data_4I6U
# 
_entry.id   4I6U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4I6U         
RCSB  RCSB076377   
WWPDB D_1000076377 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4FN3 'S52A Mutant Free Protein'             unspecified 
PDB 4FBI 'R46A Mutant Free Protein'             unspecified 
PDB 4F8D 'R46A Mutant Free Protein'             unspecified 
PDB 3G5G 'Native Free Protein'                  unspecified 
PDB 3FYA 'R35A Mutant Free Protein'             unspecified 
PDB 3CLC 'DNA Bound Tetramer'                   unspecified 
PDB 3S8Q 'DNA Bound Dimer (OL)'                 unspecified 
PDB 3UFD 'DNA Bound Dimer (OM)'                 unspecified 
PDB 4I6R 'Native Free Protein (Triclinic Form)' unspecified 
PDB 4I6T 'T36A Mutant Free Protein'             unspecified 
# 
_pdbx_database_status.entry_id                        4I6U 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-30 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Martin, R.N.A.' 1 
'McGeehan, J.E.' 2 
'Kneale, G.G.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.' 'Plos One'                 9  e98365 e98365 
2014 ?      US 1932-6203 ?    ? 24887147 10.1371/journal.pone.0098365 
1       'Structure of the restriction-modification controller protein C.Esp1396I.' 'Acta Crystallogr.,Sect.D' 65 900    905    
2009 ABCRE6 DK 0907-4449 0766 ? 19690367 10.1107/S0907444909020514    
2       
'Recognition of dual symmetry by the controller protein C.Esp1396I based on the structure of the transcriptional activation complex.' 
'Nucleic Acids Res.'       40 4158   4167   2012 NARHAD UK 0305-1048 0389 ? 22210861 10.1093/nar/gkr1250          
3       'The structural basis of differential DNA sequence recognition by restriction-modification controller proteins.' 
'Nucleic Acids Res.'       40 10532  10542  2012 NARHAD UK 0305-1048 0389 ? 22941636 10.1093/nar/gks718           
4       'Structure of the restriction-modification controller protein C.Esp1396I.' 'Acta Crystallogr.,Sect.D' 65 900    905    
2009 ABCRE6 DK 0907-4449 0766 ? 19690367 10.1107/S0907444909020514    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Martin, R.N.'   1  
primary 'McGeehan, J.E.' 2  
primary 'Kneale, G.'     3  
1       'Ball, N.'       4  
1       'Streeter, S.D.' 5  
1       'Kneale, G.G.'   6  
1       'McGeehan, J.E.' 7  
2       'McGeehan, J.E.' 8  
2       'Ball, N.J.'     9  
2       'Streeter, S.D.' 10 
2       'Thresh, S.J.'   11 
2       'Kneale, G.G.'   12 
3       'Ball, N.J.'     13 
3       'McGeehan, J.E.' 14 
3       'Streeter, S.D.' 15 
3       'Thresh, S.J.'   16 
3       'Kneale, G.G.'   17 
4       'Ball, N.'       18 
4       'Streeter, S.D.' 19 
4       'Kneale, G.G.'   20 
4       'McGeehan, J.E.' 21 
# 
_cell.length_a           48.610 
_cell.length_b           81.850 
_cell.length_c           135.080 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4I6U 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4I6U 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Regulatory protein'    9505.175 6   ? Y37F ? ? 
2 non-polymer syn 'SODIUM ION'            22.990   1   ? ?    ? ? 
3 non-polymer syn 'ACETATE ION'           59.044   3   ? ?    ? ? 
4 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120  2   ? ?    ? ? 
5 non-polymer syn GLYCEROL                92.094   2   ? ?    ? ? 
6 water       nat water                   18.015   147 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  GLU n 
1 6  SER n 
1 7  PHE n 
1 8  LEU n 
1 9  LEU n 
1 10 SER n 
1 11 LYS n 
1 12 VAL n 
1 13 SER n 
1 14 PHE n 
1 15 VAL n 
1 16 ILE n 
1 17 LYS n 
1 18 LYS n 
1 19 ILE n 
1 20 ARG n 
1 21 LEU n 
1 22 GLU n 
1 23 LYS n 
1 24 GLY n 
1 25 MET n 
1 26 THR n 
1 27 GLN n 
1 28 GLU n 
1 29 ASP n 
1 30 LEU n 
1 31 ALA n 
1 32 TYR n 
1 33 LYS n 
1 34 SER n 
1 35 ASN n 
1 36 LEU n 
1 37 ASP n 
1 38 ARG n 
1 39 THR n 
1 40 PHE n 
1 41 ILE n 
1 42 SER n 
1 43 GLY n 
1 44 ILE n 
1 45 GLU n 
1 46 ARG n 
1 47 ASN n 
1 48 SER n 
1 49 ARG n 
1 50 ASN n 
1 51 LEU n 
1 52 THR n 
1 53 ILE n 
1 54 LYS n 
1 55 SER n 
1 56 LEU n 
1 57 GLU n 
1 58 LEU n 
1 59 ILE n 
1 60 MET n 
1 61 LYS n 
1 62 GLY n 
1 63 LEU n 
1 64 GLU n 
1 65 VAL n 
1 66 SER n 
1 67 ASP n 
1 68 VAL n 
1 69 VAL n 
1 70 PHE n 
1 71 PHE n 
1 72 GLU n 
1 73 MET n 
1 74 LEU n 
1 75 ILE n 
1 76 LYS n 
1 77 GLU n 
1 78 ILE n 
1 79 LEU n 
1 80 LYS n 
1 81 HIS n 
1 82 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 esp1396IC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    RFL1396 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacter sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     211595 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8GGH0_9ENTR 
_struct_ref.pdbx_db_accession          Q8GGH0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4I6U A 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
2 1 4I6U B 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
3 1 4I6U C 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
4 1 4I6U D 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
5 1 4I6U E 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
6 1 4I6U F 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4I6U GLY A 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 1  
1 4I6U SER A 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 2  
1 4I6U HIS A 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  3  
1 4I6U PHE A 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 4  
2 4I6U GLY B 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 5  
2 4I6U SER B 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 6  
2 4I6U HIS B 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  7  
2 4I6U PHE B 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 8  
3 4I6U GLY C 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 9  
3 4I6U SER C 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 10 
3 4I6U HIS C 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  11 
3 4I6U PHE C 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 12 
4 4I6U GLY D 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 13 
4 4I6U SER D 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 14 
4 4I6U HIS D 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  15 
4 4I6U PHE D 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 16 
5 4I6U GLY E 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 17 
5 4I6U SER E 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 18 
5 4I6U HIS E 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  19 
5 4I6U PHE E 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 20 
6 4I6U GLY F 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 21 
6 4I6U SER F 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 22 
6 4I6U HIS F 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  23 
6 4I6U PHE F 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'           ?                               'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE                 ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                               'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE               ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE               ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                               'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'            ?                               'Na 1'           22.990  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                               'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ?                               'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE                  ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                               'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4I6U 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.36 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
;0.1 M sodium sulphate, 0.2 M sodium acetate, 0.1 M Bis Tris propane, 20 % w/v PEG 3350, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M' 
_diffrn_detector.pdbx_collection_date   2012-09-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111) double crystal monochromator' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_wavelength_list        0.92 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
# 
_reflns.entry_id                     4I6U 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.97 
_reflns.d_resolution_low             45.74 
_reflns.number_all                   527601 
_reflns.number_obs                   38881 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 4I6U 
_refine.ls_d_res_high                            1.9700 
_refine.ls_d_res_low                             41.7900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6200 
_refine.ls_number_reflns_obs                     38823 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1732 
_refine.ls_R_factor_R_work                       0.1709 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2171 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1951 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               23.0441 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[2][2]                            -0.0000 
_refine.aniso_B[3][3]                            -0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9540 
_refine.correlation_coeff_Fo_to_Fc_free          0.9280 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1500 
_refine.pdbx_overall_ESU_R_Free                  0.1430 
_refine.overall_SU_ML                            0.0890 
_refine.overall_SU_B                             3.0630 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                72.080 
_refine.B_iso_min                                9.350 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3757 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             147 
_refine_hist.number_atoms_total               3943 
_refine_hist.d_res_high                       1.9700 
_refine_hist.d_res_low                        41.7900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3871 0.019  0.019  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         4053 0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5157 1.864  2.008  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      9369 0.958  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 472  5.079  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 156  32.408 24.295 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 865  15.936 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 24   15.267 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         616  0.147  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   4096 0.008  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     802  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.9700 
_refine_ls_shell.d_res_low                        2.0210 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.9600 
_refine_ls_shell.number_reflns_R_work             2699 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.1730 
_refine_ls_shell.R_factor_R_free                  0.2620 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2846 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4I6U 
_struct.title                     
'Crystal Structure of a Y37F mutant of the Restriction-Modification Controller Protein C.Esp1396I' 
_struct.pdbx_descriptor           'Regulatory protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4I6U 
_struct_keywords.text            'Restriction-modification, helix-turn-helix, transcriptional regulato, DNA, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 3 ? 
M N N 3 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 6  ? LYS A 23 ? SER A 3  LYS A 20 1 ? 18 
HELX_P HELX_P2  2  THR A 26 ? ASN A 35 ? THR A 23 ASN A 32 1 ? 10 
HELX_P HELX_P3  3  ASP A 37 ? ARG A 46 ? ASP A 34 ARG A 43 1 ? 10 
HELX_P HELX_P4  4  THR A 52 ? GLU A 64 ? THR A 49 GLU A 61 1 ? 13 
HELX_P HELX_P5  5  SER A 66 ? HIS A 81 ? SER A 63 HIS A 78 1 ? 16 
HELX_P HELX_P6  6  PHE B 7  ? LYS B 23 ? PHE B 4  LYS B 20 1 ? 17 
HELX_P HELX_P7  7  THR B 26 ? ASN B 35 ? THR B 23 ASN B 32 1 ? 10 
HELX_P HELX_P8  8  ASP B 37 ? ARG B 46 ? ASP B 34 ARG B 43 1 ? 10 
HELX_P HELX_P9  9  THR B 52 ? GLU B 64 ? THR B 49 GLU B 61 1 ? 13 
HELX_P HELX_P10 10 SER B 66 ? HIS B 81 ? SER B 63 HIS B 78 1 ? 16 
HELX_P HELX_P11 11 PHE C 7  ? LYS C 23 ? PHE C 4  LYS C 20 1 ? 17 
HELX_P HELX_P12 12 THR C 26 ? ASN C 35 ? THR C 23 ASN C 32 1 ? 10 
HELX_P HELX_P13 13 ASP C 37 ? SER C 48 ? ASP C 34 SER C 45 1 ? 12 
HELX_P HELX_P14 14 THR C 52 ? GLU C 64 ? THR C 49 GLU C 61 1 ? 13 
HELX_P HELX_P15 15 SER C 66 ? LYS C 80 ? SER C 63 LYS C 77 1 ? 15 
HELX_P HELX_P16 16 PHE D 7  ? LYS D 23 ? PHE D 4  LYS D 20 1 ? 17 
HELX_P HELX_P17 17 THR D 26 ? ASN D 35 ? THR D 23 ASN D 32 1 ? 10 
HELX_P HELX_P18 18 ASP D 37 ? ARG D 46 ? ASP D 34 ARG D 43 1 ? 10 
HELX_P HELX_P19 19 THR D 52 ? GLU D 64 ? THR D 49 GLU D 61 1 ? 13 
HELX_P HELX_P20 20 SER D 66 ? LYS D 80 ? SER D 63 LYS D 77 1 ? 15 
HELX_P HELX_P21 21 PHE E 7  ? LYS E 23 ? PHE E 4  LYS E 20 1 ? 17 
HELX_P HELX_P22 22 THR E 26 ? ASN E 35 ? THR E 23 ASN E 32 1 ? 10 
HELX_P HELX_P23 23 ASP E 37 ? ARG E 46 ? ASP E 34 ARG E 43 1 ? 10 
HELX_P HELX_P24 24 THR E 52 ? GLU E 64 ? THR E 49 GLU E 61 1 ? 13 
HELX_P HELX_P25 25 SER E 66 ? LEU E 79 ? SER E 63 LEU E 76 1 ? 14 
HELX_P HELX_P26 26 PHE F 7  ? LYS F 23 ? PHE F 4  LYS F 20 1 ? 17 
HELX_P HELX_P27 27 THR F 26 ? ASN F 35 ? THR F 23 ASN F 32 1 ? 10 
HELX_P HELX_P28 28 ASP F 37 ? ARG F 46 ? ASP F 34 ARG F 43 1 ? 10 
HELX_P HELX_P29 29 THR F 52 ? GLU F 64 ? THR F 49 GLU F 61 1 ? 13 
HELX_P HELX_P30 30 SER F 66 ? LEU F 79 ? SER F 63 LEU F 76 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ARG 49 O  ? ? ? 1_555 G NA . NA ? ? A ARG 46 A NA 101 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc2 metalc ? ? A ILE 44 O  ? ? ? 1_555 G NA . NA ? ? A ILE 41 A NA 101 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc3 metalc ? ? A SER 13 OG ? ? ? 1_555 G NA . NA ? ? A SER 10 A NA 101 1_555 ? ? ? ? ? ? ? 3.090 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 101'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ACT A 102' 
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PEG A 103' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PEG A 104' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 105' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACT C 101' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT D 101' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL F 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 SER A 13 ? SER A 10  . ? 1_555 ? 
2  AC1 5 ILE A 44 ? ILE A 41  . ? 1_555 ? 
3  AC1 5 ASN A 47 ? ASN A 44  . ? 1_555 ? 
4  AC1 5 SER A 48 ? SER A 45  . ? 1_555 ? 
5  AC1 5 ARG A 49 ? ARG A 46  . ? 1_555 ? 
6  AC2 3 SER A 66 ? SER A 63  . ? 1_555 ? 
7  AC2 3 GOL K .  ? GOL A 105 . ? 1_555 ? 
8  AC2 3 LEU D 79 ? LEU D 76  . ? 1_555 ? 
9  AC3 8 SER A 48 ? SER A 45  . ? 1_555 ? 
10 AC3 8 ARG A 49 ? ARG A 46  . ? 1_555 ? 
11 AC3 8 ASN A 50 ? ASN A 47  . ? 1_555 ? 
12 AC3 8 HOH O .  ? HOH A 218 . ? 1_555 ? 
13 AC3 8 HOH O .  ? HOH A 226 . ? 1_555 ? 
14 AC3 8 PHE B 7  ? PHE B 4   . ? 1_555 ? 
15 AC3 8 HIS B 81 ? HIS B 78  . ? 1_555 ? 
16 AC3 8 LYS D 54 ? LYS D 51  . ? 1_555 ? 
17 AC4 5 ILE A 78 ? ILE A 75  . ? 1_555 ? 
18 AC4 5 HIS A 81 ? HIS A 78  . ? 1_555 ? 
19 AC4 5 ASP A 82 ? ASP A 79  . ? 1_555 ? 
20 AC4 5 ASN C 47 ? ASN C 44  . ? 3_454 ? 
21 AC4 5 HOH R .  ? HOH D 209 . ? 1_555 ? 
22 AC5 4 SER A 66 ? SER A 63  . ? 1_555 ? 
23 AC5 4 VAL A 69 ? VAL A 66  . ? 1_555 ? 
24 AC5 4 ACT H .  ? ACT A 102 . ? 1_555 ? 
25 AC5 4 HOH O .  ? HOH A 225 . ? 1_555 ? 
26 AC6 5 SER C 42 ? SER C 39  . ? 1_555 ? 
27 AC6 5 GLY C 43 ? GLY C 40  . ? 1_555 ? 
28 AC6 5 ARG C 46 ? ARG C 43  . ? 1_555 ? 
29 AC6 5 ASN C 47 ? ASN C 44  . ? 1_555 ? 
30 AC6 5 HOH R .  ? HOH D 215 . ? 3_444 ? 
31 AC7 4 LEU B 79 ? LEU B 76  . ? 1_555 ? 
32 AC7 4 ASP B 82 ? ASP B 79  . ? 1_555 ? 
33 AC7 4 LYS D 54 ? LYS D 51  . ? 1_555 ? 
34 AC7 4 SER D 55 ? SER D 52  . ? 1_555 ? 
35 AC8 4 ASP A 29 ? ASP A 26  . ? 3_554 ? 
36 AC8 4 TYR A 32 ? TYR A 29  . ? 3_554 ? 
37 AC8 4 ASP F 29 ? ASP F 26  . ? 1_555 ? 
38 AC8 4 LYS F 33 ? LYS F 30  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4I6U 
_atom_sites.fract_transf_matrix[1][1]   0.020572 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012217 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007403 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 4  ? -30.056 22.170  -28.199 1.00 39.70 ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 4  ? -29.204 21.114  -28.720 1.00 31.59 ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 4  ? -28.685 20.492  -27.412 1.00 24.97 ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 4  ? -29.340 20.562  -26.379 1.00 22.79 ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 4  ? -28.113 21.681  -29.636 1.00 35.94 ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 4  ? -27.486 20.637  -30.571 1.00 44.26 ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 4  ? -25.667 20.510  -30.423 1.00 53.52 ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 4  ? -25.118 19.017  -31.319 1.00 47.24 ? 1   MET A CE  1 
ATOM   9    N  N   . GLU A 1 5  ? -27.535 19.866  -27.439 1.00 19.04 ? 2   GLU A N   1 
ATOM   10   C  CA  . GLU A 1 5  ? -26.960 19.278  -26.239 1.00 19.58 ? 2   GLU A CA  1 
ATOM   11   C  C   . GLU A 1 5  ? -26.435 20.388  -25.290 1.00 17.73 ? 2   GLU A C   1 
ATOM   12   O  O   . GLU A 1 5  ? -26.162 21.472  -25.705 1.00 19.08 ? 2   GLU A O   1 
ATOM   13   C  CB  . GLU A 1 5  ? -25.846 18.332  -26.687 1.00 19.95 ? 2   GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 5  ? -26.395 17.209  -27.565 1.00 22.22 ? 2   GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 5  ? -25.284 16.348  -28.077 1.00 24.28 ? 2   GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 5  ? -24.508 16.877  -28.903 1.00 26.61 ? 2   GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 5  ? -25.188 15.168  -27.644 1.00 21.82 ? 2   GLU A OE2 1 
ATOM   18   N  N   . SER A 1 6  ? -26.296 20.092  -24.035 1.00 17.22 ? 3   SER A N   1 
ATOM   19   C  CA  . SER A 1 6  ? -25.782 21.017  -23.037 1.00 15.40 ? 3   SER A CA  1 
ATOM   20   C  C   . SER A 1 6  ? -24.278 21.288  -23.239 1.00 15.68 ? 3   SER A C   1 
ATOM   21   O  O   . SER A 1 6  ? -23.408 20.352  -23.182 1.00 14.08 ? 3   SER A O   1 
ATOM   22   C  CB  . SER A 1 6  ? -25.960 20.384  -21.673 1.00 15.47 ? 3   SER A CB  1 
ATOM   23   O  OG  . SER A 1 6  ? -25.172 21.082  -20.676 1.00 14.49 ? 3   SER A OG  1 
ATOM   24   N  N   . PHE A 1 7  ? -23.980 22.543  -23.465 1.00 14.53 ? 4   PHE A N   1 
ATOM   25   C  CA  . PHE A 1 7  ? -22.614 22.995  -23.558 1.00 15.46 ? 4   PHE A CA  1 
ATOM   26   C  C   . PHE A 1 7  ? -21.794 22.639  -22.293 1.00 14.48 ? 4   PHE A C   1 
ATOM   27   O  O   . PHE A 1 7  ? -20.737 22.024  -22.382 1.00 12.71 ? 4   PHE A O   1 
ATOM   28   C  CB  . PHE A 1 7  ? -22.588 24.516  -23.817 1.00 17.38 ? 4   PHE A CB  1 
ATOM   29   C  CG  . PHE A 1 7  ? -21.189 25.106  -23.821 1.00 18.05 ? 4   PHE A CG  1 
ATOM   30   C  CD1 . PHE A 1 7  ? -20.375 24.976  -24.922 1.00 20.46 ? 4   PHE A CD1 1 
ATOM   31   C  CD2 . PHE A 1 7  ? -20.709 25.799  -22.717 1.00 19.62 ? 4   PHE A CD2 1 
ATOM   32   C  CE1 . PHE A 1 7  ? -19.108 25.539  -24.952 1.00 22.32 ? 4   PHE A CE1 1 
ATOM   33   C  CE2 . PHE A 1 7  ? -19.429 26.349  -22.731 1.00 22.10 ? 4   PHE A CE2 1 
ATOM   34   C  CZ  . PHE A 1 7  ? -18.632 26.228  -23.848 1.00 20.41 ? 4   PHE A CZ  1 
ATOM   35   N  N   . LEU A 1 8  ? -22.286 23.008  -21.121 1.00 13.28 ? 5   LEU A N   1 
ATOM   36   C  CA  . LEU A 1 8  ? -21.529 22.803  -19.893 1.00 13.68 ? 5   LEU A CA  1 
ATOM   37   C  C   . LEU A 1 8  ? -21.290 21.337  -19.597 1.00 13.04 ? 5   LEU A C   1 
ATOM   38   O  O   . LEU A 1 8  ? -20.175 20.936  -19.199 1.00 12.41 ? 5   LEU A O   1 
ATOM   39   C  CB  . LEU A 1 8  ? -22.300 23.412  -18.753 1.00 15.98 ? 5   LEU A CB  1 
ATOM   40   C  CG  . LEU A 1 8  ? -21.608 23.877  -17.494 1.00 19.00 ? 5   LEU A CG  1 
ATOM   41   C  CD1 . LEU A 1 8  ? -22.393 23.723  -16.203 1.00 19.13 ? 5   LEU A CD1 1 
ATOM   42   C  CD2 . LEU A 1 8  ? -20.102 23.938  -17.361 1.00 18.52 ? 5   LEU A CD2 1 
ATOM   43   N  N   . LEU A 1 9  ? -22.337 20.529  -19.768 1.00 14.00 ? 6   LEU A N   1 
ATOM   44   C  CA  . LEU A 1 9  ? -22.157 19.053  -19.695 1.00 14.46 ? 6   LEU A CA  1 
ATOM   45   C  C   . LEU A 1 9  ? -21.039 18.530  -20.625 1.00 13.90 ? 6   LEU A C   1 
ATOM   46   O  O   . LEU A 1 9  ? -20.196 17.686  -20.186 1.00 13.07 ? 6   LEU A O   1 
ATOM   47   C  CB  . LEU A 1 9  ? -23.472 18.284  -19.875 1.00 14.07 ? 6   LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 9  ? -23.414 16.778  -19.604 1.00 14.70 ? 6   LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 9  ? -23.064 16.423  -18.195 1.00 16.02 ? 6   LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 9  ? -24.769 16.096  -19.970 1.00 15.35 ? 6   LEU A CD2 1 
ATOM   51   N  N   . SER A 1 10 ? -21.040 18.937  -21.890 1.00 15.56 ? 7   SER A N   1 
ATOM   52   C  CA  . SER A 1 10 ? -19.969 18.474  -22.795 1.00 16.58 ? 7   SER A CA  1 
ATOM   53   C  C   . SER A 1 10 ? -18.574 18.920  -22.319 1.00 15.20 ? 7   SER A C   1 
ATOM   54   O  O   . SER A 1 10 ? -17.625 18.172  -22.501 1.00 13.62 ? 7   SER A O   1 
ATOM   55   C  CB  . SER A 1 10 ? -20.189 18.904  -24.263 1.00 19.32 ? 7   SER A CB  1 
ATOM   56   O  OG  . SER A 1 10 ? -19.987 20.308  -24.376 1.00 22.39 ? 7   SER A OG  1 
ATOM   57   N  N   . LYS A 1 11 ? -18.442 20.125  -21.754 1.00 14.22 ? 8   LYS A N   1 
ATOM   58   C  CA  . LYS A 1 11 ? -17.140 20.601  -21.247 1.00 13.69 ? 8   LYS A CA  1 
ATOM   59   C  C   . LYS A 1 11 ? -16.721 19.904  -19.937 1.00 13.57 ? 8   LYS A C   1 
ATOM   60   O  O   . LYS A 1 11 ? -15.556 19.552  -19.757 1.00 12.55 ? 8   LYS A O   1 
ATOM   61   C  CB  . LYS A 1 11 ? -17.200 22.120  -21.051 1.00 15.56 ? 8   LYS A CB  1 
ATOM   62   C  CG  . LYS A 1 11 ? -17.367 22.938  -22.310 1.00 16.96 ? 8   LYS A CG  1 
ATOM   63   C  CD  . LYS A 1 11 ? -16.094 22.869  -23.186 1.00 21.06 ? 8   LYS A CD  1 
ATOM   64   C  CE  . LYS A 1 11 ? -16.259 23.640  -24.465 1.00 26.89 ? 8   LYS A CE  1 
ATOM   65   N  NZ  . LYS A 1 11 ? -15.450 22.963  -25.504 1.00 31.79 ? 8   LYS A NZ  1 
ATOM   66   N  N   . VAL A 1 12 ? -17.657 19.687  -19.023 1.00 12.34 ? 9   VAL A N   1 
ATOM   67   C  CA  . VAL A 1 12 ? -17.383 18.938  -17.819 1.00 13.29 ? 9   VAL A CA  1 
ATOM   68   C  C   . VAL A 1 12 ? -16.886 17.500  -18.195 1.00 14.06 ? 9   VAL A C   1 
ATOM   69   O  O   . VAL A 1 12 ? -15.856 17.047  -17.702 1.00 12.45 ? 9   VAL A O   1 
ATOM   70   C  CB  . VAL A 1 12 ? -18.629 18.852  -16.902 1.00 12.66 ? 9   VAL A CB  1 
ATOM   71   C  CG1 . VAL A 1 12 ? -18.423 17.868  -15.785 1.00 13.35 ? 9   VAL A CG1 1 
ATOM   72   C  CG2 . VAL A 1 12 ? -18.915 20.233  -16.320 1.00 13.82 ? 9   VAL A CG2 1 
ATOM   73   N  N   . SER A 1 13 ? -17.608 16.862  -19.099 1.00 13.59 ? 10  SER A N   1 
ATOM   74   C  CA  . SER A 1 13 ? -17.291 15.549  -19.594 1.00 16.31 ? 10  SER A CA  1 
ATOM   75   C  C   . SER A 1 13 ? -15.864 15.483  -20.178 1.00 15.48 ? 10  SER A C   1 
ATOM   76   O  O   . SER A 1 13 ? -15.111 14.529  -19.936 1.00 15.66 ? 10  SER A O   1 
ATOM   77   C  CB  . SER A 1 13 ? -18.264 15.163  -20.717 1.00 17.37 ? 10  SER A CB  1 
ATOM   78   O  OG  . SER A 1 13 ? -19.540 14.916  -20.076 1.00 25.68 ? 10  SER A OG  1 
ATOM   79   N  N   . PHE A 1 14 ? -15.602 16.422  -21.040 1.00 16.07 ? 11  PHE A N   1 
ATOM   80   C  CA  . PHE A 1 14 ? -14.295 16.542  -21.657 1.00 18.55 ? 11  PHE A CA  1 
ATOM   81   C  C   . PHE A 1 14 ? -13.174 16.738  -20.626 1.00 16.25 ? 11  PHE A C   1 
ATOM   82   O  O   . PHE A 1 14 ? -12.144 16.052  -20.695 1.00 14.99 ? 11  PHE A O   1 
ATOM   83   C  CB  . PHE A 1 14 ? -14.266 17.680  -22.681 1.00 21.12 ? 11  PHE A CB  1 
ATOM   84   C  CG  . PHE A 1 14 ? -12.920 17.809  -23.343 1.00 22.48 ? 11  PHE A CG  1 
ATOM   85   C  CD1 . PHE A 1 14 ? -12.572 16.949  -24.329 1.00 25.25 ? 11  PHE A CD1 1 
ATOM   86   C  CD2 . PHE A 1 14 ? -11.992 18.709  -22.874 1.00 24.78 ? 11  PHE A CD2 1 
ATOM   87   C  CE1 . PHE A 1 14 ? -11.304 17.028  -24.922 1.00 30.02 ? 11  PHE A CE1 1 
ATOM   88   C  CE2 . PHE A 1 14 ? -10.713 18.777  -23.436 1.00 27.75 ? 11  PHE A CE2 1 
ATOM   89   C  CZ  . PHE A 1 14 ? -10.389 17.946  -24.460 1.00 25.15 ? 11  PHE A CZ  1 
ATOM   90   N  N   . VAL A 1 15 ? -13.338 17.614  -19.661 1.00 14.74 ? 12  VAL A N   1 
ATOM   91   C  CA  . VAL A 1 15 ? -12.291 17.775  -18.605 1.00 15.77 ? 12  VAL A CA  1 
ATOM   92   C  C   . VAL A 1 15 ? -12.088 16.514  -17.774 1.00 14.34 ? 12  VAL A C   1 
ATOM   93   O  O   . VAL A 1 15 ? -10.931 16.169  -17.468 1.00 14.37 ? 12  VAL A O   1 
ATOM   94   C  CB  . VAL A 1 15 ? -12.581 18.978  -17.677 1.00 17.90 ? 12  VAL A CB  1 
ATOM   95   C  CG1 . VAL A 1 15 ? -11.568 19.086  -16.521 1.00 20.24 ? 12  VAL A CG1 1 
ATOM   96   C  CG2 . VAL A 1 15 ? -12.512 20.239  -18.444 1.00 20.49 ? 12  VAL A CG2 1 
ATOM   97   N  N   . ILE A 1 16 ? -13.167 15.766  -17.463 1.00 13.55 ? 13  ILE A N   1 
ATOM   98   C  CA  . ILE A 1 16 ? -12.991 14.499  -16.745 1.00 14.24 ? 13  ILE A CA  1 
ATOM   99   C  C   . ILE A 1 16 ? -12.095 13.539  -17.600 1.00 14.52 ? 13  ILE A C   1 
ATOM   100  O  O   . ILE A 1 16 ? -11.160 12.902  -17.065 1.00 14.19 ? 13  ILE A O   1 
ATOM   101  C  CB  . ILE A 1 16 ? -14.341 13.837  -16.440 1.00 13.36 ? 13  ILE A CB  1 
ATOM   102  C  CG1 . ILE A 1 16 ? -15.095 14.659  -15.392 1.00 14.21 ? 13  ILE A CG1 1 
ATOM   103  C  CG2 . ILE A 1 16 ? -14.190 12.383  -16.022 1.00 13.94 ? 13  ILE A CG2 1 
ATOM   104  C  CD1 . ILE A 1 16 ? -16.576 14.410  -15.374 1.00 14.68 ? 13  ILE A CD1 1 
ATOM   105  N  N   . LYS A 1 17 ? -12.426 13.417  -18.902 1.00 15.79 ? 14  LYS A N   1 
ATOM   106  C  CA  . LYS A 1 17 ? -11.644 12.509  -19.788 1.00 16.00 ? 14  LYS A CA  1 
ATOM   107  C  C   . LYS A 1 17 ? -10.160 12.944  -19.859 1.00 17.25 ? 14  LYS A C   1 
ATOM   108  O  O   . LYS A 1 17 ? -9.244  12.095  -19.759 1.00 16.54 ? 14  LYS A O   1 
ATOM   109  C  CB  . LYS A 1 17 ? -12.235 12.464  -21.167 1.00 18.48 ? 14  LYS A CB  1 
ATOM   110  C  CG  . LYS A 1 17 ? -11.410 11.692  -22.181 1.00 19.70 ? 14  LYS A CG  1 
ATOM   111  C  CD  . LYS A 1 17 ? -12.113 11.724  -23.523 1.00 25.01 ? 14  LYS A CD  1 
ATOM   112  C  CE  . LYS A 1 17 ? -11.443 10.717  -24.440 1.00 28.66 ? 14  LYS A CE  1 
ATOM   113  N  NZ  . LYS A 1 17 ? -12.060 10.565  -25.802 1.00 28.34 ? 14  LYS A NZ  1 
ATOM   114  N  N   . LYS A 1 18 ? -9.949  14.247  -20.024 1.00 16.57 ? 15  LYS A N   1 
ATOM   115  C  CA  . LYS A 1 18 ? -8.590  14.810  -20.115 1.00 18.79 ? 15  LYS A CA  1 
ATOM   116  C  C   . LYS A 1 18 ? -7.761  14.532  -18.884 1.00 17.49 ? 15  LYS A C   1 
ATOM   117  O  O   . LYS A 1 18 ? -6.593  14.085  -18.985 1.00 18.57 ? 15  LYS A O   1 
ATOM   118  C  CB  . LYS A 1 18 ? -8.682  16.293  -20.420 1.00 22.01 ? 15  LYS A CB  1 
ATOM   119  C  CG  . LYS A 1 18 ? -7.351  17.009  -20.368 1.00 24.29 ? 15  LYS A CG  1 
ATOM   120  C  CD  . LYS A 1 18 ? -7.480  18.414  -20.920 1.00 29.79 ? 15  LYS A CD  1 
ATOM   121  C  CE  . LYS A 1 18 ? -6.065  19.000  -21.098 1.00 34.44 ? 15  LYS A CE  1 
ATOM   122  N  NZ  . LYS A 1 18 ? -6.153  20.179  -21.972 1.00 39.14 ? 15  LYS A NZ  1 
ATOM   123  N  N   . ILE A 1 19 ? -8.306  14.776  -17.702 1.00 16.62 ? 16  ILE A N   1 
ATOM   124  C  CA  . ILE A 1 19 ? -7.577  14.479  -16.481 1.00 16.83 ? 16  ILE A CA  1 
ATOM   125  C  C   . ILE A 1 19 ? -7.324  12.975  -16.295 1.00 15.28 ? 16  ILE A C   1 
ATOM   126  O  O   . ILE A 1 19 ? -6.230  12.580  -15.853 1.00 14.39 ? 16  ILE A O   1 
ATOM   127  C  CB  . ILE A 1 19 ? -8.277  15.030  -15.207 1.00 17.48 ? 16  ILE A CB  1 
ATOM   128  C  CG1 . ILE A 1 19 ? -8.345  16.553  -15.307 1.00 19.81 ? 16  ILE A CG1 1 
ATOM   129  C  CG2 . ILE A 1 19 ? -7.548  14.530  -13.938 1.00 19.23 ? 16  ILE A CG2 1 
ATOM   130  C  CD1 . ILE A 1 19 ? -9.325  17.150  -14.350 1.00 19.70 ? 16  ILE A CD1 1 
ATOM   131  N  N   . ARG A 1 20 ? -8.344  12.165  -16.599 1.00 15.36 ? 17  ARG A N   1 
ATOM   132  C  CA  . ARG A 1 20 ? -8.295  10.721  -16.541 1.00 15.05 ? 17  ARG A CA  1 
ATOM   133  C  C   . ARG A 1 20 ? -7.043  10.227  -17.333 1.00 15.16 ? 17  ARG A C   1 
ATOM   134  O  O   . ARG A 1 20 ? -6.213  9.432   -16.810 1.00 13.97 ? 17  ARG A O   1 
ATOM   135  C  CB  . ARG A 1 20 ? -9.577  10.074  -17.135 1.00 13.78 ? 17  ARG A CB  1 
ATOM   136  C  CG  . ARG A 1 20 ? -9.520  8.543   -17.047 1.00 13.38 ? 17  ARG A CG  1 
ATOM   137  C  CD  . ARG A 1 20 ? -10.785 7.856   -17.565 1.00 13.42 ? 17  ARG A CD  1 
ATOM   138  N  NE  . ARG A 1 20 ? -11.074 8.210   -18.940 1.00 12.50 ? 17  ARG A NE  1 
ATOM   139  C  CZ  . ARG A 1 20 ? -10.553 7.666   -20.033 1.00 13.33 ? 17  ARG A CZ  1 
ATOM   140  N  NH1 . ARG A 1 20 ? -9.488  6.825   -19.930 1.00 12.42 ? 17  ARG A NH1 1 
ATOM   141  N  NH2 . ARG A 1 20 ? -11.051 8.020   -21.238 1.00 11.99 ? 17  ARG A NH2 1 
ATOM   142  N  N   . LEU A 1 21 ? -6.924  10.706  -18.565 1.00 14.74 ? 18  LEU A N   1 
ATOM   143  C  CA  . LEU A 1 21 ? -5.822  10.321  -19.446 1.00 16.01 ? 18  LEU A CA  1 
ATOM   144  C  C   . LEU A 1 21 ? -4.475  10.888  -19.019 1.00 17.71 ? 18  LEU A C   1 
ATOM   145  O  O   . LEU A 1 21 ? -3.478  10.167  -19.051 1.00 16.42 ? 18  LEU A O   1 
ATOM   146  C  CB  . LEU A 1 21 ? -6.099  10.689  -20.894 1.00 16.04 ? 18  LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 21 ? -7.270  9.916   -21.466 1.00 16.01 ? 18  LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 21 ? -7.650  10.552  -22.790 1.00 16.54 ? 18  LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 21 ? -6.976  8.413   -21.710 1.00 17.48 ? 18  LEU A CD2 1 
ATOM   150  N  N   . GLU A 1 22 ? -4.455  12.104  -18.527 1.00 17.86 ? 19  GLU A N   1 
ATOM   151  C  CA  . GLU A 1 22 ? -3.251  12.629  -17.920 1.00 20.01 ? 19  GLU A CA  1 
ATOM   152  C  C   . GLU A 1 22 ? -2.795  11.801  -16.709 1.00 22.25 ? 19  GLU A C   1 
ATOM   153  O  O   . GLU A 1 22 ? -1.608  11.772  -16.370 1.00 22.40 ? 19  GLU A O   1 
ATOM   154  C  CB  . GLU A 1 22 ? -3.458  14.091  -17.507 1.00 21.74 ? 19  GLU A CB  1 
ATOM   155  C  CG  . GLU A 1 22 ? -3.586  14.991  -18.700 1.00 22.63 ? 19  GLU A CG  1 
ATOM   156  C  CD  . GLU A 1 22 ? -3.746  16.476  -18.340 1.00 26.56 ? 19  GLU A CD  1 
ATOM   157  O  OE1 . GLU A 1 22 ? -3.777  17.303  -19.265 1.00 26.91 ? 19  GLU A OE1 1 
ATOM   158  O  OE2 . GLU A 1 22 ? -3.883  16.805  -17.154 1.00 27.24 ? 19  GLU A OE2 1 
ATOM   159  N  N   . LYS A 1 23 ? -3.703  11.163  -15.997 1.00 21.56 ? 20  LYS A N   1 
ATOM   160  C  CA  . LYS A 1 23 ? -3.294  10.341  -14.858 1.00 22.83 ? 20  LYS A CA  1 
ATOM   161  C  C   . LYS A 1 23 ? -3.001  8.916   -15.266 1.00 19.48 ? 20  LYS A C   1 
ATOM   162  O  O   . LYS A 1 23 ? -2.834  8.099   -14.409 1.00 18.28 ? 20  LYS A O   1 
ATOM   163  C  CB  . LYS A 1 23 ? -4.371  10.318  -13.749 1.00 24.59 ? 20  LYS A CB  1 
ATOM   164  C  CG  . LYS A 1 23 ? -4.745  11.688  -13.171 1.00 30.10 ? 20  LYS A CG  1 
ATOM   165  C  CD  . LYS A 1 23 ? -3.628  12.247  -12.341 1.00 31.37 ? 20  LYS A CD  1 
ATOM   166  C  CE  . LYS A 1 23 ? -3.939  13.593  -11.747 1.00 33.04 ? 20  LYS A CE  1 
ATOM   167  N  NZ  . LYS A 1 23 ? -4.218  13.438  -10.301 1.00 37.51 ? 20  LYS A NZ  1 
ATOM   168  N  N   . GLY A 1 24 ? -3.060  8.560   -16.552 1.00 16.58 ? 21  GLY A N   1 
ATOM   169  C  CA  . GLY A 1 24 ? -2.803  7.207   -16.913 1.00 17.19 ? 21  GLY A CA  1 
ATOM   170  C  C   . GLY A 1 24 ? -3.916  6.230   -16.715 1.00 18.10 ? 21  GLY A C   1 
ATOM   171  O  O   . GLY A 1 24 ? -3.696  5.044   -16.857 1.00 17.19 ? 21  GLY A O   1 
ATOM   172  N  N   . MET A 1 25 ? -5.135  6.704   -16.435 1.00 14.65 ? 22  MET A N   1 
ATOM   173  C  CA  . MET A 1 25 ? -6.191  5.815   -16.015 1.00 14.55 ? 22  MET A CA  1 
ATOM   174  C  C   . MET A 1 25 ? -7.109  5.427   -17.157 1.00 13.17 ? 22  MET A C   1 
ATOM   175  O  O   . MET A 1 25 ? -7.397  6.244   -18.021 1.00 14.57 ? 22  MET A O   1 
ATOM   176  C  CB  . MET A 1 25 ? -7.052  6.511   -14.914 1.00 15.81 ? 22  MET A CB  1 
ATOM   177  C  CG  . MET A 1 25 ? -6.329  6.780   -13.583 1.00 18.14 ? 22  MET A CG  1 
ATOM   178  S  SD  . MET A 1 25 ? -7.319  7.938   -12.521 1.00 23.08 ? 22  MET A SD  1 
ATOM   179  C  CE  . MET A 1 25 ? -8.545  6.798   -12.117 1.00 19.08 ? 22  MET A CE  1 
ATOM   180  N  N   . THR A 1 26 ? -7.638  4.237   -17.093 1.00 12.73 ? 23  THR A N   1 
ATOM   181  C  CA  . THR A 1 26 ? -8.715  3.790   -17.962 1.00 13.39 ? 23  THR A CA  1 
ATOM   182  C  C   . THR A 1 26 ? -10.086 4.243   -17.369 1.00 12.62 ? 23  THR A C   1 
ATOM   183  O  O   . THR A 1 26 ? -10.168 4.632   -16.196 1.00 10.45 ? 23  THR A O   1 
ATOM   184  C  CB  . THR A 1 26 ? -8.731  2.287   -18.169 1.00 13.92 ? 23  THR A CB  1 
ATOM   185  O  OG1 . THR A 1 26 ? -9.157  1.609   -16.974 1.00 14.02 ? 23  THR A OG1 1 
ATOM   186  C  CG2 . THR A 1 26 ? -7.345  1.700   -18.707 1.00 14.67 ? 23  THR A CG2 1 
ATOM   187  N  N   . GLN A 1 27 ? -11.123 4.166   -18.192 1.00 13.42 ? 24  GLN A N   1 
ATOM   188  C  CA  . GLN A 1 27 ? -12.519 4.373   -17.709 1.00 13.49 ? 24  GLN A CA  1 
ATOM   189  C  C   . GLN A 1 27 ? -12.836 3.435   -16.533 1.00 13.92 ? 24  GLN A C   1 
ATOM   190  O  O   . GLN A 1 27 ? -13.374 3.850   -15.484 1.00 13.30 ? 24  GLN A O   1 
ATOM   191  C  CB  . GLN A 1 27 ? -13.521 4.224   -18.831 1.00 13.92 ? 24  GLN A CB  1 
ATOM   192  C  CG  . GLN A 1 27 ? -13.423 5.372   -19.848 1.00 14.24 ? 24  GLN A CG  1 
ATOM   193  C  CD  . GLN A 1 27 ? -14.537 5.263   -20.892 1.00 17.11 ? 24  GLN A CD  1 
ATOM   194  O  OE1 . GLN A 1 27 ? -15.116 4.166   -21.048 1.00 16.72 ? 24  GLN A OE1 1 
ATOM   195  N  NE2 . GLN A 1 27 ? -14.868 6.374   -21.580 1.00 16.78 ? 24  GLN A NE2 1 
ATOM   196  N  N   . GLU A 1 28 ? -12.406 2.197   -16.651 1.00 13.81 ? 25  GLU A N   1 
ATOM   197  C  CA  . GLU A 1 28 ? -12.618 1.222   -15.602 1.00 15.93 ? 25  GLU A CA  1 
ATOM   198  C  C   . GLU A 1 28 ? -11.907 1.567   -14.308 1.00 14.35 ? 25  GLU A C   1 
ATOM   199  O  O   . GLU A 1 28 ? -12.441 1.345   -13.209 1.00 13.27 ? 25  GLU A O   1 
ATOM   200  C  CB  . GLU A 1 28 ? -12.117 -0.142  -16.074 1.00 19.67 ? 25  GLU A CB  1 
ATOM   201  C  CG  . GLU A 1 28 ? -12.916 -0.726  -17.218 1.00 25.64 ? 25  GLU A CG  1 
ATOM   202  C  CD  . GLU A 1 28 ? -12.818 -0.091  -18.622 1.00 30.44 ? 25  GLU A CD  1 
ATOM   203  O  OE1 . GLU A 1 28 ? -13.847 -0.362  -19.333 1.00 39.65 ? 25  GLU A OE1 1 
ATOM   204  O  OE2 . GLU A 1 28 ? -11.849 0.652   -19.066 1.00 23.70 ? 25  GLU A OE2 1 
ATOM   205  N  N   . ASP A 1 29 ? -10.679 2.043   -14.434 1.00 13.62 ? 26  ASP A N   1 
ATOM   206  C  CA  . ASP A 1 29 ? -9.918  2.513   -13.309 1.00 15.23 ? 26  ASP A CA  1 
ATOM   207  C  C   . ASP A 1 29 ? -10.638 3.676   -12.549 1.00 16.09 ? 26  ASP A C   1 
ATOM   208  O  O   . ASP A 1 29 ? -10.667 3.745   -11.315 1.00 15.56 ? 26  ASP A O   1 
ATOM   209  C  CB  . ASP A 1 29 ? -8.556  3.055   -13.740 1.00 16.09 ? 26  ASP A CB  1 
ATOM   210  C  CG  . ASP A 1 29 ? -7.586  1.992   -14.265 1.00 17.57 ? 26  ASP A CG  1 
ATOM   211  O  OD1 . ASP A 1 29 ? -7.801  0.798   -13.978 1.00 16.30 ? 26  ASP A OD1 1 
ATOM   212  O  OD2 . ASP A 1 29 ? -6.655  2.446   -15.001 1.00 15.81 ? 26  ASP A OD2 1 
ATOM   213  N  N   . LEU A 1 30 ? -11.128 4.633   -13.328 1.00 16.65 ? 27  LEU A N   1 
ATOM   214  C  CA  . LEU A 1 30 ? -11.828 5.788   -12.772 1.00 16.30 ? 27  LEU A CA  1 
ATOM   215  C  C   . LEU A 1 30 ? -13.099 5.352   -12.071 1.00 14.49 ? 27  LEU A C   1 
ATOM   216  O  O   . LEU A 1 30 ? -13.353 5.829   -10.959 1.00 14.62 ? 27  LEU A O   1 
ATOM   217  C  CB  . LEU A 1 30 ? -12.095 6.881   -13.810 1.00 16.03 ? 27  LEU A CB  1 
ATOM   218  C  CG  . LEU A 1 30 ? -12.946 8.095   -13.275 1.00 17.69 ? 27  LEU A CG  1 
ATOM   219  C  CD1 . LEU A 1 30 ? -12.217 8.809   -12.136 1.00 16.51 ? 27  LEU A CD1 1 
ATOM   220  C  CD2 . LEU A 1 30 ? -13.217 9.092   -14.416 1.00 16.55 ? 27  LEU A CD2 1 
ATOM   221  N  N   . ALA A 1 31 ? -13.852 4.420   -12.648 1.00 14.44 ? 28  ALA A N   1 
ATOM   222  C  CA  . ALA A 1 31 ? -15.018 3.852   -12.000 1.00 14.83 ? 28  ALA A CA  1 
ATOM   223  C  C   . ALA A 1 31 ? -14.685 3.184   -10.664 1.00 17.17 ? 28  ALA A C   1 
ATOM   224  O  O   . ALA A 1 31 ? -15.388 3.418   -9.643  1.00 17.35 ? 28  ALA A O   1 
ATOM   225  C  CB  . ALA A 1 31 ? -15.659 2.825   -12.870 1.00 15.10 ? 28  ALA A CB  1 
ATOM   226  N  N   . TYR A 1 32 ? -13.673 2.306   -10.695 1.00 16.41 ? 29  TYR A N   1 
ATOM   227  C  CA  . TYR A 1 32 ? -13.166 1.656   -9.474  1.00 17.11 ? 29  TYR A CA  1 
ATOM   228  C  C   . TYR A 1 32 ? -12.828 2.670   -8.384  1.00 17.71 ? 29  TYR A C   1 
ATOM   229  O  O   . TYR A 1 32 ? -13.245 2.534   -7.215  1.00 18.28 ? 29  TYR A O   1 
ATOM   230  C  CB  . TYR A 1 32 ? -11.876 0.802   -9.763  1.00 18.02 ? 29  TYR A CB  1 
ATOM   231  C  CG  . TYR A 1 32 ? -11.198 0.293   -8.520  1.00 16.42 ? 29  TYR A CG  1 
ATOM   232  C  CD1 . TYR A 1 32 ? -11.775 -0.707  -7.764  1.00 20.21 ? 29  TYR A CD1 1 
ATOM   233  C  CD2 . TYR A 1 32 ? -10.035 0.834   -8.088  1.00 18.34 ? 29  TYR A CD2 1 
ATOM   234  C  CE1 . TYR A 1 32 ? -11.188 -1.154  -6.590  1.00 20.79 ? 29  TYR A CE1 1 
ATOM   235  C  CE2 . TYR A 1 32 ? -9.441  0.405   -6.922  1.00 20.20 ? 29  TYR A CE2 1 
ATOM   236  C  CZ  . TYR A 1 32 ? -10.030 -0.586  -6.173  1.00 20.03 ? 29  TYR A CZ  1 
ATOM   237  O  OH  . TYR A 1 32 ? -9.361  -0.996  -5.010  1.00 21.68 ? 29  TYR A OH  1 
ATOM   238  N  N   . LYS A 1 33 ? -12.004 3.643   -8.713  1.00 16.87 ? 30  LYS A N   1 
ATOM   239  C  CA  . LYS A 1 33 ? -11.591 4.616   -7.737  1.00 18.13 ? 30  LYS A CA  1 
ATOM   240  C  C   . LYS A 1 33 ? -12.658 5.658   -7.262  1.00 19.66 ? 30  LYS A C   1 
ATOM   241  O  O   . LYS A 1 33 ? -12.507 6.179   -6.213  1.00 19.56 ? 30  LYS A O   1 
ATOM   242  C  CB  . LYS A 1 33 ? -10.392 5.380   -8.220  1.00 20.74 ? 30  LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 33 ? -9.160  4.521   -8.407  1.00 23.39 ? 30  LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 33 ? -7.992  5.407   -8.736  1.00 28.56 ? 30  LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 33 ? -7.423  6.113   -7.504  1.00 35.62 ? 30  LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 33 ? -6.648  7.294   -7.996  1.00 40.78 ? 30  LYS A NZ  1 
ATOM   247  N  N   . SER A 1 34 ? -13.659 5.948   -8.067  1.00 18.24 ? 31  SER A N   1 
ATOM   248  C  CA  A SER A 1 34 ? -14.774 6.828   -7.727  0.50 18.89 ? 31  SER A CA  1 
ATOM   249  C  CA  B SER A 1 34 ? -14.767 6.838   -7.687  0.50 18.76 ? 31  SER A CA  1 
ATOM   250  C  C   . SER A 1 34 ? -15.930 6.123   -7.022  1.00 20.25 ? 31  SER A C   1 
ATOM   251  O  O   . SER A 1 34 ? -16.852 6.767   -6.584  1.00 24.28 ? 31  SER A O   1 
ATOM   252  C  CB  A SER A 1 34 ? -15.305 7.415   -9.027  0.50 17.25 ? 31  SER A CB  1 
ATOM   253  C  CB  B SER A 1 34 ? -15.317 7.550   -8.919  0.50 17.18 ? 31  SER A CB  1 
ATOM   254  O  OG  A SER A 1 34 ? -14.258 8.135   -9.683  0.50 16.99 ? 31  SER A OG  1 
ATOM   255  O  OG  B SER A 1 34 ? -15.855 6.666   -9.866  0.50 16.07 ? 31  SER A OG  1 
ATOM   256  N  N   . ASN A 1 35 ? -15.882 4.802   -7.002  1.00 22.90 ? 32  ASN A N   1 
ATOM   257  C  CA  . ASN A 1 35 ? -16.959 3.925   -6.612  1.00 25.83 ? 32  ASN A CA  1 
ATOM   258  C  C   . ASN A 1 35 ? -18.223 4.131   -7.434  1.00 26.69 ? 32  ASN A C   1 
ATOM   259  O  O   . ASN A 1 35 ? -19.316 4.182   -6.907  1.00 25.49 ? 32  ASN A O   1 
ATOM   260  C  CB  . ASN A 1 35 ? -17.223 4.019   -5.097  1.00 31.73 ? 32  ASN A CB  1 
ATOM   261  C  CG  . ASN A 1 35 ? -17.699 2.687   -4.524  1.00 43.60 ? 32  ASN A CG  1 
ATOM   262  O  OD1 . ASN A 1 35 ? -18.821 2.572   -4.004  1.00 48.02 ? 32  ASN A OD1 1 
ATOM   263  N  ND2 . ASN A 1 35 ? -16.860 1.652   -4.665  1.00 42.67 ? 32  ASN A ND2 1 
ATOM   264  N  N   . LEU A 1 36 ? -18.077 4.243   -8.747  1.00 21.97 ? 33  LEU A N   1 
ATOM   265  C  CA  . LEU A 1 36 ? -19.203 4.452   -9.638  1.00 21.54 ? 33  LEU A CA  1 
ATOM   266  C  C   . LEU A 1 36 ? -19.160 3.345   -10.704 1.00 22.54 ? 33  LEU A C   1 
ATOM   267  O  O   . LEU A 1 36 ? -18.088 2.784   -10.945 1.00 18.75 ? 33  LEU A O   1 
ATOM   268  C  CB  . LEU A 1 36 ? -19.093 5.828   -10.301 1.00 22.10 ? 33  LEU A CB  1 
ATOM   269  C  CG  . LEU A 1 36 ? -19.349 7.075   -9.422  1.00 25.27 ? 33  LEU A CG  1 
ATOM   270  C  CD1 . LEU A 1 36 ? -19.072 8.315   -10.279 1.00 25.51 ? 33  LEU A CD1 1 
ATOM   271  C  CD2 . LEU A 1 36 ? -20.781 7.068   -8.869  1.00 25.66 ? 33  LEU A CD2 1 
ATOM   272  N  N   . ASP A 1 37 ? -20.295 3.037   -11.331 1.00 23.64 ? 34  ASP A N   1 
ATOM   273  C  CA  . ASP A 1 37 ? -20.351 2.010   -12.384 1.00 25.89 ? 34  ASP A CA  1 
ATOM   274  C  C   . ASP A 1 37 ? -19.562 2.420   -13.624 1.00 24.71 ? 34  ASP A C   1 
ATOM   275  O  O   . ASP A 1 37 ? -19.635 3.559   -14.104 1.00 18.62 ? 34  ASP A O   1 
ATOM   276  C  CB  . ASP A 1 37 ? -21.792 1.747   -12.822 1.00 30.72 ? 34  ASP A CB  1 
ATOM   277  C  CG  . ASP A 1 37 ? -22.009 0.302   -13.360 1.00 41.62 ? 34  ASP A CG  1 
ATOM   278  O  OD1 . ASP A 1 37 ? -21.580 -0.089  -14.512 1.00 36.13 ? 34  ASP A OD1 1 
ATOM   279  O  OD2 . ASP A 1 37 ? -22.650 -0.458  -12.582 1.00 50.90 ? 34  ASP A OD2 1 
ATOM   280  N  N   . ARG A 1 38 ? -18.815 1.467   -14.176 1.00 23.82 ? 35  ARG A N   1 
ATOM   281  C  CA  . ARG A 1 38 ? -18.103 1.730   -15.411 1.00 24.25 ? 35  ARG A CA  1 
ATOM   282  C  C   . ARG A 1 38 ? -18.998 2.193   -16.554 1.00 18.63 ? 35  ARG A C   1 
ATOM   283  O  O   . ARG A 1 38 ? -18.557 2.981   -17.334 1.00 18.37 ? 35  ARG A O   1 
ATOM   284  C  CB  . ARG A 1 38 ? -17.186 0.559   -15.825 1.00 28.03 ? 35  ARG A CB  1 
ATOM   285  C  CG  . ARG A 1 38 ? -17.878 -0.683  -16.309 1.00 34.12 ? 35  ARG A CG  1 
ATOM   286  C  CD  . ARG A 1 38 ? -16.785 -1.744  -16.635 1.00 40.63 ? 35  ARG A CD  1 
ATOM   287  N  NE  . ARG A 1 38 ? -17.184 -3.145  -16.757 1.00 48.23 ? 35  ARG A NE  1 
ATOM   288  C  CZ  . ARG A 1 38 ? -18.378 -3.612  -17.150 1.00 56.14 ? 35  ARG A CZ  1 
ATOM   289  N  NH1 . ARG A 1 38 ? -19.387 -2.808  -17.499 1.00 56.87 ? 35  ARG A NH1 1 
ATOM   290  N  NH2 . ARG A 1 38 ? -18.566 -4.930  -17.200 1.00 57.41 ? 35  ARG A NH2 1 
ATOM   291  N  N   . THR A 1 39 ? -20.249 1.754   -16.650 1.00 18.73 ? 36  THR A N   1 
ATOM   292  C  CA  . THR A 1 39 ? -21.089 2.162   -17.726 1.00 19.39 ? 36  THR A CA  1 
ATOM   293  C  C   . THR A 1 39 ? -21.575 3.655   -17.564 1.00 17.89 ? 36  THR A C   1 
ATOM   294  O  O   . THR A 1 39 ? -21.925 4.294   -18.530 1.00 17.77 ? 36  THR A O   1 
ATOM   295  C  CB  . THR A 1 39 ? -22.293 1.243   -17.895 1.00 25.17 ? 36  THR A CB  1 
ATOM   296  O  OG1 . THR A 1 39 ? -23.049 1.281   -16.715 1.00 32.45 ? 36  THR A OG1 1 
ATOM   297  C  CG2 . THR A 1 39 ? -21.836 -0.199  -18.112 1.00 25.91 ? 36  THR A CG2 1 
ATOM   298  N  N   . PHE A 1 40 ? -21.547 4.160   -16.352 1.00 17.15 ? 37  PHE A N   1 
ATOM   299  C  CA  . PHE A 1 40 ? -21.832 5.550   -16.046 1.00 17.13 ? 37  PHE A CA  1 
