A 299 ? 0.3923 0.3527 0.4502 -0.0247 0.0161  0.0073  409 LYS A C   
2066 O O   . LYS A 299 ? 0.4077 0.3640 0.4510 -0.0235 0.0227  0.0015  409 LYS A O   
2067 C CB  . LYS A 299 ? 0.3627 0.3314 0.4202 -0.0272 0.0207  0.0243  409 LYS A CB  
2068 C CG  . LYS A 299 ? 0.4497 0.4164 0.4898 -0.0317 0.0129  0.0279  409 LYS A CG  
2069 C CD  . LYS A 299 ? 0.6149 0.5852 0.6422 -0.0344 0.0156  0.0374  409 LYS A CD  
2070 C CE  . LYS A 299 ? 0.8302 0.7984 0.8364 -0.0393 0.0076  0.0403  409 LYS A CE  
2071 N NZ  . LYS A 299 ? 1.0595 1.0320 1.0509 -0.0420 0.0107  0.0502  409 LYS A NZ  
2072 N N   . LEU A 300 ? 0.3412 0.3010 0.4049 -0.0260 0.0075  0.0061  410 LEU A N   
2073 C CA  . LEU A 300 ? 0.3317 0.2855 0.3846 -0.0277 0.0040  -0.0012 410 LEU A CA  
2074 C C   . LEU A 300 ? 0.4290 0.3809 0.4665 -0.0336 -0.0051 0.0025  410 LEU A C   
2075 O O   . LEU A 300 ? 0.4288 0.3863 0.4768 -0.0355 -0.0133 0.0089  410 LEU A O   
2076 C CB  . LEU A 300 ? 0.3021 0.2584 0.3730 -0.0257 0.0010  -0.0041 410 LEU A CB  
2077 C CG  . LEU A 300 ? 0.3353 0.2861 0.3996 -0.0283 -0.0038 -0.0099 410 LEU A CG  
2078 C CD1 . LEU A 300 ? 0.3439 0.2849 0.3950 -0.0267 0.0029  -0.0188 410 LEU A CD1 
2079 C CD2 . LEU A 300 ? 0.3075 0.2647 0.3916 -0.0266 -0.0069 -0.0094 410 LEU A CD2 
2080 N N   . ASP A 301 ? 0.4378 0.3818 0.4501 -0.0361 -0.0038 -0.0016 411 ASP A N   
2081 C CA  . ASP A 301 ? 0.4681 0.4087 0.4617 -0.0427 -0.0135 0.0012  411 ASP A CA  
2082 C C   . ASP A 301 ? 0.5078 0.4461 0.5061 -0.0467 -0.0240 -0.0013 411 ASP A C   
2083 O O   . ASP A 301 ? 0.4711 0.4038 0.4727 -0.0450 -0.0218 -0.0092 411 ASP A O   
2084 C CB  . ASP A 301 ? 0.5387 0.4695 0.5012 -0.0436 -0.0088 -0.0047 411 ASP A CB  
2085 C CG  . ASP A 301 ? 0.8207 0.7572 0.7768 -0.0414 -0.0001 0.0016  411 ASP A CG  
2086 O OD1 . ASP A 301 ? 0.8193 0.7659 0.7918 -0.0418 -0.0019 0.0124  411 ASP A OD1 
2087 O OD2 . ASP A 301 ? 0.9782 0.9091 0.9128 -0.0391 0.0084  -0.0037 411 ASP A OD2 
2088 N N   . HIS A 302 ? 0.4923 0.4362 0.4934 -0.0521 -0.0355 0.0070  412 HIS A N   
2089 C CA  . HIS A 302 ? 0.4931 0.4386 0.5024 -0.0568 -0.0464 0.0078  412 HIS A CA  
2090 C C   . HIS A 302 ? 0.5271 0.4580 0.5155 -0.0618 -0.0506 -0.0018 412 HIS A C   
2091 O O   . HIS A 302 ? 0.5053 0.4352 0.5043 -0.0635 -0.0547 -0.0042 412 HIS A O   
2092 C CB  . HIS A 302 ? 0.5198 0.4753 0.5355 -0.0617 -0.0582 0.0199  412 HIS A CB  
2093 C CG  . HIS A 302 ? 0.5568 0.5260 0.5993 -0.0561 -0.0562 0.0290  412 HIS A CG  
2094 N ND1 . HIS A 302 ? 0.5896 0.5684 0.6400 -0.0583 -0.0647 0.0411  412 HIS A ND1 
2095 C CD2 . HIS A 302 ? 0.5606 0.5336 0.6220 -0.0482 -0.0471 0.0273  412 HIS A CD2 
2096 C CE1 . HIS A 302 ? 0.5650 0.5516 0.6383 -0.0510 -0.0599 0.0455  412 HIS A CE1 
2097 N NE2 . HIS A 302 ? 0.5508 0.5340 0.6307 -0.0451 -0.0498 0.0372  412 HIS A NE2 
2098 N N   . GLY A 303 ? 0.5056 0.4246 0.4647 -0.0635 -0.0486 -0.0074 413 GLY A N   
2099 C CA  . GLY A 303 ? 0.5206 0.4215 0.4549 -0.0673 -0.0519 -0.0185 413 GLY A CA  
2100 C C   . GLY A 303 ? 0.5439 0.4358 0.4837 -0.0621 -0.0440 -0.0288 413 GLY A C   
2101 O O   . GLY A 303 ? 0.5797 0.4570 0.5080 -0.0659 -0.0498 -0.0365 413 GLY A O   
2102 N N   . ARG A 304 ? 0.4494 0.3494 0.4076 -0.0537 -0.0318 -0.0284 414 ARG A N   
2103 C CA  . ARG A 304 ? 0.4240 0.3183 0.3909 -0.0480 -0.0238 -0.0363 414 ARG A CA  
2104 C C   . ARG A 304 ? 0.4416 0.3425 0.4337 -0.0498 -0.0298 -0.0331 414 ARG A C   
2105 O O   . ARG A 304 ? 0.4236 0.3184 0.4219 -0.0471 -0.0265 -0.0388 414 ARG A O   
2106 C CB  . ARG A 304 ? 0.4070 0.3089 0.3835 -0.0394 -0.0095 -0.0357 414 ARG A CB  
2107 C CG  . ARG A 304 ? 0.5444 0.4430 0.4986 -0.0370 -0.0018 -0.0371 414 ARG A CG  
2108 C CD  . ARG A 304 ? 0.6069 0.5115 0.5705 -0.0287 0.0128  -0.0374 414 ARG A CD  
2109 N NE  . ARG A 304 ? 0.7746 0.6703 0.7393 -0.0233 0.0194  -0.0467 414 ARG A NE  
2110 C CZ  . ARG A 304 ? 1.0518 0.9351 0.9953 -0.0192 0.0266  -0.0555 414 ARG A CZ  
2111 N NH1 . ARG A 304 ? 0.9469 0.8256 0.8639 -0.0200 0.0286  -0.0566 414 ARG A NH1 
2112 N NH2 . ARG A 304 ? 0.9409 0.8163 0.8889 -0.0137 0.0321  -0.0630 414 ARG A NH2 
2113 N N   . VAL A 305 ? 0.3839 0.2981 0.3909 -0.0537 -0.0381 -0.0232 415 VAL A N   
2114 C CA  . VAL A 305 ? 0.3597 0.2845 0.3917 -0.0545 -0.0426 -0.0181 415 VAL A CA  
2115 C C   . VAL A 305 ? 0.4357 0.3549 0.4631 -0.0638 -0.0559 -0.0172 415 VAL A C   
2116 O O   . VAL A 305 ? 0.4570 0.3769 0.4750 -0.0705 -0.0657 -0.0125 415 VAL A O   
2117 C CB  . VAL A 305 ? 0.3714 0.3148 0.4244 -0.0516 -0.0425 -0.0078 415 VAL A CB  
2118 C CG1 . VAL A 305 ? 0.3432 0.2986 0.4210 -0.0504 -0.0445 -0.0032 415 VAL A CG1 
2119 C CG2 . VAL A 305 ? 0.3582 0.3044 0.4140 -0.0440 -0.0311 -0.0086 415 VAL A CG2 
2120 N N   . HIS A 306 ? 0.3960 0.3097 0.4305 -0.0649 -0.0571 -0.0207 416 HIS A N   
2121 C CA  . HIS A 306 ? 0.4286 0.3366 0.4615 -0.0749 -0.0707 -0.0190 416 HIS A CA  
2122 C C   . HIS A 306 ? 0.4366 0.3644 0.4991 -0.0759 -0.0742 -0.0081 416 HIS A C   
2123 O O   . HIS A 306 ? 0.4226 0.3524 0.4988 -0.0733 -0.0704 -0.0087 416 HIS A O   
2124 C CB  . HIS A 306 ? 0.4748 0.3599 0.4926 -0.0764 -0.0709 -0.0301 416 HIS A CB  
2125 C CG  . HIS A 306 ? 0.5612 0.4287 0.5506 -0.0723 -0.0640 -0.0412 416 HIS A CG  
2126 N ND1 . HIS A 306 ? 0.5869 0.4469 0.5741 -0.0631 -0.0509 -0.0494 416 HIS A ND1 
2127 C CD2 . HIS A 306 ? 0.6239 0.4837 0.5882 -0.0755 -0.0675 -0.0438 416 HIS A CD2 
2128 C CE1 . HIS A 306 ? 0.6121 0.4602 0.5733 -0.0606 -0.0463 -0.0569 416 HIS A CE1 
2129 N NE2 . HIS A 306 ? 0.6376 0.4847 0.5830 -0.0679 -0.0557 -0.0540 416 HIS A NE2 
2130 N N   . SER A 307 ? 0.3859 0.3297 0.4585 -0.0783 -0.0801 0.0023  417 SER A N   
2131 C CA  . SER A 307 ? 0.3773 0.3429 0.4782 -0.0778 -0.0824 0.0138  417 SER A CA  
2132 C C   . SER A 307 ? 0.4537 0.4260 0.5594 -0.0887 -0.0978 0.0235  417 SER A C   
2133 O O   . SER A 307 ? 0.4488 0.4061 0.5342 -0.0977 -0.1080 0.0201  417 SER A O   
2134 C CB  . SER A 307 ? 0.4125 0.3940 0.5267 -0.0685 -0.0741 0.0187  417 SER A CB  
2135 O OG  . SER A 307 ? 0.5101 0.4946 0.6175 -0.0710 -0.0798 0.0239  417 SER A OG  
2136 N N   . GLU A 308 ? 0.4476 0.4427 0.5799 -0.0879 -0.0998 0.0357  418 GLU A N   
2137 C CA  . GLU A 308 ? 0.4881 0.4946 0.6306 -0.0981 -0.1145 0.0478  418 GLU A CA  
2138 C C   . GLU A 308 ? 0.5806 0.5905 0.7150 -0.0997 -0.1204 0.0527  418 GLU A C   
2139 O O   . GLU A 308 ? 0.6070 0.6150 0.7348 -0.1108 -0.1350 0.0578  418 GLU A O   
2140 C CB  . GLU A 308 ? 0.4848 0.5174 0.6598 -0.0952 -0.1130 0.0605  418 GLU A CB  
2141 C CG  . GLU A 308 ? 0.5801 0.6112 0.7634 -0.0949 -0.1084 0.0581  418 GLU A CG  
2142 C CD  . GLU A 308 ? 0.7961 0.8545 1.0098 -0.0913 -0.1055 0.0710  418 GLU A CD  
2143 O OE1 . GLU A 308 ? 0.5749 0.6385 0.7963 -0.0822 -0.0934 0.0682  418 GLU A OE1 
2144 O OE2 . GLU A 308 ? 0.7417 0.8171 0.9715 -0.0977 -0.1152 0.0844  418 GLU A OE2 
2145 N N   . LYS A 309 ? 0.5305 0.5443 0.6650 -0.0892 -0.1098 0.0511  419 LYS A N   
2146 C CA  . LYS A 309 ? 0.8742 0.8908 1.0016 -0.0890 -0.1134 0.0560  419 LYS A CA  
2147 C C   . LYS A 309 ? 1.2617 1.2569 1.3579 -0.0891 -0.1096 0.0444  419 LYS A C   
2148 O O   . LYS A 309 ? 0.9207 0.9055 0.9953 -0.0977 -0.1195 0.0435  419 LYS A O   
2149 C CB  . LYS A 309 ? 0.8824 0.9166 1.0317 -0.0773 -0.1044 0.0629  419 LYS A CB  
2150 C CG  . LYS A 309 ? 1.0190 1.0778 1.1984 -0.0764 -0.1091 0.0773  419 LYS A CG  
2151 C CD  . LYS A 309 ? 1.0751 1.1457 1.2612 -0.0781 -0.1181 0.0898  419 LYS A CD  
2152 C CE  . LYS A 309 ? 1.1660 1.2412 1.3518 -0.0920 -0.1353 0.0987  419 LYS A CE  
2153 N NZ  . LYS A 309 ? 1.2623 1.3486 1.4534 -0.0941 -0.1447 0.1114  419 LYS A NZ  
2154 N N   . GLN A 313 ? 0.9391 0.9183 0.9272 -0.0848 -0.1013 0.0668  423 GLN A N   
2155 C CA  . GLN A 313 ? 0.9255 0.9079 0.9274 -0.0882 -0.1094 0.0654  423 GLN A CA  
2156 C C   . GLN A 313 ? 0.9364 0.9371 0.9730 -0.0851 -0.1149 0.0790  423 GLN A C   
2157 O O   . GLN A 313 ? 0.9419 0.9513 0.9812 -0.0912 -0.1280 0.0904  423 GLN A O   
2158 C CB  . GLN A 313 ? 0.9215 0.8959 0.9272 -0.0835 -0.0992 0.0519  423 GLN A CB  
2159 N N   . GLU A 314 ? 0.8447 0.8513 0.9069 -0.0753 -0.1049 0.0777  424 GLU A N   
2160 C CA  . GLU A 314 ? 0.8060 0.8286 0.9008 -0.0693 -0.1067 0.0885  424 GLU A CA  
2161 C C   . GLU A 314 ? 0.8011 0.8261 0.9026 -0.0635 -0.1032 0.0969  424 GLU A C   
2162 O O   . GLU A 314 ? 0.8085 0.8445 0.9246 -0.0630 -0.1111 0.1102  424 GLU A O   
2163 C CB  . GLU A 314 ? 0.7914 0.8170 0.9062 -0.0616 -0.0975 0.0816  424 GLU A CB  
2164 N N   . GLY A 315 ? 0.6953 0.7102 0.7870 -0.0594 -0.0922 0.0899  425 GLY A N   
2165 C CA  . GLY A 315 ? 0.6663 0.6806 0.7628 -0.0549 -0.0883 0.0969  425 GLY A CA  
2166 C C   . GLY A 315 ? 0.6781 0.6820 0.7480 -0.0583 -0.0826 0.0928  425 GLY A C   
2167 O O   . GLY A 315 ? 0.6899 0.6909 0.7353 -0.0663 -0.0886 0.0939  425 GLY A O   
2168 N N   . LYS A 316 ? 0.5911 0.5896 0.6653 -0.0525 -0.0711 0.0880  426 LYS A N   
2169 C CA  . LYS A 316 ? 0.5800 0.5711 0.6337 -0.0541 -0.0629 0.0848  426 LYS A CA  
2170 C C   . LYS A 316 ? 0.5989 0.5821 0.6280 -0.0574 -0.0585 0.0715  426 LYS A C   
2171 O O   . LYS A 316 ? 0.6071 0.5854 0.6145 -0.0593 -0.0527 0.0695  426 LYS A O   
2172 C CB  . LYS A 316 ? 0.5917 0.5803 0.6613 -0.0473 -0.0527 0.0837  426 LYS A CB  
2173 C CG  . LYS A 316 ? 0.6013 0.5899 0.6925 -0.0404 -0.0485 0.0755  426 LYS A CG  
2174 C CD  . LYS A 316 ? 0.5282 0.5123 0.6299 -0.0354 -0.0394 0.0729  426 LYS A CD  
2175 C CE  . LYS A 316 ? 0.4689 0.4528 0.5931 -0.0280 -0.0373 0.0677  426 LYS A CE  
2176 N NZ  . LYS A 316 ? 0.5424 0.5282 0.6666 -0.0269 -0.0365 0.0580  426 LYS A NZ  
2177 N N   . GLY A 317 ? 0.5142 0.4962 0.5472 -0.0576 -0.0609 0.0634  427 GLY A N   
2178 C CA  . GLY A 317 ? 0.5110 0.4834 0.5230 -0.0604 -0.0581 0.0508  427 GLY A CA  
2179 C C   . GLY A 317 ? 0.5264 0.4935 0.5428 -0.0543 -0.0455 0.0398  427 GLY A C   
2180 O O   . GLY A 317 ? 0.5322 0.4901 0.5307 -0.0553 -0.0415 0.0295  427 GLY A O   
2181 N N   . TRP A 318 ? 0.4553 0.4274 0.4954 -0.0478 -0.0395 0.0419  428 TRP A N   
2182 C CA  . TRP A 318 ? 0.4223 0.3911 0.4698 -0.0422 -0.0287 0.0331  428 TRP A CA  
2183 C C   . TRP A 318 ? 0.4199 0.3945 0.4953 -0.0364 -0.0278 0.0352  428 TRP A C   
2184 O O   . TRP A 318 ? 0.3950 0.3752 0.4833 -0.0355 -0.0336 0.0440  428 TRP A O   
2185 C CB  . TRP A 318 ? 0.4167 0.3824 0.4526 -0.0410 -0.0187 0.0324  428 TRP A CB  
2186 C CG  . TRP A 318 ? 0.4339 0.4045 0.4767 -0.0409 -0.0187 0.0440  428 TRP A CG  
2187 C CD1 . TRP A 318 ? 0.4888 0.4612 0.5179 -0.0455 -0.0232 0.0533  428 TRP A CD1 
2188 C CD2 . TRP A 318 ? 0.4159 0.3890 0.4805 -0.0367 -0.0149 0.0479  428 TRP A CD2 
2189 N NE1 . TRP A 318 ? 0.4743 0.4507 0.5171 -0.0442 -0.0222 0.0637  428 TRP A NE1 
2190 C CE2 . TRP A 318 ? 0.4753 0.4512 0.5397 -0.0390 -0.0173 0.0601  428 TRP A CE2 
2191 C CE3 . TRP A 318 ? 0.4101 0.3827 0.4938 -0.0315 -0.0106 0.0425  428 TRP A CE3 
2192 C CZ2 . TRP A 318 ? 0.4554 0.4320 0.5390 -0.0365 -0.0158 0.0668  428 TRP A CZ2 
2193 C CZ3 . TRP A 318 ? 0.4199 0.3930 0.5206 -0.0291 -0.0095 0.0481  428 TRP A CZ3 
2194 C CH2 . TRP A 318 ? 0.4390 0.4133 0.5401 -0.0317 -0.0122 0.0600  428 TRP A CH2 
2195 N N   . LYS A 319 ? 0.3523 0.3249 0.4361 -0.0320 -0.0208 0.0270  429 LYS A N   
2196 C CA  . LYS A 319 ? 0.3204 0.2968 0.4269 -0.0261 -0.0193 0.0269  429 LYS A CA  
2197 C C   . LYS A 319 ? 0.3270 0.3000 0.4375 -0.0226 -0.0103 0.0218  429 LYS A C   
2198 O O   . LYS A 319 ? 0.3078 0.2773 0.4080 -0.0233 -0.0047 0.0153  429 LYS A O   
2199 C CB  . LYS A 319 ? 0.3329 0.3131 0.4475 -0.0250 -0.0225 0.0229  429 LYS A CB  
2200 C CG  . LYS A 319 ? 0.2943 0.2794 0.4298 -0.0182 -0.0211 0.0227  429 LYS A CG  
2201 C CD  . LYS A 319 ? 0.3388 0.3303 0.4819 -0.0175 -0.0236 0.0207  429 LYS A CD  
2202 C CE  . LYS A 319 ? 0.2808 0.2760 0.4400 -0.0099 -0.0196 0.0180  429 LYS A CE  
2203 N NZ  . LYS A 319 ? 0.2259 0.2309 0.3947 -0.0085 -0.0221 0.0193  429 LYS A NZ  
2204 N N   . ALA A 320 ? 0.2600 0.2336 0.3855 -0.0190 -0.0094 0.0253  430 ALA A N   
2205 C CA  . ALA A 320 ? 0.2443 0.2153 0.3767 -0.0165 -0.0029 0.0216  430 ALA A CA  
2206 C C   . ALA A 320 ? 0.2719 0.2437 0.4128 -0.0126 -0.0014 0.0135  430 ALA A C   
2207 O O   . ALA A 320 ? 0.2328 0.2075 0.3818 -0.0098 -0.0055 0.0135  430 ALA A O   
2208 C CB  . ALA A 320 ? 0.2465 0.2156 0.3912 -0.0151 -0.0046 0.0282  430 ALA A CB  
2209 N N   . ILE A 321 ? 0.2572 0.2277 0.3955 -0.0123 0.0047  0.0074  431 ILE A N   
2210 C CA  . ILE A 321 ? 0.2316 0.2031 0.3761 -0.0092 0.0063  0.0003  431 ILE A CA  
2211 C C   . ILE A 321 ? 0.2478 0.2183 0.4003 -0.0074 0.0108  -0.0021 431 ILE A C   
2212 O O   . ILE A 321 ? 0.2213 0.1914 0.3700 -0.0091 0.0157  -0.0013 431 ILE A O   
2213 C CB  . ILE A 321 ? 0.2792 0.2498 0.4126 -0.0111 0.0078  -0.0046 431 ILE A CB  
2214 C CG1 . ILE A 321 ? 0.2898 0.2602 0.4124 -0.0151 0.0021  -0.0019 431 ILE A CG1 
2215 C CG2 . ILE A 321 ? 0.2949 0.2674 0.4359 -0.0083 0.0089  -0.0102 431 ILE A CG2 
2216 C CD1 . ILE A 321 ? 0.2570 0.2330 0.3882 -0.0146 -0.0046 0.0006  431 ILE A CD1 
2217 N N   . ARG A 322 ? 0.2096 0.1805 0.3728 -0.0038 0.0093  -0.0053 432 ARG A N   
2218 C CA  . ARG A 322 ? 0.2053 0.1753 0.3761 -0.0027 0.0117  -0.0081 432 ARG A CA  
2219 C C   . ARG A 322 ? 0.2344 0.2070 0.4022 -0.0025 0.0160  -0.0128 432 ARG A C   
2220 O O   . ARG A 322 ? 0.2157 0.1901 0.3812 -0.0012 0.0149  -0.0159 432 ARG A O   
2221 C CB  . ARG A 322 ? 0.2136 0.1815 0.3934 0.0012  0.0079  -0.0107 432 ARG A CB  