ATOM   300  C  C   . PHE A 1 40 ? -20.643 6.413   -16.430 1.00 15.22 ? 37  PHE A C   1 
ATOM   301  O  O   . PHE A 1 40 ? -20.815 7.376   -17.143 1.00 14.47 ? 37  PHE A O   1 
ATOM   302  C  CB  . PHE A 1 40 ? -22.120 5.690   -14.544 1.00 19.43 ? 37  PHE A CB  1 
ATOM   303  C  CG  . PHE A 1 40 ? -22.496 7.108   -14.114 1.00 19.33 ? 37  PHE A CG  1 
ATOM   304  C  CD1 . PHE A 1 40 ? -23.478 7.840   -14.795 1.00 21.06 ? 37  PHE A CD1 1 
ATOM   305  C  CD2 . PHE A 1 40 ? -21.930 7.655   -12.997 1.00 23.01 ? 37  PHE A CD2 1 
ATOM   306  C  CE1 . PHE A 1 40 ? -23.851 9.120   -14.361 1.00 19.43 ? 37  PHE A CE1 1 
ATOM   307  C  CE2 . PHE A 1 40 ? -22.300 8.936   -12.566 1.00 24.52 ? 37  PHE A CE2 1 
ATOM   308  C  CZ  . PHE A 1 40 ? -23.255 9.648   -13.261 1.00 19.80 ? 37  PHE A CZ  1 
ATOM   309  N  N   . ILE A 1 41 ? -19.433 6.009   -16.062 1.00 14.45 ? 38  ILE A N   1 
ATOM   310  C  CA  . ILE A 1 41 ? -18.266 6.655   -16.584 1.00 14.82 ? 38  ILE A CA  1 
ATOM   311  C  C   . ILE A 1 41 ? -18.267 6.791   -18.099 1.00 15.23 ? 38  ILE A C   1 
ATOM   312  O  O   . ILE A 1 41 ? -17.940 7.830   -18.657 1.00 13.81 ? 38  ILE A O   1 
ATOM   313  C  CB  . ILE A 1 41 ? -16.990 5.978   -16.077 1.00 15.62 ? 38  ILE A CB  1 
ATOM   314  C  CG1 . ILE A 1 41 ? -16.922 5.996   -14.550 1.00 17.11 ? 38  ILE A CG1 1 
ATOM   315  C  CG2 . ILE A 1 41 ? -15.785 6.725   -16.616 1.00 15.96 ? 38  ILE A CG2 1 
ATOM   316  C  CD1 . ILE A 1 41 ? -17.028 7.356   -13.913 1.00 18.12 ? 38  ILE A CD1 1 
ATOM   317  N  N   . SER A 1 42 ? -18.478 5.671   -18.763 1.00 15.52 ? 39  SER A N   1 
ATOM   318  C  CA  . SER A 1 42 ? -18.487 5.616   -20.208 1.00 16.45 ? 39  SER A CA  1 
ATOM   319  C  C   . SER A 1 42 ? -19.581 6.560   -20.815 1.00 14.03 ? 39  SER A C   1 
ATOM   320  O  O   . SER A 1 42 ? -19.323 7.296   -21.790 1.00 13.97 ? 39  SER A O   1 
ATOM   321  C  CB  . SER A 1 42 ? -18.655 4.124   -20.605 1.00 17.01 ? 39  SER A CB  1 
ATOM   322  O  OG  . SER A 1 42 ? -19.177 3.999   -21.868 1.00 21.17 ? 39  SER A OG  1 
ATOM   323  N  N   . GLY A 1 43 ? -20.774 6.532   -20.251 1.00 13.08 ? 40  GLY A N   1 
ATOM   324  C  CA  . GLY A 1 43 ? -21.844 7.410   -20.712 1.00 13.12 ? 40  GLY A CA  1 
ATOM   325  C  C   . GLY A 1 43 ? -21.510 8.912   -20.588 1.00 12.44 ? 40  GLY A C   1 
ATOM   326  O  O   . GLY A 1 43 ? -21.758 9.673   -21.525 1.00 12.18 ? 40  GLY A O   1 
ATOM   327  N  N   . ILE A 1 44 ? -20.928 9.303   -19.442 1.00 14.53 ? 41  ILE A N   1 
ATOM   328  C  CA  . ILE A 1 44 ? -20.469 10.673  -19.214 1.00 14.58 ? 41  ILE A CA  1 
ATOM   329  C  C   . ILE A 1 44 ? -19.537 11.120  -20.321 1.00 14.65 ? 41  ILE A C   1 
ATOM   330  O  O   . ILE A 1 44 ? -19.737 12.151  -20.944 1.00 12.68 ? 41  ILE A O   1 
ATOM   331  C  CB  . ILE A 1 44 ? -19.808 10.858  -17.821 1.00 16.15 ? 41  ILE A CB  1 
ATOM   332  C  CG1 . ILE A 1 44 ? -20.851 10.673  -16.727 1.00 16.48 ? 41  ILE A CG1 1 
ATOM   333  C  CG2 . ILE A 1 44 ? -19.098 12.207  -17.775 1.00 17.54 ? 41  ILE A CG2 1 
ATOM   334  C  CD1 . ILE A 1 44 ? -20.217 10.413  -15.367 1.00 17.81 ? 41  ILE A CD1 1 
ATOM   335  N  N   . GLU A 1 45 ? -18.509 10.325  -20.589 1.00 15.05 ? 42  GLU A N   1 
ATOM   336  C  CA  . GLU A 1 45 ? -17.515 10.683  -21.580 1.00 14.89 ? 42  GLU A CA  1 
ATOM   337  C  C   . GLU A 1 45 ? -18.022 10.678  -23.012 1.00 14.45 ? 42  GLU A C   1 
ATOM   338  O  O   . GLU A 1 45 ? -17.477 11.338  -23.856 1.00 15.34 ? 42  GLU A O   1 
ATOM   339  C  CB  . GLU A 1 45 ? -16.302 9.733   -21.448 1.00 15.31 ? 42  GLU A CB  1 
ATOM   340  C  CG  . GLU A 1 45 ? -15.562 9.944   -20.131 1.00 16.94 ? 42  GLU A CG  1 
ATOM   341  C  CD  . GLU A 1 45 ? -14.098 9.448   -20.117 1.00 18.22 ? 42  GLU A CD  1 
ATOM   342  O  OE1 . GLU A 1 45 ? -13.435 9.683   -19.087 1.00 16.49 ? 42  GLU A OE1 1 
ATOM   343  O  OE2 . GLU A 1 45 ? -13.614 8.904   -21.144 1.00 18.37 ? 42  GLU A OE2 1 
ATOM   344  N  N   . ARG A 1 46 ? -19.086 9.962   -23.289 1.00 14.72 ? 43  ARG A N   1 
ATOM   345  C  CA  . ARG A 1 46 ? -19.715 9.983   -24.644 1.00 15.91 ? 43  ARG A CA  1 
ATOM   346  C  C   . ARG A 1 46 ? -20.778 11.117  -24.696 1.00 16.68 ? 43  ARG A C   1 
ATOM   347  O  O   . ARG A 1 46 ? -21.586 11.226  -25.635 1.00 16.37 ? 43  ARG A O   1 
ATOM   348  C  CB  . ARG A 1 46 ? -20.320 8.562   -24.772 1.00 17.56 ? 43  ARG A CB  1 
ATOM   349  C  CG  . ARG A 1 46 ? -21.069 8.136   -25.941 1.00 19.45 ? 43  ARG A CG  1 
ATOM   350  C  CD  . ARG A 1 46 ? -21.292 6.664   -25.937 1.00 17.02 ? 43  ARG A CD  1 
ATOM   351  N  NE  . ARG A 1 46 ? -22.440 6.166   -25.147 1.00 18.36 ? 43  ARG A NE  1 
ATOM   352  C  CZ  . ARG A 1 46 ? -23.725 6.327   -25.468 1.00 19.33 ? 43  ARG A CZ  1 
ATOM   353  N  NH1 . ARG A 1 46 ? -24.118 6.955   -26.584 1.00 18.27 ? 43  ARG A NH1 1 
ATOM   354  N  NH2 . ARG A 1 46 ? -24.653 5.783   -24.692 1.00 22.32 ? 43  ARG A NH2 1 
ATOM   355  N  N   . ASN A 1 47 ? -20.807 11.937  -23.660 1.00 17.15 ? 44  ASN A N   1 
ATOM   356  C  CA  . ASN A 1 47 ? -21.750 13.077  -23.591 1.00 18.00 ? 44  ASN A CA  1 
ATOM   357  C  C   . ASN A 1 47 ? -23.202 12.618  -23.613 1.00 17.21 ? 44  ASN A C   1 
ATOM   358  O  O   . ASN A 1 47 ? -24.048 13.324  -24.127 1.00 18.28 ? 44  ASN A O   1 
ATOM   359  C  CB  . ASN A 1 47 ? -21.455 14.090  -24.687 1.00 20.53 ? 44  ASN A CB  1 
ATOM   360  C  CG  . ASN A 1 47 ? -22.082 15.457  -24.401 1.00 26.01 ? 44  ASN A CG  1 
ATOM   361  O  OD1 . ASN A 1 47 ? -22.212 15.888  -23.215 1.00 25.30 ? 44  ASN A OD1 1 
ATOM   362  N  ND2 . ASN A 1 47 ? -22.488 16.160  -25.493 1.00 25.72 ? 44  ASN A ND2 1 
ATOM   363  N  N   . SER A 1 48 ? -23.465 11.472  -22.978 1.00 16.37 ? 45  SER A N   1 
ATOM   364  C  CA  . SER A 1 48 ? -24.756 10.842  -22.920 1.00 17.17 ? 45  SER A CA  1 
ATOM   365  C  C   . SER A 1 48 ? -25.343 10.678  -21.530 1.00 16.91 ? 45  SER A C   1 
ATOM   366  O  O   . SER A 1 48 ? -26.370 10.013  -21.398 1.00 17.20 ? 45  SER A O   1 
ATOM   367  C  CB  . SER A 1 48 ? -24.678 9.487   -23.588 1.00 19.65 ? 45  SER A CB  1 
ATOM   368  O  OG  . SER A 1 48 ? -24.523 9.704   -24.988 1.00 23.41 ? 45  SER A OG  1 
ATOM   369  N  N   . ARG A 1 49 ? -24.734 11.284  -20.516 1.00 15.84 ? 46  ARG A N   1 
ATOM   370  C  CA  . ARG A 1 49 ? -25.199 11.092  -19.126 1.00 18.18 ? 46  ARG A CA  1 
ATOM   371  C  C   . ARG A 1 49 ? -24.912 12.387  -18.370 1.00 17.27 ? 46  ARG A C   1 
ATOM   372  O  O   . ARG A 1 49 ? -23.776 12.915  -18.394 1.00 16.62 ? 46  ARG A O   1 
ATOM   373  C  CB  . ARG A 1 49 ? -24.522 9.900   -18.374 1.00 19.91 ? 46  ARG A CB  1 
ATOM   374  C  CG  . ARG A 1 49 ? -24.878 8.490   -18.808 1.00 24.88 ? 46  ARG A CG  1 
ATOM   375  C  CD  . ARG A 1 49 ? -26.364 8.187   -18.803 1.00 30.57 ? 46  ARG A CD  1 
ATOM   376  N  NE  . ARG A 1 49 ? -26.837 7.856   -17.478 1.00 38.31 ? 46  ARG A NE  1 
ATOM   377  C  CZ  . ARG A 1 49 ? -26.655 6.669   -16.905 1.00 42.33 ? 46  ARG A CZ  1 
ATOM   378  N  NH1 . ARG A 1 49 ? -26.002 5.704   -17.535 1.00 48.72 ? 46  ARG A NH1 1 
ATOM   379  N  NH2 . ARG A 1 49 ? -27.106 6.467   -15.681 1.00 51.71 ? 46  ARG A NH2 1 
ATOM   380  N  N   . ASN A 1 50 ? -25.952 12.854  -17.694 1.00 15.50 ? 47  ASN A N   1 
ATOM   381  C  CA  . ASN A 1 50 ? -25.896 13.968  -16.793 1.00 16.63 ? 47  ASN A CA  1 
ATOM   382  C  C   . ASN A 1 50 ? -25.291 13.398  -15.517 1.00 17.82 ? 47  ASN A C   1 
ATOM   383  O  O   . ASN A 1 50 ? -25.214 12.155  -15.318 1.00 18.27 ? 47  ASN A O   1 
ATOM   384  C  CB  . ASN A 1 50 ? -27.328 14.443  -16.597 1.00 16.85 ? 47  ASN A CB  1 
ATOM   385  C  CG  . ASN A 1 50 ? -27.447 15.821  -15.969 1.00 16.21 ? 47  ASN A CG  1 
ATOM   386  O  OD1 . ASN A 1 50 ? -26.487 16.613  -15.929 1.00 14.70 ? 47  ASN A OD1 1 
ATOM   387  N  ND2 . ASN A 1 50 ? -28.651 16.130  -15.519 1.00 16.76 ? 47  ASN A ND2 1 
ATOM   388  N  N   . LEU A 1 51 ? -24.770 14.253  -14.690 1.00 15.91 ? 48  LEU A N   1 
ATOM   389  C  CA  . LEU A 1 51 ? -24.375 13.840  -13.365 1.00 15.41 ? 48  LEU A CA  1 
ATOM   390  C  C   . LEU A 1 51 ? -24.645 14.913  -12.358 1.00 15.06 ? 48  LEU A C   1 
ATOM   391  O  O   . LEU A 1 51 ? -24.659 16.122  -12.683 1.00 12.94 ? 48  LEU A O   1 
ATOM   392  C  CB  . LEU A 1 51 ? -22.908 13.440  -13.301 1.00 16.84 ? 48  LEU A CB  1 
ATOM   393  C  CG  . LEU A 1 51 ? -21.914 14.566  -13.467 1.00 17.80 ? 48  LEU A CG  1 
ATOM   394  C  CD1 . LEU A 1 51 ? -20.521 14.022  -13.175 1.00 20.27 ? 48  LEU A CD1 1 
ATOM   395  C  CD2 . LEU A 1 51 ? -22.001 15.042  -14.873 1.00 17.74 ? 48  LEU A CD2 1 
ATOM   396  N  N   . THR A 1 52 ? -24.810 14.459  -11.127 1.00 16.46 ? 49  THR A N   1 
ATOM   397  C  CA  . THR A 1 52 ? -25.015 15.370  -9.985  1.00 17.59 ? 49  THR A CA  1 
ATOM   398  C  C   . THR A 1 52 ? -23.681 15.943  -9.536  1.00 17.38 ? 49  THR A C   1 
ATOM   399  O  O   . THR A 1 52 ? -22.611 15.382  -9.817  1.00 15.32 ? 49  THR A O   1 
ATOM   400  C  CB  . THR A 1 52 ? -25.625 14.649  -8.763  1.00 17.71 ? 49  THR A CB  1 
ATOM   401  O  OG1 . THR A 1 52 ? -24.718 13.606  -8.325  1.00 19.39 ? 49  THR A OG1 1 
ATOM   402  C  CG2 . THR A 1 52 ? -27.024 14.125  -9.080  1.00 19.84 ? 49  THR A CG2 1 
ATOM   403  N  N   . ILE A 1 53 ? -23.752 17.066  -8.824  1.00 16.47 ? 50  ILE A N   1 
ATOM   404  C  CA  . ILE A 1 53 ? -22.594 17.633  -8.146  1.00 17.55 ? 50  ILE A CA  1 
ATOM   405  C  C   . ILE A 1 53 ? -21.925 16.622  -7.229  1.00 17.86 ? 50  ILE A C   1 
ATOM   406  O  O   . ILE A 1 53 ? -20.688 16.545  -7.198  1.00 13.86 ? 50  ILE A O   1 
ATOM   407  C  CB  . ILE A 1 53 ? -22.971 18.907  -7.330  1.00 19.32 ? 50  ILE A CB  1 
ATOM   408  C  CG1 . ILE A 1 53 ? -23.405 20.048  -8.256  1.00 22.61 ? 50  ILE A CG1 1 
ATOM   409  C  CG2 . ILE A 1 53 ? -21.835 19.367  -6.399  1.00 21.61 ? 50  ILE A CG2 1 
ATOM   410  C  CD1 . ILE A 1 53 ? -22.470 20.335  -9.387  1.00 25.56 ? 50  ILE A CD1 1 
ATOM   411  N  N   . LYS A 1 54 ? -22.713 15.839  -6.455  1.00 16.35 ? 51  LYS A N   1 
ATOM   412  C  CA  . LYS A 1 54 ? -22.079 14.841  -5.597  1.00 18.86 ? 51  LYS A CA  1 
ATOM   413  C  C   . LYS A 1 54 ? -21.358 13.744  -6.378  1.00 17.70 ? 51  LYS A C   1 
ATOM   414  O  O   . LYS A 1 54 ? -20.308 13.313  -5.931  1.00 17.94 ? 51  LYS A O   1 
ATOM   415  C  CB  . LYS A 1 54 ? -23.079 14.214  -4.600  1.00 23.37 ? 51  LYS A CB  1 
ATOM   416  C  CG  . LYS A 1 54 ? -23.612 15.209  -3.566  1.00 27.51 ? 51  LYS A CG  1 
ATOM   417  C  CD  . LYS A 1 54 ? -24.567 14.514  -2.601  1.00 33.98 ? 51  LYS A CD  1 
ATOM   418  C  CE  . LYS A 1 54 ? -25.242 15.450  -1.616  1.00 40.32 ? 51  LYS A CE  1 
ATOM   419  N  NZ  . LYS A 1 54 ? -25.854 14.586  -0.550  1.00 46.01 ? 51  LYS A NZ  1 
ATOM   420  N  N   . SER A 1 55 ? -21.862 13.320  -7.556  1.00 17.08 ? 52  SER A N   1 
ATOM   421  C  CA  . SER A 1 55 ? -21.102 12.374  -8.397  1.00 16.76 ? 52  SER A CA  1 
ATOM   422  C  C   . SER A 1 55 ? -19.832 12.996  -8.951  1.00 16.30 ? 52  SER A C   1 
ATOM   423  O  O   . SER A 1 55 ? -18.822 12.309  -9.036  1.00 16.89 ? 52  SER A O   1 
ATOM   424  C  CB  . SER A 1 55 ? -21.941 11.800  -9.546  1.00 19.17 ? 52  SER A CB  1 
ATOM   425  O  OG  . SER A 1 55 ? -22.980 11.024  -9.000  1.00 21.40 ? 52  SER A OG  1 
ATOM   426  N  N   . LEU A 1 56 ? -19.854 14.292  -9.251  1.00 14.75 ? 53  LEU A N   1 
ATOM   427  C  CA  . LEU A 1 56 ? -18.669 14.982  -9.734  1.00 15.30 ? 53  LEU A CA  1 
ATOM   428  C  C   . LEU A 1 56 ? -17.625 14.975  -8.639  1.00 17.17 ? 53  LEU A C   1 
ATOM   429  O  O   . LEU A 1 56 ? -16.441 14.782  -8.898  1.00 15.70 ? 53  LEU A O   1 
ATOM   430  C  CB  . LEU A 1 56 ? -18.990 16.396  -10.184 1.00 15.59 ? 53  LEU A CB  1 
ATOM   431  C  CG  . LEU A 1 56 ? -17.803 17.269  -10.611 1.00 15.40 ? 53  LEU A CG  1 
ATOM   432  C  CD1 . LEU A 1 56 ? -17.201 16.721  -11.903 1.00 15.56 ? 53  LEU A CD1 1 
ATOM   433  C  CD2 . LEU A 1 56 ? -18.220 18.683  -10.881 1.00 16.35 ? 53  LEU A CD2 1 
ATOM   434  N  N   . GLU A 1 57 ? -18.060 15.179  -7.402  1.00 17.22 ? 54  GLU A N   1 
ATOM   435  C  CA  . GLU A 1 57 ? -17.110 15.130  -6.303  1.00 18.75 ? 54  GLU A CA  1 
ATOM   436  C  C   . GLU A 1 57 ? -16.477 13.741  -6.174  1.00 16.44 ? 54  GLU A C   1 
ATOM   437  O  O   . GLU A 1 57 ? -15.292 13.636  -5.862  1.00 17.19 ? 54  GLU A O   1 
ATOM   438  C  CB  . GLU A 1 57 ? -17.758 15.462  -4.948  1.00 20.36 ? 54  GLU A CB  1 
ATOM   439  C  CG  . GLU A 1 57 ? -18.164 16.862  -4.721  1.00 21.08 ? 54  GLU A CG  1 
ATOM   440  C  CD  . GLU A 1 57 ? -18.625 17.089  -3.264  1.00 23.01 ? 54  GLU A CD  1 
ATOM   441  O  OE1 . GLU A 1 57 ? -17.939 17.787  -2.459  1.00 19.84 ? 54  GLU A OE1 1 
ATOM   442  O  OE2 . GLU A 1 57 ? -19.711 16.572  -2.984  1.00 22.68 ? 54  GLU A OE2 1 
ATOM   443  N  N   . LEU A 1 58 ? -17.248 12.691  -6.332  1.00 14.47 ? 55  LEU A N   1 
ATOM   444  C  CA  . LEU A 1 58 ? -16.648 11.365  -6.268  1.00 16.19 ? 55  LEU A CA  1 
ATOM   445  C  C   . LEU A 1 58 ? -15.663 11.151  -7.412  1.00 15.48 ? 55  LEU A C   1 
ATOM   446  O  O   . LEU A 1 58 ? -14.624 10.472  -7.249  1.00 15.10 ? 55  LEU A O   1 
ATOM   447  C  CB  . LEU A 1 58 ? -17.695 10.267  -6.320  1.00 18.17 ? 55  LEU A CB  1 
ATOM   448  C  CG  . LEU A 1 58 ? -18.626 10.085  -5.100  1.00 20.74 ? 55  LEU A CG  1 
ATOM   449  C  CD1 . LEU A 1 58 ? -19.816 9.222   -5.489  1.00 21.96 ? 55  LEU A CD1 1 
ATOM   450  C  CD2 . LEU A 1 58 ? -17.902 9.481   -3.903  1.00 25.04 ? 55  LEU A CD2 1 
ATOM   451  N  N   . ILE A 1 59 ? -16.001 11.683  -8.580  1.00 14.46 ? 56  ILE A N   1 
ATOM   452  C  CA  . ILE A 1 59 ? -15.099 11.578  -9.743  1.00 14.48 ? 56  ILE A CA  1 
ATOM   453  C  C   . ILE A 1 59 ? -13.792 12.326  -9.472  1.00 15.47 ? 56  ILE A C   1 
ATOM   454  O  O   . ILE A 1 59 ? -12.683 11.864  -9.820  1.00 15.87 ? 56  ILE A O   1 
ATOM   455  C  CB  . ILE A 1 59 ? -15.835 12.047  -11.024 1.00 14.83 ? 56  ILE A CB  1 
ATOM   456  C  CG1 . ILE A 1 59 ? -16.753 10.916  -11.486 1.00 15.99 ? 56  ILE A CG1 1 
ATOM   457  C  CG2 . ILE A 1 59 ? -14.839 12.476  -12.113 1.00 15.36 ? 56  ILE A CG2 1 
ATOM   458  C  CD1 . ILE A 1 59 ? -17.771 11.269  -12.576 1.00 18.00 ? 56  ILE A CD1 1 
ATOM   459  N  N   . MET A 1 60 ? -13.895 13.513  -8.912  1.00 15.77 ? 57  MET A N   1 
ATOM   460  C  CA  . MET A 1 60 ? -12.685 14.289  -8.570  1.00 17.94 ? 57  MET A CA  1 
ATOM   461  C  C   . MET A 1 60 ? -11.822 13.556  -7.508  1.00 17.93 ? 57  MET A C   1 
ATOM   462  O  O   . MET A 1 60 ? -10.615 13.612  -7.560  1.00 18.06 ? 57  MET A O   1 
ATOM   463  C  CB  . MET A 1 60 ? -13.058 15.678  -8.026  1.00 18.06 ? 57  MET A CB  1 
ATOM   464  C  CG  . MET A 1 60 ? -13.671 16.576  -9.091  1.00 22.29 ? 57  MET A CG  1 
ATOM   465  S  SD  . MET A 1 60 ? -14.081 18.207  -8.454  1.00 29.24 ? 57  MET A SD  1 
ATOM   466  C  CE  . MET A 1 60 ? -15.372 17.933  -7.350  1.00 27.65 ? 57  MET A CE  1 
ATOM   467  N  N   . LYS A 1 61 ? -12.471 12.892  -6.566  1.00 20.14 ? 58  LYS A N   1 
ATOM   468  C  CA  . LYS A 1 61 ? -11.754 12.082  -5.622  1.00 22.43 ? 58  LYS A CA  1 
ATOM   469  C  C   . LYS A 1 61 ? -11.093 10.895  -6.397  1.00 22.77 ? 58  LYS A C   1 
ATOM   470  O  O   . LYS A 1 61 ? -9.931  10.643  -6.193  1.00 23.13 ? 58  LYS A O   1 
ATOM   471  C  CB  . LYS A 1 61 ? -12.646 11.540  -4.541  1.00 25.30 ? 58  LYS A CB  1 
ATOM   472  C  CG  . LYS A 1 61 ? -11.821 10.796  -3.519  1.00 31.09 ? 58  LYS A CG  1 
ATOM   473  C  CD  . LYS A 1 61 ? -12.640 9.946   -2.588  1.00 38.13 ? 58  LYS A CD  1 
ATOM   474  C  CE  . LYS A 1 61 ? -11.706 9.068   -1.781  1.00 41.78 ? 58  LYS A CE  1 
ATOM   475  N  NZ  . LYS A 1 61 ? -12.503 7.945   -1.237  1.00 48.83 ? 58  LYS A NZ  1 
ATOM   476  N  N   . GLY A 1 62 ? -11.824 10.205  -7.268  1.00 20.31 ? 59  GLY A N   1 
ATOM   477  C  CA  . GLY A 1 62 ? -11.204 9.160   -8.114  1.00 20.38 ? 59  GLY A CA  1 
ATOM   478  C  C   . GLY A 1 62 ? -10.043 9.669   -8.957  1.00 20.50 ? 59  GLY A C   1 
ATOM   479  O  O   . GLY A 1 62 ? -9.042  8.963   -9.143  1.00 26.22 ? 59  GLY A O   1 
ATOM   480  N  N   . LEU A 1 63 ? -10.134 10.885  -9.439  1.00 19.36 ? 60  LEU A N   1 
ATOM   481  C  CA  . LEU A 1 63 ? -9.061  11.498  -10.190 1.00 20.25 ? 60  LEU A CA  1 
ATOM   482  C  C   . LEU A 1 63 ? -7.884  12.071  -9.333  1.00 21.80 ? 60  LEU A C   1 
ATOM   483  O  O   . LEU A 1 63 ? -6.859  12.468  -9.918  1.00 23.23 ? 60  LEU A O   1 
ATOM   484  C  CB  . LEU A 1 63 ? -9.585  12.608  -11.093 1.00 18.12 ? 60  LEU A CB  1 
ATOM   485  C  CG  . LEU A 1 63 ? -10.571 12.165  -12.190 1.00 18.02 ? 60  LEU A CG  1 
ATOM   486  C  CD1 . LEU A 1 63 ? -11.316 13.347  -12.722 1.00 19.94 ? 60  LEU A CD1 1 
ATOM   487  C  CD2 . LEU A 1 63 ? -9.838  11.523  -13.343 1.00 18.23 ? 60  LEU A CD2 1 
ATOM   488  N  N   . GLU A 1 64 ? -8.087  12.194  -8.035  1.00 22.46 ? 61  GLU A N   1 
ATOM   489  C  CA  . GLU A 1 64 ? -7.103  12.826  -7.135  1.00 25.06 ? 61  GLU A CA  1 
ATOM   490  C  C   . GLU A 1 64 ? -6.784  14.223  -7.599  1.00 24.20 ? 61  GLU A C   1 
ATOM   491  O  O   . GLU A 1 64 ? -5.640  14.617  -7.778  1.00 22.64 ? 61  GLU A O   1 
ATOM   492  C  CB  . GLU A 1 64 ? -5.857  11.930  -6.996  1.00 26.03 ? 61  GLU A CB  1 
ATOM   493  C  CG  . GLU A 1 64 ? -6.234  10.628  -6.326  1.00 29.17 ? 61  GLU A CG  1 
ATOM   494  C  CD  . GLU A 1 64 ? -5.030  9.706   -6.042  1.00 38.23 ? 61  GLU A CD  1 
ATOM   495  O  OE1 . GLU A 1 64 ? -3.934  9.876   -6.628  1.00 41.58 ? 61  GLU A OE1 1 
ATOM   496  O  OE2 . GLU A 1 64 ? -5.224  8.789   -5.248  1.00 44.04 ? 61  GLU A OE2 1 
ATOM   497  N  N   . VAL A 1 65 ? -7.855  14.982  -7.854  1.00 23.69 ? 62  VAL A N   1 
ATOM   498  C  CA  . VAL A 1 65 ? -7.720  16.363  -8.203  1.00 21.21 ? 62  VAL A CA  1 
ATOM   499  C  C   . VAL A 1 65 ? -8.553  17.168  -7.236  1.00 17.47 ? 62  VAL A C   1 
ATOM   500  O  O   . VAL A 1 65 ? -9.632  16.737  -6.798  1.00 18.71 ? 62  VAL A O   1 
ATOM   501  C  CB  . VAL A 1 65 ? -8.118  16.568  -9.669  1.00 24.57 ? 62  VAL A CB  1 
ATOM   502  C  CG1 . VAL A 1 65 ? -9.621  16.509  -9.876  1.00 25.31 ? 62  VAL A CG1 1 
ATOM   503  C  CG2 . VAL A 1 65 ? -7.587  17.833  -10.159 1.00 28.15 ? 62  VAL A CG2 1 
ATOM   504  N  N   . SER A 1 66 ? -8.025  18.303  -6.827  1.00 17.23 ? 63  SER A N   1 
ATOM   505  C  CA  . SER A 1 66 ? -8.793  19.220  -5.992  1.00 18.10 ? 63  SER A CA  1 
ATOM   506  C  C   . SER A 1 66 ? -9.943  19.886  -6.794  1.00 16.02 ? 63  SER A C   1 
ATOM   507  O  O   . SER A 1 66 ? -9.863  19.981  -8.028  1.00 17.47 ? 63  SER A O   1 
ATOM   508  C  CB  . SER A 1 66 ? -7.907  20.268  -5.346  1.00 17.90 ? 63  SER A CB  1 
ATOM   509  O  OG  . SER A 1 66 ? -7.541  21.295  -6.259  1.00 20.96 ? 63  SER A OG  1 
ATOM   510  N  N   . ASP A 1 67 ? -10.992 20.302  -6.098  1.00 18.11 ? 64  ASP A N   1 
ATOM   511  C  CA  . ASP A 1 67 ? -12.143 21.068  -6.718  1.00 18.66 ? 64  ASP A CA  1 
ATOM   512  C  C   . ASP A 1 67 ? -11.625 22.289  -7.467  1.00 18.96 ? 64  ASP A C   1 
ATOM   513  O  O   . ASP A 1 67 ? -12.045 22.569  -8.610  1.00 18.61 ? 64  ASP A O   1 
ATOM   514  C  CB  . ASP A 1 67 ? -13.120 21.626  -5.690  1.00 24.07 ? 64  ASP A CB  1 
ATOM   515  C  CG  . ASP A 1 67 ? -13.757 20.551  -4.783  1.00 31.37 ? 64  ASP A CG  1 
ATOM   516  O  OD1 . ASP A 1 67 ? -13.753 19.378  -5.169  1.00 39.98 ? 64  ASP A OD1 1 
ATOM   517  O  OD2 . ASP A 1 67 ? -14.260 20.896  -3.690  1.00 35.42 ? 64  ASP A OD2 1 
ATOM   518  N  N   . VAL A 1 68 ? -10.704 23.032  -6.826  1.00 17.70 ? 65  VAL A N   1 
ATOM   519  C  CA  . VAL A 1 68 ? -10.168 24.225  -7.434  1.00 19.41 ? 65  VAL A CA  1 
ATOM   520  C  C   . VAL A 1 68 ? -9.447  23.906  -8.731  1.00 17.91 ? 65  VAL A C   1 
ATOM   521  O  O   . VAL A 1 68 ? -9.629  24.617  -9.716  1.00 17.38 ? 65  VAL A O   1 
ATOM   522  C  CB  . VAL A 1 68 ? -9.201  24.981  -6.499  1.00 20.67 ? 65  VAL A CB  1 
ATOM   523  C  CG1 . VAL A 1 68 ? -8.449  26.042  -7.284  1.00 23.21 ? 65  VAL A CG1 1 
ATOM   524  C  CG2 . VAL A 1 68 ? -9.989  25.569  -5.333  1.00 21.62 ? 65  VAL A CG2 1 
ATOM   525  N  N   . VAL A 1 69 ? -8.588  22.885  -8.740  1.00 18.24 ? 66  VAL A N   1 
ATOM   526  C  CA  . VAL A 1 69 ? -7.886  22.539  -9.978  1.00 16.82 ? 66  VAL A CA  1 
ATOM   527  C  C   . VAL A 1 69 ? -8.880  22.090  -11.096 1.00 16.49 ? 66  VAL A C   1 
ATOM   528  O  O   . VAL A 1 69 ? -8.751  22.420  -12.283 1.00 15.65 ? 66  VAL A O   1 
ATOM   529  C  CB  . VAL A 1 69 ? -6.858  21.433  -9.706  1.00 18.70 ? 66  VAL A CB  1 
ATOM   530  C  CG1 . VAL A 1 69 ? -6.454  20.760  -11.000 1.00 19.26 ? 66  VAL A CG1 1 
ATOM   531  C  CG2 . VAL A 1 69 ? -5.638  22.050  -9.006  1.00 19.41 ? 66  VAL A CG2 1 
ATOM   532  N  N   . PHE A 1 70 ? -9.887  21.340  -10.698 1.00 15.01 ? 67  PHE A N   1 
ATOM   533  C  CA  . PHE A 1 70 ? -10.879 20.915  -11.670 1.00 14.61 ? 67  PHE A CA  1 
ATOM   534  C  C   . PHE A 1 70 ? -11.552 22.115  -12.320 1.00 12.64 ? 67  PHE A C   1 
ATOM   535  O  O   . PHE A 1 70 ? -11.636 22.192  -13.547 1.00 12.07 ? 67  PHE A O   1 
ATOM   536  C  CB  . PHE A 1 70 ? -11.929 19.970  -11.086 1.00 14.27 ? 67  PHE A CB  1 
ATOM   537  C  CG  . PHE A 1 70 ? -12.874 19.422  -12.136 1.00 14.75 ? 67  PHE A CG  1 
ATOM   538  C  CD1 . PHE A 1 70 ? -14.018 20.111  -12.447 1.00 15.77 ? 67  PHE A CD1 1 
ATOM   539  C  CD2 . PHE A 1 70 ? -12.617 18.217  -12.792 1.00 15.38 ? 67  PHE A CD2 1 
ATOM   540  C  CE1 . PHE A 1 70 ? -14.883 19.649  -13.436 1.00 16.78 ? 67  PHE A CE1 1 
ATOM   541  C  CE2 . PHE A 1 70 ? -13.511 17.717  -13.758 1.00 17.29 ? 67  PHE A CE2 1 
ATOM   542  C  CZ  . PHE A 1 70 ? -14.637 18.463  -14.098 1.00 16.89 ? 67  PHE A CZ  1 
ATOM   543  N  N   . PHE A 1 71 ? -11.997 23.041  -11.514 1.00 13.94 ? 68  PHE A N   1 
ATOM   544  C  CA  . PHE A 1 71 ? -12.633 24.251  -12.034 1.00 14.25 ? 68  PHE A CA  1 
ATOM   545  C  C   . PHE A 1 71 ? -11.734 25.188  -12.830 1.00 14.27 ? 68  PHE A C   1 
ATOM   546  O  O   . PHE A 1 71 ? -12.227 25.825  -13.794 1.00 12.19 ? 68  PHE A O   1 
ATOM   547  C  CB  . PHE A 1 71 ? -13.483 24.924  -10.979 1.00 14.73 ? 68  PHE A CB  1 
ATOM   548  C  CG  . PHE A 1 71 ? -14.677 24.085  -10.590 1.00 16.73 ? 68  PHE A CG  1 
ATOM   549  C  CD1 . PHE A 1 71 ? -15.663 23.790  -11.514 1.00 20.58 ? 68  PHE A CD1 1 
ATOM   550  C  CD2 . PHE A 1 71 ? -14.800 23.549  -9.322  1.00 19.46 ? 68  PHE A CD2 1 
ATOM   551  C  CE1 . PHE A 1 71 ? -16.776 22.990  -11.166 1.00 21.07 ? 68  PHE A CE1 1 
ATOM   552  C  CE2 . PHE A 1 71 ? -15.864 22.718  -8.983  1.00 20.87 ? 68  PHE A CE2 1 
ATOM   553  C  CZ  . PHE A 1 71 ? -16.850 22.438  -9.911  1.00 21.58 ? 68  PHE A CZ  1 
ATOM   554  N  N   . GLU A 1 72 ? -10.445 25.294  -12.447 1.00 14.46 ? 69  GLU A N   1 
ATOM   555  C  CA  . GLU A 1 72 ? -9.474  25.986  -13.295 1.00 16.52 ? 69  GLU A CA  1 
ATOM   556  C  C   . GLU A 1 72 ? -9.341  25.393  -14.662 1.00 15.44 ? 69  GLU A C   1 
ATOM   557  O  O   . GLU A 1 72 ? -9.273  26.113  -15.691 1.00 14.45 ? 69  GLU A O   1 
ATOM   558  C  CB  . GLU A 1 72 ? -8.080  26.061  -12.618 1.00 18.20 ? 69  GLU A CB  1 
ATOM   559  C  CG  . GLU A 1 72 ? -8.054  26.982  -11.419 1.00 21.16 ? 69  GLU A CG  1 
ATOM   560  C  CD  . GLU A 1 72 ? -6.667  26.996  -10.738 1.00 27.07 ? 69  GLU A CD  1 
ATOM   561  O  OE1 . GLU A 1 72 ? -5.911  25.982  -10.868 1.00 29.37 ? 69  GLU A OE1 1 
ATOM   562  O  OE2 . GLU A 1 72 ? -6.382  27.993  -10.048 1.00 32.14 ? 69  GLU A OE2 1 
ATOM   563  N  N   . MET A 1 73 ? -9.314  24.075  -14.722 1.00 15.91 ? 70  MET A N   1 
ATOM   564  C  CA  . MET A 1 73 ? -9.204  23.416  -15.979 1.00 17.21 ? 70  MET A CA  1 
ATOM   565  C  C   . MET A 1 73 ? -10.475 23.614  -16.827 1.00 16.23 ? 70  MET A C   1 
ATOM   566  O  O   . MET A 1 73 ? -10.409 23.720  -18.034 1.00 14.05 ? 70  MET A O   1 
ATOM   567  C  CB  . MET A 1 73 ? -8.886  21.944  -15.816 1.00 17.66 ? 70  MET A CB  1 
ATOM   568  C  CG  . MET A 1 73 ? -7.492  21.735  -15.227 1.00 22.85 ? 70  MET A CG  1 
ATOM   569  S  SD  . MET A 1 73 ? -6.999  19.993  -15.156 1.00 27.30 ? 70  MET A SD  1 
ATOM   570  C  CE  . MET A 1 73 ? -6.895  19.609  -16.929 1.00 27.25 ? 70  MET A CE  1 
ATOM   571  N  N   . LEU A 1 74 ? -11.621 23.590  -16.165 1.00 13.96 ? 71  LEU A N   1 
ATOM   572  C  CA  . LEU A 1 74 ? -12.898 23.801  -16.829 1.00 12.86 ? 71  LEU A CA  1 
ATOM   573  C  C   . LEU A 1 74 ? -12.987 25.191  -17.439 1.00 13.12 ? 71  LEU A C   1 
ATOM   574  O  O   . LEU A 1 74 ? -13.401 25.364  -18.573 1.00 14.13 ? 71  LEU A O   1 
ATOM   575  C  CB  . LEU A 1 74 ? -14.019 23.528  -15.847 1.00 12.42 ? 71  LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 74 ? -15.426 23.705  -16.374 1.00 12.16 ? 71  LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 74 ? -15.741 22.717  -17.476 1.00 13.02 ? 71  LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 74 ? -16.389 23.476  -15.225 1.00 12.54 ? 71  LEU A CD2 1 
ATOM   579  N  N   . ILE A 1 75 ? -12.535 26.191  -16.704 1.00 14.98 ? 72  ILE A N   1 
ATOM   580  C  CA  . ILE A 1 75 ? -12.509 27.552  -17.166 1.00 14.98 ? 72  ILE A CA  1 
ATOM   581  C  C   . ILE A 1 75 ? -11.621 27.636  -18.407 1.00 16.82 ? 72  ILE A C   1 
ATOM   582  O  O   . ILE A 1 75 ? -11.982 28.227  -19.403 1.00 16.12 ? 72  ILE A O   1 
ATOM   583  C  CB  . ILE A 1 75 ? -12.037 28.503  -16.032 1.00 15.05 ? 72  ILE A CB  1 
ATOM   584  C  CG1 . ILE A 1 75 ? -13.186 28.712  -15.052 1.00 15.35 ? 72  ILE A CG1 1 
ATOM   585  C  CG2 . ILE A 1 75 ? -11.554 29.847  -16.567 1.00 16.27 ? 72  ILE A CG2 1 
ATOM   586  C  CD1 . ILE A 1 75 ? -12.828 29.351  -13.762 1.00 16.74 ? 72  ILE A CD1 1 
ATOM   587  N  N   . LYS A 1 76 ? -10.449 27.062  -18.340 1.00 17.28 ? 73  LYS A N   1 
ATOM   588  C  CA  . LYS A 1 76 ? -9.559  27.085  -19.516 1.00 19.39 ? 73  LYS A CA  1 
ATOM   589  C  C   . LYS A 1 76 ? -10.143 26.439  -20.732 1.00 19.18 ? 73  LYS A C   1 
ATOM   590  O  O   . LYS A 1 76 ? -9.969  26.950  -21.850 1.00 18.67 ? 73  LYS A O   1 
ATOM   591  C  CB  . LYS A 1 76 ? -8.218  26.413  -19.175 1.00 22.71 ? 73  LYS A CB  1 
ATOM   592  C  CG  . LYS A 1 76 ? -7.413  27.228  -18.220 1.00 27.21 ? 73  LYS A CG  1 
ATOM   593  C  CD  . LYS A 1 76 ? -6.328  26.362  -17.533 1.00 36.45 ? 73  LYS A CD  1 
ATOM   594  C  CE  . LYS A 1 76 ? -5.218  25.950  -18.482 1.00 43.44 ? 73  LYS A CE  1 
ATOM   595  N  NZ  . LYS A 1 76 ? -4.291  27.089  -18.817 1.00 56.57 ? 73  LYS A NZ  1 
ATOM   596  N  N   . GLU A 1 77 ? -10.817 25.300  -20.557 1.00 20.10 ? 74  GLU A N   1 
ATOM   597  C  CA  . GLU A 1 77 ? -11.418 24.624  -21.678 1.00 20.81 ? 74  GLU A CA  1 
ATOM   598  C  C   . GLU A 1 77 ? -12.603 25.396  -22.244 1.00 21.67 ? 74  GLU A C   1 
ATOM   599  O  O   . GLU A 1 77 ? -12.831 25.388  -23.451 1.00 22.99 ? 74  GLU A O   1 
ATOM   600  C  CB  . GLU A 1 77 ? -11.915 23.235  -21.313 1.00 25.21 ? 74  GLU A CB  1 
ATOM   601  C  CG  . GLU A 1 77 ? -10.797 22.239  -21.043 1.00 29.76 ? 74  GLU A CG  1 
ATOM   602  C  CD  . GLU A 1 77 ? -9.840  22.112  -22.199 1.00 29.01 ? 74  GLU A CD  1 
ATOM   603  O  OE1 . GLU A 1 77 ? -8.630  22.280  -21.983 1.00 34.05 ? 74  GLU A OE1 1 
ATOM   604  O  OE2 . GLU A 1 77 ? -10.324 21.940  -23.322 1.00 32.81 ? 74  GLU A OE2 1 
ATOM   605  N  N   . ILE A 1 78 ? -13.388 26.025  -21.390 1.00 19.50 ? 75  ILE A N   1 
ATOM   606  C  CA  . ILE A 1 78 ? -14.466 26.918  -21.873 1.00 19.53 ? 75  ILE A CA  1 
ATOM   607  C  C   . ILE A 1 78 ? -13.912 28.098  -22.667 1.00 21.61 ? 75  ILE A C   1 
ATOM   608  O  O   . ILE A 1 78 ? -14.480 28.457  -23.707 1.00 23.68 ? 75  ILE A O   1 
ATOM   609  C  CB  . ILE A 1 78 ? -15.356 27.460  -20.721 1.00 18.27 ? 75  ILE A CB  1 
ATOM   610  C  CG1 . ILE A 1 78 ? -16.190 26.287  -20.159 1.00 18.49 ? 75  ILE A CG1 1 
ATOM   611  C  CG2 . ILE A 1 78 ? -16.286 28.558  -21.274 1.00 19.25 ? 75  ILE A CG2 1 
ATOM   612  C  CD1 . ILE A 1 78 ? -16.796 26.548  -18.808 1.00 20.10 ? 75  ILE A CD1 1 
ATOM   613  N  N   . LEU A 1 79 ? -12.828 28.683  -22.174 1.00 19.90 ? 76  LEU A N   1 
ATOM   614  C  CA  . LEU A 1 79 ? -12.153 29.831  -22.878 1.00 22.95 ? 76  LEU A CA  1 
ATOM   615  C  C   . LEU A 1 79 ? -11.521 29.504  -24.208 1.00 26.79 ? 76  LEU A C   1 
ATOM   616  O  O   . LEU A 1 79 ? -11.524 30.339  -25.146 1.00 25.56 ? 76  LEU A O   1 
ATOM   617  C  CB  . LEU A 1 79 ? -11.082 30.469  -21.995 1.00 22.08 ? 76  LEU A CB  1 
ATOM   618  C  CG  . LEU A 1 79 ? -11.608 31.205  -20.769 1.00 23.86 ? 76  LEU A CG  1 
ATOM   619  C  CD1 . LEU A 1 79 ? -10.474 31.635  -19.838 1.00 27.32 ? 76  LEU A CD1 1 
ATOM   620  C  CD2 . LEU A 1 79 ? -12.453 32.384  -21.189 1.00 25.44 ? 76  LEU A CD2 1 
ATOM   621  N  N   . LYS A 1 80 ? -10.936 28.325  -24.290 1.00 30.01 ? 77  LYS A N   1 
ATOM   622  C  CA  . LYS A 1 80 ? -10.345 27.838  -25.526 1.00 36.00 ? 77  LYS A CA  1 
ATOM   623  C  C   . LYS A 1 80 ? -11.384 27.362  -26.550 1.00 37.79 ? 77  LYS A C   1 
ATOM   624  O  O   . LYS A 1 80 ? -11.055 27.262  -27.731 1.00 42.00 ? 77  LYS A O   1 
ATOM   625  C  CB  . LYS A 1 80 ? -9.348  26.704  -25.237 1.00 38.91 ? 77  LYS A CB  1 
ATOM   626  C  CG  . LYS A 1 80 ? -8.118  27.174  -24.483 1.00 42.26 ? 77  LYS A CG  1 
ATOM   627  C  CD  . LYS A 1 80 ? -7.025  26.104  -24.415 1.00 47.83 ? 77  LYS A CD  1 
ATOM   628  C  CE  . LYS A 1 80 ? -7.322  25.030  -23.385 1.00 50.02 ? 77  LYS A CE  1 
ATOM   629  N  NZ  . LYS A 1 80 ? -6.879  23.678  -23.832 1.00 54.55 ? 77  LYS A NZ  1 
ATOM   630  N  N   . HIS A 1 81 ? -12.619 27.052  -26.140 1.00 38.77 ? 78  HIS A N   1 
ATOM   631  C  CA  . HIS A 1 81 ? -13.709 26.810  -27.111 1.00 41.25 ? 78  HIS A CA  1 
ATOM   632  C  C   . HIS A 1 81 ? -13.862 28.189  -27.718 1.00 46.91 ? 78  HIS A C   1 
ATOM   633  O  O   . HIS A 1 81 ? -13.721 29.184  -27.004 1.00 62.71 ? 78  HIS A O   1 
ATOM   634  C  CB  . HIS A 1 81 ? -15.045 26.421  -26.420 1.00 38.67 ? 78  HIS A CB  1 
ATOM   635  C  CG  . HIS A 1 81 ? -16.194 26.128  -27.358 1.00 38.33 ? 78  HIS A CG  1 
ATOM   636  N  ND1 . HIS A 1 81 ? -16.620 24.849  -27.653 1.00 40.41 ? 78  HIS A ND1 1 
ATOM   637  C  CD2 . HIS A 1 81 ? -17.030 26.952  -28.032 1.00 40.96 ? 78  HIS A CD2 1 
ATOM   638  C  CE1 . HIS A 1 81 ? -17.649 24.895  -28.480 1.00 42.68 ? 78  HIS A CE1 1 
ATOM   639  N  NE2 . HIS A 1 81 ? -17.914 26.164  -28.732 1.00 42.65 ? 78  HIS A NE2 1 
ATOM   640  N  N   . ASP A 1 82 ? -14.177 28.281  -28.990 1.00 45.89 ? 79  ASP A N   1 
ATOM   641  C  CA  . ASP A 1 82 ? -14.580 29.579  -29.538 1.00 53.09 ? 79  ASP A CA  1 
ATOM   642  C  C   . ASP A 1 82 ? -15.975 30.129  -29.188 1.00 56.57 ? 79  ASP A C   1 
ATOM   643  O  O   . ASP A 1 82 ? -16.969 29.589  -29.698 1.00 63.97 ? 79  ASP A O   1 
ATOM   644  C  CB  . ASP A 1 82 ? -14.421 29.569  -31.036 1.00 54.50 ? 79  ASP A CB  1 
ATOM   645  C  CG  . ASP A 1 82 ? -13.155 30.191  -31.436 1.00 50.78 ? 79  ASP A CG  1 
ATOM   646  O  OD1 . ASP A 1 82 ? -12.317 30.450  -30.527 1.00 53.24 ? 79  ASP A OD1 1 
ATOM   647  O  OD2 . ASP A 1 82 ? -13.026 30.430  -32.634 1.00 48.53 ? 79  ASP A OD2 1 
ATOM   648  O  OXT . ASP A 1 82 ? -16.110 31.137  -28.439 1.00 40.29 ? 79  ASP A OXT 1 
ATOM   649  N  N   . SER B 1 6  ? -30.356 -0.250  -18.856 1.00 24.03 ? 3   SER B N   1 
ATOM   650  C  CA  . SER B 1 6  ? -29.975 0.453   -20.141 1.00 19.62 ? 3   SER B CA  1 
ATOM   651  C  C   . SER B 1 6  ? -30.695 1.753   -20.163 1.00 20.79 ? 3   SER B C   1 
ATOM   652  O  O   . SER B 1 6  ? -31.970 1.779   -20.136 1.00 20.16 ? 3   SER B O   1 
ATOM   653  C  CB  . SER B 1 6  ? -30.337 -0.382  -21.383 1.00 21.38 ? 3   SER B CB  1 
ATOM   654  O  OG  . SER B 1 6  ? -30.557 0.438   -22.563 1.00 22.58 ? 3   SER B OG  1 
ATOM   655  N  N   . PHE B 1 7  ? -29.942 2.855   -20.201 1.00 18.89 ? 4   PHE B N   1 
ATOM   656  C  CA  . PHE B 1 7  ? -30.579 4.180   -20.251 1.00 20.12 ? 4   PHE B CA  1 
ATOM   657  C  C   . PHE B 1 7  ? -31.433 4.325   -21.508 1.00 17.83 ? 4   PHE B C   1 
ATOM   658  O  O   . PHE B 1 7  ? -32.572 4.810   -21.460 1.00 15.72 ? 4   PHE B O   1 
ATOM   659  C  CB  . PHE B 1 7  ? -29.534 5.336   -20.143 1.00 20.73 ? 4   PHE B CB  1 
ATOM   660  C  CG  . PHE B 1 7  ? -30.145 6.715   -20.247 1.00 20.91 ? 4   PHE B CG  1 
ATOM   661  C  CD1 . PHE B 1 7  ? -30.971 7.230   -19.218 1.00 24.95 ? 4   PHE B CD1 1 
ATOM   662  C  CD2 . PHE B 1 7  ? -29.909 7.508   -21.354 1.00 22.53 ? 4   PHE B CD2 1 
ATOM   663  C  CE1 . PHE B 1 7  ? -31.573 8.485   -19.342 1.00 24.16 ? 4   PHE B CE1 1 
ATOM   664  C  CE2 . PHE B 1 7  ? -30.484 8.763   -21.464 1.00 24.25 ? 4   PHE B CE2 1 
ATOM   665  C  CZ  . PHE B 1 7  ? -31.290 9.270   -20.460 1.00 23.68 ? 4   PHE B CZ  1 
ATOM   666  N  N   . LEU B 1 8  ? -30.863 3.928   -22.650 1.00 17.85 ? 5   LEU B N   1 
ATOM   667  C  CA  . LEU B 1 8  ? -31.541 4.118   -23.922 1.00 17.79 ? 5   LEU B CA  1 
ATOM   668  C  C   . LEU B 1 8  ? -32.873 3.383   -23.918 1.00 15.84 ? 5   LEU B C   1 
ATOM   669  O  O   . LEU B 1 8  ? -33.854 3.932   -24.371 1.00 15.69 ? 5   LEU B O   1 
ATOM   670  C  CB  . LEU B 1 8  ? -30.702 3.604   -25.093 1.00 19.39 ? 5   LEU B CB  1 
ATOM   671  C  CG  . LEU B 1 8  ? -30.814 4.203   -26.478 1.00 23.58 ? 5   LEU B CG  1 
ATOM   672  C  CD1 . LEU B 1 8  ? -30.480 3.280   -27.636 1.00 23.36 ? 5   LEU B CD1 1 
ATOM   673  C  CD2 . LEU B 1 8  ? -32.005 5.134   -26.695 1.00 21.87 ? 5   LEU B CD2 1 
ATOM   674  N  N   . LEU B 1 9  ? -32.853 2.129   -23.514 1.00 16.52 ? 6   LEU B N   1 
ATOM   675  C  CA  . LEU B 1 9  ? -34.082 1.318   -23.439 1.00 17.79 ? 6   LEU B CA  1 
ATOM   676  C  C   . LEU B 1 9  ? -35.151 1.968   -22.551 1.00 16.16 ? 6   LEU B C   1 
ATOM   677  O  O   . LEU B 1 9  ? -36.335 2.102   -22.968 1.00 15.50 ? 6   LEU B O   1 
ATOM   678  C  CB  . LEU B 1 9  ? -33.795 -0.093  -23.015 1.00 20.93 ? 6   LEU B CB  1 
ATOM   679  C  CG  . LEU B 1 9  ? -34.920 -1.126  -23.079 1.00 23.98 ? 6   LEU B CG  1 
ATOM   680  C  CD1 . LEU B 1 9  ? -35.615 -1.190  -24.439 1.00 22.28 ? 6   LEU B CD1 1 
ATOM   681  C  CD2 . LEU B 1 9  ? -34.320 -2.463  -22.715 1.00 26.12 ? 6   LEU B CD2 1 
ATOM   682  N  N   . SER B 1 10 ? -34.734 2.517   -21.411 1.00 15.48 ? 7   SER B N   1 
ATOM   683  C  CA  . SER B 1 10 ? -35.707 3.197   -20.537 1.00 16.38 ? 7   SER B CA  1 
ATOM   684  C  C   . SER B 1 10 ? -36.342 4.386   -21.223 1.00 16.63 ? 7   SER B C   1 
ATOM   685  O  O   . SER B 1 10 ? -37.503 4.727   -20.989 1.00 15.60 ? 7   SER B O   1 
ATOM   686  C  CB  . SER B 1 10 ? -35.052 3.635   -19.187 1.00 18.64 ? 7   SER B CB  1 
ATOM   687  O  OG  . SER B 1 10 ? -34.191 4.754   -19.400 1.00 20.22 ? 7   SER B OG  1 
ATOM   688  N  N   . LYS B 1 11 ? -35.576 5.108   -22.051 1.00 14.77 ? 8   LYS B N   1 
ATOM   689  C  CA  . LYS B 1 11 ? -36.136 6.284   -22.691 1.00 14.55 ? 8   LYS B CA  1 
ATOM   690  C  C   . LYS B 1 11 ? -37.024 5.934   -23.885 1.00 12.64 ? 8   LYS B C   1 
ATOM   691  O  O   . LYS B 1 11 ? -38.010 6.648   -24.120 1.00 10.97 ? 8   LYS B O   1 
ATOM   692  C  CB  . LYS B 1 11 ? -35.026 7.308   -23.091 1.00 15.72 ? 8   LYS B CB  1 
ATOM   693  C  CG  . LYS B 1 11 ? -34.367 7.977   -21.848 1.00 19.49 ? 8   LYS B CG  1 
ATOM   694  C  CD  . LYS B 1 11 ? -35.302 9.061   -21.272 1.00 22.73 ? 8   LYS B CD  1 
ATOM   695  C  CE  . LYS B 1 11 ? -35.888 8.826   -19.960 1.00 29.28 ? 8   LYS B CE  1 
ATOM   696  N  NZ  . LYS B 1 11 ? -36.689 10.071  -19.633 1.00 28.69 ? 8   LYS B NZ  1 
ATOM   697  N  N   . VAL B 1 12 ? -36.625 4.933   -24.672 1.00 12.46 ? 9   VAL B N   1 
ATOM   698  C  CA  . VAL B 1 12 ? -37.465 4.451   -25.749 1.00 12.49 ? 9   VAL B CA  1 
ATOM   699  C  C   . VAL B 1 12 ? -38.853 3.992   -25.172 1.00 13.18 ? 9   VAL B C   1 
ATOM   700  O  O   . VAL B 1 12 ? -39.881 4.371   -25.685 1.00 12.13 ? 9   VAL B O   1 
ATOM   701  C  CB  . VAL B 1 12 ? -36.752 3.352   -26.534 1.00 13.38 ? 9   VAL B CB  1 
ATOM   702  C  CG1 . VAL B 1 12 ? -37.697 2.710   -27.537 1.00 14.91 ? 9   VAL B CG1 1 
ATOM   703  C  CG2 . VAL B 1 12 ? -35.532 3.948   -27.274 1.00 13.32 ? 9   VAL B CG2 1 
ATOM   704  N  N   . SER B 1 13 ? -38.846 3.216   -24.084 1.00 13.95 ? 10  SER B N   1 
ATOM   705  C  CA  . SER B 1 13 ? -40.097 2.778   -23.415 1.00 14.78 ? 10  SER B CA  1 
ATOM   706  C  C   . SER B 1 13 ? -40.926 3.914   -22.935 1.00 15.11 ? 10  SER B C   1 
ATOM   707  O  O   . SER B 1 13 ? -42.143 3.919   -23.053 1.00 16.41 ? 10  SER B O   1 
ATOM   708  C  CB  . SER B 1 13 ? -39.717 1.912   -22.217 1.00 16.45 ? 10  SER B CB  1 
ATOM   709  O  OG  . SER B 1 13 ? -38.949 0.789   -22.746 1.00 24.49 ? 10  SER B OG  1 
ATOM   710  N  N   . PHE B 1 14 ? -40.263 4.898   -22.343 1.00 15.46 ? 11  PHE B N   1 
ATOM   711  C  CA  . PHE B 1 14 ? -40.914 6.089   -21.868 1.00 16.79 ? 11  PHE B CA  1 
ATOM   712  C  C   . PHE B 1 14 ? -41.604 6.854   -22.962 1.00 16.84 ? 11  PHE B C   1 
ATOM   713  O  O   . PHE B 1 14 ? -42.750 7.375   -22.795 1.00 14.54 ? 11  PHE B O   1 
ATOM   714  C  CB  . PHE B 1 14 ? -39.900 7.008   -21.178 1.00 19.24 ? 11  PHE B CB  1 
ATOM   715  C  CG  . PHE B 1 14 ? -40.501 8.243   -20.632 1.00 24.84 ? 11  PHE B CG  1 
ATOM   716  C  CD1 . PHE B 1 14 ? -41.028 8.257   -19.352 1.00 29.52 ? 11  PHE B CD1 1 
ATOM   717  C  CD2 . PHE B 1 14 ? -40.538 9.394   -21.400 1.00 25.15 ? 11  PHE B CD2 1 
ATOM   718  C  CE1 . PHE B 1 14 ? -41.556 9.428   -18.838 1.00 33.53 ? 11  PHE B CE1 1 
ATOM   719  C  CE2 . PHE B 1 14 ? -41.098 10.556  -20.899 1.00 30.60 ? 11  PHE B CE2 1 
ATOM   720  C  CZ  . PHE B 1 14 ? -41.587 10.578  -19.609 1.00 33.67 ? 11  PHE B CZ  1 
ATOM   721  N  N   . VAL B 1 15 ? -40.944 6.956   -24.106 1.00 13.71 ? 12  VAL B N   1 
ATOM   722  C  CA  . VAL B 1 15 ? -41.566 7.668   -25.207 1.00 13.21 ? 12  VAL B CA  1 
ATOM   723  C  C   . VAL B 1 15 ? -42.755 6.907   -25.801 1.00 11.42 ? 12  VAL B C   1 
ATOM   724  O  O   . VAL B 1 15 ? -43.767 7.500   -26.185 1.00 10.95 ? 12  VAL B O   1 
ATOM   725  C  CB  . VAL B 1 15 ? -40.550 8.070   -26.296 1.00 13.68 ? 12  VAL B CB  1 
ATOM   726  C  CG1 . VAL B 1 15 ? -41.236 8.568   -27.549 1.00 14.74 ? 12  VAL B CG1 1 
ATOM   727  C  CG2 . VAL B 1 15 ? -39.601 9.168   -25.778 1.00 14.33 ? 12  VAL B CG2 1 
ATOM   728  N  N   . ILE B 1 16 ? -42.640 5.593   -25.876 1.00 12.16 ? 13  ILE B N   1 
ATOM   729  C  CA  . ILE B 1 16 ? -43.792 4.792   -26.329 1.00 12.35 ? 13  ILE B CA  1 
ATOM   730  C  C   . ILE B 1 16 ? -45.026 5.079   -25.410 1.00 13.41 ? 13  ILE B C   1 
ATOM   731  O  O   . ILE B 1 16 ? -46.180 5.305   -25.882 1.00 14.69 ? 13  ILE B O   1 
ATOM   732  C  CB  . ILE B 1 16 ? -43.398 3.330   -26.286 1.00 12.05 ? 13  ILE B CB  1 
ATOM   733  C  CG1 . ILE B 1 16 ? -42.430 3.003   -27.445 1.00 10.86 ? 13  ILE B CG1 1 
ATOM   734  C  CG2 . ILE B 1 16 ? -44.646 2.441   -26.428 1.00 13.35 ? 13  ILE B CG2 1 
ATOM   735  C  CD1 . ILE B 1 16 ? -41.708 1.690   -27.332 1.00 11.26 ? 13  ILE B CD1 1 
ATOM   736  N  N   . LYS B 1 17 ? -44.787 4.983   -24.107 1.00 13.42 ? 14  LYS B N   1 
ATOM   737  C  CA  . LYS B 1 17 ? -45.845 5.223   -23.075 1.00 14.31 ? 14  LYS B CA  1 
ATOM   738  C  C   . LYS B 1 17 ? -46.471 6.616   -23.212 1.00 15.90 ? 14  LYS B C   1 
ATOM   739  O  O   . LYS B 1 17 ? -47.721 6.784   -23.237 1.00 15.21 ? 14  LYS B O   1 
ATOM   740  C  CB  . LYS B 1 17 ? -45.265 4.985   -21.695 1.00 16.13 ? 14  LYS B CB  1 
ATOM   741  C  CG  . LYS B 1 17 ? -46.287 5.278   -20.589 1.00 17.83 ? 14  LYS B CG  1 
ATOM   742  C  CD  . LYS B 1 17 ? -45.831 4.751   -19.274 1.00 21.04 ? 14  LYS B CD  1 
ATOM   743  C  CE  . LYS B 1 17 ? -46.889 5.138   -18.252 1.00 26.44 ? 14  LYS B CE  1 
ATOM   744  N  NZ  . LYS B 1 17 ? -46.673 4.438   -16.981 1.00 29.40 ? 14  LYS B NZ  1 
ATOM   745  N  N   . LYS B 1 18 ? -45.616 7.632   -23.397 1.00 14.80 ? 15  LYS B N   1 
ATOM   746  C  CA  . LYS B 1 18 ? -46.074 8.990   -23.491 1.00 15.94 ? 15  LYS B CA  1 
ATOM   747  C  C   . LYS B 1 18 ? -46.930 9.231   -24.723 1.00 16.86 ? 15  LYS B C   1 
ATOM   748  O  O   . LYS B 1 18 ? -47.992 9.880   -24.648 1.00 13.93 ? 15  LYS B O   1 
ATOM   749  C  CB  . LYS B 1 18 ? -44.861 9.954   -23.524 1.00 18.23 ? 15  LYS B CB  1 
ATOM   750  C  CG  . LYS B 1 18 ? -45.197 11.410  -23.706 1.00 21.68 ? 15  LYS B CG  1 
ATOM   751  C  CD  . LYS B 1 18 ? -43.952 12.296  -23.428 1.00 23.94 ? 15  LYS B CD  1 
ATOM   752  C  CE  . LYS B 1 18 ? -44.345 13.695  -22.939 1.00 29.23 ? 15  LYS B CE  1 
ATOM   753  N  NZ  . LYS B 1 18 ? -44.656 14.450  -24.166 1.00 33.64 ? 15  LYS B NZ  1 
ATOM   754  N  N   . ILE B 1 19 ? -46.522 8.670   -25.863 1.00 15.12 ? 16  ILE B N   1 
ATOM   755  C  CA  . ILE B 1 19 ? -47.298 8.806   -27.047 1.00 15.13 ? 16  ILE B CA  1 
ATOM   756  C  C   . ILE B 1 19 ? -48.616 7.990   -26.977 1.00 15.18 ? 16  ILE B C   1 
ATOM   757  O  O   . ILE B 1 19 ? -49.672 8.483   -27.456 1.00 15.77 ? 16  ILE B O   1 
ATOM   758  C  CB  . ILE B 1 19 ? -46.493 8.410   -28.304 1.00 15.36 ? 16  ILE B CB  1 
ATOM   759  C  CG1 . ILE B 1 19 ? -45.297 9.384   -28.555 1.00 16.12 ? 16  ILE B CG1 1 
ATOM   760  C  CG2 . ILE B 1 19 ? -47.369 8.439   -29.517 1.00 16.81 ? 16  ILE B CG2 1 
ATOM   761  C  CD1 . ILE B 1 19 ? -44.338 8.871   -29.631 1.00 17.17 ? 16  ILE B CD1 1 
ATOM   762  N  N   . ARG B 1 20 ? -48.521 6.789   -26.415 1.00 13.43 ? 17  ARG B N   1 
ATOM   763  C  CA  . ARG B 1 20 ? -49.667 5.927   -26.197 1.00 14.00 ? 17  ARG B CA  1 
ATOM   764  C  C   . ARG B 1 20 ? -50.758 6.762   -25.454 1.00 14.31 ? 17  ARG B C   1 
ATOM   765  O  O   . ARG B 1 20 ? -51.958 6.878   -25.905 1.00 15.31 ? 17  ARG B O   1 
ATOM   766  C  CB  . ARG B 1 20 ? -49.252 4.714   -25.374 1.00 13.29 ? 17  ARG B CB  1 
ATOM   767  C  CG  . ARG B 1 20 ? -50.365 3.801   -25.004 1.00 14.11 ? 17  ARG B CG  1 
ATOM   768  C  CD  . ARG B 1 20 ? -49.899 2.515   -24.312 1.00 14.75 ? 17  ARG B CD  1 
ATOM   769  N  NE  . ARG B 1 20 ? -49.393 2.628   -22.950 1.00 13.64 ? 17  ARG B NE  1 
ATOM   770  C  CZ  . ARG B 1 20 ? -50.106 2.961   -21.874 1.00 15.53 ? 17  ARG B CZ  1 
ATOM   771  N  NH1 . ARG B 1 20 ? -51.396 3.318   -21.941 1.00 13.85 ? 17  ARG B NH1 1 
ATOM   772  N  NH2 . ARG B 1 20 ? -49.498 2.949   -20.675 1.00 16.13 ? 17  ARG B NH2 1 
ATOM   773  N  N   . LEU B 1 21 ? -50.326 7.381   -24.363 1.00 15.07 ? 18  LEU B N   1 
ATOM   774  C  CA  . LEU B 1 21 ? -51.251 8.181   -23.503 1.00 15.57 ? 18  LEU B CA  1 
ATOM   775  C  C   . LEU B 1 21 ? -51.775 9.405   -24.194 1.00 16.73 ? 18  LEU B C   1 
ATOM   776  O  O   . LEU B 1 21 ? -52.983 9.727   -24.125 1.00 17.05 ? 18  LEU B O   1 
ATOM   777  C  CB  . LEU B 1 21 ? -50.599 8.525   -22.167 1.00 15.66 ? 18  LEU B CB  1 
ATOM   778  C  CG  . LEU B 1 21 ? -50.414 7.270   -21.358 1.00 15.90 ? 18  LEU B CG  1 
ATOM   779  C  CD1 . LEU B 1 21 ? -49.484 7.633   -20.205 1.00 15.83 ? 18  LEU B CD1 1 
ATOM   780  C  CD2 . LEU B 1 21 ? -51.751 6.735   -20.821 1.00 17.77 ? 18  LEU B CD2 1 
ATOM   781  N  N   . GLU B 1 22 ? -50.894 10.126  -24.859 1.00 18.65 ? 19  GLU B N   1 
ATOM   782  C  CA  . GLU B 1 22 ? -51.312 11.237  -25.674 1.00 18.17 ? 19  GLU B CA  1 
ATOM   783  C  C   . GLU B 1 22 ? -52.371 10.859  -26.715 1.00 20.45 ? 19  GLU B C   1 
ATOM   784  O  O   . GLU B 1 22 ? -53.208 11.689  -27.072 1.00 19.58 ? 19  GLU B O   1 
ATOM   785  C  CB  . GLU B 1 22 ? -50.073 11.848  -26.376 1.00 20.54 ? 19  GLU B CB  1 
ATOM   786  C  CG  . GLU B 1 22 ? -49.299 12.789  -25.508 1.00 22.99 ? 19  GLU B CG  1 
ATOM   787  C  CD  . GLU B 1 22 ? -48.082 13.428  -26.216 1.00 27.44 ? 19  GLU B CD  1 
ATOM   788  O  OE1 . GLU B 1 22 ? -47.342 14.074  -25.508 1.00 30.98 ? 19  GLU B OE1 1 
ATOM   789  O  OE2 . GLU B 1 22 ? -47.897 13.306  -27.440 1.00 29.25 ? 19  GLU B OE2 1 
ATOM   790  N  N   . LYS B 1 23 ? -52.324 9.651   -27.278 1.00 18.00 ? 20  LYS B N   1 
ATOM   791  C  CA  . LYS B 1 23 ? -53.385 9.222   -28.210 1.00 18.44 ? 20  LYS B CA  1 
ATOM   792  C  C   . LYS B 1 23 ? -54.569 8.574   -27.532 1.00 16.71 ? 20  LYS B C   1 
ATOM   793  O  O   . LYS B 1 23 ? -55.400 8.068   -28.218 1.00 16.08 ? 20  LYS B O   1 
ATOM   794  C  CB  . LYS B 1 23 ? -52.830 8.204   -29.221 1.00 21.51 ? 20  LYS B CB  1 
ATOM   795  C  CG  . LYS B 1 23 ? -51.599 8.751   -29.947 1.00 26.09 ? 20  LYS B CG  1 
ATOM   796  C  CD  . LYS B 1 23 ? -51.948 9.262   -31.292 1.00 26.92 ? 20  LYS B CD  1 
ATOM   797  C  CE  . LYS B 1 23 ? -50.753 9.929   -31.965 1.00 27.74 ? 20  LYS B CE  1 
ATOM   798  N  NZ  . LYS B 1 23 ? -50.805 9.433   -33.344 1.00 28.25 ? 20  LYS B NZ  1 
ATOM   799  N  N   . GLY B 1 24 ? -54.622 8.544   -26.198 1.00 15.68 ? 21  GLY B N   1 
ATOM   800  C  CA  . GLY B 1 24 ? -55.749 7.958   -25.465 1.00 16.15 ? 21  GLY B CA  1 
ATOM   801  C  C   . GLY B 1 24 ? -55.809 6.433   -25.373 1.00 16.62 ? 21  GLY B C   1 
ATOM   802  O  O   . GLY B 1 24 ? -56.837 5.881   -25.029 1.00 13.84 ? 21  GLY B O   1 
ATOM   803  N  N   . MET B 1 25 ? -54.704 5.738   -25.705 1.00 14.33 ? 22  MET B N   1 
ATOM   804  C  CA  . MET B 1 25 ? -54.696 4.296   -25.811 1.00 14.24 ? 22  MET B CA  1 
ATOM   805  C  C   . MET B 1 25 ? -54.268 3.622   -24.540 1.00 13.37 ? 22  MET B C   1 
ATOM   806  O  O   . MET B 1 25 ? -53.374 4.083   -23.853 1.00 13.86 ? 22  MET B O   1 
ATOM   807  C  CB  . MET B 1 25 ? -53.739 3.896   -26.950 1.00 15.97 ? 22  MET B CB  1 
ATOM   808  C  CG  . MET B 1 25 ? -54.132 4.410   -28.318 1.00 18.14 ? 22  MET B CG  1 
ATOM   809  S  SD  . MET B 1 25 ? -52.783 4.251   -29.576 1.00 24.19 ? 22  MET B SD  1 
ATOM   810  C  CE  . MET B 1 25 ? -52.888 2.523   -29.822 1.00 19.84 ? 22  MET B CE  1 
ATOM   811  N  N   . THR B 1 26 ? -54.870 2.505   -24.235 1.00 13.74 ? 23  THR B N   1 
ATOM   812  C  CA  . THR B 1 26 ? -54.406 1.584   -23.200 1.00 13.69 ? 23  THR B CA  1 
ATOM   813  C  C   . THR B 1 26 ? -53.276 0.691   -23.805 1.00 13.50 ? 23  THR B C   1 
ATOM   814  O  O   . THR B 1 26 ? -53.105 0.687   -25.000 1.00 12.25 ? 23  THR B O   1 
ATOM   815  C  CB  . THR B 1 26 ? -55.513 0.646   -22.752 1.00 14.51 ? 23  THR B CB  1 
ATOM   816  O  OG1 . THR B 1 26 ? -55.821 -0.277  -23.797 1.00 15.05 ? 23  THR B OG1 1 
ATOM   817  C  CG2 . THR B 1 26 ? -56.875 1.437   -22.319 1.00 15.71 ? 23  THR B CG2 1 
ATOM   818  N  N   . GLN B 1 27 ? -52.617 -0.129  -22.974 1.00 12.85 ? 24  GLN B N   1 
ATOM   819  C  CA  . GLN B 1 27 ? -51.624 -1.082  -23.424 1.00 12.63 ? 24  GLN B CA  1 
ATOM   820  C  C   . GLN B 1 27 ? -52.255 -2.100  -24.330 1.00 14.35 ? 24  GLN B C   1 
ATOM   821  O  O   . GLN B 1 27 ? -51.727 -2.418  -25.401 1.00 13.43 ? 24  GLN B O   1 
ATOM   822  C  CB  . GLN B 1 27 ? -50.920 -1.766  -22.230 1.00 13.32 ? 24  GLN B CB  1 
ATOM   823  C  CG  . GLN B 1 27 ? -50.120 -0.813  -21.373 1.00 13.19 ? 24  GLN B CG  1 
ATOM   824  C  CD  . GLN B 1 27 ? -49.341 -1.542  -20.296 1.00 15.46 ? 24  GLN B CD  1 
ATOM   825  O  OE1 . GLN B 1 27 ? -49.733 -2.629  -19.902 1.00 17.33 ? 24  GLN B OE1 1 
ATOM   826  N  NE2 . GLN B 1 27 ? -48.270 -0.937  -19.783 1.00 15.31 ? 24  GLN B NE2 1 
ATOM   827  N  N   . GLU B 1 28 ? -53.458 -2.534  -23.974 1.00 14.32 ? 25  GLU B N   1 
ATOM   828  C  CA  A GLU B 1 28 ? -54.173 -3.449  -24.803 0.50 14.59 ? 25  GLU B CA  1 
ATOM   829  C  CA  B GLU B 1 28 ? -54.183 -3.459  -24.809 0.50 14.73 ? 25  GLU B CA  1 
ATOM   830  C  C   . GLU B 1 28 ? -54.490 -2.873  -26.189 1.00 13.64 ? 25  GLU B C   1 
ATOM   831  O  O   . GLU B 1 28 ? -54.340 -3.580  -27.194 1.00 13.55 ? 25  GLU B O   1 
ATOM   832  C  CB  A GLU B 1 28 ? -55.421 -3.936  -24.057 0.50 16.25 ? 25  GLU B CB  1 
ATOM   833  C  CB  B GLU B 1 28 ? -55.470 -3.961  -24.118 0.50 16.80 ? 25  GLU B CB  1 
ATOM   834  C  CG  A GLU B 1 28 ? -55.059 -4.699  -22.793 0.50 18.14 ? 25  GLU B CG  1 
ATOM   835  C  CG  B GLU B 1 28 ? -56.244 -4.958  -24.942 0.50 19.10 ? 25  GLU B CG  1 
ATOM   836  C  CD  A GLU B 1 28 ? -54.858 -3.883  -21.482 0.50 19.63 ? 25  GLU B CD  1 
ATOM   837  C  CD  B GLU B 1 28 ? -57.564 -5.391  -24.324 0.50 22.24 ? 25  GLU B CD  1 
ATOM   838  O  OE1 A GLU B 1 28 ? -54.814 -4.626  -20.476 0.50 23.86 ? 25  GLU B OE1 1 
ATOM   839  O  OE1 B GLU B 1 28 ? -57.988 -4.793  -23.323 0.50 24.40 ? 25  GLU B OE1 1 
ATOM   840  O  OE2 A GLU B 1 28 ? -54.690 -2.599  -21.398 0.50 15.94 ? 25  GLU B OE2 1 
ATOM   841  O  OE2 B GLU B 1 28 ? -58.173 -6.336  -24.861 0.50 24.27 ? 25  GLU B OE2 1 
ATOM   842  N  N   . ASP B 1 29 ? -54.934 -1.602  -26.263 1.00 13.06 ? 26  ASP B N   1 
ATOM   843  C  CA  . ASP B 1 29 ? -55.202 -0.926  -27.539 1.00 12.74 ? 26  ASP B CA  1 
ATOM   844  C  C   . ASP B 1 29 ? -53.909 -0.921  -28.391 1.00 12.73 ? 26  ASP B C   1 
ATOM   845  O  O   . ASP B 1 29 ? -53.924 -1.253  -29.583 1.00 12.62 ? 26  ASP B O   1 
ATOM   846  C  CB  . ASP B 1 29 ? -55.632 0.545   -27.385 1.00 13.96 ? 26  ASP B CB  1 
ATOM   847  C  CG  . ASP B 1 29 ? -56.997 0.754   -26.661 1.00 15.66 ? 26  ASP B CG  1 
ATOM   848  O  OD1 . ASP B 1 29 ? -57.799 -0.188  -26.650 1.00 16.92 ? 26  ASP B OD1 1 
ATOM   849  O  OD2 . ASP B 1 29 ? -57.148 1.886   -26.081 1.00 14.46 ? 26  ASP B OD2 1 
ATOM   850  N  N   . LEU B 1 30 ? -52.765 -0.619  -27.743 1.00 12.32 ? 27  LEU B N   1 
ATOM   851  C  CA  . LEU B 1 30 ? -51.464 -0.608  -28.482 1.00 12.04 ? 27  LEU B CA  1 
ATOM   852  C  C   . LEU B 1 30 ? -51.052 -1.976  -28.997 1.00 10.81 ? 27  LEU B C   1 
ATOM   853  O  O   . LEU B 1 30 ? -50.595 -2.123  -30.156 1.00 11.70 ? 27  LEU B O   1 
ATOM   854  C  CB  . LEU B 1 30 ? -50.362 0.058   -27.635 1.00 11.67 ? 27  LEU B CB  1 
ATOM   855  C  CG  . LEU B 1 30 ? -49.012 0.177   -28.363 1.00 12.36 ? 27  LEU B CG  1 
ATOM   856  C  CD1 . LEU B 1 30 ? -49.143 0.956   -29.648 1.00 12.65 ? 27  LEU B CD1 1 
ATOM   857  C  CD2 . LEU B 1 30 ? -47.993 0.939   -27.494 1.00 12.53 ? 27  LEU B CD2 1 
ATOM   858  N  N   . ALA B 1 31 ? -51.219 -3.008  -28.180 1.00 12.37 ? 28  ALA B N   1 
ATOM   859  C  CA  . ALA B 1 31 ? -50.953 -4.367  -28.600 1.00 12.02 ? 28  ALA B CA  1 
ATOM   860  C  C   . ALA B 1 31 ? -51.813 -4.751  -29.819 1.00 13.34 ? 28  ALA B C   1 
ATOM   861  O  O   . ALA B 1 31 ? -51.306 -5.297  -30.835 1.00 13.05 ? 28  ALA B O   1 
ATOM   862  C  CB  . ALA B 1 31 ? -51.226 -5.328  -27.475 1.00 12.44 ? 28  ALA B CB  1 
ATOM   863  N  N   . TYR B 1 32 ? -53.112 -4.468  -29.691 1.00 14.12 ? 29  TYR B N   1 
ATOM   864  C  CA  . TYR B 1 32 ? -54.047 -4.686  -30.789 1.00 14.25 ? 29  TYR B CA  1 
ATOM   865  C  C   . TYR B 1 32 ? -53.603 -3.977  -32.072 1.00 14.03 ? 29  TYR B C   1 
ATOM   866  O  O   . TYR B 1 32 ? -53.546 -4.593  -33.135 1.00 14.00 ? 29  TYR B O   1 
ATOM   867  C  CB  . TYR B 1 32 ? -55.532 -4.341  -30.364 1.00 15.86 ? 29  TYR B CB  1 
ATOM   868  C  CG  . TYR B 1 32 ? -56.400 -4.249  -31.552 1.00 17.57 ? 29  TYR B CG  1 
ATOM   869  C  CD1 . TYR B 1 32 ? -56.876 -5.399  -32.191 1.00 19.88 ? 29  TYR B CD1 1 
ATOM   870  C  CD2 . TYR B 1 32 ? -56.686 -3.009  -32.119 1.00 19.34 ? 29  TYR B CD2 1 
ATOM   871  C  CE1 . TYR B 1 32 ? -57.622 -5.315  -33.371 1.00 21.77 ? 29  TYR B CE1 1 
ATOM   872  C  CE2 . TYR B 1 32 ? -57.438 -2.908  -33.301 1.00 20.14 ? 29  TYR B CE2 1 
ATOM   873  C  CZ  . TYR B 1 32 ? -57.920 -4.050  -33.901 1.00 20.68 ? 29  TYR B CZ  1 
ATOM   874  O  OH  . TYR B 1 32 ? -58.617 -3.923  -35.069 1.00 20.40 ? 29  TYR B OH  1 
ATOM   875  N  N   . LYS B 1 33 ? -53.293 -2.689  -32.012 1.00 14.29 ? 30  LYS B N   1 
ATOM   876  C  CA  . LYS B 1 33 ? -53.025 -1.911  -33.217 1.00 16.13 ? 30  LYS B CA  1 
ATOM   877  C  C   . LYS B 1 33 ? -51.686 -2.249  -33.821 1.00 16.36 ? 30  LYS B C   1 
ATOM   878  O  O   . LYS B 1 33 ? -51.519 -2.099  -35.033 1.00 13.93 ? 30  LYS B O   1 
ATOM   879  C  CB  . LYS B 1 33 ? -53.023 -0.411  -32.977 1.00 16.96 ? 30  LYS B CB  1 
ATOM   880  C  CG  . LYS B 1 33 ? -54.349 0.259   -32.715 1.00 24.25 ? 30  LYS B CG  1 
ATOM   881  C  CD  . LYS B 1 33 ? -55.288 0.093   -33.900 1.00 28.81 ? 30  LYS B CD  1 
ATOM   882  C  CE  . LYS B 1 33 ? -55.954 1.378   -34.277 1.00 39.95 ? 30  LYS B CE  1 
ATOM   883  N  NZ  . LYS B 1 33 ? -55.034 2.248   -35.077 1.00 45.38 ? 30  LYS B NZ  1 
ATOM   884  N  N   . SER B 1 34 ? -50.732 -2.656  -32.976 1.00 13.81 ? 31  SER B N   1 
ATOM   885  C  CA  A SER B 1 34 ? -49.371 -3.047  -33.481 0.50 13.52 ? 31  SER B CA  1 
ATOM   886  C  CA  B SER B 1 34 ? -49.366 -3.032  -33.455 0.50 13.78 ? 31  SER B CA  1 
ATOM   887  C  C   . SER B 1 34 ? -49.230 -4.482  -33.905 1.00 14.64 ? 31  SER B C   1 
ATOM   888  O  O   . SER B 1 34 ? -48.156 -4.888  -34.396 1.00 15.92 ? 31  SER B O   1 
ATOM   889  C  CB  A SER B 1 34 ? -48.339 -2.831  -32.373 0.50 12.07 ? 31  SER B CB  1 
ATOM   890  C  CB  B SER B 1 34 ? -48.339 -2.737  -32.325 0.50 12.42 ? 31  SER B CB  1 
ATOM   891  O  OG  A SER B 1 34 ? -48.537 -1.594  -31.771 0.50 11.58 ? 31  SER B OG  1 
ATOM   892  O  OG  B SER B 1 34 ? -48.507 -3.580  -31.184 0.50 12.63 ? 31  SER B OG  1 
ATOM   893  N  N   . ASN B 1 35 ? -50.282 -5.260  -33.685 1.00 17.65 ? 32  ASN B N   1 
ATOM   894  C  CA  . ASN B 1 35 ? -50.331 -6.693  -33.853 1.00 20.33 ? 32  ASN B CA  1 
ATOM   895  C  C   . ASN B 1 35 ? -49.278 -7.411  -32.970 1.00 19.59 ? 32  ASN B C   1 
ATOM   896  O  O   . ASN B 1 35 ? -48.647 -8.311  -33.421 1.00 16.74 ? 32  ASN B O   1 
ATOM   897  C  CB  . ASN B 1 35 ? -50.174 -7.052  -35.329 1.00 24.02 ? 32  ASN B CB  1 
ATOM   898  C  CG  . ASN B 1 35 ? -50.611 -8.449  -35.619 1.00 32.70 ? 32  ASN B CG  1 
ATOM   899  O  OD1 . ASN B 1 35 ? -50.045 -9.112  -36.494 1.00 42.86 ? 32  ASN B OD1 1 
ATOM   900  N  ND2 . ASN B 1 35 ? -51.606 -8.932  -34.888 1.00 36.83 ? 32  ASN B ND2 1 
ATOM   901  N  N   . LEU B 1 36 ? -49.159 -6.994  -31.706 1.00 16.17 ? 33  LEU B N   1 
ATOM   902  C  CA  . LEU B 1 36 ? -48.189 -7.532  -30.763 1.00 16.75 ? 33  LEU B CA  1 
ATOM   903  C  C   . LEU B 1 36 ? -48.951 -8.000  -29.554 1.00 18.50 ? 33  LEU B C   1 
ATOM   904  O  O   . LEU B 1 36 ? -50.106 -7.634  -29.362 1.00 18.79 ? 33  LEU B O   1 
ATOM   905  C  CB  . LEU B 1 36 ? -47.139 -6.487  -30.397 1.00 14.97 ? 33  LEU B CB  1 
ATOM   906  C  CG  . LEU B 1 36 ? -46.174 -6.069  -31.517 1.00 15.62 ? 33  LEU B CG  1 
ATOM   907  C  CD1 . LEU B 1 36 ? -45.296 -4.890  -31.152 1.00 15.95 ? 33  LEU B CD1 1 
ATOM   908  C  CD2 . LEU B 1 36 ? -45.300 -7.240  -31.916 1.00 18.18 ? 33  LEU B CD2 1 
ATOM   909  N  N   . ASP B 1 37 ? -48.349 -8.810  -28.721 1.00 19.28 ? 34  ASP B N   1 
ATOM   910  C  CA  . ASP B 1 37 ? -49.100 -9.262  -27.526 1.00 20.90 ? 34  ASP B CA  1 
ATOM   911  C  C   . ASP B 1 37 ? -49.015 -8.305  -26.360 1.00 20.02 ? 34  ASP B C   1 
ATOM   912  O  O   . ASP B 1 37 ? -48.060 -7.507  -26.250 1.00 15.87 ? 34  ASP B O   1 
ATOM   913  C  CB  . ASP B 1 37 ? -48.698 -10.653 -27.179 1.00 24.50 ? 34  ASP B CB  1 
ATOM   914  C  CG  . ASP B 1 37 ? -47.300 -10.710 -26.712 1.00 25.87 ? 34  ASP B CG  1 
ATOM   915  O  OD1 . ASP B 1 37 ? -46.415 -10.837 -27.579 1.00 36.09 ? 34  ASP B OD1 1 
ATOM   916  O  OD2 . ASP B 1 37 ? -47.104 -10.550 -25.488 1.00 25.62 ? 34  ASP B OD2 1 
ATOM   917  N  N   . ARG B 1 38 ? -50.037 -8.342  -25.510 1.00 17.63 ? 35  ARG B N   1 
ATOM   918  C  CA  . ARG B 1 38 ? -50.190 -7.406  -24.419 1.00 18.92 ? 35  ARG B CA  1 
ATOM   919  C  C   . ARG B 1 38 ? -49.051 -7.542  -23.427 1.00 16.15 ? 35  ARG B C   1 
ATOM   920  O  O   . ARG B 1 38 ? -48.624 -6.560  -22.751 1.00 15.64 ? 35  ARG B O   1 
ATOM   921  C  CB  . ARG B 1 38 ? -51.531 -7.692  -23.682 1.00 25.23 ? 35  ARG B CB  1 
ATOM   922  C  CG  . ARG B 1 38 ? -52.756 -7.631  -24.610 1.00 34.28 ? 35  ARG B CG  1 
ATOM   923  C  CD  . ARG B 1 38 ? -54.092 -8.198  -24.092 1.00 40.88 ? 35  ARG B CD  1 
ATOM   924  N  NE  . ARG B 1 38 ? -53.927 -9.094  -22.943 1.00 56.63 ? 35  ARG B NE  1 
ATOM   925  C  CZ  . ARG B 1 38 ? -53.930 -8.709  -21.660 1.00 65.05 ? 35  ARG B CZ  1 
ATOM   926  N  NH1 . ARG B 1 38 ? -54.116 -7.428  -21.333 1.00 72.08 ? 35  ARG B NH1 1 
ATOM   927  N  NH2 . ARG B 1 38 ? -53.740 -9.608  -20.691 1.00 65.70 ? 35  ARG B NH2 1 
ATOM   928  N  N   . THR B 1 39 ? -48.614 -8.776  -23.250 1.00 13.92 ? 36  THR B N   1 
ATOM   929  C  CA  . THR B 1 39 ? -47.528 -9.014  -22.326 1.00 14.74 ? 36  THR B CA  1 
ATOM   930  C  C   . THR B 1 39 ? -46.239 -8.255  -22.766 1.00 12.32 ? 36  THR B C   1 
ATOM   931  O  O   . THR B 1 39 ? -45.524 -7.714  -21.930 1.00 12.32 ? 36  THR B O   1 
ATOM   932  C  CB  . THR B 1 39 ? -47.243 -10.491 -22.128 1.00 13.95 ? 36  THR B CB  1 
ATOM   933  O  OG1 . THR B 1 39 ? -48.394 -11.071 -21.512 1.00 18.57 ? 36  THR B OG1 1 
ATOM   934  C  CG2 . THR B 1 39 ? -46.084 -10.654 -21.203 1.00 14.99 ? 36  THR B CG2 1 
ATOM   935  N  N   . PHE B 1 40 ? -46.008 -8.194  -24.058 1.00 12.01 ? 37  PHE B N   1 
ATOM   936  C  CA  . PHE B 1 40 ? -44.815 -7.509  -24.607 1.00 11.35 ? 37  PHE B CA  1 
ATOM   937  C  C   . PHE B 1 40 ? -44.889 -6.040  -24.402 1.00 11.47 ? 37  PHE B C   1 
ATOM   938  O  O   . PHE B 1 40 ? -43.963 -5.430  -23.898 1.00 9.35  ? 37  PHE B O   1 
ATOM   939  C  CB  . PHE B 1 40 ? -44.695 -7.911  -26.049 1.00 11.76 ? 37  PHE B CB  1 
ATOM   940  C  CG  . PHE B 1 40 ? -43.490 -7.348  -26.777 1.00 12.57 ? 37  PHE B CG  1 
ATOM   941  C  CD1 . PHE B 1 40 ? -42.262 -7.256  -26.190 1.00 11.93 ? 37  PHE B CD1 1 
ATOM   942  C  CD2 . PHE B 1 40 ? -43.616 -6.980  -28.102 1.00 14.31 ? 37  PHE B CD2 1 
ATOM   943  C  CE1 . PHE B 1 40 ? -41.154 -6.843  -26.917 1.00 13.18 ? 37  PHE B CE1 1 
ATOM   944  C  CE2 . PHE B 1 40 ? -42.496 -6.566  -28.868 1.00 14.36 ? 37  PHE B CE2 1 
ATOM   945  C  CZ  . PHE B 1 40 ? -41.284 -6.467  -28.266 1.00 12.80 ? 37  PHE B CZ  1 
ATOM   946  N  N   . ILE B 1 41 ? -46.068 -5.460  -24.669 1.00 10.91 ? 38  ILE B N   1 
ATOM   947  C  CA  . ILE B 1 41 ? -46.254 -4.043  -24.421 1.00 12.15 ? 38  ILE B CA  1 
ATOM   948  C  C   . ILE B 1 41 ? -46.059 -3.664  -22.950 1.00 12.30 ? 38  ILE B C   1 
ATOM   949  O  O   . ILE B 1 41 ? -45.342 -2.712  -22.611 1.00 11.33 ? 38  ILE B O   1 
ATOM   950  C  CB  . ILE B 1 41 ? -47.663 -3.555  -24.931 1.00 13.23 ? 38  ILE B CB  1 
ATOM   951  C  CG1 . ILE B 1 41 ? -47.824 -3.832  -26.449 1.00 14.71 ? 38  ILE B CG1 1 
ATOM   952  C  CG2 . ILE B 1 41 ? -47.845 -2.128  -24.506 1.00 13.49 ? 38  ILE B CG2 1 
ATOM   953  C  CD1 . ILE B 1 41 ? -46.772 -3.182  -27.331 1.00 14.50 ? 38  ILE B CD1 1 
ATOM   954  N  N   . SER B 1 42 ? -46.709 -4.419  -22.062 1.00 13.88 ? 39  SER B N   1 
ATOM   955  C  CA  . SER B 1 42 ? -46.553 -4.305  -20.624 1.00 13.65 ? 39  SER B CA  1 
ATOM   956  C  C   . SER B 1 42 ? -45.076 -4.420  -20.194 1.00 12.85 ? 39  SER B C   1 
ATOM   957  O  O   . SER B 1 42 ? -44.558 -3.567  -19.412 1.00 13.22 ? 39  SER B O   1 
ATOM   958  C  CB  . SER B 1 42 ? -47.421 -5.399  -19.941 1.00 16.13 ? 39  SER B CB  1 
ATOM   959  O  OG  . SER B 1 42 ? -47.118 -5.412  -18.570 1.00 22.62 ? 39  SER B OG  1 
ATOM   960  N  N   . GLY B 1 43 ? -44.403 -5.462  -20.687 1.00 11.72 ? 40  GLY B N   1 
ATOM   961  C  CA  . GLY B 1 43 ? -42.976 -5.665  -20.353 1.00 12.08 ? 40  GLY B CA  1 
ATOM   962  C  C   . GLY B 1 43 ? -42.075 -4.532  -20.836 1.00 12.30 ? 40  GLY B C   1 
ATOM   963  O  O   . GLY B 1 43 ? -41.125 -4.103  -20.102 1.00 12.15 ? 40  GLY B O   1 
ATOM   964  N  N   . ILE B 1 44 ? -42.309 -4.059  -22.075 1.00 11.54 ? 41  ILE B N   1 
ATOM   965  C  CA  . ILE B 1 44 ? -41.588 -2.851  -22.539 1.00 12.86 ? 41  ILE B CA  1 
ATOM   966  C  C   . ILE B 1 44 ? -41.722 -1.680  -21.560 1.00 13.45 ? 41  ILE B C   1 
ATOM   967  O  O   . ILE B 1 44 ? -40.699 -1.008  -21.220 1.00 13.77 ? 41  ILE B O   1 
ATOM   968  C  CB  . ILE B 1 44 ? -42.021 -2.440  -23.962 1.00 13.21 ? 41  ILE B CB  1 
ATOM   969  C  CG1 . ILE B 1 44 ? -41.545 -3.518  -24.935 1.00 13.03 ? 41  ILE B CG1 1 
ATOM   970  C  CG2 . ILE B 1 44 ? -41.545 -1.011  -24.269 1.00 13.54 ? 41  ILE B CG2 1 
ATOM   971  C  CD1 . ILE B 1 44 ? -42.324 -3.413  -26.222 1.00 14.92 ? 41  ILE B CD1 1 
ATOM   972  N  N   . GLU B 1 45 ? -42.960 -1.393  -21.148 1.00 12.99 ? 42  GLU B N   1 
ATOM   973  C  CA  . GLU B 1 45 ? -43.159 -0.240  -20.307 1.00 13.81 ? 42  GLU B CA  1 
ATOM   974  C  C   . GLU B 1 45 ? -42.649 -0.444  -18.890 1.00 15.10 ? 42  GLU B C   1 
ATOM   975  O  O   . GLU B 1 45 ? -42.393 0.555   -18.211 1.00 16.05 ? 42  GLU B O   1 
ATOM   976  C  CB  . GLU B 1 45 ? -44.622 0.218   -20.332 1.00 14.35 ? 42  GLU B CB  1 
ATOM   977  C  CG  . GLU B 1 45 ? -45.007 0.823   -21.679 1.00 14.60 ? 42  GLU B CG  1 
ATOM   978  C  CD  . GLU B 1 45 ? -46.402 1.445   -21.726 1.00 16.04 ? 42  GLU B CD  1 
ATOM   979  O  OE1 . GLU B 1 45 ? -46.813 1.879   -22.848 1.00 16.25 ? 42  GLU B OE1 1 
ATOM   980  O  OE2 . GLU B 1 45 ? -47.085 1.497   -20.658 1.00 18.01 ? 42  GLU B OE2 1 
ATOM   981  N  N   . ARG B 1 46 ? -42.430 -1.683  -18.447 1.00 13.75 ? 43  ARG B N   1 
ATOM   982  C  CA  . ARG B 1 46 ? -41.800 -1.951  -17.126 1.00 16.95 ? 43  ARG B CA  1 
ATOM   983  C  C   . ARG B 1 46 ? -40.294 -2.120  -17.263 1.00 17.09 ? 43  ARG B C   1 
ATOM   984  O  O   . ARG B 1 46 ? -39.685 -2.676  -16.364 1.00 18.22 ? 43  ARG B O   1 
ATOM   985  C  CB  . ARG B 1 46 ? -42.363 -3.253  -16.480 1.00 17.85 ? 43  ARG B CB  1 
ATOM   986  C  CG  . ARG B 1 46 ? -43.792 -3.168  -16.097 1.00 22.69 ? 43  ARG B CG  1 
ATOM   987  C  CD  . ARG B 1 46 ? -44.310 -4.442  -15.437 1.00 25.44 ? 43  ARG B CD  1 
ATOM   988  N  NE  . ARG B 1 46 ? -44.278 -5.589  -16.323 1.00 26.79 ? 43  ARG B NE  1 
ATOM   989  C  CZ  . ARG B 1 46 ? -43.493 -6.659  -16.212 1.00 28.17 ? 43  ARG B CZ  1 
ATOM   990  N  NH1 . ARG B 1 46 ? -42.577 -6.827  -15.269 1.00 31.33 ? 43  ARG B NH1 1 
ATOM   991  N  NH2 . ARG B 1 46 ? -43.606 -7.583  -17.122 1.00 34.17 ? 43  ARG B NH2 1 
ATOM   992  N  N   . ASN B 1 47 ? -39.718 -1.689  -18.394 1.00 16.88 ? 44  ASN B N   1 
ATOM   993  C  CA  . ASN B 1 47 ? -38.290 -1.798  -18.661 1.00 17.84 ? 44  ASN B CA  1 
ATOM   994  C  C   . ASN B 1 47 ? -37.732 -3.196  -18.570 1.00 18.18 ? 44  ASN B C   1 
ATOM   995  O  O   . ASN B 1 47 ? -36.610 -3.375  -18.137 1.00 17.85 ? 44  ASN B O   1 
ATOM   996  C  CB  . ASN B 1 47 ? -37.498 -0.802  -17.766 1.00 21.68 ? 44  ASN B CB  1 
ATOM   997  C  CG  . ASN B 1 47 ? -37.847 0.634   -18.092 1.00 26.54 ? 44  ASN B CG  1 
ATOM   998  O  OD1 . ASN B 1 47 ? -38.035 0.996   -19.245 1.00 30.28 ? 44  ASN B OD1 1 
ATOM   999  N  ND2 . ASN B 1 47 ? -37.967 1.438   -17.094 1.00 30.66 ? 44  ASN B ND2 1 
ATOM   1000 N  N   . SER B 1 48 ? -38.477 -4.199  -19.049 1.00 14.94 ? 45  SER B N   1 
ATOM   1001 C  CA  . SER B 1 48 ? -38.080 -5.575  -18.911 1.00 15.42 ? 45  SER B CA  1 
ATOM   1002 C  C   . SER B 1 48 ? -38.110 -6.345  -20.192 1.00 13.91 ? 45  SER B C   1 
ATOM   1003 O  O   . SER B 1 48 ? -38.060 -7.550  -20.119 1.00 13.35 ? 45  SER B O   1 
ATOM   1004 C  CB  . SER B 1 48 ? -39.066 -6.278  -18.007 1.00 18.44 ? 45  SER B CB  1 
ATOM   1005 O  OG  . SER B 1 48 ? -38.941 -5.717  -16.780 1.00 23.21 ? 45  SER B OG  1 
ATOM   1006 N  N   . ARG B 1 49 ? -38.254 -5.660  -21.345 1.00 12.46 ? 46  ARG B N   1 
ATOM   1007 C  CA  . ARG B 1 49 ? -38.161 -6.312  -22.616 1.00 13.59 ? 46  ARG B CA  1 
ATOM   1008 C  C   . ARG B 1 49 ? -37.240 -5.507  -23.537 1.00 14.51 ? 46  ARG B C   1 
ATOM   1009 O  O   . ARG B 1 49 ? -37.448 -4.307  -23.771 1.00 16.63 ? 46  ARG B O   1 
ATOM   1010 C  CB  . ARG B 1 49 ? -39.543 -6.462  -23.261 1.00 14.66 ? 46  ARG B CB  1 
ATOM   1011 C  CG  . ARG B 1 49 ? -40.512 -7.382  -22.524 1.00 14.16 ? 46  ARG B CG  1 
ATOM   1012 C  CD  . ARG B 1 49 ? -40.130 -8.892  -22.618 1.00 14.44 ? 46  ARG B CD  1 
ATOM   1013 N  NE  . ARG B 1 49 ? -40.519 -9.529  -23.867 1.00 13.25 ? 46  ARG B NE  1 
ATOM   1014 C  CZ  . ARG B 1 49 ? -41.721 -10.029 -24.126 1.00 15.02 ? 46  ARG B CZ  1 
ATOM   1015 N  NH1 . ARG B 1 49 ? -42.680 -10.065 -23.211 1.00 14.39 ? 46  ARG B NH1 1 
ATOM   1016 N  NH2 . ARG B 1 49 ? -41.951 -10.601 -25.300 1.00 15.29 ? 46  ARG B NH2 1 
ATOM   1017 N  N   . ASN B 1 50 ? -36.251 -6.191  -24.068 1.00 13.42 ? 47  ASN B N   1 
ATOM   1018 C  CA  . ASN B 1 50 ? -35.228 -5.628  -24.939 1.00 12.96 ? 47  ASN B CA  1 
ATOM   1019 C  C   . ASN B 1 50 ? -35.660 -5.632  -26.379 1.00 13.31 ? 47  ASN B C   1 
ATOM   1020 O  O   . ASN B 1 50 ? -35.246 -6.465  -27.200 1.00 11.87 ? 47  ASN B O   1 
ATOM   1021 C  CB  . ASN B 1 50 ? -33.959 -6.439  -24.760 1.00 13.20 ? 47  ASN B CB  1 
ATOM   1022 C  CG  . ASN B 1 50 ? -32.768 -5.868  -25.513 1.00 13.64 ? 47  ASN B CG  1 
ATOM   1023 O  OD1 . ASN B 1 50 ? -32.754 -4.718  -25.954 1.00 13.87 ? 47  ASN B OD1 1 
ATOM   1024 N  ND2 . ASN B 1 50 ? -31.787 -6.714  -25.694 1.00 14.11 ? 47  ASN B ND2 1 
ATOM   1025 N  N   . LEU B 1 51 ? -36.530 -4.685  -26.693 1.00 14.76 ? 48  LEU B N   1 
ATOM   1026 C  CA  . LEU B 1 51 ? -37.143 -4.696  -27.999 1.00 16.25 ? 48  LEU B CA  1 
ATOM   1027 C  C   . LEU B 1 51 ? -36.178 -4.380  -29.156 1.00 13.35 ? 48  LEU B C   1 
ATOM   1028 O  O   . LEU B 1 51 ? -35.188 -3.701  -28.962 1.00 13.93 ? 48  LEU B O   1 
ATOM   1029 C  CB  . LEU B 1 51 ? -38.355 -3.800  -28.080 1.00 19.14 ? 48  LEU B CB  1 
ATOM   1030 C  CG  . LEU B 1 51 ? -38.129 -2.358  -28.376 1.00 18.76 ? 48  LEU B CG  1 
ATOM   1031 C  CD1 . LEU B 1 51 ? -39.452 -1.898  -28.957 1.00 22.80 ? 48  LEU B CD1 1 
ATOM   1032 C  CD2 . LEU B 1 51 ? -37.810 -1.661  -27.089 1.00 22.52 ? 48  LEU B CD2 1 
ATOM   1033 N  N   . THR B 1 52 ? -36.500 -4.972  -30.287 1.00 13.32 ? 49  THR B N   1 
ATOM   1034 C  CA  . THR B 1 52 ? -35.762 -4.776  -31.559 1.00 12.52 ? 49  THR B CA  1 
ATOM   1035 C  C   . THR B 1 52 ? -36.248 -3.594  -32.353 1.00 13.30 ? 49  THR B C   1 
ATOM   1036 O  O   . THR B 1 52 ? -37.408 -3.080  -32.135 1.00 11.63 ? 49  THR B O   1 
ATOM   1037 C  CB  . THR B 1 52 ? -35.745 -5.994  -32.464 1.00 11.07 ? 49  THR B CB  1 
ATOM   1038 O  OG1 . THR B 1 52 ? -37.044 -6.359  -32.924 1.00 11.76 ? 49  THR B OG1 1 
ATOM   1039 C  CG2 . THR B 1 52 ? -35.057 -7.212  -31.781 1.00 12.74 ? 49  THR B CG2 1 
ATOM   1040 N  N   . ILE B 1 53 ? -35.362 -3.109  -33.241 1.00 12.89 ? 50  ILE B N   1 
ATOM   1041 C  CA  . ILE B 1 53 ? -35.758 -2.042  -34.136 1.00 15.02 ? 50  ILE B CA  1 
ATOM   1042 C  C   . ILE B 1 53 ? -36.993 -2.422  -34.929 1.00 14.72 ? 50  ILE B C   1 
ATOM   1043 O  O   . ILE B 1 53 ? -37.876 -1.584  -35.094 1.00 15.64 ? 50  ILE B O   1 
ATOM   1044 C  CB  . ILE B 1 53 ? -34.636 -1.608  -35.105 1.00 17.17 ? 50  ILE B CB  1 
ATOM   1045 C  CG1 . ILE B 1 53 ? -33.461 -1.059  -34.286 1.00 18.88 ? 50  ILE B CG1 1 
ATOM   1046 C  CG2 . ILE B 1 53 ? -35.159 -0.581  -36.129 1.00 17.26 ? 50  ILE B CG2 1 
ATOM   1047 C  CD1 . ILE B 1 53 ? -33.752 0.083   -33.370 1.00 18.53 ? 50  ILE B CD1 1 
ATOM   1048 N  N   . LYS B 1 54 ? -37.068 -3.653  -35.452 1.00 16.19 ? 51  LYS B N   1 
ATOM   1049 C  CA  . LYS B 1 54 ? -38.248 -4.092  -36.181 1.00 17.85 ? 51  LYS B CA  1 
ATOM   1050 C  C   . LYS B 1 54 ? -39.563 -4.020  -35.351 1.00 16.47 ? 51  LYS B C   1 
ATOM   1051 O  O   . LYS B 1 54 ? -40.616 -3.573  -35.828 1.00 14.40 ? 51  LYS B O   1 
ATOM   1052 C  CB  . LYS B 1 54 ? -38.044 -5.510  -36.720 1.00 23.86 ? 51  LYS B CB  1 
ATOM   1053 C  CG  . LYS B 1 54 ? -38.923 -5.876  -37.882 1.00 30.90 ? 51  LYS B CG  1 
ATOM   1054 C  CD  . LYS B 1 54 ? -38.565 -7.272  -38.430 1.00 38.24 ? 51  LYS B CD  1 
ATOM   1055 C  CE  . LYS B 1 54 ? -37.435 -7.272  -39.440 1.00 38.30 ? 51  LYS B CE  1 
ATOM   1056 N  NZ  . LYS B 1 54 ? -37.219 -8.654  -39.986 1.00 41.65 ? 51  LYS B NZ  1 
ATOM   1057 N  N   . SER B 1 55 ? -39.505 -4.460  -34.101 1.00 13.21 ? 52  SER B N   1 
ATOM   1058 C  CA  . SER B 1 55 ? -40.614 -4.288  -33.176 1.00 13.27 ? 52  SER B CA  1 
ATOM   1059 C  C   . SER B 1 55 ? -41.001 -2.841  -32.906 1.00 12.24 ? 52  SER B C   1 
ATOM   1060 O  O   . SER B 1 55 ? -42.207 -2.511  -32.784 1.00 12.30 ? 52  SER B O   1 
ATOM   1061 C  CB  . SER B 1 55 ? -40.336 -4.997  -31.822 1.00 13.14 ? 52  SER B CB  1 
ATOM   1062 O  OG  . SER B 1 55 ? -40.333 -6.349  -32.020 1.00 14.42 ? 52  SER B OG  1 
ATOM   1063 N  N   . LEU B 1 56 ? -40.011 -1.983  -32.802 1.00 11.87 ? 53  LEU B N   1 
ATOM   1064 C  CA  . LEU B 1 56 ? -40.215 -0.545  -32.609 1.00 12.94 ? 53  LEU B CA  1 
ATOM   1065 C  C   . LEU B 1 56 ? -41.001 0.044   -33.806 1.00 13.93 ? 53  LEU B C   1 
ATOM   1066 O  O   . LEU B 1 56 ? -41.934 0.838   -33.629 1.00 11.59 ? 53  LEU B O   1 
ATOM   1067 C  CB  . LEU B 1 56 ? -38.888 0.195   -32.419 1.00 12.95 ? 53  LEU B CB  1 
ATOM   1068 C  CG  . LEU B 1 56 ? -38.978 1.676   -32.152 1.00 14.57 ? 53  LEU B CG  1 
ATOM   1069 C  CD1 . LEU B 1 56 ? -39.773 2.037   -30.886 1.00 14.41 ? 53  LEU B CD1 1 
ATOM   1070 C  CD2 . LEU B 1 56 ? -37.583 2.339   -32.145 1.00 14.50 ? 53  LEU B CD2 1 
ATOM   1071 N  N   . GLU B 1 57 ? -40.627 -0.394  -34.992 1.00 14.45 ? 54  GLU B N   1 
ATOM   1072 C  CA  . GLU B 1 57 ? -41.333 -0.007  -36.217 1.00 16.74 ? 54  GLU B CA  1 
ATOM   1073 C  C   . GLU B 1 57 ? -42.799 -0.374  -36.180 1.00 15.43 ? 54  GLU B C   1 
ATOM   1074 O  O   . GLU B 1 57 ? -43.660 0.472   -36.525 1.00 14.61 ? 54  GLU B O   1 
ATOM   1075 C  CB  . GLU B 1 57 ? -40.558 -0.590  -37.433 1.00 17.66 ? 54  GLU B CB  1 
ATOM   1076 C  CG  . GLU B 1 57 ? -41.036 -0.122  -38.778 1.00 23.56 ? 54  GLU B CG  1 
ATOM   1077 C  CD  . GLU B 1 57 ? -39.998 -0.401  -39.883 1.00 25.85 ? 54  GLU B CD  1 
ATOM   1078 O  OE1 . GLU B 1 57 ? -39.845 0.443   -40.798 1.00 34.48 ? 54  GLU B OE1 1 
ATOM   1079 O  OE2 . GLU B 1 57 ? -39.312 -1.448  -39.806 1.00 27.49 ? 54  GLU B OE2 1 
ATOM   1080 N  N   . LEU B 1 58 ? -43.111 -1.578  -35.715 1.00 14.39 ? 55  LEU B N   1 
ATOM   1081 C  CA  . LEU B 1 58 ? -44.491 -1.985  -35.596 1.00 14.81 ? 55  LEU B CA  1 
ATOM   1082 C  C   . LEU B 1 58 ? -45.234 -1.171  -34.534 1.00 14.31 ? 55  LEU B C   1 
ATOM   1083 O  O   . LEU B 1 58 ? -46.424 -0.853  -34.700 1.00 13.35 ? 55  LEU B O   1 
ATOM   1084 C  CB  . LEU B 1 58 ? -44.636 -3.446  -35.291 1.00 16.89 ? 55  LEU B CB  1 
ATOM   1085 C  CG  . LEU B 1 58 ? -44.140 -4.421  -36.322 1.00 21.05 ? 55  LEU B CG  1 
ATOM   1086 C  CD1 . LEU B 1 58 ? -43.941 -5.745  -35.638 1.00 22.78 ? 55  LEU B CD1 1 
ATOM   1087 C  CD2 . LEU B 1 58 ? -45.142 -4.577  -37.449 1.00 23.93 ? 55  LEU B CD2 1 
ATOM   1088 N  N   . ILE B 1 59 ? -44.549 -0.861  -33.439 1.00 13.53 ? 56  ILE B N   1 
ATOM   1089 C  CA  . ILE B 1 59 ? -45.101 0.004   -32.427 1.00 13.39 ? 56  ILE B CA  1 
ATOM   1090 C  C   . ILE B 1 59 ? -45.442 1.391   -32.923 1.00 14.14 ? 56  ILE B C   1 
ATOM   1091 O  O   . ILE B 1 59 ? -46.525 1.935   -32.632 1.00 13.72 ? 56  ILE B O   1 
ATOM   1092 C  CB  . ILE B 1 59 ? -44.250 -0.004  -31.141 1.00 12.61 ? 56  ILE B CB  1 
ATOM   1093 C  CG1 . ILE B 1 59 ? -44.352 -1.425  -30.488 1.00 12.32 ? 56  ILE B CG1 1 
ATOM   1094 C  CG2 . ILE B 1 59 ? -44.689 1.089   -30.164 1.00 12.63 ? 56  ILE B CG2 1 
ATOM   1095 C  CD1 . ILE B 1 59 ? -43.351 -1.726  -29.373 1.00 13.63 ? 56  ILE B CD1 1 
ATOM   1096 N  N   . MET B 1 60 ? -44.533 1.992   -33.640 1.00 13.54 ? 57  MET B N   1 
ATOM   1097 C  CA  . MET B 1 60 ? -44.793 3.294   -34.227 1.00 14.75 ? 57  MET B CA  1 
ATOM   1098 C  C   . MET B 1 60 ? -46.019 3.280   -35.142 1.00 15.81 ? 57  MET B C   1 
ATOM   1099 O  O   . MET B 1 60 ? -46.831 4.256   -35.142 1.00 15.06 ? 57  MET B O   1 
ATOM   1100 C  CB  . MET B 1 60 ? -43.592 3.813   -35.036 1.00 14.96 ? 57  MET B CB  1 
ATOM   1101 C  CG  . MET B 1 60 ? -42.351 4.072   -34.203 1.00 18.53 ? 57  MET B CG  1 
ATOM   1102 S  SD  . MET B 1 60 ? -40.868 4.482   -35.227 1.00 25.85 ? 57  MET B SD  1 
ATOM   1103 C  CE  . MET B 1 60 ? -40.527 3.075   -36.115 1.00 25.40 ? 57  MET B CE  1 
ATOM   1104 N  N   . LYS B 1 61 ? -46.160 2.217   -35.897 1.00 16.64 ? 58  LYS B N   1 
ATOM   1105 C  CA  . LYS B 1 61 ? -47.313 2.066   -36.778 1.00 18.76 ? 58  LYS B CA  1 
ATOM   1106 C  C   . LYS B 1 61 ? -48.574 1.928   -35.993 1.00 17.73 ? 58  LYS B C   1 
ATOM   1107 O  O   . LYS B 1 61 ? -49.582 2.539   -36.344 1.00 17.31 ? 58  LYS B O   1 
ATOM   1108 C  CB  . LYS B 1 61 ? -47.140 0.841   -37.711 1.00 22.52 ? 58  LYS B CB  1 
ATOM   1109 C  CG  . LYS B 1 61 ? -46.120 1.127   -38.795 1.00 26.36 ? 58  LYS B CG  1 
ATOM   1110 C  CD  . LYS B 1 61 ? -45.778 -0.068  -39.694 1.00 34.16 ? 58  LYS B CD  1 
ATOM   1111 C  CE  . LYS B 1 61 ? -46.908 -1.072  -39.892 1.00 42.56 ? 58  LYS B CE  1 
ATOM   1112 N  NZ  . LYS B 1 61 ? -46.346 -2.275  -40.590 1.00 53.73 ? 58  LYS B NZ  1 
ATOM   1113 N  N   . GLY B 1 62 ? -48.540 1.142   -34.928 1.00 15.09 ? 59  GLY B N   1 
ATOM   1114 C  CA  . GLY B 1 62 ? -49.664 1.085   -34.026 1.00 16.82 ? 59  GLY B CA  1 
ATOM   1115 C  C   . GLY B 1 62 ? -50.047 2.363   -33.327 1.00 17.77 ? 59  GLY B C   1 
ATOM   1116 O  O   . GLY B 1 62 ? -51.261 2.591   -33.039 1.00 17.82 ? 59  GLY B O   1 
ATOM   1117 N  N   . LEU B 1 63 ? -49.042 3.167   -32.972 1.00 14.55 ? 60  LEU B N   1 
ATOM   1118 C  CA  . LEU B 1 63 ? -49.261 4.501   -32.425 1.00 14.03 ? 60  LEU B CA  1 
ATOM   1119 C  C   . LEU B 1 63 ? -49.705 5.538   -33.505 1.00 14.97 ? 60  LEU B C   1 
ATOM   1120 O  O   . LEU B 1 63 ? -50.050 6.628   -33.142 1.00 15.67 ? 60  LEU B O   1 
ATOM   1121 C  CB  . LEU B 1 63 ? -47.988 5.077   -31.758 1.00 13.52 ? 60  LEU B CB  1 
ATOM   1122 C  CG  . LEU B 1 63 ? -47.459 4.371   -30.519 1.00 13.91 ? 60  LEU B CG  1 
ATOM   1123 C  CD1 . LEU B 1 63 ? -46.029 4.728   -30.227 1.00 15.20 ? 60  LEU B CD1 1 
ATOM   1124 C  CD2 . LEU B 1 63 ? -48.294 4.715   -29.321 1.00 15.77 ? 60  LEU B CD2 1 
ATOM   1125 N  N   . GLU B 1 64 ? -49.545 5.226   -34.768 1.00 15.33 ? 61  GLU B N   1 
ATOM   1126 C  CA  . GLU B 1 64 ? -49.726 6.167   -35.908 1.00 18.38 ? 61  GLU B CA  1 
ATOM   1127 C  C   . GLU B 1 64 ? -48.855 7.385   -35.803 1.00 20.86 ? 61  GLU B C   1 
ATOM   1128 O  O   . GLU B 1 64 ? -49.327 8.517   -35.947 1.00 18.67 ? 61  GLU B O   1 
ATOM   1129 C  CB  . GLU B 1 64 ? -51.235 6.476   -36.116 1.00 20.37 ? 61  GLU B CB  1 
ATOM   1130 C  CG  . GLU B 1 64 ? -51.970 5.176   -36.431 1.00 23.81 ? 61  GLU B CG  1 
ATOM   1131 C  CD  . GLU B 1 64 ? -53.486 5.326   -36.643 1.00 30.94 ? 61  GLU B CD  1 
ATOM   1132 O  OE1 . GLU B 1 64 ? -53.983 6.463   -36.560 1.00 33.11 ? 61  GLU B OE1 1 
ATOM   1133 O  OE2 . GLU B 1 64 ? -54.145 4.294   -36.933 1.00 32.59 ? 61  GLU B OE2 1 
ATOM   1134 N  N   . VAL B 1 65 ? -47.572 7.163   -35.439 1.00 16.75 ? 62  VAL B N   1 
ATOM   1135 C  CA  . VAL B 1 65 ? -46.625 8.245   -35.416 1.00 17.40 ? 62  VAL B CA  1 
ATOM   1136 C  C   . VAL B 1 65 ? -45.578 7.900   -36.452 1.00 17.23 ? 62  VAL B C   1 
ATOM   1137 O  O   . VAL B 1 65 ? -45.249 6.708   -36.685 1.00 13.76 ? 62  VAL B O   1 
ATOM   1138 C  CB  . VAL B 1 65 ? -46.086 8.496   -33.969 1.00 18.75 ? 62  VAL B CB  1 
ATOM   1139 C  CG1 . VAL B 1 65 ? -45.289 7.323   -33.484 1.00 20.43 ? 62  VAL B CG1 1 
ATOM   1140 C  CG2 . VAL B 1 65 ? -45.225 9.664   -33.913 1.00 24.68 ? 62  VAL B CG2 1 
ATOM   1141 N  N   . SER B 1 66 ? -45.103 8.920   -37.149 1.00 17.80 ? 63  SER B N   1 
ATOM   1142 C  CA  . SER B 1 66 ? -43.995 8.688   -38.059 1.00 18.83 ? 63  SER B CA  1 
ATOM   1143 C  C   . SER B 1 66 ? -42.680 8.464   -37.265 1.00 19.34 ? 63  SER B C   1 
ATOM   1144 O  O   . SER B 1 66 ? -42.536 8.907   -36.091 1.00 14.95 ? 63  SER B O   1 
ATOM   1145 C  CB  . SER B 1 66 ? -43.795 9.862   -38.992 1.00 20.24 ? 63  SER B CB  1 
ATOM   1146 O  OG  . SER B 1 66 ? -43.340 10.979  -38.255 1.00 18.99 ? 63  SER B OG  1 
ATOM   1147 N  N   . ASP B 1 67 ? -41.734 7.843   -37.966 1.00 19.16 ? 64  ASP B N   1 
ATOM   1148 C  CA  . ASP B 1 67 ? -40.421 7.588   -37.401 1.00 19.28 ? 64  ASP B CA  1 
ATOM   1149 C  C   . ASP B 1 67 ? -39.723 8.876   -36.973 1.00 16.73 ? 64  ASP B C   1 
ATOM   1150 O  O   . ASP B 1 67 ? -39.155 8.953   -35.855 1.00 16.74 ? 64  ASP B O   1 
ATOM   1151 C  CB  . ASP B 1 67 ? -39.568 6.692   -38.296 1.00 19.73 ? 64  ASP B CB  1 
ATOM   1152 C  CG  . ASP B 1 67 ? -39.586 7.098   -39.768 1.00 23.16 ? 64  ASP B CG  1 
ATOM   1153 O  OD1 . ASP B 1 67 ? -39.953 8.258   -40.133 1.00 21.10 ? 64  ASP B OD1 1 
ATOM   1154 O  OD2 . ASP B 1 67 ? -39.248 6.186   -40.556 1.00 26.03 ? 64  ASP B OD2 1 
ATOM   1155 N  N   . VAL B 1 68 ? -39.860 9.915   -37.775 1.00 17.50 ? 65  VAL B N   1 
ATOM   1156 C  CA  . VAL B 1 68 ? -39.250 11.200  -37.495 1.00 18.29 ? 65  VAL B CA  1 
ATOM   1157 C  C   . VAL B 1 68 ? -39.823 11.826  -36.252 1.00 18.67 ? 65  VAL B C   1 
ATOM   1158 O  O   . VAL B 1 68 ? -39.077 12.300  -35.358 1.00 15.88 ? 65  VAL B O   1 
ATOM   1159 C  CB  . VAL B 1 68 ? -39.319 12.149  -38.731 1.00 20.86 ? 65  VAL B CB  1 
ATOM   1160 C  CG1 . VAL B 1 68 ? -38.921 13.554  -38.352 1.00 21.70 ? 65  VAL B CG1 1 
ATOM   1161 C  CG2 . VAL B 1 68 ? -38.422 11.634  -39.819 1.00 20.69 ? 65  VAL B CG2 1 
ATOM   1162 N  N   . VAL B 1 69 ? -41.144 11.774  -36.108 1.00 17.28 ? 66  VAL B N   1 
ATOM   1163 C  CA  . VAL B 1 69 ? -41.740 12.366  -34.921 1.00 17.84 ? 66  VAL B CA  1 
ATOM   1164 C  C   . VAL B 1 69 ? -41.359 11.590  -33.631 1.00 14.91 ? 66  VAL B C   1 
ATOM   1165 O  O   . VAL B 1 69 ? -41.108 12.203  -32.613 1.00 13.09 ? 66  VAL B O   1 
ATOM   1166 C  CB  . VAL B 1 69 ? -43.298 12.552  -35.069 1.00 18.94 ? 66  VAL B CB  1 
ATOM   1167 C  CG1 . VAL B 1 69 ? -43.936 12.806  -33.724 1.00 21.41 ? 66  VAL B CG1 1 
ATOM   1168 C  CG2 . VAL B 1 69 ? -43.608 13.761  -35.984 1.00 21.11 ? 66  VAL B CG2 1 
ATOM   1169 N  N   . PHE B 1 70 ? -41.322 10.275  -33.725 1.00 13.18 ? 67  PHE B N   1 
ATOM   1170 C  CA  . PHE B 1 70 ? -40.938 9.432   -32.608 1.00 12.43 ? 67  PHE B CA  1 
ATOM   1171 C  C   . PHE B 1 70 ? -39.503 9.783   -32.152 1.00 12.05 ? 67  PHE B C   1 
ATOM   1172 O  O   . PHE B 1 70 ? -39.206 10.012  -30.934 1.00 10.96 ? 67  PHE B O   1 
ATOM   1173 C  CB  . PHE B 1 70 ? -41.047 7.958   -32.945 1.00 12.74 ? 67  PHE B CB  1 
ATOM   1174 C  CG  . PHE B 1 70 ? -40.764 7.069   -31.727 1.00 12.42 ? 67  PHE B CG  1 
ATOM   1175 C  CD1 . PHE B 1 70 ? -39.457 6.738   -31.377 1.00 12.28 ? 67  PHE B CD1 1 
ATOM   1176 C  CD2 . PHE B 1 70 ? -41.777 6.589   -30.921 1.00 13.74 ? 67  PHE B CD2 1 
ATOM   1177 C  CE1 . PHE B 1 70 ? -39.161 6.040   -30.233 1.00 12.15 ? 67  PHE B CE1 1 
ATOM   1178 C  CE2 . PHE B 1 70 ? -41.472 5.873   -29.790 1.00 12.70 ? 67  PHE B CE2 1 
ATOM   1179 C  CZ  . PHE B 1 70 ? -40.165 5.563   -29.474 1.00 12.98 ? 67  PHE B CZ  1 
ATOM   1180 N  N   . PHE B 1 71 ? -38.630 9.901   -33.133 1.00 11.49 ? 68  PHE B N   1 
ATOM   1181 C  CA  . PHE B 1 71 ? -37.201 10.230  -32.802 1.00 12.91 ? 68  PHE B CA  1 
ATOM   1182 C  C   . PHE B 1 71 ? -37.005 11.666  -32.289 1.00 13.89 ? 68  PHE B C   1 
ATOM   1183 O  O   . PHE B 1 71 ? -36.125 11.895  -31.413 1.00 11.93 ? 68  PHE B O   1 
ATOM   1184 C  CB  . PHE B 1 71 ? -36.247 9.834   -33.936 1.00 12.01 ? 68  PHE B CB  1 
ATOM   1185 C  CG  . PHE B 1 71 ? -36.186 8.328   -34.154 1.00 12.98 ? 68  PHE B CG  1 
ATOM   1186 C  CD1 . PHE B 1 71 ? -35.862 7.467   -33.108 1.00 13.78 ? 68  PHE B CD1 1 
ATOM   1187 C  CD2 . PHE B 1 71 ? -36.420 7.776   -35.412 1.00 13.97 ? 68  PHE B CD2 1 
ATOM   1188 C  CE1 . PHE B 1 71 ? -35.823 6.073   -33.296 1.00 14.38 ? 68  PHE B CE1 1 
ATOM   1189 C  CE2 . PHE B 1 71 ? -36.387 6.383   -35.602 1.00 15.83 ? 68  PHE B CE2 1 
ATOM   1190 C  CZ  . PHE B 1 71 ? -36.126 5.527   -34.526 1.00 15.00 ? 68  PHE B CZ  1 
ATOM   1191 N  N   . GLU B 1 72 ? -37.756 12.640  -32.827 1.00 14.98 ? 69  GLU B N   1 
ATOM   1192 C  CA  . GLU B 1 72 ? -37.706 14.006  -32.278 1.00 16.90 ? 69  GLU B CA  1 
ATOM   1193 C  C   . GLU B 1 72 ? -38.146 14.007  -30.815 1.00 15.38 ? 69  GLU B C   1 
ATOM   1194 O  O   . GLU B 1 72 ? -37.555 14.699  -29.981 1.00 14.33 ? 69  GLU B O   1 
ATOM   1195 C  CB  . GLU B 1 72 ? -38.587 15.013  -33.090 1.00 20.85 ? 69  GLU B CB  1 
ATOM   1196 C  CG  . GLU B 1 72 ? -38.005 15.364  -34.427 1.00 24.77 ? 69  GLU B CG  1 
ATOM   1197 C  CD  . GLU B 1 72 ? -38.956 16.138  -35.349 1.00 33.47 ? 69  GLU B CD  1 
ATOM   1198 O  OE1 . GLU B 1 72 ? -40.184 16.103  -35.131 1.00 36.44 ? 69  GLU B OE1 1 
ATOM   1199 O  OE2 . GLU B 1 72 ? -38.459 16.752  -36.319 1.00 39.61 ? 69  GLU B OE2 1 
ATOM   1200 N  N   . MET B 1 73 ? -39.191 13.241  -30.483 1.00 15.11 ? 70  MET B N   1 
ATOM   1201 C  CA  . MET B 1 73 ? -39.618 13.147  -29.097 1.00 16.00 ? 70  MET B CA  1 
ATOM   1202 C  C   . MET B 1 73 ? -38.586 12.448  -28.197 1.00 14.50 ? 70  MET B C   1 
ATOM   1203 O  O   . MET B 1 73 ? -38.420 12.826  -27.044 1.00 14.16 ? 70  MET B O   1 
ATOM   1204 C  CB  . MET B 1 73 ? -40.990 12.442  -28.946 1.00 18.17 ? 70  MET B CB  1 
ATOM   1205 C  CG  . MET B 1 73 ? -42.072 13.189  -29.729 1.00 24.85 ? 70  MET B CG  1 
ATOM   1206 S  SD  . MET B 1 73 ? -43.763 12.544  -29.492 1.00 28.93 ? 70  MET B SD  1 
ATOM   1207 C  CE  . MET B 1 73 ? -43.779 12.402  -27.688 1.00 25.81 ? 70  MET B CE  1 
ATOM   1208 N  N   . LEU B 1 74 ? -37.971 11.394  -28.702 1.00 13.25 ? 71  LEU B N   1 
ATOM   1209 C  CA  . LEU B 1 74 ? -36.930 10.689  -27.966 1.00 12.06 ? 71  LEU B CA  1 
ATOM   1210 C  C   . LEU B 1 74 ? -35.742 11.648  -27.661 1.00 12.48 ? 71  LEU B C   1 
ATOM   1211 O  O   . LEU B 1 74 ? -35.277 11.708  -26.532 1.00 12.88 ? 71  LEU B O   1 
ATOM   1212 C  CB  . LEU B 1 74 ? -36.482 9.468   -28.759 1.00 12.18 ? 71  LEU B CB  1 
ATOM   1213 C  CG  . LEU B 1 74 ? -35.346 8.637   -28.197 1.00 11.87 ? 71  LEU B CG  1 
ATOM   1214 C  CD1 . LEU B 1 74 ? -35.700 8.095   -26.806 1.00 11.97 ? 71  LEU B CD1 1 
ATOM   1215 C  CD2 . LEU B 1 74 ? -34.956 7.564   -29.214 1.00 12.33 ? 71  LEU B CD2 1 
ATOM   1216 N  N   . ILE B 1 75 ? -35.308 12.421  -28.649 1.00 11.91 ? 72  ILE B N   1 
ATOM   1217 C  CA  . ILE B 1 75 ? -34.224 13.394  -28.416 1.00 12.82 ? 72  ILE B CA  1 
ATOM   1218 C  C   . ILE B 1 75 ? -34.632 14.406  -27.294 1.00 14.30 ? 72  ILE B C   1 
ATOM   1219 O  O   . ILE B 1 75 ? -33.897 14.682  -26.288 1.00 14.01 ? 72  ILE B O   1 
ATOM   1220 C  CB  . ILE B 1 75 ? -33.922 14.115  -29.743 1.00 13.17 ? 72  ILE B CB  1 
ATOM   1221 C  CG1 . ILE B 1 75 ? -33.122 13.169  -30.661 1.00 12.64 ? 72  ILE B CG1 1 
ATOM   1222 C  CG2 . ILE B 1 75 ? -33.182 15.452  -29.495 1.00 14.14 ? 72  ILE B CG2 1 
ATOM   1223 C  CD1 . ILE B 1 75 ? -32.941 13.702  -32.073 1.00 13.50 ? 72  ILE B CD1 1 
ATOM   1224 N  N   . LYS B 1 76 ? -35.873 14.890  -27.400 1.00 16.75 ? 73  LYS B N   1 
ATOM   1225 C  CA  . LYS B 1 76 ? -36.384 15.814  -26.398 1.00 19.68 ? 73  LYS B CA  1 
ATOM   1226 C  C   . LYS B 1 76 ? -36.392 15.301  -25.007 1.00 17.19 ? 73  LYS B C   1 
ATOM   1227 O  O   . LYS B 1 76 ? -35.967 16.025  -24.091 1.00 16.54 ? 73  LYS B O   1 
ATOM   1228 C  CB  . LYS B 1 76 ? -37.808 16.284  -26.702 1.00 24.98 ? 73  LYS B CB  1 
ATOM   1229 C  CG  . LYS B 1 76 ? -37.952 17.401  -27.669 1.00 31.73 ? 73  LYS B CG  1 
ATOM   1230 C  CD  . LYS B 1 76 ? -39.443 17.807  -27.664 1.00 40.88 ? 73  LYS B CD  1 
ATOM   1231 C  CE  . LYS B 1 76 ? -39.811 18.896  -28.654 1.00 46.46 ? 73  LYS B CE  1 
ATOM   1232 N  NZ  . LYS B 1 76 ? -39.016 18.877  -29.913 1.00 49.71 ? 73  LYS B NZ  1 
ATOM   1233 N  N   . GLU B 1 77 ? -36.870 14.071  -24.836 1.00 16.10 ? 74  GLU B N   1 
ATOM   1234 C  CA  . GLU B 1 77 ? -36.985 13.481  -23.524 1.00 18.86 ? 74  GLU B CA  1 
ATOM   1235 C  C   . GLU B 1 77 ? -35.589 13.135  -22.937 1.00 18.49 ? 74  GLU B C   1 
ATOM   1236 O  O   . GLU B 1 77 ? -35.400 13.217  -21.734 1.00 18.40 ? 74  GLU B O   1 
ATOM   1237 C  CB  . GLU B 1 77 ? -37.862 12.237  -23.571 1.00 20.45 ? 74  GLU B CB  1 
ATOM   1238 C  CG  . GLU B 1 77 ? -39.327 12.614  -23.960 1.00 22.88 ? 74  GLU B CG  1 
ATOM   1239 C  CD  . GLU B 1 77 ? -39.968 13.571  -22.959 1.00 24.72 ? 74  GLU B CD  1 
ATOM   1240 O  OE1 . GLU B 1 77 ? -40.774 14.407  -23.402 1.00 30.00 ? 74  GLU B OE1 1 
ATOM   1241 O  OE2 . GLU B 1 77 ? -39.662 13.460  -21.736 1.00 23.59 ? 74  GLU B OE2 1 
ATOM   1242 N  N   . ILE B 1 78 ? -34.656 12.754  -23.811 1.00 15.51 ? 75  ILE B N   1 
ATOM   1243 C  CA  . ILE B 1 78 ? -33.287 12.561  -23.395 1.00 15.22 ? 75  ILE B CA  1 
ATOM   1244 C  C   . ILE B 1 78 ? -32.703 13.885  -22.911 1.00 15.82 ? 75  ILE B C   1 
ATOM   1245 O  O   . ILE B 1 78 ? -32.095 13.917  -21.825 1.00 19.13 ? 75  ILE B O   1 
ATOM   1246 C  CB  . ILE B 1 78 ? -32.405 11.957  -24.522 1.00 15.61 ? 75  ILE B CB  1 
ATOM   1247 C  CG1 . ILE B 1 78 ? -32.736 10.469  -24.800 1.00 15.51 ? 75  ILE B CG1 1 
ATOM   1248 C  CG2 . ILE B 1 78 ? -30.940 12.140  -24.185 1.00 16.49 ? 75  ILE B CG2 1 
ATOM   1249 C  CD1 . ILE B 1 78 ? -32.176 10.015  -26.189 1.00 17.31 ? 75  ILE B CD1 1 
ATOM   1250 N  N   . LEU B 1 79 ? -32.896 14.969  -23.647 1.00 15.91 ? 76  LEU B N   1 
ATOM   1251 C  CA  . LEU B 1 79 ? -32.343 16.287  -23.284 1.00 17.74 ? 76  LEU B CA  1 
ATOM   1252 C  C   . LEU B 1 79 ? -33.022 16.870  -22.011 1.00 21.27 ? 76  LEU B C   1 
ATOM   1253 O  O   . LEU B 1 79 ? -32.349 17.454  -21.153 1.00 19.30 ? 76  LEU B O   1 
ATOM   1254 C  CB  . LEU B 1 79 ? -32.475 17.283  -24.435 1.00 18.05 ? 76  LEU B CB  1 
ATOM   1255 C  CG  . LEU B 1 79 ? -31.586 17.022  -25.646 1.00 19.08 ? 76  LEU B CG  1 
ATOM   1256 C  CD1 . LEU B 1 79 ? -31.982 17.949  -26.786 1.00 22.49 ? 76  LEU B CD1 1 
ATOM   1257 C  CD2 . LEU B 1 79 ? -30.124 17.192  -25.234 1.00 21.88 ? 76  LEU B CD2 1 
ATOM   1258 N  N   . LYS B 1 80 ? -34.337 16.644  -21.888 1.00 21.65 ? 77  LYS B N   1 
ATOM   1259 C  CA  . LYS B 1 80 ? -35.080 17.002  -20.687 1.00 27.16 ? 77  LYS B CA  1 
ATOM   1260 C  C   . LYS B 1 80 ? -34.757 16.164  -19.469 1.00 26.74 ? 77  LYS B C   1 
ATOM   1261 O  O   . LYS B 1 80 ? -34.974 16.629  -18.386 1.00 27.73 ? 77  LYS B O   1 
ATOM   1262 C  CB  . LYS B 1 80 ? -36.613 16.973  -20.926 1.00 27.48 ? 77  LYS B CB  1 
ATOM   1263 C  CG  . LYS B 1 80 ? -37.092 18.204  -21.700 1.00 32.83 ? 77  LYS B CG  1 
ATOM   1264 C  CD  . LYS B 1 80 ? -38.629 18.288  -21.670 1.00 40.55 ? 77  LYS B CD  1 
ATOM   1265 C  CE  . LYS B 1 80 ? -39.250 17.151  -22.473 1.00 41.88 ? 77  LYS B CE  1 
ATOM   1266 N  NZ  . LYS B 1 80 ? -40.716 16.968  -22.221 1.00 47.65 ? 77  LYS B NZ  1 
ATOM   1267 N  N   . HIS B 1 81 ? -34.205 14.967  -19.630 1.00 25.69 ? 78  HIS B N   1 
ATOM   1268 C  CA  . HIS B 1 81 ? -33.993 14.058  -18.503 1.00 24.30 ? 78  HIS B CA  1 
ATOM   1269 C  C   . HIS B 1 81 ? -32.950 14.612  -17.534 1.00 22.86 ? 78  HIS B C   1 
ATOM   1270 O  O   . HIS B 1 81 ? -31.810 14.944  -17.920 1.00 22.07 ? 78  HIS B O   1 
ATOM   1271 C  CB  . HIS B 1 81 ? -33.603 12.623  -18.965 1.00 25.05 ? 78  HIS B CB  1 
ATOM   1272 C  CG  . HIS B 1 81 ? -33.686 11.571  -17.872 1.00 26.70 ? 78  HIS B CG  1 
ATOM   1273 N  ND1 . HIS B 1 81 ? -32.692 11.382  -16.929 1.00 30.29 ? 78  HIS B ND1 1 
ATOM   1274 C  CD2 . HIS B 1 81 ? -34.646 10.664  -17.568 1.00 27.49 ? 78  HIS B CD2 1 
ATOM   1275 C  CE1 . HIS B 1 81 ? -33.039 10.409  -16.093 1.00 27.61 ? 78  HIS B CE1 1 
ATOM   1276 N  NE2 . HIS B 1 81 ? -34.220 9.955   -16.463 1.00 29.74 ? 78  HIS B NE2 1 