2222 C CG  . ARG A 322 ? 0.2327 0.1944 0.4182 0.0012  0.0043  -0.0066 432 ARG A CG  
2223 C CD  . ARG A 322 ? 0.3755 0.3344 0.5668 -0.0020 0.0051  -0.0055 432 ARG A CD  
2224 N NE  . ARG A 322 ? 0.3788 0.3370 0.5744 -0.0001 0.0043  -0.0118 432 ARG A NE  
2225 C CZ  . ARG A 322 ? 0.4627 0.4258 0.6594 -0.0016 0.0076  -0.0136 432 ARG A CZ  
2226 N NH1 . ARG A 322 ? 0.2918 0.2599 0.4856 -0.0042 0.0129  -0.0104 432 ARG A NH1 
2227 N NH2 . ARG A 322 ? 0.2807 0.2434 0.4806 0.0000  0.0057  -0.0187 432 ARG A NH2 
2228 N N   . VAL A 323 ? 0.1929 0.1662 0.3618 -0.0037 0.0207  -0.0124 433 VAL A N   
2229 C CA  . VAL A 323 ? 0.1899 0.1652 0.3577 -0.0027 0.0252  -0.0161 433 VAL A CA  
2230 C C   . VAL A 323 ? 0.2285 0.2068 0.4079 -0.0023 0.0268  -0.0156 433 VAL A C   
2231 O O   . VAL A 323 ? 0.1868 0.1660 0.3712 -0.0044 0.0276  -0.0109 433 VAL A O   
2232 C CB  . VAL A 323 ? 0.2338 0.2076 0.3895 -0.0037 0.0307  -0.0156 433 VAL A CB  
2233 C CG1 . VAL A 323 ? 0.2313 0.2054 0.3867 -0.0014 0.0359  -0.0197 433 VAL A CG1 
2234 C CG2 . VAL A 323 ? 0.2311 0.2013 0.3744 -0.0054 0.0272  -0.0159 433 VAL A CG2 
2235 N N   . ASP A 324 ? 0.2115 0.1919 0.3956 -0.0003 0.0266  -0.0192 434 ASP A N   
2236 C CA  . ASP A 324 ? 0.1972 0.1815 0.3923 -0.0005 0.0274  -0.0182 434 ASP A CA  
2237 C C   . ASP A 324 ? 0.2434 0.2311 0.4392 0.0015  0.0329  -0.0192 434 ASP A C   
2238 O O   . ASP A 324 ? 0.2310 0.2168 0.4213 0.0033  0.0330  -0.0227 434 ASP A O   
2239 C CB  . ASP A 324 ? 0.1989 0.1830 0.3996 0.0002  0.0213  -0.0211 434 ASP A CB  
2240 C CG  . ASP A 324 ? 0.2577 0.2365 0.4581 -0.0002 0.0158  -0.0213 434 ASP A CG  
2241 O OD1 . ASP A 324 ? 0.2477 0.2239 0.4496 -0.0026 0.0156  -0.0172 434 ASP A OD1 
2242 O OD2 . ASP A 324 ? 0.3286 0.3057 0.5274 0.0023  0.0120  -0.0253 434 ASP A OD2 
2243 N N   . LEU A 325 ? 0.2308 0.2235 0.4341 0.0013  0.0377  -0.0152 435 LEU A N   
2244 C CA  . LEU A 325 ? 0.2225 0.2187 0.4286 0.0046  0.0440  -0.0155 435 LEU A CA  
2245 C C   . LEU A 325 ? 0.2729 0.2769 0.4952 0.0042  0.0425  -0.0121 435 LEU A C   
2246 O O   . LEU A 325 ? 0.2597 0.2674 0.4908 0.0007  0.0398  -0.0075 435 LEU A O   
2247 C CB  . LEU A 325 ? 0.2257 0.2228 0.4258 0.0063  0.0530  -0.0133 435 LEU A CB  
2248 C CG  . LEU A 325 ? 0.2868 0.2766 0.4690 0.0056  0.0541  -0.0154 435 LEU A CG  
2249 C CD1 . LEU A 325 ? 0.3089 0.3011 0.4847 0.0075  0.0635  -0.0128 435 LEU A CD1 
2250 C CD2 . LEU A 325 ? 0.3097 0.2910 0.4806 0.0068  0.0516  -0.0221 435 LEU A CD2 
2251 N N   . VAL A 326 ? 0.2417 0.2478 0.4685 0.0071  0.0430  -0.0137 436 VAL A N   
2252 C CA  . VAL A 326 ? 0.2429 0.2575 0.4854 0.0070  0.0411  -0.0097 436 VAL A CA  
2253 C C   . VAL A 326 ? 0.2769 0.2957 0.5251 0.0122  0.0490  -0.0080 436 VAL A C   
2254 O O   . VAL A 326 ? 0.2568 0.2690 0.4963 0.0158  0.0517  -0.0125 436 VAL A O   
2255 C CB  . VAL A 326 ? 0.3072 0.3209 0.5503 0.0059  0.0327  -0.0126 436 VAL A CB  
2256 C CG1 . VAL A 326 ? 0.2952 0.3178 0.5537 0.0040  0.0283  -0.0078 436 VAL A CG1 
2257 C CG2 . VAL A 326 ? 0.3187 0.3260 0.5526 0.0033  0.0267  -0.0162 436 VAL A CG2 
2258 N N   . MET A 327 ? 0.2405 0.2704 0.5047 0.0126  0.0522  -0.0011 437 MET A N   
2259 C CA  . MET A 327 ? 0.2482 0.2845 0.5220 0.0187  0.0604  0.0019  437 MET A CA  
2260 C C   . MET A 327 ? 0.2681 0.3137 0.5596 0.0180  0.0547  0.0068  437 MET A C   
2261 O O   . MET A 327 ? 0.2350 0.2887 0.5383 0.0126  0.0487  0.0122  437 MET A O   
2262 C CB  . MET A 327 ? 0.2938 0.3387 0.5735 0.0206  0.0701  0.0079  437 MET A CB  
2263 C CG  . MET A 327 ? 0.3521 0.4037 0.6409 0.0291  0.0806  0.0106  437 MET A CG  
2264 S SD  . MET A 327 ? 0.4293 0.4644 0.6947 0.0368  0.0894  0.0005  437 MET A SD  
2265 C CE  . MET A 327 ? 0.3887 0.4293 0.6682 0.0473  0.0986  0.0029  437 MET A CE  
2266 N N   . CYS A 328 ? 0.2529 0.2969 0.5465 0.0229  0.0557  0.0054  438 CYS A N   
2267 C CA  . CYS A 328 ? 0.2460 0.2997 0.5562 0.0222  0.0498  0.0111  438 CYS A CA  
2268 C C   . CYS A 328 ? 0.2755 0.3349 0.5988 0.0301  0.0573  0.0153  438 CYS A C   
2269 O O   . CYS A 328 ? 0.2576 0.3081 0.5719 0.0367  0.0658  0.0107  438 CYS A O   
2270 C CB  . CYS A 328 ? 0.2527 0.3003 0.5544 0.0190  0.0399  0.0070  438 CYS A CB  
2271 S SG  . CYS A 328 ? 0.3092 0.3468 0.6025 0.0246  0.0424  0.0027  438 CYS A SG  
2272 N N   . PRO A 329 ? 0.2231 0.2968 0.5679 0.0298  0.0540  0.0242  439 PRO A N   
2273 C CA  . PRO A 329 ? 0.2217 0.3011 0.5811 0.0385  0.0607  0.0290  439 PRO A CA  
2274 C C   . PRO A 329 ? 0.2656 0.3317 0.6149 0.0424  0.0593  0.0234  439 PRO A C   
2275 O O   . PRO A 329 ? 0.2504 0.3108 0.5901 0.0370  0.0499  0.0203  439 PRO A O   
2276 C CB  . PRO A 329 ? 0.2400 0.3372 0.6233 0.0348  0.0531  0.0400  439 PRO A CB  
2277 C CG  . PRO A 329 ? 0.2730 0.3738 0.6545 0.0246  0.0450  0.0409  439 PRO A CG  
2278 C CD  . PRO A 329 ? 0.2197 0.3034 0.5756 0.0217  0.0426  0.0300  439 PRO A CD  
2279 N N   . TYR A 330 ? 0.2468 0.3076 0.5980 0.0519  0.0688  0.0221  440 TYR A N   
2280 C CA  . TYR A 330 ? 0.2480 0.2938 0.5903 0.0557  0.0679  0.0172  440 TYR A CA  
2281 C C   . TYR A 330 ? 0.2763 0.3258 0.6263 0.0520  0.0567  0.0222  440 TYR A C   
2282 O O   . TYR A 330 ? 0.2659 0.3039 0.6026 0.0495  0.0517  0.0176  440 TYR A O   
2283 C CB  . TYR A 330 ? 0.2767 0.3173 0.6250 0.0676  0.0792  0.0168  440 TYR A CB  
2284 C CG  . TYR A 330 ? 0.3033 0.3233 0.6386 0.0708  0.0783  0.0099  440 TYR A CG  
2285 C CD1 . TYR A 330 ? 0.3341 0.3369 0.6451 0.0678  0.0781  -0.0003 440 TYR A CD1 
2286 C CD2 . TYR A 330 ? 0.3265 0.3443 0.6750 0.0764  0.0768  0.0145  440 TYR A CD2 
2287 C CE1 . TYR A 330 ? 0.3642 0.3477 0.6644 0.0695  0.0761  -0.0059 440 TYR A CE1 
2288 C CE2 . TYR A 330 ? 0.3596 0.3572 0.6973 0.0785  0.0751  0.0089  440 TYR A CE2 
2289 C CZ  . TYR A 330 ? 0.4560 0.4363 0.7695 0.0747  0.0745  -0.0013 440 TYR A CZ  
2290 O OH  . TYR A 330 ? 0.5083 0.4684 0.8119 0.0753  0.0714  -0.0061 440 TYR A OH  
2291 N N   . ASP A 331 ? 0.2225 0.2889 0.5939 0.0515  0.0527  0.0324  441 ASP A N   
2292 C CA  . ASP A 331 ? 0.2077 0.2792 0.5863 0.0482  0.0419  0.0383  441 ASP A CA  
2293 C C   . ASP A 331 ? 0.2344 0.3056 0.5988 0.0381  0.0308  0.0354  441 ASP A C   
2294 O O   . ASP A 331 ? 0.2324 0.3046 0.5959 0.0356  0.0227  0.0384  441 ASP A O   
2295 C CB  . ASP A 331 ? 0.2242 0.3147 0.6298 0.0501  0.0398  0.0507  441 ASP A CB  
2296 C CG  . ASP A 331 ? 0.2836 0.3893 0.6982 0.0434  0.0362  0.0553  441 ASP A CG  
2297 O OD1 . ASP A 331 ? 0.3390 0.4590 0.7690 0.0391  0.0269  0.0645  441 ASP A OD1 
2298 O OD2 . ASP A 331 ? 0.2337 0.3374 0.6416 0.0427  0.0425  0.0508  441 ASP A OD2 
2299 N N   . ARG A 332 ? 0.1818 0.2510 0.5346 0.0331  0.0308  0.0297  442 ARG A N   
2300 C CA  . ARG A 332 ? 0.1730 0.2405 0.5115 0.0250  0.0214  0.0258  442 ARG A CA  
2301 C C   . ARG A 332 ? 0.2095 0.2624 0.5263 0.0244  0.0237  0.0164  442 ARG A C   
2302 O O   . ARG A 332 ? 0.1720 0.2228 0.4762 0.0193  0.0177  0.0123  442 ARG A O   
2303 C CB  . ARG A 332 ? 0.1544 0.2299 0.4972 0.0190  0.0174  0.0272  442 ARG A CB  
2304 C CG  . ARG A 332 ? 0.1749 0.2668 0.5424 0.0187  0.0155  0.0380  442 ARG A CG  
2305 C CD  . ARG A 332 ? 0.2220 0.3219 0.5994 0.0184  0.0074  0.0452  442 ARG A CD  
2306 N NE  . ARG A 332 ? 0.2829 0.3999 0.6853 0.0175  0.0047  0.0564  442 ARG A NE  
2307 C CZ  . ARG A 332 ? 0.3976 0.5234 0.8058 0.0090  -0.0061 0.0605  442 ARG A CZ  
2308 N NH1 . ARG A 332 ? 0.2491 0.3664 0.6382 0.0018  -0.0147 0.0531  442 ARG A NH1 
2309 N NH2 . ARG A 332 ? 0.1967 0.3393 0.6298 0.0079  -0.0088 0.0720  442 ARG A NH2 
2310 N N   . ARG A 333 ? 0.1772 0.2198 0.4897 0.0300  0.0319  0.0128  443 ARG A N   
2311 C CA  . ARG A 333 ? 0.1878 0.2171 0.4811 0.0288  0.0336  0.0047  443 ARG A CA  
2312 C C   . ARG A 333 ? 0.2155 0.2425 0.4987 0.0247  0.0260  0.0036  443 ARG A C   
2313 O O   . ARG A 333 ? 0.2384 0.2606 0.5079 0.0216  0.0249  -0.0017 443 ARG A O   
2314 C CB  . ARG A 333 ? 0.2055 0.2225 0.4950 0.0350  0.0418  0.0011  443 ARG A CB  
2315 C CG  . ARG A 333 ? 0.3121 0.3232 0.6065 0.0385  0.0407  0.0037  443 ARG A CG  
2316 C CD  . ARG A 333 ? 0.2591 0.2581 0.5529 0.0462  0.0496  0.0002  443 ARG A CD  
2317 N NE  . ARG A 333 ? 0.2408 0.2311 0.5397 0.0497  0.0478  0.0026  443 ARG A NE  
2318 C CZ  . ARG A 333 ? 0.4688 0.4664 0.7859 0.0538  0.0469  0.0106  443 ARG A CZ  
2319 N NH1 . ARG A 333 ? 0.2662 0.2812 0.5988 0.0547  0.0473  0.0171  443 ARG A NH1 
2320 N NH2 . ARG A 333 ? 0.3794 0.3670 0.7005 0.0567  0.0448  0.0130  443 ARG A NH2 
2321 N N   . ALA A 334 ? 0.1436 0.1758 0.4340 0.0248  0.0209  0.0095  444 ALA A N   
2322 C CA  . ALA A 334 ? 0.1551 0.1872 0.4357 0.0212  0.0148  0.0097  444 ALA A CA  
2323 C C   . ALA A 334 ? 0.2106 0.2500 0.4838 0.0166  0.0089  0.0080  444 ALA A C   
2324 O O   . ALA A 334 ? 0.2194 0.2568 0.4798 0.0145  0.0071  0.0046  444 ALA A O   
2325 C CB  . ALA A 334 ? 0.1537 0.1895 0.4435 0.0225  0.0112  0.0177  444 ALA A CB  
2326 N N   . PHE A 335 ? 0.1960 0.2435 0.4775 0.0152  0.0058  0.0105  445 PHE A N   
2327 C CA  . PHE A 335 ? 0.1718 0.2233 0.4457 0.0108  -0.0009 0.0079  445 PHE A CA  
2328 C C   . PHE A 335 ? 0.1995 0.2435 0.4635 0.0097  0.0021  0.0004  445 PHE A C   
2329 O O   . PHE A 335 ? 0.1753 0.2171 0.4267 0.0079  -0.0013 -0.0043 445 PHE A O   
2330 C CB  . PHE A 335 ? 0.1903 0.2514 0.4774 0.0084  -0.0066 0.0134  445 PHE A CB  
2331 C CG  . PHE A 335 ? 0.1994 0.2689 0.4981 0.0095  -0.0101 0.0222  445 PHE A CG  
2332 C CD1 . PHE A 335 ? 0.2345 0.3075 0.5515 0.0138  -0.0053 0.0286  445 PHE A CD1 
2333 C CD2 . PHE A 335 ? 0.1968 0.2708 0.4875 0.0073  -0.0176 0.0246  445 PHE A CD2 
2334 C CE1 . PHE A 335 ? 0.2388 0.3189 0.5677 0.0156  -0.0085 0.0375  445 PHE A CE1 
2335 C CE2 . PHE A 335 ? 0.2300 0.3119 0.5314 0.0083  -0.0211 0.0340  445 PHE A CE2 
2336 C CZ  . PHE A 335 ? 0.2111 0.2958 0.5325 0.0124  -0.0170 0.0406  445 PHE A CZ  
2337 N N   . ALA A 336 ? 0.1779 0.2181 0.4473 0.0115  0.0090  -0.0004 446 ALA A N   
2338 C CA  . ALA A 336 ? 0.1754 0.2090 0.4364 0.0105  0.0120  -0.0060 446 ALA A CA  
2339 C C   . ALA A 336 ? 0.2083 0.2343 0.4552 0.0113  0.0138  -0.0108 446 ALA A C   
2340 O O   . ALA A 336 ? 0.2021 0.2253 0.4395 0.0097  0.0118  -0.0149 446 ALA A O   
2341 C CB  . ALA A 336 ? 0.1804 0.2135 0.4498 0.0126  0.0196  -0.0044 446 ALA A CB  
2342 N N   . LEU A 337 ? 0.1806 0.2033 0.4274 0.0138  0.0170  -0.0097 447 LEU A N   
2343 C CA  . LEU A 337 ? 0.1745 0.1912 0.4105 0.0135  0.0176  -0.0124 447 LEU A CA  
2344 C C   . LEU A 337 ? 0.2350 0.2571 0.4641 0.0118  0.0123  -0.0124 447 LEU A C   
2345 O O   . LEU A 337 ? 0.2170 0.2370 0.4372 0.0112  0.0124  -0.0157 447 LEU A O   
2346 C CB  . LEU A 337 ? 0.1724 0.1842 0.4116 0.0155  0.0198  -0.0100 447 LEU A CB  
2347 C CG  . LEU A 337 ? 0.2181 0.2235 0.4484 0.0139  0.0192  -0.0113 447 LEU A CG  
2348 C CD1 . LEU A 337 ? 0.1968 0.1958 0.4173 0.0127  0.0215  -0.0168 447 LEU A CD1 
2349 C CD2 . LEU A 337 ? 0.2344 0.2320 0.4689 0.0154  0.0202  -0.0089 447 LEU A CD2 
2350 N N   . LEU A 338 ? 0.2085 0.2381 0.4416 0.0116  0.0081  -0.0084 448 LEU A N   
2351 C CA  . LEU A 338 ? 0.1948 0.2306 0.4197 0.0109  0.0038  -0.0082 448 LEU A CA  
2352 C C   . LEU A 338 ? 0.2381 0.2725 0.4549 0.0104  0.0018  -0.0142 448 LEU A C   
2353 O O   . LEU A 338 ? 0.2130 0.2476 0.4201 0.0115  0.0021  -0.0171 448 LEU A O   
2354 C CB  . LEU A 338 ? 0.1959 0.2398 0.4260 0.0104  -0.0009 -0.0022 448 LEU A CB  
2355 C CG  . LEU A 338 ? 0.2444 0.2958 0.4642 0.0101  -0.0051 -0.0012 448 LEU A CG  
2356 C CD1 . LEU A 338 ? 0.2387 0.2924 0.4536 0.0108  -0.0023 0.0014  448 LEU A CD1 
2357 C CD2 . LEU A 338 ? 0.2235 0.2828 0.4486 0.0090  -0.0105 0.0053  448 LEU A CD2 
2358 N N   . GLY A 339 ? 0.2061 0.2388 0.4279 0.0090  0.0001  -0.0156 449 GLY A N   
2359 C CA  . GLY A 339 ? 0.2112 0.2397 0.4265 0.0080  -0.0028 -0.0211 449 GLY A CA  
2360 C C   . GLY A 339 ? 0.2800 0.3015 0.4905 0.0090  0.0014  -0.0251 449 GLY A C   
2361 O O   . GLY A 339 ? 0.3261 0.3443 0.5279 0.0101  -0.0004 -0.0297 449 GLY A O   
2362 N N   . TRP A 340 ? 0.2358 0.2545 0.4510 0.0092  0.0067  -0.0234 450 TRP A N   
2363 C CA  . TRP A 340 ? 0.2492 0.2617 0.4596 0.0094  0.0100  -0.0262 450 TRP A CA  
2364 C C   . TRP A 340 ? 0.2476 0.2603 0.4510 0.0109  0.0114  -0.0267 450 TRP A C   
2365 O O   . TRP A 340 ? 0.2341 0.2431 0.4330 0.0111  0.0126  -0.0286 450 TRP A O   
2366 C CB  . TRP A 340 ? 0.2544 0.2637 0.4705 0.0088  0.0148  -0.0246 450 TRP A CB  
2367 C CG  . TRP A 340 ? 0.2919 0.3015 0.5145 0.0068  0.0135  -0.0237 450 TRP A CG  
2368 C CD1 . TRP A 340 ? 0.3339 0.3491 0.5666 0.0054  0.0109  -0.0204 450 TRP A CD1 
2369 C CD2 . TRP A 340 ? 0.3004 0.3054 0.5208 0.0051  0.0131  -0.0251 450 TRP A CD2 
2370 N NE1 . TRP A 340 ? 0.3385 0.3526 0.5757 0.0024  0.0086  -0.0196 450 TRP A NE1 
2371 C CE2 . TRP A 340 ? 0.3572 0.3645 0.5868 0.0023  0.0099  -0.0225 450 TRP A CE2 
2372 C CE3 . TRP A 340 ? 0.3275 0.3268 0.5404 0.0054  0.0148  -0.0270 450 TRP A CE3 
2373 C CZ2 . TRP A 340 ? 0.3562 0.3595 0.5876 -0.0006 0.0084  -0.0219 450 TRP A CZ2 
2374 C CZ3 . TRP A 340 ? 0.3612 0.3569 0.5756 0.0032  0.0139  -0.0262 450 TRP A CZ3 
2375 C CH2 . TRP A 340 ? 0.3698 0.3670 0.5933 0.0002  0.0106  -0.0238 450 TRP A CH2 
2376 N N   . THR A 341 ? 0.1722 0.1905 0.3757 0.0115  0.0107  -0.0238 451 THR A N   
2377 C CA  . THR A 341 ? 0.1574 0.1779 0.3566 0.0120  0.0117  -0.0224 451 THR A CA  
2378 C C   . THR A 341 ? 0.2027 0.2281 0.3952 0.0146  0.0104  -0.0246 451 THR A C   
2379 O O   . THR A 341 ? 0.1743 0.2012 0.3641 0.0156  0.0117  -0.0242 451 THR A O   
2380 C CB  . THR A 341 ? 0.1773 0.2016 0.3806 0.0111  0.0114  -0.0171 451 THR A CB  
2381 O OG1 . THR A 341 ? 0.1929 0.2099 0.4013 0.0101  0.0134  -0.0165 451 THR A OG1 
2382 C CG2 . THR A 341 ? 0.1781 0.2073 0.3791 0.0105  0.0115  -0.0136 451 THR A CG2 
2383 N N   . GLY A 342 ? 0.1703 0.1978 0.3598 0.0159  0.0076  -0.0267 452 GLY A N   
2384 C CA  . GLY A 342 ? 0.1518 0.1821 0.3325 0.0197  0.0067  -0.0302 452 GLY A CA  
2385 C C   . GLY A 342 ? 0.2087 0.2502 0.3860 0.0220  0.0085  -0.0260 452 GLY A C   
2386 O O   . GLY A 342 ? 0.2019 0.2487 0.3838 0.0197  0.0084  -0.0201 452 GLY A O   
2387 N N   . SER A 343 ? 0.1245 0.1548 0.3307 -0.0069 0.0145  -0.0001 453 SER A N   
2388 C CA  . SER A 343 ? 0.1291 0.1605 0.3483 -0.0089 0.0111  0.0026  453 SER A CA  
2389 C C   . SER A 343 ? 0.1921 0.2214 0.4205 -0.0083 0.0056  0.0011  453 SER A C   
2390 O O   . SER A 343 ? 0.1883 0.2156 0.4087 -0.0065 0.0054  -0.0021 453 SER A O   
2391 C CB  . SER A 343 ? 0.1541 0.1798 0.3730 -0.0082 0.0121  -0.0017 453 SER A CB  
2392 O OG  . SER A 343 ? 0.2122 0.2343 0.4245 -0.0054 0.0113  -0.0102 453 SER A OG  
2393 N N   . ARG A 344 ? 0.1760 0.2064 0.4246 -0.0101 0.0003  0.0038  454 ARG A N   
2394 C CA  . ARG A 344 ? 0.1826 0.2105 0.4446 -0.0094 -0.0063 0.0006  454 ARG A CA  
2395 C C   . ARG A 344 ? 0.2336 0.2567 0.4854 -0.0062 -0.0058 -0.0138 454 ARG A C   
2396 O O   . ARG A 344 ? 0.2357 0.2597 0.4836 -0.0056 -0.0079 -0.0162 454 ARG A O   
2397 C CB  . ARG A 344 ? 0.1675 0.1966 0.4614 -0.0118 -0.0137 0.0051  454 ARG A CB  
2398 N N   . GLN A 345 ? 0.1827 0.2052 0.4297 -0.0047 -0.0030 -0.0223 455 GLN A N   
2399 C CA  . GLN A 345 ? 0.1813 0.2091 0.4181 -0.0026 -0.0024 -0.0354 455 GLN A CA  
2400 C C   . GLN A 345 ? 0.2270 0.2589 0.4421 -0.0029 0.0009  -0.0304 455 GLN A C   
2401 O O   . GLN A 345 ? 0.1994 0.2399 0.4094 -0.0031 -0.0009 -0.0357 455 GLN A O   
2402 C CB  . GLN A 345 ? 0.1911 0.2223 0.4272 -0.0012 0.0003  -0.0443 455 GLN A CB  
2403 C CG  . GLN A 345 ? 0.3041 0.3501 0.5345 0.0004  -0.0001 -0.0601 455 GLN A CG  
2404 C CD  . GLN A 345 ? 0.4658 0.5164 0.7168 0.0014  -0.0065 -0.0756 455 GLN A CD  
2405 O OE1 . GLN A 345 ? 0.3628 0.4032 0.6395 0.0014  -0.0119 -0.0755 455 GLN A OE1 
2406 N NE2 . GLN A 345 ? 0.4274 0.4965 0.6700 0.0016  -0.0070 -0.0885 455 GLN A NE2 
2407 N N   . PHE A 346 ? 0.1905 0.2188 0.3963 -0.0034 0.0052  -0.0206 456 PHE A N   
2408 C CA  . PHE A 346 ? 0.1818 0.2128 0.3763 -0.0036 0.0069  -0.0148 456 PHE A CA  
2409 C C   . PHE A 346 ? 0.2284 0.2596 0.4265 -0.0042 0.0039  -0.0118 456 PHE A C   
2410 O O   . PHE A 346 ? 0.2137 0.2512 0.4069 -0.0050 0.0027  -0.0104 456 PHE A O   
2411 C CB  . PHE A 346 ? 0.1858 0.2125 0.3775 -0.0035 0.0108  -0.0083 456 PHE A CB  
2412 C CG  . PHE A 346 ? 0.1941 0.2231 0.3824 -0.0036 0.0113  -0.0031 456 PHE A CG  
2413 C CD1 . PHE A 346 ? 0.2201 0.2544 0.4037 -0.0040 0.0117  -0.0004 456 PHE A CD1 
2414 C CD2 . PHE A 346 ? 0.2091 0.2371 0.4031 -0.0034 0.0104  0.0005  456 PHE A CD2 
2415 C CE1 . PHE A 346 ? 0.2307 0.2685 0.4190 -0.0049 0.0102  0.0078  456 PHE A CE1 
2416 C CE2 . PHE A 346 ? 0.2384 0.2683 0.4375 -0.0036 0.0094  0.0062  456 PHE A CE2 
2417 C CZ  . PHE A 346 ? 0.2123 0.2468 0.4102 -0.0047 0.0088  0.0109  456 PHE A CZ  
2418 N N   . GLU A 347 ? 0.2216 0.2489 0.4294 -0.0045 0.0022  -0.0089 457 GLU A N   
2419 C CA  . GLU A 347 ? 0.2352 0.2633 0.4477 -0.0049 -0.0010 -0.0051 457 GLU A CA  
2420 C C   . GLU A 347 ? 0.2647 0.2954 0.4799 -0.0054 -0.0058 -0.0115 457 GLU A C   
2421 O O   . GLU A 347 ? 0.2436 0.2775 0.4548 -0.0061 -0.0071 -0.0089 457 GLU A O   
2422 C CB  . GLU A 347 ? 0.2656 0.2950 0.4904 -0.0060 -0.0029 0.0010  457 GLU A CB  
2423 C CG  . GLU A 347 ? 0.4258 0.4606 0.6487 -0.0064 0.0017  0.0058  457 GLU A CG  
2424 C CD  . GLU A 347 ? 0.7541 0.7907 0.9699 -0.0049 0.0054  0.0055  457 GLU A CD  
2425 O OE1 . GLU A 347 ? 0.9696 1.0064 1.1812 -0.0042 0.0094  0.0029  457 GLU A OE1 
2426 O OE2 . GLU A 347 ? 0.7383 0.7753 0.9555 -0.0044 0.0036  0.0072  457 GLU A OE2 
2427 N N   . ARG A 348 ? 0.2234 0.2544 0.4485 -0.0051 -0.0089 -0.0210 458 ARG A N   
2428 C CA  . ARG A 348 ? 0.2309 0.2680 0.4623 -0.0052 -0.0139 -0.0326 458 ARG A CA  
2429 C C   . ARG A 348 ? 0.2847 0.3356 0.4991 -0.0062 -0.0117 -0.0362 458 ARG A C   
2430 O O   . ARG A 348 ? 0.3082 0.3665 0.5209 -0.0079 -0.0148 -0.0370 458 ARG A O   
2431 C CB  . ARG A 348 ? 0.2414 0.2784 0.4903 -0.0039 -0.0169 -0.0458 458 ARG A CB  
2432 C CG  . ARG A 348 ? 0.4043 0.4329 0.6817 -0.0042 -0.0237 -0.0425 458 ARG A CG  
2433 C CD  . ARG A 348 ? 0.4440 0.4730 0.7473 -0.0028 -0.0284 -0.0579 458 ARG A CD  
2434 N NE  . ARG A 348 ? 0.7755 0.8032 1.0767 -0.0020 -0.0235 -0.0579 458 ARG A NE  
2435 C CZ  . ARG A 348 ? 0.9303 0.9517 1.2512 -0.0033 -0.0253 -0.0479 458 ARG A CZ  
2436 N NH1 . ARG A 348 ? 0.8460 0.8645 1.1926 -0.0057 -0.0325 -0.0360 458 ARG A NH1 
2437 N NH2 . ARG A 348 ? 0.5218 0.5428 0.8385 -0.0029 -0.0204 -0.0477 458 ARG A NH2 
2438 N N   . ASP A 349 ? 0.2258 0.2827 0.4289 -0.0061 -0.0071 -0.0359 459 ASP A N   
2439 C CA  . ASP A 349 ? 0.2238 0.3003 0.4139 -0.0084 -0.0059 -0.0349 459 ASP A CA  
2440 C C   . ASP A 349 ? 0.2352 0.3122 0.4204 -0.0107 -0.0058 -0.0190 459 ASP A C   
2441 O O   . ASP A 349 ? 0.2129 0.3085 0.3937 -0.0142 -0.0078 -0.0161 459 ASP A O   
2442 C CB  . ASP A 349 ? 0.2381 0.3232 0.4210 -0.0079 -0.0022 -0.0364 459 ASP A CB  
2443 C CG  . ASP A 349 ? 0.3384 0.4369 0.5257 -0.0066 -0.0030 -0.0557 459 ASP A CG  
2444 O OD1 . ASP A 349 ? 0.3053 0.4121 0.4876 -0.0058 0.0001  -0.0583 459 ASP A OD1 
2445 O OD2 . ASP A 349 ? 0.3613 0.4631 0.5592 -0.0061 -0.0071 -0.0692 459 ASP A OD2 
2446 N N   . LEU A 350 ? 0.1963 0.2566 0.3849 -0.0093 -0.0038 -0.0094 460 LEU A N   
2447 C CA  . LEU A 350 ? 0.2096 0.2685 0.4008 -0.0105 -0.0042 0.0030  460 LEU A CA  
2448 C C   . LEU A 350 ? 0.2600 0.3231 0.4537 -0.0124 -0.0082 0.0038  460 LEU A C   
2449 O O   . LEU A 350 ? 0.2488 0.3236 0.4425 -0.0157 -0.0101 0.0123  460 LEU A O   
2450 C CB  . LEU A 350 ? 0.2187 0.2621 0.4162 -0.0077 -0.0015 0.0060  460 LEU A CB  
2451 C CG  . LEU A 350 ? 0.2982 0.3381 0.4993 -0.0067 0.0014  0.0108  460 LEU A CG  
2452 C CD1 . LEU A 350 ? 0.3053 0.3372 0.5128 -0.0043 0.0038  0.0090  460 LEU A CD1 
2453 C CD2 . LEU A 350 ? 0.2735 0.3204 0.4822 -0.0089 -0.0009 0.0214  460 LEU A CD2 
2454 N N   . ARG A 351 ? 0.2141 0.2690 0.4127 -0.0108 -0.0103 -0.0033 461 ARG A N   
2455 C CA  . ARG A 351 ? 0.2192 0.2756 0.4222 -0.0122 -0.0148 -0.0028 461 ARG A CA  
2456 C C   . ARG A 351 ? 0.2661 0.3413 0.4646 -0.0153 -0.0180 -0.0110 461 ARG A C   
2457 O O   . ARG A 351 ? 0.2391 0.3236 0.4363 -0.0185 -0.0206 -0.0054 461 ARG A O   
2458 C CB  . ARG A 351 ? 0.2239 0.2689 0.4384 -0.0102 -0.0177 -0.0061 461 ARG A CB  
2459 C CG  . ARG A 351 ? 0.3846 0.4209 0.6026 -0.0085 -0.0148 0.0032  461 ARG A CG  
2460 C CD  . ARG A 351 ? 0.6121 0.6445 0.8434 -0.0081 -0.0185 0.0060  461 ARG A CD  
2461 N NE  . ARG A 351 ? 0.7249 0.7586 0.9558 -0.0071 -0.0143 0.0140  461 ARG A NE  
2462 C CZ  . ARG A 351 ? 0.8371 0.8735 1.0724 -0.0069 -0.0123 0.0160  461 ARG A CZ  
2463 N NH1 . ARG A 351 ? 0.3830 0.4265 0.6170 -0.0062 -0.0080 0.0198  461 ARG A NH1 
2464 N NH2 . ARG A 351 ? 0.7424 0.7772 0.9860 -0.0077 -0.0149 0.0135  461 ARG A NH2 
2465 N N   . ARG A 352 ? 0.2205 0.3049 0.4173 -0.0146 -0.0176 -0.0248 462 ARG A N   
2466 C CA  . ARG A 352 ? 0.2177 0.3280 0.4106 -0.0175 -0.0200 -0.0373 462 ARG A CA  
2467 C C   . ARG A 352 ? 0.2677 0.4024 0.4491 -0.0227 -0.0187 -0.0246 462 ARG A C   
2468 O O   . ARG A 352 ? 0.2728 0.4293 0.4517 -0.0272 -0.0219 -0.0248 462 ARG A O   
2469 C CB  . ARG A 352 ? 0.1907 0.3069 0.3872 -0.0149 -0.0191 -0.0558 462 ARG A CB  
2470 C CG  . ARG A 352 ? 0.3358 0.4832 0.5320 -0.0169 -0.0218 -0.0756 462 ARG A CG  
2471 C CD  . ARG A 352 ? 0.4763 0.6267 0.6835 -0.0130 -0.0216 -0.0977 462 ARG A CD  
2472 N NE  . ARG A 352 ? 0.4986 0.6471 0.6974 -0.0115 -0.0159 -0.0917 462 ARG A NE  
2473 C CZ  . ARG A 352 ? 0.6701 0.8469 0.8606 -0.0123 -0.0131 -0.1008 462 ARG A CZ  
2474 N NH1 . ARG A 352 ? 0.5262 0.7404 0.7145 -0.0149 -0.0150 -0.1174 462 ARG A NH1 
2475 N NH2 . ARG A 352 ? 0.5115 0.6829 0.6963 -0.0107 -0.0085 -0.0937 462 ARG A NH2 
2476 N N   . TYR A 353 ? 0.2091 0.3421 0.3868 -0.0226 -0.0150 -0.0123 463 TYR A N   
2477 C CA  . TYR A 353 ? 0.2034 0.3579 0.3783 -0.0280 -0.0154 0.0054  463 TYR A CA  
2478 C C   . TYR A 353 ? 0.2210 0.3714 0.4030 -0.0309 -0.0182 0.0207  463 TYR A C   
2479 O O   . TYR A 353 ? 0.1917 0.3695 0.3730 -0.0374 -0.0214 0.0297  463 TYR A O   
2480 C CB  . TYR A 353 ? 0.2016 0.3467 0.3788 -0.0263 -0.0123 0.0160  463 TYR A CB  
2481 C CG  . TYR A 353 ? 0.2238 0.3892 0.4070 -0.0320 -0.0146 0.0378  463 TYR A CG  
2482 C CD1 . TYR A 353 ? 0.2540 0.4548 0.4321 -0.0369 -0.0157 0.0427  463 TYR A CD1 
2483 C CD2 . TYR A 353 ? 0.2202 0.3725 0.4187 -0.0328 -0.0165 0.0543  463 TYR A CD2 
2484 C CE1 . TYR A 353 ? 0.2567 0.4806 0.4459 -0.0436 -0.0197 0.0674  463 TYR A CE1 
2485 C CE2 . TYR A 353 ? 0.2232 0.3951 0.4357 -0.0388 -0.0206 0.0766  463 TYR A CE2 
2486 C CZ  . TYR A 353 ? 0.3295 0.5370 0.5381 -0.0446 -0.0226 0.0850  463 TYR A CZ  
2487 O OH  . TYR A 353 ? 0.3730 0.6029 0.6007 -0.0515 -0.0282 0.1112  463 TYR A OH  
2488 N N   . ALA A 354 ? 0.1987 0.3192 0.3884 -0.0267 -0.0172 0.0240  464 ALA A N   
2489 C CA  . ALA A 354 ? 0.2148 0.3306 0.4135 -0.0287 -0.0196 0.0370  464 ALA A CA  
2490 C C   . ALA A 354 ? 0.2636 0.3958 0.4582 -0.0329 -0.0238 0.0338  464 ALA A C   
2491 O O   . ALA A 354 ? 0.2596 0.4093 0.4580 -0.0388 -0.0267 0.0481  464 ALA A O   
2492 C CB  . ALA A 354 ? 0.2251 0.3126 0.4308 -0.0230 -0.0176 0.0354  464 ALA A CB  
2493 N N   . THR A 355 ? 0.2489 0.3784 0.4389 -0.0307 -0.0249 0.0155  465 THR A N   
2494 C CA  . THR A 355 ? 0.2730 0.4171 0.4618 -0.0341 -0.0296 0.0080  465 THR A CA  
2495 C C   . THR A 355 ? 0.3515 0.5371 0.5321 -0.0410 -0.0312 0.0052  465 THR A C   
2496 O O   . THR A 355 ? 0.3517 0.5578 0.5319 -0.0474 -0.0342 0.0160  465 THR A O   
2497 C CB  . THR A 355 ? 0.4026 0.5320 0.5970 -0.0294 -0.0319 -0.0121 465 THR A CB  
2498 O OG1 . THR A 355 ? 0.4029 0.5027 0.6054 -0.0248 -0.0310 -0.0051 465 THR A OG1 
2499 C CG2 . THR A 355 ? 0.4488 0.5918 0.6467 -0.0324 -0.0379 -0.0230 465 THR A CG2 
2500 N N   . HIS A 356 ? 0.3268 0.5283 0.5016 -0.0401 -0.0292 -0.0089 466 HIS A N   
2501 C CA  . HIS A 356 ? 0.3419 0.5906 0.5085 -0.0464 -0.0304 -0.0161 466 HIS A CA  
2502 C C   . HIS A 356 ? 0.3333 0.6122 0.4968 -0.0539 -0.0303 0.0085  466 HIS A C   
2503 O O   . HIS A 356 ? 0.3439 0.6671 0.5029 -0.0622 -0.0331 0.0119  466 HIS A O   
2504 C CB  . HIS A 356 ? 0.3745 0.6321 0.5390 -0.0422 -0.0284 -0.0416 466 HIS A CB  
2505 C CG  . HIS A 356 ? 0.4430 0.6788 0.6187 -0.0364 -0.0310 -0.0662 466 HIS A CG  
2506 N ND1 . HIS A 356 ? 0.4783 0.6931 0.6624 -0.0295 -0.0293 -0.0814 466 HIS A ND1 
2507 C CD2 . HIS A 356 ? 0.4853 0.7157 0.6692 -0.0369 -0.0362 -0.0740 466 HIS A CD2 
2508 C CE1 . HIS A 356 ? 0.4804 0.6793 0.6807 -0.0263 -0.0342 -0.0973 466 HIS A CE1 
2509 N NE2 . HIS A 356 ? 0.4873 0.6940 0.6878 -0.0304 -0.0386 -0.0938 466 HIS A NE2 
2510 N N   . GLU A 357 ? 0.2231 0.4825 0.3921 -0.0519 -0.0279 0.0262  467 GLU A N   
2511 C CA  . GLU A 357 ? 0.1966 0.4848 0.3704 -0.0592 -0.0295 0.0520  467 GLU A CA  
2512 C C   . GLU A 357 ? 0.2477 0.5257 0.4378 -0.0629 -0.0328 0.0785  467 GLU A C   
2513 O O   . GLU A 357 ? 0.2758 0.5885 0.4744 -0.0720 -0.0369 0.1016  467 GLU A O   
2514 C CB  . GLU A 357 ? 0.1997 0.4791 0.3753 -0.0557 -0.0265 0.0562  467 GLU A CB  
2515 C CG  . GLU A 357 ? 0.2619 0.5506 0.4245 -0.0517 -0.0229 0.0320  467 GLU A CG  
2516 C CD  . GLU A 357 ? 0.4008 0.7454 0.5531 -0.0580 -0.0242 0.0222  467 GLU A CD  
2517 O OE1 . GLU A 357 ? 0.3713 0.7205 0.5167 -0.0537 -0.0221 -0.0069 467 GLU A OE1 
2518 O OE2 . GLU A 357 ? 0.3170 0.7041 0.4711 -0.0677 -0.0278 0.0431  467 GLU A OE2 
2519 N N   . ARG A 358 ? 0.1673 0.4022 0.3650 -0.0565 -0.0316 0.0769  468 ARG A N   
2520 C CA  . ARG A 358 ? 0.1632 0.3869 0.3808 -0.0587 -0.0344 0.0995  468 ARG A CA  
2521 C C   . ARG A 358 ? 0.2480 0.4621 0.4665 -0.0592 -0.0362 0.0985  468 ARG A C   
2522 O O   . ARG A 358 ? 0.2124 0.4194 0.4488 -0.0612 -0.0386 0.1164  468 ARG A O   
2523 C CB  . ARG A 358 ? 0.1265 0.3126 0.3576 -0.0510 -0.0314 0.1007  468 ARG A CB  
2524 C CG  . ARG A 358 ? 0.2217 0.4140 0.4575 -0.0508 -0.0307 0.1061  468 ARG A CG  
2525 C CD  . ARG A 358 ? 0.3931 0.6104 0.6525 -0.0590 -0.0367 0.1347  468 ARG A CD  
2526 N NE  . ARG A 358 ? 0.5408 0.7907 0.7958 -0.0639 -0.0381 0.1420  468 ARG A NE  
2527 C CZ  . ARG A 358 ? 0.6791 0.9605 0.9553 -0.0728 -0.0447 0.1700  468 ARG A CZ  
2528 N NH1 . ARG A 358 ? 0.5076 0.7897 0.8138 -0.0775 -0.0506 0.1929  468 ARG A NH1 
2529 N NH2 . ARG A 358 ? 0.4696 0.7845 0.7402 -0.0773 -0.0459 0.1769  468 ARG A NH2 
2530 N N   . LYS A 359 ? 0.2651 0.4781 0.4680 -0.0572 -0.0357 0.0775  469 LYS A N   
2531 C CA  . LYS A 359 ? 0.2757 0.4781 0.4793 -0.0571 -0.0381 0.0747  469 LYS A CA  
2532 C C   . LYS A 359 ? 0.3145 0.4781 0.5307 -0.0503 -0.0362 0.0808  469 LYS A C   
2533 O O   . LYS A 359 ? 0.3025 0.4609 0.5290 -0.0521 -0.0383 0.0933  469 LYS A O   
2534 C CB  . LYS A 359 ? 0.3199 0.5573 0.5258 -0.0676 -0.0430 0.0906  469 LYS A CB  
2535 C CG  . LYS A 359 ? 0.5751 0.8589 0.7668 -0.0745 -0.0447 0.0800  469 LYS A CG  