ATOM   1277 N  N   . ASP B 1 82 ? -33.357 14.750  -16.270 1.00 22.28 ? 79  ASP B N   1 
ATOM   1278 C  CA  . ASP B 1 82 ? -32.465 15.223  -15.231 1.00 25.26 ? 79  ASP B CA  1 
ATOM   1279 C  C   . ASP B 1 82 ? -31.661 14.061  -14.638 1.00 28.83 ? 79  ASP B C   1 
ATOM   1280 O  O   . ASP B 1 82 ? -32.153 13.201  -13.890 1.00 32.07 ? 79  ASP B O   1 
ATOM   1281 C  CB  . ASP B 1 82 ? -33.203 16.019  -14.138 1.00 26.30 ? 79  ASP B CB  1 
ATOM   1282 C  CG  . ASP B 1 82 ? -32.247 16.863  -13.302 1.00 30.34 ? 79  ASP B CG  1 
ATOM   1283 O  OD1 . ASP B 1 82 ? -31.153 17.262  -13.809 1.00 27.72 ? 79  ASP B OD1 1 
ATOM   1284 O  OD2 . ASP B 1 82 ? -32.574 17.129  -12.131 1.00 35.29 ? 79  ASP B OD2 1 
ATOM   1285 O  OXT . ASP B 1 82 ? -30.468 13.952  -14.927 1.00 28.19 ? 79  ASP B OXT 1 
ATOM   1286 N  N   . SER C 1 6  ? -38.250 -3.752  -43.884 1.00 39.57 ? 3   SER C N   1 
ATOM   1287 C  CA  . SER C 1 6  ? -38.017 -2.649  -42.913 1.00 36.37 ? 3   SER C CA  1 
ATOM   1288 C  C   . SER C 1 6  ? -37.201 -1.488  -43.492 1.00 36.72 ? 3   SER C C   1 
ATOM   1289 O  O   . SER C 1 6  ? -35.973 -1.541  -43.695 1.00 40.58 ? 3   SER C O   1 
ATOM   1290 C  CB  . SER C 1 6  ? -37.370 -3.151  -41.614 1.00 35.97 ? 3   SER C CB  1 
ATOM   1291 O  OG  . SER C 1 6  ? -37.128 -2.073  -40.732 1.00 25.79 ? 3   SER C OG  1 
ATOM   1292 N  N   . PHE C 1 7  ? -37.933 -0.421  -43.748 1.00 33.21 ? 4   PHE C N   1 
ATOM   1293 C  CA  . PHE C 1 7  ? -37.364 0.864   -44.042 1.00 27.91 ? 4   PHE C CA  1 
ATOM   1294 C  C   . PHE C 1 7  ? -36.437 1.354   -42.914 1.00 23.29 ? 4   PHE C C   1 
ATOM   1295 O  O   . PHE C 1 7  ? -35.330 1.797   -43.168 1.00 25.01 ? 4   PHE C O   1 
ATOM   1296 C  CB  . PHE C 1 7  ? -38.524 1.817   -44.222 1.00 30.57 ? 4   PHE C CB  1 
ATOM   1297 C  CG  . PHE C 1 7  ? -38.129 3.237   -44.394 1.00 32.93 ? 4   PHE C CG  1 
ATOM   1298 C  CD1 . PHE C 1 7  ? -37.755 3.706   -45.639 1.00 33.45 ? 4   PHE C CD1 1 
ATOM   1299 C  CD2 . PHE C 1 7  ? -38.166 4.119   -43.315 1.00 34.50 ? 4   PHE C CD2 1 
ATOM   1300 C  CE1 . PHE C 1 7  ? -37.424 5.041   -45.813 1.00 36.30 ? 4   PHE C CE1 1 
ATOM   1301 C  CE2 . PHE C 1 7  ? -37.835 5.456   -43.481 1.00 33.47 ? 4   PHE C CE2 1 
ATOM   1302 C  CZ  . PHE C 1 7  ? -37.448 5.912   -44.738 1.00 34.39 ? 4   PHE C CZ  1 
ATOM   1303 N  N   . LEU C 1 8  ? -36.898 1.281   -41.674 1.00 20.73 ? 5   LEU C N   1 
ATOM   1304 C  CA  . LEU C 1 8  ? -36.147 1.806   -40.574 1.00 18.71 ? 5   LEU C CA  1 
ATOM   1305 C  C   . LEU C 1 8  ? -34.768 1.117   -40.438 1.00 19.31 ? 5   LEU C C   1 
ATOM   1306 O  O   . LEU C 1 8  ? -33.728 1.777   -40.221 1.00 17.12 ? 5   LEU C O   1 
ATOM   1307 C  CB  . LEU C 1 8  ? -36.904 1.626   -39.278 1.00 21.04 ? 5   LEU C CB  1 
ATOM   1308 C  CG  . LEU C 1 8  ? -36.926 2.716   -38.249 1.00 24.48 ? 5   LEU C CG  1 
ATOM   1309 C  CD1 . LEU C 1 8  ? -37.084 2.215   -36.817 1.00 26.22 ? 5   LEU C CD1 1 
ATOM   1310 C  CD2 . LEU C 1 8  ? -35.863 3.789   -38.421 1.00 24.20 ? 5   LEU C CD2 1 
ATOM   1311 N  N   . LEU C 1 9  ? -34.766 -0.194  -40.533 1.00 16.99 ? 6   LEU C N   1 
ATOM   1312 C  CA  . LEU C 1 9  ? -33.474 -0.934  -40.417 1.00 17.37 ? 6   LEU C CA  1 
ATOM   1313 C  C   . LEU C 1 9  ? -32.451 -0.507  -41.402 1.00 17.53 ? 6   LEU C C   1 
ATOM   1314 O  O   . LEU C 1 9  ? -31.272 -0.405  -41.057 1.00 13.82 ? 6   LEU C O   1 
ATOM   1315 C  CB  . LEU C 1 9  ? -33.672 -2.400  -40.506 1.00 17.50 ? 6   LEU C CB  1 
ATOM   1316 C  CG  . LEU C 1 9  ? -34.095 -3.070  -39.215 1.00 19.42 ? 6   LEU C CG  1 
ATOM   1317 C  CD1 . LEU C 1 9  ? -34.289 -4.575  -39.479 1.00 19.96 ? 6   LEU C CD1 1 
ATOM   1318 C  CD2 . LEU C 1 9  ? -33.071 -2.873  -38.098 1.00 18.43 ? 6   LEU C CD2 1 
ATOM   1319 N  N   . SER C 1 10 ? -32.818 -0.189  -42.629 1.00 17.67 ? 7   SER C N   1 
ATOM   1320 C  CA  . SER C 1 10 ? -31.768 0.161   -43.541 1.00 18.99 ? 7   SER C CA  1 
ATOM   1321 C  C   . SER C 1 10 ? -31.309 1.592   -43.334 1.00 18.08 ? 7   SER C C   1 
ATOM   1322 O  O   . SER C 1 10 ? -30.167 1.941   -43.675 1.00 18.63 ? 7   SER C O   1 
ATOM   1323 C  CB  . SER C 1 10 ? -32.173 -0.115  -45.001 1.00 24.20 ? 7   SER C CB  1 
ATOM   1324 O  OG  . SER C 1 10 ? -33.082 0.873   -45.369 1.00 27.33 ? 7   SER C OG  1 
ATOM   1325 N  N   . LYS C 1 11 ? -32.162 2.454   -42.778 1.00 15.91 ? 8   LYS C N   1 
ATOM   1326 C  CA  . LYS C 1 11 ? -31.696 3.783   -42.335 1.00 14.92 ? 8   LYS C CA  1 
ATOM   1327 C  C   . LYS C 1 11 ? -30.789 3.698   -41.081 1.00 14.05 ? 8   LYS C C   1 
ATOM   1328 O  O   . LYS C 1 11 ? -29.759 4.356   -41.038 1.00 13.75 ? 8   LYS C O   1 
ATOM   1329 C  CB  . LYS C 1 11 ? -32.890 4.691   -42.062 1.00 16.52 ? 8   LYS C CB  1 
ATOM   1330 C  CG  . LYS C 1 11 ? -33.723 4.966   -43.321 1.00 19.73 ? 8   LYS C CG  1 
ATOM   1331 C  CD  . LYS C 1 11 ? -32.935 5.732   -44.370 1.00 21.64 ? 8   LYS C CD  1 
ATOM   1332 C  CE  . LYS C 1 11 ? -33.591 5.592   -45.750 1.00 27.53 ? 8   LYS C CE  1 
ATOM   1333 N  NZ  . LYS C 1 11 ? -33.408 6.871   -46.496 1.00 31.75 ? 8   LYS C NZ  1 
ATOM   1334 N  N   . VAL C 1 12 ? -31.115 2.824   -40.136 1.00 12.74 ? 9   VAL C N   1 
ATOM   1335 C  CA  . VAL C 1 12 ? -30.262 2.658   -38.994 1.00 14.04 ? 9   VAL C CA  1 
ATOM   1336 C  C   . VAL C 1 12 ? -28.865 2.124   -39.423 1.00 14.96 ? 9   VAL C C   1 
ATOM   1337 O  O   . VAL C 1 12 ? -27.775 2.630   -39.014 1.00 12.28 ? 9   VAL C O   1 
ATOM   1338 C  CB  . VAL C 1 12 ? -30.926 1.735   -37.985 1.00 14.69 ? 9   VAL C CB  1 
ATOM   1339 C  CG1 . VAL C 1 12 ? -29.897 1.246   -36.969 1.00 16.40 ? 9   VAL C CG1 1 
ATOM   1340 C  CG2 . VAL C 1 12 ? -32.090 2.438   -37.309 1.00 14.97 ? 9   VAL C CG2 1 
ATOM   1341 N  N   . SER C 1 13 ? -28.873 1.149   -40.324 1.00 15.25 ? 10  SER C N   1 
ATOM   1342 C  CA  . SER C 1 13 ? -27.588 0.565   -40.697 1.00 17.19 ? 10  SER C CA  1 
ATOM   1343 C  C   . SER C 1 13 ? -26.703 1.525   -41.501 1.00 17.49 ? 10  SER C C   1 
ATOM   1344 O  O   . SER C 1 13 ? -25.460 1.533   -41.352 1.00 16.20 ? 10  SER C O   1 
ATOM   1345 C  CB  . SER C 1 13 ? -27.800 -0.744  -41.389 1.00 21.06 ? 10  SER C CB  1 
ATOM   1346 O  OG  . SER C 1 13 ? -28.175 -0.576  -42.692 1.00 22.02 ? 10  SER C OG  1 
ATOM   1347 N  N   . PHE C 1 14 ? -27.310 2.345   -42.347 1.00 16.77 ? 11  PHE C N   1 
ATOM   1348 C  CA  . PHE C 1 14 ? -26.591 3.425   -43.049 1.00 18.91 ? 11  PHE C CA  1 
ATOM   1349 C  C   . PHE C 1 14 ? -25.974 4.505   -42.144 1.00 16.73 ? 11  PHE C C   1 
ATOM   1350 O  O   . PHE C 1 14 ? -24.806 4.938   -42.347 1.00 15.36 ? 11  PHE C O   1 
ATOM   1351 C  CB  . PHE C 1 14 ? -27.501 4.051   -44.135 1.00 23.28 ? 11  PHE C CB  1 
ATOM   1352 C  CG  . PHE C 1 14 ? -26.736 4.680   -45.248 1.00 27.94 ? 11  PHE C CG  1 
ATOM   1353 C  CD1 . PHE C 1 14 ? -25.914 3.911   -46.036 1.00 29.69 ? 11  PHE C CD1 1 
ATOM   1354 C  CD2 . PHE C 1 14 ? -26.769 6.045   -45.441 1.00 35.02 ? 11  PHE C CD2 1 
ATOM   1355 C  CE1 . PHE C 1 14 ? -25.187 4.472   -47.074 1.00 35.47 ? 11  PHE C CE1 1 
ATOM   1356 C  CE2 . PHE C 1 14 ? -26.023 6.643   -46.474 1.00 38.09 ? 11  PHE C CE2 1 
ATOM   1357 C  CZ  . PHE C 1 14 ? -25.229 5.855   -47.280 1.00 38.70 ? 11  PHE C CZ  1 
ATOM   1358 N  N   . VAL C 1 15 ? -26.694 4.895   -41.081 1.00 15.40 ? 12  VAL C N   1 
ATOM   1359 C  CA  . VAL C 1 15 ? -26.160 5.835   -40.109 1.00 14.31 ? 12  VAL C CA  1 
ATOM   1360 C  C   . VAL C 1 15 ? -25.014 5.234   -39.319 1.00 13.13 ? 12  VAL C C   1 
ATOM   1361 O  O   . VAL C 1 15 ? -23.973 5.911   -39.140 1.00 14.73 ? 12  VAL C O   1 
ATOM   1362 C  CB  . VAL C 1 15 ? -27.259 6.398   -39.172 1.00 14.88 ? 12  VAL C CB  1 
ATOM   1363 C  CG1 . VAL C 1 15 ? -26.629 7.269   -38.091 1.00 16.40 ? 12  VAL C CG1 1 
ATOM   1364 C  CG2 . VAL C 1 15 ? -28.228 7.222   -40.028 1.00 16.21 ? 12  VAL C CG2 1 
ATOM   1365 N  N   . ILE C 1 16 ? -25.160 3.957   -38.935 1.00 12.55 ? 13  ILE C N   1 
ATOM   1366 C  CA  . ILE C 1 16 ? -24.040 3.231   -38.278 1.00 12.49 ? 13  ILE C CA  1 
ATOM   1367 C  C   . ILE C 1 16 ? -22.792 3.296   -39.168 1.00 13.50 ? 13  ILE C C   1 
ATOM   1368 O  O   . ILE C 1 16 ? -21.673 3.709   -38.713 1.00 12.66 ? 13  ILE C O   1 
ATOM   1369 C  CB  . ILE C 1 16 ? -24.436 1.818   -37.817 1.00 11.85 ? 13  ILE C CB  1 
ATOM   1370 C  CG1 . ILE C 1 16 ? -25.459 1.882   -36.702 1.00 12.32 ? 13  ILE C CG1 1 
ATOM   1371 C  CG2 . ILE C 1 16 ? -23.197 1.011   -37.444 1.00 12.72 ? 13  ILE C CG2 1 
ATOM   1372 C  CD1 . ILE C 1 16 ? -26.093 0.536   -36.398 1.00 13.22 ? 13  ILE C CD1 1 
ATOM   1373 N  N   . LYS C 1 17 ? -22.960 2.884   -40.432 1.00 13.69 ? 14  LYS C N   1 
ATOM   1374 C  CA  . LYS C 1 17 ? -21.839 2.905   -41.369 1.00 14.57 ? 14  LYS C CA  1 
ATOM   1375 C  C   . LYS C 1 17 ? -21.225 4.304   -41.562 1.00 15.03 ? 14  LYS C C   1 
ATOM   1376 O  O   . LYS C 1 17 ? -19.999 4.434   -41.558 1.00 15.62 ? 14  LYS C O   1 
ATOM   1377 C  CB  . LYS C 1 17 ? -22.271 2.294   -42.694 1.00 14.98 ? 14  LYS C CB  1 
ATOM   1378 C  CG  . LYS C 1 17 ? -21.138 2.312   -43.740 1.00 16.24 ? 14  LYS C CG  1 
ATOM   1379 C  CD  . LYS C 1 17 ? -21.645 1.826   -45.085 1.00 17.83 ? 14  LYS C CD  1 
ATOM   1380 C  CE  . LYS C 1 17 ? -20.481 1.520   -46.008 1.00 21.15 ? 14  LYS C CE  1 
ATOM   1381 N  NZ  . LYS C 1 17 ? -21.011 0.969   -47.279 1.00 22.94 ? 14  LYS C NZ  1 
ATOM   1382 N  N   . LYS C 1 18 ? -22.052 5.333   -41.715 1.00 14.83 ? 15  LYS C N   1 
ATOM   1383 C  CA  . LYS C 1 18 ? -21.549 6.718   -41.885 1.00 17.00 ? 15  LYS C CA  1 
ATOM   1384 C  C   . LYS C 1 18 ? -20.744 7.235   -40.694 1.00 15.69 ? 15  LYS C C   1 
ATOM   1385 O  O   . LYS C 1 18 ? -19.694 7.873   -40.866 1.00 15.53 ? 15  LYS C O   1 
ATOM   1386 C  CB  . LYS C 1 18 ? -22.690 7.692   -42.208 1.00 19.49 ? 15  LYS C CB  1 
ATOM   1387 C  CG  . LYS C 1 18 ? -23.153 7.527   -43.644 1.00 23.33 ? 15  LYS C CG  1 
ATOM   1388 C  CD  . LYS C 1 18 ? -24.493 8.243   -43.866 1.00 28.16 ? 15  LYS C CD  1 
ATOM   1389 C  CE  . LYS C 1 18 ? -24.376 9.735   -44.096 1.00 30.35 ? 15  LYS C CE  1 
ATOM   1390 N  NZ  . LYS C 1 18 ? -25.429 10.192  -45.077 1.00 29.45 ? 15  LYS C NZ  1 
ATOM   1391 N  N   . ILE C 1 19 ? -21.208 6.921   -39.491 1.00 16.01 ? 16  ILE C N   1 
ATOM   1392 C  CA  . ILE C 1 19 ? -20.522 7.336   -38.268 1.00 14.92 ? 16  ILE C CA  1 
ATOM   1393 C  C   . ILE C 1 19 ? -19.232 6.520   -38.099 1.00 14.80 ? 16  ILE C C   1 
ATOM   1394 O  O   . ILE C 1 19 ? -18.169 7.060   -37.739 1.00 14.97 ? 16  ILE C O   1 
ATOM   1395 C  CB  . ILE C 1 19 ? -21.419 7.213   -37.008 1.00 16.36 ? 16  ILE C CB  1 
ATOM   1396 C  CG1 . ILE C 1 19 ? -22.616 8.141   -37.114 1.00 16.14 ? 16  ILE C CG1 1 
ATOM   1397 C  CG2 . ILE C 1 19 ? -20.660 7.548   -35.726 1.00 16.23 ? 16  ILE C CG2 1 
ATOM   1398 C  CD1 . ILE C 1 19 ? -23.731 7.777   -36.142 1.00 16.50 ? 16  ILE C CD1 1 
ATOM   1399 N  N   . ARG C 1 20 ? -19.286 5.242   -38.374 1.00 14.47 ? 17  ARG C N   1 
ATOM   1400 C  CA  . ARG C 1 20 ? -18.094 4.426   -38.322 1.00 15.08 ? 17  ARG C CA  1 
ATOM   1401 C  C   . ARG C 1 20 ? -17.021 4.950   -39.290 1.00 14.92 ? 17  ARG C C   1 
ATOM   1402 O  O   . ARG C 1 20 ? -15.834 5.062   -38.939 1.00 16.00 ? 17  ARG C O   1 
ATOM   1403 C  CB  . ARG C 1 20 ? -18.435 2.966   -38.662 1.00 14.76 ? 17  ARG C CB  1 
ATOM   1404 C  CG  . ARG C 1 20 ? -17.218 2.012   -38.754 1.00 15.65 ? 17  ARG C CG  1 
ATOM   1405 C  CD  . ARG C 1 20 ? -17.605 0.611   -39.242 1.00 15.94 ? 17  ARG C CD  1 
ATOM   1406 N  NE  . ARG C 1 20 ? -18.050 0.433   -40.643 1.00 16.09 ? 17  ARG C NE  1 
ATOM   1407 C  CZ  . ARG C 1 20 ? -17.263 0.383   -41.708 1.00 17.45 ? 17  ARG C CZ  1 
ATOM   1408 N  NH1 . ARG C 1 20 ? -15.953 0.655   -41.615 1.00 16.69 ? 17  ARG C NH1 1 
ATOM   1409 N  NH2 . ARG C 1 20 ? -17.786 0.086   -42.908 1.00 17.24 ? 17  ARG C NH2 1 
ATOM   1410 N  N   . LEU C 1 21 ? -17.431 5.243   -40.516 1.00 16.76 ? 18  LEU C N   1 
ATOM   1411 C  CA  . LEU C 1 21 ? -16.527 5.850   -41.507 1.00 17.71 ? 18  LEU C CA  1 
ATOM   1412 C  C   . LEU C 1 21 ? -15.982 7.222   -41.066 1.00 20.06 ? 18  LEU C C   1 
ATOM   1413 O  O   . LEU C 1 21 ? -14.773 7.462   -41.200 1.00 17.39 ? 18  LEU C O   1 
ATOM   1414 C  CB  . LEU C 1 21 ? -17.209 5.941   -42.868 1.00 18.01 ? 18  LEU C CB  1 
ATOM   1415 C  CG  . LEU C 1 21 ? -17.576 4.605   -43.494 1.00 18.12 ? 18  LEU C CG  1 
ATOM   1416 C  CD1 . LEU C 1 21 ? -18.223 4.839   -44.853 1.00 19.61 ? 18  LEU C CD1 1 
ATOM   1417 C  CD2 . LEU C 1 21 ? -16.357 3.749   -43.556 1.00 19.53 ? 18  LEU C CD2 1 
ATOM   1418 N  N   . GLU C 1 22 ? -16.833 8.087   -40.514 1.00 19.19 ? 19  GLU C N   1 
ATOM   1419 C  CA  . GLU C 1 22 ? -16.382 9.374   -40.006 1.00 23.57 ? 19  GLU C CA  1 
ATOM   1420 C  C   . GLU C 1 22 ? -15.330 9.179   -38.872 1.00 23.79 ? 19  GLU C C   1 
ATOM   1421 O  O   . GLU C 1 22 ? -14.411 9.958   -38.763 1.00 22.20 ? 19  GLU C O   1 
ATOM   1422 C  CB  . GLU C 1 22 ? -17.536 10.213  -39.512 1.00 26.10 ? 19  GLU C CB  1 
ATOM   1423 C  CG  . GLU C 1 22 ? -17.133 11.619  -39.053 1.00 35.45 ? 19  GLU C CG  1 
ATOM   1424 C  CD  . GLU C 1 22 ? -18.318 12.547  -38.739 1.00 41.63 ? 19  GLU C CD  1 
ATOM   1425 O  OE1 . GLU C 1 22 ? -19.476 12.095  -38.761 1.00 50.49 ? 19  GLU C OE1 1 
ATOM   1426 O  OE2 . GLU C 1 22 ? -18.100 13.742  -38.429 1.00 49.99 ? 19  GLU C OE2 1 
ATOM   1427 N  N   . LYS C 1 23 ? -15.456 8.131   -38.069 1.00 21.61 ? 20  LYS C N   1 
ATOM   1428 C  CA  . LYS C 1 23 ? -14.525 7.901   -36.973 1.00 21.68 ? 20  LYS C CA  1 
ATOM   1429 C  C   . LYS C 1 23 ? -13.237 7.220   -37.437 1.00 24.11 ? 20  LYS C C   1 
ATOM   1430 O  O   . LYS C 1 23 ? -12.397 6.925   -36.601 1.00 23.01 ? 20  LYS C O   1 
ATOM   1431 C  CB  . LYS C 1 23 ? -15.195 7.053   -35.910 1.00 22.35 ? 20  LYS C CB  1 
ATOM   1432 C  CG  . LYS C 1 23 ? -16.372 7.717   -35.218 1.00 23.36 ? 20  LYS C CG  1 
ATOM   1433 C  CD  . LYS C 1 23 ? -15.982 8.991   -34.495 1.00 26.08 ? 20  LYS C CD  1 
ATOM   1434 C  CE  . LYS C 1 23 ? -17.207 9.609   -33.847 1.00 31.44 ? 20  LYS C CE  1 
ATOM   1435 N  NZ  . LYS C 1 23 ? -16.918 10.105  -32.501 1.00 33.38 ? 20  LYS C NZ  1 
ATOM   1436 N  N   . GLY C 1 24 ? -13.091 6.924   -38.737 1.00 21.11 ? 21  GLY C N   1 
ATOM   1437 C  CA  . GLY C 1 24 ? -11.942 6.213   -39.245 1.00 23.14 ? 21  GLY C CA  1 
ATOM   1438 C  C   . GLY C 1 24 ? -11.859 4.767   -38.816 1.00 22.79 ? 21  GLY C C   1 
ATOM   1439 O  O   . GLY C 1 24 ? -10.772 4.221   -38.804 1.00 22.98 ? 21  GLY C O   1 
ATOM   1440 N  N   . MET C 1 25 ? -12.997 4.116   -38.464 1.00 18.81 ? 22  MET C N   1 
ATOM   1441 C  CA  . MET C 1 25 ? -13.004 2.762   -37.937 1.00 15.80 ? 22  MET C CA  1 
ATOM   1442 C  C   . MET C 1 25 ? -13.379 1.764   -39.007 1.00 16.08 ? 22  MET C C   1 
ATOM   1443 O  O   . MET C 1 25 ? -14.295 2.005   -39.789 1.00 14.72 ? 22  MET C O   1 
ATOM   1444 C  CB  . MET C 1 25 ? -13.994 2.676   -36.772 1.00 17.70 ? 22  MET C CB  1 
ATOM   1445 C  CG  . MET C 1 25 ? -13.631 3.515   -35.558 1.00 18.51 ? 22  MET C CG  1 
ATOM   1446 S  SD  . MET C 1 25 ? -14.950 3.584   -34.331 1.00 20.13 ? 22  MET C SD  1 
ATOM   1447 C  CE  . MET C 1 25 ? -14.902 1.943   -33.748 1.00 18.72 ? 22  MET C CE  1 
ATOM   1448 N  N   . THR C 1 26 ? -12.711 0.608   -39.020 1.00 15.93 ? 23  THR C N   1 
ATOM   1449 C  CA  . THR C 1 26 ? -13.104 -0.522  -39.844 1.00 15.75 ? 23  THR C CA  1 
ATOM   1450 C  C   . THR C 1 26 ? -14.267 -1.252  -39.126 1.00 14.28 ? 23  THR C C   1 
ATOM   1451 O  O   . THR C 1 26 ? -14.535 -0.974  -37.972 1.00 13.63 ? 23  THR C O   1 
ATOM   1452 C  CB  . THR C 1 26 ? -11.939 -1.555  -40.018 1.00 15.43 ? 23  THR C CB  1 
ATOM   1453 O  OG1 . THR C 1 26 ? -11.577 -2.119  -38.743 1.00 16.65 ? 23  THR C OG1 1 
ATOM   1454 C  CG2 . THR C 1 26 ? -10.723 -0.905  -40.614 1.00 17.72 ? 23  THR C CG2 1 
ATOM   1455 N  N   . GLN C 1 27 ? -14.902 -2.215  -39.768 1.00 14.27 ? 24  GLN C N   1 
ATOM   1456 C  CA  . GLN C 1 27 ? -15.906 -3.046  -39.089 1.00 14.54 ? 24  GLN C CA  1 
ATOM   1457 C  C   . GLN C 1 27 ? -15.317 -3.831  -37.940 1.00 15.98 ? 24  GLN C C   1 
ATOM   1458 O  O   . GLN C 1 27 ? -15.929 -3.939  -36.852 1.00 13.70 ? 24  GLN C O   1 
ATOM   1459 C  CB  . GLN C 1 27 ? -16.534 -4.029  -40.064 1.00 14.76 ? 24  GLN C CB  1 
ATOM   1460 C  CG  . GLN C 1 27 ? -17.266 -3.350  -41.167 1.00 14.63 ? 24  GLN C CG  1 
ATOM   1461 C  CD  . GLN C 1 27 ? -18.007 -4.341  -42.072 1.00 17.67 ? 24  GLN C CD  1 
ATOM   1462 O  OE1 . GLN C 1 27 ? -17.626 -5.480  -42.170 1.00 20.61 ? 24  GLN C OE1 1 
ATOM   1463 N  NE2 . GLN C 1 27 ? -19.017 -3.892  -42.744 1.00 18.10 ? 24  GLN C NE2 1 
ATOM   1464 N  N   . GLU C 1 28 ? -14.072 -4.310  -38.128 1.00 15.98 ? 25  GLU C N   1 
ATOM   1465 C  CA  . GLU C 1 28 ? -13.400 -5.036  -37.060 1.00 18.94 ? 25  GLU C CA  1 
ATOM   1466 C  C   . GLU C 1 28 ? -13.159 -4.145  -35.863 1.00 15.60 ? 25  GLU C C   1 
ATOM   1467 O  O   . GLU C 1 28 ? -13.324 -4.584  -34.735 1.00 15.45 ? 25  GLU C O   1 
ATOM   1468 C  CB  . GLU C 1 28 ? -12.022 -5.643  -37.542 1.00 22.15 ? 25  GLU C CB  1 
ATOM   1469 C  CG  . GLU C 1 28 ? -11.498 -6.673  -36.548 1.00 27.63 ? 25  GLU C CG  1 
ATOM   1470 C  CD  . GLU C 1 28 ? -10.109 -7.227  -36.870 1.00 34.39 ? 25  GLU C CD  1 
ATOM   1471 O  OE1 . GLU C 1 28 ? -9.425  -6.699  -37.783 1.00 41.24 ? 25  GLU C OE1 1 
ATOM   1472 O  OE2 . GLU C 1 28 ? -9.706  -8.171  -36.166 1.00 42.18 ? 25  GLU C OE2 1 
ATOM   1473 N  N   . ASP C 1 29 ? -12.813 -2.877  -36.111 1.00 14.72 ? 26  ASP C N   1 
ATOM   1474 C  CA  . ASP C 1 29 ? -12.567 -1.935  -35.032 1.00 14.43 ? 26  ASP C CA  1 
ATOM   1475 C  C   . ASP C 1 29 ? -13.883 -1.731  -34.215 1.00 14.50 ? 26  ASP C C   1 
ATOM   1476 O  O   . ASP C 1 29 ? -13.897 -1.654  -32.962 1.00 15.01 ? 26  ASP C O   1 
ATOM   1477 C  CB  . ASP C 1 29 ? -12.100 -0.565  -35.516 1.00 14.18 ? 26  ASP C CB  1 
ATOM   1478 C  CG  . ASP C 1 29 ? -10.676 -0.560  -36.204 1.00 15.28 ? 26  ASP C CG  1 
ATOM   1479 O  OD1 . ASP C 1 29 ? -9.906  -1.504  -35.990 1.00 16.19 ? 26  ASP C OD1 1 
ATOM   1480 O  OD2 . ASP C 1 29 ? -10.462 0.378   -37.011 1.00 14.63 ? 26  ASP C OD2 1 
ATOM   1481 N  N   . LEU C 1 30 ? -14.956 -1.533  -34.947 1.00 14.53 ? 27  LEU C N   1 
ATOM   1482 C  CA  . LEU C 1 30 ? -16.260 -1.348  -34.276 1.00 14.60 ? 27  LEU C CA  1 
ATOM   1483 C  C   . LEU C 1 30 ? -16.692 -2.545  -33.472 1.00 12.88 ? 27  LEU C C   1 
ATOM   1484 O  O   . LEU C 1 30 ? -17.138 -2.388  -32.329 1.00 12.13 ? 27  LEU C O   1 
ATOM   1485 C  CB  . LEU C 1 30 ? -17.332 -0.933  -35.291 1.00 15.13 ? 27  LEU C CB  1 
ATOM   1486 C  CG  . LEU C 1 30 ? -18.742 -0.740  -34.696 1.00 14.77 ? 27  LEU C CG  1 
ATOM   1487 C  CD1 . LEU C 1 30 ? -18.748 0.268   -33.576 1.00 14.65 ? 27  LEU C CD1 1 
ATOM   1488 C  CD2 . LEU C 1 30 ? -19.679 -0.253  -35.835 1.00 14.52 ? 27  LEU C CD2 1 
ATOM   1489 N  N   . ALA C 1 31 ? -16.496 -3.744  -33.991 1.00 12.75 ? 28  ALA C N   1 
ATOM   1490 C  CA  . ALA C 1 31 ? -16.775 -4.979  -33.248 1.00 12.97 ? 28  ALA C CA  1 
ATOM   1491 C  C   . ALA C 1 31 ? -15.989 -5.052  -31.936 1.00 13.69 ? 28  ALA C C   1 
ATOM   1492 O  O   . ALA C 1 31 ? -16.552 -5.367  -30.874 1.00 13.33 ? 28  ALA C O   1 
ATOM   1493 C  CB  . ALA C 1 31 ? -16.472 -6.214  -34.088 1.00 13.25 ? 28  ALA C CB  1 
ATOM   1494 N  N   . TYR C 1 32 ? -14.675 -4.787  -32.040 1.00 14.50 ? 29  TYR C N   1 
ATOM   1495 C  CA  . TYR C 1 32 ? -13.786 -4.653  -30.873 1.00 14.24 ? 29  TYR C CA  1 
ATOM   1496 C  C   . TYR C 1 32 ? -14.310 -3.724  -29.799 1.00 15.35 ? 29  TYR C C   1 
ATOM   1497 O  O   . TYR C 1 32 ? -14.447 -4.106  -28.628 1.00 16.06 ? 29  TYR C O   1 
ATOM   1498 C  CB  . TYR C 1 32 ? -12.326 -4.283  -31.352 1.00 14.63 ? 29  TYR C CB  1 
ATOM   1499 C  CG  . TYR C 1 32 ? -11.412 -3.946  -30.214 1.00 14.73 ? 29  TYR C CG  1 
ATOM   1500 C  CD1 . TYR C 1 32 ? -11.014 -4.909  -29.328 1.00 17.13 ? 29  TYR C CD1 1 
ATOM   1501 C  CD2 . TYR C 1 32 ? -11.074 -2.630  -29.937 1.00 15.54 ? 29  TYR C CD2 1 
ATOM   1502 C  CE1 . TYR C 1 32 ? -10.227 -4.585  -28.225 1.00 18.03 ? 29  TYR C CE1 1 
ATOM   1503 C  CE2 . TYR C 1 32 ? -10.328 -2.308  -28.818 1.00 16.35 ? 29  TYR C CE2 1 
ATOM   1504 C  CZ  . TYR C 1 32 ? -9.883  -3.293  -27.994 1.00 17.02 ? 29  TYR C CZ  1 
ATOM   1505 O  OH  . TYR C 1 32 ? -9.164  -2.943  -26.864 1.00 17.85 ? 29  TYR C OH  1 
ATOM   1506 N  N   . LYS C 1 33 ? -14.591 -2.502  -30.195 1.00 15.66 ? 30  LYS C N   1 
ATOM   1507 C  CA  A LYS C 1 33 ? -14.966 -1.461  -29.234 0.50 16.57 ? 30  LYS C CA  1 
ATOM   1508 C  CA  B LYS C 1 33 ? -14.991 -1.444  -29.269 0.50 17.13 ? 30  LYS C CA  1 
ATOM   1509 C  C   . LYS C 1 33 ? -16.385 -1.671  -28.677 1.00 18.37 ? 30  LYS C C   1 
ATOM   1510 O  O   . LYS C 1 33 ? -16.678 -1.259  -27.555 1.00 19.54 ? 30  LYS C O   1 
ATOM   1511 C  CB  A LYS C 1 33 ? -14.837 -0.073  -29.862 0.50 16.80 ? 30  LYS C CB  1 
ATOM   1512 C  CB  B LYS C 1 33 ? -14.975 -0.118  -30.008 0.50 18.13 ? 30  LYS C CB  1 
ATOM   1513 C  CG  A LYS C 1 33 ? -13.421 0.382   -30.168 0.50 17.15 ? 30  LYS C CG  1 
ATOM   1514 C  CG  B LYS C 1 33 ? -13.604 0.435   -30.272 0.50 19.07 ? 30  LYS C CG  1 
ATOM   1515 C  CD  A LYS C 1 33 ? -13.415 1.797   -30.722 0.50 18.53 ? 30  LYS C CD  1 
ATOM   1516 C  CD  B LYS C 1 33 ? -13.077 1.024   -28.985 0.50 21.64 ? 30  LYS C CD  1 
ATOM   1517 C  CE  A LYS C 1 33 ? -13.713 2.884   -29.696 0.50 18.30 ? 30  LYS C CE  1 
ATOM   1518 C  CE  B LYS C 1 33 ? -11.876 1.896   -29.252 0.50 22.50 ? 30  LYS C CE  1 
ATOM   1519 N  NZ  A LYS C 1 33 ? -14.109 4.110   -30.448 0.50 17.90 ? 30  LYS C NZ  1 
ATOM   1520 N  NZ  B LYS C 1 33 ? -12.140 3.084   -28.425 0.50 23.42 ? 30  LYS C NZ  1 
ATOM   1521 N  N   . SER C 1 34 ? -17.255 -2.316  -29.450 1.00 16.34 ? 31  SER C N   1 
ATOM   1522 C  CA  . SER C 1 34 ? -18.663 -2.508  -29.012 1.00 17.99 ? 31  SER C CA  1 
ATOM   1523 C  C   . SER C 1 34 ? -18.855 -3.829  -28.242 1.00 19.92 ? 31  SER C C   1 
ATOM   1524 O  O   . SER C 1 34 ? -19.937 -4.096  -27.677 1.00 18.94 ? 31  SER C O   1 
ATOM   1525 C  CB  . SER C 1 34 ? -19.579 -2.397  -30.251 1.00 17.18 ? 31  SER C CB  1 
ATOM   1526 O  OG  . SER C 1 34 ? -19.424 -3.480  -31.164 1.00 19.08 ? 31  SER C OG  1 
ATOM   1527 N  N   . ASN C 1 35 ? -17.802 -4.653  -28.257 1.00 19.55 ? 32  ASN C N   1 
ATOM   1528 C  CA  . ASN C 1 35 ? -17.827 -6.043  -27.820 1.00 24.25 ? 32  ASN C CA  1 
ATOM   1529 C  C   . ASN C 1 35 ? -18.930 -6.919  -28.487 1.00 25.69 ? 32  ASN C C   1 
ATOM   1530 O  O   . ASN C 1 35 ? -19.669 -7.662  -27.824 1.00 24.70 ? 32  ASN C O   1 
ATOM   1531 C  CB  . ASN C 1 35 ? -17.931 -6.091  -26.297 1.00 29.72 ? 32  ASN C CB  1 
ATOM   1532 C  CG  . ASN C 1 35 ? -17.361 -7.383  -25.709 1.00 37.40 ? 32  ASN C CG  1 
ATOM   1533 O  OD1 . ASN C 1 35 ? -16.339 -7.947  -26.181 1.00 39.59 ? 32  ASN C OD1 1 
ATOM   1534 N  ND2 . ASN C 1 35 ? -18.016 -7.864  -24.662 1.00 38.71 ? 32  ASN C ND2 1 
ATOM   1535 N  N   . LEU C 1 36 ? -19.052 -6.788  -29.794 1.00 22.87 ? 33  LEU C N   1 
ATOM   1536 C  CA  . LEU C 1 36 ? -19.967 -7.574  -30.574 1.00 20.52 ? 33  LEU C CA  1 
ATOM   1537 C  C   . LEU C 1 36 ? -19.168 -8.359  -31.577 1.00 20.73 ? 33  LEU C C   1 
ATOM   1538 O  O   . LEU C 1 36 ? -18.036 -7.998  -31.896 1.00 20.47 ? 33  LEU C O   1 
ATOM   1539 C  CB  . LEU C 1 36 ? -20.972 -6.652  -31.274 1.00 19.19 ? 33  LEU C CB  1 
ATOM   1540 C  CG  . LEU C 1 36 ? -21.939 -5.895  -30.336 1.00 19.78 ? 33  LEU C CG  1 
ATOM   1541 C  CD1 . LEU C 1 36 ? -22.666 -4.773  -31.041 1.00 17.90 ? 33  LEU C CD1 1 
ATOM   1542 C  CD2 . LEU C 1 36 ? -22.939 -6.793  -29.680 1.00 21.76 ? 33  LEU C CD2 1 
ATOM   1543 N  N   . ASP C 1 37 ? -19.763 -9.396  -32.143 1.00 21.32 ? 34  ASP C N   1 
ATOM   1544 C  CA  . ASP C 1 37 ? -19.073 -10.161 -33.166 1.00 25.85 ? 34  ASP C CA  1 
ATOM   1545 C  C   . ASP C 1 37 ? -18.926 -9.384  -34.454 1.00 21.77 ? 34  ASP C C   1 
ATOM   1546 O  O   . ASP C 1 37 ? -19.840 -8.682  -34.886 1.00 17.09 ? 34  ASP C O   1 
ATOM   1547 C  CB  . ASP C 1 37 ? -19.717 -11.516 -33.447 1.00 33.62 ? 34  ASP C CB  1 
ATOM   1548 C  CG  . ASP C 1 37 ? -18.680 -12.538 -33.933 1.00 47.60 ? 34  ASP C CG  1 
ATOM   1549 O  OD1 . ASP C 1 37 ? -17.945 -13.088 -33.069 1.00 56.96 ? 34  ASP C OD1 1 
ATOM   1550 O  OD2 . ASP C 1 37 ? -18.554 -12.758 -35.166 1.00 55.36 ? 34  ASP C OD2 1 
ATOM   1551 N  N   . ARG C 1 38 ? -17.769 -9.521  -35.099 1.00 19.84 ? 35  ARG C N   1 
ATOM   1552 C  CA  . ARG C 1 38 ? -17.574 -8.861  -36.397 1.00 21.97 ? 35  ARG C CA  1 
ATOM   1553 C  C   . ARG C 1 38 ? -18.672 -9.225  -37.455 1.00 20.15 ? 35  ARG C C   1 
ATOM   1554 O  O   . ARG C 1 38 ? -19.079 -8.429  -38.370 1.00 18.37 ? 35  ARG C O   1 
ATOM   1555 C  CB  . ARG C 1 38 ? -16.191 -9.192  -36.954 1.00 25.31 ? 35  ARG C CB  1 
ATOM   1556 C  CG  . ARG C 1 38 ? -15.942 -8.402  -38.255 1.00 34.27 ? 35  ARG C CG  1 
ATOM   1557 C  CD  . ARG C 1 38 ? -14.958 -9.066  -39.208 1.00 42.29 ? 35  ARG C CD  1 
ATOM   1558 N  NE  . ARG C 1 38 ? -15.279 -10.474 -39.494 1.00 47.27 ? 35  ARG C NE  1 
ATOM   1559 C  CZ  . ARG C 1 38 ? -16.180 -10.915 -40.382 1.00 50.75 ? 35  ARG C CZ  1 
ATOM   1560 N  NH1 . ARG C 1 38 ? -16.951 -10.086 -41.099 1.00 43.94 ? 35  ARG C NH1 1 
ATOM   1561 N  NH2 . ARG C 1 38 ? -16.348 -12.228 -40.517 1.00 53.01 ? 35  ARG C NH2 1 
ATOM   1562 N  N   . THR C 1 39 ? -19.134 -10.443 -37.366 1.00 20.51 ? 36  THR C N   1 
ATOM   1563 C  CA  . THR C 1 39 ? -20.131 -10.918 -38.327 1.00 21.75 ? 36  THR C CA  1 
ATOM   1564 C  C   . THR C 1 39 ? -21.487 -10.210 -38.083 1.00 19.71 ? 36  THR C C   1 
ATOM   1565 O  O   . THR C 1 39 ? -22.256 -10.018 -39.015 1.00 18.28 ? 36  THR C O   1 
ATOM   1566 C  CB  . THR C 1 39 ? -20.347 -12.437 -38.270 1.00 22.70 ? 36  THR C CB  1 
ATOM   1567 O  OG1 . THR C 1 39 ? -20.559 -12.857 -36.923 1.00 26.99 ? 36  THR C OG1 1 
ATOM   1568 C  CG2 . THR C 1 39 ? -19.157 -13.200 -38.850 1.00 25.50 ? 36  THR C CG2 1 
ATOM   1569 N  N   . PHE C 1 40 ? -21.766 -9.854  -36.851 1.00 17.13 ? 37  PHE C N   1 
ATOM   1570 C  CA  . PHE C 1 40 ? -22.990 -9.096  -36.541 1.00 19.17 ? 37  PHE C CA  1 
ATOM   1571 C  C   . PHE C 1 40 ? -22.900 -7.689  -37.111 1.00 16.58 ? 37  PHE C C   1 
ATOM   1572 O  O   . PHE C 1 40 ? -23.809 -7.251  -37.811 1.00 16.02 ? 37  PHE C O   1 
ATOM   1573 C  CB  . PHE C 1 40 ? -23.182 -9.068  -35.031 1.00 21.33 ? 37  PHE C CB  1 
ATOM   1574 C  CG  . PHE C 1 40 ? -24.405 -8.345  -34.557 1.00 22.51 ? 37  PHE C CG  1 
ATOM   1575 C  CD1 . PHE C 1 40 ? -25.684 -8.734  -34.996 1.00 27.76 ? 37  PHE C CD1 1 
ATOM   1576 C  CD2 . PHE C 1 40 ? -24.309 -7.362  -33.601 1.00 25.66 ? 37  PHE C CD2 1 
ATOM   1577 C  CE1 . PHE C 1 40 ? -26.834 -8.115  -34.515 1.00 28.25 ? 37  PHE C CE1 1 
ATOM   1578 C  CE2 . PHE C 1 40 ? -25.471 -6.753  -33.092 1.00 27.36 ? 37  PHE C CE2 1 
ATOM   1579 C  CZ  . PHE C 1 40 ? -26.729 -7.151  -33.528 1.00 26.11 ? 37  PHE C CZ  1 
ATOM   1580 N  N   . ILE C 1 41 ? -21.773 -7.022  -36.913 1.00 15.46 ? 38  ILE C N   1 
ATOM   1581 C  CA  . ILE C 1 41 ? -21.509 -5.742  -37.504 1.00 15.57 ? 38  ILE C CA  1 
ATOM   1582 C  C   . ILE C 1 41 ? -21.590 -5.769  -39.048 1.00 15.39 ? 38  ILE C C   1 
ATOM   1583 O  O   . ILE C 1 41 ? -22.213 -4.907  -39.681 1.00 14.26 ? 38  ILE C O   1 
ATOM   1584 C  CB  . ILE C 1 41 ? -20.104 -5.200  -37.081 1.00 16.33 ? 38  ILE C CB  1 
ATOM   1585 C  CG1 . ILE C 1 41 ? -19.998 -4.917  -35.575 1.00 18.37 ? 38  ILE C CG1 1 
ATOM   1586 C  CG2 . ILE C 1 41 ? -19.854 -3.939  -37.807 1.00 16.69 ? 38  ILE C CG2 1 
ATOM   1587 C  CD1 . ILE C 1 41 ? -21.119 -4.095  -34.996 1.00 19.32 ? 38  ILE C CD1 1 
ATOM   1588 N  N   . SER C 1 42 ? -20.974 -6.763  -39.687 1.00 16.09 ? 39  SER C N   1 
ATOM   1589 C  CA  . SER C 1 42 ? -21.017 -6.775  -41.142 1.00 16.62 ? 39  SER C CA  1 
ATOM   1590 C  C   . SER C 1 42 ? -22.411 -7.098  -41.705 1.00 14.37 ? 39  SER C C   1 
ATOM   1591 O  O   . SER C 1 42 ? -22.762 -6.578  -42.735 1.00 14.55 ? 39  SER C O   1 
ATOM   1592 C  CB  . SER C 1 42 ? -19.930 -7.734  -41.725 1.00 23.22 ? 39  SER C CB  1 
ATOM   1593 O  OG  . SER C 1 42 ? -19.966 -8.962  -41.075 1.00 28.83 ? 39  SER C OG  1 
ATOM   1594 N  N   . GLY C 1 43 ? -23.156 -7.989  -41.041 1.00 14.21 ? 40  GLY C N   1 
ATOM   1595 C  CA  . GLY C 1 43 ? -24.531 -8.292  -41.333 1.00 14.12 ? 40  GLY C CA  1 
ATOM   1596 C  C   . GLY C 1 43 ? -25.500 -7.107  -41.171 1.00 14.47 ? 40  GLY C C   1 
ATOM   1597 O  O   . GLY C 1 43 ? -26.440 -6.935  -41.976 1.00 13.80 ? 40  GLY C O   1 
ATOM   1598 N  N   . ILE C 1 44 ? -25.275 -6.272  -40.151 1.00 13.29 ? 41  ILE C N   1 
ATOM   1599 C  CA  . ILE C 1 44 ? -25.974 -4.999  -40.084 1.00 13.72 ? 41  ILE C CA  1 
ATOM   1600 C  C   . ILE C 1 44 ? -25.705 -4.117  -41.317 1.00 13.93 ? 41  ILE C C   1 
ATOM   1601 O  O   . ILE C 1 44 ? -26.638 -3.569  -41.960 1.00 12.78 ? 41  ILE C O   1 
ATOM   1602 C  CB  . ILE C 1 44 ? -25.626 -4.257  -38.788 1.00 14.68 ? 41  ILE C CB  1 
ATOM   1603 C  CG1 . ILE C 1 44 ? -26.253 -4.970  -37.612 1.00 16.23 ? 41  ILE C CG1 1 
ATOM   1604 C  CG2 . ILE C 1 44 ? -26.107 -2.799  -38.849 1.00 15.48 ? 41  ILE C CG2 1 
ATOM   1605 C  CD1 . ILE C 1 44 ? -25.710 -4.526  -36.288 1.00 18.16 ? 41  ILE C CD1 1 
ATOM   1606 N  N   . GLU C 1 45 ? -24.440 -3.891  -41.631 1.00 13.86 ? 42  GLU C N   1 
ATOM   1607 C  CA  . GLU C 1 45 ? -24.145 -2.911  -42.645 1.00 14.36 ? 42  GLU C CA  1 
ATOM   1608 C  C   . GLU C 1 45 ? -24.543 -3.403  -44.059 1.00 15.04 ? 42  GLU C C   1 
ATOM   1609 O  O   . GLU C 1 45 ? -25.021 -2.634  -44.853 1.00 14.73 ? 42  GLU C O   1 
ATOM   1610 C  CB  . GLU C 1 45 ? -22.676 -2.576  -42.603 1.00 16.20 ? 42  GLU C CB  1 
ATOM   1611 C  CG  . GLU C 1 45 ? -22.338 -1.676  -41.383 1.00 18.42 ? 42  GLU C CG  1 
ATOM   1612 C  CD  . GLU C 1 45 ? -20.926 -1.023  -41.465 1.00 20.92 ? 42  GLU C CD  1 
ATOM   1613 O  OE1 . GLU C 1 45 ? -20.567 -0.335  -40.492 1.00 19.60 ? 42  GLU C OE1 1 
ATOM   1614 O  OE2 . GLU C 1 45 ? -20.185 -1.245  -42.460 1.00 19.58 ? 42  GLU C OE2 1 
ATOM   1615 N  N   . ARG C 1 46 ? -24.312 -4.681  -44.334 1.00 15.20 ? 43  ARG C N   1 
ATOM   1616 C  CA  . ARG C 1 46 ? -24.525 -5.195  -45.697 1.00 15.87 ? 43  ARG C CA  1 
ATOM   1617 C  C   . ARG C 1 46 ? -25.989 -5.582  -45.838 1.00 15.22 ? 43  ARG C C   1 
ATOM   1618 O  O   . ARG C 1 46 ? -26.580 -5.288  -46.843 1.00 15.49 ? 43  ARG C O   1 
ATOM   1619 C  CB  . ARG C 1 46 ? -23.607 -6.390  -46.053 1.00 14.71 ? 43  ARG C CB  1 
ATOM   1620 C  CG  . ARG C 1 46 ? -23.830 -6.828  -47.516 1.00 14.88 ? 43  ARG C CG  1 
ATOM   1621 C  CD  . ARG C 1 46 ? -22.752 -7.754  -48.034 1.00 13.66 ? 43  ARG C CD  1 
ATOM   1622 N  NE  . ARG C 1 46 ? -22.902 -9.020  -47.355 1.00 12.55 ? 43  ARG C NE  1 
ATOM   1623 C  CZ  . ARG C 1 46 ? -23.671 -10.066 -47.724 1.00 12.96 ? 43  ARG C CZ  1 
ATOM   1624 N  NH1 . ARG C 1 46 ? -24.404 -10.062 -48.815 1.00 13.53 ? 43  ARG C NH1 1 
ATOM   1625 N  NH2 . ARG C 1 46 ? -23.734 -11.161 -46.943 1.00 14.84 ? 43  ARG C NH2 1 
ATOM   1626 N  N   . ASN C 1 47 ? -26.562 -6.219  -44.832 1.00 15.41 ? 44  ASN C N   1 
ATOM   1627 C  CA  . ASN C 1 47 ? -27.928 -6.802  -44.973 1.00 16.30 ? 44  ASN C CA  1 
ATOM   1628 C  C   . ASN C 1 47 ? -29.026 -6.121  -44.129 1.00 17.30 ? 44  ASN C C   1 
ATOM   1629 O  O   . ASN C 1 47 ? -30.146 -6.530  -44.198 1.00 16.37 ? 44  ASN C O   1 
ATOM   1630 C  CB  . ASN C 1 47 ? -27.910 -8.300  -44.680 1.00 15.56 ? 44  ASN C CB  1 
ATOM   1631 C  CG  . ASN C 1 47 ? -27.215 -9.066  -45.784 1.00 17.18 ? 44  ASN C CG  1 
ATOM   1632 O  OD1 . ASN C 1 47 ? -27.533 -8.866  -46.967 1.00 20.20 ? 44  ASN C OD1 1 
ATOM   1633 N  ND2 . ASN C 1 47 ? -26.288 -9.927  -45.426 1.00 20.64 ? 44  ASN C ND2 1 
ATOM   1634 N  N   . SER C 1 48 ? -28.686 -5.076  -43.389 1.00 16.35 ? 45  SER C N   1 
ATOM   1635 C  CA  . SER C 1 48 ? -29.648 -4.342  -42.557 1.00 16.66 ? 45  SER C CA  1 
ATOM   1636 C  C   . SER C 1 48 ? -30.357 -5.286  -41.608 1.00 17.32 ? 45  SER C C   1 
ATOM   1637 O  O   . SER C 1 48 ? -31.567 -5.221  -41.456 1.00 17.70 ? 45  SER C O   1 
ATOM   1638 C  CB  . SER C 1 48 ? -30.665 -3.614  -43.437 1.00 18.63 ? 45  SER C CB  1 
ATOM   1639 O  OG  . SER C 1 48 ? -30.022 -2.661  -44.232 1.00 19.38 ? 45  SER C OG  1 
ATOM   1640 N  N   . ARG C 1 49 ? -29.592 -6.160  -40.989 1.00 15.98 ? 46  ARG C N   1 
ATOM   1641 C  CA  . ARG C 1 49 ? -30.066 -7.169  -40.052 1.00 19.18 ? 46  ARG C CA  1 
ATOM   1642 C  C   . ARG C 1 49 ? -30.698 -6.463  -38.838 1.00 16.29 ? 46  ARG C C   1 
ATOM   1643 O  O   . ARG C 1 49 ? -30.256 -5.398  -38.467 1.00 14.60 ? 46  ARG C O   1 
ATOM   1644 C  CB  . ARG C 1 49 ? -28.884 -7.946  -39.538 1.00 27.25 ? 46  ARG C CB  1 
ATOM   1645 C  CG  . ARG C 1 49 ? -29.241 -9.135  -38.708 1.00 40.40 ? 46  ARG C CG  1 
ATOM   1646 C  CD  . ARG C 1 49 ? -28.290 -9.289  -37.545 1.00 47.30 ? 46  ARG C CD  1 
ATOM   1647 N  NE  . ARG C 1 49 ? -27.130 -10.082 -37.912 1.00 50.97 ? 46  ARG C NE  1 
ATOM   1648 C  CZ  . ARG C 1 49 ? -26.830 -11.277 -37.403 1.00 50.51 ? 46  ARG C CZ  1 
ATOM   1649 N  NH1 . ARG C 1 49 ? -27.614 -11.836 -36.499 1.00 51.91 ? 46  ARG C NH1 1 
ATOM   1650 N  NH2 . ARG C 1 49 ? -25.722 -11.904 -37.788 1.00 45.07 ? 46  ARG C NH2 1 
ATOM   1651 N  N   . ASN C 1 50 ? -31.691 -7.085  -38.228 1.00 14.14 ? 47  ASN C N   1 
ATOM   1652 C  CA  . ASN C 1 50 ? -32.413 -6.533  -37.035 1.00 14.56 ? 47  ASN C CA  1 
ATOM   1653 C  C   . ASN C 1 50 ? -31.522 -6.553  -35.786 1.00 14.26 ? 47  ASN C C   1 
ATOM   1654 O  O   . ASN C 1 50 ? -30.547 -7.298  -35.719 1.00 16.49 ? 47  ASN C O   1 
ATOM   1655 C  CB  . ASN C 1 50 ? -33.667 -7.391  -36.763 1.00 13.62 ? 47  ASN C CB  1 
ATOM   1656 C  CG  . ASN C 1 50 ? -34.662 -6.714  -35.855 1.00 13.81 ? 47  ASN C CG  1 
ATOM   1657 O  OD1 . ASN C 1 50 ? -34.605 -5.531  -35.675 1.00 12.55 ? 47  ASN C OD1 1 
ATOM   1658 N  ND2 . ASN C 1 50 ? -35.550 -7.509  -35.220 1.00 13.26 ? 47  ASN C ND2 1 
ATOM   1659 N  N   . LEU C 1 51 ? -31.768 -5.656  -34.837 1.00 14.49 ? 48  LEU C N   1 
ATOM   1660 C  CA  . LEU C 1 51 ? -30.917 -5.577  -33.640 1.00 14.02 ? 48  LEU C CA  1 
ATOM   1661 C  C   . LEU C 1 51 ? -31.741 -5.032  -32.542 1.00 14.18 ? 48  LEU C C   1 
ATOM   1662 O  O   . LEU C 1 51 ? -32.726 -4.347  -32.768 1.00 10.43 ? 48  LEU C O   1 
ATOM   1663 C  CB  . LEU C 1 51 ? -29.641 -4.698  -33.849 1.00 15.09 ? 48  LEU C CB  1 
ATOM   1664 C  CG  . LEU C 1 51 ? -29.753 -3.225  -34.131 1.00 15.70 ? 48  LEU C CG  1 
ATOM   1665 C  CD1 . LEU C 1 51 ? -28.457 -2.460  -33.880 1.00 17.99 ? 48  LEU C CD1 1 
ATOM   1666 C  CD2 . LEU C 1 51 ? -30.185 -2.972  -35.559 1.00 17.69 ? 48  LEU C CD2 1 
ATOM   1667 N  N   . THR C 1 52 ? -31.340 -5.368  -31.330 1.00 13.82 ? 49  THR C N   1 
ATOM   1668 C  CA  . THR C 1 52 ? -32.083 -4.890  -30.125 1.00 13.30 ? 49  THR C CA  1 
ATOM   1669 C  C   . THR C 1 52 ? -31.599 -3.490  -29.826 1.00 14.36 ? 49  THR C C   1 
ATOM   1670 O  O   . THR C 1 52 ? -30.526 -3.058  -30.283 1.00 13.14 ? 49  THR C O   1 
ATOM   1671 C  CB  . THR C 1 52 ? -31.755 -5.752  -28.877 1.00 14.22 ? 49  THR C CB  1 
ATOM   1672 O  OG1 . THR C 1 52 ? -30.327 -5.659  -28.642 1.00 14.71 ? 49  THR C OG1 1 
ATOM   1673 C  CG2 . THR C 1 52 ? -32.171 -7.137  -29.057 1.00 14.36 ? 49  THR C CG2 1 
ATOM   1674 N  N   . ILE C 1 53 ? -32.388 -2.764  -29.047 1.00 13.19 ? 50  ILE C N   1 
ATOM   1675 C  CA  . ILE C 1 53 ? -32.026 -1.450  -28.556 1.00 14.03 ? 50  ILE C CA  1 
ATOM   1676 C  C   . ILE C 1 53 ? -30.739 -1.546  -27.730 1.00 14.25 ? 50  ILE C C   1 
ATOM   1677 O  O   . ILE C 1 53 ? -29.886 -0.659  -27.850 1.00 12.58 ? 50  ILE C O   1 
ATOM   1678 C  CB  . ILE C 1 53 ? -33.164 -0.822  -27.715 1.00 16.00 ? 50  ILE C CB  1 
ATOM   1679 C  CG1 . ILE C 1 53 ? -34.371 -0.497  -28.578 1.00 17.97 ? 50  ILE C CG1 1 
ATOM   1680 C  CG2 . ILE C 1 53 ? -32.728 0.474   -27.024 1.00 17.38 ? 50  ILE C CG2 1 
ATOM   1681 C  CD1 . ILE C 1 53 ? -34.128 0.425   -29.752 1.00 19.91 ? 50  ILE C CD1 1 
ATOM   1682 N  N   . LYS C 1 54 ? -30.570 -2.612  -26.941 1.00 15.08 ? 51  LYS C N   1 
ATOM   1683 C  CA  . LYS C 1 54 ? -29.352 -2.721  -26.129 1.00 17.83 ? 51  LYS C CA  1 
ATOM   1684 C  C   . LYS C 1 54 ? -28.101 -2.859  -27.041 1.00 16.90 ? 51  LYS C C   1 
ATOM   1685 O  O   . LYS C 1 54 ? -27.102 -2.246  -26.729 1.00 15.00 ? 51  LYS C O   1 
ATOM   1686 C  CB  . LYS C 1 54 ? -29.387 -3.879  -25.112 1.00 20.98 ? 51  LYS C CB  1 
ATOM   1687 C  CG  . LYS C 1 54 ? -30.247 -3.550  -23.852 1.00 28.00 ? 51  LYS C CG  1 
ATOM   1688 C  CD  . LYS C 1 54 ? -29.861 -4.478  -22.688 1.00 34.38 ? 51  LYS C CD  1 
ATOM   1689 C  CE  . LYS C 1 54 ? -30.707 -4.261  -21.472 1.00 41.84 ? 51  LYS C CE  1 
ATOM   1690 N  NZ  . LYS C 1 54 ? -31.996 -4.969  -21.652 1.00 47.31 ? 51  LYS C NZ  1 
ATOM   1691 N  N   . SER C 1 55 ? -28.191 -3.646  -28.124 1.00 16.23 ? 52  SER C N   1 
ATOM   1692 C  CA  . SER C 1 55 ? -27.121 -3.790  -29.121 1.00 16.26 ? 52  SER C CA  1 
ATOM   1693 C  C   . SER C 1 55 ? -26.831 -2.496  -29.774 1.00 14.98 ? 52  SER C C   1 
ATOM   1694 O  O   . SER C 1 55 ? -25.652 -2.165  -30.001 1.00 14.06 ? 52  SER C O   1 
ATOM   1695 C  CB  . SER C 1 55 ? -27.442 -4.810  -30.225 1.00 18.25 ? 52  SER C CB  1 
ATOM   1696 O  OG  . SER C 1 55 ? -27.410 -6.090  -29.688 1.00 23.34 ? 52  SER C OG  1 
ATOM   1697 N  N   . LEU C 1 56 ? -27.904 -1.721  -30.074 1.00 13.86 ? 53  LEU C N   1 
ATOM   1698 C  CA  . LEU C 1 56 ? -27.699 -0.442  -30.657 1.00 13.66 ? 53  LEU C CA  1 
ATOM   1699 C  C   . LEU C 1 56 ? -26.889 0.457   -29.709 1.00 13.10 ? 53  LEU C C   1 
ATOM   1700 O  O   . LEU C 1 56 ? -26.005 1.198   -30.142 1.00 12.19 ? 53  LEU C O   1 
ATOM   1701 C  CB  . LEU C 1 56 ? -29.027 0.241   -31.104 1.00 14.53 ? 53  LEU C CB  1 
ATOM   1702 C  CG  . LEU C 1 56 ? -28.875 1.646   -31.640 1.00 16.34 ? 53  LEU C CG  1 
ATOM   1703 C  CD1 . LEU C 1 56 ? -28.158 1.594   -32.987 1.00 17.53 ? 53  LEU C CD1 1 
ATOM   1704 C  CD2 . LEU C 1 56 ? -30.259 2.263   -31.838 1.00 18.29 ? 53  LEU C CD2 1 
ATOM   1705 N  N   . GLU C 1 57 ? -27.211 0.402   -28.414 1.00 13.85 ? 54  GLU C N   1 
ATOM   1706 C  CA  . GLU C 1 57 ? -26.513 1.249   -27.454 1.00 14.56 ? 54  GLU C CA  1 
ATOM   1707 C  C   . GLU C 1 57 ? -25.004 0.822   -27.361 1.00 13.19 ? 54  GLU C C   1 
ATOM   1708 O  O   . GLU C 1 57 ? -24.108 1.677   -27.212 1.00 14.91 ? 54  GLU C O   1 
ATOM   1709 C  CB  . GLU C 1 57 ? -27.255 1.097   -26.106 1.00 16.45 ? 54  GLU C CB  1 
ATOM   1710 C  CG  . GLU C 1 57 ? -26.840 2.065   -25.053 1.00 20.29 ? 54  GLU C CG  1 
ATOM   1711 C  CD  . GLU C 1 57 ? -27.656 1.961   -23.774 1.00 21.62 ? 54  GLU C CD  1 
ATOM   1712 O  OE1 . GLU C 1 57 ? -27.909 3.037   -23.198 1.00 22.41 ? 54  GLU C OE1 1 
ATOM   1713 O  OE2 . GLU C 1 57 ? -28.034 0.827   -23.362 1.00 25.25 ? 54  GLU C OE2 1 
ATOM   1714 N  N   . LEU C 1 58 ? -24.733 -0.468  -27.428 1.00 13.48 ? 55  LEU C N   1 
ATOM   1715 C  CA  . LEU C 1 58 ? -23.314 -0.980  -27.394 1.00 14.17 ? 55  LEU C CA  1 
ATOM   1716 C  C   . LEU C 1 58 ? -22.586 -0.475  -28.673 1.00 14.19 ? 55  LEU C C   1 
ATOM   1717 O  O   . LEU C 1 58 ? -21.427 -0.100  -28.637 1.00 13.39 ? 55  LEU C O   1 
ATOM   1718 C  CB  . LEU C 1 58 ? -23.273 -2.475  -27.409 1.00 16.15 ? 55  LEU C CB  1 
ATOM   1719 C  CG  . LEU C 1 58 ? -23.556 -3.152  -26.088 1.00 19.13 ? 55  LEU C CG  1 
ATOM   1720 C  CD1 . LEU C 1 58 ? -23.640 -4.631  -26.300 1.00 21.39 ? 55  LEU C CD1 1 
ATOM   1721 C  CD2 . LEU C 1 58 ? -22.461 -2.742  -25.104 1.00 21.74 ? 55  LEU C CD2 1 
ATOM   1722 N  N   . ILE C 1 59 ? -23.299 -0.451  -29.816 1.00 12.73 ? 56  ILE C N   1 
ATOM   1723 C  CA  . ILE C 1 59 ? -22.751 0.188   -31.019 1.00 12.03 ? 56  ILE C CA  1 
ATOM   1724 C  C   . ILE C 1 59 ? -22.420 1.660   -30.861 1.00 12.85 ? 56  ILE C C   1 
ATOM   1725 O  O   . ILE C 1 59 ? -21.335 2.133   -31.259 1.00 11.08 ? 56  ILE C O   1 
ATOM   1726 C  CB  . ILE C 1 59 ? -23.590 -0.120  -32.288 1.00 11.85 ? 56  ILE C CB  1 
ATOM   1727 C  CG1 . ILE C 1 59 ? -23.462 -1.584  -32.634 1.00 12.85 ? 56  ILE C CG1 1 
ATOM   1728 C  CG2 . ILE C 1 59 ? -23.137 0.735   -33.465 1.00 12.52 ? 56  ILE C CG2 1 
ATOM   1729 C  CD1 . ILE C 1 59 ? -24.485 -2.123  -33.636 1.00 13.46 ? 56  ILE C CD1 1 
ATOM   1730 N  N   . MET C 1 60 ? -23.336 2.430   -30.283 1.00 13.06 ? 57  MET C N   1 
ATOM   1731 C  CA  . MET C 1 60 ? -23.090 3.815   -30.051 1.00 14.68 ? 57  MET C CA  1 
ATOM   1732 C  C   . MET C 1 60 ? -21.888 4.040   -29.118 1.00 12.92 ? 57  MET C C   1 
ATOM   1733 O  O   . MET C 1 60 ? -21.135 4.994   -29.266 1.00 12.61 ? 57  MET C O   1 
ATOM   1734 C  CB  . MET C 1 60 ? -24.362 4.485   -29.471 1.00 16.52 ? 57  MET C CB  1 
ATOM   1735 C  CG  . MET C 1 60 ? -25.397 4.800   -30.566 1.00 22.70 ? 57  MET C CG  1 
ATOM   1736 S  SD  . MET C 1 60 ? -26.866 5.627   -29.809 1.00 32.51 ? 57  MET C SD  1 
ATOM   1737 C  CE  . MET C 1 60 ? -27.473 4.178   -29.122 1.00 28.69 ? 57  MET C CE  1 
ATOM   1738 N  N   . LYS C 1 61 ? -21.764 3.190   -28.142 1.00 13.59 ? 58  LYS C N   1 
ATOM   1739 C  CA  . LYS C 1 61 ? -20.653 3.249   -27.153 1.00 16.73 ? 58  LYS C CA  1 
ATOM   1740 C  C   . LYS C 1 61 ? -19.336 2.970   -27.900 1.00 15.53 ? 58  LYS C C   1 
ATOM   1741 O  O   . LYS C 1 61 ? -18.364 3.702   -27.765 1.00 13.59 ? 58  LYS C O   1 
ATOM   1742 C  CB  . LYS C 1 61 ? -20.946 2.210   -26.069 1.00 20.38 ? 58  LYS C CB  1 
ATOM   1743 C  CG  . LYS C 1 61 ? -19.928 2.137   -24.917 1.00 29.24 ? 58  LYS C CG  1 
ATOM   1744 C  CD  . LYS C 1 61 ? -18.653 1.411   -25.262 1.00 33.52 ? 58  LYS C CD  1 
ATOM   1745 C  CE  . LYS C 1 61 ? -18.271 0.406   -24.179 1.00 43.63 ? 58  LYS C CE  1 
ATOM   1746 N  NZ  . LYS C 1 61 ? -19.035 -0.864  -24.383 1.00 46.05 ? 58  LYS C NZ  1 
ATOM   1747 N  N   . GLY C 1 62 ? -19.391 2.005   -28.806 1.00 14.47 ? 59  GLY C N   1 
ATOM   1748 C  CA  . GLY C 1 62 ? -18.204 1.682   -29.640 1.00 14.41 ? 59  GLY C CA  1 
ATOM   1749 C  C   . GLY C 1 62 ? -17.777 2.812   -30.550 1.00 14.84 ? 59  GLY C C   1 
ATOM   1750 O  O   . GLY C 1 62 ? -16.586 3.074   -30.732 1.00 14.23 ? 59  GLY C O   1 
ATOM   1751 N  N   . LEU C 1 63 ? -18.753 3.462   -31.155 1.00 13.98 ? 60  LEU C N   1 
ATOM   1752 C  CA  . LEU C 1 63 ? -18.544 4.601   -31.974 1.00 13.76 ? 60  LEU C CA  1 
ATOM   1753 C  C   . LEU C 1 63 ? -18.152 5.881   -31.226 1.00 15.18 ? 60  LEU C C   1 
ATOM   1754 O  O   . LEU C 1 63 ? -17.737 6.834   -31.896 1.00 16.46 ? 60  LEU C O   1 
ATOM   1755 C  CB  . LEU C 1 63 ? -19.791 4.913   -32.845 1.00 14.73 ? 60  LEU C CB  1 
ATOM   1756 C  CG  . LEU C 1 63 ? -20.233 3.857   -33.829 1.00 15.05 ? 60  LEU C CG  1 
ATOM   1757 C  CD1 . LEU C 1 63 ? -21.673 4.122   -34.326 1.00 15.21 ? 60  LEU C CD1 1 
ATOM   1758 C  CD2 . LEU C 1 63 ? -19.289 3.830   -35.023 1.00 16.01 ? 60  LEU C CD2 1 
ATOM   1759 N  N   . GLU C 1 64 ? -18.365 5.919   -29.918 1.00 15.81 ? 61  GLU C N   1 
ATOM   1760 C  CA  . GLU C 1 64 ? -18.223 7.130   -29.104 1.00 18.46 ? 61  GLU C CA  1 
ATOM   1761 C  C   . GLU C 1 64 ? -19.059 8.286   -29.591 1.00 17.48 ? 61  GLU C C   1 
ATOM   1762 O  O   . GLU C 1 64 ? -18.610 9.418   -29.685 1.00 16.02 ? 61  GLU C O   1 
ATOM   1763 C  CB  . GLU C 1 64 ? -16.734 7.494   -28.950 1.00 22.82 ? 61  GLU C CB  1 
ATOM   1764 C  CG  . GLU C 1 64 ? -15.993 6.292   -28.417 1.00 24.40 ? 61  GLU C CG  1 
ATOM   1765 C  CD  . GLU C 1 64 ? -14.504 6.559   -28.160 1.00 33.45 ? 61  GLU C CD  1 