2536 C CD  . LYS A 359 ? 0.7630 1.0901 0.9577 -0.0869 -0.0497 0.0992  469 LYS A CD  
2537 C CE  . LYS A 359 ? 0.9356 1.3214 1.1188 -0.0955 -0.0510 0.0944  469 LYS A CE  
2538 N NZ  . LYS A 359 ? 1.0556 1.4531 1.2235 -0.0927 -0.0505 0.0588  469 LYS A NZ  
2539 N N   . MET A 360 ? 0.2642 0.4048 0.4803 -0.0429 -0.0320 0.0714  470 MET A N   
2540 C CA  . MET A 360 ? 0.2552 0.3660 0.4813 -0.0362 -0.0293 0.0721  470 MET A CA  
2541 C C   . MET A 360 ? 0.3060 0.3993 0.5240 -0.0303 -0.0277 0.0547  470 MET A C   
2542 O O   . MET A 360 ? 0.3043 0.4038 0.5128 -0.0302 -0.0281 0.0413  470 MET A O   
2543 C CB  . MET A 360 ? 0.2787 0.3830 0.5168 -0.0339 -0.0265 0.0787  470 MET A CB  
2544 C CG  . MET A 360 ? 0.3297 0.4463 0.5887 -0.0393 -0.0300 0.0999  470 MET A CG  
2545 S SD  . MET A 360 ? 0.3811 0.4905 0.6620 -0.0367 -0.0289 0.1063  470 MET A SD  
2546 C CE  . MET A 360 ? 0.3413 0.4749 0.6514 -0.0462 -0.0364 0.1356  470 MET A CE  
2547 N N   . MET A 361 ? 0.2636 0.3388 0.4886 -0.0258 -0.0267 0.0556  471 MET A N   
2548 C CA  . MET A 361 ? 0.2521 0.3145 0.4747 -0.0214 -0.0266 0.0445  471 MET A CA  
2549 C C   . MET A 361 ? 0.2742 0.3253 0.5020 -0.0165 -0.0219 0.0440  471 MET A C   
2550 O O   . MET A 361 ? 0.2723 0.3206 0.5097 -0.0149 -0.0202 0.0507  471 MET A O   
2551 C CB  . MET A 361 ? 0.2795 0.3390 0.5061 -0.0221 -0.0311 0.0475  471 MET A CB  
2552 C CG  . MET A 361 ? 0.3228 0.3964 0.5450 -0.0276 -0.0362 0.0466  471 MET A CG  
2553 S SD  . MET A 361 ? 0.3754 0.4445 0.6044 -0.0286 -0.0420 0.0525  471 MET A SD  
2554 C CE  . MET A 361 ? 0.3395 0.4000 0.5745 -0.0255 -0.0469 0.0371  471 MET A CE  
2555 N N   . LEU A 362 ? 0.2348 0.2825 0.4581 -0.0143 -0.0196 0.0352  472 LEU A N   
2556 C CA  . LEU A 362 ? 0.2332 0.2748 0.4601 -0.0105 -0.0149 0.0333  472 LEU A CA  
2557 C C   . LEU A 362 ? 0.2771 0.3153 0.5048 -0.0087 -0.0155 0.0285  472 LEU A C   
2558 O O   . LEU A 362 ? 0.2557 0.2932 0.4820 -0.0097 -0.0188 0.0229  472 LEU A O   
2559 C CB  . LEU A 362 ? 0.2300 0.2730 0.4531 -0.0106 -0.0119 0.0306  472 LEU A CB  
2560 C CG  . LEU A 362 ? 0.2722 0.3103 0.4980 -0.0072 -0.0072 0.0263  472 LEU A CG  
2561 C CD1 . LEU A 362 ? 0.2399 0.2779 0.4795 -0.0051 -0.0052 0.0291  472 LEU A CD1 
2562 C CD2 . LEU A 362 ? 0.3041 0.3434 0.5241 -0.0078 -0.0056 0.0235  472 LEU A CD2 
2563 N N   . ASP A 363 ? 0.2182 0.2583 0.4515 -0.0064 -0.0127 0.0303  473 ASP A N   
2564 C CA  . ASP A 363 ? 0.1948 0.2387 0.4321 -0.0060 -0.0134 0.0303  473 ASP A CA  
2565 C C   . ASP A 363 ? 0.2080 0.2613 0.4477 -0.0040 -0.0078 0.0290  473 ASP A C   
2566 O O   . ASP A 363 ? 0.2171 0.2696 0.4577 -0.0022 -0.0040 0.0254  473 ASP A O   
2567 C CB  . ASP A 363 ? 0.2217 0.2688 0.4674 -0.0074 -0.0197 0.0374  473 ASP A CB  
2568 C CG  . ASP A 363 ? 0.2951 0.3487 0.5444 -0.0067 -0.0194 0.0442  473 ASP A CG  
2569 O OD1 . ASP A 363 ? 0.3234 0.3786 0.5717 -0.0048 -0.0144 0.0420  473 ASP A OD1 
2570 O OD2 . ASP A 363 ? 0.4670 0.5242 0.7234 -0.0080 -0.0247 0.0516  473 ASP A OD2 
2571 N N   . ASN A 364 ? 0.1567 0.2221 0.4009 -0.0048 -0.0079 0.0318  474 ASN A N   
2572 C CA  . ASN A 364 ? 0.1538 0.2361 0.3998 -0.0037 -0.0025 0.0283  474 ASN A CA  
2573 C C   . ASN A 364 ? 0.2155 0.3103 0.4675 -0.0014 -0.0002 0.0267  474 ASN A C   
2574 O O   . ASN A 364 ? 0.2120 0.3234 0.4675 0.0002  0.0047  0.0188  474 ASN A O   
2575 C CB  . ASN A 364 ? 0.1016 0.2021 0.3529 -0.0069 -0.0044 0.0356  474 ASN A CB  
2576 C CG  . ASN A 364 ? 0.2548 0.3475 0.5046 -0.0087 -0.0050 0.0349  474 ASN A CG  
2577 O OD1 . ASN A 364 ? 0.1971 0.2706 0.4404 -0.0075 -0.0045 0.0286  474 ASN A OD1 
2578 N ND2 . ASN A 364 ? 0.1516 0.2624 0.4087 -0.0122 -0.0062 0.0424  474 ASN A ND2 
2579 N N   . HIS A 365 ? 0.1850 0.2754 0.4400 -0.0014 -0.0038 0.0332  475 HIS A N   
2580 C CA  . HIS A 365 ? 0.1896 0.2930 0.4527 0.0008  -0.0021 0.0325  475 HIS A CA  
2581 C C   . HIS A 365 ? 0.2274 0.3160 0.4959 0.0030  -0.0014 0.0293  475 HIS A C   
2582 O O   . HIS A 365 ? 0.2124 0.3109 0.4931 0.0060  0.0014  0.0238  475 HIS A O   
2583 C CB  . HIS A 365 ? 0.2150 0.3288 0.4815 -0.0013 -0.0075 0.0455  475 HIS A CB  
2584 C CG  . HIS A 365 ? 0.2752 0.3956 0.5426 -0.0053 -0.0126 0.0553  475 HIS A CG  
2585 N ND1 . HIS A 365 ? 0.3103 0.4110 0.5777 -0.0074 -0.0189 0.0598  475 HIS A ND1 
2586 C CD2 . HIS A 365 ? 0.3109 0.4582 0.5837 -0.0078 -0.0129 0.0614  475 HIS A CD2 
2587 C CE1 . HIS A 365 ? 0.3063 0.4184 0.5827 -0.0107 -0.0234 0.0684  475 HIS A CE1 
2588 N NE2 . HIS A 365 ? 0.3118 0.4526 0.5911 -0.0117 -0.0201 0.0719  475 HIS A NE2 
2589 N N   . ALA A 366 ? 0.1690 0.2384 0.4320 0.0011  -0.0044 0.0333  476 ALA A N   
2590 C CA  . ALA A 366 ? 0.1637 0.2247 0.4352 0.0013  -0.0053 0.0358  476 ALA A CA  
2591 C C   . ALA A 366 ? 0.2034 0.2524 0.4680 -0.0019 -0.0079 0.0396  476 ALA A C   
2592 O O   . ALA A 366 ? 0.1934 0.2391 0.4456 -0.0036 -0.0091 0.0382  476 ALA A O   
2593 C CB  . ALA A 366 ? 0.1748 0.2389 0.4508 0.0006  -0.0085 0.0446  476 ALA A CB  
2594 N N   . LEU A 367 ? 0.1695 0.2159 0.4457 -0.0031 -0.0093 0.0453  477 LEU A N   
2595 C CA  . LEU A 367 ? 0.1731 0.2175 0.4466 -0.0076 -0.0125 0.0530  477 LEU A CA  
2596 C C   . LEU A 367 ? 0.2244 0.2719 0.5068 -0.0109 -0.0165 0.0651  477 LEU A C   
2597 O O   . LEU A 367 ? 0.2058 0.2538 0.5092 -0.0095 -0.0164 0.0688  477 LEU A O   
2598 C CB  . LEU A 367 ? 0.1688 0.2124 0.4537 -0.0073 -0.0114 0.0524  477 LEU A CB  
2599 C CG  . LEU A 367 ? 0.2080 0.2577 0.4919 -0.0131 -0.0153 0.0636  477 LEU A CG  
2600 C CD1 . LEU A 367 ? 0.1728 0.2266 0.4316 -0.0156 -0.0157 0.0596  477 LEU A CD1 
2601 C CD2 . LEU A 367 ? 0.2097 0.2596 0.5105 -0.0128 -0.0154 0.0657  477 LEU A CD2 
2602 N N   . TYR A 368 ? 0.2024 0.2535 0.4711 -0.0155 -0.0202 0.0700  478 TYR A N   
2603 C CA  . TYR A 368 ? 0.1945 0.2512 0.4688 -0.0198 -0.0243 0.0822  478 TYR A CA  
2604 C C   . TYR A 368 ? 0.2204 0.2906 0.4909 -0.0269 -0.0278 0.0908  478 TYR A C   
2605 O O   . TYR A 368 ? 0.2136 0.2897 0.4675 -0.0287 -0.0282 0.0836  478 TYR A O   
2606 C CB  . TYR A 368 ? 0.1969 0.2516 0.4610 -0.0197 -0.0267 0.0805  478 TYR A CB  
2607 C CG  . TYR A 368 ? 0.2199 0.2810 0.4876 -0.0248 -0.0312 0.0926  478 TYR A CG  
2608 C CD1 . TYR A 368 ? 0.2434 0.3041 0.5292 -0.0243 -0.0312 0.1028  478 TYR A CD1 
2609 C CD2 . TYR A 368 ? 0.2325 0.3025 0.4877 -0.0303 -0.0357 0.0928  478 TYR A CD2 
2610 C CE1 . TYR A 368 ? 0.2437 0.3112 0.5339 -0.0297 -0.0355 0.1161  478 TYR A CE1 
2611 C CE2 . TYR A 368 ? 0.2505 0.3297 0.5085 -0.0359 -0.0400 0.1043  478 TYR A CE2 
2612 C CZ  . TYR A 368 ? 0.2954 0.3726 0.5703 -0.0360 -0.0399 0.1176  478 TYR A CZ  
2613 O OH  . TYR A 368 ? 0.1829 0.2694 0.4610 -0.0421 -0.0443 0.1304  478 TYR A OH  
2614 N N   . ASP A 369 ? 0.1641 0.2428 0.4525 -0.0314 -0.0307 0.1066  479 ASP A N   
2615 C CA  . ASP A 369 ? 0.1634 0.2637 0.4525 -0.0401 -0.0350 0.1203  479 ASP A CA  
2616 C C   . ASP A 369 ? 0.2154 0.3271 0.4964 -0.0458 -0.0389 0.1268  479 ASP A C   
2617 O O   . ASP A 369 ? 0.2030 0.3117 0.4990 -0.0467 -0.0407 0.1376  479 ASP A O   
2618 C CB  . ASP A 369 ? 0.1872 0.2925 0.5085 -0.0427 -0.0374 0.1374  479 ASP A CB  
2619 C CG  . ASP A 369 ? 0.2978 0.4316 0.6254 -0.0528 -0.0426 0.1566  479 ASP A CG  
2620 O OD1 . ASP A 369 ? 0.3311 0.4864 0.6413 -0.0597 -0.0451 0.1605  479 ASP A OD1 
2621 O OD2 . ASP A 369 ? 0.3477 0.4860 0.7012 -0.0544 -0.0451 0.1686  479 ASP A OD2 
2622 N N   . ARG A 370 ? 0.2019 0.3276 0.4612 -0.0494 -0.0404 0.1183  480 ARG A N   
2623 C CA  . ARG A 370 ? 0.2196 0.3587 0.4703 -0.0550 -0.0447 0.1203  480 ARG A CA  
2624 C C   . ARG A 370 ? 0.2881 0.4560 0.5499 -0.0657 -0.0492 0.1431  480 ARG A C   
2625 O O   . ARG A 370 ? 0.2916 0.4670 0.5533 -0.0703 -0.0526 0.1501  480 ARG A O   
2626 C CB  . ARG A 370 ? 0.2242 0.3739 0.4543 -0.0556 -0.0455 0.1005  480 ARG A CB  
2627 C CG  . ARG A 370 ? 0.3469 0.4708 0.5715 -0.0467 -0.0432 0.0815  480 ARG A CG  
2628 C CD  . ARG A 370 ? 0.3255 0.4601 0.5382 -0.0471 -0.0452 0.0611  480 ARG A CD  
2629 N NE  . ARG A 370 ? 0.3823 0.5337 0.5922 -0.0526 -0.0508 0.0574  480 ARG A NE  
2630 C CZ  . ARG A 370 ? 0.5320 0.7131 0.7337 -0.0578 -0.0533 0.0450  480 ARG A CZ  
2631 N NH1 . ARG A 370 ? 0.3254 0.5229 0.5261 -0.0628 -0.0586 0.0401  480 ARG A NH1 
2632 N NH2 . ARG A 370 ? 0.4095 0.6073 0.6046 -0.0582 -0.0504 0.0364  480 ARG A NH2 
2633 N N   . THR A 371 ? 0.2486 0.4344 0.5215 -0.0703 -0.0499 0.1563  481 THR A N   
2634 C CA  . THR A 371 ? 0.2539 0.4725 0.5427 -0.0819 -0.0553 0.1827  481 THR A CA  
2635 C C   . THR A 371 ? 0.3133 0.5158 0.6351 -0.0812 -0.0572 0.2020  481 THR A C   
2636 O O   . THR A 371 ? 0.2905 0.5069 0.6223 -0.0884 -0.0614 0.2191  481 THR A O   
2637 C CB  . THR A 371 ? 0.3050 0.5537 0.5975 -0.0880 -0.0568 0.1926  481 THR A CB  
2638 O OG1 . THR A 371 ? 0.3285 0.5917 0.5918 -0.0872 -0.0544 0.1708  481 THR A OG1 
2639 C CG2 . THR A 371 ? 0.2845 0.5772 0.5947 -0.1023 -0.0638 0.2237  481 THR A CG2 
2640 N N   . LYS A 372 ? 0.2817 0.4574 0.6224 -0.0727 -0.0542 0.1980  482 LYS A N   
2641 C CA  . LYS A 372 ? 0.2723 0.4327 0.6496 -0.0702 -0.0557 0.2104  482 LYS A CA  
2642 C C   . LYS A 372 ? 0.3201 0.4574 0.6908 -0.0632 -0.0525 0.1986  482 LYS A C   
2643 O O   . LYS A 372 ? 0.3181 0.4480 0.7172 -0.0623 -0.0540 0.2090  482 LYS A O   
2644 C CB  . LYS A 372 ? 0.3091 0.4536 0.7108 -0.0635 -0.0540 0.2057  482 LYS A CB  
2645 C CG  . LYS A 372 ? 0.4735 0.6420 0.8960 -0.0715 -0.0595 0.2257  482 LYS A CG  
2646 C CD  . LYS A 372 ? 0.5574 0.7087 1.0145 -0.0652 -0.0598 0.2231  482 LYS A CD  
2647 C CE  . LYS A 372 ? 0.6975 0.8729 1.1730 -0.0730 -0.0660 0.2430  482 LYS A CE  
2648 N NZ  . LYS A 372 ? 0.8206 0.9772 1.3266 -0.0659 -0.0663 0.2360  482 LYS A NZ  
2649 N N   . ARG A 373 ? 0.2592 0.3868 0.5960 -0.0585 -0.0489 0.1780  483 ARG A N   
2650 C CA  . ARG A 373 ? 0.2579 0.3675 0.5869 -0.0524 -0.0469 0.1683  483 ARG A CA  
2651 C C   . ARG A 373 ? 0.3055 0.3952 0.6551 -0.0429 -0.0427 0.1611  483 ARG A C   
2652 O O   . ARG A 373 ? 0.2979 0.3807 0.6591 -0.0399 -0.0423 0.1635  483 ARG A O   
2653 C CB  . ARG A 373 ? 0.2366 0.3564 0.5687 -0.0592 -0.0515 0.1837  483 ARG A CB  
2654 C CG  . ARG A 373 ? 0.2660 0.4046 0.5718 -0.0664 -0.0548 0.1809  483 ARG A CG  
2655 C CD  . ARG A 373 ? 0.2623 0.4159 0.5738 -0.0748 -0.0598 0.1987  483 ARG A CD  
2656 N NE  . ARG A 373 ? 0.2617 0.4333 0.5484 -0.0806 -0.0631 0.1905  483 ARG A NE  
2657 C CZ  . ARG A 373 ? 0.4749 0.6656 0.7601 -0.0894 -0.0680 0.2021  483 ARG A CZ  
2658 N NH1 . ARG A 373 ? 0.4013 0.5943 0.7085 -0.0937 -0.0702 0.2256  483 ARG A NH1 
2659 N NH2 . ARG A 373 ? 0.4042 0.6130 0.6687 -0.0940 -0.0712 0.1894  483 ARG A NH2 
2660 N N   . VAL A 374 ? 0.2616 0.3452 0.6155 -0.0381 -0.0394 0.1506  484 VAL A N   
2661 C CA  . VAL A 374 ? 0.2484 0.3189 0.6225 -0.0293 -0.0352 0.1394  484 VAL A CA  
2662 C C   . VAL A 374 ? 0.2590 0.3219 0.6148 -0.0232 -0.0302 0.1199  484 VAL A C   
2663 O O   . VAL A 374 ? 0.2439 0.3103 0.5831 -0.0259 -0.0304 0.1179  484 VAL A O   
2664 C CB  . VAL A 374 ? 0.2848 0.3570 0.7027 -0.0299 -0.0378 0.1494  484 VAL A CB  
2665 C CG1 . VAL A 374 ? 0.2819 0.3611 0.7262 -0.0354 -0.0429 0.1700  484 VAL A CG1 
2666 C CG2 . VAL A 374 ? 0.2819 0.3620 0.7050 -0.0345 -0.0405 0.1563  484 VAL A CG2 
2667 N N   . PHE A 375 ? 0.2234 0.2797 0.5843 -0.0153 -0.0256 0.1057  485 PHE A N   
2668 C CA  . PHE A 375 ? 0.2135 0.2662 0.5630 -0.0099 -0.0209 0.0885  485 PHE A CA  
2669 C C   . PHE A 375 ? 0.2325 0.2840 0.6087 -0.0081 -0.0204 0.0851  485 PHE A C   
2670 O O   . PHE A 375 ? 0.2129 0.2651 0.6229 -0.0071 -0.0223 0.0891  485 PHE A O   
2671 C CB  . PHE A 375 ? 0.2316 0.2868 0.5770 -0.0038 -0.0168 0.0765  485 PHE A CB  
2672 C CG  . PHE A 375 ? 0.2462 0.3022 0.5656 -0.0055 -0.0182 0.0788  485 PHE A CG  
2673 C CD1 . PHE A 375 ? 0.2837 0.3392 0.5837 -0.0048 -0.0169 0.0710  485 PHE A CD1 
2674 C CD2 . PHE A 375 ? 0.2499 0.3073 0.5686 -0.0079 -0.0217 0.0896  485 PHE A CD2 
2675 C CE1 . PHE A 375 ? 0.2877 0.3439 0.5726 -0.0064 -0.0200 0.0739  485 PHE A CE1 
2676 C CE2 . PHE A 375 ? 0.2811 0.3389 0.5818 -0.0094 -0.0246 0.0919  485 PHE A CE2 
2677 C CZ  . PHE A 375 ? 0.2770 0.3340 0.5631 -0.0087 -0.0242 0.0841  485 PHE A CZ  
2678 N N   . LEU A 376 ? 0.2075 0.2570 0.5728 -0.0079 -0.0190 0.0787  486 LEU A N   
2679 C CA  . LEU A 376 ? 0.1947 0.2426 0.5863 -0.0065 -0.0197 0.0761  486 LEU A CA  
2680 C C   . LEU A 376 ? 0.2428 0.2894 0.6376 0.0011  -0.0141 0.0541  486 LEU A C   
2681 O O   . LEU A 376 ? 0.2446 0.2922 0.6113 0.0027  -0.0100 0.0447  486 LEU A O   
2682 C CB  . LEU A 376 ? 0.1842 0.2346 0.5636 -0.0119 -0.0223 0.0850  486 LEU A CB  
2683 C CG  . LEU A 376 ? 0.2264 0.2880 0.6026 -0.0207 -0.0279 0.1065  486 LEU A CG  
2684 C CD1 . LEU A 376 ? 0.2160 0.2868 0.5736 -0.0254 -0.0291 0.1109  486 LEU A CD1 
2685 C CD2 . LEU A 376 ? 0.2269 0.2939 0.6455 -0.0243 -0.0340 0.1243  486 LEU A CD2 
2686 N N   . GLU A 377 ? 0.1667 0.2141 0.5993 0.0053  -0.0145 0.0457  487 GLU A N   
2687 C CA  . GLU A 377 ? 0.1603 0.2128 0.6014 0.0123  -0.0094 0.0217  487 GLU A CA  
2688 C C   . GLU A 377 ? 0.2160 0.2642 0.6617 0.0127  -0.0096 0.0151  487 GLU A C   
2689 O O   . GLU A 377 ? 0.1977 0.2396 0.6611 0.0089  -0.0153 0.0288  487 GLU A O   
2690 C CB  . GLU A 377 ? 0.1742 0.2324 0.6600 0.0174  -0.0101 0.0108  487 GLU A CB  
2691 C CG  . GLU A 377 ? 0.2850 0.3506 0.7662 0.0184  -0.0085 0.0136  487 GLU A CG  
2692 N N   . ALA A 378 ? 0.1646 0.2195 0.5972 0.0167  -0.0040 -0.0043 488 ALA A N   
2693 C CA  . ALA A 378 ? 0.1615 0.2134 0.5984 0.0176  -0.0037 -0.0130 488 ALA A CA  
2694 C C   . ALA A 378 ? 0.2347 0.3014 0.6787 0.0234  0.0018  -0.0400 488 ALA A C   
2695 O O   . ALA A 378 ? 0.2213 0.3030 0.6434 0.0245  0.0070  -0.0476 488 ALA A O   
2696 C CB  . ALA A 378 ? 0.1585 0.2048 0.5558 0.0132  -0.0026 -0.0027 488 ALA A CB  
2697 N N   . GLU A 379 ? 0.2286 0.2948 0.7049 0.0264  0.0000  -0.0539 489 GLU A N   
2698 C CA  . GLU A 379 ? 0.2264 0.3111 0.7114 0.0314  0.0049  -0.0829 489 GLU A CA  
2699 C C   . GLU A 379 ? 0.2490 0.3322 0.7105 0.0295  0.0071  -0.0857 489 GLU A C   
2700 O O   . GLU A 379 ? 0.2601 0.3621 0.7197 0.0319  0.0118  -0.1073 489 GLU A O   
2701 C CB  . GLU A 379 ? 0.2515 0.3386 0.7946 0.0368  0.0009  -0.1018 489 GLU A CB  
2702 C CG  . GLU A 379 ? 0.4298 0.5241 0.9993 0.0399  0.0001  -0.1052 489 GLU A CG  
2703 C CD  . GLU A 379 ? 0.7886 0.9142 1.3507 0.0445  0.0077  -0.1301 489 GLU A CD  
2704 O OE1 . GLU A 379 ? 0.7282 0.8721 1.3222 0.0501  0.0092  -0.1609 489 GLU A OE1 
2705 O OE2 . GLU A 379 ? 0.7735 0.9084 1.2999 0.0423  0.0117  -0.1194 489 GLU A OE2 
2706 N N   . SER A 380 ? 0.1552 0.2196 0.5999 0.0248  0.0038  -0.0641 490 SER A N   
2707 C CA  . SER A 380 ? 0.1282 0.1886 0.5519 0.0227  0.0052  -0.0635 490 SER A CA  
2708 C C   . SER A 380 ? 0.1853 0.2334 0.5761 0.0173  0.0041  -0.0398 490 SER A C   
2709 O O   . SER A 380 ? 0.1645 0.2065 0.5547 0.0148  0.0007  -0.0236 490 SER A O   
2710 C CB  . SER A 380 ? 0.1648 0.2171 0.6252 0.0241  -0.0001 -0.0692 490 SER A CB  
2711 O OG  . SER A 380 ? 0.2271 0.2654 0.7114 0.0215  -0.0081 -0.0481 490 SER A OG  
2712 N N   . GLU A 381 ? 0.1552 0.2014 0.5208 0.0153  0.0065  -0.0388 491 GLU A N   
2713 C CA  . GLU A 381 ? 0.1582 0.1955 0.4961 0.0109  0.0056  -0.0209 491 GLU A CA  
2714 C C   . GLU A 381 ? 0.2080 0.2367 0.5636 0.0083  -0.0011 -0.0049 491 GLU A C   
2715 O O   . GLU A 381 ? 0.1857 0.2134 0.5277 0.0045  -0.0034 0.0107  491 GLU A O   
2716 C CB  . GLU A 381 ? 0.1799 0.2183 0.4945 0.0099  0.0094  -0.0251 491 GLU A CB  
2717 C CG  . GLU A 381 ? 0.2090 0.2603 0.5033 0.0099  0.0148  -0.0328 491 GLU A CG  
2718 C CD  . GLU A 381 ? 0.4369 0.4904 0.7135 0.0081  0.0178  -0.0346 491 GLU A CD  
2719 O OE1 . GLU A 381 ? 0.3517 0.4039 0.6379 0.0090  0.0179  -0.0416 491 GLU A OE1 
2720 O OE2 . GLU A 381 ? 0.3604 0.4172 0.6169 0.0056  0.0193  -0.0286 491 GLU A OE2 
2721 N N   . GLU A 382 ? 0.1889 0.2149 0.5779 0.0099  -0.0051 -0.0086 492 GLU A N   
2722 C CA  . GLU A 382 ? 0.2002 0.2225 0.6156 0.0066  -0.0134 0.0098  492 GLU A CA  
2723 C C   . GLU A 382 ? 0.2290 0.2541 0.6577 0.0037  -0.0179 0.0256  492 GLU A C   
2724 O O   . GLU A 382 ? 0.2304 0.2602 0.6548 -0.0020 -0.0223 0.0471  492 GLU A O   
2725 C CB  . GLU A 382 ? 0.2203 0.2394 0.6814 0.0095  -0.0185 0.0006  492 GLU A CB  
2726 C CG  . GLU A 382 ? 0.2936 0.3107 0.7446 0.0108  -0.0160 -0.0100 492 GLU A CG  
2727 C CD  . GLU A 382 ? 0.4513 0.4745 0.8904 0.0152  -0.0083 -0.0373 492 GLU A CD  
2728 O OE1 . GLU A 382 ? 0.3563 0.3878 0.7829 0.0171  -0.0031 -0.0475 492 GLU A OE1 
2729 O OE2 . GLU A 382 ? 0.4050 0.4281 0.8469 0.0161  -0.0077 -0.0472 492 GLU A OE2 
2730 N N   . GLU A 383 ? 0.1584 0.1845 0.6022 0.0072  -0.0165 0.0151  493 GLU A N   
2731 C CA  . GLU A 383 ? 0.1446 0.1732 0.6007 0.0045  -0.0202 0.0294  493 GLU A CA  
2732 C C   . GLU A 383 ? 0.2101 0.2424 0.6231 0.0003  -0.0175 0.0408  493 GLU A C   
2733 O O   . GLU A 383 ? 0.2004 0.2381 0.6184 -0.0051 -0.0224 0.0602  493 GLU A O   
2734 C CB  . GLU A 383 ? 0.1614 0.1916 0.6414 0.0100  -0.0184 0.0129  493 GLU A CB  
2735 C CG  . GLU A 383 ? 0.2883 0.3168 0.8238 0.0139  -0.0235 0.0016  493 GLU A CG  
2736 C CD  . GLU A 383 ? 0.5798 0.6133 1.1482 0.0197  -0.0226 -0.0169 493 GLU A CD  
2737 O OE1 . GLU A 383 ? 0.6341 0.6661 1.2569 0.0228  -0.0284 -0.0259 493 GLU A OE1 
2738 O OE2 . GLU A 383 ? 0.3295 0.3696 0.8735 0.0211  -0.0168 -0.0220 493 GLU A OE2 
2739 N N   . ILE A 384 ? 0.1610 0.1927 0.5354 0.0020  -0.0107 0.0294  494 ILE A N   
2740 C CA  . ILE A 384 ? 0.1685 0.2029 0.5081 -0.0015 -0.0092 0.0368  494 ILE A CA  
2741 C C   . ILE A 384 ? 0.2106 0.2503 0.5410 -0.0069 -0.0126 0.0513  494 ILE A C   
2742 O O   . ILE A 384 ? 0.2231 0.2717 0.5458 -0.0117 -0.0156 0.0641  494 ILE A O   
2743 C CB  . ILE A 384 ? 0.2076 0.2413 0.5176 0.0011  -0.0029 0.0234  494 ILE A CB  
2744 C CG1 . ILE A 384 ? 0.2233 0.2609 0.5423 0.0054  0.0002  0.0110  494 ILE A CG1 
2745 C CG2 . ILE A 384 ? 0.2013 0.2367 0.4842 -0.0024 -0.0034 0.0301  494 ILE A CG2 
2746 C CD1 . ILE A 384 ? 0.3036 0.3475 0.6015 0.0069  0.0054  0.0003  494 ILE A CD1 
2747 N N   . PHE A 385 ? 0.1506 0.1886 0.4814 -0.0063 -0.0122 0.0489  495 PHE A N   
2748 C CA  . PHE A 385 ? 0.1595 0.2072 0.4828 -0.0112 -0.0153 0.0624  495 PHE A CA  
2749 C C   . PHE A 385 ? 0.2215 0.2818 0.5726 -0.0170 -0.0233 0.0844  495 PHE A C   
2750 O O   . PHE A 385 ? 0.2112 0.2893 0.5494 -0.0230 -0.0258 0.0977  495 PHE A O   
2751 C CB  . PHE A 385 ? 0.1801 0.2230 0.5053 -0.0093 -0.0142 0.0571  495 PHE A CB  
2752 C CG  . PHE A 385 ? 0.2003 0.2382 0.4934 -0.0067 -0.0074 0.0431  495 PHE A CG  
2753 C CD1 . PHE A 385 ? 0.2500 0.2794 0.5384 -0.0022 -0.0023 0.0266  495 PHE A CD1 
2754 C CD2 . PHE A 385 ? 0.2336 0.2790 0.5046 -0.0094 -0.0066 0.0469  495 PHE A CD2 
2755 C CE1 . PHE A 385 ? 0.2642 0.2916 0.5284 -0.0012 0.0027  0.0176  495 PHE A CE1 
2756 C CE2 . PHE A 385 ? 0.2622 0.3023 0.5102 -0.0071 -0.0012 0.0348  495 PHE A CE2 
2757 C CZ  . PHE A 385 ? 0.2382 0.2686 0.4840 -0.0035 0.0030  0.0219  495 PHE A CZ  
2758 N N   . ALA A 386 ? 0.1769 0.2316 0.5692 -0.0155 -0.0279 0.0876  496 ALA A N   
2759 C CA  . ALA A 386 ? 0.1836 0.2511 0.6116 -0.0217 -0.0371 0.1118  496 ALA A CA  
2760 C C   . ALA A 386 ? 0.2348 0.3130 0.6518 -0.0261 -0.0377 0.1217  496 ALA A C   
2761 O O   . ALA A 386 ? 0.2235 0.3239 0.6455 -0.0344 -0.0435 0.1446  496 ALA A O   
2762 C CB  . ALA A 386 ? 0.1899 0.2469 0.6704 -0.0182 -0.0422 0.1094  496 ALA A CB  
2763 N N   . HIS A 387 ? 0.1907 0.2574 0.5915 -0.0214 -0.0320 0.1057  497 HIS A N   
2764 C CA  . HIS A 387 ? 0.2037 0.2789 0.5922 -0.0253 -0.0326 0.1137  497 HIS A CA  
2765 C C   . HIS A 387 ? 0.2568 0.3498 0.6094 -0.0310 -0.0319 0.1190  497 HIS A C   
2766 O O   . HIS A 387 ? 0.2360 0.3471 0.5865 -0.0378 -0.0356 0.1332  497 HIS A O   
2767 C CB  . HIS A 387 ? 0.2139 0.2751 0.5888 -0.0191 -0.0267 0.0957  497 HIS A CB  
2768 C CG  . HIS A 387 ? 0.2571 0.3097 0.6668 -0.0146 -0.0275 0.0908  497 HIS A CG  
2769 N ND1 . HIS A 387 ? 0.2898 0.3483 0.7354 -0.0185 -0.0341 0.1081  497 HIS A ND1 
2770 C CD2 . HIS A 387 ? 0.2761 0.3190 0.6897 -0.0070 -0.0224 0.0700  497 HIS A CD2 
2771 C CE1 . HIS A 387 ? 0.2814 0.3307 0.7533 -0.0121 -0.0327 0.0950  497 HIS A CE1 
2772 N NE2 . HIS A 387 ? 0.2808 0.3229 0.7333 -0.0051 -0.0254 0.0710  497 HIS A NE2 
2773 N N   . LEU A 388 ? 0.2213 0.3111 0.5477 -0.0283 -0.0273 0.1059  498 LEU A N   
2774 C CA  . LEU A 388 ? 0.2339 0.3403 0.5289 -0.0319 -0.0260 0.1039  498 LEU A CA  
2775 C C   . LEU A 388 ? 0.2743 0.4083 0.5742 -0.0391 -0.0307 0.1212  498 LEU A C   
2776 O O   . LEU A 388 ? 0.2629 0.4195 0.5401 -0.0430 -0.0302 0.1199  498 LEU A O   
2777 C CB  . LEU A 388 ? 0.2393 0.3303 0.5094 -0.0257 -0.0195 0.0822  498 LEU A CB  
2778 C CG  . LEU A 388 ? 0.2957 0.3687 0.5556 -0.0204 -0.0155 0.0670  498 LEU A CG  
2779 C CD1 . LEU A 388 ? 0.2886 0.3499 0.5331 -0.0155 -0.0105 0.0512  498 LEU A CD1 
2780 C CD2 . LEU A 388 ? 0.3341 0.4159 0.5804 -0.0234 -0.0170 0.0667  498 LEU A CD2 
2781 N N   . GLY A 389 ? 0.2414 0.3766 0.5737 -0.0407 -0.0357 0.1368  499 GLY A N   
2782 C CA  . GLY A 389 ? 0.2459 0.4103 0.5889 -0.0482 -0.0415 0.1578  499 GLY A CA  
2783 C C   . GLY A 389 ? 0.2835 0.4470 0.6060 -0.0451 -0.0375 0.1469  499 GLY A C   
2784 O O   . GLY A 389 ? 0.2972 0.4916 0.6119 -0.0510 -0.0398 0.1582  499 GLY A O   
2785 N N   . LEU A 390 ? 0.1922 0.3242 0.5063 -0.0363 -0.0314 0.1253  500 LEU A N   
2786 C CA  . LEU A 390 ? 0.1736 0.3004 0.4703 -0.0329 -0.0271 0.1143  500 LEU A CA  
2787 C C   . LEU A 390 ? 0.2329 0.3447 0.5563 -0.0300 -0.0295 0.1174  500 LEU A C   
2788 O O   . LEU A 390 ? 0.2288 0.3212 0.5761 -0.0262 -0.0304 0.1124  500 LEU A O   
2789 C CB  . LEU A 390 ? 0.1642 0.2698 0.4326 -0.0261 -0.0189 0.0885  500 LEU A CB  
2790 C CG  . LEU A 390 ? 0.2228 0.3385 0.4652 -0.0272 -0.0164 0.0789  500 LEU A CG  
2791 C CD1 . LEU A 390 ? 0.1960 0.2875 0.4244 -0.0208 -0.0107 0.0583  500 LEU A CD1 
2792 C CD2 . LEU A 390 ? 0.2397 0.3804 0.4642 -0.0304 -0.0159 0.0777  500 LEU A CD2 
2793 N N   . ASP A 391 ? 0.2027 0.3239 0.5220 -0.0313 -0.0303 0.1225  501 ASP A N   
2794 C CA  . ASP A 391 ? 0.2027 0.3083 0.5436 -0.0281 -0.0322 0.1219  501 ASP A CA  
2795 C C   . ASP A 391 ? 0.2326 0.3100 0.5573 -0.0200 -0.0239 0.0950  501 ASP A C   
2796 O O   . ASP A 391 ? 0.2081 0.2833 0.4996 -0.0181 -0.0171 0.0813  501 ASP A O   
2797 C CB  . ASP A 391 ? 0.2362 0.3601 0.5695 -0.0313 -0.0339 0.1328  501 ASP A CB  
2798 C CG  . ASP A 391 ? 0.3677 0.5272 0.7219 -0.0405 -0.0434 0.1635  501 ASP A CG  
2799 O OD1 . ASP A 391 ? 0.3681 0.5314 0.7583 -0.0441 -0.0512 0.1803  501 ASP A OD1 
2800 O OD2 . ASP A 391 ? 0.4647 0.6514 0.8015 -0.0444 -0.0434 0.1717  501 ASP A OD2 
2801 N N   . TYR A 392 ? 0.1725 0.2322 0.5236 -0.0159 -0.0250 0.0873  502 TYR A N   
2802 C CA  . TYR A 392 ? 0.1715 0.2129 0.5093 -0.0095 -0.0176 0.0631  502 TYR A CA  
2803 C C   . TYR A 392 ? 0.2061 0.2448 0.5161 -0.0083 -0.0122 0.0553  502 TYR A C   
2804 O O   . TYR A 392 ? 0.2033 0.2458 0.5203 -0.0099 -0.0152 0.0638  502 TYR A O   
2805 C CB  . TYR A 392 ? 0.1811 0.2110 0.5556 -0.0056 -0.0202 0.0535  502 TYR A CB  
2806 C CG  . TYR A 392 ? 0.1961 0.2167 0.5564 -0.0002 -0.0124 0.0286  502 TYR A CG  
2807 C CD1 . TYR A 392 ? 0.1909 0.2120 0.5332 0.0013  -0.0073 0.0199  502 TYR A CD1 
2808 C CD2 . TYR A 392 ? 0.2057 0.2211 0.5715 0.0025  -0.0106 0.0154  502 TYR A CD2 
2809 C CE1 . TYR A 392 ? 0.1912 0.2113 0.5223 0.0049  -0.0009 0.0008  502 TYR A CE1 
2810 C CE2 . TYR A 392 ? 0.2095 0.2247 0.5624 0.0060  -0.0036 -0.0057 502 TYR A CE2 
2811 C CZ  . TYR A 392 ? 0.2818 0.3012 0.6185 0.0069  0.0011  -0.0120 502 TYR A CZ  
2812 O OH  . TYR A 392 ? 0.2675 0.2939 0.5933 0.0091  0.0072  -0.0291 502 TYR A OH  
2813 N N   . ILE A 393 ? 0.1663 0.2001 0.4479 -0.0061 -0.0051 0.0413  503 ILE A N   
2814 C CA  . ILE A 393 ? 0.1610 0.1917 0.4194 -0.0050 0.0002  0.0334  503 ILE A CA  
2815 C C   . ILE A 393 ? 0.2095 0.2302 0.4712 -0.0014 0.0043  0.0176  503 ILE A C   
2816 O O   . ILE A 393 ? 0.1924 0.2123 0.4520 0.0002  0.0068  0.0091  503 ILE A O   
2817 C CB  . ILE A 393 ? 0.1884 0.2249 0.4193 -0.0060 0.0036  0.0307  503 ILE A CB  
2818 C CG1 . ILE A 393 ? 0.1894 0.2443 0.4166 -0.0101 -0.0003 0.0430  503 ILE A CG1 
2819 C CG2 . ILE A 393 ? 0.1880 0.2207 0.4015 -0.0048 0.0083  0.0230  503 ILE A CG2 
2820 C CD1 . ILE A 393 ? 0.1806 0.2511 0.4130 -0.0134 -0.0041 0.0574  503 ILE A CD1 
2821 N N   . GLU A 394 ? 0.1786 0.1956 0.4463 -0.0006 0.0047  0.0141  504 GLU A N   
2822 C CA  . GLU A 394 ? 0.1936 0.2082 0.4638 0.0018  0.0087  -0.0019 504 GLU A CA  
2823 C C   . GLU A 394 ? 0.2360 0.2537 0.4804 0.0013  0.0149  -0.0081 504 GLU A C   
2824 O O   . GLU A 394 ? 0.2392 0.2565 0.4658 -0.0003 0.0159  -0.0015 504 GLU A O   
2825 C CB  . GLU A 394 ? 0.2197 0.2313 0.4993 0.0018  0.0073  -0.0031 504 GLU A CB  
2826 C CG  . GLU A 394 ? 0.3279 0.3371 0.6417 0.0019  -0.0009 0.0047  504 GLU A CG  
2827 C CD  . GLU A 394 ? 0.4706 0.4790 0.8189 0.0048  -0.0040 -0.0079 504 GLU A CD  
2828 O OE1 . GLU A 394 ? 0.3104 0.3234 0.6538 0.0071  0.0012  -0.0255 504 GLU A OE1 
2829 O OE2 . GLU A 394 ? 0.4674 0.4735 0.8514 0.0046  -0.0124 0.0005  504 GLU A OE2 
2830 N N   . PRO A 395 ? 0.1966 0.2212 0.4419 0.0022  0.0185  -0.0203 505 PRO A N   
2831 C CA  . PRO A 395 ? 0.1934 0.2248 0.4199 0.0003  0.0226  -0.0210 505 PRO A CA  
2832 C C   . PRO A 395 ? 0.2653 0.2937 0.4777 -0.0018 0.0245  -0.0161 505 PRO A C   
2833 O O   . PRO A 395 ? 0.2591 0.2869 0.4604 -0.0032 0.0250  -0.0110 505 PRO A O   
2834 C CB  . PRO A 395 ? 0.2062 0.2535 0.4402 0.0005  0.0255  -0.0337 505 PRO A CB  
2835 C CG  . PRO A 395 ? 0.2610 0.3073 0.5172 0.0038  0.0227  -0.0411 505 PRO A CG  
2836 C CD  . PRO A 395 ? 0.2114 0.2430 0.4782 0.0045  0.0183  -0.0341 505 PRO A CD  
2837 N N   . TRP A 396 ? 0.2254 0.2513 0.4416 -0.0019 0.0246  -0.0176 506 TRP A N   
2838 C CA  . TRP A 396 ? 0.2201 0.2432 0.4242 -0.0038 0.0264  -0.0124 506 TRP A CA  
2839 C C   . TRP A 396 ? 0.2226 0.2386 0.4193 -0.0035 0.0243  -0.0028 506 TRP A C   
2840 O O   . TRP A 396 ? 0.1986 0.2132 0.3860 -0.0046 0.0259  0.0007  506 TRP A O   
2841 C CB  . TRP A 396 ? 0.2232 0.2466 0.4340 -0.0042 0.0266  -0.0166 506 TRP A CB  
2842 C CG  . TRP A 396 ? 0.2517 0.2681 0.4807 -0.0020 0.0216  -0.0157 506 TRP A CG  
2843 C CD1 . TRP A 396 ? 0.2912 0.3009 0.5223 -0.0022 0.0181  -0.0044 506 TRP A CD1 
2844 C CD2 . TRP A 396 ? 0.2607 0.2792 0.5140 0.0002  0.0186  -0.0256 506 TRP A CD2 
2845 N NE1 . TRP A 396 ? 0.2997 0.3066 0.5569 -0.0009 0.0120  -0.0035 506 TRP A NE1 
2846 C CE2 . TRP A 396 ? 0.3182 0.3286 0.5912 0.0010  0.0122  -0.0179 506 TRP A CE2 
2847 C CE3 . TRP A 396 ? 0.2821 0.3115 0.5454 0.0015  0.0204  -0.0407 506 TRP A CE3 
2848 C CZ2 . TRP A 396 ? 0.3197 0.3290 0.6267 0.0032  0.0066  -0.0249 506 TRP A CZ2 