ATOM   1766 O  OE1 . GLU C 1 64 ? -13.915 7.361   -28.892 1.00 35.59 ? 61  GLU C OE1 1 
ATOM   1767 O  OE2 . GLU C 1 64 ? -13.944 5.906   -27.265 1.00 42.66 ? 61  GLU C OE2 1 
ATOM   1768 N  N   . VAL C 1 65 ? -20.322 7.994   -29.931 1.00 14.68 ? 62  VAL C N   1 
ATOM   1769 C  CA  . VAL C 1 65 ? -21.216 9.067   -30.312 1.00 13.83 ? 62  VAL C CA  1 
ATOM   1770 C  C   . VAL C 1 65 ? -22.319 9.176   -29.248 1.00 12.64 ? 62  VAL C C   1 
ATOM   1771 O  O   . VAL C 1 65 ? -22.716 8.154   -28.704 1.00 13.18 ? 62  VAL C O   1 
ATOM   1772 C  CB  . VAL C 1 65 ? -21.821 8.722   -31.697 1.00 14.99 ? 62  VAL C CB  1 
ATOM   1773 C  CG1 . VAL C 1 65 ? -22.572 7.436   -31.707 1.00 13.63 ? 62  VAL C CG1 1 
ATOM   1774 C  CG2 . VAL C 1 65 ? -22.735 9.773   -32.159 1.00 17.79 ? 62  VAL C CG2 1 
ATOM   1775 N  N   . SER C 1 66 ? -22.819 10.370  -28.960 1.00 13.52 ? 63  SER C N   1 
ATOM   1776 C  CA  . SER C 1 66 ? -23.942 10.521  -28.041 1.00 13.50 ? 63  SER C CA  1 
ATOM   1777 C  C   . SER C 1 66 ? -25.214 9.936   -28.635 1.00 14.54 ? 63  SER C C   1 
ATOM   1778 O  O   . SER C 1 66 ? -25.409 9.907   -29.857 1.00 13.19 ? 63  SER C O   1 
ATOM   1779 C  CB  . SER C 1 66 ? -24.188 11.984  -27.657 1.00 13.77 ? 63  SER C CB  1 
ATOM   1780 O  OG  . SER C 1 66 ? -24.622 12.773  -28.735 1.00 15.16 ? 63  SER C OG  1 
ATOM   1781 N  N   . ASP C 1 67 ? -26.155 9.647   -27.758 1.00 15.06 ? 64  ASP C N   1 
ATOM   1782 C  CA  . ASP C 1 67 ? -27.457 9.161   -28.206 1.00 14.97 ? 64  ASP C CA  1 
ATOM   1783 C  C   . ASP C 1 67 ? -28.105 10.218  -29.104 1.00 13.99 ? 64  ASP C C   1 
ATOM   1784 O  O   . ASP C 1 67 ? -28.620 9.894   -30.194 1.00 15.01 ? 64  ASP C O   1 
ATOM   1785 C  CB  . ASP C 1 67 ? -28.366 8.863   -26.981 1.00 17.24 ? 64  ASP C CB  1 
ATOM   1786 C  CG  . ASP C 1 67 ? -27.802 7.757   -26.049 1.00 20.54 ? 64  ASP C CG  1 
ATOM   1787 O  OD1 . ASP C 1 67 ? -27.019 6.908   -26.503 1.00 22.63 ? 64  ASP C OD1 1 
ATOM   1788 O  OD2 . ASP C 1 67 ? -28.197 7.700   -24.849 1.00 25.31 ? 64  ASP C OD2 1 
ATOM   1789 N  N   . VAL C 1 68 ? -28.127 11.461  -28.625 1.00 13.88 ? 65  VAL C N   1 
ATOM   1790 C  CA  . VAL C 1 68 ? -28.776 12.558  -29.318 1.00 13.71 ? 65  VAL C CA  1 
ATOM   1791 C  C   . VAL C 1 68 ? -28.187 12.748  -30.738 1.00 14.74 ? 65  VAL C C   1 
ATOM   1792 O  O   . VAL C 1 68 ? -28.928 12.874  -31.704 1.00 12.53 ? 65  VAL C O   1 
ATOM   1793 C  CB  . VAL C 1 68 ? -28.689 13.850  -28.475 1.00 15.11 ? 65  VAL C CB  1 
ATOM   1794 C  CG1 . VAL C 1 68 ? -28.990 15.059  -29.326 1.00 15.13 ? 65  VAL C CG1 1 
ATOM   1795 C  CG2 . VAL C 1 68 ? -29.605 13.769  -27.244 1.00 16.39 ? 65  VAL C CG2 1 
ATOM   1796 N  N   . VAL C 1 69 ? -26.848 12.664  -30.868 1.00 13.52 ? 66  VAL C N   1 
ATOM   1797 C  CA  . VAL C 1 69 ? -26.210 12.822  -32.169 1.00 12.92 ? 66  VAL C CA  1 
ATOM   1798 C  C   . VAL C 1 69 ? -26.631 11.723  -33.104 1.00 11.87 ? 66  VAL C C   1 
ATOM   1799 O  O   . VAL C 1 69 ? -26.943 11.994  -34.255 1.00 11.54 ? 66  VAL C O   1 
ATOM   1800 C  CB  . VAL C 1 69 ? -24.669 12.964  -32.072 1.00 14.21 ? 66  VAL C CB  1 
ATOM   1801 C  CG1 . VAL C 1 69 ? -23.967 12.752  -33.404 1.00 15.37 ? 66  VAL C CG1 1 
ATOM   1802 C  CG2 . VAL C 1 69 ? -24.326 14.363  -31.611 1.00 17.14 ? 66  VAL C CG2 1 
ATOM   1803 N  N   . PHE C 1 70 ? -26.654 10.500  -32.624 1.00 12.06 ? 67  PHE C N   1 
ATOM   1804 C  CA  . PHE C 1 70 ? -27.016 9.384   -33.431 1.00 12.67 ? 67  PHE C CA  1 
ATOM   1805 C  C   . PHE C 1 70 ? -28.442 9.588   -33.972 1.00 12.31 ? 67  PHE C C   1 
ATOM   1806 O  O   . PHE C 1 70 ? -28.718 9.428   -35.166 1.00 12.21 ? 67  PHE C O   1 
ATOM   1807 C  CB  . PHE C 1 70 ? -26.911 8.062   -32.655 1.00 13.30 ? 67  PHE C CB  1 
ATOM   1808 C  CG  . PHE C 1 70 ? -27.299 6.891   -33.481 1.00 15.22 ? 67  PHE C CG  1 
ATOM   1809 C  CD1 . PHE C 1 70 ? -28.636 6.526   -33.610 1.00 15.70 ? 67  PHE C CD1 1 
ATOM   1810 C  CD2 . PHE C 1 70 ? -26.357 6.209   -34.198 1.00 15.85 ? 67  PHE C CD2 1 
ATOM   1811 C  CE1 . PHE C 1 70 ? -28.982 5.502   -34.440 1.00 17.20 ? 67  PHE C CE1 1 
ATOM   1812 C  CE2 . PHE C 1 70 ? -26.712 5.135   -35.020 1.00 18.85 ? 67  PHE C CE2 1 
ATOM   1813 C  CZ  . PHE C 1 70 ? -28.035 4.792   -35.142 1.00 17.51 ? 67  PHE C CZ  1 
ATOM   1814 N  N   . PHE C 1 71 ? -29.350 9.947   -33.085 1.00 11.97 ? 68  PHE C N   1 
ATOM   1815 C  CA  . PHE C 1 71 ? -30.742 10.117  -33.502 1.00 12.50 ? 68  PHE C CA  1 
ATOM   1816 C  C   . PHE C 1 71 ? -30.961 11.319  -34.392 1.00 12.16 ? 68  PHE C C   1 
ATOM   1817 O  O   . PHE C 1 71 ? -31.836 11.269  -35.272 1.00 13.59 ? 68  PHE C O   1 
ATOM   1818 C  CB  . PHE C 1 71 ? -31.677 10.043  -32.277 1.00 12.64 ? 68  PHE C CB  1 
ATOM   1819 C  CG  . PHE C 1 71 ? -31.747 8.656   -31.726 1.00 14.02 ? 68  PHE C CG  1 
ATOM   1820 C  CD1 . PHE C 1 71 ? -32.333 7.654   -32.470 1.00 14.74 ? 68  PHE C CD1 1 
ATOM   1821 C  CD2 . PHE C 1 71 ? -31.214 8.328   -30.484 1.00 16.25 ? 68  PHE C CD2 1 
ATOM   1822 C  CE1 . PHE C 1 71 ? -32.385 6.351   -32.003 1.00 15.42 ? 68  PHE C CE1 1 
ATOM   1823 C  CE2 . PHE C 1 71 ? -31.209 7.004   -30.027 1.00 16.09 ? 68  PHE C CE2 1 
ATOM   1824 C  CZ  . PHE C 1 71 ? -31.820 6.018   -30.805 1.00 15.52 ? 68  PHE C CZ  1 
ATOM   1825 N  N   . GLU C 1 72 ? -30.209 12.404  -34.198 1.00 13.26 ? 69  GLU C N   1 
ATOM   1826 C  CA  . GLU C 1 72 ? -30.271 13.538  -35.140 1.00 16.04 ? 69  GLU C CA  1 
ATOM   1827 C  C   . GLU C 1 72 ? -29.848 13.129  -36.531 1.00 14.80 ? 69  GLU C C   1 
ATOM   1828 O  O   . GLU C 1 72 ? -30.441 13.578  -37.537 1.00 14.51 ? 69  GLU C O   1 
ATOM   1829 C  CB  . GLU C 1 72 ? -29.420 14.748  -34.663 1.00 20.15 ? 69  GLU C CB  1 
ATOM   1830 C  CG  . GLU C 1 72 ? -30.056 15.493  -33.492 1.00 27.90 ? 69  GLU C CG  1 
ATOM   1831 C  CD  . GLU C 1 72 ? -29.270 16.767  -33.121 1.00 34.48 ? 69  GLU C CD  1 
ATOM   1832 O  OE1 . GLU C 1 72 ? -28.188 16.996  -33.723 1.00 46.92 ? 69  GLU C OE1 1 
ATOM   1833 O  OE2 . GLU C 1 72 ? -29.724 17.528  -32.255 1.00 40.12 ? 69  GLU C OE2 1 
ATOM   1834 N  N   . MET C 1 73 ? -28.766 12.360  -36.607 1.00 14.70 ? 70  MET C N   1 
ATOM   1835 C  CA  . MET C 1 73 ? -28.323 11.807  -37.881 1.00 16.07 ? 70  MET C CA  1 
ATOM   1836 C  C   . MET C 1 73 ? -29.318 10.821  -38.493 1.00 14.95 ? 70  MET C C   1 
ATOM   1837 O  O   . MET C 1 73 ? -29.493 10.813  -39.703 1.00 14.97 ? 70  MET C O   1 
ATOM   1838 C  CB  . MET C 1 73 ? -26.995 11.083  -37.736 1.00 18.19 ? 70  MET C CB  1 
ATOM   1839 C  CG  . MET C 1 73 ? -25.883 12.028  -37.310 1.00 21.65 ? 70  MET C CG  1 
ATOM   1840 S  SD  . MET C 1 73 ? -24.299 11.227  -37.358 1.00 28.34 ? 70  MET C SD  1 
ATOM   1841 C  CE  . MET C 1 73 ? -24.224 10.911  -39.143 1.00 27.51 ? 70  MET C CE  1 
ATOM   1842 N  N   . LEU C 1 74 ? -29.970 9.994   -37.676 1.00 12.95 ? 71  LEU C N   1 
ATOM   1843 C  CA  . LEU C 1 74 ? -31.003 9.116   -38.197 1.00 12.01 ? 71  LEU C CA  1 
ATOM   1844 C  C   . LEU C 1 74 ? -32.198 9.899   -38.832 1.00 11.84 ? 71  LEU C C   1 
ATOM   1845 O  O   . LEU C 1 74 ? -32.686 9.560   -39.912 1.00 12.85 ? 71  LEU C O   1 
ATOM   1846 C  CB  . LEU C 1 74 ? -31.425 8.135   -37.083 1.00 12.46 ? 71  LEU C CB  1 
ATOM   1847 C  CG  . LEU C 1 74 ? -32.526 7.086   -37.424 1.00 12.96 ? 71  LEU C CG  1 
ATOM   1848 C  CD1 . LEU C 1 74 ? -32.105 6.219   -38.585 1.00 14.53 ? 71  LEU C CD1 1 
ATOM   1849 C  CD2 . LEU C 1 74 ? -32.745 6.167   -36.250 1.00 13.83 ? 71  LEU C CD2 1 
ATOM   1850 N  N   . ILE C 1 75 ? -32.689 10.903  -38.137 1.00 11.97 ? 72  ILE C N   1 
ATOM   1851 C  CA  . ILE C 1 75 ? -33.779 11.756  -38.673 1.00 13.88 ? 72  ILE C CA  1 
ATOM   1852 C  C   . ILE C 1 75 ? -33.364 12.351  -40.068 1.00 16.73 ? 72  ILE C C   1 
ATOM   1853 O  O   . ILE C 1 75 ? -34.138 12.364  -41.038 1.00 15.71 ? 72  ILE C O   1 
ATOM   1854 C  CB  . ILE C 1 75 ? -34.108 12.838  -37.677 1.00 13.09 ? 72  ILE C CB  1 
ATOM   1855 C  CG1 . ILE C 1 75 ? -34.845 12.223  -36.471 1.00 12.51 ? 72  ILE C CG1 1 
ATOM   1856 C  CG2 . ILE C 1 75 ? -34.915 13.965  -38.318 1.00 14.26 ? 72  ILE C CG2 1 
ATOM   1857 C  CD1 . ILE C 1 75 ? -34.828 13.188  -35.323 1.00 12.13 ? 72  ILE C CD1 1 
ATOM   1858 N  N   . LYS C 1 76 ? -32.135 12.868  -40.148 1.00 18.53 ? 73  LYS C N   1 
ATOM   1859 C  CA  . LYS C 1 76 ? -31.639 13.475  -41.380 1.00 21.00 ? 73  LYS C CA  1 
ATOM   1860 C  C   . LYS C 1 76 ? -31.603 12.473  -42.499 1.00 20.30 ? 73  LYS C C   1 
ATOM   1861 O  O   . LYS C 1 76 ? -31.915 12.764  -43.677 1.00 19.56 ? 73  LYS C O   1 
ATOM   1862 C  CB  . LYS C 1 76 ? -30.233 14.066  -41.177 1.00 23.12 ? 73  LYS C CB  1 
ATOM   1863 C  CG  . LYS C 1 76 ? -30.174 15.397  -40.443 1.00 28.90 ? 73  LYS C CG  1 
ATOM   1864 C  CD  . LYS C 1 76 ? -28.668 15.743  -40.259 1.00 33.12 ? 73  LYS C CD  1 
ATOM   1865 C  CE  . LYS C 1 76 ? -28.353 17.068  -39.624 1.00 37.23 ? 73  LYS C CE  1 
ATOM   1866 N  NZ  . LYS C 1 76 ? -29.572 17.789  -39.185 1.00 41.97 ? 73  LYS C NZ  1 
ATOM   1867 N  N   . GLU C 1 77 ? -31.192 11.259  -42.160 1.00 20.71 ? 74  GLU C N   1 
ATOM   1868 C  CA  . GLU C 1 77 ? -31.087 10.223  -43.162 1.00 21.31 ? 74  GLU C CA  1 
ATOM   1869 C  C   . GLU C 1 77 ? -32.475 9.742   -43.622 1.00 21.97 ? 74  GLU C C   1 
ATOM   1870 O  O   . GLU C 1 77 ? -32.684 9.412   -44.794 1.00 21.03 ? 74  GLU C O   1 
ATOM   1871 C  CB  . GLU C 1 77 ? -30.270 9.100   -42.621 1.00 21.19 ? 74  GLU C CB  1 
ATOM   1872 C  CG  . GLU C 1 77 ? -29.947 8.039   -43.659 1.00 24.73 ? 74  GLU C CG  1 
ATOM   1873 C  CD  . GLU C 1 77 ? -28.840 8.559   -44.593 1.00 31.74 ? 74  GLU C CD  1 
ATOM   1874 O  OE1 . GLU C 1 77 ? -28.018 9.356   -44.118 1.00 31.61 ? 74  GLU C OE1 1 
ATOM   1875 O  OE2 . GLU C 1 77 ? -28.763 8.148   -45.748 1.00 32.18 ? 74  GLU C OE2 1 
ATOM   1876 N  N   . ILE C 1 78 ? -33.417 9.669   -42.696 1.00 20.95 ? 75  ILE C N   1 
ATOM   1877 C  CA  . ILE C 1 78 ? -34.793 9.273   -43.044 1.00 20.68 ? 75  ILE C CA  1 
ATOM   1878 C  C   . ILE C 1 78 ? -35.398 10.372  -43.982 1.00 24.65 ? 75  ILE C C   1 
ATOM   1879 O  O   . ILE C 1 78 ? -36.041 10.062  -44.948 1.00 26.70 ? 75  ILE C O   1 
ATOM   1880 C  CB  . ILE C 1 78 ? -35.660 9.141   -41.790 1.00 18.72 ? 75  ILE C CB  1 
ATOM   1881 C  CG1 . ILE C 1 78 ? -35.273 7.869   -41.003 1.00 17.34 ? 75  ILE C CG1 1 
ATOM   1882 C  CG2 . ILE C 1 78 ? -37.149 9.156   -42.189 1.00 20.45 ? 75  ILE C CG2 1 
ATOM   1883 C  CD1 . ILE C 1 78 ? -35.708 7.889   -39.546 1.00 18.77 ? 75  ILE C CD1 1 
ATOM   1884 N  N   . LEU C 1 79 ? -35.148 11.631  -43.693 1.00 25.55 ? 76  LEU C N   1 
ATOM   1885 C  CA  . LEU C 1 79 ? -35.679 12.748  -44.495 1.00 28.13 ? 76  LEU C CA  1 
ATOM   1886 C  C   . LEU C 1 79 ? -34.952 12.950  -45.848 1.00 30.60 ? 76  LEU C C   1 
ATOM   1887 O  O   . LEU C 1 79 ? -35.512 13.576  -46.728 1.00 33.04 ? 76  LEU C O   1 
ATOM   1888 C  CB  . LEU C 1 79 ? -35.638 14.039  -43.692 1.00 25.09 ? 76  LEU C CB  1 
ATOM   1889 C  CG  . LEU C 1 79 ? -36.644 14.079  -42.525 1.00 28.14 ? 76  LEU C CG  1 
ATOM   1890 C  CD1 . LEU C 1 79 ? -36.334 15.205  -41.599 1.00 26.91 ? 76  LEU C CD1 1 
ATOM   1891 C  CD2 . LEU C 1 79 ? -38.087 14.168  -42.995 1.00 30.15 ? 76  LEU C CD2 1 
ATOM   1892 N  N   . LYS C 1 80 ? -33.765 12.380  -46.020 1.00 31.75 ? 77  LYS C N   1 
ATOM   1893 C  CA  . LYS C 1 80 ? -32.902 12.644  -47.170 1.00 35.28 ? 77  LYS C CA  1 
ATOM   1894 C  C   . LYS C 1 80 ? -33.620 12.361  -48.508 1.00 38.83 ? 77  LYS C C   1 
ATOM   1895 O  O   . LYS C 1 80 ? -34.134 11.261  -48.733 1.00 43.49 ? 77  LYS C O   1 
ATOM   1896 C  CB  . LYS C 1 80 ? -31.598 11.818  -47.060 1.00 37.61 ? 77  LYS C CB  1 
ATOM   1897 C  CG  . LYS C 1 80 ? -30.576 12.135  -48.144 1.00 41.74 ? 77  LYS C CG  1 
ATOM   1898 C  CD  . LYS C 1 80 ? -29.176 11.581  -47.874 1.00 44.07 ? 77  LYS C CD  1 
ATOM   1899 C  CE  . LYS C 1 80 ? -28.224 11.996  -49.006 1.00 45.87 ? 77  LYS C CE  1 
ATOM   1900 N  NZ  . LYS C 1 80 ? -26.959 11.194  -49.033 1.00 45.95 ? 77  LYS C NZ  1 
ATOM   1901 N  N   . SER D 1 6  ? -22.098 17.315  1.555   1.00 30.55 ? 3   SER D N   1 
ATOM   1902 C  CA  . SER D 1 6  ? -21.299 17.688  0.316   1.00 26.89 ? 3   SER D CA  1 
ATOM   1903 C  C   . SER D 1 6  ? -20.785 19.090  0.458   1.00 23.55 ? 3   SER D C   1 
ATOM   1904 O  O   . SER D 1 6  ? -21.582 20.022  0.415   1.00 24.77 ? 3   SER D O   1 
ATOM   1905 C  CB  . SER D 1 6  ? -22.113 17.543  -0.969  1.00 27.21 ? 3   SER D CB  1 
ATOM   1906 O  OG  . SER D 1 6  ? -21.329 18.046  -2.104  1.00 23.76 ? 3   SER D OG  1 
ATOM   1907 N  N   . PHE D 1 7  ? -19.469 19.247  0.599   1.00 20.80 ? 4   PHE D N   1 
ATOM   1908 C  CA  . PHE D 1 7  ? -18.838 20.549  0.647   1.00 23.78 ? 4   PHE D CA  1 
ATOM   1909 C  C   . PHE D 1 7  ? -19.091 21.345  -0.705  1.00 22.50 ? 4   PHE D C   1 
ATOM   1910 O  O   . PHE D 1 7  ? -19.423 22.523  -0.689  1.00 21.09 ? 4   PHE D O   1 
ATOM   1911 C  CB  . PHE D 1 7  ? -17.361 20.343  0.844   1.00 24.27 ? 4   PHE D CB  1 
ATOM   1912 C  CG  . PHE D 1 7  ? -16.515 21.600  0.670   1.00 27.33 ? 4   PHE D CG  1 
ATOM   1913 C  CD1 . PHE D 1 7  ? -16.355 22.500  1.716   1.00 28.99 ? 4   PHE D CD1 1 
ATOM   1914 C  CD2 . PHE D 1 7  ? -15.843 21.850  -0.529  1.00 27.55 ? 4   PHE D CD2 1 
ATOM   1915 C  CE1 . PHE D 1 7  ? -15.552 23.615  1.581   1.00 29.14 ? 4   PHE D CE1 1 
ATOM   1916 C  CE2 . PHE D 1 7  ? -15.073 22.983  -0.683  1.00 31.07 ? 4   PHE D CE2 1 
ATOM   1917 C  CZ  . PHE D 1 7  ? -14.918 23.869  0.377   1.00 29.62 ? 4   PHE D CZ  1 
ATOM   1918 N  N   . LEU D 1 8  ? -18.978 20.661  -1.843  1.00 19.29 ? 5   LEU D N   1 
ATOM   1919 C  CA  . LEU D 1 8  ? -19.065 21.397  -3.135  1.00 20.23 ? 5   LEU D CA  1 
ATOM   1920 C  C   . LEU D 1 8  ? -20.505 21.847  -3.397  1.00 19.47 ? 5   LEU D C   1 
ATOM   1921 O  O   . LEU D 1 8  ? -20.729 22.951  -3.859  1.00 19.04 ? 5   LEU D O   1 
ATOM   1922 C  CB  . LEU D 1 8  ? -18.631 20.507  -4.252  1.00 20.20 ? 5   LEU D CB  1 
ATOM   1923 C  CG  . LEU D 1 8  ? -17.972 21.101  -5.494  1.00 21.05 ? 5   LEU D CG  1 
ATOM   1924 C  CD1 . LEU D 1 8  ? -18.400 20.302  -6.688  1.00 22.91 ? 5   LEU D CD1 1 
ATOM   1925 C  CD2 . LEU D 1 8  ? -17.968 22.586  -5.692  1.00 20.26 ? 5   LEU D CD2 1 
ATOM   1926 N  N   . LEU D 1 9  ? -21.476 20.991  -3.092  1.00 20.09 ? 6   LEU D N   1 
ATOM   1927 C  CA  . LEU D 1 9  ? -22.894 21.407  -3.148  1.00 22.90 ? 6   LEU D CA  1 
ATOM   1928 C  C   . LEU D 1 9  ? -23.199 22.651  -2.300  1.00 22.09 ? 6   LEU D C   1 
ATOM   1929 O  O   . LEU D 1 9  ? -23.909 23.581  -2.771  1.00 22.89 ? 6   LEU D O   1 
ATOM   1930 C  CB  . LEU D 1 9  ? -23.820 20.226  -2.825  1.00 26.75 ? 6   LEU D CB  1 
ATOM   1931 C  CG  . LEU D 1 9  ? -25.333 20.302  -3.006  1.00 30.62 ? 6   LEU D CG  1 
ATOM   1932 C  CD1 . LEU D 1 9  ? -25.746 20.724  -4.405  1.00 29.21 ? 6   LEU D CD1 1 
ATOM   1933 C  CD2 . LEU D 1 9  ? -25.915 18.912  -2.714  1.00 31.05 ? 6   LEU D CD2 1 
ATOM   1934 N  N   . SER D 1 10 ? -22.631 22.742  -1.089  1.00 25.18 ? 7   SER D N   1 
ATOM   1935 C  CA  . SER D 1 10 ? -22.850 23.926  -0.258  1.00 24.72 ? 7   SER D CA  1 
ATOM   1936 C  C   . SER D 1 10 ? -22.267 25.146  -0.897  1.00 23.26 ? 7   SER D C   1 
ATOM   1937 O  O   . SER D 1 10 ? -22.880 26.177  -0.820  1.00 20.48 ? 7   SER D O   1 
ATOM   1938 C  CB  . SER D 1 10 ? -22.299 23.808  1.184   1.00 27.30 ? 7   SER D CB  1 
ATOM   1939 O  OG  . SER D 1 10 ? -20.881 23.797  1.189   1.00 32.13 ? 7   SER D OG  1 
ATOM   1940 N  N   . LYS D 1 11 ? -21.092 25.032  -1.524  1.00 19.48 ? 8   LYS D N   1 
ATOM   1941 C  CA  . LYS D 1 11 ? -20.487 26.177  -2.157  1.00 20.31 ? 8   LYS D CA  1 
ATOM   1942 C  C   . LYS D 1 11 ? -21.257 26.639  -3.440  1.00 18.16 ? 8   LYS D C   1 
ATOM   1943 O  O   . LYS D 1 11 ? -21.444 27.838  -3.670  1.00 17.76 ? 8   LYS D O   1 
ATOM   1944 C  CB  . LYS D 1 11 ? -19.032 25.925  -2.444  1.00 20.82 ? 8   LYS D CB  1 
ATOM   1945 C  CG  . LYS D 1 11 ? -18.175 25.627  -1.208  1.00 24.05 ? 8   LYS D CG  1 
ATOM   1946 C  CD  . LYS D 1 11 ? -18.150 26.819  -0.287  1.00 30.74 ? 8   LYS D CD  1 
ATOM   1947 C  CE  . LYS D 1 11 ? -17.505 26.503  1.050   1.00 39.38 ? 8   LYS D CE  1 
ATOM   1948 N  NZ  . LYS D 1 11 ? -17.755 27.656  1.948   1.00 44.92 ? 8   LYS D NZ  1 
ATOM   1949 N  N   . VAL D 1 12 ? -21.630 25.680  -4.263  1.00 17.78 ? 9   VAL D N   1 
ATOM   1950 C  CA  . VAL D 1 12 ? -22.373 25.979  -5.481  1.00 19.18 ? 9   VAL D CA  1 
ATOM   1951 C  C   . VAL D 1 12 ? -23.726 26.663  -5.111  1.00 19.34 ? 9   VAL D C   1 
ATOM   1952 O  O   . VAL D 1 12 ? -24.126 27.684  -5.686  1.00 18.97 ? 9   VAL D O   1 
ATOM   1953 C  CB  . VAL D 1 12 ? -22.614 24.682  -6.292  1.00 16.59 ? 9   VAL D CB  1 
ATOM   1954 C  CG1 . VAL D 1 12 ? -23.680 24.846  -7.386  1.00 17.54 ? 9   VAL D CG1 1 
ATOM   1955 C  CG2 . VAL D 1 12 ? -21.312 24.163  -6.871  1.00 16.44 ? 9   VAL D CG2 1 
ATOM   1956 N  N   . SER D 1 13 ? -24.431 26.095  -4.147  1.00 19.83 ? 10  SER D N   1 
ATOM   1957 C  CA  . SER D 1 13 ? -25.669 26.710  -3.644  1.00 19.54 ? 10  SER D CA  1 
ATOM   1958 C  C   . SER D 1 13 ? -25.508 28.140  -3.122  1.00 18.48 ? 10  SER D C   1 
ATOM   1959 O  O   . SER D 1 13 ? -26.372 28.998  -3.386  1.00 19.33 ? 10  SER D O   1 
ATOM   1960 C  CB  . SER D 1 13 ? -26.256 25.832  -2.513  1.00 22.03 ? 10  SER D CB  1 
ATOM   1961 O  OG  . SER D 1 13 ? -26.626 24.548  -3.048  1.00 27.50 ? 10  SER D OG  1 
ATOM   1962 N  N   . PHE D 1 14 ? -24.422 28.420  -2.404  1.00 18.90 ? 11  PHE D N   1 
ATOM   1963 C  CA  . PHE D 1 14 ? -24.167 29.754  -1.908  1.00 20.48 ? 11  PHE D CA  1 
ATOM   1964 C  C   . PHE D 1 14 ? -23.941 30.740  -3.034  1.00 20.60 ? 11  PHE D C   1 
ATOM   1965 O  O   . PHE D 1 14 ? -24.390 31.919  -2.955  1.00 20.69 ? 11  PHE D O   1 
ATOM   1966 C  CB  . PHE D 1 14 ? -22.959 29.736  -0.977  1.00 24.11 ? 11  PHE D CB  1 
ATOM   1967 C  CG  . PHE D 1 14 ? -22.652 31.040  -0.356  1.00 28.95 ? 11  PHE D CG  1 
ATOM   1968 C  CD1 . PHE D 1 14 ? -23.431 31.504  0.703   1.00 35.33 ? 11  PHE D CD1 1 
ATOM   1969 C  CD2 . PHE D 1 14 ? -21.607 31.824  -0.819  1.00 32.25 ? 11  PHE D CD2 1 
ATOM   1970 C  CE1 . PHE D 1 14 ? -23.162 32.737  1.283   1.00 38.82 ? 11  PHE D CE1 1 
ATOM   1971 C  CE2 . PHE D 1 14 ? -21.324 33.060  -0.237  1.00 36.49 ? 11  PHE D CE2 1 
ATOM   1972 C  CZ  . PHE D 1 14 ? -22.104 33.513  0.818   1.00 38.53 ? 11  PHE D CZ  1 
ATOM   1973 N  N   . VAL D 1 15 ? -23.184 30.333  -4.055  1.00 17.48 ? 12  VAL D N   1 
ATOM   1974 C  CA  . VAL D 1 15 ? -22.906 31.242  -5.173  1.00 15.69 ? 12  VAL D CA  1 
ATOM   1975 C  C   . VAL D 1 15 ? -24.158 31.581  -5.940  1.00 14.42 ? 12  VAL D C   1 
ATOM   1976 O  O   . VAL D 1 15 ? -24.337 32.718  -6.304  1.00 13.92 ? 12  VAL D O   1 
ATOM   1977 C  CB  . VAL D 1 15 ? -21.814 30.699  -6.119  1.00 16.83 ? 12  VAL D CB  1 
ATOM   1978 C  CG1 . VAL D 1 15 ? -21.616 31.646  -7.319  1.00 16.98 ? 12  VAL D CG1 1 
ATOM   1979 C  CG2 . VAL D 1 15 ? -20.494 30.634  -5.373  1.00 18.79 ? 12  VAL D CG2 1 
ATOM   1980 N  N   . ILE D 1 16 ? -25.004 30.570  -6.192  1.00 15.57 ? 13  ILE D N   1 
ATOM   1981 C  CA  . ILE D 1 16 ? -26.337 30.759  -6.781  1.00 15.47 ? 13  ILE D CA  1 
ATOM   1982 C  C   . ILE D 1 16 ? -27.127 31.872  -6.035  1.00 17.93 ? 13  ILE D C   1 
ATOM   1983 O  O   . ILE D 1 16 ? -27.656 32.823  -6.655  1.00 15.22 ? 13  ILE D O   1 
ATOM   1984 C  CB  . ILE D 1 16 ? -27.140 29.460  -6.814  1.00 14.66 ? 13  ILE D CB  1 
ATOM   1985 C  CG1 . ILE D 1 16 ? -26.509 28.476  -7.852  1.00 14.96 ? 13  ILE D CG1 1 
ATOM   1986 C  CG2 . ILE D 1 16 ? -28.569 29.695  -7.254  1.00 15.30 ? 13  ILE D CG2 1 
ATOM   1987 C  CD1 . ILE D 1 16 ? -26.981 27.064  -7.734  1.00 15.09 ? 13  ILE D CD1 1 
ATOM   1988 N  N   . LYS D 1 17 ? -27.256 31.675  -4.734  1.00 19.05 ? 14  LYS D N   1 
ATOM   1989 C  CA  . LYS D 1 17 ? -27.975 32.629  -3.891  1.00 19.37 ? 14  LYS D CA  1 
ATOM   1990 C  C   . LYS D 1 17 ? -27.368 34.014  -3.944  1.00 18.41 ? 14  LYS D C   1 
ATOM   1991 O  O   . LYS D 1 17 ? -28.109 35.001  -4.095  1.00 19.17 ? 14  LYS D O   1 
ATOM   1992 C  CB  . LYS D 1 17 ? -28.027 32.100  -2.469  1.00 22.88 ? 14  LYS D CB  1 
ATOM   1993 C  CG  . LYS D 1 17 ? -28.829 32.981  -1.531  1.00 25.76 ? 14  LYS D CG  1 
ATOM   1994 C  CD  . LYS D 1 17 ? -28.980 32.312  -0.176  1.00 31.12 ? 14  LYS D CD  1 
ATOM   1995 C  CE  . LYS D 1 17 ? -29.477 33.302  0.869   1.00 37.62 ? 14  LYS D CE  1 
ATOM   1996 N  NZ  . LYS D 1 17 ? -29.263 32.754  2.266   1.00 44.53 ? 14  LYS D NZ  1 
ATOM   1997 N  N   . LYS D 1 18 ? -26.042 34.089  -3.816  1.00 17.23 ? 15  LYS D N   1 
ATOM   1998 C  CA  . LYS D 1 18 ? -25.347 35.344  -3.821  1.00 20.08 ? 15  LYS D CA  1 
ATOM   1999 C  C   . LYS D 1 18 ? -25.666 36.155  -5.109  1.00 19.09 ? 15  LYS D C   1 
ATOM   2000 O  O   . LYS D 1 18 ? -26.006 37.378  -5.032  1.00 18.04 ? 15  LYS D O   1 
ATOM   2001 C  CB  . LYS D 1 18 ? -23.860 35.096  -3.674  1.00 24.15 ? 15  LYS D CB  1 
ATOM   2002 C  CG  . LYS D 1 18 ? -23.019 36.345  -3.717  1.00 28.67 ? 15  LYS D CG  1 
ATOM   2003 C  CD  . LYS D 1 18 ? -21.564 36.055  -3.387  1.00 32.48 ? 15  LYS D CD  1 
ATOM   2004 C  CE  . LYS D 1 18 ? -20.751 37.303  -3.682  1.00 38.38 ? 15  LYS D CE  1 
ATOM   2005 N  NZ  . LYS D 1 18 ? -19.320 36.976  -3.915  1.00 40.79 ? 15  LYS D NZ  1 
ATOM   2006 N  N   . ILE D 1 19 ? -25.581 35.501  -6.275  1.00 17.38 ? 16  ILE D N   1 
ATOM   2007 C  CA  . ILE D 1 19 ? -25.827 36.167  -7.560  1.00 15.22 ? 16  ILE D CA  1 
ATOM   2008 C  C   . ILE D 1 19 ? -27.314 36.528  -7.688  1.00 15.05 ? 16  ILE D C   1 
ATOM   2009 O  O   . ILE D 1 19 ? -27.633 37.619  -8.162  1.00 16.95 ? 16  ILE D O   1 
ATOM   2010 C  CB  . ILE D 1 19 ? -25.382 35.259  -8.748  1.00 15.77 ? 16  ILE D CB  1 
ATOM   2011 C  CG1 . ILE D 1 19 ? -23.896 34.935  -8.673  1.00 15.19 ? 16  ILE D CG1 1 
ATOM   2012 C  CG2 . ILE D 1 19 ? -25.707 35.950  -10.083 1.00 15.37 ? 16  ILE D CG2 1 
ATOM   2013 C  CD1 . ILE D 1 19 ? -23.451 33.793  -9.562  1.00 15.28 ? 16  ILE D CD1 1 
ATOM   2014 N  N   . ARG D 1 20 ? -28.226 35.624  -7.309  1.00 14.02 ? 17  ARG D N   1 
ATOM   2015 C  CA  . ARG D 1 20 ? -29.662 35.896  -7.305  1.00 14.95 ? 17  ARG D CA  1 
ATOM   2016 C  C   . ARG D 1 20 ? -29.990 37.159  -6.533  1.00 16.52 ? 17  ARG D C   1 
ATOM   2017 O  O   . ARG D 1 20 ? -30.714 38.047  -7.032  1.00 18.59 ? 17  ARG D O   1 
ATOM   2018 C  CB  . ARG D 1 20 ? -30.442 34.748  -6.664  1.00 15.81 ? 17  ARG D CB  1 
ATOM   2019 C  CG  . ARG D 1 20 ? -31.951 34.919  -6.747  1.00 16.94 ? 17  ARG D CG  1 
ATOM   2020 C  CD  . ARG D 1 20 ? -32.703 33.778  -6.095  1.00 19.55 ? 17  ARG D CD  1 
ATOM   2021 N  NE  . ARG D 1 20 ? -32.383 33.584  -4.674  1.00 23.25 ? 17  ARG D NE  1 
ATOM   2022 C  CZ  . ARG D 1 20 ? -32.924 34.280  -3.661  1.00 21.89 ? 17  ARG D CZ  1 
ATOM   2023 N  NH1 . ARG D 1 20 ? -33.676 35.302  -3.906  1.00 20.02 ? 17  ARG D NH1 1 
ATOM   2024 N  NH2 . ARG D 1 20 ? -32.635 33.980  -2.396  1.00 23.19 ? 17  ARG D NH2 1 
ATOM   2025 N  N   . LEU D 1 21 ? -29.482 37.232  -5.317  1.00 17.39 ? 18  LEU D N   1 
ATOM   2026 C  CA  . LEU D 1 21 ? -29.726 38.409  -4.474  1.00 21.17 ? 18  LEU D CA  1 
ATOM   2027 C  C   . LEU D 1 21 ? -29.060 39.694  -5.029  1.00 21.44 ? 18  LEU D C   1 
ATOM   2028 O  O   . LEU D 1 21 ? -29.677 40.747  -4.956  1.00 24.16 ? 18  LEU D O   1 
ATOM   2029 C  CB  . LEU D 1 21 ? -29.229 38.189  -3.046  1.00 21.04 ? 18  LEU D CB  1 
ATOM   2030 C  CG  . LEU D 1 21 ? -29.866 37.046  -2.250  1.00 20.65 ? 18  LEU D CG  1 
ATOM   2031 C  CD1 . LEU D 1 21 ? -28.964 36.808  -1.021  1.00 23.95 ? 18  LEU D CD1 1 
ATOM   2032 C  CD2 . LEU D 1 21 ? -31.274 37.332  -1.907  1.00 21.66 ? 18  LEU D CD2 1 
ATOM   2033 N  N   . GLU D 1 22 ? -27.853 39.640  -5.560  1.00 21.85 ? 19  GLU D N   1 
ATOM   2034 C  CA  . GLU D 1 22 ? -27.258 40.826  -6.192  1.00 25.18 ? 19  GLU D CA  1 
ATOM   2035 C  C   . GLU D 1 22 ? -28.067 41.304  -7.409  1.00 26.27 ? 19  GLU D C   1 
ATOM   2036 O  O   . GLU D 1 22 ? -28.128 42.510  -7.678  1.00 26.96 ? 19  GLU D O   1 
ATOM   2037 C  CB  . GLU D 1 22 ? -25.807 40.603  -6.604  1.00 29.15 ? 19  GLU D CB  1 
ATOM   2038 C  CG  . GLU D 1 22 ? -24.856 40.310  -5.436  1.00 34.00 ? 19  GLU D CG  1 
ATOM   2039 C  CD  . GLU D 1 22 ? -23.409 39.963  -5.867  1.00 40.86 ? 19  GLU D CD  1 
ATOM   2040 O  OE1 . GLU D 1 22 ? -22.462 40.219  -5.062  1.00 39.84 ? 19  GLU D OE1 1 
ATOM   2041 O  OE2 . GLU D 1 22 ? -23.211 39.433  -6.991  1.00 42.73 ? 19  GLU D OE2 1 
ATOM   2042 N  N   . LYS D 1 23 ? -28.748 40.407  -8.106  1.00 23.86 ? 20  LYS D N   1 
ATOM   2043 C  CA  . LYS D 1 23 ? -29.626 40.819  -9.211  1.00 27.02 ? 20  LYS D CA  1 
ATOM   2044 C  C   . LYS D 1 23 ? -31.024 41.297  -8.792  1.00 24.21 ? 20  LYS D C   1 
ATOM   2045 O  O   . LYS D 1 23 ? -31.792 41.765  -9.658  1.00 21.17 ? 20  LYS D O   1 
ATOM   2046 C  CB  . LYS D 1 23 ? -29.802 39.702  -10.243 1.00 28.99 ? 20  LYS D CB  1 
ATOM   2047 C  CG  . LYS D 1 23 ? -28.531 39.192  -10.923 1.00 36.30 ? 20  LYS D CG  1 
ATOM   2048 C  CD  . LYS D 1 23 ? -28.316 39.704  -12.361 1.00 42.86 ? 20  LYS D CD  1 
ATOM   2049 C  CE  . LYS D 1 23 ? -29.501 39.459  -13.304 1.00 45.30 ? 20  LYS D CE  1 
ATOM   2050 N  NZ  . LYS D 1 23 ? -30.114 38.130  -13.053 1.00 46.23 ? 20  LYS D NZ  1 
ATOM   2051 N  N   . GLY D 1 24 ? -31.382 41.151  -7.505  1.00 21.52 ? 21  GLY D N   1 
ATOM   2052 C  CA  . GLY D 1 24 ? -32.699 41.572  -7.030  1.00 21.21 ? 21  GLY D CA  1 
ATOM   2053 C  C   . GLY D 1 24 ? -33.802 40.567  -7.317  1.00 22.28 ? 21  GLY D C   1 
ATOM   2054 O  O   . GLY D 1 24 ? -34.979 40.886  -7.245  1.00 18.61 ? 21  GLY D O   1 
ATOM   2055 N  N   . MET D 1 25 ? -33.440 39.335  -7.725  1.00 20.84 ? 22  MET D N   1 
ATOM   2056 C  CA  . MET D 1 25 ? -34.442 38.337  -8.108  1.00 19.55 ? 22  MET D CA  1 
ATOM   2057 C  C   . MET D 1 25 ? -34.908 37.596  -6.884  1.00 18.73 ? 22  MET D C   1 
ATOM   2058 O  O   . MET D 1 25 ? -34.126 37.306  -6.014  1.00 18.31 ? 22  MET D O   1 
ATOM   2059 C  CB  . MET D 1 25 ? -33.851 37.287  -9.081  1.00 19.98 ? 22  MET D CB  1 
ATOM   2060 C  CG  . MET D 1 25 ? -33.504 37.851  -10.431 1.00 21.36 ? 22  MET D CG  1 
ATOM   2061 S  SD  . MET D 1 25 ? -32.575 36.655  -11.415 1.00 24.73 ? 22  MET D SD  1 
ATOM   2062 C  CE  . MET D 1 25 ? -33.869 35.818  -12.233 1.00 20.55 ? 22  MET D CE  1 
ATOM   2063 N  N   . THR D 1 26 ? -36.185 37.271  -6.823  1.00 19.76 ? 23  THR D N   1 
ATOM   2064 C  CA  . THR D 1 26 ? -36.634 36.392  -5.784  1.00 23.19 ? 23  THR D CA  1 
ATOM   2065 C  C   . THR D 1 26 ? -36.441 34.952  -6.276  1.00 22.83 ? 23  THR D C   1 
ATOM   2066 O  O   . THR D 1 26 ? -36.189 34.729  -7.458  1.00 19.81 ? 23  THR D O   1 
ATOM   2067 C  CB  . THR D 1 26 ? -38.143 36.549  -5.562  1.00 23.86 ? 23  THR D CB  1 
ATOM   2068 O  OG1 . THR D 1 26 ? -38.792 36.236  -6.782  1.00 23.49 ? 23  THR D OG1 1 
ATOM   2069 C  CG2 . THR D 1 26 ? -38.486 38.004  -5.105  1.00 25.85 ? 23  THR D CG2 1 
ATOM   2070 N  N   . GLN D 1 27 ? -36.679 33.985  -5.400  1.00 23.08 ? 24  GLN D N   1 
ATOM   2071 C  CA  . GLN D 1 27 ? -36.659 32.582  -5.845  1.00 24.45 ? 24  GLN D CA  1 
ATOM   2072 C  C   . GLN D 1 27 ? -37.642 32.257  -6.936  1.00 26.67 ? 24  GLN D C   1 
ATOM   2073 O  O   . GLN D 1 27 ? -37.370 31.431  -7.809  1.00 23.85 ? 24  GLN D O   1 
ATOM   2074 C  CB  . GLN D 1 27 ? -36.859 31.654  -4.662  1.00 25.11 ? 24  GLN D CB  1 
ATOM   2075 C  CG  . GLN D 1 27 ? -35.765 31.745  -3.644  1.00 25.74 ? 24  GLN D CG  1 
ATOM   2076 C  CD  . GLN D 1 27 ? -36.075 30.816  -2.501  1.00 29.14 ? 24  GLN D CD  1 
ATOM   2077 O  OE1 . GLN D 1 27 ? -37.240 30.434  -2.324  1.00 27.14 ? 24  GLN D OE1 1 
ATOM   2078 N  NE2 . GLN D 1 27 ? -35.069 30.435  -1.752  1.00 27.91 ? 24  GLN D NE2 1 
ATOM   2079 N  N   . GLU D 1 28 ? -38.805 32.902  -6.912  1.00 28.05 ? 25  GLU D N   1 
ATOM   2080 C  CA  . GLU D 1 28 ? -39.818 32.710  -7.938  1.00 28.43 ? 25  GLU D CA  1 
ATOM   2081 C  C   . GLU D 1 28 ? -39.357 33.288  -9.272  1.00 24.97 ? 25  GLU D C   1 
ATOM   2082 O  O   . GLU D 1 28 ? -39.613 32.700  -10.330 1.00 21.40 ? 25  GLU D O   1 
ATOM   2083 C  CB  . GLU D 1 28 ? -41.149 33.403  -7.513  1.00 35.15 ? 25  GLU D CB  1 
ATOM   2084 C  CG  . GLU D 1 28 ? -42.253 33.332  -8.544  1.00 41.74 ? 25  GLU D CG  1 
ATOM   2085 C  CD  . GLU D 1 28 ? -42.331 34.542  -9.469  1.00 55.20 ? 25  GLU D CD  1 
ATOM   2086 O  OE1 . GLU D 1 28 ? -41.379 35.365  -9.523  1.00 62.86 ? 25  GLU D OE1 1 
ATOM   2087 O  OE2 . GLU D 1 28 ? -43.370 34.672  -10.164 1.00 69.15 ? 25  GLU D OE2 1 
ATOM   2088 N  N   . ASP D 1 29 ? -38.712 34.453  -9.223  1.00 24.72 ? 26  ASP D N   1 
ATOM   2089 C  CA  . ASP D 1 29 ? -38.180 35.077  -10.433 1.00 21.69 ? 26  ASP D CA  1 
ATOM   2090 C  C   . ASP D 1 29 ? -37.177 34.067  -11.050 1.00 18.29 ? 26  ASP D C   1 
ATOM   2091 O  O   . ASP D 1 29 ? -37.216 33.821  -12.224 1.00 18.64 ? 26  ASP D O   1 
ATOM   2092 C  CB  . ASP D 1 29 ? -37.415 36.386  -10.124 1.00 22.92 ? 26  ASP D CB  1 
ATOM   2093 C  CG  . ASP D 1 29 ? -38.345 37.580  -9.670  1.00 26.78 ? 26  ASP D CG  1 
ATOM   2094 O  OD1 . ASP D 1 29 ? -39.489 37.656  -10.115 1.00 25.95 ? 26  ASP D OD1 1 
ATOM   2095 O  OD2 . ASP D 1 29 ? -37.884 38.393  -8.850  1.00 27.49 ? 26  ASP D OD2 1 
ATOM   2096 N  N   . LEU D 1 30 ? -36.298 33.528  -10.239 1.00 18.62 ? 27  LEU D N   1 
ATOM   2097 C  CA  . LEU D 1 30 ? -35.225 32.616  -10.753 1.00 18.84 ? 27  LEU D CA  1 
ATOM   2098 C  C   . LEU D 1 30 ? -35.845 31.319  -11.294 1.00 20.51 ? 27  LEU D C   1 
ATOM   2099 O  O   . LEU D 1 30 ? -35.455 30.813  -12.347 1.00 18.60 ? 27  LEU D O   1 
ATOM   2100 C  CB  . LEU D 1 30 ? -34.155 32.352  -9.718  1.00 17.24 ? 27  LEU D CB  1 
ATOM   2101 C  CG  . LEU D 1 30 ? -32.988 31.430  -10.135 1.00 16.40 ? 27  LEU D CG  1 
ATOM   2102 C  CD1 . LEU D 1 30 ? -32.240 31.906  -11.401 1.00 16.39 ? 27  LEU D CD1 1 
ATOM   2103 C  CD2 . LEU D 1 30 ? -32.032 31.236  -8.965  1.00 16.40 ? 27  LEU D CD2 1 
ATOM   2104 N  N   . ALA D 1 31 ? -36.855 30.792  -10.596 1.00 20.42 ? 28  ALA D N   1 
ATOM   2105 C  CA  . ALA D 1 31 ? -37.587 29.595  -11.059 1.00 20.61 ? 28  ALA D CA  1 
ATOM   2106 C  C   . ALA D 1 31 ? -38.133 29.821  -12.420 1.00 23.24 ? 28  ALA D C   1 
ATOM   2107 O  O   . ALA D 1 31 ? -37.991 28.993  -13.318 1.00 25.17 ? 28  ALA D O   1 
ATOM   2108 C  CB  . ALA D 1 31 ? -38.750 29.297  -10.119 1.00 22.20 ? 28  ALA D CB  1 
ATOM   2109 N  N   . TYR D 1 32 ? -38.860 30.905  -12.568 1.00 24.09 ? 29  TYR D N   1 
ATOM   2110 C  CA  . TYR D 1 32 ? -39.415 31.243  -13.850 1.00 28.23 ? 29  TYR D CA  1 
ATOM   2111 C  C   . TYR D 1 32 ? -38.360 31.356  -14.973 1.00 25.62 ? 29  TYR D C   1 
ATOM   2112 O  O   . TYR D 1 32 ? -38.533 30.797  -16.050 1.00 25.62 ? 29  TYR D O   1 
ATOM   2113 C  CB  . TYR D 1 32 ? -40.215 32.535  -13.709 1.00 30.95 ? 29  TYR D CB  1 
ATOM   2114 C  CG  . TYR D 1 32 ? -40.791 33.034  -14.985 1.00 36.69 ? 29  TYR D CG  1 
ATOM   2115 C  CD1 . TYR D 1 32 ? -41.786 32.310  -15.641 1.00 39.25 ? 29  TYR D CD1 1 
ATOM   2116 C  CD2 . TYR D 1 32 ? -40.385 34.267  -15.528 1.00 37.26 ? 29  TYR D CD2 1 
ATOM   2117 C  CE1 . TYR D 1 32 ? -42.334 32.770  -16.826 1.00 40.62 ? 29  TYR D CE1 1 
ATOM   2118 C  CE2 . TYR D 1 32 ? -40.926 34.724  -16.699 1.00 42.15 ? 29  TYR D CE2 1 
ATOM   2119 C  CZ  . TYR D 1 32 ? -41.907 33.971  -17.330 1.00 41.45 ? 29  TYR D CZ  1 
ATOM   2120 O  OH  . TYR D 1 32 ? -42.435 34.417  -18.484 1.00 55.81 ? 29  TYR D OH  1 
ATOM   2121 N  N   . LYS D 1 33 ? -37.277 32.075  -14.750 1.00 23.17 ? 30  LYS D N   1 
ATOM   2122 C  CA  . LYS D 1 33 ? -36.291 32.284  -15.838 1.00 24.75 ? 30  LYS D CA  1 
ATOM   2123 C  C   . LYS D 1 33 ? -35.458 31.043  -16.127 1.00 24.87 ? 30  LYS D C   1 
ATOM   2124 O  O   . LYS D 1 33 ? -34.903 30.934  -17.196 1.00 25.65 ? 30  LYS D O   1 
ATOM   2125 C  CB  . LYS D 1 33 ? -35.337 33.440  -15.520 1.00 26.84 ? 30  LYS D CB  1 
ATOM   2126 C  CG  . LYS D 1 33 ? -35.959 34.851  -15.518 1.00 30.25 ? 30  LYS D CG  1 
ATOM   2127 C  CD  . LYS D 1 33 ? -36.323 35.375  -16.913 1.00 36.93 ? 30  LYS D CD  1 
ATOM   2128 C  CE  . LYS D 1 33 ? -37.580 36.280  -16.929 1.00 44.92 ? 30  LYS D CE  1 
ATOM   2129 N  NZ  . LYS D 1 33 ? -37.403 37.756  -17.263 1.00 54.44 ? 30  LYS D NZ  1 
ATOM   2130 N  N   . SER D 1 34 ? -35.365 30.126  -15.163 1.00 22.97 ? 31  SER D N   1 
ATOM   2131 C  CA  . SER D 1 34 ? -34.606 28.870  -15.308 1.00 25.59 ? 31  SER D CA  1 
ATOM   2132 C  C   . SER D 1 34 ? -35.441 27.723  -15.834 1.00 24.85 ? 31  SER D C   1 
ATOM   2133 O  O   . SER D 1 34 ? -34.921 26.620  -16.062 1.00 25.29 ? 31  SER D O   1 
ATOM   2134 C  CB  . SER D 1 34 ? -34.096 28.440  -13.949 1.00 26.88 ? 31  SER D CB  1 
ATOM   2135 O  OG  . SER D 1 34 ? -33.143 29.357  -13.518 1.00 32.83 ? 31  SER D OG  1 
ATOM   2136 N  N   . ASN D 1 35 ? -36.739 27.959  -15.916 1.00 27.14 ? 32  ASN D N   1 
ATOM   2137 C  CA  . ASN D 1 35 ? -37.737 26.936  -16.125 1.00 29.29 ? 32  ASN D CA  1 
ATOM   2138 C  C   . ASN D 1 35 ? -37.620 25.733  -15.201 1.00 30.47 ? 32  ASN D C   1 
ATOM   2139 O  O   . ASN D 1 35 ? -37.628 24.590  -15.647 1.00 29.95 ? 32  ASN D O   1 
ATOM   2140 C  CB  . ASN D 1 35 ? -37.745 26.494  -17.596 1.00 35.31 ? 32  ASN D CB  1 
ATOM   2141 C  CG  . ASN D 1 35 ? -39.144 26.110  -18.060 1.00 40.50 ? 32  ASN D CG  1 
ATOM   2142 O  OD1 . ASN D 1 35 ? -39.578 24.992  -17.854 1.00 44.63 ? 32  ASN D OD1 1 
ATOM   2143 N  ND2 . ASN D 1 35 ? -39.866 27.056  -18.660 1.00 43.91 ? 32  ASN D ND2 1 
ATOM   2144 N  N   . LEU D 1 36 ? -37.472 26.001  -13.913 1.00 24.78 ? 33  LEU D N   1 
ATOM   2145 C  CA  . LEU D 1 36 ? -37.421 24.994  -12.901 1.00 25.93 ? 33  LEU D CA  1 
ATOM   2146 C  C   . LEU D 1 36 ? -38.556 25.295  -11.898 1.00 27.44 ? 33  LEU D C   1 
ATOM   2147 O  O   . LEU D 1 36 ? -39.078 26.415  -11.866 1.00 29.00 ? 33  LEU D O   1 
ATOM   2148 C  CB  . LEU D 1 36 ? -36.053 25.032  -12.219 1.00 22.12 ? 33  LEU D CB  1 
ATOM   2149 C  CG  . LEU D 1 36 ? -34.896 24.560  -13.106 1.00 23.22 ? 33  LEU D CG  1 
ATOM   2150 C  CD1 . LEU D 1 36 ? -33.538 24.749  -12.428 1.00 22.97 ? 33  LEU D CD1 1 
ATOM   2151 C  CD2 . LEU D 1 36 ? -35.057 23.092  -13.495 1.00 22.36 ? 33  LEU D CD2 1 
ATOM   2152 N  N   . ASP D 1 37 ? -38.886 24.346  -11.030 1.00 30.27 ? 34  ASP D N   1 
ATOM   2153 C  CA  . ASP D 1 37 ? -39.911 24.588  -9.967  1.00 32.97 ? 34  ASP D CA  1 
ATOM   2154 C  C   . ASP D 1 37 ? -39.372 25.472  -8.833  1.00 30.11 ? 34  ASP D C   1 
ATOM   2155 O  O   . ASP D 1 37 ? -38.200 25.336  -8.425  1.00 25.33 ? 34  ASP D O   1 
ATOM   2156 C  CB  . ASP D 1 37 ? -40.369 23.240  -9.377  1.00 42.21 ? 34  ASP D CB  1 
ATOM   2157 C  CG  . ASP D 1 37 ? -41.681 23.343  -8.598  1.00 52.95 ? 34  ASP D CG  1 
ATOM   2158 O  OD1 . ASP D 1 37 ? -41.928 24.361  -7.895  1.00 65.58 ? 34  ASP D OD1 1 
ATOM   2159 O  OD2 . ASP D 1 37 ? -42.482 22.378  -8.686  1.00 62.78 ? 34  ASP D OD2 1 
ATOM   2160 N  N   . ARG D 1 38 ? -40.212 26.355  -8.286  1.00 25.09 ? 35  ARG D N   1 
ATOM   2161 C  CA  . ARG D 1 38 ? -39.831 27.151  -7.124  1.00 28.66 ? 35  ARG D CA  1 
ATOM   2162 C  C   . ARG D 1 38 ? -39.313 26.327  -5.975  1.00 25.18 ? 35  ARG D C   1 
ATOM   2163 O  O   . ARG D 1 38 ? -38.361 26.684  -5.290  1.00 23.01 ? 35  ARG D O   1 
ATOM   2164 C  CB  . ARG D 1 38 ? -41.052 27.874  -6.546  1.00 38.03 ? 35  ARG D CB  1 
ATOM   2165 C  CG  . ARG D 1 38 ? -41.573 29.105  -7.282  1.00 49.96 ? 35  ARG D CG  1 
ATOM   2166 C  CD  . ARG D 1 38 ? -43.015 29.502  -6.835  1.00 58.06 ? 35  ARG D CD  1 
ATOM   2167 N  NE  . ARG D 1 38 ? -43.515 28.718  -5.688  1.00 62.40 ? 35  ARG D NE  1 
ATOM   2168 C  CZ  . ARG D 1 38 ? -43.066 28.800  -4.431  1.00 65.48 ? 35  ARG D CZ  1 
ATOM   2169 N  NH1 . ARG D 1 38 ? -42.091 29.646  -4.104  1.00 67.59 ? 35  ARG D NH1 1 
ATOM   2170 N  NH2 . ARG D 1 38 ? -43.583 28.011  -3.491  1.00 64.37 ? 35  ARG D NH2 1 
ATOM   2171 N  N   . THR D 1 39 ? -39.989 25.230  -5.679  1.00 21.92 ? 36  THR D N   1 
ATOM   2172 C  CA  . THR D 1 39 ? -39.573 24.516  -4.511  1.00 23.34 ? 36  THR D CA  1 
ATOM   2173 C  C   . THR D 1 39 ? -38.214 23.838  -4.746  1.00 24.18 ? 36  THR D C   1 
ATOM   2174 O  O   . THR D 1 39 ? -37.475 23.617  -3.785  1.00 23.88 ? 36  THR D O   1 
ATOM   2175 C  CB  . THR D 1 39 ? -40.606 23.480  -4.084  1.00 23.48 ? 36  THR D CB  1 
ATOM   2176 O  OG1 . THR D 1 39 ? -40.992 22.743  -5.222  1.00 29.07 ? 36  THR D OG1 1 
ATOM   2177 C  CG2 . THR D 1 39 ? -41.811 24.179  -3.578  1.00 25.71 ? 36  THR D CG2 1 
ATOM   2178 N  N   . PHE D 1 40 ? -37.883 23.541  -5.995  1.00 24.88 ? 37  PHE D N   1 
ATOM   2179 C  CA  . PHE D 1 40 ? -36.502 23.099  -6.319  1.00 26.02 ? 37  PHE D CA  1 
ATOM   2180 C  C   . PHE D 1 40 ? -35.417 24.192  -6.060  1.00 23.01 ? 37  PHE D C   1 
ATOM   2181 O  O   . PHE D 1 40 ? -34.412 23.955  -5.397  1.00 22.57 ? 37  PHE D O   1 
ATOM   2182 C  CB  . PHE D 1 40 ? -36.470 22.562  -7.754  1.00 26.34 ? 37  PHE D CB  1 
ATOM   2183 C  CG  . PHE D 1 40 ? -35.127 22.027  -8.152  1.00 30.74 ? 37  PHE D CG  1 
ATOM   2184 C  CD1 . PHE D 1 40 ? -34.520 21.019  -7.392  1.00 30.66 ? 37  PHE D CD1 1 
ATOM   2185 C  CD2 . PHE D 1 40 ? -34.457 22.529  -9.262  1.00 33.51 ? 37  PHE D CD2 1 
ATOM   2186 C  CE1 . PHE D 1 40 ? -33.266 20.527  -7.710  1.00 32.79 ? 37  PHE D CE1 1 
ATOM   2187 C  CE2 . PHE D 1 40 ? -33.195 22.017  -9.601  1.00 36.11 ? 37  PHE D CE2 1 
ATOM   2188 C  CZ  . PHE D 1 40 ? -32.609 21.012  -8.825  1.00 34.40 ? 37  PHE D CZ  1 
ATOM   2189 N  N   . ILE D 1 41 ? -35.662 25.424  -6.516  1.00 23.34 ? 38  ILE D N   1 
ATOM   2190 C  CA  . ILE D 1 41 ? -34.771 26.537  -6.206  1.00 21.29 ? 38  ILE D CA  1 
ATOM   2191 C  C   . ILE D 1 41 ? -34.606 26.754  -4.707  1.00 20.40 ? 38  ILE D C   1 
ATOM   2192 O  O   . ILE D 1 41 ? -33.505 26.911  -4.171  1.00 18.17 ? 38  ILE D O   1 
ATOM   2193 C  CB  . ILE D 1 41 ? -35.271 27.868  -6.863  1.00 22.24 ? 38  ILE D CB  1 
ATOM   2194 C  CG1 . ILE D 1 41 ? -35.240 27.750  -8.416  1.00 23.21 ? 38  ILE D CG1 1 
ATOM   2195 C  CG2 . ILE D 1 41 ? -34.447 29.022  -6.356  1.00 21.80 ? 38  ILE D CG2 1 
ATOM   2196 C  CD1 . ILE D 1 41 ? -33.889 27.345  -8.952  1.00 24.11 ? 38  ILE D CD1 1 
ATOM   2197 N  N   . SER D 1 42 ? -35.726 26.744  -3.998  1.00 22.71 ? 39  SER D N   1 
ATOM   2198 C  CA  . SER D 1 42 ? -35.677 26.895  -2.561  1.00 22.69 ? 39  SER D CA  1 
ATOM   2199 C  C   . SER D 1 42 ? -34.875 25.754  -1.934  1.00 20.38 ? 39  SER D C   1 
ATOM   2200 O  O   . SER D 1 42 ? -34.041 25.970  -1.065  1.00 23.12 ? 39  SER D O   1 
ATOM   2201 C  CB  . SER D 1 42 ? -37.100 26.948  -1.997  1.00 24.80 ? 39  SER D CB  1 
ATOM   2202 O  OG  . SER D 1 42 ? -36.957 26.978  -0.612  1.00 29.83 ? 39  SER D OG  1 
ATOM   2203 N  N   . GLY D 1 43 ? -35.069 24.540  -2.413  1.00 22.34 ? 40  GLY D N   1 
ATOM   2204 C  CA  . GLY D 1 43 ? -34.299 23.414  -1.874  1.00 25.23 ? 40  GLY D CA  1 
ATOM   2205 C  C   . GLY D 1 43 ? -32.812 23.533  -2.092  1.00 23.49 ? 40  GLY D C   1 
ATOM   2206 O  O   . GLY D 1 43 ? -32.022 23.303  -1.188  1.00 23.09 ? 40  GLY D O   1 
ATOM   2207 N  N   . ILE D 1 44 ? -32.423 23.967  -3.296  1.00 23.10 ? 41  ILE D N   1 
ATOM   2208 C  CA  . ILE D 1 44 ? -31.001 24.166  -3.592  1.00 21.43 ? 41  ILE D CA  1 
ATOM   2209 C  C   . ILE D 1 44 ? -30.315 25.094  -2.623  1.00 21.71 ? 41  ILE D C   1 
ATOM   2210 O  O   . ILE D 1 44 ? -29.157 24.822  -2.145  1.00 23.93 ? 41  ILE D O   1 
ATOM   2211 C  CB  . ILE D 1 44 ? -30.888 24.628  -5.061  1.00 23.01 ? 41  ILE D CB  1 
ATOM   2212 C  CG1 . ILE D 1 44 ? -31.114 23.415  -5.928  1.00 25.98 ? 41  ILE D CG1 1 
ATOM   2213 C  CG2 . ILE D 1 44 ? -29.539 25.209  -5.378  1.00 24.34 ? 41  ILE D CG2 1 
ATOM   2214 C  CD1 . ILE D 1 44 ? -31.388 23.776  -7.337  1.00 32.83 ? 41  ILE D CD1 1 
ATOM   2215 N  N   . GLU D 1 45 ? -30.989 26.193  -2.326  1.00 23.69 ? 42  GLU D N   1 
ATOM   2216 C  CA  . GLU D 1 45 ? -30.437 27.264  -1.503  1.00 28.00 ? 42  GLU D CA  1 
ATOM   2217 C  C   . GLU D 1 45 ? -30.376 26.917  -0.014  1.00 30.95 ? 42  GLU D C   1 
ATOM   2218 O  O   . GLU D 1 45 ? -29.517 27.407  0.702   1.00 31.32 ? 42  GLU D O   1 
ATOM   2219 C  CB  . GLU D 1 45 ? -31.213 28.600  -1.720  1.00 31.23 ? 42  GLU D CB  1 
ATOM   2220 C  CG  . GLU D 1 45 ? -30.955 29.197  -3.131  1.00 31.84 ? 42  GLU D CG  1 
ATOM   2221 C  CD  . GLU D 1 45 ? -31.409 30.639  -3.336  1.00 33.91 ? 42  GLU D CD  1 
ATOM   2222 O  OE1 . GLU D 1 45 ? -31.136 31.182  -4.447  1.00 27.29 ? 42  GLU D OE1 1 
ATOM   2223 O  OE2 . GLU D 1 45 ? -32.051 31.231  -2.428  1.00 33.16 ? 42  GLU D OE2 1 
ATOM   2224 N  N   . ARG D 1 46 ? -31.287 26.070  0.435   1.00 33.86 ? 43  ARG D N   1 
ATOM   2225 C  CA  . ARG D 1 46 ? -31.184 25.445  1.745   1.00 34.29 ? 43  ARG D CA  1 
ATOM   2226 C  C   . ARG D 1 46 ? -30.246 24.263  1.700   1.00 34.73 ? 43  ARG D C   1 
ATOM   2227 O  O   . ARG D 1 46 ? -30.190 23.461  2.627   1.00 37.30 ? 43  ARG D O   1 
ATOM   2228 C  CB  . ARG D 1 46 ? -32.574 25.000  2.208   1.00 35.95 ? 43  ARG D CB  1 
ATOM   2229 C  CG  . ARG D 1 46 ? -33.373 26.205  2.675   1.00 37.09 ? 43  ARG D CG  1 
ATOM   2230 C  CD  . ARG D 1 46 ? -34.276 25.900  3.831   1.00 38.11 ? 43  ARG D CD  1 
ATOM   2231 N  NE  . ARG D 1 46 ? -35.498 25.303  3.351   1.00 34.30 ? 43  ARG D NE  1 
ATOM   2232 C  CZ  . ARG D 1 46 ? -36.274 24.444  4.025   1.00 33.65 ? 43  ARG D CZ  1 
ATOM   2233 N  NH1 . ARG D 1 46 ? -35.992 24.082  5.258   1.00 34.15 ? 43  ARG D NH1 1 
ATOM   2234 N  NH2 . ARG D 1 46 ? -37.389 23.975  3.462   1.00 32.48 ? 43  ARG D NH2 1 
ATOM   2235 N  N   . ASN D 1 47 ? -29.542 24.089  0.583   1.00 33.83 ? 44  ASN D N   1 
ATOM   2236 C  CA  . ASN D 1 47 ? -28.553 23.061  0.522   1.00 32.17 ? 44  ASN D CA  1 
ATOM   2237 C  C   . ASN D 1 47 ? -29.156 21.655  0.739   1.00 31.84 ? 44  ASN D C   1 
ATOM   2238 O  O   . ASN D 1 47 ? -28.517 20.751  1.293   1.00 28.01 ? 44  ASN D O   1 
ATOM   2239 C  CB  . ASN D 1 47 ? -27.540 23.394  1.589   1.00 39.53 ? 44  ASN D CB  1 
ATOM   2240 C  CG  . ASN D 1 47 ? -26.199 22.927  1.248   1.00 46.84 ? 44  ASN D CG  1 
ATOM   2241 O  OD1 . ASN D 1 47 ? -26.019 21.962  0.479   1.00 47.39 ? 44  ASN D OD1 1 
ATOM   2242 N  ND2 . ASN D 1 47 ? -25.217 23.611  1.798   1.00 52.73 ? 44  ASN D ND2 1 
ATOM   2243 N  N   . SER D 1 48 ? -30.405 21.481  0.334   1.00 31.02 ? 45  SER D N   1 
ATOM   2244 C  CA  . SER D 1 48 ? -31.130 20.248  0.639   1.00 36.04 ? 45  SER D CA  1 
ATOM   2245 C  C   . SER D 1 48 ? -31.486 19.475  -0.629  1.00 33.53 ? 45  SER D C   1 
ATOM   2246 O  O   . SER D 1 48 ? -32.356 18.604  -0.546  1.00 30.25 ? 45  SER D O   1 
ATOM   2247 C  CB  . SER D 1 48 ? -32.456 20.575  1.361   1.00 35.90 ? 45  SER D CB  1 
ATOM   2248 O  OG  . SER D 1 48 ? -32.420 21.830  1.950   1.00 47.01 ? 45  SER D OG  1 
ATOM   2249 N  N   . ARG D 1 49 ? -30.877 19.802  -1.786  1.00 29.35 ? 46  ARG D N   1 
ATOM   2250 C  CA  . ARG D 1 49 ? -31.191 19.102  -3.050  1.00 28.35 ? 46  ARG D CA  1 
ATOM   2251 C  C   . ARG D 1 49 ? -29.912 18.866  -3.840  1.00 27.53 ? 46  ARG D C   1 
ATOM   2252 O  O   . ARG D 1 49 ? -29.074 19.761  -3.956  1.00 28.56 ? 46  ARG D O   1 
ATOM   2253 C  CB  . ARG D 1 49 ? -32.148 19.909  -3.926  1.00 31.04 ? 46  ARG D CB  1 
ATOM   2254 C  CG  . ARG D 1 49 ? -33.543 20.114  -3.332  1.00 35.25 ? 46  ARG D CG  1 