2849 C CZ3 . TRP A 396 ? 0.3180 0.3472 0.6119 0.0044  0.0160  -0.0507 506 TRP A CZ3 
2850 C CH2 . TRP A 396 ? 0.3308 0.3483 0.6485 0.0053  0.0088  -0.0429 506 TRP A CH2 
2851 N N   . GLU A 397 ? 0.1552 0.1704 0.3571 -0.0025 0.0209  0.0010  507 GLU A N   
2852 C CA  . GLU A 397 ? 0.1468 0.1644 0.3418 -0.0030 0.0188  0.0090  507 GLU A CA  
2853 C C   . GLU A 397 ? 0.1965 0.2171 0.3839 -0.0030 0.0191  0.0064  507 GLU A C   
2854 O O   . GLU A 397 ? 0.1793 0.2070 0.3621 -0.0036 0.0172  0.0096  507 GLU A O   
2855 C CB  . GLU A 397 ? 0.1621 0.1831 0.3712 -0.0034 0.0135  0.0181  507 GLU A CB  
2856 C CG  . GLU A 397 ? 0.2613 0.2798 0.4838 -0.0036 0.0108  0.0230  507 GLU A CG  
2857 C CD  . GLU A 397 ? 0.2472 0.2697 0.4940 -0.0046 0.0035  0.0342  507 GLU A CD  
2858 O OE1 . GLU A 397 ? 0.2533 0.2772 0.5099 -0.0045 0.0014  0.0345  507 GLU A OE1 
2859 O OE2 . GLU A 397 ? 0.2738 0.2991 0.5327 -0.0059 -0.0009 0.0447  507 GLU A OE2 
2860 N N   . ARG A 398 ? 0.1729 0.1918 0.3608 -0.0029 0.0209  0.0007  508 ARG A N   
2861 C CA  . ARG A 398 ? 0.1815 0.2022 0.3670 -0.0031 0.0198  -0.0011 508 ARG A CA  
2862 C C   . ARG A 398 ? 0.2074 0.2279 0.3912 -0.0040 0.0211  -0.0035 508 ARG A C   
2863 O O   . ARG A 398 ? 0.1762 0.1978 0.3647 -0.0045 0.0194  -0.0047 508 ARG A O   
2864 C CB  . ARG A 398 ? 0.1849 0.2069 0.3775 -0.0027 0.0192  -0.0025 508 ARG A CB  
2865 C CG  . ARG A 398 ? 0.2545 0.2762 0.4560 -0.0017 0.0171  -0.0004 508 ARG A CG  
2866 C CD  . ARG A 398 ? 0.2010 0.2255 0.4109 -0.0008 0.0170  -0.0037 508 ARG A CD  
2867 N NE  . ARG A 398 ? 0.2299 0.2538 0.4561 0.0006  0.0152  -0.0043 508 ARG A NE  
2868 C CZ  . ARG A 398 ? 0.2619 0.2902 0.5003 0.0023  0.0157  -0.0108 508 ARG A CZ  
2869 N NH1 . ARG A 398 ? 0.1634 0.1998 0.3962 0.0021  0.0181  -0.0149 508 ARG A NH1 
2870 N NH2 . ARG A 398 ? 0.1623 0.1894 0.4222 0.0040  0.0133  -0.0131 508 ARG A NH2 
2871 N N   . ASN A 399 ? 0.1916 0.2109 0.3722 -0.0044 0.0231  -0.0030 509 ASN A N   
2872 C CA  . ASN A 399 ? 0.1872 0.2063 0.3719 -0.0055 0.0236  -0.0039 509 ASN A CA  
2873 C C   . ASN A 399 ? 0.2174 0.2380 0.4040 -0.0040 0.0216  -0.0100 509 ASN A C   
2874 O O   . ASN A 399 ? 0.2202 0.2411 0.4096 -0.0037 0.0225  -0.0126 509 ASN A O   
2875 C CB  . ASN A 399 ? 0.1719 0.1901 0.3542 -0.0069 0.0267  -0.0007 509 ASN A CB  
2876 C CG  . ASN A 399 ? 0.2314 0.2543 0.4154 -0.0090 0.0283  0.0013  509 ASN A CG  
2877 O OD1 . ASN A 399 ? 0.1398 0.1705 0.3306 -0.0117 0.0279  0.0038  509 ASN A OD1 
2878 N ND2 . ASN A 399 ? 0.1552 0.1771 0.3360 -0.0082 0.0295  0.0000  509 ASN A ND2 
2879 N N   . ALA A 400 ? 0.1677 0.1916 0.3548 -0.0031 0.0188  -0.0139 510 ALA A N   
2880 C CA  . ALA A 400 ? 0.1823 0.2133 0.3720 -0.0017 0.0166  -0.0237 510 ALA A CA  
2881 C C   . ALA A 400 ? 0.2903 0.3182 0.4990 -0.0015 0.0139  -0.0305 510 ALA A C   
2882 O O   . ALA A 400 ? 0.2472 0.2695 0.4672 -0.0032 0.0118  -0.0244 510 ALA A O   
2883 C CB  . ALA A 400 ? 0.1795 0.2168 0.3657 -0.0018 0.0139  -0.0249 510 ALA A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   111 ?   ?   ?   A . n 
A 1 2   GLY 2   112 ?   ?   ?   A . n 
A 1 3   SER 3   113 ?   ?   ?   A . n 
A 1 4   SER 4   114 ?   ?   ?   A . n 
A 1 5   HIS 5   115 ?   ?   ?   A . n 
A 1 6   HIS 6   116 ?   ?   ?   A . n 
A 1 7   HIS 7   117 ?   ?   ?   A . n 
A 1 8   HIS 8   118 ?   ?   ?   A . n 
A 1 9   HIS 9   119 ?   ?   ?   A . n 
A 1 10  HIS 10  120 ?   ?   ?   A . n 
A 1 11  SER 11  121 ?   ?   ?   A . n 
A 1 12  SER 12  122 ?   ?   ?   A . n 
A 1 13  GLY 13  123 ?   ?   ?   A . n 
A 1 14  LEU 14  124 ?   ?   ?   A . n 
A 1 15  VAL 15  125 ?   ?   ?   A . n 
A 1 16  PRO 16  126 ?   ?   ?   A . n 
A 1 17  ARG 17  127 ?   ?   ?   A . n 
A 1 18  GLY 18  128 ?   ?   ?   A . n 
A 1 19  SER 19  129 ?   ?   ?   A . n 
A 1 20  HIS 20  130 ?   ?   ?   A . n 
A 1 21  MET 21  131 ?   ?   ?   A . n 
A 1 22  SER 22  132 ?   ?   ?   A . n 
A 1 23  PRO 23  133 ?   ?   ?   A . n 
A 1 24  SER 24  134 ?   ?   ?   A . n 
A 1 25  PRO 25  135 ?   ?   ?   A . n 
A 1 26  VAL 26  136 ?   ?   ?   A . n 
A 1 27  PRO 27  137 ?   ?   ?   A . n 
A 1 28  GLY 28  138 ?   ?   ?   A . n 
A 1 29  SER 29  139 ?   ?   ?   A . n 
A 1 30  GLN 30  140 ?   ?   ?   A . n 
A 1 31  ASN 31  141 ?   ?   ?   A . n 
A 1 32  VAL 32  142 ?   ?   ?   A . n 
A 1 33  PRO 33  143 ?   ?   ?   A . n 
A 1 34  ALA 34  144 ?   ?   ?   A . n 
A 1 35  PRO 35  145 ?   ?   ?   A . n 
A 1 36  ALA 36  146 ?   ?   ?   A . n 
A 1 37  VAL 37  147 ?   ?   ?   A . n 
A 1 38  LYS 38  148 ?   ?   ?   A . n 
A 1 39  LYS 39  149 149 LYS LYS A . n 
A 1 40  ILE 40  150 150 ILE ILE A . n 
A 1 41  SER 41  151 151 SER SER A . n 
A 1 42  GLN 42  152 152 GLN GLN A . n 
A 1 43  TYR 43  153 153 TYR TYR A . n 
A 1 44  ALA 44  154 154 ALA ALA A . n 
A 1 45  CYS 45  155 155 CYS CYS A . n 
A 1 46  GLN 46  156 156 GLN GLN A . n 
A 1 47  ARG 47  157 157 ARG ARG A . n 
A 1 48  ARG 48  158 158 ARG ARG A . n 
A 1 49  THR 49  159 159 THR THR A . n 
A 1 50  THR 50  160 160 THR THR A . n 
A 1 51  LEU 51  161 161 LEU LEU A . n 
A 1 52  ASN 52  162 162 ASN ASN A . n 
A 1 53  ASN 53  163 163 ASN ASN A . n 
A 1 54  TYR 54  164 164 TYR TYR A . n 
A 1 55  ASN 55  165 165 ASN ASN A . n 
A 1 56  GLN 56  166 166 GLN GLN A . n 
A 1 57  LEU 57  167 167 LEU LEU A . n 
A 1 58  PHE 58  168 168 PHE PHE A . n 
A 1 59  THR 59  169 169 THR THR A . n 
A 1 60  ASP 60  170 170 ASP ASP A . n 
A 1 61  ALA 61  171 171 ALA ALA A . n 
A 1 62  LEU 62  172 172 LEU LEU A . n 
A 1 63  ASP 63  173 173 ASP ASP A . n 
A 1 64  ILE 64  174 174 ILE ILE A . n 
A 1 65  LEU 65  175 175 LEU LEU A . n 
A 1 66  ALA 66  176 176 ALA ALA A . n 
A 1 67  GLU 67  177 177 GLU GLU A . n 
A 1 68  ASN 68  178 178 ASN ASN A . n 
A 1 69  ASP 69  179 179 ASP ASP A . n 
A 1 70  GLU 70  180 180 GLU GLU A . n 
A 1 71  LEU 71  181 181 LEU LEU A . n 
A 1 72  ARG 72  182 182 ARG ARG A . n 
A 1 73  GLU 73  183 183 GLU GLU A . n 
A 1 74  ASN 74  184 184 ASN ASN A . n 
A 1 75  GLU 75  185 185 GLU GLU A . n 
A 1 76  GLY 76  186 186 GLY GLY A . n 
A 1 77  SER 77  187 187 SER SER A . n 
A 1 78  CYS 78  188 188 CYS CYS A . n 
A 1 79  LEU 79  189 189 LEU LEU A . n 
A 1 80  ALA 80  190 190 ALA ALA A . n 
A 1 81  PHE 81  191 191 PHE PHE A . n 
A 1 82  MET 82  192 192 MET MET A . n 
A 1 83  ARG 83  193 193 ARG ARG A . n 
A 1 84  ALA 84  194 194 ALA ALA A . n 
A 1 85  SER 85  195 195 SER SER A . n 
A 1 86  SER 86  196 196 SER SER A . n 
A 1 87  VAL 87  197 197 VAL VAL A . n 
A 1 88  LEU 88  198 198 LEU LEU A . n 
A 1 89  LYS 89  199 199 LYS LYS A . n 
A 1 90  SER 90  200 200 SER SER A . n 
A 1 91  LEU 91  201 201 LEU LEU A . n 
A 1 92  PRO 92  202 202 PRO PRO A . n 
A 1 93  PHE 93  203 203 PHE PHE A . n 
A 1 94  PRO 94  204 204 PRO PRO A . n 
A 1 95  ILE 95  205 205 ILE ILE A . n 
A 1 96  THR 96  206 206 THR THR A . n 
A 1 97  SER 97  207 207 SER SER A . n 
A 1 98  MET 98  208 208 MET MET A . n 
A 1 99  LYS 99  209 209 LYS LYS A . n 
A 1 100 ASP 100 210 210 ASP ASP A . n 
A 1 101 THR 101 211 211 THR THR A . n 
A 1 102 GLU 102 212 212 GLU GLU A . n 
A 1 103 GLY 103 213 213 GLY GLY A . n 
A 1 104 ILE 104 214 214 ILE ILE A . n 
A 1 105 PRO 105 215 215 PRO PRO A . n 
A 1 106 CYS 106 216 216 CYS CYS A . n 
A 1 107 LEU 107 217 217 LEU LEU A . n 
A 1 108 GLY 108 218 218 GLY GLY A . n 
A 1 109 ASP 109 219 219 ASP ASP A . n 
A 1 110 LYS 110 220 220 LYS LYS A . n 
A 1 111 VAL 111 221 221 VAL VAL A . n 
A 1 112 LYS 112 222 222 LYS LYS A . n 
A 1 113 SER 113 223 223 SER SER A . n 
A 1 114 ILE 114 224 224 ILE ILE A . n 
A 1 115 ILE 115 225 225 ILE ILE A . n 
A 1 116 GLU 116 226 226 GLU GLU A . n 
A 1 117 GLY 117 227 227 GLY GLY A . n 
A 1 118 ILE 118 228 228 ILE ILE A . n 
A 1 119 ILE 119 229 229 ILE ILE A . n 
A 1 120 GLU 120 230 230 GLU GLU A . n 
A 1 121 ASP 121 231 231 ASP ASP A . n 
A 1 122 GLY 122 232 232 GLY GLY A . n 
A 1 123 GLU 123 233 233 GLU GLU A . n 
A 1 124 SER 124 234 234 SER SER A . n 
A 1 125 SER 125 235 235 SER SER A . n 
A 1 126 GLU 126 236 236 GLU GLU A . n 
A 1 127 ALA 127 237 237 ALA ALA A . n 
A 1 128 LYS 128 238 238 LYS LYS A . n 
A 1 129 ALA 129 239 239 ALA ALA A . n 
A 1 130 VAL 130 240 240 VAL VAL A . n 
A 1 131 LEU 131 241 241 LEU LEU A . n 
A 1 132 ASN 132 242 242 ASN ASN A . n 
A 1 133 ASP 133 243 243 ASP ASP A . n 
A 1 134 GLU 134 244 244 GLU GLU A . n 
A 1 135 ARG 135 245 245 ARG ARG A . n 
A 1 136 TYR 136 246 246 TYR TYR A . n 
A 1 137 LYS 137 247 247 LYS LYS A . n 
A 1 138 SER 138 248 248 SER SER A . n 
A 1 139 PHE 139 249 249 PHE PHE A . n 
A 1 140 LYS 140 250 250 LYS LYS A . n 
A 1 141 LEU 141 251 251 LEU LEU A . n 
A 1 142 PHE 142 252 252 PHE PHE A . n 
A 1 143 THR 143 253 253 THR THR A . n 
A 1 144 SER 144 254 254 SER SER A . n 
A 1 145 VAL 145 255 255 VAL VAL A . n 
A 1 146 PHE 146 256 256 PHE PHE A . n 
A 1 147 GLY 147 257 257 GLY GLY A . n 
A 1 148 VAL 148 258 258 VAL VAL A . n 
A 1 149 GLY 149 259 259 GLY GLY A . n 
A 1 150 LEU 150 260 260 LEU LEU A . n 
A 1 151 LYS 151 261 261 LYS LYS A . n 
A 1 152 THR 152 262 262 THR THR A . n 
A 1 153 ALA 153 263 263 ALA ALA A . n 
A 1 154 GLU 154 264 264 GLU GLU A . n 
A 1 155 LYS 155 265 265 LYS LYS A . n 
A 1 156 TRP 156 266 266 TRP TRP A . n 
A 1 157 PHE 157 267 267 PHE PHE A . n 
A 1 158 ARG 158 268 268 ARG ARG A . n 
A 1 159 MET 159 269 269 MET MET A . n 
A 1 160 GLY 160 270 270 GLY GLY A . n 
A 1 161 PHE 161 271 271 PHE PHE A . n 
A 1 162 ARG 162 272 272 ARG ARG A . n 
A 1 163 THR 163 273 273 THR THR A . n 
A 1 164 LEU 164 274 274 LEU LEU A . n 
A 1 165 SER 165 275 275 SER SER A . n 
A 1 166 LYS 166 276 276 LYS LYS A . n 
A 1 167 ILE 167 277 277 ILE ILE A . n 
A 1 168 GLN 168 278 278 GLN GLN A . n 
A 1 169 SER 169 279 279 SER SER A . n 
A 1 170 ASP 170 280 280 ASP ASP A . n 
A 1 171 LYS 171 281 281 LYS LYS A . n 
A 1 172 SER 172 282 282 SER SER A . n 
A 1 173 LEU 173 283 283 LEU LEU A . n 
A 1 174 ARG 174 284 284 ARG ARG A . n 
A 1 175 PHE 175 285 285 PHE PHE A . n 
A 1 176 THR 176 286 286 THR THR A . n 
A 1 177 GLN 177 287 287 GLN GLN A . n 
A 1 178 MET 178 288 288 MET MET A . n 
A 1 179 GLN 179 289 289 GLN GLN A . n 
A 1 180 LYS 180 290 290 LYS LYS A . n 
A 1 181 ALA 181 291 291 ALA ALA A . n 
A 1 182 GLY 182 292 292 GLY GLY A . n 
A 1 183 PHE 183 293 293 PHE PHE A . n 
A 1 184 LEU 184 294 294 LEU LEU A . n 
A 1 185 TYR 185 295 295 TYR TYR A . n 
A 1 186 TYR 186 296 296 TYR TYR A . n 
A 1 187 GLU 187 297 297 GLU GLU A . n 
A 1 188 ASP 188 298 298 ASP ASP A . n 
A 1 189 LEU 189 299 299 LEU LEU A . n 
A 1 190 VAL 190 300 300 VAL VAL A . n 
A 1 191 SER 191 301 301 SER SER A . n 
A 1 192 CYS 192 302 302 CYS CYS A . n 
A 1 193 VAL 193 303 303 VAL VAL A . n 
A 1 194 ASN 194 304 304 ASN ASN A . n 
A 1 195 ARG 195 305 305 ARG ARG A . n 
A 1 196 PRO 196 306 306 PRO PRO A . n 
A 1 197 GLU 197 307 307 GLU GLU A . n 
A 1 198 ALA 198 308 308 ALA ALA A . n 
A 1 199 GLU 199 309 309 GLU GLU A . n 
A 1 200 ALA 200 310 310 ALA ALA A . n 
A 1 201 VAL 201 311 311 VAL VAL A . n 
A 1 202 SER 202 312 312 SER SER A . n 
A 1 203 MET 203 313 313 MET MET A . n 
A 1 204 LEU 204 314 314 LEU LEU A . n 
A 1 205 VAL 205 315 315 VAL VAL A . n 
A 1 206 LYS 206 316 316 LYS LYS A . n 
A 1 207 GLU 207 317 317 GLU GLU A . n 
A 1 208 ALA 208 318 318 ALA ALA A . n 
A 1 209 VAL 209 319 319 VAL VAL A . n 
A 1 210 VAL 210 320 320 VAL VAL A . n 
A 1 211 THR 211 321 321 THR THR A . n 
A 1 212 PHE 212 322 322 PHE PHE A . n 
A 1 213 LEU 213 323 323 LEU LEU A . n 
A 1 214 PRO 214 324 324 PRO PRO A . n 
A 1 215 ASP 215 325 325 ASP ASP A . n 
A 1 216 ALA 216 326 326 ALA ALA A . n 
A 1 217 LEU 217 327 327 LEU LEU A . n 
A 1 218 VAL 218 328 328 VAL VAL A . n 
A 1 219 THR 219 329 329 THR THR A . n 
A 1 220 MET 220 330 330 MET MET A . n 
A 1 221 THR 221 331 331 THR THR A . n 
A 1 222 GLY 222 332 332 GLY GLY A . n 
A 1 223 GLY 223 333 333 GLY GLY A . n 
A 1 224 PHE 224 334 334 PHE PHE A . n 
A 1 225 ARG 225 335 335 ARG ARG A . n 
A 1 226 ARG 226 336 336 ARG ARG A . n 
A 1 227 GLY 227 337 337 GLY GLY A . n 
A 1 228 LYS 228 338 338 LYS LYS A . n 
A 1 229 MET 229 339 339 MET MET A . n 
A 1 230 THR 230 340 340 THR THR A . n 
A 1 231 GLY 231 341 341 GLY GLY A . n 
A 1 232 HIS 232 342 342 HIS HIS A . n 
A 1 233 ASP 233 343 343 ASP ASP A . n 
A 1 234 VAL 234 344 344 VAL VAL A . n 
A 1 235 ASP 235 345 345 ASP ASP A . n 
A 1 236 PHE 236 346 346 PHE PHE A . n 
A 1 237 LEU 237 347 347 LEU LEU A . n 
A 1 238 ILE 238 348 348 ILE ILE A . n 
A 1 239 THR 239 349 349 THR THR A . n 
A 1 240 SER 240 350 350 SER SER A . n 
A 1 241 PRO 241 351 351 PRO PRO A . n 
A 1 242 GLU 242 352 352 GLU GLU A . n 
A 1 243 ALA 243 353 353 ALA ALA A . n 
A 1 244 THR 244 354 354 THR THR A . n 
A 1 245 GLU 245 355 355 GLU GLU A . n 
A 1 246 ASP 246 356 356 ASP ASP A . n 
A 1 247 GLU 247 357 357 GLU GLU A . n 
A 1 248 GLU 248 358 358 GLU GLU A . n 
A 1 249 GLN 249 359 359 GLN GLN A . n 
A 1 250 GLN 250 360 360 GLN GLN A . n 
A 1 251 LEU 251 361 361 LEU LEU A . n 
A 1 252 LEU 252 362 362 LEU LEU A . n 
A 1 253 HIS 253 363 363 HIS HIS A . n 
A 1 254 LYS 254 364 364 LYS LYS A . n 
A 1 255 VAL 255 365 365 VAL VAL A . n 
A 1 256 THR 256 366 366 THR THR A . n 
A 1 257 ASP 257 367 367 ASP ASP A . n 
A 1 258 PHE 258 368 368 PHE PHE A . n 
A 1 259 TRP 259 369 369 TRP TRP A . n 
A 1 260 LYS 260 370 370 LYS LYS A . n 
A 1 261 GLN 261 371 371 GLN GLN A . n 
A 1 262 GLN 262 372 372 GLN GLN A . n 
A 1 263 GLY 263 373 373 GLY GLY A . n 
A 1 264 LEU 264 374 374 LEU LEU A . n 
A 1 265 LEU 265 375 375 LEU LEU A . n 