ATOM   2255 C  CD  . ARG D 1 49 ? -34.385 18.828  -3.246  1.00 39.24 ? 46  ARG D CD  1 
ATOM   2256 N  NE  . ARG D 1 49 ? -35.240 18.582  -4.413  1.00 45.40 ? 46  ARG D NE  1 
ATOM   2257 C  CZ  . ARG D 1 49 ? -36.379 19.223  -4.682  1.00 45.86 ? 46  ARG D CZ  1 
ATOM   2258 N  NH1 . ARG D 1 49 ? -36.829 20.206  -3.901  1.00 51.08 ? 46  ARG D NH1 1 
ATOM   2259 N  NH2 . ARG D 1 49 ? -37.042 18.922  -5.781  1.00 50.24 ? 46  ARG D NH2 1 
ATOM   2260 N  N   . ASN D 1 50 ? -29.793 17.687  -4.431  1.00 26.53 ? 47  ASN D N   1 
ATOM   2261 C  CA  . ASN D 1 50 ? -28.583 17.303  -5.198  1.00 31.63 ? 47  ASN D CA  1 
ATOM   2262 C  C   . ASN D 1 50 ? -28.621 17.593  -6.715  1.00 31.19 ? 47  ASN D C   1 
ATOM   2263 O  O   . ASN D 1 50 ? -28.962 16.734  -7.538  1.00 40.89 ? 47  ASN D O   1 
ATOM   2264 C  CB  . ASN D 1 50 ? -28.264 15.830  -5.031  1.00 32.00 ? 47  ASN D CB  1 
ATOM   2265 C  CG  . ASN D 1 50 ? -26.862 15.478  -5.511  1.00 32.40 ? 47  ASN D CG  1 
ATOM   2266 O  OD1 . ASN D 1 50 ? -25.932 16.350  -5.773  1.00 30.34 ? 47  ASN D OD1 1 
ATOM   2267 N  ND2 . ASN D 1 50 ? -26.691 14.204  -5.669  1.00 31.89 ? 47  ASN D ND2 1 
ATOM   2268 N  N   . LEU D 1 51 ? -28.133 18.762  -7.045  1.00 22.33 ? 48  LEU D N   1 
ATOM   2269 C  CA  . LEU D 1 51 ? -28.208 19.406  -8.335  1.00 20.27 ? 48  LEU D CA  1 
ATOM   2270 C  C   . LEU D 1 51 ? -27.312 18.706  -9.388  1.00 17.45 ? 48  LEU D C   1 
ATOM   2271 O  O   . LEU D 1 51 ? -26.159 18.345  -9.104  1.00 18.19 ? 48  LEU D O   1 
ATOM   2272 C  CB  . LEU D 1 51 ? -27.681 20.858  -8.068  1.00 23.45 ? 48  LEU D CB  1 
ATOM   2273 C  CG  . LEU D 1 51 ? -27.478 21.929  -9.123  1.00 25.05 ? 48  LEU D CG  1 
ATOM   2274 C  CD1 . LEU D 1 51 ? -28.807 22.347  -9.665  1.00 29.60 ? 48  LEU D CD1 1 
ATOM   2275 C  CD2 . LEU D 1 51 ? -26.804 23.159  -8.549  1.00 28.65 ? 48  LEU D CD2 1 
ATOM   2276 N  N   . THR D 1 52 ? -27.820 18.618  -10.587 1.00 15.73 ? 49  THR D N   1 
ATOM   2277 C  CA  . THR D 1 52 ? -27.074 18.143  -11.713 1.00 16.30 ? 49  THR D CA  1 
ATOM   2278 C  C   . THR D 1 52 ? -26.426 19.268  -12.484 1.00 17.37 ? 49  THR D C   1 
ATOM   2279 O  O   . THR D 1 52 ? -26.793 20.482  -12.367 1.00 13.69 ? 49  THR D O   1 
ATOM   2280 C  CB  . THR D 1 52 ? -27.927 17.345  -12.722 1.00 16.41 ? 49  THR D CB  1 
ATOM   2281 O  OG1 . THR D 1 52 ? -28.854 18.191  -13.397 1.00 13.49 ? 49  THR D OG1 1 
ATOM   2282 C  CG2 . THR D 1 52 ? -28.722 16.189  -12.051 1.00 17.50 ? 49  THR D CG2 1 
ATOM   2283 N  N   . ILE D 1 53 ? -25.443 18.862  -13.288 1.00 16.07 ? 50  ILE D N   1 
ATOM   2284 C  CA  . ILE D 1 53 ? -24.793 19.796  -14.196 1.00 14.54 ? 50  ILE D CA  1 
ATOM   2285 C  C   . ILE D 1 53 ? -25.773 20.457  -15.131 1.00 13.43 ? 50  ILE D C   1 
ATOM   2286 O  O   . ILE D 1 53 ? -25.686 21.697  -15.320 1.00 11.76 ? 50  ILE D O   1 
ATOM   2287 C  CB  . ILE D 1 53 ? -23.669 19.132  -15.034 1.00 15.92 ? 50  ILE D CB  1 
ATOM   2288 C  CG1 . ILE D 1 53 ? -22.546 18.641  -14.142 1.00 16.94 ? 50  ILE D CG1 1 
ATOM   2289 C  CG2 . ILE D 1 53 ? -23.145 20.114  -16.075 1.00 16.81 ? 50  ILE D CG2 1 
ATOM   2290 C  CD1 . ILE D 1 53 ? -21.911 19.636  -13.215 1.00 18.10 ? 50  ILE D CD1 1 
ATOM   2291 N  N   . LYS D 1 54 ? -26.718 19.709  -15.723 1.00 14.02 ? 51  LYS D N   1 
ATOM   2292 C  CA  . LYS D 1 54 ? -27.678 20.380  -16.646 1.00 13.49 ? 51  LYS D CA  1 
ATOM   2293 C  C   . LYS D 1 54 ? -28.591 21.383  -15.933 1.00 14.56 ? 51  LYS D C   1 
ATOM   2294 O  O   . LYS D 1 54 ? -28.893 22.442  -16.478 1.00 13.73 ? 51  LYS D O   1 
ATOM   2295 C  CB  . LYS D 1 54 ? -28.565 19.409  -17.451 1.00 15.36 ? 51  LYS D CB  1 
ATOM   2296 C  CG  . LYS D 1 54 ? -27.771 18.574  -18.483 1.00 15.59 ? 51  LYS D CG  1 
ATOM   2297 C  CD  . LYS D 1 54 ? -28.593 17.954  -19.639 1.00 16.86 ? 51  LYS D CD  1 
ATOM   2298 C  CE  . LYS D 1 54 ? -29.513 16.904  -19.069 1.00 17.31 ? 51  LYS D CE  1 
ATOM   2299 N  NZ  . LYS D 1 54 ? -30.248 16.016  -20.027 1.00 17.44 ? 51  LYS D NZ  1 
ATOM   2300 N  N   . SER D 1 55 ? -28.986 21.079  -14.690 1.00 14.97 ? 52  SER D N   1 
ATOM   2301 C  CA  . SER D 1 55 ? -29.799 22.042  -13.887 1.00 16.33 ? 52  SER D CA  1 
ATOM   2302 C  C   . SER D 1 55 ? -29.048 23.268  -13.479 1.00 15.26 ? 52  SER D C   1 
ATOM   2303 O  O   . SER D 1 55 ? -29.585 24.383  -13.509 1.00 15.88 ? 52  SER D O   1 
ATOM   2304 C  CB  . SER D 1 55 ? -30.354 21.353  -12.638 1.00 18.04 ? 52  SER D CB  1 
ATOM   2305 O  OG  . SER D 1 55 ? -31.401 20.533  -13.075 1.00 21.45 ? 52  SER D OG  1 
ATOM   2306 N  N   . LEU D 1 56 ? -27.775 23.076  -13.169 1.00 13.28 ? 53  LEU D N   1 
ATOM   2307 C  CA  . LEU D 1 56 ? -26.901 24.169  -12.872 1.00 13.48 ? 53  LEU D CA  1 
ATOM   2308 C  C   . LEU D 1 56 ? -26.772 25.141  -14.062 1.00 12.54 ? 53  LEU D C   1 
ATOM   2309 O  O   . LEU D 1 56 ? -26.864 26.352  -13.890 1.00 11.38 ? 53  LEU D O   1 
ATOM   2310 C  CB  . LEU D 1 56 ? -25.555 23.635  -12.434 1.00 12.90 ? 53  LEU D CB  1 
ATOM   2311 C  CG  . LEU D 1 56 ? -24.515 24.741  -12.225 1.00 13.98 ? 53  LEU D CG  1 
ATOM   2312 C  CD1 . LEU D 1 56 ? -24.944 25.724  -11.128 1.00 14.17 ? 53  LEU D CD1 1 
ATOM   2313 C  CD2 . LEU D 1 56 ? -23.174 24.218  -11.836 1.00 14.29 ? 53  LEU D CD2 1 
ATOM   2314 N  N   . GLU D 1 57 ? -26.591 24.599  -15.257 1.00 12.65 ? 54  GLU D N   1 
ATOM   2315 C  CA  . GLU D 1 57 ? -26.558 25.404  -16.445 1.00 13.75 ? 54  GLU D CA  1 
ATOM   2316 C  C   . GLU D 1 57 ? -27.877 26.203  -16.652 1.00 12.95 ? 54  GLU D C   1 
ATOM   2317 O  O   . GLU D 1 57 ? -27.830 27.338  -17.080 1.00 12.85 ? 54  GLU D O   1 
ATOM   2318 C  CB  . GLU D 1 57 ? -26.277 24.536  -17.689 1.00 13.85 ? 54  GLU D CB  1 
ATOM   2319 C  CG  . GLU D 1 57 ? -26.059 25.302  -18.939 1.00 15.61 ? 54  GLU D CG  1 
ATOM   2320 C  CD  . GLU D 1 57 ? -25.648 24.412  -20.077 1.00 15.96 ? 54  GLU D CD  1 
ATOM   2321 O  OE1 . GLU D 1 57 ? -24.618 24.731  -20.740 1.00 15.69 ? 54  GLU D OE1 1 
ATOM   2322 O  OE2 . GLU D 1 57 ? -26.339 23.400  -20.264 1.00 18.11 ? 54  GLU D OE2 1 
ATOM   2323 N  N   . LEU D 1 58 ? -29.023 25.579  -16.389 1.00 14.52 ? 55  LEU D N   1 
ATOM   2324 C  CA  . LEU D 1 58 ? -30.328 26.289  -16.512 1.00 15.24 ? 55  LEU D CA  1 
ATOM   2325 C  C   . LEU D 1 58 ? -30.351 27.454  -15.536 1.00 14.03 ? 55  LEU D C   1 
ATOM   2326 O  O   . LEU D 1 58 ? -30.820 28.509  -15.858 1.00 14.27 ? 55  LEU D O   1 
ATOM   2327 C  CB  . LEU D 1 58 ? -31.493 25.365  -16.210 1.00 16.48 ? 55  LEU D CB  1 
ATOM   2328 C  CG  . LEU D 1 58 ? -31.802 24.346  -17.333 1.00 19.80 ? 55  LEU D CG  1 
ATOM   2329 C  CD1 . LEU D 1 58 ? -32.941 23.408  -16.940 1.00 21.73 ? 55  LEU D CD1 1 
ATOM   2330 C  CD2 . LEU D 1 58 ? -32.145 25.066  -18.659 1.00 21.56 ? 55  LEU D CD2 1 
ATOM   2331 N  N   . ILE D 1 59 ? -29.833 27.256  -14.337 1.00 14.25 ? 56  ILE D N   1 
ATOM   2332 C  CA  . ILE D 1 59 ? -29.792 28.317  -13.314 1.00 14.58 ? 56  ILE D CA  1 
ATOM   2333 C  C   . ILE D 1 59 ? -28.850 29.458  -13.743 1.00 13.59 ? 56  ILE D C   1 
ATOM   2334 O  O   . ILE D 1 59 ? -29.219 30.610  -13.684 1.00 12.72 ? 56  ILE D O   1 
ATOM   2335 C  CB  . ILE D 1 59 ? -29.433 27.704  -11.952 1.00 15.13 ? 56  ILE D CB  1 
ATOM   2336 C  CG1 . ILE D 1 59 ? -30.614 26.850  -11.405 1.00 16.50 ? 56  ILE D CG1 1 
ATOM   2337 C  CG2 . ILE D 1 59 ? -28.989 28.784  -11.003 1.00 16.08 ? 56  ILE D CG2 1 
ATOM   2338 C  CD1 . ILE D 1 59 ? -30.214 26.076  -10.176 1.00 18.97 ? 56  ILE D CD1 1 
ATOM   2339 N  N   . MET D 1 60 ? -27.671 29.128  -14.271 1.00 12.53 ? 57  MET D N   1 
ATOM   2340 C  CA  . MET D 1 60 ? -26.760 30.127  -14.793 1.00 13.87 ? 57  MET D CA  1 
ATOM   2341 C  C   . MET D 1 60 ? -27.377 30.927  -15.928 1.00 13.41 ? 57  MET D C   1 
ATOM   2342 O  O   . MET D 1 60 ? -27.192 32.159  -15.962 1.00 13.73 ? 57  MET D O   1 
ATOM   2343 C  CB  . MET D 1 60 ? -25.431 29.463  -15.235 1.00 16.27 ? 57  MET D CB  1 
ATOM   2344 C  CG  . MET D 1 60 ? -24.736 28.813  -14.062 1.00 19.98 ? 57  MET D CG  1 
ATOM   2345 S  SD  . MET D 1 60 ? -23.337 27.746  -14.623 1.00 30.79 ? 57  MET D SD  1 
ATOM   2346 C  CE  . MET D 1 60 ? -22.412 29.091  -15.188 1.00 26.70 ? 57  MET D CE  1 
ATOM   2347 N  N   . LYS D 1 61 ? -28.139 30.256  -16.803 1.00 14.12 ? 58  LYS D N   1 
ATOM   2348 C  CA  . LYS D 1 61 ? -28.823 30.950  -17.911 1.00 14.88 ? 58  LYS D CA  1 
ATOM   2349 C  C   . LYS D 1 61 ? -29.922 31.932  -17.356 1.00 15.36 ? 58  LYS D C   1 
ATOM   2350 O  O   . LYS D 1 61 ? -30.029 33.087  -17.773 1.00 16.89 ? 58  LYS D O   1 
ATOM   2351 C  CB  . LYS D 1 61 ? -29.471 29.927  -18.885 1.00 15.99 ? 58  LYS D CB  1 
ATOM   2352 C  CG  . LYS D 1 61 ? -28.455 29.318  -19.826 1.00 19.72 ? 58  LYS D CG  1 
ATOM   2353 C  CD  . LYS D 1 61 ? -28.999 28.128  -20.584 1.00 24.72 ? 58  LYS D CD  1 
ATOM   2354 C  CE  . LYS D 1 61 ? -27.893 27.591  -21.483 1.00 29.27 ? 58  LYS D CE  1 
ATOM   2355 N  NZ  . LYS D 1 61 ? -28.538 27.028  -22.667 1.00 37.24 ? 58  LYS D NZ  1 
ATOM   2356 N  N   . GLY D 1 62 ? -30.666 31.445  -16.372 1.00 16.09 ? 59  GLY D N   1 
ATOM   2357 C  CA  . GLY D 1 62 ? -31.670 32.218  -15.642 1.00 15.42 ? 59  GLY D CA  1 
ATOM   2358 C  C   . GLY D 1 62 ? -31.091 33.427  -14.925 1.00 16.86 ? 59  GLY D C   1 
ATOM   2359 O  O   . GLY D 1 62 ? -31.733 34.476  -14.835 1.00 17.25 ? 59  GLY D O   1 
ATOM   2360 N  N   . LEU D 1 63 ? -29.906 33.276  -14.363 1.00 13.91 ? 60  LEU D N   1 
ATOM   2361 C  CA  . LEU D 1 63 ? -29.232 34.362  -13.757 1.00 14.44 ? 60  LEU D CA  1 
ATOM   2362 C  C   . LEU D 1 63 ? -28.546 35.319  -14.743 1.00 15.70 ? 60  LEU D C   1 
ATOM   2363 O  O   . LEU D 1 63 ? -28.083 36.395  -14.315 1.00 13.91 ? 60  LEU D O   1 
ATOM   2364 C  CB  . LEU D 1 63 ? -28.218 33.888  -12.735 1.00 14.17 ? 60  LEU D CB  1 
ATOM   2365 C  CG  . LEU D 1 63 ? -28.744 33.141  -11.487 1.00 15.12 ? 60  LEU D CG  1 
ATOM   2366 C  CD1 . LEU D 1 63 ? -27.597 32.394  -10.823 1.00 15.46 ? 60  LEU D CD1 1 
ATOM   2367 C  CD2 . LEU D 1 63 ? -29.356 34.129  -10.497 1.00 16.43 ? 60  LEU D CD2 1 
ATOM   2368 N  N   . GLU D 1 64 ? -28.411 34.891  -15.993 1.00 14.94 ? 61  GLU D N   1 
ATOM   2369 C  CA  . GLU D 1 64 ? -27.579 35.596  -17.000 1.00 16.56 ? 61  GLU D CA  1 
ATOM   2370 C  C   . GLU D 1 64 ? -26.153 35.886  -16.549 1.00 15.75 ? 61  GLU D C   1 
ATOM   2371 O  O   . GLU D 1 64 ? -25.607 36.964  -16.752 1.00 16.12 ? 61  GLU D O   1 
ATOM   2372 C  CB  . GLU D 1 64 ? -28.302 36.869  -17.478 1.00 20.10 ? 61  GLU D CB  1 
ATOM   2373 C  CG  . GLU D 1 64 ? -29.762 36.577  -17.754 1.00 24.47 ? 61  GLU D CG  1 
ATOM   2374 C  CD  . GLU D 1 64 ? -30.615 37.834  -17.963 1.00 35.82 ? 61  GLU D CD  1 
ATOM   2375 O  OE1 . GLU D 1 64 ? -30.617 38.771  -17.105 1.00 44.54 ? 61  GLU D OE1 1 
ATOM   2376 O  OE2 . GLU D 1 64 ? -31.315 37.860  -18.995 1.00 43.51 ? 61  GLU D OE2 1 
ATOM   2377 N  N   . VAL D 1 65 ? -25.528 34.876  -15.971 1.00 13.61 ? 62  VAL D N   1 
ATOM   2378 C  CA  . VAL D 1 65 ? -24.191 34.970  -15.533 1.00 13.94 ? 62  VAL D CA  1 
ATOM   2379 C  C   . VAL D 1 65 ? -23.349 34.094  -16.479 1.00 12.75 ? 62  VAL D C   1 
ATOM   2380 O  O   . VAL D 1 65 ? -23.777 33.005  -16.875 1.00 11.48 ? 62  VAL D O   1 
ATOM   2381 C  CB  . VAL D 1 65 ? -24.029 34.526  -14.054 1.00 14.05 ? 62  VAL D CB  1 
ATOM   2382 C  CG1 . VAL D 1 65 ? -24.301 33.076  -13.859 1.00 13.86 ? 62  VAL D CG1 1 
ATOM   2383 C  CG2 . VAL D 1 65 ? -22.605 34.771  -13.595 1.00 14.53 ? 62  VAL D CG2 1 
ATOM   2384 N  N   . SER D 1 66 ? -22.206 34.599  -16.909 1.00 12.43 ? 63  SER D N   1 
ATOM   2385 C  CA  . SER D 1 66 ? -21.344 33.785  -17.740 1.00 13.33 ? 63  SER D CA  1 
ATOM   2386 C  C   . SER D 1 66 ? -20.796 32.580  -17.015 1.00 13.74 ? 63  SER D C   1 
ATOM   2387 O  O   . SER D 1 66 ? -20.528 32.650  -15.801 1.00 12.00 ? 63  SER D O   1 
ATOM   2388 C  CB  . SER D 1 66 ? -20.188 34.564  -18.323 1.00 16.68 ? 63  SER D CB  1 
ATOM   2389 O  OG  . SER D 1 66 ? -19.115 34.582  -17.482 1.00 21.52 ? 63  SER D OG  1 
ATOM   2390 N  N   . ASP D 1 67 ? -20.652 31.468  -17.749 1.00 14.66 ? 64  ASP D N   1 
ATOM   2391 C  CA  . ASP D 1 67 ? -20.122 30.258  -17.131 1.00 16.16 ? 64  ASP D CA  1 
ATOM   2392 C  C   . ASP D 1 67 ? -18.750 30.543  -16.431 1.00 14.68 ? 64  ASP D C   1 
ATOM   2393 O  O   . ASP D 1 67 ? -18.523 30.184  -15.260 1.00 14.21 ? 64  ASP D O   1 
ATOM   2394 C  CB  . ASP D 1 67 ? -19.962 29.164  -18.181 1.00 18.97 ? 64  ASP D CB  1 
ATOM   2395 C  CG  . ASP D 1 67 ? -21.300 28.768  -18.933 1.00 23.59 ? 64  ASP D CG  1 
ATOM   2396 O  OD1 . ASP D 1 67 ? -22.425 29.044  -18.547 1.00 24.55 ? 64  ASP D OD1 1 
ATOM   2397 O  OD2 . ASP D 1 67 ? -21.197 28.113  -19.967 1.00 33.04 ? 64  ASP D OD2 1 
ATOM   2398 N  N   . VAL D 1 68 ? -17.842 31.197  -17.132 1.00 14.13 ? 65  VAL D N   1 
ATOM   2399 C  CA  . VAL D 1 68 ? -16.490 31.436  -16.567 1.00 15.35 ? 65  VAL D CA  1 
ATOM   2400 C  C   . VAL D 1 68 ? -16.615 32.253  -15.258 1.00 16.70 ? 65  VAL D C   1 
ATOM   2401 O  O   . VAL D 1 68 ? -15.978 31.919  -14.222 1.00 15.66 ? 65  VAL D O   1 
ATOM   2402 C  CB  . VAL D 1 68 ? -15.564 32.129  -17.586 1.00 17.18 ? 65  VAL D CB  1 
ATOM   2403 C  CG1 . VAL D 1 68 ? -14.335 32.665  -16.894 1.00 20.20 ? 65  VAL D CG1 1 
ATOM   2404 C  CG2 . VAL D 1 68 ? -15.196 31.140  -18.701 1.00 19.24 ? 65  VAL D CG2 1 
ATOM   2405 N  N   . VAL D 1 69 ? -17.506 33.257  -15.262 1.00 16.54 ? 66  VAL D N   1 
ATOM   2406 C  CA  . VAL D 1 69 ? -17.654 34.109  -14.067 1.00 16.48 ? 66  VAL D CA  1 
ATOM   2407 C  C   . VAL D 1 69 ? -18.203 33.294  -12.914 1.00 16.01 ? 66  VAL D C   1 
ATOM   2408 O  O   . VAL D 1 69 ? -17.710 33.405  -11.764 1.00 15.28 ? 66  VAL D O   1 
ATOM   2409 C  CB  . VAL D 1 69 ? -18.518 35.382  -14.370 1.00 16.96 ? 66  VAL D CB  1 
ATOM   2410 C  CG1 . VAL D 1 69 ? -18.960 36.092  -13.121 1.00 17.08 ? 66  VAL D CG1 1 
ATOM   2411 C  CG2 . VAL D 1 69 ? -17.745 36.374  -15.291 1.00 18.60 ? 66  VAL D CG2 1 
ATOM   2412 N  N   . PHE D 1 70 ? -19.198 32.443  -13.182 1.00 12.97 ? 67  PHE D N   1 
ATOM   2413 C  CA  . PHE D 1 70 ? -19.761 31.631  -12.124 1.00 12.81 ? 67  PHE D CA  1 
ATOM   2414 C  C   . PHE D 1 70 ? -18.672 30.756  -11.443 1.00 13.14 ? 67  PHE D C   1 
ATOM   2415 O  O   . PHE D 1 70 ? -18.574 30.733  -10.218 1.00 13.05 ? 67  PHE D O   1 
ATOM   2416 C  CB  . PHE D 1 70 ? -20.947 30.751  -12.657 1.00 13.42 ? 67  PHE D CB  1 
ATOM   2417 C  CG  . PHE D 1 70 ? -21.545 29.906  -11.588 1.00 14.47 ? 67  PHE D CG  1 
ATOM   2418 C  CD1 . PHE D 1 70 ? -20.951 28.714  -11.237 1.00 13.78 ? 67  PHE D CD1 1 
ATOM   2419 C  CD2 . PHE D 1 70 ? -22.689 30.342  -10.893 1.00 13.95 ? 67  PHE D CD2 1 
ATOM   2420 C  CE1 . PHE D 1 70 ? -21.439 27.947  -10.167 1.00 14.89 ? 67  PHE D CE1 1 
ATOM   2421 C  CE2 . PHE D 1 70 ? -23.180 29.571  -9.841  1.00 14.49 ? 67  PHE D CE2 1 
ATOM   2422 C  CZ  . PHE D 1 70 ? -22.568 28.390  -9.481  1.00 14.00 ? 67  PHE D CZ  1 
ATOM   2423 N  N   . PHE D 1 71 ? -17.837 30.121  -12.254 1.00 12.74 ? 68  PHE D N   1 
ATOM   2424 C  CA  . PHE D 1 71 ? -16.779 29.222  -11.740 1.00 14.23 ? 68  PHE D CA  1 
ATOM   2425 C  C   . PHE D 1 71 ? -15.639 29.993  -11.060 1.00 14.82 ? 68  PHE D C   1 
ATOM   2426 O  O   . PHE D 1 71 ? -15.096 29.508  -10.093 1.00 15.03 ? 68  PHE D O   1 
ATOM   2427 C  CB  . PHE D 1 71 ? -16.313 28.242  -12.809 1.00 13.60 ? 68  PHE D CB  1 
ATOM   2428 C  CG  . PHE D 1 71 ? -17.384 27.285  -13.214 1.00 14.24 ? 68  PHE D CG  1 
ATOM   2429 C  CD1 . PHE D 1 71 ? -17.941 26.452  -12.296 1.00 15.39 ? 68  PHE D CD1 1 
ATOM   2430 C  CD2 . PHE D 1 71 ? -17.897 27.276  -14.478 1.00 14.26 ? 68  PHE D CD2 1 
ATOM   2431 C  CE1 . PHE D 1 71 ? -18.953 25.590  -12.619 1.00 17.18 ? 68  PHE D CE1 1 
ATOM   2432 C  CE2 . PHE D 1 71 ? -18.899 26.421  -14.843 1.00 14.11 ? 68  PHE D CE2 1 
ATOM   2433 C  CZ  . PHE D 1 71 ? -19.466 25.587  -13.923 1.00 16.04 ? 68  PHE D CZ  1 
ATOM   2434 N  N   . GLU D 1 72 ? -15.384 31.231  -11.485 1.00 17.22 ? 69  GLU D N   1 
ATOM   2435 C  CA  . GLU D 1 72 ? -14.430 32.089  -10.784 1.00 17.77 ? 69  GLU D CA  1 
ATOM   2436 C  C   . GLU D 1 72 ? -14.919 32.443  -9.383  1.00 17.05 ? 69  GLU D C   1 
ATOM   2437 O  O   . GLU D 1 72 ? -14.157 32.378  -8.450  1.00 17.68 ? 69  GLU D O   1 
ATOM   2438 C  CB  . GLU D 1 72 ? -14.075 33.339  -11.581 1.00 21.02 ? 69  GLU D CB  1 
ATOM   2439 C  CG  . GLU D 1 72 ? -13.243 33.009  -12.807 1.00 27.83 ? 69  GLU D CG  1 
ATOM   2440 C  CD  . GLU D 1 72 ? -12.944 34.223  -13.693 1.00 36.77 ? 69  GLU D CD  1 
ATOM   2441 O  OE1 . GLU D 1 72 ? -13.849 35.073  -13.892 1.00 42.40 ? 69  GLU D OE1 1 
ATOM   2442 O  OE2 . GLU D 1 72 ? -11.809 34.312  -14.215 1.00 42.02 ? 69  GLU D OE2 1 
ATOM   2443 N  N   . MET D 1 73 ? -16.172 32.814  -9.266  1.00 15.22 ? 70  MET D N   1 
ATOM   2444 C  CA  . MET D 1 73 ? -16.815 33.037  -8.004  1.00 17.70 ? 70  MET D CA  1 
ATOM   2445 C  C   . MET D 1 73 ? -16.822 31.809  -7.125  1.00 16.62 ? 70  MET D C   1 
ATOM   2446 O  O   . MET D 1 73 ? -16.562 31.921  -5.924  1.00 14.78 ? 70  MET D O   1 
ATOM   2447 C  CB  . MET D 1 73 ? -18.258 33.522  -8.217  1.00 19.00 ? 70  MET D CB  1 
ATOM   2448 C  CG  . MET D 1 73 ? -18.332 34.888  -8.895  1.00 20.20 ? 70  MET D CG  1 
ATOM   2449 S  SD  . MET D 1 73 ? -20.057 35.482  -9.081  1.00 23.30 ? 70  MET D SD  1 
ATOM   2450 C  CE  . MET D 1 73 ? -20.505 35.892  -7.388  1.00 22.63 ? 70  MET D CE  1 
ATOM   2451 N  N   . LEU D 1 74 ? -17.098 30.634  -7.720  1.00 14.46 ? 71  LEU D N   1 
ATOM   2452 C  CA  . LEU D 1 74 ? -17.083 29.359  -6.979  1.00 14.18 ? 71  LEU D CA  1 
ATOM   2453 C  C   . LEU D 1 74 ? -15.680 29.078  -6.391  1.00 15.03 ? 71  LEU D C   1 
ATOM   2454 O  O   . LEU D 1 74 ? -15.550 28.713  -5.214  1.00 15.81 ? 71  LEU D O   1 
ATOM   2455 C  CB  . LEU D 1 74 ? -17.508 28.208  -7.926  1.00 14.14 ? 71  LEU D CB  1 
ATOM   2456 C  CG  . LEU D 1 74 ? -17.530 26.807  -7.304  1.00 13.98 ? 71  LEU D CG  1 
ATOM   2457 C  CD1 . LEU D 1 74 ? -18.498 26.900  -6.129  1.00 14.79 ? 71  LEU D CD1 1 
ATOM   2458 C  CD2 . LEU D 1 74 ? -17.950 25.693  -8.294  1.00 14.97 ? 71  LEU D CD2 1 
ATOM   2459 N  N   . ILE D 1 75 ? -14.660 29.272  -7.208  1.00 15.23 ? 72  ILE D N   1 
ATOM   2460 C  CA  . ILE D 1 75 ? -13.311 29.079  -6.769  1.00 17.59 ? 72  ILE D CA  1 
ATOM   2461 C  C   . ILE D 1 75 ? -13.004 30.003  -5.564  1.00 19.62 ? 72  ILE D C   1 
ATOM   2462 O  O   . ILE D 1 75 ? -12.517 29.535  -4.537  1.00 17.76 ? 72  ILE D O   1 
ATOM   2463 C  CB  . ILE D 1 75 ? -12.333 29.286  -7.905  1.00 16.20 ? 72  ILE D CB  1 
ATOM   2464 C  CG1 . ILE D 1 75 ? -12.413 28.054  -8.806  1.00 16.15 ? 72  ILE D CG1 1 
ATOM   2465 C  CG2 . ILE D 1 75 ? -10.903 29.508  -7.379  1.00 16.87 ? 72  ILE D CG2 1 
ATOM   2466 C  CD1 . ILE D 1 75 ? -11.808 28.266  -10.214 1.00 15.11 ? 72  ILE D CD1 1 
ATOM   2467 N  N   . LYS D 1 76 ? -13.357 31.275  -5.690  1.00 20.41 ? 73  LYS D N   1 
ATOM   2468 C  CA  . LYS D 1 76 ? -13.157 32.241  -4.585  1.00 23.91 ? 73  LYS D CA  1 
ATOM   2469 C  C   . LYS D 1 76 ? -13.788 31.840  -3.307  1.00 21.40 ? 73  LYS D C   1 
ATOM   2470 O  O   . LYS D 1 76 ? -13.175 31.879  -2.224  1.00 21.46 ? 73  LYS D O   1 
ATOM   2471 C  CB  . LYS D 1 76 ? -13.673 33.584  -4.994  1.00 27.41 ? 73  LYS D CB  1 
ATOM   2472 C  CG  . LYS D 1 76 ? -12.822 34.111  -6.122  1.00 31.48 ? 73  LYS D CG  1 
ATOM   2473 C  CD  . LYS D 1 76 ? -13.468 35.310  -6.771  1.00 38.46 ? 73  LYS D CD  1 
ATOM   2474 C  CE  . LYS D 1 76 ? -12.907 36.579  -6.192  1.00 40.39 ? 73  LYS D CE  1 
ATOM   2475 N  NZ  . LYS D 1 76 ? -11.571 36.759  -6.808  1.00 44.90 ? 73  LYS D NZ  1 
ATOM   2476 N  N   . GLU D 1 77 ? -14.989 31.330  -3.410  1.00 19.82 ? 74  GLU D N   1 
ATOM   2477 C  CA  . GLU D 1 77 ? -15.706 30.906  -2.257  1.00 23.18 ? 74  GLU D CA  1 
ATOM   2478 C  C   . GLU D 1 77 ? -15.088 29.634  -1.590  1.00 23.73 ? 74  GLU D C   1 
ATOM   2479 O  O   . GLU D 1 77 ? -15.002 29.542  -0.327  1.00 21.47 ? 74  GLU D O   1 
ATOM   2480 C  CB  . GLU D 1 77 ? -17.133 30.643  -2.678  1.00 28.00 ? 74  GLU D CB  1 
ATOM   2481 C  CG  . GLU D 1 77 ? -18.172 30.967  -1.678  1.00 34.87 ? 74  GLU D CG  1 
ATOM   2482 C  CD  . GLU D 1 77 ? -18.054 32.362  -1.068  1.00 33.81 ? 74  GLU D CD  1 
ATOM   2483 O  OE1 . GLU D 1 77 ? -17.965 33.421  -1.755  1.00 38.23 ? 74  GLU D OE1 1 
ATOM   2484 O  OE2 . GLU D 1 77 ? -18.077 32.338  0.147   1.00 38.75 ? 74  GLU D OE2 1 
ATOM   2485 N  N   . ILE D 1 78 ? -14.640 28.708  -2.424  1.00 20.50 ? 75  ILE D N   1 
ATOM   2486 C  CA  . ILE D 1 78 ? -13.902 27.497  -1.974  1.00 21.39 ? 75  ILE D CA  1 
ATOM   2487 C  C   . ILE D 1 78 ? -12.617 27.896  -1.226  1.00 22.87 ? 75  ILE D C   1 
ATOM   2488 O  O   . ILE D 1 78 ? -12.344 27.374  -0.119  1.00 25.29 ? 75  ILE D O   1 
ATOM   2489 C  CB  . ILE D 1 78 ? -13.576 26.546  -3.157  1.00 20.78 ? 75  ILE D CB  1 
ATOM   2490 C  CG1 . ILE D 1 78 ? -14.855 25.885  -3.638  1.00 20.12 ? 75  ILE D CG1 1 
ATOM   2491 C  CG2 . ILE D 1 78 ? -12.524 25.480  -2.732  1.00 22.37 ? 75  ILE D CG2 1 
ATOM   2492 C  CD1 . ILE D 1 78 ? -14.745 25.202  -5.001  1.00 20.21 ? 75  ILE D CD1 1 
ATOM   2493 N  N   . LEU D 1 79 ? -11.890 28.847  -1.788  1.00 23.46 ? 76  LEU D N   1 
ATOM   2494 C  CA  . LEU D 1 79 ? -10.612 29.306  -1.244  1.00 27.71 ? 76  LEU D CA  1 
ATOM   2495 C  C   . LEU D 1 79 ? -10.727 30.060  0.090   1.00 34.03 ? 76  LEU D C   1 
ATOM   2496 O  O   . LEU D 1 79 ? -9.740  30.157  0.826   1.00 33.87 ? 76  LEU D O   1 
ATOM   2497 C  CB  . LEU D 1 79 ? -9.862  30.187  -2.255  1.00 26.81 ? 76  LEU D CB  1 
ATOM   2498 C  CG  . LEU D 1 79 ? -9.413  29.388  -3.482  1.00 28.29 ? 76  LEU D CG  1 
ATOM   2499 C  CD1 . LEU D 1 79 ? -8.781  30.253  -4.553  1.00 27.08 ? 76  LEU D CD1 1 
ATOM   2500 C  CD2 . LEU D 1 79 ? -8.438  28.305  -3.061  1.00 31.63 ? 76  LEU D CD2 1 
ATOM   2501 N  N   . LYS D 1 80 ? -11.913 30.560  0.397   1.00 36.13 ? 77  LYS D N   1 
ATOM   2502 C  CA  . LYS D 1 80 ? -12.229 31.101  1.723   1.00 44.70 ? 77  LYS D CA  1 
ATOM   2503 C  C   . LYS D 1 80 ? -11.962 30.082  2.807   1.00 46.26 ? 77  LYS D C   1 
ATOM   2504 O  O   . LYS D 1 80 ? -11.587 30.430  3.914   1.00 44.72 ? 77  LYS D O   1 
ATOM   2505 C  CB  . LYS D 1 80 ? -13.709 31.429  1.816   1.00 48.01 ? 77  LYS D CB  1 
ATOM   2506 C  CG  . LYS D 1 80 ? -14.030 32.872  2.052   1.00 54.33 ? 77  LYS D CG  1 
ATOM   2507 C  CD  . LYS D 1 80 ? -14.074 33.680  0.781   1.00 56.72 ? 77  LYS D CD  1 
ATOM   2508 C  CE  . LYS D 1 80 ? -15.299 34.579  0.828   1.00 58.67 ? 77  LYS D CE  1 
ATOM   2509 N  NZ  . LYS D 1 80 ? -15.169 35.622  -0.212  1.00 64.48 ? 77  LYS D NZ  1 
ATOM   2510 N  N   . HIS D 1 81 ? -12.220 28.821  2.491   1.00 51.32 ? 78  HIS D N   1 
ATOM   2511 C  CA  . HIS D 1 81 ? -11.924 27.713  3.385   1.00 54.16 ? 78  HIS D CA  1 
ATOM   2512 C  C   . HIS D 1 81 ? -10.480 27.260  3.266   1.00 50.57 ? 78  HIS D C   1 
ATOM   2513 O  O   . HIS D 1 81 ? -9.932  26.792  4.241   1.00 56.87 ? 78  HIS D O   1 
ATOM   2514 C  CB  . HIS D 1 81 ? -12.875 26.554  3.103   1.00 55.85 ? 78  HIS D CB  1 
ATOM   2515 C  CG  . HIS D 1 81 ? -14.254 26.807  3.597   1.00 58.88 ? 78  HIS D CG  1 
ATOM   2516 N  ND1 . HIS D 1 81 ? -14.958 25.889  4.344   1.00 59.43 ? 78  HIS D ND1 1 
ATOM   2517 C  CD2 . HIS D 1 81 ? -15.038 27.905  3.509   1.00 62.66 ? 78  HIS D CD2 1 
ATOM   2518 C  CE1 . HIS D 1 81 ? -16.133 26.394  4.664   1.00 59.28 ? 78  HIS D CE1 1 
ATOM   2519 N  NE2 . HIS D 1 81 ? -16.200 27.623  4.184   1.00 63.97 ? 78  HIS D NE2 1 
ATOM   2520 N  N   . SER E 1 6  ? -0.537  22.939  -45.962 1.00 26.10 ? 3   SER E N   1 
ATOM   2521 C  CA  . SER E 1 6  ? -1.241  23.861  -46.888 1.00 21.26 ? 3   SER E CA  1 
ATOM   2522 C  C   . SER E 1 6  ? -2.695  24.032  -46.469 1.00 19.58 ? 3   SER E C   1 
ATOM   2523 O  O   . SER E 1 6  ? -3.470  23.056  -46.411 1.00 18.11 ? 3   SER E O   1 
ATOM   2524 C  CB  . SER E 1 6  ? -1.152  23.372  -48.330 1.00 20.88 ? 3   SER E CB  1 
ATOM   2525 O  OG  . SER E 1 6  ? -2.178  23.965  -49.229 1.00 18.79 ? 3   SER E OG  1 
ATOM   2526 N  N   . PHE E 1 7  ? -3.073  25.283  -46.228 1.00 17.24 ? 4   PHE E N   1 
ATOM   2527 C  CA  . PHE E 1 7  ? -4.445  25.657  -46.034 1.00 17.46 ? 4   PHE E CA  1 
ATOM   2528 C  C   . PHE E 1 7  ? -5.389  25.133  -47.166 1.00 16.42 ? 4   PHE E C   1 
ATOM   2529 O  O   . PHE E 1 7  ? -6.394  24.473  -46.897 1.00 13.74 ? 4   PHE E O   1 
ATOM   2530 C  CB  . PHE E 1 7  ? -4.570  27.165  -45.947 1.00 15.33 ? 4   PHE E CB  1 
ATOM   2531 C  CG  . PHE E 1 7  ? -5.965  27.634  -45.820 1.00 17.22 ? 4   PHE E CG  1 
ATOM   2532 C  CD1 . PHE E 1 7  ? -6.626  27.550  -44.610 1.00 17.48 ? 4   PHE E CD1 1 
ATOM   2533 C  CD2 . PHE E 1 7  ? -6.620  28.190  -46.900 1.00 17.55 ? 4   PHE E CD2 1 
ATOM   2534 C  CE1 . PHE E 1 7  ? -7.921  28.029  -44.502 1.00 17.45 ? 4   PHE E CE1 1 
ATOM   2535 C  CE2 . PHE E 1 7  ? -7.913  28.676  -46.781 1.00 19.00 ? 4   PHE E CE2 1 
ATOM   2536 C  CZ  . PHE E 1 7  ? -8.571  28.583  -45.574 1.00 18.22 ? 4   PHE E CZ  1 
ATOM   2537 N  N   . LEU E 1 8  ? -5.105  25.509  -48.426 1.00 15.85 ? 5   LEU E N   1 
ATOM   2538 C  CA  . LEU E 1 8  ? -6.029  25.119  -49.540 1.00 16.45 ? 5   LEU E CA  1 
ATOM   2539 C  C   . LEU E 1 8  ? -6.180  23.614  -49.663 1.00 14.15 ? 5   LEU E C   1 
ATOM   2540 O  O   . LEU E 1 8  ? -7.295  23.102  -49.888 1.00 15.42 ? 5   LEU E O   1 
ATOM   2541 C  CB  . LEU E 1 8  ? -5.471  25.613  -50.879 1.00 16.63 ? 5   LEU E CB  1 
ATOM   2542 C  CG  . LEU E 1 8  ? -6.423  26.027  -52.014 1.00 18.41 ? 5   LEU E CG  1 
ATOM   2543 C  CD1 . LEU E 1 8  ? -5.825  25.891  -53.420 1.00 17.29 ? 5   LEU E CD1 1 
ATOM   2544 C  CD2 . LEU E 1 8  ? -7.900  25.867  -51.913 1.00 18.13 ? 5   LEU E CD2 1 
ATOM   2545 N  N   . LEU E 1 9  ? -5.058  22.913  -49.565 1.00 15.50 ? 6   LEU E N   1 
ATOM   2546 C  CA  . LEU E 1 9  ? -5.074  21.447  -49.551 1.00 16.14 ? 6   LEU E CA  1 
ATOM   2547 C  C   . LEU E 1 9  ? -5.933  20.845  -48.406 1.00 17.83 ? 6   LEU E C   1 
ATOM   2548 O  O   . LEU E 1 9  ? -6.691  19.876  -48.626 1.00 14.18 ? 6   LEU E O   1 
ATOM   2549 C  CB  . LEU E 1 9  ? -3.682  20.852  -49.540 1.00 19.02 ? 6   LEU E CB  1 
ATOM   2550 C  CG  . LEU E 1 9  ? -3.511  19.307  -49.473 1.00 21.70 ? 6   LEU E CG  1 
ATOM   2551 C  CD1 . LEU E 1 9  ? -3.982  18.683  -50.785 1.00 23.74 ? 6   LEU E CD1 1 
ATOM   2552 C  CD2 . LEU E 1 9  ? -2.045  18.881  -49.180 1.00 23.90 ? 6   LEU E CD2 1 
ATOM   2553 N  N   . SER E 1 10 ? -5.883  21.455  -47.221 1.00 16.90 ? 7   SER E N   1 
ATOM   2554 C  CA  . SER E 1 10 ? -6.671  20.964  -46.088 1.00 17.97 ? 7   SER E CA  1 
ATOM   2555 C  C   . SER E 1 10 ? -8.158  21.199  -46.367 1.00 18.04 ? 7   SER E C   1 
ATOM   2556 O  O   . SER E 1 10 ? -9.011  20.399  -45.967 1.00 17.49 ? 7   SER E O   1 
ATOM   2557 C  CB  . SER E 1 10 ? -6.256  21.639  -44.735 1.00 18.98 ? 7   SER E CB  1 
ATOM   2558 O  OG  . SER E 1 10 ? -6.634  23.022  -44.748 1.00 20.01 ? 7   SER E OG  1 
ATOM   2559 N  N   . LYS E 1 11 ? -8.483  22.283  -47.058 1.00 15.63 ? 8   LYS E N   1 
ATOM   2560 C  CA  . LYS E 1 11 ? -9.861  22.512  -47.368 1.00 16.08 ? 8   LYS E CA  1 
ATOM   2561 C  C   . LYS E 1 11 ? -10.366 21.580  -48.479 1.00 15.59 ? 8   LYS E C   1 
ATOM   2562 O  O   . LYS E 1 11 ? -11.515 21.112  -48.406 1.00 16.71 ? 8   LYS E O   1 
ATOM   2563 C  CB  . LYS E 1 11 ? -10.157 23.978  -47.679 1.00 16.67 ? 8   LYS E CB  1 
ATOM   2564 C  CG  . LYS E 1 11 ? -9.815  24.992  -46.542 1.00 17.88 ? 8   LYS E CG  1 
ATOM   2565 C  CD  . LYS E 1 11 ? -10.902 24.973  -45.471 1.00 20.54 ? 8   LYS E CD  1 
ATOM   2566 C  CE  . LYS E 1 11 ? -10.474 25.692  -44.178 1.00 23.28 ? 8   LYS E CE  1 
ATOM   2567 N  NZ  . LYS E 1 11 ? -11.663 25.667  -43.282 1.00 26.46 ? 8   LYS E NZ  1 
ATOM   2568 N  N   . VAL E 1 12 ? -9.566  21.383  -49.522 1.00 15.15 ? 9   VAL E N   1 
ATOM   2569 C  CA  . VAL E 1 12 ? -9.997  20.516  -50.623 1.00 15.90 ? 9   VAL E CA  1 
ATOM   2570 C  C   . VAL E 1 12 ? -10.201 19.079  -50.089 1.00 15.86 ? 9   VAL E C   1 
ATOM   2571 O  O   . VAL E 1 12 ? -11.188 18.412  -50.415 1.00 17.24 ? 9   VAL E O   1 
ATOM   2572 C  CB  . VAL E 1 12 ? -8.912  20.503  -51.743 1.00 16.91 ? 9   VAL E CB  1 
ATOM   2573 C  CG1 . VAL E 1 12 ? -9.182  19.401  -52.763 1.00 17.26 ? 9   VAL E CG1 1 
ATOM   2574 C  CG2 . VAL E 1 12 ? -8.869  21.881  -52.413 1.00 18.11 ? 9   VAL E CG2 1 
ATOM   2575 N  N   . SER E 1 13 ? -9.235  18.618  -49.308 1.00 16.88 ? 10  SER E N   1 
ATOM   2576 C  CA  . SER E 1 13 ? -9.334  17.315  -48.714 1.00 19.37 ? 10  SER E CA  1 
ATOM   2577 C  C   . SER E 1 13 ? -10.508 17.155  -47.773 1.00 18.69 ? 10  SER E C   1 
ATOM   2578 O  O   . SER E 1 13 ? -11.106 16.087  -47.725 1.00 18.16 ? 10  SER E O   1 
ATOM   2579 C  CB  . SER E 1 13 ? -8.044  16.898  -48.059 1.00 21.15 ? 10  SER E CB  1 
ATOM   2580 O  OG  . SER E 1 13 ? -7.970  17.425  -46.780 1.00 24.37 ? 10  SER E OG  1 
ATOM   2581 N  N   . PHE E 1 14 ? -10.823 18.193  -47.012 1.00 18.87 ? 11  PHE E N   1 
ATOM   2582 C  CA  . PHE E 1 14 ? -12.013 18.164  -46.146 1.00 19.79 ? 11  PHE E CA  1 
ATOM   2583 C  C   . PHE E 1 14 ? -13.305 18.045  -46.943 1.00 17.87 ? 11  PHE E C   1 
ATOM   2584 O  O   . PHE E 1 14 ? -14.235 17.299  -46.577 1.00 18.07 ? 11  PHE E O   1 
ATOM   2585 C  CB  . PHE E 1 14 ? -12.105 19.439  -45.295 1.00 20.57 ? 11  PHE E CB  1 
ATOM   2586 C  CG  . PHE E 1 14 ? -13.317 19.476  -44.453 1.00 21.91 ? 11  PHE E CG  1 
ATOM   2587 C  CD1 . PHE E 1 14 ? -13.346 18.805  -43.231 1.00 25.54 ? 11  PHE E CD1 1 
ATOM   2588 C  CD2 . PHE E 1 14 ? -14.450 20.105  -44.878 1.00 21.10 ? 11  PHE E CD2 1 
ATOM   2589 C  CE1 . PHE E 1 14 ? -14.522 18.789  -42.470 1.00 25.23 ? 11  PHE E CE1 1 
ATOM   2590 C  CE2 . PHE E 1 14 ? -15.592 20.119  -44.089 1.00 25.49 ? 11  PHE E CE2 1 
ATOM   2591 C  CZ  . PHE E 1 14 ? -15.610 19.481  -42.884 1.00 24.46 ? 11  PHE E CZ  1 
ATOM   2592 N  N   . VAL E 1 15 ? -13.389 18.757  -48.047 1.00 14.06 ? 12  VAL E N   1 
ATOM   2593 C  CA  . VAL E 1 15 ? -14.583 18.664  -48.854 1.00 15.34 ? 12  VAL E CA  1 
ATOM   2594 C  C   . VAL E 1 15 ? -14.709 17.275  -49.489 1.00 14.87 ? 12  VAL E C   1 
ATOM   2595 O  O   . VAL E 1 15 ? -15.813 16.768  -49.578 1.00 14.66 ? 12  VAL E O   1 
ATOM   2596 C  CB  . VAL E 1 15 ? -14.640 19.769  -49.939 1.00 15.72 ? 12  VAL E CB  1 
ATOM   2597 C  CG1 . VAL E 1 15 ? -15.744 19.555  -50.955 1.00 16.72 ? 12  VAL E CG1 1 
ATOM   2598 C  CG2 . VAL E 1 15 ? -14.834 21.108  -49.316 1.00 14.96 ? 12  VAL E CG2 1 
ATOM   2599 N  N   . ILE E 1 16 ? -13.612 16.708  -49.964 1.00 15.40 ? 13  ILE E N   1 
ATOM   2600 C  CA  . ILE E 1 16 ? -13.664 15.363  -50.502 1.00 15.68 ? 13  ILE E CA  1 
ATOM   2601 C  C   . ILE E 1 16 ? -14.217 14.367  -49.462 1.00 16.41 ? 13  ILE E C   1 
ATOM   2602 O  O   . ILE E 1 16 ? -15.122 13.570  -49.763 1.00 16.15 ? 13  ILE E O   1 
ATOM   2603 C  CB  . ILE E 1 16 ? -12.287 14.919  -50.976 1.00 14.75 ? 13  ILE E CB  1 
ATOM   2604 C  CG1 . ILE E 1 16 ? -11.887 15.649  -52.270 1.00 14.79 ? 13  ILE E CG1 1 
ATOM   2605 C  CG2 . ILE E 1 16 ? -12.244 13.429  -51.299 1.00 15.81 ? 13  ILE E CG2 1 
ATOM   2606 C  CD1 . ILE E 1 16 ? -10.403 15.555  -52.498 1.00 14.43 ? 13  ILE E CD1 1 
ATOM   2607 N  N   . LYS E 1 17 ? -13.607 14.369  -48.282 1.00 15.34 ? 14  LYS E N   1 
ATOM   2608 C  CA  . LYS E 1 17 ? -14.029 13.532  -47.169 1.00 17.34 ? 14  LYS E CA  1 
ATOM   2609 C  C   . LYS E 1 17 ? -15.505 13.750  -46.821 1.00 17.73 ? 14  LYS E C   1 
ATOM   2610 O  O   . LYS E 1 17 ? -16.237 12.764  -46.630 1.00 18.22 ? 14  LYS E O   1 
ATOM   2611 C  CB  . LYS E 1 17 ? -13.132 13.774  -45.946 1.00 18.83 ? 14  LYS E CB  1 
ATOM   2612 C  CG  . LYS E 1 17 ? -13.362 12.820  -44.784 1.00 24.05 ? 14  LYS E CG  1 
ATOM   2613 C  CD  . LYS E 1 17 ? -12.473 13.156  -43.571 1.00 27.24 ? 14  LYS E CD  1 
ATOM   2614 C  CE  . LYS E 1 17 ? -11.974 11.866  -42.941 1.00 35.17 ? 14  LYS E CE  1 
ATOM   2615 N  NZ  . LYS E 1 17 ? -12.265 11.777  -41.492 1.00 40.89 ? 14  LYS E NZ  1 
ATOM   2616 N  N   . LYS E 1 18 ? -15.955 14.999  -46.748 1.00 16.90 ? 15  LYS E N   1 
ATOM   2617 C  CA  . LYS E 1 18 ? -17.335 15.287  -46.408 1.00 17.59 ? 15  LYS E CA  1 
ATOM   2618 C  C   . LYS E 1 18 ? -18.363 14.729  -47.397 1.00 17.41 ? 15  LYS E C   1 
ATOM   2619 O  O   . LYS E 1 18 ? -19.417 14.158  -47.032 1.00 14.78 ? 15  LYS E O   1 
ATOM   2620 C  CB  . LYS E 1 18 ? -17.500 16.777  -46.210 1.00 20.26 ? 15  LYS E CB  1 
ATOM   2621 C  CG  . LYS E 1 18 ? -18.904 17.216  -45.885 1.00 21.92 ? 15  LYS E CG  1 
ATOM   2622 C  CD  . LYS E 1 18 ? -19.022 18.661  -45.491 1.00 26.38 ? 15  LYS E CD  1 
ATOM   2623 C  CE  . LYS E 1 18 ? -20.497 18.958  -45.281 1.00 31.01 ? 15  LYS E CE  1 
ATOM   2624 N  NZ  . LYS E 1 18 ? -20.618 20.343  -44.744 1.00 35.95 ? 15  LYS E NZ  1 
ATOM   2625 N  N   . ILE E 1 19 ? -18.090 14.901  -48.687 1.00 17.07 ? 16  ILE E N   1 
ATOM   2626 C  CA  . ILE E 1 19 ? -18.976 14.309  -49.714 1.00 16.76 ? 16  ILE E CA  1 
ATOM   2627 C  C   . ILE E 1 19 ? -18.948 12.789  -49.678 1.00 15.81 ? 16  ILE E C   1 
ATOM   2628 O  O   . ILE E 1 19 ? -20.008 12.123  -49.708 1.00 17.44 ? 16  ILE E O   1 
ATOM   2629 C  CB  . ILE E 1 19 ? -18.568 14.824  -51.131 1.00 16.73 ? 16  ILE E CB  1 
ATOM   2630 C  CG1 . ILE E 1 19 ? -18.742 16.333  -51.197 1.00 17.41 ? 16  ILE E CG1 1 
ATOM   2631 C  CG2 . ILE E 1 19 ? -19.492 14.232  -52.187 1.00 17.57 ? 16  ILE E CG2 1 
ATOM   2632 C  CD1 . ILE E 1 19 ? -17.860 16.982  -52.262 1.00 18.57 ? 16  ILE E CD1 1 
ATOM   2633 N  N   . ARG E 1 20 ? -17.750 12.225  -49.597 1.00 15.75 ? 17  ARG E N   1 
ATOM   2634 C  CA  . ARG E 1 20 ? -17.555 10.801  -49.516 1.00 17.19 ? 17  ARG E CA  1 
ATOM   2635 C  C   . ARG E 1 20 ? -18.413 10.218  -48.344 1.00 18.69 ? 17  ARG E C   1 
ATOM   2636 O  O   . ARG E 1 20 ? -19.180 9.257   -48.534 1.00 20.35 ? 17  ARG E O   1 
ATOM   2637 C  CB  . ARG E 1 20 ? -16.080 10.456  -49.315 1.00 16.69 ? 17  ARG E CB  1 
ATOM   2638 C  CG  . ARG E 1 20 ? -15.855 8.958   -49.102 1.00 18.45 ? 17  ARG E CG  1 
ATOM   2639 C  CD  . ARG E 1 20 ? -14.420 8.524   -48.969 1.00 18.37 ? 17  ARG E CD  1 
ATOM   2640 N  NE  . ARG E 1 20 ? -13.755 8.943   -47.763 1.00 18.93 ? 17  ARG E NE  1 
ATOM   2641 C  CZ  . ARG E 1 20 ? -13.901 8.355   -46.556 1.00 21.71 ? 17  ARG E CZ  1 
ATOM   2642 N  NH1 . ARG E 1 20 ? -14.789 7.373   -46.370 1.00 20.39 ? 17  ARG E NH1 1 
ATOM   2643 N  NH2 . ARG E 1 20 ? -13.188 8.772   -45.525 1.00 22.80 ? 17  ARG E NH2 1 
ATOM   2644 N  N   . LEU E 1 21 ? -18.304 10.849  -47.180 1.00 18.87 ? 18  LEU E N   1 
ATOM   2645 C  CA  . LEU E 1 21 ? -19.047 10.445  -45.961 1.00 21.50 ? 18  LEU E CA  1 
ATOM   2646 C  C   . LEU E 1 21 ? -20.561 10.589  -46.073 1.00 22.82 ? 18  LEU E C   1 
ATOM   2647 O  O   . LEU E 1 21 ? -21.306 9.671   -45.659 1.00 22.37 ? 18  LEU E O   1 
ATOM   2648 C  CB  . LEU E 1 21 ? -18.497 11.195  -44.759 1.00 22.08 ? 18  LEU E CB  1 
ATOM   2649 C  CG  . LEU E 1 21 ? -17.089 10.737  -44.376 1.00 20.67 ? 18  LEU E CG  1 
ATOM   2650 C  CD1 . LEU E 1 21 ? -16.554 11.654  -43.328 1.00 20.40 ? 18  LEU E CD1 1 
ATOM   2651 C  CD2 . LEU E 1 21 ? -17.036 9.309   -43.850 1.00 23.33 ? 18  LEU E CD2 1 
ATOM   2652 N  N   . GLU E 1 22 ? -21.017 11.676  -46.697 1.00 23.15 ? 19  GLU E N   1 
ATOM   2653 C  CA  . GLU E 1 22 ? -22.437 11.894  -46.988 1.00 24.30 ? 19  GLU E CA  1 
ATOM   2654 C  C   . GLU E 1 22 ? -23.032 10.803  -47.864 1.00 23.55 ? 19  GLU E C   1 
ATOM   2655 O  O   . GLU E 1 22 ? -24.193 10.437  -47.722 1.00 21.14 ? 19  GLU E O   1 
ATOM   2656 C  CB  . GLU E 1 22 ? -22.649 13.294  -47.609 1.00 27.87 ? 19  GLU E CB  1 
ATOM   2657 C  CG  . GLU E 1 22 ? -24.079 13.605  -48.083 1.00 30.93 ? 19  GLU E CG  1 
ATOM   2658 C  CD  . GLU E 1 22 ? -25.106 13.556  -46.948 1.00 34.17 ? 19  GLU E CD  1 
ATOM   2659 O  OE1 . GLU E 1 22 ? -24.779 13.972  -45.798 1.00 34.23 ? 19  GLU E OE1 1 
ATOM   2660 O  OE2 . GLU E 1 22 ? -26.243 13.086  -47.204 1.00 41.17 ? 19  GLU E OE2 1 
ATOM   2661 N  N   . LYS E 1 23 ? -22.223 10.262  -48.760 1.00 20.92 ? 20  LYS E N   1 
ATOM   2662 C  CA  . LYS E 1 23 ? -22.637 9.182   -49.608 1.00 22.74 ? 20  LYS E CA  1 
ATOM   2663 C  C   . LYS E 1 23 ? -22.425 7.803   -48.997 1.00 19.72 ? 20  LYS E C   1 
ATOM   2664 O  O   . LYS E 1 23 ? -22.742 6.818   -49.644 1.00 21.96 ? 20  LYS E O   1 
ATOM   2665 C  CB  . LYS E 1 23 ? -21.899 9.236   -50.956 1.00 23.06 ? 20  LYS E CB  1 
ATOM   2666 C  CG  . LYS E 1 23 ? -22.273 10.474  -51.709 1.00 28.35 ? 20  LYS E CG  1 
ATOM   2667 C  CD  . LYS E 1 23 ? -21.736 10.490  -53.130 1.00 33.58 ? 20  LYS E CD  1 
ATOM   2668 C  CE  . LYS E 1 23 ? -22.066 11.852  -53.748 1.00 40.74 ? 20  LYS E CE  1 
ATOM   2669 N  NZ  . LYS E 1 23 ? -22.583 11.832  -55.157 1.00 43.57 ? 20  LYS E NZ  1 
ATOM   2670 N  N   . GLY E 1 24 ? -21.878 7.718   -47.799 1.00 18.62 ? 21  GLY E N   1 
ATOM   2671 C  CA  . GLY E 1 24 ? -21.682 6.420   -47.148 1.00 19.71 ? 21  GLY E CA  1 
ATOM   2672 C  C   . GLY E 1 24 ? -20.665 5.575   -47.908 1.00 22.12 ? 21  GLY E C   1 
ATOM   2673 O  O   . GLY E 1 24 ? -20.747 4.328   -47.870 1.00 19.81 ? 21  GLY E O   1 
ATOM   2674 N  N   . MET E 1 25 ? -19.668 6.236   -48.563 1.00 18.13 ? 22  MET E N   1 
ATOM   2675 C  CA  . MET E 1 25 ? -18.643 5.518   -49.351 1.00 19.39 ? 22  MET E CA  1 
ATOM   2676 C  C   . MET E 1 25 ? -17.419 5.327   -48.533 1.00 16.83 ? 22  MET E C   1 
ATOM   2677 O  O   . MET E 1 25 ? -16.959 6.259   -47.860 1.00 17.24 ? 22  MET E O   1 
ATOM   2678 C  CB  . MET E 1 25 ? -18.206 6.322   -50.610 1.00 21.31 ? 22  MET E CB  1 
ATOM   2679 C  CG  . MET E 1 25 ? -19.289 6.487   -51.634 1.00 25.62 ? 22  MET E CG  1 
ATOM   2680 S  SD  . MET E 1 25 ? -18.772 7.571   -53.025 1.00 28.05 ? 22  MET E SD  1 
ATOM   2681 C  CE  . MET E 1 25 ? -17.558 6.563   -53.834 1.00 24.76 ? 22  MET E CE  1 
ATOM   2682 N  N   . THR E 1 26 ? -16.858 4.145   -48.574 1.00 16.83 ? 23  THR E N   1 
ATOM   2683 C  CA  . THR E 1 26 ? -15.602 3.901   -47.937 1.00 17.50 ? 23  THR E CA  1 
ATOM   2684 C  C   . THR E 1 26 ? -14.474 4.549   -48.797 1.00 18.27 ? 23  THR E C   1 
ATOM   2685 O  O   . THR E 1 26 ? -14.682 4.883   -50.007 1.00 16.22 ? 23  THR E O   1 
ATOM   2686 C  CB  . THR E 1 26 ? -15.295 2.407   -47.810 1.00 20.21 ? 23  THR E CB  1 
ATOM   2687 O  OG1 . THR E 1 26 ? -15.218 1.833   -49.117 1.00 21.22 ? 23  THR E OG1 1 
ATOM   2688 C  CG2 . THR E 1 26 ? -16.387 1.634   -46.985 1.00 21.03 ? 23  THR E CG2 1 
ATOM   2689 N  N   . GLN E 1 27 ? -13.288 4.635   -48.227 1.00 17.07 ? 24  GLN E N   1 
ATOM   2690 C  CA  . GLN E 1 27 ? -12.104 5.078   -48.996 1.00 20.70 ? 24  GLN E CA  1 
ATOM   2691 C  C   . GLN E 1 27 ? -11.821 4.149   -50.149 1.00 22.50 ? 24  GLN E C   1 
ATOM   2692 O  O   . GLN E 1 27 ? -11.489 4.602   -51.227 1.00 19.36 ? 24  GLN E O   1 
ATOM   2693 C  CB  . GLN E 1 27 ? -10.846 5.138   -48.099 1.00 22.56 ? 24  GLN E CB  1 
ATOM   2694 C  CG  . GLN E 1 27 ? -10.974 6.277   -47.105 1.00 24.70 ? 24  GLN E CG  1 
ATOM   2695 C  CD  . GLN E 1 27 ? -9.773  6.421   -46.204 1.00 25.98 ? 24  GLN E CD  1 
ATOM   2696 O  OE1 . GLN E 1 27 ? -9.011  5.509   -46.054 1.00 28.22 ? 24  GLN E OE1 1 
ATOM   2697 N  NE2 . GLN E 1 27 ? -9.601  7.563   -45.640 1.00 24.66 ? 24  GLN E NE2 1 
ATOM   2698 N  N   . GLU E 1 28 ? -12.023 2.838   -49.934 1.00 22.95 ? 25  GLU E N   1 
ATOM   2699 C  CA  . GLU E 1 28 ? -11.890 1.835   -51.016 1.00 25.05 ? 25  GLU E CA  1 
ATOM   2700 C  C   . GLU E 1 28 ? -12.931 2.062   -52.108 1.00 21.61 ? 25  GLU E C   1 
ATOM   2701 O  O   . GLU E 1 28 ? -12.571 2.047   -53.290 1.00 18.78 ? 25  GLU E O   1 
ATOM   2702 C  CB  . GLU E 1 28 ? -12.006 0.385   -50.464 1.00 29.18 ? 25  GLU E CB  1 
ATOM   2703 C  CG  . GLU E 1 28 ? -11.161 0.154   -49.215 1.00 33.69 ? 25  GLU E CG  1 
ATOM   2704 C  CD  . GLU E 1 28 ? -11.871 0.453   -47.872 1.00 38.27 ? 25  GLU E CD  1 
ATOM   2705 O  OE1 . GLU E 1 28 ? -12.412 -0.517  -47.259 1.00 56.29 ? 25  GLU E OE1 1 
ATOM   2706 O  OE2 . GLU E 1 28 ? -11.893 1.631   -47.391 1.00 31.65 ? 25  GLU E OE2 1 
ATOM   2707 N  N   . ASP E 1 29 ? -14.209 2.329   -51.741 1.00 17.65 ? 26  ASP E N   1 
ATOM   2708 C  CA  . ASP E 1 29 ? -15.225 2.646   -52.749 1.00 19.92 ? 26  ASP E CA  1 
ATOM   2709 C  C   . ASP E 1 29 ? -14.814 3.814   -53.632 1.00 17.12 ? 26  ASP E C   1 
ATOM   2710 O  O   . ASP E 1 29 ? -14.981 3.807   -54.856 1.00 16.42 ? 26  ASP E O   1 
ATOM   2711 C  CB  . ASP E 1 29 ? -16.595 2.990   -52.150 1.00 23.42 ? 26  ASP E CB  1 
ATOM   2712 C  CG  . ASP E 1 29 ? -17.240 1.812   -51.414 1.00 30.39 ? 26  ASP E CG  1 
ATOM   2713 O  OD1 . ASP E 1 29 ? -16.940 0.660   -51.854 1.00 27.81 ? 26  ASP E OD1 1 
ATOM   2714 O  OD2 . ASP E 1 29 ? -18.015 2.087   -50.425 1.00 29.73 ? 26  ASP E OD2 1 
ATOM   2715 N  N   . LEU E 1 30 ? -14.306 4.852   -53.005 1.00 17.95 ? 27  LEU E N   1 
ATOM   2716 C  CA  . LEU E 1 30 ? -13.866 6.022   -53.809 1.00 18.60 ? 27  LEU E CA  1 
ATOM   2717 C  C   . LEU E 1 30 ? -12.634 5.699   -54.690 1.00 18.59 ? 27  LEU E C   1 
ATOM   2718 O  O   . LEU E 1 30 ? -12.594 6.124   -55.823 1.00 22.27 ? 27  LEU E O   1 
ATOM   2719 C  CB  . LEU E 1 30 ? -13.616 7.246   -52.910 1.00 18.20 ? 27  LEU E CB  1 
ATOM   2720 C  CG  . LEU E 1 30 ? -13.128 8.500   -53.608 1.00 17.72 ? 27  LEU E CG  1 
ATOM   2721 C  CD1 . LEU E 1 30 ? -14.163 8.971   -54.615 1.00 16.93 ? 27  LEU E CD1 1 
ATOM   2722 C  CD2 . LEU E 1 30 ? -12.872 9.547   -52.522 1.00 18.74 ? 27  LEU E CD2 1 
ATOM   2723 N  N   . ALA E 1 31 ? -11.688 4.945   -54.142 1.00 18.94 ? 28  ALA E N   1 
ATOM   2724 C  CA  . ALA E 1 31 ? -10.506 4.510   -54.866 1.00 21.53 ? 28  ALA E CA  1 
ATOM   2725 C  C   . ALA E 1 31 ? -10.915 3.744   -56.125 1.00 22.63 ? 28  ALA E C   1 
ATOM   2726 O  O   . ALA E 1 31 ? -10.437 4.058   -57.190 1.00 21.62 ? 28  ALA E O   1 
ATOM   2727 C  CB  . ALA E 1 31 ? -9.622  3.699   -53.957 1.00 21.09 ? 28  ALA E CB  1 
ATOM   2728 N  N   . TYR E 1 32 ? -11.890 2.819   -56.026 1.00 21.91 ? 29  TYR E N   1 
ATOM   2729 C  CA  . TYR E 1 32 ? -12.388 2.124   -57.202 1.00 20.22 ? 29  TYR E CA  1 
ATOM   2730 C  C   . TYR E 1 32 ? -12.963 3.022   -58.249 1.00 21.09 ? 29  TYR E C   1 
ATOM   2731 O  O   . TYR E 1 32 ? -12.629 2.896   -59.434 1.00 20.59 ? 29  TYR E O   1 
ATOM   2732 C  CB  . TYR E 1 32 ? -13.489 1.097   -56.874 1.00 20.02 ? 29  TYR E CB  1 
ATOM   2733 C  CG  . TYR E 1 32 ? -13.109 0.045   -55.887 1.00 20.99 ? 29  TYR E CG  1 
ATOM   2734 C  CD1 . TYR E 1 32 ? -11.854 -0.554  -55.893 1.00 21.10 ? 29  TYR E CD1 1 
ATOM   2735 C  CD2 . TYR E 1 32 ? -14.046 -0.384  -54.951 1.00 25.23 ? 29  TYR E CD2 1 
ATOM   2736 C  CE1 . TYR E 1 32 ? -11.528 -1.524  -54.952 1.00 22.39 ? 29  TYR E CE1 1 
ATOM   2737 C  CE2 . TYR E 1 32 ? -13.725 -1.336  -54.005 1.00 25.14 ? 29  TYR E CE2 1 
ATOM   2738 C  CZ  . TYR E 1 32 ? -12.486 -1.893  -54.022 1.00 24.05 ? 29  TYR E CZ  1 
ATOM   2739 O  OH  . TYR E 1 32 ? -12.249 -2.834  -53.083 1.00 29.50 ? 29  TYR E OH  1 
ATOM   2740 N  N   . LYS E 1 33 ? -13.880 3.901   -57.844 1.00 18.43 ? 30  LYS E N   1 
ATOM   2741 C  CA  . LYS E 1 33 ? -14.528 4.734   -58.786 1.00 20.23 ? 30  LYS E CA  1 
ATOM   2742 C  C   . LYS E 1 33 ? -13.650 5.854   -59.345 1.00 20.80 ? 30  LYS E C   1 
ATOM   2743 O  O   . LYS E 1 33 ? -13.998 6.410   -60.347 1.00 21.53 ? 30  LYS E O   1 
ATOM   2744 C  CB  . LYS E 1 33 ? -15.724 5.393   -58.145 1.00 23.75 ? 30  LYS E CB  1 
ATOM   2745 C  CG  . LYS E 1 33 ? -16.780 4.404   -57.713 1.00 29.42 ? 30  LYS E CG  1 
ATOM   2746 C  CD  . LYS E 1 33 ? -18.093 4.926   -58.197 1.00 34.43 ? 30  LYS E CD  1 
ATOM   2747 C  CE  . LYS E 1 33 ? -19.221 4.138   -57.631 1.00 37.57 ? 30  LYS E CE  1 
ATOM   2748 N  NZ  . LYS E 1 33 ? -20.391 4.679   -58.361 1.00 43.23 ? 30  LYS E NZ  1 
ATOM   2749 N  N   . SER E 1 34 ? -12.562 6.195   -58.671 1.00 22.16 ? 31  SER E N   1 
ATOM   2750 C  CA  A SER E 1 34 ? -11.631 7.249   -59.130 0.50 21.90 ? 31  SER E CA  1 
ATOM   2751 C  CA  B SER E 1 34 ? -11.623 7.244   -59.141 0.50 21.42 ? 31  SER E CA  1 
ATOM   2752 C  C   . SER E 1 34 ? -10.410 6.665   -59.843 1.00 24.89 ? 31  SER E C   1 
ATOM   2753 O  O   . SER E 1 34 ? -9.537  7.410   -60.363 1.00 26.97 ? 31  SER E O   1 
ATOM   2754 C  CB  A SER E 1 34 ? -11.155 8.037   -57.920 0.50 20.68 ? 31  SER E CB  1 
ATOM   2755 C  CB  B SER E 1 34 ? -11.125 8.061   -57.960 0.50 19.75 ? 31  SER E CB  1 
ATOM   2756 O  OG  A SER E 1 34 ? -12.249 8.658   -57.227 0.50 18.50 ? 31  SER E OG  1 
ATOM   2757 O  OG  B SER E 1 34 ? -10.188 7.369   -57.150 0.50 16.71 ? 31  SER E OG  1 
ATOM   2758 N  N   . ASN E 1 35 ? -10.301 5.343   -59.821 1.00 25.65 ? 32  ASN E N   1 
ATOM   2759 C  CA  . ASN E 1 35 ? -9.138  4.647   -60.312 1.00 27.37 ? 32  ASN E CA  1 
ATOM   2760 C  C   . ASN E 1 35 ? -7.821  5.006   -59.648 1.00 30.19 ? 32  ASN E C   1 
ATOM   2761 O  O   . ASN E 1 35 ? -6.755  5.020   -60.283 1.00 27.46 ? 32  ASN E O   1 
ATOM   2762 C  CB  . ASN E 1 35 ? -9.084  4.751   -61.840 1.00 29.82 ? 32  ASN E CB  1 
ATOM   2763 C  CG  . ASN E 1 35 ? -10.220 3.990   -62.480 1.00 30.63 ? 32  ASN E CG  1 
ATOM   2764 O  OD1 . ASN E 1 35 ? -10.490 2.855   -62.105 1.00 28.37 ? 32  ASN E OD1 1 
ATOM   2765 N  ND2 . ASN E 1 35 ? -10.959 4.636   -63.356 1.00 32.29 ? 32  ASN E ND2 1 
ATOM   2766 N  N   . LEU E 1 36 ? -7.874  5.225   -58.345 1.00 26.11 ? 33  LEU E N   1 
ATOM   2767 C  CA  . LEU E 1 36 ? -6.670  5.539   -57.606 1.00 26.19 ? 33  LEU E CA  1 
ATOM   2768 C  C   . LEU E 1 36 ? -6.502  4.538   -56.485 1.00 29.06 ? 33  LEU E C   1 
ATOM   2769 O  O   . LEU E 1 36 ? -7.420  3.785   -56.130 1.00 28.52 ? 33  LEU E O   1 
ATOM   2770 C  CB  . LEU E 1 36 ? -6.764  6.938   -57.034 1.00 24.70 ? 33  LEU E CB  1 
ATOM   2771 C  CG  . LEU E 1 36 ? -6.967  8.077   -58.036 1.00 24.81 ? 33  LEU E CG  1 
ATOM   2772 C  CD1 . LEU E 1 36 ? -7.479  9.354   -57.346 1.00 23.83 ? 33  LEU E CD1 1 
ATOM   2773 C  CD2 . LEU E 1 36 ? -5.647  8.349   -58.750 1.00 24.15 ? 33  LEU E CD2 1 
ATOM   2774 N  N   . ASP E 1 37 ? -5.329  4.587   -55.898 1.00 30.18 ? 34  ASP E N   1 
ATOM   2775 C  CA  . ASP E 1 37 ? -4.958  3.699   -54.821 1.00 37.15 ? 34  ASP E CA  1 
ATOM   2776 C  C   . ASP E 1 37 ? -5.686  4.058   -53.528 1.00 36.23 ? 34  ASP E C   1 
ATOM   2777 O  O   . ASP E 1 37 ? -5.824  5.240   -53.202 1.00 30.30 ? 34  ASP E O   1 
ATOM   2778 C  CB  . ASP E 1 37 ? -3.463  3.874   -54.573 1.00 43.57 ? 34  ASP E CB  1 
ATOM   2779 C  CG  . ASP E 1 37 ? -2.805  2.625   -54.270 1.00 54.19 ? 34  ASP E CG  1 
ATOM   2780 O  OD1 . ASP E 1 37 ? -3.395  1.815   -53.509 1.00 68.00 ? 34  ASP E OD1 1 
ATOM   2781 O  OD2 . ASP E 1 37 ? -1.678  2.462   -54.790 1.00 65.57 ? 34  ASP E OD2 1 
ATOM   2782 N  N   . ARG E 1 38 ? -6.090  3.048   -52.757 1.00 31.11 ? 35  ARG E N   1 
ATOM   2783 C  CA  . ARG E 1 38 ? -6.742  3.302   -51.490 1.00 30.91 ? 35  ARG E CA  1 
ATOM   2784 C  C   . ARG E 1 38 ? -5.839  4.075   -50.550 1.00 26.70 ? 35  ARG E C   1 
ATOM   2785 O  O   . ARG E 1 38 ? -6.278  5.020   -49.858 1.00 30.85 ? 35  ARG E O   1 
ATOM   2786 C  CB  . ARG E 1 38 ? -7.191  2.011   -50.801 1.00 34.19 ? 35  ARG E CB  1 
ATOM   2787 C  CG  . ARG E 1 38 ? -8.128  2.292   -49.631 1.00 39.29 ? 35  ARG E CG  1 
ATOM   2788 C  CD  . ARG E 1 38 ? -8.208  1.123   -48.651 1.00 47.72 ? 35  ARG E CD  1 
ATOM   2789 N  NE  . ARG E 1 38 ? -6.915  0.637   -48.196 1.00 50.87 ? 35  ARG E NE  1 
ATOM   2790 C  CZ  . ARG E 1 38 ? -6.108  1.286   -47.367 1.00 55.43 ? 35  ARG E CZ  1 
ATOM   2791 N  NH1 . ARG E 1 38 ? -6.422  2.483   -46.887 1.00 57.94 ? 35  ARG E NH1 1 
ATOM   2792 N  NH2 . ARG E 1 38 ? -4.965  0.726   -47.028 1.00 56.68 ? 35  ARG E NH2 1 
ATOM   2793 N  N   . THR E 1 39 ? -4.584  3.683   -50.496 1.00 27.01 ? 36  THR E N   1 
ATOM   2794 C  CA  . THR E 1 39 ? -3.593  4.374   -49.655 1.00 26.72 ? 36  THR E CA  1 
ATOM   2795 C  C   . THR E 1 39 ? -3.388  5.834   -50.091 1.00 24.78 ? 36  THR E C   1 
ATOM   2796 O  O   . THR E 1 39 ? -3.157  6.714   -49.261 1.00 28.43 ? 36  THR E O   1 
ATOM   2797 C  CB  . THR E 1 39 ? -2.228  3.653   -49.664 1.00 28.12 ? 36  THR E CB  1 
ATOM   2798 O  OG1 . THR E 1 39 ? -1.769  3.537   -51.019 1.00 35.29 ? 36  THR E OG1 1 
ATOM   2799 C  CG2 . THR E 1 39 ? -2.344  2.261   -49.100 1.00 32.08 ? 36  THR E CG2 1 
ATOM   2800 N  N   . PHE E 1 40 ? -3.529  6.109   -51.373 1.00 27.45 ? 37  PHE E N   1 
ATOM   2801 C  CA  . PHE E 1 40 ? -3.485  7.508   -51.855 1.00 26.26 ? 37  PHE E CA  1 
ATOM   2802 C  C   . PHE E 1 40 ? -4.692  8.310   -51.304 1.00 23.94 ? 37  PHE E C   1 
ATOM   2803 O  O   . PHE E 1 40 ? -4.533  9.356   -50.690 1.00 25.21 ? 37  PHE E O   1 
ATOM   2804 C  CB  . PHE E 1 40 ? -3.525  7.531   -53.387 1.00 27.50 ? 37  PHE E CB  1 
ATOM   2805 C  CG  . PHE E 1 40 ? -3.345  8.921   -53.966 1.00 30.20 ? 37  PHE E CG  1 
ATOM   2806 C  CD1 . PHE E 1 40 ? -2.294  9.751   -53.515 1.00 31.02 ? 37  PHE E CD1 1 
ATOM   2807 C  CD2 . PHE E 1 40 ? -4.229  9.424   -54.897 1.00 31.96 ? 37  PHE E CD2 1 
ATOM   2808 C  CE1 . PHE E 1 40 ? -2.118  11.031  -54.025 1.00 33.06 ? 37  PHE E CE1 1 
ATOM   2809 C  CE2 . PHE E 1 40 ? -4.061  10.707  -55.408 1.00 35.98 ? 37  PHE E CE2 1 
ATOM   2810 C  CZ  . PHE E 1 40 ? -2.999  11.513  -54.974 1.00 35.24 ? 37  PHE E CZ  1 
ATOM   2811 N  N   . ILE E 1 41 ? -5.900  7.794   -51.514 1.00 21.31 ? 38  ILE E N   1 
ATOM   2812 C  CA  . ILE E 1 41 ? -7.113  8.453   -50.961 1.00 22.17 ? 38  ILE E CA  1 
ATOM   2813 C  C   . ILE E 1 41 ? -6.912  8.722   -49.459 1.00 21.43 ? 38  ILE E C   1 
ATOM   2814 O  O   . ILE E 1 41 ? -7.171  9.796   -48.974 1.00 22.31 ? 38  ILE E O   1 
ATOM   2815 C  CB  . ILE E 1 41 ? -8.433  7.631   -51.184 1.00 21.37 ? 38  ILE E CB  1 
ATOM   2816 C  CG1 . ILE E 1 41 ? -8.768  7.404   -52.645 1.00 22.50 ? 38  ILE E CG1 1 
ATOM   2817 C  CG2 . ILE E 1 41 ? -9.620  8.275   -50.463 1.00 21.41 ? 38  ILE E CG2 1 
ATOM   2818 C  CD1 . ILE E 1 41 ? -8.940  8.655   -53.492 1.00 22.17 ? 38  ILE E CD1 1 
ATOM   2819 N  N   . SER E 1 42 ? -6.427  7.733   -48.737 1.00 23.89 ? 39  SER E N   1 
ATOM   2820 C  CA  . SER E 1 42 ? -6.231  7.844   -47.291 1.00 26.08 ? 39  SER E CA  1 
ATOM   2821 C  C   . SER E 1 42 ? -5.202  8.926   -46.981 1.00 24.70 ? 39  SER E C   1 
ATOM   2822 O  O   . SER E 1 42 ? -5.359  9.745   -46.046 1.00 22.54 ? 39  SER E O   1 
ATOM   2823 C  CB  . SER E 1 42 ? -5.747  6.479   -46.738 1.00 27.27 ? 39  SER E CB  1 
ATOM   2824 O  OG  . SER E 1 42 ? -5.414  6.654   -45.398 1.00 29.04 ? 39  SER E OG  1 
ATOM   2825 N  N   . GLY E 1 43 ? -4.129  8.931   -47.760 1.00 26.35 ? 40  GLY E N   1 
ATOM   2826 C  CA  . GLY E 1 43 ? -3.055  9.958   -47.561 1.00 25.96 ? 40  GLY E CA  1 
ATOM   2827 C  C   . GLY E 1 43 ? -3.548  11.397  -47.753 1.00 23.53 ? 40  GLY E C   1 
ATOM   2828 O  O   . GLY E 1 43 ? -3.272  12.284  -46.975 1.00 23.89 ? 40  GLY E O   1 
ATOM   2829 N  N   . ILE E 1 44 ? -4.336  11.612  -48.776 1.00 24.39 ? 41  ILE E N   1 
ATOM   2830 C  CA  . ILE E 1 44 ? -4.958  12.938  -49.036 1.00 26.63 ? 41  ILE E CA  1 
ATOM   2831 C  C   . ILE E 1 44 ? -5.893  13.388  -47.921 1.00 27.81 ? 41  ILE E C   1 
ATOM   2832 O  O   . ILE E 1 44 ? -5.906  14.568  -47.519 1.00 27.10 ? 41  ILE E O   1 
ATOM   2833 C  CB  . ILE E 1 44 ? -5.791  12.851  -50.299 1.00 26.69 ? 41  ILE E CB  1 
ATOM   2834 C  CG1 . ILE E 1 44 ? -4.885  12.694  -51.501 1.00 26.17 ? 41  ILE E CG1 1 
ATOM   2835 C  CG2 . ILE E 1 44 ? -6.784  14.012  -50.420 1.00 27.17 ? 41  ILE E CG2 1 
ATOM   2836 C  CD1 . ILE E 1 44 ? -5.706  12.259  -52.699 1.00 27.27 ? 41  ILE E CD1 1 
ATOM   2837 N  N   . GLU E 1 45 ? -6.705  12.454  -47.431 1.00 27.67 ? 42  GLU E N   1 
ATOM   2838 C  CA  . GLU E 1 45 ? -7.649  12.781  -46.344 1.00 28.18 ? 42  GLU E CA  1 
ATOM   2839 C  C   . GLU E 1 45 ? -6.969  13.094  -45.000 1.00 28.11 ? 42  GLU E C   1 
ATOM   2840 O  O   . GLU E 1 45 ? -7.483  13.905  -44.219 1.00 27.17 ? 42  GLU E O   1 
ATOM   2841 C  CB  . GLU E 1 45 ? -8.733  11.687  -46.215 1.00 26.16 ? 42  GLU E CB  1 
ATOM   2842 C  CG  . GLU E 1 45 ? -9.741  11.749  -47.368 1.00 26.23 ? 42  GLU E CG  1 
ATOM   2843 C  CD  . GLU E 1 45 ? -10.930 10.825  -47.178 1.00 26.16 ? 42  GLU E CD  1 
ATOM   2844 O  OE1 . GLU E 1 45 ? -11.833 10.824  -48.061 1.00 23.82 ? 42  GLU E OE1 1 
ATOM   2845 O  OE2 . GLU E 1 45 ? -10.932 10.111  -46.164 1.00 26.05 ? 42  GLU E OE2 1 
ATOM   2846 N  N   . ARG E 1 46 ? -5.822  12.475  -44.743 1.00 32.96 ? 43  ARG E N   1 
ATOM   2847 C  CA  . ARG E 1 46 ? -4.915  12.900  -43.651 1.00 39.30 ? 43  ARG E CA  1 
ATOM   2848 C  C   . ARG E 1 46 ? -4.019  14.127  -43.981 1.00 40.71 ? 43  ARG E C   1 
ATOM   2849 O  O   . ARG E 1 46 ? -3.211  14.541  -43.165 1.00 41.47 ? 43  ARG E O   1 
ATOM   2850 C  CB  . ARG E 1 46 ? -3.988  11.759  -43.254 1.00 42.26 ? 43  ARG E CB  1 
ATOM   2851 C  CG  . ARG E 1 46 ? -4.611  10.757  -42.307 1.00 47.47 ? 43  ARG E CG  1 
ATOM   2852 C  CD  . ARG E 1 46 ? -3.528  9.791   -41.811 1.00 54.77 ? 43  ARG E CD  1 
ATOM   2853 N  NE  . ARG E 1 46 ? -3.193  8.784   -42.831 1.00 59.27 ? 43  ARG E NE  1 
ATOM   2854 C  CZ  . ARG E 1 46 ? -2.158  8.829   -43.684 1.00 61.83 ? 43  ARG E CZ  1 
ATOM   2855 N  NH1 . ARG E 1 46 ? -1.287  9.827   -43.663 1.00 58.70 ? 43  ARG E NH1 1 
ATOM   2856 N  NH2 . ARG E 1 46 ? -1.986  7.847   -44.567 1.00 62.73 ? 43  ARG E NH2 1 
ATOM   2857 N  N   . ASN E 1 47 ? -4.160  14.713  -45.153 1.00 36.39 ? 44  ASN E N   1 
ATOM   2858 C  CA  . ASN E 1 47 ? -3.250  15.772  -45.591 1.00 41.04 ? 44  ASN E CA  1 
ATOM   2859 C  C   . ASN E 1 47 ? -1.770  15.393  -45.602 1.00 39.61 ? 44  ASN E C   1 
ATOM   2860 O  O   . ASN E 1 47 ? -0.925  16.253  -45.476 1.00 43.74 ? 44  ASN E O   1 
ATOM   2861 C  CB  . ASN E 1 47 ? -3.516  17.089  -44.811 1.00 42.60 ? 44  ASN E CB  1 
ATOM   2862 C  CG  . ASN E 1 47 ? -4.925  17.602  -45.048 1.00 44.84 ? 44  ASN E CG  1 
ATOM   2863 O  OD1 . ASN E 1 47 ? -5.389  17.673  -46.194 1.00 47.94 ? 44  ASN E OD1 1 
ATOM   2864 N  ND2 . ASN E 1 47 ? -5.625  17.921  -43.985 1.00 41.49 ? 44  ASN E ND2 1 
ATOM   2865 N  N   . SER E 1 48 ? -1.479  14.107  -45.784 1.00 39.65 ? 45  SER E N   1 
ATOM   2866 C  CA  . SER E 1 48 ? -0.114  13.598  -45.919 1.00 40.29 ? 45  SER E CA  1 
ATOM   2867 C  C   . SER E 1 48 ? 0.283   13.517  -47.364 1.00 38.99 ? 45  SER E C   1 
ATOM   2868 O  O   . SER E 1 48 ? 1.415   13.167  -47.630 1.00 40.79 ? 45  SER E O   1 
ATOM   2869 C  CB  . SER E 1 48 ? 0.015   12.171  -45.372 1.00 44.98 ? 45  SER E CB  1 
ATOM   2870 O  OG  . SER E 1 48 ? -1.266  11.598  -45.148 1.00 54.38 ? 45  SER E OG  1 
ATOM   2871 N  N   . ARG E 1 49 ? -0.642  13.775  -48.298 1.00 32.65 ? 46  ARG E N   1 
ATOM   2872 C  CA  . ARG E 1 49 ? -0.305  13.752  -49.720 1.00 34.82 ? 46  ARG E CA  1 
ATOM   2873 C  C   . ARG E 1 49 ? -0.807  15.007  -50.445 1.00 30.40 ? 46  ARG E C   1 
ATOM   2874 O  O   . ARG E 1 49 ? -1.941  15.431  -50.300 1.00 27.81 ? 46  ARG E O   1 
ATOM   2875 C  CB  . ARG E 1 49 ? -0.878  12.507  -50.478 1.00 35.74 ? 46  ARG E CB  1 
ATOM   2876 C  CG  . ARG E 1 49 ? -0.486  11.134  -49.937 1.00 36.93 ? 46  ARG E CG  1 
ATOM   2877 C  CD  . ARG E 1 49 ? 0.965   10.781  -50.189 1.00 39.65 ? 46  ARG E CD  1 
ATOM   2878 N  NE  . ARG E 1 49 ? 1.175   10.388  -51.574 1.00 42.79 ? 46  ARG E NE  1 
ATOM   2879 C  CZ  . ARG E 1 49 ? 0.920   9.177   -52.076 1.00 48.89 ? 46  ARG E CZ  1 
ATOM   2880 N  NH1 . ARG E 1 49 ? 0.416   8.212   -51.312 1.00 48.93 ? 46  ARG E NH1 1 
ATOM   2881 N  NH2 . ARG E 1 49 ? 1.142   8.930   -53.367 1.00 52.74 ? 46  ARG E NH2 1 
ATOM   2882 N  N   . ASN E 1 50 ? 0.040   15.526  -51.299 1.00 30.33 ? 47  ASN E N   1 
ATOM   2883 C  CA  . ASN E 1 50 ? -0.371  16.546  -52.219 1.00 31.29 ? 47  ASN E CA  1 
ATOM   2884 C  C   . ASN E 1 50 ? -1.072  15.806  -53.389 1.00 33.40 ? 47  ASN E C   1 
ATOM   2885 O  O   . ASN E 1 50 ? -0.922  14.588  -53.612 1.00 39.00 ? 47  ASN E O   1 
ATOM   2886 C  CB  . ASN E 1 50 ? 0.829   17.368  -52.570 1.00 32.16 ? 47  ASN E CB  1 
ATOM   2887 C  CG  . ASN E 1 50 ? 0.496   18.716  -53.230 1.00 32.80 ? 47  ASN E CG  1 
ATOM   2888 O  OD1 . ASN E 1 50 ? -0.636  19.313  -53.152 1.00 26.58 ? 47  ASN E OD1 1 
ATOM   2889 N  ND2 . ASN E 1 50 ? 1.538   19.238  -53.844 1.00 29.93 ? 47  ASN E ND2 1 
ATOM   2890 N  N   . LEU E 1 51 ? -1.971  16.518  -54.001 1.00 27.27 ? 48  LEU E N   1 
ATOM   2891 C  CA  . LEU E 1 51 ? -2.928  15.988  -54.935 1.00 26.15 ? 48  LEU E CA  1 
ATOM   2892 C  C   . LEU E 1 51 ? -2.744  16.889  -56.122 1.00 21.75 ? 48  LEU E C   1 
ATOM   2893 O  O   . LEU E 1 51 ? -2.673  18.105  -55.954 1.00 20.41 ? 48  LEU E O   1 
ATOM   2894 C  CB  . LEU E 1 51 ? -4.312  16.214  -54.309 1.00 27.14 ? 48  LEU E CB  1 
ATOM   2895 C  CG  . LEU E 1 51 ? -5.617  16.234  -55.057 1.00 28.78 ? 48  LEU E CG  1 
ATOM   2896 C  CD1 . LEU E 1 51 ? -6.099  14.844  -55.360 1.00 30.06 ? 48  LEU E CD1 1 
ATOM   2897 C  CD2 . LEU E 1 51 ? -6.619  16.908  -54.138 1.00 34.04 ? 48  LEU E CD2 1 
ATOM   2898 N  N   . THR E 1 52 ? -2.663  16.309  -57.290 1.00 23.54 ? 49  THR E N   1 
ATOM   2899 C  CA  . THR E 1 52 ? -2.716  17.060  -58.556 1.00 22.05 ? 49  THR E CA  1 
ATOM   2900 C  C   . THR E 1 52 ? -4.142  17.405  -58.890 1.00 22.77 ? 49  THR E C   1 
ATOM   2901 O  O   . THR E 1 52 ? -5.112  16.716  -58.443 1.00 17.87 ? 49  THR E O   1 
ATOM   2902 C  CB  . THR E 1 52 ? -2.084  16.291  -59.734 1.00 24.44 ? 49  THR E CB  1 
ATOM   2903 O  OG1 . THR E 1 52 ? -2.800  15.085  -59.994 1.00 25.51 ? 49  THR E OG1 1 
ATOM   2904 C  CG2 . THR E 1 52 ? -0.659  15.939  -59.489 1.00 26.15 ? 49  THR E CG2 1 
ATOM   2905 N  N   . ILE E 1 53 ? -4.270  18.433  -59.747 1.00 17.23 ? 50  ILE E N   1 
ATOM   2906 C  CA  . ILE E 1 53 ? -5.528  18.784  -60.331 1.00 18.71 ? 50  ILE E CA  1 
ATOM   2907 C  C   . ILE E 1 53 ? -6.104  17.607  -61.122 1.00 18.36 ? 50  ILE E C   1 
ATOM   2908 O  O   . ILE E 1 53 ? -7.323  17.392  -61.082 1.00 15.05 ? 50  ILE E O   1 
ATOM   2909 C  CB  . ILE E 1 53 ? -5.388  20.054  -61.213 1.00 19.79 ? 50  ILE E CB  1 
ATOM   2910 C  CG1 . ILE E 1 53 ? -4.942  21.260  -60.330 1.00 23.98 ? 50  ILE E CG1 1 
ATOM   2911 C  CG2 . ILE E 1 53 ? -6.694  20.367  -61.944 1.00 19.57 ? 50  ILE E CG2 1 
ATOM   2912 C  CD1 . ILE E 1 53 ? -5.987  21.589  -59.320 1.00 27.46 ? 50  ILE E CD1 1 
ATOM   2913 N  N   . LYS E 1 54 ? -5.237  16.858  -61.813 1.00 17.89 ? 51  LYS E N   1 
ATOM   2914 C  CA  . LYS E 1 54 ? -5.732  15.651  -62.560 1.00 22.02 ? 51  LYS E CA  1 
ATOM   2915 C  C   . LYS E 1 54 ? -6.367  14.587  -61.627 1.00 20.42 ? 51  LYS E C   1 
ATOM   2916 O  O   . LYS E 1 54 ? -7.435  14.011  -61.956 1.00 19.33 ? 51  LYS E O   1 
ATOM   2917 C  CB  . LYS E 1 54 ? -4.651  14.967  -63.383 1.00 25.44 ? 51  LYS E CB  1 
ATOM   2918 C  CG  . LYS E 1 54 ? -4.255  15.751  -64.616 1.00 31.48 ? 51  LYS E CG  1 
ATOM   2919 C  CD  . LYS E 1 54 ? -3.449  14.938  -65.648 1.00 36.03 ? 51  LYS E CD  1 
ATOM   2920 C  CE  . LYS E 1 54 ? -2.671  15.886  -66.577 1.00 40.53 ? 51  LYS E CE  1 
ATOM   2921 N  NZ  . LYS E 1 54 ? -1.606  15.264  -67.422 1.00 40.51 ? 51  LYS E NZ  1 
ATOM   2922 N  N   . SER E 1 55 ? -5.708  14.354  -60.508 1.00 19.65 ? 52  SER E N   1 
ATOM   2923 C  CA  . SER E 1 55 ? -6.250  13.488  -59.443 1.00 19.07 ? 52  SER E CA  1 
ATOM   2924 C  C   . SER E 1 55 ? -7.528  13.991  -58.814 1.00 19.93 ? 52  SER E C   1 
ATOM   2925 O  O   . SER E 1 55 ? -8.482  13.194  -58.573 1.00 21.10 ? 52  SER E O   1 
ATOM   2926 C  CB  . SER E 1 55 ? -5.198  13.231  -58.417 1.00 20.15 ? 52  SER E CB  1 
ATOM   2927 O  OG  . SER E 1 55 ? -4.146  12.461  -59.023 1.00 25.65 ? 52  SER E OG  1 
ATOM   2928 N  N   . LEU E 1 56 ? -7.604  15.305  -58.564 1.00 18.33 ? 53  LEU E N   1 
ATOM   2929 C  CA  . LEU E 1 56 ? -8.850  15.916  -58.135 1.00 16.85 ? 53  LEU E CA  1 
ATOM   2930 C  C   . LEU E 1 56 ? -10.003 15.639  -59.073 1.00 17.18 ? 53  LEU E C   1 
ATOM   2931 O  O   . LEU E 1 56 ? -11.100 15.341  -58.636 1.00 15.69 ? 53  LEU E O   1 
ATOM   2932 C  CB  . LEU E 1 56 ? -8.716  17.410  -57.909 1.00 18.53 ? 53  LEU E CB  1 
ATOM   2933 C  CG  . LEU E 1 56 ? -10.015 18.127  -57.499 1.00 18.08 ? 53  LEU E CG  1 
ATOM   2934 C  CD1 . LEU E 1 56 ? -10.610 17.626  -56.160 1.00 19.21 ? 53  LEU E CD1 1 
ATOM   2935 C  CD2 . LEU E 1 56 ? -9.794  19.626  -57.379 1.00 19.12 ? 53  LEU E CD2 1 
ATOM   2936 N  N   . GLU E 1 57 ? -9.761  15.722  -60.378 1.00 16.35 ? 54  GLU E N   1 
ATOM   2937 C  CA  . GLU E 1 57 ? -10.814 15.541  -61.332 1.00 16.78 ? 54  GLU E CA  1 
ATOM   2938 C  C   . GLU E 1 57 ? -11.299 14.060  -61.324 1.00 15.03 ? 54  GLU E C   1 
ATOM   2939 O  O   . GLU E 1 57 ? -12.491 13.816  -61.544 1.00 17.01 ? 54  GLU E O   1 
ATOM   2940 C  CB  . GLU E 1 57 ? -10.267 15.943  -62.725 1.00 18.37 ? 54  GLU E CB  1 
ATOM   2941 C  CG  . GLU E 1 57 ? -11.224 15.723  -63.888 1.00 21.65 ? 54  GLU E CG  1 
ATOM   2942 C  CD  . GLU E 1 57 ? -10.617 16.246  -65.210 1.00 22.07 ? 54  GLU E CD  1 
ATOM   2943 O  OE1 . GLU E 1 57 ? -11.277 17.046  -65.915 1.00 19.84 ? 54  GLU E OE1 1 
ATOM   2944 O  OE2 . GLU E 1 57 ? -9.471  15.851  -65.525 1.00 22.68 ? 54  GLU E OE2 1 
ATOM   2945 N  N   . LEU E 1 58 ? -10.370 13.104  -61.196 1.00 15.89 ? 55  LEU E N   1 
ATOM   2946 C  CA  . LEU E 1 58 ? -10.745 11.677  -61.045 1.00 17.55 ? 55  LEU E CA  1 
ATOM   2947 C  C   . LEU E 1 58 ? -11.638 11.458  -59.808 1.00 16.86 ? 55  LEU E C   1 
ATOM   2948 O  O   . LEU E 1 58 ? -12.641 10.750  -59.864 1.00 14.78 ? 55  LEU E O   1 
ATOM   2949 C  CB  . LEU E 1 58 ? -9.507  10.811  -60.937 1.00 19.54 ? 55  LEU E CB  1 
ATOM   2950 C  CG  . LEU E 1 58 ? -8.781  10.681  -62.307 1.00 20.78 ? 55  LEU E CG  1 
ATOM   2951 C  CD1 . LEU E 1 58 ? -7.476  10.058  -62.025 1.00 22.72 ? 55  LEU E CD1 1 
ATOM   2952 C  CD2 . LEU E 1 58 ? -9.546  9.792   -63.287 1.00 26.14 ? 55  LEU E CD2 1 
ATOM   2953 N  N   . ILE E 1 59 ? -11.252 12.098  -58.698 1.00 18.35 ? 56  ILE E N   1 
ATOM   2954 C  CA  . ILE E 1 59 ? -12.062 12.065  -57.455 1.00 17.28 ? 56  ILE E CA  1 
ATOM   2955 C  C   . ILE E 1 59 ? -13.427 12.652  -57.632 1.00 17.89 ? 56  ILE E C   1 
ATOM   2956 O  O   . ILE E 1 59 ? -14.435 12.050  -57.161 1.00 17.63 ? 56  ILE E O   1 
ATOM   2957 C  CB  . ILE E 1 59 ? -11.278 12.674  -56.298 1.00 17.05 ? 56  ILE E CB  1 
ATOM   2958 C  CG1 . ILE E 1 59 ? -10.155 11.722  -55.982 1.00 16.67 ? 56  ILE E CG1 1 
ATOM   2959 C  CG2 . ILE E 1 59 ? -12.167 12.915  -55.068 1.00 18.40 ? 56  ILE E CG2 1 
ATOM   2960 C  CD1 . ILE E 1 59 ? -9.079  12.262  -55.097 1.00 19.06 ? 56  ILE E CD1 1 
ATOM   2961 N  N   . MET E 1 60 ? -13.528 13.804  -58.282 1.00 16.82 ? 57  MET E N   1 
ATOM   2962 C  CA  . MET E 1 60 ? -14.878 14.401  -58.505 1.00 20.64 ? 57  MET E CA  1 
ATOM   2963 C  C   . MET E 1 60 ? -15.784 13.497  -59.345 1.00 20.78 ? 57  MET E C   1 
ATOM   2964 O  O   . MET E 1 60 ? -16.964 13.303  -59.033 1.00 21.33 ? 57  MET E O   1 
ATOM   2965 C  CB  . MET E 1 60 ? -14.818 15.794  -59.117 1.00 23.32 ? 57  MET E CB  1 
ATOM   2966 C  CG  . MET E 1 60 ? -14.114 16.803  -58.184 1.00 26.36 ? 57  MET E CG  1 
ATOM   2967 S  SD  . MET E 1 60 ? -13.643 18.352  -59.037 1.00 27.35 ? 57  MET E SD  1 
ATOM   2968 C  CE  . MET E 1 60 ? -15.290 18.810  -59.486 1.00 27.44 ? 57  MET E CE  1 
ATOM   2969 N  N   . LYS E 1 61 ? -15.188 12.876  -60.351 1.00 19.63 ? 58  LYS E N   1 
ATOM   2970 C  CA  . LYS E 1 61 ? -15.870 11.883  -61.171 1.00 20.66 ? 58  LYS E CA  1 
ATOM   2971 C  C   . LYS E 1 61 ? -16.328 10.695  -60.285 1.00 19.92 ? 58  LYS E C   1 
ATOM   2972 O  O   . LYS E 1 61 ? -17.508 10.286  -60.318 1.00 18.62 ? 58  LYS E O   1 
ATOM   2973 C  CB  . LYS E 1 61 ? -14.925 11.439  -62.326 1.00 22.10 ? 58  LYS E CB  1 
ATOM   2974 C  CG  . LYS E 1 61 ? -14.757 12.558  -63.394 1.00 32.01 ? 58  LYS E CG  1 
ATOM   2975 C  CD  . LYS E 1 61 ? -13.499 12.607  -64.321 1.00 29.56 ? 58  LYS E CD  1 
ATOM   2976 C  CE  . LYS E 1 61 ? -13.526 11.531  -65.393 1.00 35.62 ? 58  LYS E CE  1 
ATOM   2977 N  NZ  . LYS E 1 61 ? -12.168 11.152  -65.952 1.00 29.44 ? 58  LYS E NZ  1 
ATOM   2978 N  N   . GLY E 1 62 ? -15.412 10.192  -59.453 1.00 18.00 ? 59  GLY E N   1 
ATOM   2979 C  CA  . GLY E 1 62 ? -15.710 9.097   -58.511 1.00 19.87 ? 59  GLY E CA  1 
ATOM   2980 C  C   . GLY E 1 62 ? -16.824 9.411   -57.483 1.00 20.24 ? 59  GLY E C   1 
ATOM   2981 O  O   . GLY E 1 62 ? -17.651 8.553   -57.177 1.00 19.23 ? 59  GLY E O   1 
ATOM   2982 N  N   . LEU E 1 63 ? -16.844 10.638  -56.961 1.00 18.32 ? 60  LEU E N   1 
ATOM   2983 C  CA  . LEU E 1 63 ? -17.886 11.098  -56.040 1.00 18.38 ? 60  LEU E CA  1 
ATOM   2984 C  C   . LEU E 1 63 ? -19.213 11.389  -56.677 1.00 20.73 ? 60  LEU E C   1 
ATOM   2985 O  O   . LEU E 1 63 ? -20.219 11.589  -55.968 1.00 22.23 ? 60  LEU E O   1 
ATOM   2986 C  CB  . LEU E 1 63 ? -17.412 12.364  -55.318 1.00 18.57 ? 60  LEU E CB  1 
ATOM   2987 C  CG  . LEU E 1 63 ? -16.199 12.249  -54.330 1.00 19.62 ? 60  LEU E CG  1 
ATOM   2988 C  CD1 . LEU E 1 63 ? -15.741 13.665  -53.987 1.00 21.12 ? 60  LEU E CD1 1 
ATOM   2989 C  CD2 . LEU E 1 63 ? -16.525 11.488  -53.056 1.00 22.29 ? 60  LEU E CD2 1 
ATOM   2990 N  N   . GLU E 1 64 ? -19.228 11.459  -58.008 1.00 20.87 ? 61  GLU E N   1 
ATOM   2991 C  CA  . GLU E 1 64 ? -20.426 11.799  -58.738 1.00 23.16 ? 61  GLU E CA  1 
ATOM   2992 C  C   . GLU E 1 64 ? -20.972 13.118  -58.287 1.00 24.05 ? 61  GLU E C   1 
ATOM   2993 O  O   . GLU E 1 64 ? -22.176 13.260  -58.136 1.00 21.91 ? 61  GLU E O   1 
ATOM   2994 C  CB  . GLU E 1 64 ? -21.482 10.646  -58.658 1.00 25.98 ? 61  GLU E CB  1 
ATOM   2995 C  CG  . GLU E 1 64 ? -20.913 9.333   -59.131 1.00 29.65 ? 61  GLU E CG  1 
ATOM   2996 C  CD  . GLU E 1 64 ? -21.902 8.153   -58.998 1.00 34.22 ? 61  GLU E CD  1 
ATOM   2997 O  OE1 . GLU E 1 64 ? -23.036 8.308   -58.515 1.00 42.83 ? 61  GLU E OE1 1 
ATOM   2998 O  OE2 . GLU E 1 64 ? -21.532 7.054   -59.364 1.00 35.68 ? 61  GLU E OE2 1 
ATOM   2999 N  N   . VAL E 1 65 ? -20.093 14.109  -58.075 1.00 20.74 ? 62  VAL E N   1 
ATOM   3000 C  CA  . VAL E 1 65 ? -20.596 15.404  -57.598 1.00 20.87 ? 62  VAL E CA  1 
ATOM   3001 C  C   . VAL E 1 65 ? -20.484 16.458  -58.704 1.00 18.29 ? 62  VAL E C   1 
ATOM   3002 O  O   . VAL E 1 65 ? -19.503 16.442  -59.448 1.00 16.72 ? 62  VAL E O   1 
ATOM   3003 C  CB  . VAL E 1 65 ? -19.842 15.809  -56.306 1.00 19.83 ? 62  VAL E CB  1 
ATOM   3004 C  CG1 . VAL E 1 65 ? -18.335 15.990  -56.566 1.00 21.92 ? 62  VAL E CG1 1 
ATOM   3005 C  CG2 . VAL E 1 65 ? -20.470 17.016  -55.702 1.00 23.20 ? 62  VAL E CG2 1 
ATOM   3006 N  N   . SER E 1 66 ? -21.477 17.348  -58.816 1.00 20.24 ? 63  SER E N   1 
ATOM   3007 C  CA  . SER E 1 66 ? -21.380 18.454  -59.771 1.00 22.75 ? 63  SER E CA  1 
ATOM   3008 C  C   . SER E 1 66 ? -20.207 19.384  -59.428 1.00 24.55 ? 63  SER E C   1 
ATOM   3009 O  O   . SER E 1 66 ? -19.869 19.550  -58.230 1.00 19.83 ? 63  SER E O   1 
ATOM   3010 C  CB  . SER E 1 66 ? -22.666 19.256  -59.857 1.00 24.85 ? 63  SER E CB  1 
ATOM   3011 O  OG  . SER E 1 66 ? -22.794 20.266  -58.856 1.00 31.66 ? 63  SER E OG  1 
ATOM   3012 N  N   . ASP E 1 67 ? -19.599 19.982  -60.445 1.00 25.31 ? 64  ASP E N   1 
ATOM   3013 C  CA  . ASP E 1 67 ? -18.498 20.989  -60.205 1.00 29.79 ? 64  ASP E CA  1 
ATOM   3014 C  C   . ASP E 1 67 ? -19.011 22.191  -59.416 1.00 29.99 ? 64  ASP E C   1 
ATOM   3015 O  O   . ASP E 1 67 ? -18.337 22.690  -58.529 1.00 29.36 ? 64  ASP E O   1 
ATOM   3016 C  CB  . ASP E 1 67 ? -17.859 21.487  -61.485 1.00 34.09 ? 64  ASP E CB  1 
ATOM   3017 C  CG  . ASP E 1 67 ? -17.006 20.415  -62.187 1.00 40.37 ? 64  ASP E CG  1 
ATOM   3018 O  OD1 . ASP E 1 67 ? -17.557 19.633  -62.963 1.00 40.20 ? 64  ASP E OD1 1 
ATOM   3019 O  OD2 . ASP E 1 67 ? -15.763 20.379  -61.990 1.00 55.03 ? 64  ASP E OD2 1 
ATOM   3020 N  N   . VAL E 1 68 ? -20.211 22.644  -59.749 1.00 26.92 ? 65  VAL E N   1 
ATOM   3021 C  CA  . VAL E 1 68 ? -20.839 23.732  -59.037 1.00 31.09 ? 65  VAL E CA  1 
ATOM   3022 C  C   . VAL E 1 68 ? -20.957 23.431  -57.545 1.00 27.87 ? 65  VAL E C   1 
ATOM   3023 O  O   . VAL E 1 68 ? -20.546 24.261  -56.729 1.00 25.97 ? 65  VAL E O   1 
ATOM   3024 C  CB  . VAL E 1 68 ? -22.239 24.061  -59.621 1.00 34.18 ? 65  VAL E CB  1 
ATOM   3025 C  CG1 . VAL E 1 68 ? -23.040 24.956  -58.674 1.00 37.70 ? 65  VAL E CG1 1 
ATOM   3026 C  CG2 . VAL E 1 68 ? -22.077 24.722  -60.969 1.00 36.21 ? 65  VAL E CG2 1 
ATOM   3027 N  N   . VAL E 1 69 ? -21.483 22.256  -57.194 1.00 25.06 ? 66  VAL E N   1 
ATOM   3028 C  CA  . VAL E 1 69 ? -21.616 21.878  -55.792 1.00 26.28 ? 66  VAL E CA  1 
ATOM   3029 C  C   . VAL E 1 69 ? -20.232 21.783  -55.119 1.00 24.18 ? 66  VAL E C   1 
ATOM   3030 O  O   . VAL E 1 69 ? -20.052 22.301  -54.014 1.00 22.98 ? 66  VAL E O   1 
ATOM   3031 C  CB  . VAL E 1 69 ? -22.481 20.615  -55.573 1.00 24.67 ? 66  VAL E CB  1 
ATOM   3032 C  CG1 . VAL E 1 69 ? -22.419 20.103  -54.136 1.00 25.86 ? 66  VAL E CG1 1 
ATOM   3033 C  CG2 . VAL E 1 69 ? -23.932 20.931  -55.927 1.00 26.06 ? 66  VAL E CG2 1 
ATOM   3034 N  N   . PHE E 1 70 ? -19.284 21.167  -55.793 1.00 20.22 ? 67  PHE E N   1 
ATOM   3035 C  CA  . PHE E 1 70 ? -17.983 20.925  -55.206 1.00 22.07 ? 67  PHE E CA  1 
ATOM   3036 C  C   . PHE E 1 70 ? -17.268 22.259  -54.898 1.00 21.00 ? 67  PHE E C   1 
ATOM   3037 O  O   . PHE E 1 70 ? -16.728 22.445  -53.812 1.00 17.36 ? 67  PHE E O   1 
ATOM   3038 C  CB  . PHE E 1 70 ? -17.081 20.114  -56.133 1.00 19.82 ? 67  PHE E CB  1 
ATOM   3039 C  CG  . PHE E 1 70 ? -15.775 19.736  -55.500 1.00 20.70 ? 67  PHE E CG  1 
ATOM   3040 C  CD1 . PHE E 1 70 ? -15.646 18.562  -54.775 1.00 21.65 ? 67  PHE E CD1 1 
ATOM   3041 C  CD2 . PHE E 1 70 ? -14.686 20.585  -55.551 1.00 21.52 ? 67  PHE E CD2 1 
ATOM   3042 C  CE1 . PHE E 1 70 ? -14.462 18.247  -54.113 1.00 21.52 ? 67  PHE E CE1 1 
ATOM   3043 C  CE2 . PHE E 1 70 ? -13.516 20.292  -54.873 1.00 18.73 ? 67  PHE E CE2 1 
ATOM   3044 C  CZ  . PHE E 1 70 ? -13.395 19.111  -54.170 1.00 21.41 ? 67  PHE E CZ  1 
ATOM   3045 N  N   . PHE E 1 71 ? -17.271 23.152  -55.879 1.00 18.84 ? 68  PHE E N   1 
ATOM   3046 C  CA  . PHE E 1 71 ? -16.518 24.407  -55.741 1.00 20.68 ? 68  PHE E CA  1 
ATOM   3047 C  C   . PHE E 1 71 ? -17.251 25.390  -54.870 1.00 18.89 ? 68  PHE E C   1 
ATOM   3048 O  O   . PHE E 1 71 ? -16.573 26.108  -54.129 1.00 19.76 ? 68  PHE E O   1 
ATOM   3049 C  CB  . PHE E 1 71 ? -16.077 25.000  -57.084 1.00 20.33 ? 68  PHE E CB  1 
ATOM   3050 C  CG  . PHE E 1 71 ? -14.982 24.252  -57.669 1.00 19.56 ? 68  PHE E CG  1 
ATOM   3051 C  CD1 . PHE E 1 71 ? -13.768 24.231  -57.053 1.00 20.41 ? 68  PHE E CD1 1 
ATOM   3052 C  CD2 . PHE E 1 71 ? -15.132 23.550  -58.830 1.00 20.55 ? 68  PHE E CD2 1 
ATOM   3053 C  CE1 . PHE E 1 71 ? -12.731 23.501  -57.544 1.00 21.17 ? 68  PHE E CE1 1 
ATOM   3054 C  CE2 . PHE E 1 71 ? -14.098 22.817  -59.330 1.00 19.45 ? 68  PHE E CE2 1 
ATOM   3055 C  CZ  . PHE E 1 71 ? -12.887 22.788  -58.693 1.00 21.39 ? 68  PHE E CZ  1 
ATOM   3056 N  N   . GLU E 1 72 ? -18.576 25.300  -54.807 1.00 21.33 ? 69  GLU E N   1 
ATOM   3057 C  CA  . GLU E 1 72 ? -19.365 26.056  -53.824 1.00 23.43 ? 69  GLU E CA  1 
ATOM   3058 C  C   . GLU E 1 72 ? -19.125 25.629  -52.402 1.00 22.57 ? 69  GLU E C   1 
ATOM   3059 O  O   . GLU E 1 72 ? -19.084 26.472  -51.504 1.00 20.99 ? 69  GLU E O   1 
ATOM   3060 C  CB  . GLU E 1 72 ? -20.868 26.013  -54.100 1.00 25.56 ? 69  GLU E CB  1 
ATOM   3061 C  CG  . GLU E 1 72 ? -21.280 27.033  -55.144 1.00 30.56 ? 69  GLU E CG  1 
ATOM   3062 C  CD  . GLU E 1 72 ? -22.769 26.999  -55.503 1.00 35.68 ? 69  GLU E CD  1 
ATOM   3063 O  OE1 . GLU E 1 72 ? -23.576 26.341  -54.806 1.00 39.20 ? 69  GLU E OE1 1 
ATOM   3064 O  OE2 . GLU E 1 72 ? -23.111 27.657  -56.504 1.00 41.76 ? 69  GLU E OE2 1 
ATOM   3065 N  N   . MET E 1 73 ? -19.019 24.315  -52.196 1.00 21.41 ? 70  MET E N   1 
ATOM   3066 C  CA  . MET E 1 73 ? -18.715 23.764  -50.890 1.00 20.90 ? 70  MET E CA  1 
ATOM   3067 C  C   . MET E 1 73 ? -17.318 24.217  -50.472 1.00 18.05 ? 70  MET E C   1 
ATOM   3068 O  O   . MET E 1 73 ? -17.091 24.561  -49.303 1.00 17.04 ? 70  MET E O   1 
ATOM   3069 C  CB  . MET E 1 73 ? -18.802 22.217  -50.875 1.00 21.14 ? 70  MET E CB  1 
ATOM   3070 C  CG  . MET E 1 73 ? -20.258 21.665  -50.898 1.00 24.11 ? 70  MET E CG  1 
ATOM   3071 S  SD  . MET E 1 73 ? -20.262 19.833  -50.983 1.00 24.33 ? 70  MET E SD  1 
ATOM   3072 C  CE  . MET E 1 73 ? -19.740 19.389  -49.329 1.00 22.50 ? 70  MET E CE  1 
ATOM   3073 N  N   . LEU E 1 74 ? -16.368 24.153  -51.410 1.00 19.47 ? 71  LEU E N   1 
ATOM   3074 C  CA  . LEU E 1 74 ? -14.968 24.583  -51.155 1.00 16.41 ? 71  LEU E CA  1 
ATOM   3075 C  C   . LEU E 1 74 ? -14.901 26.066  -50.708 1.00 17.77 ? 71  LEU E C   1 
ATOM   3076 O  O   . LEU E 1 74 ? -14.246 26.372  -49.705 1.00 16.79 ? 71  LEU E O   1 
ATOM   3077 C  CB  . LEU E 1 74 ? -14.090 24.312  -52.343 1.00 16.42 ? 71  LEU E CB  1 
ATOM   3078 C  CG  . LEU E 1 74 ? -12.617 24.667  -52.158 1.00 16.34 ? 71  LEU E CG  1 
ATOM   3079 C  CD1 . LEU E 1 74 ? -11.980 23.963  -51.001 1.00 15.63 ? 71  LEU E CD1 1 
ATOM   3080 C  CD2 . LEU E 1 74 ? -11.795 24.382  -53.414 1.00 18.30 ? 71  LEU E CD2 1 
ATOM   3081 N  N   . ILE E 1 75 ? -15.607 26.953  -51.404 1.00 16.81 ? 72  ILE E N   1 
ATOM   3082 C  CA  . ILE E 1 75 ? -15.611 28.383  -51.059 1.00 19.52 ? 72  ILE E CA  1 
ATOM   3083 C  C   . ILE E 1 75 ? -16.246 28.578  -49.676 1.00 20.12 ? 72  ILE E C   1 
ATOM   3084 O  O   . ILE E 1 75 ? -15.746 29.340  -48.824 1.00 19.35 ? 72  ILE E O   1 
ATOM   3085 C  CB  . ILE E 1 75 ? -16.387 29.219  -52.099 1.00 21.25 ? 72  ILE E CB  1 
ATOM   3086 C  CG1 . ILE E 1 75 ? -15.593 29.347  -53.405 1.00 24.11 ? 72  ILE E CG1 1 
ATOM   3087 C  CG2 . ILE E 1 75 ? -16.699 30.574  -51.525 1.00 24.51 ? 72  ILE E CG2 1 
ATOM   3088 C  CD1 . ILE E 1 75 ? -16.418 29.584  -54.657 1.00 25.61 ? 72  ILE E CD1 1 
ATOM   3089 N  N   . LYS E 1 76 ? -17.320 27.851  -49.410 1.00 20.10 ? 73  LYS E N   1 
ATOM   3090 C  CA  . LYS E 1 76 ? -17.955 27.924  -48.114 1.00 22.84 ? 73  LYS E CA  1 
ATOM   3091 C  C   . LYS E 1 76 ? -17.103 27.481  -46.968 1.00 21.93 ? 73  LYS E C   1 
ATOM   3092 O  O   . LYS E 1 76 ? -17.153 28.086  -45.908 1.00 22.84 ? 73  LYS E O   1 
ATOM   3093 C  CB  . LYS E 1 76 ? -19.249 27.135  -48.099 1.00 27.39 ? 73  LYS E CB  1 
ATOM   3094 C  CG  . LYS E 1 76 ? -20.350 27.884  -48.794 1.00 32.35 ? 73  LYS E CG  1 
ATOM   3095 C  CD  . LYS E 1 76 ? -21.647 27.071  -48.744 1.00 36.50 ? 73  LYS E CD  1 
ATOM   3096 C  CE  . LYS E 1 76 ? -22.610 27.555  -49.800 1.00 40.33 ? 73  LYS E CE  1 
ATOM   3097 N  NZ  . LYS E 1 76 ? -23.828 26.708  -49.695 1.00 45.72 ? 73  LYS E NZ  1 
ATOM   3098 N  N   . GLU E 1 77 ? -16.298 26.435  -47.156 1.00 20.57 ? 74  GLU E N   1 
ATOM   3099 C  CA  . GLU E 1 77 ? -15.421 25.969  -46.142 1.00 19.18 ? 74  GLU E CA  1 
ATOM   3100 C  C   . GLU E 1 77 ? -14.235 26.912  -45.982 1.00 19.67 ? 74  GLU E C   1 
ATOM   3101 O  O   . GLU E 1 77 ? -13.810 27.161  -44.850 1.00 17.23 ? 74  GLU E O   1 
ATOM   3102 C  CB  . GLU E 1 77 ? -14.922 24.565  -46.450 1.00 21.44 ? 74  GLU E CB  1 
ATOM   3103 C  CG  . GLU E 1 77 ? -15.999 23.525  -46.383 1.00 24.10 ? 74  GLU E CG  1 
ATOM   3104 C  CD  . GLU E 1 77 ? -16.677 23.441  -45.003 1.00 27.07 ? 74  GLU E CD  1 
ATOM   3105 O  OE1 . GLU E 1 77 ? -17.881 23.093  -44.960 1.00 32.00 ? 74  GLU E OE1 1 
ATOM   3106 O  OE2 . GLU E 1 77 ? -16.006 23.648  -43.980 1.00 28.03 ? 74  GLU E OE2 1 
ATOM   3107 N  N   . ILE E 1 78 ? -13.677 27.407  -47.104 1.00 18.17 ? 75  ILE E N   1 
ATOM   3108 C  CA  . ILE E 1 78 ? -12.549 28.384  -47.040 1.00 18.22 ? 75  ILE E CA  1 
ATOM   3109 C  C   . ILE E 1 78 ? -13.020 29.593  -46.180 1.00 19.44 ? 75  ILE E C   1 
ATOM   3110 O  O   . ILE E 1 78 ? -12.305 30.073  -45.289 1.00 16.60 ? 75  ILE E O   1 
ATOM   3111 C  CB  . ILE E 1 78 ? -12.113 28.827  -48.448 1.00 17.42 ? 75  ILE E CB  1 
ATOM   3112 C  CG1 . ILE E 1 78 ? -11.257 27.732  -49.130 1.00 17.77 ? 75  ILE E CG1 1 
ATOM   3113 C  CG2 . ILE E 1 78 ? -11.303 30.110  -48.401 1.00 18.45 ? 75  ILE E CG2 1 
ATOM   3114 C  CD1 . ILE E 1 78 ? -10.997 27.982  -50.613 1.00 18.32 ? 75  ILE E CD1 1 
ATOM   3115 N  N   . LEU E 1 79 ? -14.264 30.030  -46.379 1.00 17.26 ? 76  LEU E N   1 
ATOM   3116 C  CA  . LEU E 1 79 ? -14.732 31.211  -45.671 1.00 19.62 ? 76  LEU E CA  1 
ATOM   3117 C  C   . LEU E 1 79 ? -15.496 30.995  -44.403 1.00 20.14 ? 76  LEU E C   1 
ATOM   3118 O  O   . LEU E 1 79 ? -16.082 31.969  -43.906 1.00 21.49 ? 76  LEU E O   1 
ATOM   3119 C  CB  . LEU E 1 79 ? -15.616 32.046  -46.560 1.00 21.98 ? 76  LEU E CB  1 
ATOM   3120 C  CG  . LEU E 1 79 ? -14.974 32.669  -47.766 1.00 22.15 ? 76  LEU E CG  1 
ATOM   3121 C  CD1 . LEU E 1 79 ? -16.135 33.254  -48.567 1.00 25.07 ? 76  LEU E CD1 1 
ATOM   3122 C  CD2 . LEU E 1 79 ? -13.993 33.753  -47.390 1.00 21.40 ? 76  LEU E CD2 1 
ATOM   3123 N  N   . LYS E 1 80 ? -15.484 29.790  -43.840 1.00 19.49 ? 77  LYS E N   1 
ATOM   3124 C  CA  . LYS E 1 80 ? -16.316 29.519  -42.691 1.00 22.52 ? 77  LYS E CA  1 
ATOM   3125 C  C   . LYS E 1 80 ? -15.887 30.255  -41.414 1.00 20.51 ? 77  LYS E C   1 
ATOM   3126 O  O   . LYS E 1 80 ? -16.723 30.871  -40.719 1.00 16.38 ? 77  LYS E O   1 
ATOM   3127 C  CB  . LYS E 1 80 ? -16.302 28.048  -42.382 1.00 28.03 ? 77  LYS E CB  1 
ATOM   3128 C  CG  . LYS E 1 80 ? -17.481 27.657  -41.515 1.00 35.77 ? 77  LYS E CG  1 
ATOM   3129 C  CD  . LYS E 1 80 ? -17.046 26.710  -40.417 1.00 44.54 ? 77  LYS E CD  1 
ATOM   3130 C  CE  . LYS E 1 80 ? -17.576 25.318  -40.642 1.00 52.02 ? 77  LYS E CE  1 
ATOM   3131 N  NZ  . LYS E 1 80 ? -16.967 24.766  -41.886 1.00 55.22 ? 77  LYS E NZ  1 
ATOM   3132 N  N   . HIS E 1 81 ? -14.614 30.121  -41.032 1.00 17.14 ? 78  HIS E N   1 
ATOM   3133 C  CA  . HIS E 1 81 ? -14.099 30.866  -39.862 1.00 19.97 ? 78  HIS E CA  1 
ATOM   3134 C  C   . HIS E 1 81 ? -12.581 30.766  -39.792 1.00 17.73 ? 78  HIS E C   1 
ATOM   3135 O  O   . HIS E 1 81 ? -12.014 29.674  -39.840 1.00 17.31 ? 78  HIS E O   1 
ATOM   3136 C  CB  . HIS E 1 81 ? -14.725 30.429  -38.503 1.00 25.68 ? 78  HIS E CB  1 
ATOM   3137 C  CG  . HIS E 1 81 ? -14.652 28.959  -38.224 1.00 34.97 ? 78  HIS E CG  1 
ATOM   3138 N  ND1 . HIS E 1 81 ? -15.752 28.226  -37.808 1.00 43.90 ? 78  HIS E ND1 1 
ATOM   3139 C  CD2 . HIS E 1 81 ? -13.615 28.084  -38.251 1.00 43.62 ? 78  HIS E CD2 1 
ATOM   3140 C  CE1 . HIS E 1 81 ? -15.398 26.965  -37.619 1.00 44.30 ? 78  HIS E CE1 1 
ATOM   3141 N  NE2 . HIS E 1 81 ? -14.108 26.850  -37.883 1.00 44.67 ? 78  HIS E NE2 1 
ATOM   3142 N  N   . ASP E 1 82 ? -11.924 31.924  -39.714 1.00 18.04 ? 79  ASP E N   1 
ATOM   3143 C  CA  . ASP E 1 82 ? -10.474 32.000  -39.588 1.00 17.86 ? 79  ASP E CA  1 
ATOM   3144 C  C   . ASP E 1 82 ? -9.781  31.148  -40.651 1.00 19.58 ? 79  ASP E C   1 
ATOM   3145 O  O   . ASP E 1 82 ? -8.791  30.494  -40.343 1.00 18.99 ? 79  ASP E O   1 
ATOM   3146 C  CB  . ASP E 1 82 ? -10.043 31.601  -38.171 1.00 18.18 ? 79  ASP E CB  1 
ATOM   3147 C  CG  . ASP E 1 82 ? -10.214 32.754  -37.177 1.00 18.99 ? 79  ASP E CG  1 
ATOM   3148 O  OD1 . ASP E 1 82 ? -10.112 33.915  -37.567 1.00 18.38 ? 79  ASP E OD1 1 
ATOM   3149 O  OD2 . ASP E 1 82 ? -10.473 32.540  -36.016 1.00 21.67 ? 79  ASP E OD2 1 
ATOM   3150 O  OXT . ASP E 1 82 ? -10.205 31.092  -41.832 1.00 20.92 ? 79  ASP E OXT 1 
ATOM   3151 N  N   . SER F 1 6  ? -6.228  16.701  -69.532 1.00 26.82 ? 3   SER F N   1 
ATOM   3152 C  CA  . SER F 1 6  ? -7.236  16.904  -68.449 1.00 24.16 ? 3   SER F CA  1 
ATOM   3153 C  C   . SER F 1 6  ? -8.027  18.164  -68.716 1.00 25.40 ? 3   SER F C   1 
ATOM   3154 O  O   . SER F 1 6  ? -7.472  19.264  -68.797 1.00 25.83 ? 3   SER F O   1 
ATOM   3155 C  CB  . SER F 1 6  ? -6.601  16.991  -67.044 1.00 26.46 ? 3   SER F CB  1 
ATOM   3156 O  OG  . SER F 1 6  ? -7.510  17.590  -66.042 1.00 23.57 ? 3   SER F OG  1 
ATOM   3157 N  N   . PHE F 1 7  ? -9.330  17.993  -68.814 1.00 21.35 ? 4   PHE F N   1 
ATOM   3158 C  CA  . PHE F 1 7  ? -10.246 19.096  -68.907 1.00 22.55 ? 4   PHE F CA  1 
ATOM   3159 C  C   . PHE F 1 7  ? -10.059 20.137  -67.780 1.00 26.69 ? 4   PHE F C   1 
ATOM   3160 O  O   . PHE F 1 7  ? -9.894  21.360  -68.038 1.00 21.16 ? 4   PHE F O   1 
ATOM   3161 C  CB  . PHE F 1 7  ? -11.644 18.543  -68.867 1.00 23.73 ? 4   PHE F CB  1 
ATOM   3162 C  CG  . PHE F 1 7  ? -12.688 19.570  -68.962 1.00 24.93 ? 4   PHE F CG  1 
ATOM   3163 C  CD1 . PHE F 1 7  ? -12.920 20.200  -70.164 1.00 29.90 ? 4   PHE F CD1 1 
ATOM   3164 C  CD2 . PHE F 1 7  ? -13.458 19.881  -67.887 1.00 27.56 ? 4   PHE F CD2 1 
ATOM   3165 C  CE1 . PHE F 1 7  ? -13.896 21.168  -70.275 1.00 29.47 ? 4   PHE F CE1 1 
ATOM   3166 C  CE2 . PHE F 1 7  ? -14.437 20.865  -67.982 1.00 31.17 ? 4   PHE F CE2 1 
ATOM   3167 C  CZ  . PHE F 1 7  ? -14.667 21.482  -69.186 1.00 31.26 ? 4   PHE F CZ  1 
ATOM   3168 N  N   . LEU F 1 8  ? -10.129 19.653  -66.529 1.00 21.77 ? 5   LEU F N   1 
ATOM   3169 C  CA  . LEU F 1 8  ? -10.058 20.549  -65.351 1.00 21.56 ? 5   LEU F CA  1 
ATOM   3170 C  C   . LEU F 1 8  ? -8.750  21.331  -65.297 1.00 18.40 ? 5   LEU F C   1 
ATOM   3171 O  O   . LEU F 1 8  ? -8.730  22.506  -64.966 1.00 18.22 ? 5   LEU F O   1 
ATOM   3172 C  CB  . LEU F 1 8  ? -10.139 19.747  -64.037 1.00 21.65 ? 5   LEU F CB  1 
ATOM   3173 C  CG  . LEU F 1 8  ? -10.878 20.359  -62.815 1.00 24.53 ? 5   LEU F CG  1 
ATOM   3174 C  CD1 . LEU F 1 8  ? -10.383 19.863  -61.476 1.00 23.92 ? 5   LEU F CD1 1 
ATOM   3175 C  CD2 . LEU F 1 8  ? -11.253 21.806  -62.820 1.00 27.34 ? 5   LEU F CD2 1 
ATOM   3176 N  N   . LEU F 1 9  ? -7.673  20.637  -65.530 1.00 17.96 ? 6   LEU F N   1 
ATOM   3177 C  CA  . LEU F 1 9  ? -6.374  21.235  -65.590 1.00 19.88 ? 6   LEU F CA  1 
ATOM   3178 C  C   . LEU F 1 9  ? -6.208  22.302  -66.682 1.00 21.33 ? 6   LEU F C   1 
ATOM   3179 O  O   . LEU F 1 9  ? -5.603  23.369  -66.451 1.00 21.57 ? 6   LEU F O   1 
ATOM   3180 C  CB  . LEU F 1 9  ? -5.314  20.147  -65.723 1.00 21.51 ? 6   LEU F CB  1 
ATOM   3181 C  CG  . LEU F 1 9  ? -3.879  20.710  -65.753 1.00 23.37 ? 6   LEU F CG  1 
ATOM   3182 C  CD1 . LEU F 1 9  ? -3.430  21.476  -64.501 1.00 23.25 ? 6   LEU F CD1 1 
ATOM   3183 C  CD2 . LEU F 1 9  ? -2.921  19.592  -66.032 1.00 26.71 ? 6   LEU F CD2 1 
ATOM   3184 N  N   . SER F 1 10 ? -6.691  22.013  -67.881 1.00 20.46 ? 7   SER F N   1 
ATOM   3185 C  CA  . SER F 1 10 ? -6.716  23.023  -68.931 1.00 20.95 ? 7   SER F CA  1 
ATOM   3186 C  C   . SER F 1 10 ? -7.575  24.235  -68.523 1.00 20.25 ? 7   SER F C   1 
ATOM   3187 O  O   . SER F 1 10 ? -7.202  25.371  -68.850 1.00 20.03 ? 7   SER F O   1 
ATOM   3188 C  CB  . SER F 1 10 ? -7.211  22.423  -70.266 1.00 24.29 ? 7   SER F CB  1 
ATOM   3189 O  OG  . SER F 1 10 ? -8.632  22.407  -70.259 1.00 28.39 ? 7   SER F OG  1 
ATOM   3190 N  N   . LYS F 1 11 ? -8.708  24.065  -67.842 1.00 17.56 ? 8   LYS F N   1 
ATOM   3191 C  CA  . LYS F 1 11 ? -9.455  25.264  -67.390 1.00 19.37 ? 8   LYS F CA  1 
ATOM   3192 C  C   . LYS F 1 11 ? -8.738  26.073  -66.273 1.00 18.39 ? 8   LYS F C   1 
ATOM   3193 O  O   . LYS F 1 11 ? -8.861  27.285  -66.204 1.00 18.14 ? 8   LYS F O   1 
ATOM   3194 C  CB  . LYS F 1 11 ? -10.870 24.934  -66.915 1.00 21.82 ? 8   LYS F CB  1 
ATOM   3195 C  CG  . LYS F 1 11 ? -11.787 24.310  -67.948 1.00 25.46 ? 8   LYS F CG  1 
ATOM   3196 C  CD  . LYS F 1 11 ? -11.997 25.263  -69.102 1.00 28.60 ? 8   LYS F CD  1 
ATOM   3197 C  CE  . LYS F 1 11 ? -13.016 24.753  -70.119 1.00 34.23 ? 8   LYS F CE  1 
ATOM   3198 N  NZ  . LYS F 1 11 ? -12.707 25.376  -71.447 1.00 37.02 ? 8   LYS F NZ  1 
ATOM   3199 N  N   . VAL F 1 12 ? -8.110  25.385  -65.334 1.00 19.42 ? 9   VAL F N   1 
ATOM   3200 C  CA  . VAL F 1 12 ? -7.364  26.054  -64.226 1.00 18.65 ? 9   VAL F CA  1 
ATOM   3201 C  C   . VAL F 1 12 ? -6.163  26.843  -64.849 1.00 19.25 ? 9   VAL F C   1 
ATOM   3202 O  O   . VAL F 1 12 ? -5.947  27.995  -64.525 1.00 19.54 ? 9   VAL F O   1 
ATOM   3203 C  CB  . VAL F 1 12 ? -6.867  24.978  -63.211 1.00 17.41 ? 9   VAL F CB  1 
ATOM   3204 C  CG1 . VAL F 1 12 ? -5.852  25.521  -62.247 1.00 18.34 ? 9   VAL F CG1 1 
ATOM   3205 C  CG2 . VAL F 1 12 ? -8.020  24.352  -62.441 1.00 17.15 ? 9   VAL F CG2 1 
ATOM   3206 N  N   . SER F 1 13 ? -5.455  26.230  -65.788 1.00 20.14 ? 10  SER F N   1 
ATOM   3207 C  CA  A SER F 1 13 ? -4.333  26.876  -66.509 0.50 22.54 ? 10  SER F CA  1 
ATOM   3208 C  CA  B SER F 1 13 ? -4.321  26.889  -66.477 0.50 21.30 ? 10  SER F CA  1 
ATOM   3209 C  C   . SER F 1 13 ? -4.768  28.139  -67.230 1.00 22.53 ? 10  SER F C   1 
ATOM   3210 O  O   . SER F 1 13 ? -4.036  29.134  -67.286 1.00 22.23 ? 10  SER F O   1 
ATOM   3211 C  CB  A SER F 1 13 ? -3.765  25.931  -67.569 0.50 23.72 ? 10  SER F CB  1 
ATOM   3212 C  CB  B SER F 1 13 ? -3.620  25.941  -67.468 0.50 21.11 ? 10  SER F CB  1 
ATOM   3213 O  OG  A SER F 1 13 ? -4.773  25.632  -68.531 0.50 26.01 ? 10  SER F OG  1 
ATOM   3214 O  OG  B SER F 1 13 ? -3.290  24.691  -66.875 0.50 19.99 ? 10  SER F OG  1 
ATOM   3215 N  N   . PHE F 1 14 ? -5.945  28.067  -67.832 1.00 22.82 ? 11  PHE F N   1 
ATOM   3216 C  CA  . PHE F 1 14 ? -6.519  29.184  -68.565 1.00 22.05 ? 11  PHE F CA  1 
ATOM   3217 C  C   . PHE F 1 14 ? -6.916  30.314  -67.619 1.00 22.15 ? 11  PHE F C   1 
ATOM   3218 O  O   . PHE F 1 14 ? -6.674  31.491  -67.885 1.00 22.72 ? 11  PHE F O   1 
ATOM   3219 C  CB  . PHE F 1 14 ? -7.718  28.729  -69.405 1.00 23.54 ? 11  PHE F CB  1 
ATOM   3220 C  CG  . PHE F 1 14 ? -8.481  29.886  -70.037 1.00 26.57 ? 11  PHE F CG  1 
ATOM   3221 C  CD1 . PHE F 1 14 ? -8.044  30.448  -71.246 1.00 28.75 ? 11  PHE F CD1 1 
ATOM   3222 C  CD2 . PHE F 1 14 ? -9.604  30.416  -69.432 1.00 25.89 ? 11  PHE F CD2 1 
ATOM   3223 C  CE1 . PHE F 1 14 ? -8.733  31.522  -71.823 1.00 30.14 ? 11  PHE F CE1 1 
ATOM   3224 C  CE2 . PHE F 1 14 ? -10.285 31.507  -69.995 1.00 29.95 ? 11  PHE F CE2 1 
ATOM   3225 C  CZ  . PHE F 1 14 ? -9.836  32.061  -71.204 1.00 27.96 ? 11  PHE F CZ  1 
ATOM   3226 N  N   . VAL F 1 15 ? -7.508  29.984  -66.489 1.00 20.42 ? 12  VAL F N   1 
ATOM   3227 C  CA  . VAL F 1 15 ? -7.912  31.018  -65.529 1.00 20.44 ? 12  VAL F CA  1 
ATOM   3228 C  C   . VAL F 1 15 ? -6.716  31.742  -64.901 1.00 18.50 ? 12  VAL F C   1 
ATOM   3229 O  O   . VAL F 1 15 ? -6.760  32.965  -64.693 1.00 20.29 ? 12  VAL F O   1 
ATOM   3230 C  CB  . VAL F 1 15 ? -8.819  30.394  -64.436 1.00 23.04 ? 12  VAL F CB  1 
ATOM   3231 C  CG1 . VAL F 1 15 ? -8.963  31.328  -63.235 1.00 24.38 ? 12  VAL F CG1 1 
ATOM   3232 C  CG2 . VAL F 1 15 ? -10.162 30.095  -65.051 1.00 23.40 ? 12  VAL F CG2 1 