A 1 266 LEU 266 376 376 LEU LEU A . n 
A 1 267 TYR 267 377 377 TYR TYR A . n 
A 1 268 CYS 268 378 378 CYS CYS A . n 
A 1 269 ASP 269 379 379 ASP ASP A . n 
A 1 270 ILE 270 380 380 ILE ILE A . n 
A 1 271 LEU 271 381 381 LEU LEU A . n 
A 1 272 GLU 272 382 382 GLU GLU A . n 
A 1 273 SER 273 383 383 SER SER A . n 
A 1 274 THR 274 384 384 THR THR A . n 
A 1 275 PHE 275 385 385 PHE PHE A . n 
A 1 276 GLU 276 386 386 GLU GLU A . n 
A 1 277 LYS 277 387 387 LYS LYS A . n 
A 1 278 PHE 278 388 388 PHE PHE A . n 
A 1 279 LYS 279 389 389 LYS LYS A . n 
A 1 280 GLN 280 390 390 GLN GLN A . n 
A 1 281 PRO 281 391 391 PRO PRO A . n 
A 1 282 SER 282 392 392 SER SER A . n 
A 1 283 ARG 283 393 393 ARG ARG A . n 
A 1 284 LYS 284 394 394 LYS LYS A . n 
A 1 285 VAL 285 395 395 VAL VAL A . n 
A 1 286 ASP 286 396 396 ASP ASP A . n 
A 1 287 ALA 287 397 397 ALA ALA A . n 
A 1 288 LEU 288 398 398 LEU LEU A . n 
A 1 289 ASP 289 399 399 ASP ASP A . n 
A 1 290 HIS 290 400 400 HIS HIS A . n 
A 1 291 PHE 291 401 401 PHE PHE A . n 
A 1 292 GLN 292 402 402 GLN GLN A . n 
A 1 293 LYS 293 403 403 LYS LYS A . n 
A 1 294 CYS 294 404 404 CYS CYS A . n 
A 1 295 PHE 295 405 405 PHE PHE A . n 
A 1 296 LEU 296 406 406 LEU LEU A . n 
A 1 297 ILE 297 407 407 ILE ILE A . n 
A 1 298 LEU 298 408 408 LEU LEU A . n 
A 1 299 LYS 299 409 409 LYS LYS A . n 
A 1 300 LEU 300 410 410 LEU LEU A . n 
A 1 301 ASP 301 411 411 ASP ASP A . n 
A 1 302 HIS 302 412 412 HIS HIS A . n 
A 1 303 GLY 303 413 413 GLY GLY A . n 
A 1 304 ARG 304 414 414 ARG ARG A . n 
A 1 305 VAL 305 415 415 VAL VAL A . n 
A 1 306 HIS 306 416 416 HIS HIS A . n 
A 1 307 SER 307 417 417 SER SER A . n 
A 1 308 GLU 308 418 418 GLU GLU A . n 
A 1 309 LYS 309 419 419 LYS LYS A . n 
A 1 310 SER 310 420 ?   ?   ?   A . n 
A 1 311 GLY 311 421 ?   ?   ?   A . n 
A 1 312 GLN 312 422 ?   ?   ?   A . n 
A 1 313 GLN 313 423 423 GLN ALA A . n 
A 1 314 GLU 314 424 424 GLU ALA A . n 
A 1 315 GLY 315 425 425 GLY GLY A . n 
A 1 316 LYS 316 426 426 LYS LYS A . n 
A 1 317 GLY 317 427 427 GLY GLY A . n 
A 1 318 TRP 318 428 428 TRP TRP A . n 
A 1 319 LYS 319 429 429 LYS LYS A . n 
A 1 320 ALA 320 430 430 ALA ALA A . n 
A 1 321 ILE 321 431 431 ILE ILE A . n 
A 1 322 ARG 322 432 432 ARG ARG A . n 
A 1 323 VAL 323 433 433 VAL VAL A . n 
A 1 324 ASP 324 434 434 ASP ASP A . n 
A 1 325 LEU 325 435 435 LEU LEU A . n 
A 1 326 VAL 326 436 436 VAL VAL A . n 
A 1 327 MET 327 437 437 MET MET A . n 
A 1 328 CYS 328 438 438 CYS CYS A . n 
A 1 329 PRO 329 439 439 PRO PRO A . n 
A 1 330 TYR 330 440 440 TYR TYR A . n 
A 1 331 ASP 331 441 441 ASP ASP A . n 
A 1 332 ARG 332 442 442 ARG ARG A . n 
A 1 333 ARG 333 443 443 ARG ARG A . n 
A 1 334 ALA 334 444 444 ALA ALA A . n 
A 1 335 PHE 335 445 445 PHE PHE A . n 
A 1 336 ALA 336 446 446 ALA ALA A . n 
A 1 337 LEU 337 447 447 LEU LEU A . n 
A 1 338 LEU 338 448 448 LEU LEU A . n 
A 1 339 GLY 339 449 449 GLY GLY A . n 
A 1 340 TRP 340 450 450 TRP TRP A . n 
A 1 341 THR 341 451 451 THR THR A . n 
A 1 342 GLY 342 452 452 GLY GLY A . n 
A 1 343 SER 343 453 453 SER SER A . n 
A 1 344 ARG 344 454 454 ARG ARG A . n 
A 1 345 GLN 345 455 455 GLN GLN A . n 
A 1 346 PHE 346 456 456 PHE PHE A . n 
A 1 347 GLU 347 457 457 GLU GLU A . n 
A 1 348 ARG 348 458 458 ARG ARG A . n 
A 1 349 ASP 349 459 459 ASP ASP A . n 
A 1 350 LEU 350 460 460 LEU LEU A . n 
A 1 351 ARG 351 461 461 ARG ARG A . n 
A 1 352 ARG 352 462 462 ARG ARG A . n 
A 1 353 TYR 353 463 463 TYR TYR A . n 
A 1 354 ALA 354 464 464 ALA ALA A . n 
A 1 355 THR 355 465 465 THR THR A . n 
A 1 356 HIS 356 466 466 HIS HIS A . n 
A 1 357 GLU 357 467 467 GLU GLU A . n 
A 1 358 ARG 358 468 468 ARG ARG A . n 
A 1 359 LYS 359 469 469 LYS LYS A . n 
A 1 360 MET 360 470 470 MET MET A . n 
A 1 361 MET 361 471 471 MET MET A . n 
A 1 362 LEU 362 472 472 LEU LEU A . n 
A 1 363 ASP 363 473 473 ASP ASP A . n 
A 1 364 ASN 364 474 474 ASN ASN A . n 
A 1 365 HIS 365 475 475 HIS HIS A . n 
A 1 366 ALA 366 476 476 ALA ALA A . n 
A 1 367 LEU 367 477 477 LEU LEU A . n 
A 1 368 TYR 368 478 478 TYR TYR A . n 
A 1 369 ASP 369 479 479 ASP ASP A . n 
A 1 370 ARG 370 480 480 ARG ARG A . n 
A 1 371 THR 371 481 481 THR THR A . n 
A 1 372 LYS 372 482 482 LYS LYS A . n 
A 1 373 ARG 373 483 483 ARG ARG A . n 
A 1 374 VAL 374 484 484 VAL VAL A . n 
A 1 375 PHE 375 485 485 PHE PHE A . n 
A 1 376 LEU 376 486 486 LEU LEU A . n 
A 1 377 GLU 377 487 487 GLU GLU A . n 
A 1 378 ALA 378 488 488 ALA ALA A . n 
A 1 379 GLU 379 489 489 GLU GLU A . n 
A 1 380 SER 380 490 490 SER SER A . n 
A 1 381 GLU 381 491 491 GLU GLU A . n 
A 1 382 GLU 382 492 492 GLU GLU A . n 
A 1 383 GLU 383 493 493 GLU GLU A . n 
A 1 384 ILE 384 494 494 ILE ILE A . n 
A 1 385 PHE 385 495 495 PHE PHE A . n 
A 1 386 ALA 386 496 496 ALA ALA A . n 
A 1 387 HIS 387 497 497 HIS HIS A . n 
A 1 388 LEU 388 498 498 LEU LEU A . n 
A 1 389 GLY 389 499 499 GLY GLY A . n 
A 1 390 LEU 390 500 500 LEU LEU A . n 
A 1 391 ASP 391 501 501 ASP ASP A . n 
A 1 392 TYR 392 502 502 TYR TYR A . n 
A 1 393 ILE 393 503 503 ILE ILE A . n 
A 1 394 GLU 394 504 504 GLU GLU A . n 
A 1 395 PRO 395 505 505 PRO PRO A . n 
A 1 396 TRP 396 506 506 TRP TRP A . n 
A 1 397 GLU 397 507 507 GLU GLU A . n 
A 1 398 ARG 398 508 508 ARG ARG A . n 
A 1 399 ASN 399 509 509 ASN ASN A . n 
A 1 400 ALA 400 510 510 ALA ALA A . n 
B 2 1   DA  1   2   2   DA  DA  C . n 
B 2 2   DA  2   3   3   DA  DA  C . n 
B 2 3   DA  3   4   4   DA  DA  C . n 
B 2 4   DA  4   5   ?   ?   ?   C . n 
B 2 5   DA  5   6   ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NA  1   601  1   NA  NA  A . 
D 4 APC 1   602  1   APC APC A . 
E 5 MN  1   603  1   MN  MN  A . 
F 5 MN  1   604  2   MN  MN  A . 
G 6 HOH 1   701  1   HOH HOH A . 
G 6 HOH 2   702  2   HOH HOH A . 
G 6 HOH 3   703  3   HOH HOH A . 
G 6 HOH 4   704  4   HOH HOH A . 
G 6 HOH 5   705  5   HOH HOH A . 
G 6 HOH 6   706  6   HOH HOH A . 
G 6 HOH 7   707  7   HOH HOH A . 
G 6 HOH 8   708  8   HOH HOH A . 
G 6 HOH 9   709  9   HOH HOH A . 
G 6 HOH 10  710  10  HOH HOH A . 
G 6 HOH 11  711  11  HOH HOH A . 
G 6 HOH 12  712  12  HOH HOH A . 
G 6 HOH 13  713  13  HOH HOH A . 
G 6 HOH 14  714  14  HOH HOH A . 
G 6 HOH 15  715  15  HOH HOH A . 
G 6 HOH 16  716  16  HOH HOH A . 
G 6 HOH 17  717  17  HOH HOH A . 
G 6 HOH 18  718  18  HOH HOH A . 
G 6 HOH 19  719  19  HOH HOH A . 
G 6 HOH 20  720  20  HOH HOH A . 
G 6 HOH 21  721  21  HOH HOH A . 
G 6 HOH 22  722  22  HOH HOH A . 
G 6 HOH 23  723  23  HOH HOH A . 
G 6 HOH 24  724  24  HOH HOH A . 
G 6 HOH 25  725  25  HOH HOH A . 
G 6 HOH 26  726  26  HOH HOH A . 
G 6 HOH 27  727  27  HOH HOH A . 
G 6 HOH 28  728  28  HOH HOH A . 
G 6 HOH 29  729  29  HOH HOH A . 
G 6 HOH 30  730  30  HOH HOH A . 
G 6 HOH 31  731  31  HOH HOH A . 
G 6 HOH 32  732  32  HOH HOH A . 
G 6 HOH 33  733  33  HOH HOH A . 
G 6 HOH 34  734  34  HOH HOH A . 
G 6 HOH 35  735  35  HOH HOH A . 
G 6 HOH 36  736  36  HOH HOH A . 
G 6 HOH 37  737  37  HOH HOH A . 
G 6 HOH 38  738  38  HOH HOH A . 
G 6 HOH 39  739  39  HOH HOH A . 
G 6 HOH 40  740  40  HOH HOH A . 
G 6 HOH 41  741  41  HOH HOH A . 
G 6 HOH 42  742  42  HOH HOH A . 
G 6 HOH 43  743  43  HOH HOH A . 
G 6 HOH 44  744  44  HOH HOH A . 
G 6 HOH 45  745  45  HOH HOH A . 
G 6 HOH 46  746  46  HOH HOH A . 
G 6 HOH 47  747  47  HOH HOH A . 
G 6 HOH 48  748  48  HOH HOH A . 
G 6 HOH 49  749  49  HOH HOH A . 
G 6 HOH 50  750  50  HOH HOH A . 
G 6 HOH 51  751  51  HOH HOH A . 
G 6 HOH 52  752  52  HOH HOH A . 
G 6 HOH 53  753  53  HOH HOH A . 
G 6 HOH 54  754  54  HOH HOH A . 
G 6 HOH 55  755  55  HOH HOH A . 
G 6 HOH 56  756  56  HOH HOH A . 
G 6 HOH 57  757  57  HOH HOH A . 
G 6 HOH 58  758  58  HOH HOH A . 
G 6 HOH 59  759  59  HOH HOH A . 
G 6 HOH 60  760  60  HOH HOH A . 
G 6 HOH 61  761  61  HOH HOH A . 
G 6 HOH 62  762  62  HOH HOH A . 
G 6 HOH 63  763  63  HOH HOH A . 
G 6 HOH 64  764  64  HOH HOH A . 
G 6 HOH 65  765  65  HOH HOH A . 
G 6 HOH 66  766  66  HOH HOH A . 
G 6 HOH 67  767  67  HOH HOH A . 
G 6 HOH 68  768  68  HOH HOH A . 
G 6 HOH 69  769  69  HOH HOH A . 
G 6 HOH 70  770  70  HOH HOH A . 
G 6 HOH 71  771  71  HOH HOH A . 
G 6 HOH 72  772  72  HOH HOH A . 
G 6 HOH 73  773  73  HOH HOH A . 
G 6 HOH 74  774  74  HOH HOH A . 
G 6 HOH 75  775  75  HOH HOH A . 
G 6 HOH 76  776  76  HOH HOH A . 
G 6 HOH 77  777  77  HOH HOH A . 
G 6 HOH 78  778  78  HOH HOH A . 
G 6 HOH 79  779  79  HOH HOH A . 
G 6 HOH 80  780  80  HOH HOH A . 
G 6 HOH 81  781  81  HOH HOH A . 
G 6 HOH 82  782  82  HOH HOH A . 
G 6 HOH 83  783  83  HOH HOH A . 
G 6 HOH 84  784  84  HOH HOH A . 
G 6 HOH 85  785  85  HOH HOH A . 
G 6 HOH 86  786  86  HOH HOH A . 
G 6 HOH 87  787  87  HOH HOH A . 
G 6 HOH 88  788  88  HOH HOH A . 
G 6 HOH 89  789  89  HOH HOH A . 
G 6 HOH 90  790  90  HOH HOH A . 
G 6 HOH 91  791  91  HOH HOH A . 
G 6 HOH 92  792  92  HOH HOH A . 
G 6 HOH 93  793  93  HOH HOH A . 
G 6 HOH 94  794  94  HOH HOH A . 
G 6 HOH 95  795  95  HOH HOH A . 
G 6 HOH 96  796  96  HOH HOH A . 
G 6 HOH 97  797  97  HOH HOH A . 
G 6 HOH 98  798  98  HOH HOH A . 
G 6 HOH 99  799  99  HOH HOH A . 
G 6 HOH 100 800  100 HOH HOH A . 
G 6 HOH 101 801  101 HOH HOH A . 
G 6 HOH 102 802  102 HOH HOH A . 
G 6 HOH 103 803  104 HOH HOH A . 
G 6 HOH 104 804  105 HOH HOH A . 
G 6 HOH 105 805  106 HOH HOH A . 
G 6 HOH 106 806  107 HOH HOH A . 
G 6 HOH 107 807  108 HOH HOH A . 
G 6 HOH 108 808  109 HOH HOH A . 
G 6 HOH 109 809  110 HOH HOH A . 
G 6 HOH 110 810  111 HOH HOH A . 
G 6 HOH 111 811  112 HOH HOH A . 
G 6 HOH 112 812  113 HOH HOH A . 
G 6 HOH 113 813  114 HOH HOH A . 
G 6 HOH 114 814  115 HOH HOH A . 
G 6 HOH 115 815  116 HOH HOH A . 
G 6 HOH 116 816  117 HOH HOH A . 
G 6 HOH 117 817  118 HOH HOH A . 
G 6 HOH 118 818  119 HOH HOH A . 
G 6 HOH 119 819  120 HOH HOH A . 
G 6 HOH 120 820  121 HOH HOH A . 
G 6 HOH 121 821  122 HOH HOH A . 
G 6 HOH 122 822  123 HOH HOH A . 
G 6 HOH 123 823  124 HOH HOH A . 
G 6 HOH 124 824  125 HOH HOH A . 
G 6 HOH 125 825  126 HOH HOH A . 
G 6 HOH 126 826  127 HOH HOH A . 
G 6 HOH 127 827  128 HOH HOH A . 
G 6 HOH 128 828  129 HOH HOH A . 
G 6 HOH 129 829  130 HOH HOH A . 
G 6 HOH 130 830  131 HOH HOH A . 
G 6 HOH 131 831  132 HOH HOH A . 
G 6 HOH 132 832  133 HOH HOH A . 
G 6 HOH 133 833  134 HOH HOH A . 
G 6 HOH 134 834  135 HOH HOH A . 
G 6 HOH 135 835  136 HOH HOH A . 
G 6 HOH 136 836  137 HOH HOH A . 
G 6 HOH 137 837  138 HOH HOH A . 
G 6 HOH 138 838  139 HOH HOH A . 
G 6 HOH 139 839  140 HOH HOH A . 
G 6 HOH 140 840  141 HOH HOH A . 
G 6 HOH 141 841  142 HOH HOH A . 
G 6 HOH 142 842  143 HOH HOH A . 
G 6 HOH 143 843  144 HOH HOH A . 
G 6 HOH 144 844  145 HOH HOH A . 
G 6 HOH 145 845  146 HOH HOH A . 
G 6 HOH 146 846  147 HOH HOH A . 
G 6 HOH 147 847  148 HOH HOH A . 
G 6 HOH 148 848  149 HOH HOH A . 
G 6 HOH 149 849  150 HOH HOH A . 
G 6 HOH 150 850  151 HOH HOH A . 
G 6 HOH 151 851  152 HOH HOH A . 
G 6 HOH 152 852  153 HOH HOH A . 
G 6 HOH 153 853  154 HOH HOH A . 
G 6 HOH 154 854  155 HOH HOH A . 
G 6 HOH 155 855  156 HOH HOH A . 
G 6 HOH 156 856  157 HOH HOH A . 
G 6 HOH 157 857  158 HOH HOH A . 
G 6 HOH 158 858  159 HOH HOH A . 
G 6 HOH 159 859  160 HOH HOH A . 
G 6 HOH 160 860  161 HOH HOH A . 
G 6 HOH 161 861  162 HOH HOH A . 
G 6 HOH 162 862  163 HOH HOH A . 
G 6 HOH 163 863  164 HOH HOH A . 
G 6 HOH 164 864  165 HOH HOH A . 
G 6 HOH 165 865  166 HOH HOH A . 
G 6 HOH 166 866  167 HOH HOH A . 
G 6 HOH 167 867  168 HOH HOH A . 
G 6 HOH 168 868  169 HOH HOH A . 
G 6 HOH 169 869  170 HOH HOH A . 
G 6 HOH 170 870  171 HOH HOH A . 
G 6 HOH 171 871  172 HOH HOH A . 
G 6 HOH 172 872  173 HOH HOH A . 
G 6 HOH 173 873  174 HOH HOH A . 
G 6 HOH 174 874  175 HOH HOH A . 
G 6 HOH 175 875  176 HOH HOH A . 
G 6 HOH 176 876  177 HOH HOH A . 
G 6 HOH 177 877  178 HOH HOH A . 
G 6 HOH 178 878  179 HOH HOH A . 
G 6 HOH 179 879  180 HOH HOH A . 
G 6 HOH 180 880  181 HOH HOH A . 
G 6 HOH 181 881  182 HOH HOH A . 
G 6 HOH 182 882  183 HOH HOH A . 
G 6 HOH 183 883  184 HOH HOH A . 
G 6 HOH 184 884  185 HOH HOH A . 
G 6 HOH 185 885  186 HOH HOH A . 
G 6 HOH 186 886  187 HOH HOH A . 
G 6 HOH 187 887  188 HOH HOH A . 
G 6 HOH 188 888  189 HOH HOH A . 
G 6 HOH 189 889  190 HOH HOH A . 
G 6 HOH 190 890  191 HOH HOH A . 
G 6 HOH 191 891  192 HOH HOH A . 
G 6 HOH 192 892  193 HOH HOH A . 
G 6 HOH 193 893  194 HOH HOH A . 
G 6 HOH 194 894  195 HOH HOH A . 
G 6 HOH 195 895  196 HOH HOH A . 
G 6 HOH 196 896  197 HOH HOH A . 
G 6 HOH 197 897  198 HOH HOH A . 
G 6 HOH 198 898  199 HOH HOH A . 
G 6 HOH 199 899  200 HOH HOH A . 
G 6 HOH 200 900  201 HOH HOH A . 
G 6 HOH 201 901  202 HOH HOH A . 
G 6 HOH 202 902  203 HOH HOH A . 
G 6 HOH 203 903  204 HOH HOH A . 
G 6 HOH 204 904  205 HOH HOH A . 
G 6 HOH 205 905  206 HOH HOH A . 
G 6 HOH 206 906  207 HOH HOH A . 
G 6 HOH 207 907  208 HOH HOH A . 
G 6 HOH 208 908  209 HOH HOH A . 
G 6 HOH 209 909  210 HOH HOH A . 
G 6 HOH 210 910  211 HOH HOH A . 
G 6 HOH 211 911  212 HOH HOH A . 
G 6 HOH 212 912  213 HOH HOH A . 
G 6 HOH 213 913  214 HOH HOH A . 
G 6 HOH 214 914  215 HOH HOH A . 
G 6 HOH 215 915  216 HOH HOH A . 
G 6 HOH 216 916  217 HOH HOH A . 
G 6 HOH 217 917  218 HOH HOH A . 
G 6 HOH 218 918  219 HOH HOH A . 
G 6 HOH 219 919  220 HOH HOH A . 
G 6 HOH 220 920  221 HOH HOH A . 
G 6 HOH 221 921  222 HOH HOH A . 
G 6 HOH 222 922  223 HOH HOH A . 
G 6 HOH 223 923  224 HOH HOH A . 
G 6 HOH 224 924  225 HOH HOH A . 
G 6 HOH 225 925  226 HOH HOH A . 
G 6 HOH 226 926  227 HOH HOH A . 
G 6 HOH 227 927  228 HOH HOH A . 
G 6 HOH 228 928  229 HOH HOH A . 
G 6 HOH 229 929  230 HOH HOH A . 
G 6 HOH 230 930  231 HOH HOH A . 
G 6 HOH 231 931  232 HOH HOH A . 
G 6 HOH 232 932  233 HOH HOH A . 
G 6 HOH 233 933  234 HOH HOH A . 
G 6 HOH 234 934  235 HOH HOH A . 
G 6 HOH 235 935  236 HOH HOH A . 
G 6 HOH 236 936  237 HOH HOH A . 
G 6 HOH 237 937  238 HOH HOH A . 
G 6 HOH 238 938  239 HOH HOH A . 
G 6 HOH 239 939  240 HOH HOH A . 
G 6 HOH 240 940  241 HOH HOH A . 
G 6 HOH 241 941  242 HOH HOH A . 
G 6 HOH 242 942  243 HOH HOH A . 
G 6 HOH 243 943  244 HOH HOH A . 
G 6 HOH 244 944  245 HOH HOH A . 
G 6 HOH 245 945  246 HOH HOH A . 
G 6 HOH 246 946  247 HOH HOH A . 
G 6 HOH 247 947  248 HOH HOH A . 
G 6 HOH 248 948  249 HOH HOH A . 
G 6 HOH 249 949  250 HOH HOH A . 
G 6 HOH 250 950  251 HOH HOH A . 
G 6 HOH 251 951  252 HOH HOH A . 
G 6 HOH 252 952  253 HOH HOH A . 
G 6 HOH 253 953  254 HOH HOH A . 
G 6 HOH 254 954  255 HOH HOH A . 
G 6 HOH 255 955  256 HOH HOH A . 
G 6 HOH 256 956  257 HOH HOH A . 
G 6 HOH 257 957  258 HOH HOH A . 
G 6 HOH 258 958  259 HOH HOH A . 
G 6 HOH 259 959  260 HOH HOH A . 
G 6 HOH 260 960  261 HOH HOH A . 
G 6 HOH 261 961  262 HOH HOH A . 
G 6 HOH 262 962  263 HOH HOH A . 
G 6 HOH 263 963  264 HOH HOH A . 
G 6 HOH 264 964  265 HOH HOH A . 
G 6 HOH 265 965  266 HOH HOH A . 
G 6 HOH 266 966  267 HOH HOH A . 
G 6 HOH 267 967  268 HOH HOH A . 
G 6 HOH 268 968  269 HOH HOH A . 
G 6 HOH 269 969  270 HOH HOH A . 
G 6 HOH 270 970  271 HOH HOH A . 
G 6 HOH 271 971  272 HOH HOH A . 
G 6 HOH 272 972  273 HOH HOH A . 
G 6 HOH 273 973  274 HOH HOH A . 
G 6 HOH 274 974  275 HOH HOH A . 
G 6 HOH 275 975  276 HOH HOH A . 
G 6 HOH 276 976  277 HOH HOH A . 
G 6 HOH 277 977  278 HOH HOH A . 
G 6 HOH 278 978  279 HOH HOH A . 
G 6 HOH 279 979  280 HOH HOH A . 
G 6 HOH 280 980  281 HOH HOH A . 
G 6 HOH 281 981  282 HOH HOH A . 
G 6 HOH 282 982  283 HOH HOH A . 
G 6 HOH 283 983  284 HOH HOH A . 
G 6 HOH 284 984  285 HOH HOH A . 
G 6 HOH 285 985  286 HOH HOH A . 
G 6 HOH 286 986  287 HOH HOH A . 
G 6 HOH 287 987  288 HOH HOH A . 
G 6 HOH 288 988  289 HOH HOH A . 
G 6 HOH 289 989  290 HOH HOH A . 
G 6 HOH 290 990  291 HOH HOH A . 
G 6 HOH 291 991  292 HOH HOH A . 
G 6 HOH 292 992  294 HOH HOH A . 
G 6 HOH 293 993  295 HOH HOH A . 
G 6 HOH 294 994  296 HOH HOH A . 
G 6 HOH 295 995  297 HOH HOH A . 
G 6 HOH 296 996  298 HOH HOH A . 
G 6 HOH 297 997  299 HOH HOH A . 
G 6 HOH 298 998  300 HOH HOH A . 
G 6 HOH 299 999  301 HOH HOH A . 
G 6 HOH 300 1000 302 HOH HOH A . 
G 6 HOH 301 1001 303 HOH HOH A . 
G 6 HOH 302 1002 304 HOH HOH A . 
G 6 HOH 303 1003 305 HOH HOH A . 
G 6 HOH 304 1004 306 HOH HOH A . 
G 6 HOH 305 1005 307 HOH HOH A . 
G 6 HOH 306 1006 308 HOH HOH A . 
G 6 HOH 307 1007 309 HOH HOH A . 
G 6 HOH 308 1008 310 HOH HOH A . 
G 6 HOH 309 1009 311 HOH HOH A . 
G 6 HOH 310 1010 312 HOH HOH A . 
G 6 HOH 311 1011 313 HOH HOH A . 
G 6 HOH 312 1012 314 HOH HOH A . 
G 6 HOH 313 1013 315 HOH HOH A . 
G 6 HOH 314 1014 316 HOH HOH A . 
G 6 HOH 315 1015 317 HOH HOH A . 
G 6 HOH 316 1016 318 HOH HOH A . 
G 6 HOH 317 1017 319 HOH HOH A . 
G 6 HOH 318 1018 320 HOH HOH A . 
G 6 HOH 319 1019 321 HOH HOH A . 
G 6 HOH 320 1020 322 HOH HOH A . 
G 6 HOH 321 1021 323 HOH HOH A . 
G 6 HOH 322 1022 324 HOH HOH A . 
G 6 HOH 323 1023 325 HOH HOH A . 
G 6 HOH 324 1024 326 HOH HOH A . 
G 6 HOH 325 1025 327 HOH HOH A . 
G 6 HOH 326 1026 328 HOH HOH A . 
G 6 HOH 327 1027 329 HOH HOH A . 
G 6 HOH 328 1028 330 HOH HOH A . 
G 6 HOH 329 1029 331 HOH HOH A . 
G 6 HOH 330 1030 332 HOH HOH A . 
G 6 HOH 331 1031 333 HOH HOH A . 
G 6 HOH 332 1032 334 HOH HOH A . 
G 6 HOH 333 1033 335 HOH HOH A . 
G 6 HOH 334 1034 336 HOH HOH A . 
G 6 HOH 335 1035 337 HOH HOH A . 
G 6 HOH 336 1036 338 HOH HOH A . 
G 6 HOH 337 1037 339 HOH HOH A . 
G 6 HOH 338 1038 340 HOH HOH A . 
G 6 HOH 339 1039 341 HOH HOH A . 
G 6 HOH 340 1040 342 HOH HOH A . 
G 6 HOH 341 1041 343 HOH HOH A . 
G 6 HOH 342 1042 344 HOH HOH A . 
G 6 HOH 343 1043 345 HOH HOH A . 
G 6 HOH 344 1044 346 HOH HOH A . 
G 6 HOH 345 1045 347 HOH HOH A . 
G 6 HOH 346 1046 348 HOH HOH A . 
G 6 HOH 347 1047 349 HOH HOH A . 
H 6 HOH 1   101  103 HOH HOH C . 
H 6 HOH 2   102  293 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 OD1 ? A ASP 235 ? A ASP 345 ? 1_555 93.2  ? 
2  OD2 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 88.0  ? 
3  OD1 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 91.3  ? 
4  OD2 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 N7  ? D APC .   ? A APC 602 ? 1_555 164.2 ? 
5  OD1 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 N7  ? D APC .   ? A APC 602 ? 1_555 102.6 ? 
6  OD2 ? A ASP 324 ? A ASP 434 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 N7  ? D APC .   ? A APC 602 ? 1_555 91.9  ? 
7  OD2 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 99.3  ? 
8  OD1 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 104.1 ? 
9  OD2 ? A ASP 324 ? A ASP 434 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 162.5 ? 
10 N7  ? D APC .   ? A APC 602 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 76.8  ? 
11 OD2 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O   ? G HOH .   ? A HOH 962 ? 1_555 87.3  ? 
12 OD1 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O   ? G HOH .   ? A HOH 962 ? 1_555 171.8 ? 
13 OD2 ? A ASP 324 ? A ASP 434 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O   ? G HOH .   ? A HOH 962 ? 1_555 96.9  ? 
14 N7  ? D APC .   ? A APC 602 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O   ? G HOH .   ? A HOH 962 ? 1_555 77.1  ? 
15 O1A ? D APC .   ? A APC 602 ? 1_555 MN ? E MN . ? A MN 603 ? 1_555 O   ? G HOH .   ? A HOH 962 ? 1_555 67.8  ? 
16 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O1B ? D APC .   ? A APC 602 ? 1_555 170.5 ? 
17 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 91.6  ? 
18 O1B ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 95.5  ? 
19 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O2G ? D APC .   ? A APC 602 ? 1_555 83.0  ? 
20 O1B ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O2G ? D APC .   ? A APC 602 ? 1_555 90.2  ? 
21 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O2G ? D APC .   ? A APC 602 ? 1_555 173.8 ? 
22 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 97.1  ? 
23 O1B ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 90.3  ? 
24 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 80.3  ? 
25 O2G ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O1A ? D APC .   ? A APC 602 ? 1_555 97.4  ? 
26 OD1 ? A ASP 233 ? A ASP 343 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O   ? G HOH .   ? A HOH 981 ? 1_555 79.3  ? 
27 O1B ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O   ? G HOH .   ? A HOH 981 ? 1_555 93.8  ? 
28 OD2 ? A ASP 235 ? A ASP 345 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O   ? G HOH .   ? A HOH 981 ? 1_555 94.6  ? 
29 O2G ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O   ? G HOH .   ? A HOH 981 ? 1_555 87.3  ? 
30 O1A ? D APC .   ? A APC 602 ? 1_555 MN ? F MN . ? A MN 604 ? 1_555 O   ? G HOH .   ? A HOH 981 ? 1_555 173.7 ? 
31 OP2 ? B DA  3   ? C DA  4   ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? A THR 143 ? A THR 253 ? 1_555 168.2 ? 
32 OP2 ? B DA  3   ? C DA  4   ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? A VAL 148 ? A VAL 258 ? 1_555 89.2  ? 
33 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? A VAL 148 ? A VAL 258 ? 1_555 102.5 ? 
34 OP2 ? B DA  3   ? C DA  4   ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? A VAL 145 ? A VAL 255 ? 1_555 95.5  ? 
35 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? A VAL 145 ? A VAL 255 ? 1_555 85.7  ? 
36 O   ? A VAL 148 ? A VAL 258 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? A VAL 145 ? A VAL 255 ? 1_555 94.1  ? 
37 OP2 ? B DA  3   ? C DA  4   ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? H HOH .   ? C HOH 101 ? 1_555 85.0  ? 
38 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? H HOH .   ? C HOH 101 ? 1_555 95.3  ? 
39 O   ? A VAL 148 ? A VAL 258 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? H HOH .   ? C HOH 101 ? 1_555 78.9  ? 
40 O   ? A VAL 145 ? A VAL 255 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? H HOH .   ? C HOH 101 ? 1_555 173.0 ? 
41 OP2 ? B DA  3   ? C DA  4   ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? G HOH .   ? A HOH 922 ? 1_555 91.3  ? 
42 O   ? A THR 143 ? A THR 253 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? G HOH .   ? A HOH 922 ? 1_555 77.4  ? 
43 O   ? A VAL 148 ? A VAL 258 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? G HOH .   ? A HOH 922 ? 1_555 172.2 ? 
44 O   ? A VAL 145 ? A VAL 255 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? G HOH .   ? A HOH 922 ? 1_555 78.1  ? 
45 O   ? H HOH .   ? C HOH 101 ? 1_555 NA ? C NA . ? A NA 601 ? 1_555 O   ? G HOH .   ? A HOH 922 ? 1_555 108.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-07-24 
2 'Structure model' 1 1 2013-07-31 
3 'Structure model' 1 2 2013-11-13 
4 'Structure model' 1 3 2017-07-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
4 4 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -27.4928 12.5425 -6.2396  -0.0927 -0.0777 0.0186 0.0052  0.0136  -0.0197 2.6652 2.3216 1.1581 
-0.1213 -0.1735 -0.3443 0.0528  -0.0114 -0.0413 -0.1398 0.1368  0.0282  0.1290  -0.1693 0.0014  
'X-RAY DIFFRACTION' 2 ? refined -18.5277 28.0866 -29.1113 -0.0186 -0.0595 0.1618 0.0116  0.0016  0.0388  1.1247 3.3748 1.4844 
-0.5257 -0.4586 0.6558  -0.0596 0.0445  0.0151  -0.0365 -0.0648 -0.0783 0.1468  0.1355  0.2028  
'X-RAY DIFFRACTION' 3 ? refined -8.5869  4.2204  -31.4225 -0.1062 -0.1206 0.0800 0.0075  0.0465  -0.0227 1.4969 1.3874 1.2970 
-0.0285 0.3895  -0.8071 -0.0413 -0.0476 0.0888  0.1490  0.0118  -0.2131 -0.2156 0.0739  0.1313  
'X-RAY DIFFRACTION' 4 ? refined -6.9984  -1.1530 -9.2088  -0.1168 -0.0685 0.1176 -0.0110 -0.0068 0.0373  4.6704 0.1637 0.2154 
0.5825  0.9097  -0.3822 0.0756  -0.1175 0.0420  -0.3298 -0.3370 -0.1464 0.0768  -0.0145 -0.0122 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 149 A 243 '{A|149 - 243}' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 244 A 302 '{A|244 - 302}' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 303 A 452 '{A|303 - 452}' ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 453 A 510 '{A|453 - 510}' ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum ? 1 
PHASER phasing           .       ? 2 
BUSTER refinement        2.11.2  ? 3 
XDS    'data reduction'  .       ? 4 
SCALA  'data scaling'    .       ? 5 
# 
_pdbx_entry_details.entry_id             4I2C 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'PROTEIN FRAGMENT IS THE CATALYTIC CORE OF THE TDT-S (TDT-SMALL) ISOFORM (UNP RESIDUES 132-482, 503-530).' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 331 ? ? -115.13 -152.19 
2 1 ASN A 509 ? ? -83.44  46.44   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 149 ? CG  ? A LYS 39  CG  
2  1 Y 1 A LYS 149 ? CD  ? A LYS 39  CD  
3  1 Y 1 A LYS 149 ? CE  ? A LYS 39  CE  
4  1 Y 1 A LYS 149 ? NZ  ? A LYS 39  NZ  
5  1 Y 1 A ARG 182 ? NE  ? A ARG 72  NE  
6  1 Y 1 A ARG 182 ? CZ  ? A ARG 72  CZ  
7  1 Y 1 A ARG 182 ? NH1 ? A ARG 72  NH1 
8  1 Y 1 A ARG 182 ? NH2 ? A ARG 72  NH2 
9  1 Y 1 A LYS 209 ? CE  ? A LYS 99  CE  
10 1 Y 1 A LYS 209 ? NZ  ? A LYS 99  NZ  
11 1 Y 1 A LYS 238 ? CE  ? A LYS 128 CE  
12 1 Y 1 A LYS 238 ? NZ  ? A LYS 128 NZ  
13 1 Y 1 A GLU 355 ? CG  ? A GLU 245 CG  
14 1 Y 1 A GLU 355 ? CD  ? A GLU 245 CD  
15 1 Y 1 A GLU 355 ? OE1 ? A GLU 245 OE1 
16 1 Y 1 A GLU 355 ? OE2 ? A GLU 245 OE2 
17 1 Y 1 A VAL 395 ? CG1 ? A VAL 285 CG1 
18 1 Y 1 A VAL 395 ? CG2 ? A VAL 285 CG2 
19 1 Y 1 A ASP 396 ? CG  ? A ASP 286 CG  
20 1 Y 1 A ASP 396 ? OD1 ? A ASP 286 OD1 
21 1 Y 1 A ASP 396 ? OD2 ? A ASP 286 OD2 
22 1 Y 1 A LEU 398 ? CG  ? A LEU 288 CG  
23 1 Y 1 A LEU 398 ? CD1 ? A LEU 288 CD1 
24 1 Y 1 A LEU 398 ? CD2 ? A LEU 288 CD2 
25 1 Y 1 A GLN 423 ? CG  ? A GLN 313 CG  
26 1 Y 1 A GLN 423 ? CD  ? A GLN 313 CD  
27 1 Y 1 A GLN 423 ? OE1 ? A GLN 313 OE1 
28 1 Y 1 A GLN 423 ? NE2 ? A GLN 313 NE2 
29 1 Y 1 A GLU 424 ? CG  ? A GLU 314 CG  
30 1 Y 1 A GLU 424 ? CD  ? A GLU 314 CD  
31 1 Y 1 A GLU 424 ? OE1 ? A GLU 314 OE1 
32 1 Y 1 A GLU 424 ? OE2 ? A GLU 314 OE2 
33 1 Y 1 A ARG 454 ? CG  ? A ARG 344 CG  
34 1 Y 1 A ARG 454 ? CD  ? A ARG 344 CD  
35 1 Y 1 A ARG 454 ? NE  ? A ARG 344 NE  
36 1 Y 1 A ARG 454 ? CZ  ? A ARG 344 CZ  
37 1 Y 1 A ARG 454 ? NH1 ? A ARG 344 NH1 
38 1 Y 1 A ARG 454 ? NH2 ? A ARG 344 NH2 
39 1 Y 1 A GLU 487 ? CD  ? A GLU 377 CD  
40 1 Y 1 A GLU 487 ? OE1 ? A GLU 377 OE1 
41 1 Y 1 A GLU 487 ? OE2 ? A GLU 377 OE2 
42 1 Y 1 C DA  2   ? C8  ? B DA  1   C8  
43 1 Y 1 C DA  2   ? N7  ? B DA  1   N7  
44 1 Y 1 C DA  2   ? C5  ? B DA  1   C5  
45 1 Y 1 C DA  2   ? C6  ? B DA  1   C6  
46 1 Y 1 C DA  2   ? N6  ? B DA  1   N6  
47 1 Y 1 C DA  2   ? N1  ? B DA  1   N1  
48 1 Y 1 C DA  2   ? C2  ? B DA  1   C2  
49 1 Y 1 C DA  2   ? N3  ? B DA  1   N3  
50 1 Y 1 C DA  2   ? C4  ? B DA  1   C4  
51 1 Y 1 C DA  3   ? C8  ? B DA  2   C8  
52 1 Y 1 C DA  3   ? N7  ? B DA  2   N7  
53 1 Y 1 C DA  3   ? C5  ? B DA  2   C5  
54 1 Y 1 C DA  3   ? C6  ? B DA  2   C6  
55 1 Y 1 C DA  3   ? N6  ? B DA  2   N6  
56 1 Y 1 C DA  3   ? N1  ? B DA  2   N1  
57 1 Y 1 C DA  3   ? C2  ? B DA  2   C2  
58 1 Y 1 C DA  3   ? N3  ? B DA  2   N3  
59 1 Y 1 C DA  3   ? C4  ? B DA  2   C4  
60 1 Y 1 C DA  4   ? C8  ? B DA  3   C8  
61 1 Y 1 C DA  4   ? N7  ? B DA  3   N7  
62 1 Y 1 C DA  4   ? C5  ? B DA  3   C5  
63 1 Y 1 C DA  4   ? C6  ? B DA  3   C6  
64 1 Y 1 C DA  4   ? N6  ? B DA  3   N6  
65 1 Y 1 C DA  4   ? N1  ? B DA  3   N1  
66 1 Y 1 C DA  4   ? C2  ? B DA  3   C2  
67 1 Y 1 C DA  4   ? N3  ? B DA  3   N3  
68 1 Y 1 C DA  4   ? C4  ? B DA  3   C4  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 111 ? A MET 1   
2  1 Y 1 A GLY 112 ? A GLY 2   
3  1 Y 1 A SER 113 ? A SER 3   
4  1 Y 1 A SER 114 ? A SER 4   
5  1 Y 1 A HIS 115 ? A HIS 5   
6  1 Y 1 A HIS 116 ? A HIS 6   
7  1 Y 1 A HIS 117 ? A HIS 7   
8  1 Y 1 A HIS 118 ? A HIS 8   
9  1 Y 1 A HIS 119 ? A HIS 9   
10 1 Y 1 A HIS 120 ? A HIS 10  
11 1 Y 1 A SER 121 ? A SER 11  
12 1 Y 1 A SER 122 ? A SER 12  
13 1 Y 1 A GLY 123 ? A GLY 13  
14 1 Y 1 A LEU 124 ? A LEU 14  
15 1 Y 1 A VAL 125 ? A VAL 15  
16 1 Y 1 A PRO 126 ? A PRO 16  
17 1 Y 1 A ARG 127 ? A ARG 17  
18 1 Y 1 A GLY 128 ? A GLY 18  
19 1 Y 1 A SER 129 ? A SER 19  
20 1 Y 1 A HIS 130 ? A HIS 20  
21 1 Y 1 A MET 131 ? A MET 21  
22 1 Y 1 A SER 132 ? A SER 22  
23 1 Y 1 A PRO 133 ? A PRO 23  
24 1 Y 1 A SER 134 ? A SER 24  
25 1 Y 1 A PRO 135 ? A PRO 25  
26 1 Y 1 A VAL 136 ? A VAL 26  
27 1 Y 1 A PRO 137 ? A PRO 27  
28 1 Y 1 A GLY 138 ? A GLY 28  
29 1 Y 1 A SER 139 ? A SER 29  
30 1 Y 1 A GLN 140 ? A GLN 30  
31 1 Y 1 A ASN 141 ? A ASN 31  
32 1 Y 1 A VAL 142 ? A VAL 32  
33 1 Y 1 A PRO 143 ? A PRO 33  
34 1 Y 1 A ALA 144 ? A ALA 34  
35 1 Y 1 A PRO 145 ? A PRO 35  
36 1 Y 1 A ALA 146 ? A ALA 36  
37 1 Y 1 A VAL 147 ? A VAL 37  
38 1 Y 1 A LYS 148 ? A LYS 38  
39 1 Y 1 A SER 420 ? A SER 310 
40 1 Y 1 A GLY 421 ? A GLY 311 
41 1 Y 1 A GLN 422 ? A GLN 312 
42 1 Y 1 C DA  5   ? B DA  4   
43 1 Y 1 C DA  6   ? B DA  5   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SODIUM ION'                                    NA  
4 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' APC 
5 'MANGANESE (II) ION'                            MN  
6 water                                           HOH 
#