ATOM   3233 N  N   . ILE F 1 16 ? -5.664  30.995  -64.618 1.00 17.28 ? 13  ILE F N   1 
ATOM   3234 C  CA  . ILE F 1 16 ? -4.422  31.537  -64.121 1.00 17.00 ? 13  ILE F CA  1 
ATOM   3235 C  C   . ILE F 1 16 ? -3.838  32.564  -65.121 1.00 19.70 ? 13  ILE F C   1 
ATOM   3236 O  O   . ILE F 1 16 ? -3.588  33.707  -64.774 1.00 19.58 ? 13  ILE F O   1 
ATOM   3237 C  CB  . ILE F 1 16 ? -3.406  30.436  -63.885 1.00 16.12 ? 13  ILE F CB  1 
ATOM   3238 C  CG1 . ILE F 1 16 ? -3.857  29.631  -62.659 1.00 15.25 ? 13  ILE F CG1 1 
ATOM   3239 C  CG2 . ILE F 1 16 ? -1.992  31.002  -63.727 1.00 15.64 ? 13  ILE F CG2 1 
ATOM   3240 C  CD1 . ILE F 1 16 ? -3.050  28.407  -62.468 1.00 16.06 ? 13  ILE F CD1 1 
ATOM   3241 N  N   . LYS F 1 17 ? -3.688  32.138  -66.363 1.00 21.13 ? 14  LYS F N   1 
ATOM   3242 C  CA  . LYS F 1 17 ? -3.297  33.037  -67.442 1.00 21.07 ? 14  LYS F CA  1 
ATOM   3243 C  C   . LYS F 1 17 ? -4.213  34.250  -67.607 1.00 20.99 ? 14  LYS F C   1 
ATOM   3244 O  O   . LYS F 1 17 ? -3.707  35.371  -67.667 1.00 23.47 ? 14  LYS F O   1 
ATOM   3245 C  CB  . LYS F 1 17 ? -3.085  32.256  -68.766 1.00 23.19 ? 14  LYS F CB  1 
ATOM   3246 C  CG  . LYS F 1 17 ? -2.662  33.202  -69.919 1.00 27.19 ? 14  LYS F CG  1 
ATOM   3247 C  CD  . LYS F 1 17 ? -2.282  32.435  -71.173 1.00 33.04 ? 14  LYS F CD  1 
ATOM   3248 C  CE  . LYS F 1 17 ? -1.675  33.382  -72.202 1.00 37.03 ? 14  LYS F CE  1 
ATOM   3249 N  NZ  . LYS F 1 17 ? -1.179  32.623  -73.376 1.00 39.38 ? 14  LYS F NZ  1 
ATOM   3250 N  N   . LYS F 1 18 ? -5.533  34.100  -67.666 1.00 20.58 ? 15  LYS F N   1 
ATOM   3251 C  CA  . LYS F 1 18 ? -6.431  35.270  -67.753 1.00 21.88 ? 15  LYS F CA  1 
ATOM   3252 C  C   . LYS F 1 18 ? -6.232  36.283  -66.638 1.00 23.61 ? 15  LYS F C   1 
ATOM   3253 O  O   . LYS F 1 18 ? -6.233  37.487  -66.873 1.00 22.90 ? 15  LYS F O   1 
ATOM   3254 C  CB  . LYS F 1 18 ? -7.884  34.790  -67.797 1.00 24.34 ? 15  LYS F CB  1 
ATOM   3255 C  CG  . LYS F 1 18 ? -8.967  35.830  -67.722 1.00 28.94 ? 15  LYS F CG  1 
ATOM   3256 C  CD  . LYS F 1 18 ? -10.269 35.289  -68.299 1.00 32.42 ? 15  LYS F CD  1 
ATOM   3257 C  CE  . LYS F 1 18 ? -11.253 36.434  -68.545 1.00 35.27 ? 15  LYS F CE  1 
ATOM   3258 N  NZ  . LYS F 1 18 ? -12.668 36.020  -68.568 1.00 39.12 ? 15  LYS F NZ  1 
ATOM   3259 N  N   . ILE F 1 19 ? -6.075  35.814  -65.410 1.00 23.86 ? 16  ILE F N   1 
ATOM   3260 C  CA  . ILE F 1 19 ? -5.952  36.713  -64.225 1.00 23.46 ? 16  ILE F CA  1 
ATOM   3261 C  C   . ILE F 1 19 ? -4.615  37.412  -64.296 1.00 21.88 ? 16  ILE F C   1 
ATOM   3262 O  O   . ILE F 1 19 ? -4.545  38.637  -64.108 1.00 22.56 ? 16  ILE F O   1 
ATOM   3263 C  CB  . ILE F 1 19 ? -6.160  35.945  -62.886 1.00 25.50 ? 16  ILE F CB  1 
ATOM   3264 C  CG1 . ILE F 1 19 ? -7.580  35.392  -62.848 1.00 27.99 ? 16  ILE F CG1 1 
ATOM   3265 C  CG2 . ILE F 1 19 ? -5.916  36.870  -61.657 1.00 25.47 ? 16  ILE F CG2 1 
ATOM   3266 C  CD1 . ILE F 1 19 ? -7.851  34.485  -61.675 1.00 30.53 ? 16  ILE F CD1 1 
ATOM   3267 N  N   . ARG F 1 20 ? -3.567  36.667  -64.644 1.00 22.15 ? 17  ARG F N   1 
ATOM   3268 C  CA  . ARG F 1 20 ? -2.234  37.239  -64.833 1.00 23.53 ? 17  ARG F CA  1 
ATOM   3269 C  C   . ARG F 1 20 ? -2.186  38.364  -65.869 1.00 26.38 ? 17  ARG F C   1 
ATOM   3270 O  O   . ARG F 1 20 ? -1.594  39.453  -65.644 1.00 22.55 ? 17  ARG F O   1 
ATOM   3271 C  CB  . ARG F 1 20 ? -1.215  36.172  -65.236 1.00 21.88 ? 17  ARG F CB  1 
ATOM   3272 C  CG  . ARG F 1 20 ? 0.167   36.714  -65.436 1.00 20.61 ? 17  ARG F CG  1 
ATOM   3273 C  CD  . ARG F 1 20 ? 1.205   35.720  -65.916 1.00 21.94 ? 17  ARG F CD  1 
ATOM   3274 N  NE  . ARG F 1 20 ? 0.974   35.188  -67.257 1.00 22.73 ? 17  ARG F NE  1 
ATOM   3275 C  CZ  . ARG F 1 20 ? 1.278   35.798  -68.407 1.00 25.27 ? 17  ARG F CZ  1 
ATOM   3276 N  NH1 . ARG F 1 20 ? 1.713   37.072  -68.445 1.00 21.03 ? 17  ARG F NH1 1 
ATOM   3277 N  NH2 . ARG F 1 20 ? 1.083   35.133  -69.542 1.00 23.45 ? 17  ARG F NH2 1 
ATOM   3278 N  N   . LEU F 1 21 ? -2.790  38.105  -67.014 1.00 26.19 ? 18  LEU F N   1 
ATOM   3279 C  CA  . LEU F 1 21 ? -2.825  39.123  -68.092 1.00 31.15 ? 18  LEU F CA  1 
ATOM   3280 C  C   . LEU F 1 21 ? -3.688  40.302  -67.660 1.00 33.02 ? 18  LEU F C   1 
ATOM   3281 O  O   . LEU F 1 21 ? -3.309  41.453  -67.838 1.00 34.38 ? 18  LEU F O   1 
ATOM   3282 C  CB  . LEU F 1 21 ? -3.319  38.509  -69.414 1.00 29.77 ? 18  LEU F CB  1 
ATOM   3283 C  CG  . LEU F 1 21 ? -2.318  37.585  -70.039 1.00 28.29 ? 18  LEU F CG  1 
ATOM   3284 C  CD1 . LEU F 1 21 ? -2.965  36.838  -71.228 1.00 31.34 ? 18  LEU F CD1 1 
ATOM   3285 C  CD2 . LEU F 1 21 ? -1.062  38.323  -70.485 1.00 27.72 ? 18  LEU F CD2 1 
ATOM   3286 N  N   . GLU F 1 22 ? -4.812  40.034  -67.012 1.00 35.33 ? 19  GLU F N   1 
ATOM   3287 C  CA  . GLU F 1 22 ? -5.646  41.119  -66.514 1.00 38.42 ? 19  GLU F CA  1 
ATOM   3288 C  C   . GLU F 1 22 ? -4.952  42.004  -65.483 1.00 39.75 ? 19  GLU F C   1 
ATOM   3289 O  O   . GLU F 1 22 ? -5.071  43.216  -65.559 1.00 40.37 ? 19  GLU F O   1 
ATOM   3290 C  CB  . GLU F 1 22 ? -6.999  40.622  -65.993 1.00 41.42 ? 19  GLU F CB  1 
ATOM   3291 C  CG  . GLU F 1 22 ? -8.112  40.915  -66.975 1.00 48.91 ? 19  GLU F CG  1 
ATOM   3292 C  CD  . GLU F 1 22 ? -9.132  39.791  -67.092 1.00 54.28 ? 19  GLU F CD  1 
ATOM   3293 O  OE1 . GLU F 1 22 ? -9.480  39.437  -68.240 1.00 51.70 ? 19  GLU F OE1 1 
ATOM   3294 O  OE2 . GLU F 1 22 ? -9.590  39.267  -66.047 1.00 58.19 ? 19  GLU F OE2 1 
ATOM   3295 N  N   . LYS F 1 23 ? -4.209  41.416  -64.551 1.00 34.34 ? 20  LYS F N   1 
ATOM   3296 C  CA  . LYS F 1 23 ? -3.485  42.179  -63.544 1.00 34.58 ? 20  LYS F CA  1 
ATOM   3297 C  C   . LYS F 1 23 ? -2.220  42.845  -64.095 1.00 34.99 ? 20  LYS F C   1 
ATOM   3298 O  O   . LYS F 1 23 ? -1.467  43.434  -63.323 1.00 37.56 ? 20  LYS F O   1 
ATOM   3299 C  CB  . LYS F 1 23 ? -3.047  41.293  -62.371 1.00 34.13 ? 20  LYS F CB  1 
ATOM   3300 C  CG  . LYS F 1 23 ? -4.136  40.572  -61.620 1.00 41.49 ? 20  LYS F CG  1 
ATOM   3301 C  CD  . LYS F 1 23 ? -4.742  41.409  -60.499 1.00 44.52 ? 20  LYS F CD  1 
ATOM   3302 C  CE  . LYS F 1 23 ? -5.608  40.593  -59.562 1.00 46.25 ? 20  LYS F CE  1 
ATOM   3303 N  NZ  . LYS F 1 23 ? -5.029  40.577  -58.189 1.00 47.97 ? 20  LYS F NZ  1 
ATOM   3304 N  N   . GLY F 1 24 ? -1.945  42.729  -65.386 1.00 30.26 ? 21  GLY F N   1 
ATOM   3305 C  CA  . GLY F 1 24 ? -0.792  43.379  -65.971 1.00 29.77 ? 21  GLY F CA  1 
ATOM   3306 C  C   . GLY F 1 24 ? 0.552   42.760  -65.641 1.00 30.98 ? 21  GLY F C   1 
ATOM   3307 O  O   . GLY F 1 24 ? 1.597   43.423  -65.835 1.00 28.32 ? 21  GLY F O   1 
ATOM   3308 N  N   . MET F 1 25 ? 0.552   41.491  -65.177 1.00 22.59 ? 22  MET F N   1 
ATOM   3309 C  CA  . MET F 1 25 ? 1.771   40.823  -64.774 1.00 20.25 ? 22  MET F CA  1 
ATOM   3310 C  C   . MET F 1 25 ? 2.374   39.956  -65.874 1.00 19.71 ? 22  MET F C   1 
ATOM   3311 O  O   . MET F 1 25 ? 1.660   39.268  -66.581 1.00 21.55 ? 22  MET F O   1 
ATOM   3312 C  CB  . MET F 1 25 ? 1.473   39.909  -63.560 1.00 20.89 ? 22  MET F CB  1 
ATOM   3313 C  CG  . MET F 1 25 ? 0.914   40.586  -62.306 1.00 23.78 ? 22  MET F CG  1 
ATOM   3314 S  SD  . MET F 1 25 ? 0.537   39.359  -60.976 1.00 25.88 ? 22  MET F SD  1 
ATOM   3315 C  CE  . MET F 1 25 ? 2.133   38.702  -60.608 1.00 24.99 ? 22  MET F CE  1 
ATOM   3316 N  N   . THR F 1 26 ? 3.678   39.909  -65.932 1.00 18.05 ? 23  THR F N   1 
ATOM   3317 C  CA  . THR F 1 26 ? 4.391   39.005  -66.782 1.00 20.58 ? 23  THR F CA  1 
ATOM   3318 C  C   . THR F 1 26 ? 4.503   37.605  -66.097 1.00 20.01 ? 23  THR F C   1 
ATOM   3319 O  O   . THR F 1 26 ? 4.277   37.471  -64.881 1.00 17.60 ? 23  THR F O   1 
ATOM   3320 C  CB  . THR F 1 26 ? 5.835   39.477  -67.072 1.00 21.07 ? 23  THR F CB  1 
ATOM   3321 O  OG1 . THR F 1 26 ? 6.610   39.528  -65.882 1.00 20.30 ? 23  THR F OG1 1 
ATOM   3322 C  CG2 . THR F 1 26 ? 5.896   40.922  -67.740 1.00 22.71 ? 23  THR F CG2 1 
ATOM   3323 N  N   . GLN F 1 27 ? 4.879   36.605  -66.869 1.00 18.88 ? 24  GLN F N   1 
ATOM   3324 C  CA  . GLN F 1 27 ? 5.201   35.270  -66.305 1.00 19.38 ? 24  GLN F CA  1 
ATOM   3325 C  C   . GLN F 1 27 ? 6.337   35.361  -65.274 1.00 19.74 ? 24  GLN F C   1 
ATOM   3326 O  O   . GLN F 1 27 ? 6.233   34.769  -64.217 1.00 16.08 ? 24  GLN F O   1 
ATOM   3327 C  CB  . GLN F 1 27 ? 5.570   34.262  -67.385 1.00 18.47 ? 24  GLN F CB  1 
ATOM   3328 C  CG  . GLN F 1 27 ? 4.429   33.891  -68.297 1.00 19.58 ? 24  GLN F CG  1 
ATOM   3329 C  CD  . GLN F 1 27 ? 4.876   32.853  -69.352 1.00 21.06 ? 24  GLN F CD  1 
ATOM   3330 O  OE1 . GLN F 1 27 ? 6.053   32.660  -69.548 1.00 22.23 ? 24  GLN F OE1 1 
ATOM   3331 N  NE2 . GLN F 1 27 ? 3.946   32.218  -70.010 1.00 19.74 ? 24  GLN F NE2 1 
ATOM   3332 N  N   . GLU F 1 28 ? 7.397   36.133  -65.555 1.00 17.95 ? 25  GLU F N   1 
ATOM   3333 C  CA  A GLU F 1 28 ? 8.452   36.379  -64.566 0.50 18.40 ? 25  GLU F CA  1 
ATOM   3334 C  CA  B GLU F 1 28 ? 8.441   36.346  -64.548 0.50 19.57 ? 25  GLU F CA  1 
ATOM   3335 C  C   . GLU F 1 28 ? 7.899   36.982  -63.242 1.00 17.62 ? 25  GLU F C   1 
ATOM   3336 O  O   . GLU F 1 28 ? 8.283   36.578  -62.135 1.00 16.64 ? 25  GLU F O   1 
ATOM   3337 C  CB  A GLU F 1 28 ? 9.526   37.301  -65.176 0.50 19.58 ? 25  GLU F CB  1 
ATOM   3338 C  CB  B GLU F 1 28 ? 9.576   37.202  -65.114 0.50 22.92 ? 25  GLU F CB  1 
ATOM   3339 C  CG  A GLU F 1 28 ? 10.322  36.662  -66.312 0.50 19.93 ? 25  GLU F CG  1 
ATOM   3340 C  CG  B GLU F 1 28 ? 10.895  36.926  -64.437 0.50 25.20 ? 25  GLU F CG  1 
ATOM   3341 C  CD  A GLU F 1 28 ? 9.693   36.811  -67.705 0.50 19.71 ? 25  GLU F CD  1 
ATOM   3342 C  CD  B GLU F 1 28 ? 11.864  38.051  -64.610 0.50 29.76 ? 25  GLU F CD  1 
ATOM   3343 O  OE1 A GLU F 1 28 ? 10.423  36.542  -68.655 0.50 21.18 ? 25  GLU F OE1 1 
ATOM   3344 O  OE1 B GLU F 1 28 ? 11.496  39.025  -65.309 0.50 36.16 ? 25  GLU F OE1 1 
ATOM   3345 O  OE2 A GLU F 1 28 ? 8.519   37.184  -67.883 0.50 16.12 ? 25  GLU F OE2 1 
ATOM   3346 O  OE2 B GLU F 1 28 ? 12.973  37.964  -64.029 0.50 33.65 ? 25  GLU F OE2 1 
ATOM   3347 N  N   . ASP F 1 29 ? 6.987   37.952  -63.362 1.00 17.09 ? 26  ASP F N   1 
ATOM   3348 C  CA  . ASP F 1 29 ? 6.430   38.601  -62.194 1.00 18.61 ? 26  ASP F CA  1 
ATOM   3349 C  C   . ASP F 1 29 ? 5.653   37.575  -61.364 1.00 19.35 ? 26  ASP F C   1 
ATOM   3350 O  O   . ASP F 1 29 ? 5.663   37.643  -60.125 1.00 17.71 ? 26  ASP F O   1 
ATOM   3351 C  CB  . ASP F 1 29 ? 5.417   39.690  -62.540 1.00 19.22 ? 26  ASP F CB  1 
ATOM   3352 C  CG  . ASP F 1 29 ? 6.041   40.941  -63.212 1.00 21.54 ? 26  ASP F CG  1 
ATOM   3353 O  OD1 . ASP F 1 29 ? 7.245   41.177  -63.067 1.00 20.07 ? 26  ASP F OD1 1 
ATOM   3354 O  OD2 . ASP F 1 29 ? 5.256   41.591  -63.899 1.00 18.84 ? 26  ASP F OD2 1 
ATOM   3355 N  N   . LEU F 1 30 ? 4.874   36.721  -62.058 1.00 18.67 ? 27  LEU F N   1 
ATOM   3356 C  CA  . LEU F 1 30 ? 4.030   35.729  -61.372 1.00 18.39 ? 27  LEU F CA  1 
ATOM   3357 C  C   . LEU F 1 30 ? 4.933   34.698  -60.693 1.00 16.83 ? 27  LEU F C   1 
ATOM   3358 O  O   . LEU F 1 30 ? 4.686   34.326  -59.530 1.00 18.33 ? 27  LEU F O   1 
ATOM   3359 C  CB  . LEU F 1 30 ? 3.013   35.013  -62.296 1.00 16.65 ? 27  LEU F CB  1 
ATOM   3360 C  CG  . LEU F 1 30 ? 2.176   33.887  -61.629 1.00 15.92 ? 27  LEU F CG  1 
ATOM   3361 C  CD1 . LEU F 1 30 ? 1.470   34.531  -60.410 1.00 16.75 ? 27  LEU F CD1 1 
ATOM   3362 C  CD2 . LEU F 1 30 ? 1.150   33.280  -62.599 1.00 16.21 ? 27  LEU F CD2 1 
ATOM   3363 N  N   . ALA F 1 31 ? 5.990   34.254  -61.391 1.00 16.72 ? 28  ALA F N   1 
ATOM   3364 C  CA  . ALA F 1 31 ? 6.979   33.369  -60.809 1.00 16.66 ? 28  ALA F CA  1 
ATOM   3365 C  C   . ALA F 1 31 ? 7.636   33.974  -59.543 1.00 18.30 ? 28  ALA F C   1 
ATOM   3366 O  O   . ALA F 1 31 ? 7.756   33.289  -58.478 1.00 16.95 ? 28  ALA F O   1 
ATOM   3367 C  CB  . ALA F 1 31 ? 8.071   33.044  -61.839 1.00 17.33 ? 28  ALA F CB  1 
ATOM   3368 N  N   . TYR F 1 32 ? 8.146   35.213  -59.685 1.00 16.69 ? 29  TYR F N   1 
ATOM   3369 C  CA  . TYR F 1 32 ? 8.654   35.958  -58.531 1.00 16.66 ? 29  TYR F CA  1 
ATOM   3370 C  C   . TYR F 1 32 ? 7.656   36.001  -57.316 1.00 17.47 ? 29  TYR F C   1 
ATOM   3371 O  O   . TYR F 1 32 ? 8.061   35.595  -56.206 1.00 18.05 ? 29  TYR F O   1 
ATOM   3372 C  CB  . TYR F 1 32 ? 9.193   37.368  -58.916 1.00 16.31 ? 29  TYR F CB  1 
ATOM   3373 C  CG  . TYR F 1 32 ? 9.404   38.180  -57.669 1.00 16.31 ? 29  TYR F CG  1 
ATOM   3374 C  CD1 . TYR F 1 32 ? 10.539  37.972  -56.873 1.00 15.66 ? 29  TYR F CD1 1 
ATOM   3375 C  CD2 . TYR F 1 32 ? 8.426   39.020  -57.215 1.00 16.50 ? 29  TYR F CD2 1 
ATOM   3376 C  CE1 . TYR F 1 32 ? 10.706  38.622  -55.646 1.00 15.90 ? 29  TYR F CE1 1 
ATOM   3377 C  CE2 . TYR F 1 32 ? 8.592   39.736  -56.000 1.00 17.97 ? 29  TYR F CE2 1 
ATOM   3378 C  CZ  . TYR F 1 32 ? 9.732   39.546  -55.233 1.00 16.60 ? 29  TYR F CZ  1 
ATOM   3379 O  OH  . TYR F 1 32 ? 9.884   40.218  -54.012 1.00 17.98 ? 29  TYR F OH  1 
ATOM   3380 N  N   . LYS F 1 33 ? 6.414   36.473  -57.518 1.00 15.62 ? 30  LYS F N   1 
ATOM   3381 C  CA  A LYS F 1 33 ? 5.437   36.610  -56.448 0.50 17.36 ? 30  LYS F CA  1 
ATOM   3382 C  CA  B LYS F 1 33 ? 5.458   36.601  -56.428 0.50 17.33 ? 30  LYS F CA  1 
ATOM   3383 C  C   . LYS F 1 33 ? 4.967   35.267  -55.844 1.00 18.08 ? 30  LYS F C   1 
ATOM   3384 O  O   . LYS F 1 33 ? 4.552   35.222  -54.677 1.00 17.43 ? 30  LYS F O   1 
ATOM   3385 C  CB  A LYS F 1 33 ? 4.225   37.441  -56.910 0.50 17.94 ? 30  LYS F CB  1 
ATOM   3386 C  CB  B LYS F 1 33 ? 4.261   37.472  -56.826 0.50 17.89 ? 30  LYS F CB  1 
ATOM   3387 C  CG  A LYS F 1 33 ? 4.544   38.907  -57.315 0.50 19.00 ? 30  LYS F CG  1 
ATOM   3388 C  CG  B LYS F 1 33 ? 4.614   38.966  -57.001 0.50 19.01 ? 30  LYS F CG  1 
ATOM   3389 C  CD  A LYS F 1 33 ? 4.696   39.820  -56.104 0.50 19.96 ? 30  LYS F CD  1 
ATOM   3390 C  CD  B LYS F 1 33 ? 3.410   39.763  -57.461 0.50 19.33 ? 30  LYS F CD  1 
ATOM   3391 C  CE  A LYS F 1 33 ? 3.375   40.091  -55.433 0.50 21.13 ? 30  LYS F CE  1 
ATOM   3392 C  CE  B LYS F 1 33 ? 2.398   40.050  -56.374 0.50 21.48 ? 30  LYS F CE  1 
ATOM   3393 N  NZ  A LYS F 1 33 ? 3.540   40.583  -54.044 0.50 22.21 ? 30  LYS F NZ  1 
ATOM   3394 N  NZ  B LYS F 1 33 ? 1.130   40.371  -57.076 0.50 23.38 ? 30  LYS F NZ  1 
ATOM   3395 N  N   . SER F 1 34 ? 5.041   34.186  -56.615 1.00 16.18 ? 31  SER F N   1 
ATOM   3396 C  CA  A SER F 1 34 ? 4.558   32.874  -56.122 0.50 16.20 ? 31  SER F CA  1 
ATOM   3397 C  CA  B SER F 1 34 ? 4.564   32.860  -56.159 0.50 16.86 ? 31  SER F CA  1 
ATOM   3398 C  C   . SER F 1 34 ? 5.683   32.027  -55.558 1.00 18.38 ? 31  SER F C   1 
ATOM   3399 O  O   . SER F 1 34 ? 5.442   30.922  -55.006 1.00 18.61 ? 31  SER F O   1 
ATOM   3400 C  CB  A SER F 1 34 ? 3.886   32.100  -57.242 0.50 15.47 ? 31  SER F CB  1 
ATOM   3401 C  CB  B SER F 1 34 ? 3.890   32.109  -57.320 0.50 16.86 ? 31  SER F CB  1 
ATOM   3402 O  OG  A SER F 1 34 ? 2.807   32.801  -57.844 0.50 15.27 ? 31  SER F OG  1 
ATOM   3403 O  OG  B SER F 1 34 ? 4.780   31.698  -58.380 0.50 18.42 ? 31  SER F OG  1 
ATOM   3404 N  N   . ASN F 1 35 ? 6.912   32.532  -55.669 1.00 20.05 ? 32  ASN F N   1 
ATOM   3405 C  CA  . ASN F 1 35 ? 8.092   31.792  -55.281 1.00 24.11 ? 32  ASN F CA  1 
ATOM   3406 C  C   . ASN F 1 35 ? 8.317   30.515  -56.090 1.00 25.12 ? 32  ASN F C   1 
ATOM   3407 O  O   . ASN F 1 35 ? 8.773   29.487  -55.587 1.00 25.53 ? 32  ASN F O   1 
ATOM   3408 C  CB  . ASN F 1 35 ? 8.062   31.494  -53.783 1.00 28.73 ? 32  ASN F CB  1 
ATOM   3409 C  CG  . ASN F 1 35 ? 9.410   31.674  -53.179 1.00 43.08 ? 32  ASN F CG  1 
ATOM   3410 O  OD1 . ASN F 1 35 ? 10.350  30.951  -53.505 1.00 44.44 ? 32  ASN F OD1 1 
ATOM   3411 N  ND2 . ASN F 1 35 ? 9.550   32.718  -52.365 1.00 55.31 ? 32  ASN F ND2 1 
ATOM   3412 N  N   . LEU F 1 36 ? 8.012   30.596  -57.368 1.00 22.86 ? 33  LEU F N   1 
ATOM   3413 C  CA  . LEU F 1 36 ? 8.120   29.492  -58.251 1.00 22.76 ? 33  LEU F CA  1 
ATOM   3414 C  C   . LEU F 1 36 ? 9.068   29.903  -59.419 1.00 24.41 ? 33  LEU F C   1 
ATOM   3415 O  O   . LEU F 1 36 ? 9.408   31.034  -59.581 1.00 29.36 ? 33  LEU F O   1 
ATOM   3416 C  CB  . LEU F 1 36 ? 6.749   29.096  -58.795 1.00 20.49 ? 33  LEU F CB  1 
ATOM   3417 C  CG  . LEU F 1 36 ? 5.749   28.537  -57.766 1.00 21.05 ? 33  LEU F CG  1 
ATOM   3418 C  CD1 . LEU F 1 36 ? 4.363   28.319  -58.360 1.00 21.51 ? 33  LEU F CD1 1 
ATOM   3419 C  CD2 . LEU F 1 36 ? 6.309   27.240  -57.215 1.00 22.76 ? 33  LEU F CD2 1 
ATOM   3420 N  N   . ASP F 1 37 ? 9.507   28.975  -60.211 1.00 25.49 ? 34  ASP F N   1 
ATOM   3421 C  CA  . ASP F 1 37 ? 10.387  29.389  -61.283 1.00 26.81 ? 34  ASP F CA  1 
ATOM   3422 C  C   . ASP F 1 37 ? 9.588   29.703  -62.580 1.00 22.76 ? 34  ASP F C   1 
ATOM   3423 O  O   . ASP F 1 37 ? 8.493   29.202  -62.800 1.00 17.82 ? 34  ASP F O   1 
ATOM   3424 C  CB  . ASP F 1 37 ? 11.390  28.315  -61.495 1.00 30.95 ? 34  ASP F CB  1 
ATOM   3425 C  CG  . ASP F 1 37 ? 10.757  27.091  -61.944 1.00 34.19 ? 34  ASP F CG  1 
ATOM   3426 O  OD1 . ASP F 1 37 ? 10.301  26.328  -61.073 1.00 48.40 ? 34  ASP F OD1 1 
ATOM   3427 O  OD2 . ASP F 1 37 ? 10.649  26.929  -63.164 1.00 40.11 ? 34  ASP F OD2 1 
ATOM   3428 N  N   . ARG F 1 38 ? 10.154  30.543  -63.436 1.00 22.83 ? 35  ARG F N   1 
ATOM   3429 C  CA  . ARG F 1 38 ? 9.460   30.982  -64.645 1.00 21.96 ? 35  ARG F CA  1 
ATOM   3430 C  C   . ARG F 1 38 ? 9.182   29.808  -65.584 1.00 19.28 ? 35  ARG F C   1 
ATOM   3431 O  O   . ARG F 1 38 ? 8.137   29.794  -66.287 1.00 19.17 ? 35  ARG F O   1 
ATOM   3432 C  CB  . ARG F 1 38 ? 10.260  32.083  -65.383 1.00 24.97 ? 35  ARG F CB  1 
ATOM   3433 C  CG  . ARG F 1 38 ? 9.417   32.774  -66.478 1.00 33.31 ? 35  ARG F CG  1 
ATOM   3434 C  CD  . ARG F 1 38 ? 10.001  32.572  -67.877 1.00 37.58 ? 35  ARG F CD  1 
ATOM   3435 N  NE  . ARG F 1 38 ? 9.020   32.642  -68.986 1.00 42.17 ? 35  ARG F NE  1 
ATOM   3436 C  CZ  . ARG F 1 38 ? 9.375   32.585  -70.284 1.00 45.52 ? 35  ARG F CZ  1 
ATOM   3437 N  NH1 . ARG F 1 38 ? 10.664  32.421  -70.648 1.00 37.50 ? 35  ARG F NH1 1 
ATOM   3438 N  NH2 . ARG F 1 38 ? 8.451   32.657  -71.228 1.00 47.64 ? 35  ARG F NH2 1 
ATOM   3439 N  N   . THR F 1 39 ? 10.058  28.810  -65.564 1.00 17.49 ? 36  THR F N   1 
ATOM   3440 C  CA  . THR F 1 39 ? 9.842   27.619  -66.405 1.00 20.03 ? 36  THR F CA  1 
ATOM   3441 C  C   . THR F 1 39 ? 8.551   26.890  -66.073 1.00 18.53 ? 36  THR F C   1 
ATOM   3442 O  O   . THR F 1 39 ? 7.831   26.469  -66.950 1.00 15.58 ? 36  THR F O   1 
ATOM   3443 C  CB  . THR F 1 39 ? 11.008  26.645  -66.286 1.00 24.59 ? 36  THR F CB  1 
ATOM   3444 O  OG1 . THR F 1 39 ? 12.210  27.315  -66.733 1.00 26.57 ? 36  THR F OG1 1 
ATOM   3445 C  CG2 . THR F 1 39 ? 10.751  25.477  -67.175 1.00 27.48 ? 36  THR F CG2 1 
ATOM   3446 N  N   . PHE F 1 40 ? 8.264   26.796  -64.780 1.00 18.40 ? 37  PHE F N   1 
ATOM   3447 C  CA  . PHE F 1 40 ? 7.037   26.148  -64.304 1.00 18.65 ? 37  PHE F CA  1 
ATOM   3448 C  C   . PHE F 1 40 ? 5.809   26.967  -64.650 1.00 16.82 ? 37  PHE F C   1 
ATOM   3449 O  O   . PHE F 1 40 ? 4.816   26.426  -65.154 1.00 17.64 ? 37  PHE F O   1 
ATOM   3450 C  CB  . PHE F 1 40 ? 7.194   25.916  -62.775 1.00 21.53 ? 37  PHE F CB  1 
ATOM   3451 C  CG  . PHE F 1 40 ? 6.040   25.204  -62.096 1.00 23.65 ? 37  PHE F CG  1 
ATOM   3452 C  CD1 . PHE F 1 40 ? 5.456   24.074  -62.642 1.00 24.48 ? 37  PHE F CD1 1 
ATOM   3453 C  CD2 . PHE F 1 40 ? 5.650   25.592  -60.815 1.00 28.24 ? 37  PHE F CD2 1 
ATOM   3454 C  CE1 . PHE F 1 40 ? 4.445   23.374  -61.956 1.00 27.82 ? 37  PHE F CE1 1 
ATOM   3455 C  CE2 . PHE F 1 40 ? 4.653   24.897  -60.110 1.00 27.93 ? 37  PHE F CE2 1 
ATOM   3456 C  CZ  . PHE F 1 40 ? 4.030   23.800  -60.694 1.00 28.91 ? 37  PHE F CZ  1 
ATOM   3457 N  N   . ILE F 1 41 ? 5.852   28.303  -64.469 1.00 17.14 ? 38  ILE F N   1 
ATOM   3458 C  CA  . ILE F 1 41 ? 4.674   29.143  -64.837 1.00 15.70 ? 38  ILE F CA  1 
ATOM   3459 C  C   . ILE F 1 41 ? 4.366   29.011  -66.336 1.00 15.83 ? 38  ILE F C   1 
ATOM   3460 O  O   . ILE F 1 41 ? 3.183   28.863  -66.760 1.00 15.63 ? 38  ILE F O   1 
ATOM   3461 C  CB  . ILE F 1 41 ? 4.911   30.645  -64.460 1.00 17.83 ? 38  ILE F CB  1 
ATOM   3462 C  CG1 . ILE F 1 41 ? 5.068   30.809  -62.931 1.00 16.83 ? 38  ILE F CG1 1 
ATOM   3463 C  CG2 . ILE F 1 41 ? 3.799   31.543  -64.989 1.00 18.52 ? 38  ILE F CG2 1 
ATOM   3464 C  CD1 . ILE F 1 41 ? 3.963   30.215  -62.097 1.00 17.62 ? 38  ILE F CD1 1 
ATOM   3465 N  N   . SER F 1 42 ? 5.420   29.064  -67.154 1.00 15.82 ? 39  SER F N   1 
ATOM   3466 C  CA  . SER F 1 42 ? 5.243   28.882  -68.600 1.00 17.44 ? 39  SER F CA  1 
ATOM   3467 C  C   . SER F 1 42 ? 4.637   27.514  -68.947 1.00 15.08 ? 39  SER F C   1 
ATOM   3468 O  O   . SER F 1 42 ? 3.676   27.425  -69.738 1.00 16.98 ? 39  SER F O   1 
ATOM   3469 C  CB  . SER F 1 42 ? 6.584   29.120  -69.344 1.00 19.48 ? 39  SER F CB  1 
ATOM   3470 O  OG  . SER F 1 42 ? 6.428   28.734  -70.716 1.00 22.21 ? 39  SER F OG  1 
ATOM   3471 N  N   . GLY F 1 43 ? 5.224   26.474  -68.363 1.00 16.23 ? 40  GLY F N   1 
ATOM   3472 C  CA  . GLY F 1 43 ? 4.753   25.098  -68.544 1.00 18.87 ? 40  GLY F CA  1 
ATOM   3473 C  C   . GLY F 1 43 ? 3.288   24.899  -68.193 1.00 19.04 ? 40  GLY F C   1 
ATOM   3474 O  O   . GLY F 1 43 ? 2.554   24.250  -68.932 1.00 17.58 ? 40  GLY F O   1 
ATOM   3475 N  N   . ILE F 1 44 ? 2.852   25.496  -67.066 1.00 16.82 ? 41  ILE F N   1 
ATOM   3476 C  CA  . ILE F 1 44 ? 1.411   25.525  -66.720 1.00 17.70 ? 41  ILE F CA  1 
ATOM   3477 C  C   . ILE F 1 44 ? 0.571   26.173  -67.784 1.00 18.22 ? 41  ILE F C   1 
ATOM   3478 O  O   . ILE F 1 44 ? -0.468  25.636  -68.228 1.00 15.96 ? 41  ILE F O   1 
ATOM   3479 C  CB  . ILE F 1 44 ? 1.152   26.248  -65.355 1.00 19.52 ? 41  ILE F CB  1 
ATOM   3480 C  CG1 . ILE F 1 44 ? 1.774   25.402  -64.244 1.00 21.20 ? 41  ILE F CG1 1 
ATOM   3481 C  CG2 . ILE F 1 44 ? -0.328  26.497  -65.167 1.00 19.37 ? 41  ILE F CG2 1 
ATOM   3482 C  CD1 . ILE F 1 44 ? 2.213   26.208  -63.023 1.00 23.49 ? 41  ILE F CD1 1 
ATOM   3483 N  N   . GLU F 1 45 ? 0.997   27.342  -68.216 1.00 19.43 ? 42  GLU F N   1 
ATOM   3484 C  CA  . GLU F 1 45 ? 0.224   28.045  -69.215 1.00 20.36 ? 42  GLU F CA  1 
ATOM   3485 C  C   . GLU F 1 45 ? 0.196   27.375  -70.622 1.00 19.58 ? 42  GLU F C   1 
ATOM   3486 O  O   . GLU F 1 45 ? -0.755  27.542  -71.344 1.00 19.84 ? 42  GLU F O   1 
ATOM   3487 C  CB  . GLU F 1 45 ? 0.692   29.502  -69.315 1.00 21.88 ? 42  GLU F CB  1 
ATOM   3488 C  CG  . GLU F 1 45 ? 0.462   30.277  -68.004 1.00 23.20 ? 42  GLU F CG  1 
ATOM   3489 C  CD  . GLU F 1 45 ? 0.703   31.789  -68.139 1.00 28.24 ? 42  GLU F CD  1 
ATOM   3490 O  OE1 . GLU F 1 45 ? 0.333   32.502  -67.184 1.00 28.17 ? 42  GLU F OE1 1 
ATOM   3491 O  OE2 . GLU F 1 45 ? 1.215   32.262  -69.181 1.00 26.82 ? 42  GLU F OE2 1 
ATOM   3492 N  N   . ARG F 1 46 ? 1.212   26.582  -70.923 1.00 21.77 ? 43  ARG F N   1 
ATOM   3493 C  CA  . ARG F 1 46 ? 1.324   25.782  -72.175 1.00 21.55 ? 43  ARG F CA  1 
ATOM   3494 C  C   . ARG F 1 46 ? 0.750   24.375  -71.979 1.00 24.25 ? 43  ARG F C   1 
ATOM   3495 O  O   . ARG F 1 46 ? 1.053   23.479  -72.808 1.00 23.21 ? 43  ARG F O   1 
ATOM   3496 C  CB  . ARG F 1 46 ? 2.830   25.626  -72.547 1.00 20.76 ? 43  ARG F CB  1 
ATOM   3497 C  CG  . ARG F 1 46 ? 3.486   26.933  -72.943 1.00 22.11 ? 43  ARG F CG  1 
ATOM   3498 C  CD  . ARG F 1 46 ? 4.970   26.849  -73.375 1.00 22.58 ? 43  ARG F CD  1 
ATOM   3499 N  NE  . ARG F 1 46 ? 5.912   26.340  -72.348 1.00 23.69 ? 43  ARG F NE  1 
ATOM   3500 C  CZ  . ARG F 1 46 ? 6.419   25.100  -72.287 1.00 25.95 ? 43  ARG F CZ  1 
ATOM   3501 N  NH1 . ARG F 1 46 ? 6.114   24.190  -73.201 1.00 25.66 ? 43  ARG F NH1 1 
ATOM   3502 N  NH2 . ARG F 1 46 ? 7.211   24.737  -71.279 1.00 29.17 ? 43  ARG F NH2 1 
ATOM   3503 N  N   . ASN F 1 47 ? -0.030  24.151  -70.883 1.00 24.20 ? 44  ASN F N   1 
ATOM   3504 C  CA  . ASN F 1 47 ? -0.616  22.859  -70.580 1.00 24.99 ? 44  ASN F CA  1 
ATOM   3505 C  C   . ASN F 1 47 ? 0.302   21.655  -70.598 1.00 24.84 ? 44  ASN F C   1 
ATOM   3506 O  O   . ASN F 1 47 ? -0.040  20.560  -71.054 1.00 24.50 ? 44  ASN F O   1 
ATOM   3507 C  CB  . ASN F 1 47 ? -1.826  22.615  -71.475 1.00 31.97 ? 44  ASN F CB  1 
ATOM   3508 C  CG  . ASN F 1 47 ? -3.075  23.107  -70.816 1.00 37.08 ? 44  ASN F CG  1 
ATOM   3509 O  OD1 . ASN F 1 47 ? -3.478  22.590  -69.755 1.00 50.62 ? 44  ASN F OD1 1 
ATOM   3510 N  ND2 . ASN F 1 47 ? -3.647  24.137  -71.360 1.00 40.36 ? 44  ASN F ND2 1 
ATOM   3511 N  N   . SER F 1 48 ? 1.463   21.874  -70.044 1.00 19.84 ? 45  SER F N   1 
ATOM   3512 C  CA  . SER F 1 48 ? 2.539   20.927  -70.076 1.00 21.78 ? 45  SER F CA  1 
ATOM   3513 C  C   . SER F 1 48 ? 3.053   20.656  -68.716 1.00 20.47 ? 45  SER F C   1 
ATOM   3514 O  O   . SER F 1 48 ? 4.132   20.060  -68.593 1.00 23.68 ? 45  SER F O   1 
ATOM   3515 C  CB  . SER F 1 48 ? 3.674   21.518  -70.931 1.00 21.39 ? 45  SER F CB  1 
ATOM   3516 O  OG  . SER F 1 48 ? 3.246   21.597  -72.262 1.00 24.81 ? 45  SER F OG  1 
ATOM   3517 N  N   . ARG F 1 49 ? 2.375   21.156  -67.651 1.00 24.18 ? 46  ARG F N   1 
ATOM   3518 C  CA  . ARG F 1 49 ? 2.803   20.751  -66.280 1.00 24.57 ? 46  ARG F CA  1 
ATOM   3519 C  C   . ARG F 1 49 ? 1.600   20.222  -65.438 1.00 25.53 ? 46  ARG F C   1 
ATOM   3520 O  O   . ARG F 1 49 ? 0.502   20.804  -65.440 1.00 24.03 ? 46  ARG F O   1 
ATOM   3521 C  CB  . ARG F 1 49 ? 3.544   21.891  -65.558 1.00 26.58 ? 46  ARG F CB  1 
ATOM   3522 C  CG  . ARG F 1 49 ? 4.890   22.330  -66.138 1.00 26.18 ? 46  ARG F CG  1 
ATOM   3523 C  CD  . ARG F 1 49 ? 6.047   21.321  -65.987 1.00 29.38 ? 46  ARG F CD  1 
ATOM   3524 N  NE  . ARG F 1 49 ? 6.731   21.326  -64.665 1.00 32.78 ? 46  ARG F NE  1 
ATOM   3525 C  CZ  . ARG F 1 49 ? 7.798   22.067  -64.316 1.00 30.99 ? 46  ARG F CZ  1 
ATOM   3526 N  NH1 . ARG F 1 49 ? 8.397   22.910  -65.180 1.00 27.39 ? 46  ARG F NH1 1 
ATOM   3527 N  NH2 . ARG F 1 49 ? 8.301   21.943  -63.073 1.00 33.71 ? 46  ARG F NH2 1 
ATOM   3528 N  N   . ASN F 1 50 ? 1.820   19.101  -64.744 1.00 26.84 ? 47  ASN F N   1 
ATOM   3529 C  CA  . ASN F 1 50 ? 0.763   18.422  -63.937 1.00 28.53 ? 47  ASN F CA  1 
ATOM   3530 C  C   . ASN F 1 50 ? 0.680   19.049  -62.555 1.00 28.96 ? 47  ASN F C   1 
ATOM   3531 O  O   . ASN F 1 50 ? 1.179   18.467  -61.547 1.00 26.22 ? 47  ASN F O   1 
ATOM   3532 C  CB  . ASN F 1 50 ? 1.111   16.926  -63.804 1.00 30.89 ? 47  ASN F CB  1 
ATOM   3533 C  CG  . ASN F 1 50 ? -0.044  16.058  -63.300 1.00 35.42 ? 47  ASN F CG  1 
ATOM   3534 O  OD1 . ASN F 1 50 ? -1.126  16.534  -62.917 1.00 32.91 ? 47  ASN F OD1 1 
ATOM   3535 N  ND2 . ASN F 1 50 ? 0.196   14.736  -63.315 1.00 35.88 ? 47  ASN F ND2 1 
ATOM   3536 N  N   . LEU F 1 51 ? 0.056   20.237  -62.536 1.00 25.82 ? 48  LEU F N   1 
ATOM   3537 C  CA  . LEU F 1 51 ? -0.055  21.106  -61.378 1.00 25.59 ? 48  LEU F CA  1 
ATOM   3538 C  C   . LEU F 1 51 ? -0.712  20.516  -60.095 1.00 24.39 ? 48  LEU F C   1 
ATOM   3539 O  O   . LEU F 1 51 ? -1.802  19.955  -60.144 1.00 26.02 ? 48  LEU F O   1 
ATOM   3540 C  CB  . LEU F 1 51 ? -0.817  22.375  -61.793 1.00 26.60 ? 48  LEU F CB  1 
ATOM   3541 C  CG  . LEU F 1 51 ? -0.978  23.472  -60.755 1.00 26.50 ? 48  LEU F CG  1 
ATOM   3542 C  CD1 . LEU F 1 51 ? 0.398   24.056  -60.443 1.00 27.09 ? 48  LEU F CD1 1 
ATOM   3543 C  CD2 . LEU F 1 51 ? -1.959  24.566  -61.152 1.00 26.76 ? 48  LEU F CD2 1 
ATOM   3544 N  N   . THR F 1 52 ? -0.072  20.719  -58.948 1.00 21.91 ? 49  THR F N   1 
ATOM   3545 C  CA  . THR F 1 52 ? -0.642  20.315  -57.645 1.00 22.20 ? 49  THR F CA  1 
ATOM   3546 C  C   . THR F 1 52 ? -1.478  21.404  -56.922 1.00 18.71 ? 49  THR F C   1 
ATOM   3547 O  O   . THR F 1 52 ? -1.356  22.573  -57.188 1.00 17.18 ? 49  THR F O   1 
ATOM   3548 C  CB  . THR F 1 52 ? 0.430   19.885  -56.642 1.00 22.19 ? 49  THR F CB  1 
ATOM   3549 O  OG1 . THR F 1 52 ? 1.186   21.006  -56.237 1.00 20.89 ? 49  THR F OG1 1 
ATOM   3550 C  CG2 . THR F 1 52 ? 1.323   18.765  -57.164 1.00 23.26 ? 49  THR F CG2 1 
ATOM   3551 N  N   . ILE F 1 53 ? -2.267  21.010  -55.931 1.00 17.88 ? 50  ILE F N   1 
ATOM   3552 C  CA  . ILE F 1 53 ? -3.060  21.975  -55.150 1.00 17.03 ? 50  ILE F CA  1 
ATOM   3553 C  C   . ILE F 1 53 ? -2.163  22.946  -54.348 1.00 16.60 ? 50  ILE F C   1 
ATOM   3554 O  O   . ILE F 1 53 ? -2.483  24.142  -54.239 1.00 14.78 ? 50  ILE F O   1 
ATOM   3555 C  CB  . ILE F 1 53 ? -4.014  21.265  -54.157 1.00 19.15 ? 50  ILE F CB  1 
ATOM   3556 C  CG1 . ILE F 1 53 ? -5.080  20.442  -54.901 1.00 20.72 ? 50  ILE F CG1 1 
ATOM   3557 C  CG2 . ILE F 1 53 ? -4.780  22.263  -53.272 1.00 19.44 ? 50  ILE F CG2 1 
ATOM   3558 C  CD1 . ILE F 1 53 ? -5.972  21.249  -55.776 1.00 21.28 ? 50  ILE F CD1 1 
ATOM   3559 N  N   . LYS F 1 54 ? -1.054  22.438  -53.807 1.00 16.98 ? 51  LYS F N   1 
ATOM   3560 C  CA  . LYS F 1 54 ? -0.138  23.287  -53.026 1.00 19.34 ? 51  LYS F CA  1 
ATOM   3561 C  C   . LYS F 1 54 ? 0.483   24.316  -53.965 1.00 20.22 ? 51  LYS F C   1 
ATOM   3562 O  O   . LYS F 1 54 ? 0.576   25.492  -53.616 1.00 17.34 ? 51  LYS F O   1 
ATOM   3563 C  CB  . LYS F 1 54 ? 0.983   22.477  -52.355 1.00 24.08 ? 51  LYS F CB  1 
ATOM   3564 C  CG  . LYS F 1 54 ? 0.645   21.659  -51.099 1.00 29.45 ? 51  LYS F CG  1 
ATOM   3565 C  CD  . LYS F 1 54 ? 2.017   21.289  -50.497 1.00 35.15 ? 51  LYS F CD  1 
ATOM   3566 C  CE  . LYS F 1 54 ? 1.972   20.388  -49.304 1.00 40.57 ? 51  LYS F CE  1 
ATOM   3567 N  NZ  . LYS F 1 54 ? 3.345   20.408  -48.713 1.00 41.80 ? 51  LYS F NZ  1 
ATOM   3568 N  N   . SER F 1 55 ? 0.861   23.884  -55.180 1.00 18.39 ? 52  SER F N   1 
ATOM   3569 C  CA  . SER F 1 55 ? 1.367   24.843  -56.156 1.00 19.30 ? 52  SER F CA  1 
ATOM   3570 C  C   . SER F 1 55 ? 0.298   25.844  -56.614 1.00 17.13 ? 52  SER F C   1 
ATOM   3571 O  O   . SER F 1 55 ? 0.605   27.028  -56.752 1.00 17.55 ? 52  SER F O   1 
ATOM   3572 C  CB  . SER F 1 55 ? 2.063   24.143  -57.345 1.00 19.65 ? 52  SER F CB  1 
ATOM   3573 O  OG  . SER F 1 55 ? 3.273   23.559  -56.906 1.00 22.30 ? 52  SER F OG  1 
ATOM   3574 N  N   . LEU F 1 56 ? -0.956  25.418  -56.783 1.00 16.40 ? 53  LEU F N   1 
ATOM   3575 C  CA  . LEU F 1 56 ? -2.022  26.310  -57.080 1.00 15.99 ? 53  LEU F CA  1 
ATOM   3576 C  C   . LEU F 1 56 ? -2.188  27.376  -56.026 1.00 16.39 ? 53  LEU F C   1 
ATOM   3577 O  O   . LEU F 1 56 ? -2.444  28.515  -56.365 1.00 16.62 ? 53  LEU F O   1 
ATOM   3578 C  CB  . LEU F 1 56 ? -3.373  25.600  -57.278 1.00 17.11 ? 53  LEU F CB  1 
ATOM   3579 C  CG  . LEU F 1 56 ? -4.629  26.426  -57.518 1.00 17.36 ? 53  LEU F CG  1 
ATOM   3580 C  CD1 . LEU F 1 56 ? -4.538  27.304  -58.788 1.00 18.63 ? 53  LEU F CD1 1 
ATOM   3581 C  CD2 . LEU F 1 56 ? -5.821  25.504  -57.630 1.00 18.32 ? 53  LEU F CD2 1 
ATOM   3582 N  N   . GLU F 1 57 ? -2.040  27.014  -54.754 1.00 14.94 ? 54  GLU F N   1 
ATOM   3583 C  CA  . GLU F 1 57 ? -2.222  27.959  -53.688 1.00 15.21 ? 54  GLU F CA  1 
ATOM   3584 C  C   . GLU F 1 57 ? -1.163  29.040  -53.828 1.00 13.63 ? 54  GLU F C   1 
ATOM   3585 O  O   . GLU F 1 57 ? -1.483  30.203  -53.650 1.00 14.15 ? 54  GLU F O   1 
ATOM   3586 C  CB  . GLU F 1 57 ? -2.091  27.272  -52.311 1.00 15.93 ? 54  GLU F CB  1 
ATOM   3587 C  CG  . GLU F 1 57 ? -2.203  28.181  -51.094 1.00 17.86 ? 54  GLU F CG  1 
ATOM   3588 C  CD  . GLU F 1 57 ? -2.292  27.389  -49.780 1.00 18.38 ? 54  GLU F CD  1 
ATOM   3589 O  OE1 . GLU F 1 57 ? -3.215  27.682  -48.961 1.00 19.45 ? 54  GLU F OE1 1 
ATOM   3590 O  OE2 . GLU F 1 57 ? -1.515  26.456  -49.593 1.00 20.40 ? 54  GLU F OE2 1 
ATOM   3591 N  N   . LEU F 1 58 ? 0.073   28.647  -54.097 1.00 14.42 ? 55  LEU F N   1 
ATOM   3592 C  CA  . LEU F 1 58 ? 1.172   29.613  -54.263 1.00 16.38 ? 55  LEU F CA  1 
ATOM   3593 C  C   . LEU F 1 58 ? 0.922   30.599  -55.389 1.00 16.39 ? 55  LEU F C   1 
ATOM   3594 O  O   . LEU F 1 58 ? 1.161   31.782  -55.242 1.00 15.65 ? 55  LEU F O   1 
ATOM   3595 C  CB  . LEU F 1 58 ? 2.510   28.927  -54.506 1.00 17.80 ? 55  LEU F CB  1 
ATOM   3596 C  CG  . LEU F 1 58 ? 3.106   28.109  -53.374 1.00 20.43 ? 55  LEU F CG  1 
ATOM   3597 C  CD1 . LEU F 1 58 ? 4.402   27.406  -53.764 1.00 20.99 ? 55  LEU F CD1 1 
ATOM   3598 C  CD2 . LEU F 1 58 ? 3.340   29.001  -52.191 1.00 23.25 ? 55  LEU F CD2 1 
ATOM   3599 N  N   . ILE F 1 59 ? 0.389   30.104  -56.504 1.00 17.37 ? 56  ILE F N   1 
ATOM   3600 C  CA  . ILE F 1 59 ? -0.060  30.955  -57.612 1.00 16.73 ? 56  ILE F CA  1 
ATOM   3601 C  C   . ILE F 1 59 ? -1.189  31.884  -57.267 1.00 16.75 ? 56  ILE F C   1 
ATOM   3602 O  O   . ILE F 1 59 ? -1.193  33.089  -57.694 1.00 16.19 ? 56  ILE F O   1 
ATOM   3603 C  CB  . ILE F 1 59 ? -0.364  30.097  -58.880 1.00 18.31 ? 56  ILE F CB  1 
ATOM   3604 C  CG1 . ILE F 1 59 ? 0.969   29.520  -59.343 1.00 20.11 ? 56  ILE F CG1 1 
ATOM   3605 C  CG2 . ILE F 1 59 ? -1.094  30.929  -59.946 1.00 18.42 ? 56  ILE F CG2 1 
ATOM   3606 C  CD1 . ILE F 1 59 ? 0.923   28.349  -60.307 1.00 22.83 ? 56  ILE F CD1 1 
ATOM   3607 N  N   . MET F 1 60 ? -2.179  31.411  -56.541 1.00 17.80 ? 57  MET F N   1 
ATOM   3608 C  CA  . MET F 1 60 ? -3.268  32.323  -56.091 1.00 19.33 ? 57  MET F CA  1 
ATOM   3609 C  C   . MET F 1 60 ? -2.758  33.463  -55.177 1.00 18.34 ? 57  MET F C   1 
ATOM   3610 O  O   . MET F 1 60 ? -3.211  34.616  -55.278 1.00 18.25 ? 57  MET F O   1 
ATOM   3611 C  CB  . MET F 1 60 ? -4.379  31.554  -55.350 1.00 21.23 ? 57  MET F CB  1 
ATOM   3612 C  CG  . MET F 1 60 ? -5.076  30.574  -56.286 1.00 25.94 ? 57  MET F CG  1 
ATOM   3613 S  SD  . MET F 1 60 ? -6.218  29.412  -55.452 1.00 28.14 ? 57  MET F SD  1 
ATOM   3614 C  CE  . MET F 1 60 ? -7.559  30.579  -55.365 1.00 29.12 ? 57  MET F CE  1 
ATOM   3615 N  N   . LYS F 1 61 ? -1.838  33.115  -54.279 1.00 19.88 ? 58  LYS F N   1 
ATOM   3616 C  CA  . LYS F 1 61 ? -1.150  34.115  -53.435 1.00 20.51 ? 58  LYS F CA  1 
ATOM   3617 C  C   . LYS F 1 61 ? -0.364  35.099  -54.328 1.00 20.84 ? 58  LYS F C   1 
ATOM   3618 O  O   . LYS F 1 61 ? -0.474  36.317  -54.175 1.00 18.53 ? 58  LYS F O   1 
ATOM   3619 C  CB  . LYS F 1 61 ? -0.170  33.448  -52.472 1.00 23.03 ? 58  LYS F CB  1 
ATOM   3620 C  CG  . LYS F 1 61 ? -0.842  32.721  -51.307 1.00 27.87 ? 58  LYS F CG  1 
ATOM   3621 C  CD  . LYS F 1 61 ? 0.239   32.170  -50.356 1.00 28.45 ? 58  LYS F CD  1 
ATOM   3622 C  CE  . LYS F 1 61 ? -0.279  31.247  -49.292 1.00 31.57 ? 58  LYS F CE  1 
ATOM   3623 N  NZ  . LYS F 1 61 ? 0.827   30.486  -48.614 1.00 33.16 ? 58  LYS F NZ  1 
ATOM   3624 N  N   . GLY F 1 62 ? 0.399   34.573  -55.270 1.00 19.02 ? 59  GLY F N   1 
ATOM   3625 C  CA  . GLY F 1 62 ? 1.167   35.415  -56.242 1.00 20.20 ? 59  GLY F CA  1 
ATOM   3626 C  C   . GLY F 1 62 ? 0.359   36.368  -57.093 1.00 20.84 ? 59  GLY F C   1 
ATOM   3627 O  O   . GLY F 1 62 ? 0.824   37.483  -57.412 1.00 20.43 ? 59  GLY F O   1 
ATOM   3628 N  N   . LEU F 1 63 ? -0.815  35.901  -57.510 1.00 18.90 ? 60  LEU F N   1 
ATOM   3629 C  CA  . LEU F 1 63 ? -1.775  36.703  -58.211 1.00 18.63 ? 60  LEU F CA  1 
ATOM   3630 C  C   . LEU F 1 63 ? -2.487  37.763  -57.353 1.00 19.45 ? 60  LEU F C   1 
ATOM   3631 O  O   . LEU F 1 63 ? -3.121  38.683  -57.898 1.00 18.06 ? 60  LEU F O   1 
ATOM   3632 C  CB  . LEU F 1 63 ? -2.787  35.855  -58.925 1.00 17.68 ? 60  LEU F CB  1 
ATOM   3633 C  CG  . LEU F 1 63 ? -2.334  34.936  -60.070 1.00 18.25 ? 60  LEU F CG  1 
ATOM   3634 C  CD1 . LEU F 1 63 ? -3.513  34.019  -60.361 1.00 17.44 ? 60  LEU F CD1 1 
ATOM   3635 C  CD2 . LEU F 1 63 ? -1.897  35.668  -61.323 1.00 20.44 ? 60  LEU F CD2 1 
ATOM   3636 N  N   . GLU F 1 64 ? -2.385  37.628  -56.040 1.00 19.83 ? 61  GLU F N   1 
ATOM   3637 C  CA  . GLU F 1 64 ? -3.166  38.409  -55.081 1.00 20.44 ? 61  GLU F CA  1 
ATOM   3638 C  C   . GLU F 1 64 ? -4.658  38.413  -55.346 1.00 22.77 ? 61  GLU F C   1 
ATOM   3639 O  O   . GLU F 1 64 ? -5.325  39.405  -55.153 1.00 21.84 ? 61  GLU F O   1 
ATOM   3640 C  CB  . GLU F 1 64 ? -2.577  39.822  -54.913 1.00 23.33 ? 61  GLU F CB  1 
ATOM   3641 C  CG  . GLU F 1 64 ? -1.148  39.743  -54.413 1.00 24.68 ? 61  GLU F CG  1 
ATOM   3642 C  CD  . GLU F 1 64 ? -0.614  41.131  -54.171 1.00 29.61 ? 61  GLU F CD  1 
ATOM   3643 O  OE1 . GLU F 1 64 ? 0.103   41.630  -55.042 1.00 34.25 ? 61  GLU F OE1 1 
ATOM   3644 O  OE2 . GLU F 1 64 ? -1.025  41.741  -53.172 1.00 33.85 ? 61  GLU F OE2 1 
ATOM   3645 N  N   . VAL F 1 65 ? -5.199  37.271  -55.750 1.00 19.76 ? 62  VAL F N   1 
ATOM   3646 C  CA  . VAL F 1 65 ? -6.579  37.205  -56.128 1.00 20.90 ? 62  VAL F CA  1 
ATOM   3647 C  C   . VAL F 1 65 ? -7.350  36.527  -54.980 1.00 20.87 ? 62  VAL F C   1 
ATOM   3648 O  O   . VAL F 1 65 ? -6.774  35.665  -54.308 1.00 20.51 ? 62  VAL F O   1 
ATOM   3649 C  CB  . VAL F 1 65 ? -6.737  36.452  -57.459 1.00 21.35 ? 62  VAL F CB  1 
ATOM   3650 C  CG1 . VAL F 1 65 ? -6.309  35.000  -57.371 1.00 20.80 ? 62  VAL F CG1 1 
ATOM   3651 C  CG2 . VAL F 1 65 ? -8.159  36.557  -57.936 1.00 24.22 ? 62  VAL F CG2 1 
ATOM   3652 N  N   . SER F 1 66 ? -8.620  36.891  -54.774 1.00 23.81 ? 63  SER F N   1 
ATOM   3653 C  CA  . SER F 1 66 ? -9.447  36.205  -53.773 1.00 25.93 ? 63  SER F CA  1 
ATOM   3654 C  C   . SER F 1 66 ? -9.838  34.826  -54.281 1.00 28.23 ? 63  SER F C   1 
ATOM   3655 O  O   . SER F 1 66 ? -10.026 34.634  -55.463 1.00 24.38 ? 63  SER F O   1 
ATOM   3656 C  CB  . SER F 1 66 ? -10.704 36.983  -53.406 1.00 28.22 ? 63  SER F CB  1 
ATOM   3657 O  OG  . SER F 1 66 ? -11.818 36.708  -54.237 1.00 33.56 ? 63  SER F OG  1 
ATOM   3658 N  N   . ASP F 1 67 ? -9.969  33.885  -53.369 1.00 31.72 ? 64  ASP F N   1 
ATOM   3659 C  CA  . ASP F 1 67 ? -10.451 32.548  -53.686 1.00 31.85 ? 64  ASP F CA  1 
ATOM   3660 C  C   . ASP F 1 67 ? -11.820 32.535  -54.299 1.00 35.12 ? 64  ASP F C   1 
ATOM   3661 O  O   . ASP F 1 67 ? -12.036 31.799  -55.253 1.00 36.82 ? 64  ASP F O   1 
ATOM   3662 C  CB  . ASP F 1 67 ? -10.402 31.697  -52.436 1.00 38.17 ? 64  ASP F CB  1 
ATOM   3663 C  CG  . ASP F 1 67 ? -8.991  31.492  -51.960 1.00 35.58 ? 64  ASP F CG  1 
ATOM   3664 O  OD1 . ASP F 1 67 ? -8.102  31.705  -52.792 1.00 43.82 ? 64  ASP F OD1 1 
ATOM   3665 O  OD2 . ASP F 1 67 ? -8.732  31.187  -50.775 1.00 44.32 ? 64  ASP F OD2 1 
ATOM   3666 N  N   . VAL F 1 68 ? -12.745 33.342  -53.799 1.00 29.30 ? 65  VAL F N   1 
ATOM   3667 C  CA  . VAL F 1 68 ? -14.063 33.432  -54.411 1.00 34.48 ? 65  VAL F CA  1 
ATOM   3668 C  C   . VAL F 1 68 ? -13.983 33.795  -55.901 1.00 32.47 ? 65  VAL F C   1 
ATOM   3669 O  O   . VAL F 1 68 ? -14.638 33.156  -56.760 1.00 29.48 ? 65  VAL F O   1 
ATOM   3670 C  CB  . VAL F 1 68 ? -14.998 34.478  -53.693 1.00 35.97 ? 65  VAL F CB  1 
ATOM   3671 C  CG1 . VAL F 1 68 ? -16.259 34.735  -54.509 1.00 38.44 ? 65  VAL F CG1 1 
ATOM   3672 C  CG2 . VAL F 1 68 ? -15.395 34.001  -52.317 1.00 37.48 ? 65  VAL F CG2 1 
ATOM   3673 N  N   . VAL F 1 69 ? -13.225 34.849  -56.220 1.00 26.04 ? 66  VAL F N   1 
ATOM   3674 C  CA  . VAL F 1 69 ? -13.128 35.257  -57.613 1.00 25.85 ? 66  VAL F CA  1 
ATOM   3675 C  C   . VAL F 1 69 ? -12.486 34.127  -58.431 1.00 22.94 ? 66  VAL F C   1 
ATOM   3676 O  O   . VAL F 1 69 ? -12.974 33.839  -59.540 1.00 22.56 ? 66  VAL F O   1 
ATOM   3677 C  CB  . VAL F 1 69 ? -12.337 36.601  -57.799 1.00 27.38 ? 66  VAL F CB  1 
ATOM   3678 C  CG1 . VAL F 1 69 ? -12.018 36.865  -59.261 1.00 27.80 ? 66  VAL F CG1 1 
ATOM   3679 C  CG2 . VAL F 1 69 ? -13.131 37.763  -57.207 1.00 31.30 ? 66  VAL F CG2 1 
ATOM   3680 N  N   . PHE F 1 70 ? -11.427 33.493  -57.917 1.00 21.10 ? 67  PHE F N   1 
ATOM   3681 C  CA  . PHE F 1 70 ? -10.722 32.478  -58.729 1.00 21.78 ? 67  PHE F CA  1 
ATOM   3682 C  C   . PHE F 1 70 ? -11.680 31.321  -59.035 1.00 20.75 ? 67  PHE F C   1 
ATOM   3683 O  O   . PHE F 1 70 ? -11.852 30.907  -60.179 1.00 19.52 ? 67  PHE F O   1 
ATOM   3684 C  CB  . PHE F 1 70 ? -9.465  31.978  -58.041 1.00 21.73 ? 67  PHE F CB  1 
ATOM   3685 C  CG  . PHE F 1 70 ? -8.684  31.001  -58.850 1.00 22.88 ? 67  PHE F CG  1 
ATOM   3686 C  CD1 . PHE F 1 70 ? -9.012  29.643  -58.876 1.00 24.87 ? 67  PHE F CD1 1 
ATOM   3687 C  CD2 . PHE F 1 70 ? -7.667  31.425  -59.660 1.00 25.24 ? 67  PHE F CD2 1 
ATOM   3688 C  CE1 . PHE F 1 70 ? -8.305  28.765  -59.642 1.00 22.81 ? 67  PHE F CE1 1 
ATOM   3689 C  CE2 . PHE F 1 70 ? -6.947  30.514  -60.429 1.00 25.28 ? 67  PHE F CE2 1 
ATOM   3690 C  CZ  . PHE F 1 70 ? -7.277  29.203  -60.432 1.00 22.57 ? 67  PHE F CZ  1 
ATOM   3691 N  N   . PHE F 1 71 ? -12.311 30.799  -58.001 1.00 22.11 ? 68  PHE F N   1 
ATOM   3692 C  CA  . PHE F 1 71 ? -13.188 29.621  -58.150 1.00 24.17 ? 68  PHE F CA  1 
ATOM   3693 C  C   . PHE F 1 71 ? -14.460 29.942  -58.886 1.00 27.35 ? 68  PHE F C   1 
ATOM   3694 O  O   . PHE F 1 71 ? -14.923 29.116  -59.653 1.00 28.92 ? 68  PHE F O   1 
ATOM   3695 C  CB  . PHE F 1 71 ? -13.395 28.882  -56.782 1.00 22.77 ? 68  PHE F CB  1 
ATOM   3696 C  CG  . PHE F 1 71 ? -12.176 28.172  -56.335 1.00 22.07 ? 68  PHE F CG  1 
ATOM   3697 C  CD1 . PHE F 1 71 ? -11.679 27.133  -57.085 1.00 21.65 ? 68  PHE F CD1 1 
ATOM   3698 C  CD2 . PHE F 1 71 ? -11.480 28.521  -55.166 1.00 22.17 ? 68  PHE F CD2 1 
ATOM   3699 C  CE1 . PHE F 1 71 ? -10.540 26.441  -56.702 1.00 21.33 ? 68  PHE F CE1 1 
ATOM   3700 C  CE2 . PHE F 1 71 ? -10.333 27.837  -54.799 1.00 19.76 ? 68  PHE F CE2 1 
ATOM   3701 C  CZ  . PHE F 1 71 ? -9.859  26.817  -55.572 1.00 21.69 ? 68  PHE F CZ  1 
ATOM   3702 N  N   . GLU F 1 72 ? -14.995 31.163  -58.760 1.00 30.15 ? 69  GLU F N   1 
ATOM   3703 C  CA  . GLU F 1 72 ? -16.101 31.577  -59.646 1.00 30.48 ? 69  GLU F CA  1 
ATOM   3704 C  C   . GLU F 1 72 ? -15.718 31.677  -61.122 1.00 29.48 ? 69  GLU F C   1 
ATOM   3705 O  O   . GLU F 1 72 ? -16.471 31.260  -61.981 1.00 30.17 ? 69  GLU F O   1 
ATOM   3706 C  CB  . GLU F 1 72 ? -16.728 32.903  -59.155 1.00 38.47 ? 69  GLU F CB  1 
ATOM   3707 C  CG  . GLU F 1 72 ? -17.433 32.717  -57.803 1.00 45.13 ? 69  GLU F CG  1 
ATOM   3708 C  CD  . GLU F 1 72 ? -18.372 33.859  -57.426 1.00 53.49 ? 69  GLU F CD  1 
ATOM   3709 O  OE1 . GLU F 1 72 ? -18.376 34.930  -58.095 1.00 54.44 ? 69  GLU F OE1 1 
ATOM   3710 O  OE2 . GLU F 1 72 ? -19.111 33.670  -56.438 1.00 57.30 ? 69  GLU F OE2 1 
ATOM   3711 N  N   . MET F 1 73 ? -14.551 32.231  -61.441 1.00 25.59 ? 70  MET F N   1 
ATOM   3712 C  CA  . MET F 1 73 ? -14.085 32.199  -62.822 1.00 25.16 ? 70  MET F CA  1 
ATOM   3713 C  C   . MET F 1 73 ? -13.924 30.749  -63.350 1.00 25.31 ? 70  MET F C   1 
ATOM   3714 O  O   . MET F 1 73 ? -14.232 30.452  -64.523 1.00 21.37 ? 70  MET F O   1 
ATOM   3715 C  CB  . MET F 1 73 ? -12.763 32.965  -62.956 1.00 25.26 ? 70  MET F CB  1 
ATOM   3716 C  CG  . MET F 1 73 ? -12.842 34.437  -62.538 1.00 29.30 ? 70  MET F CG  1 
ATOM   3717 S  SD  . MET F 1 73 ? -11.286 35.353  -62.792 1.00 33.22 ? 70  MET F SD  1 
ATOM   3718 C  CE  . MET F 1 73 ? -11.072 35.056  -64.545 1.00 30.01 ? 70  MET F CE  1 
ATOM   3719 N  N   . LEU F 1 74 ? -13.400 29.853  -62.495 1.00 21.70 ? 71  LEU F N   1 
ATOM   3720 C  CA  . LEU F 1 74 ? -13.174 28.494  -62.895 1.00 22.23 ? 71  LEU F CA  1 
ATOM   3721 C  C   . LEU F 1 74 ? -14.524 27.824  -63.306 1.00 27.34 ? 71  LEU F C   1 
ATOM   3722 O  O   . LEU F 1 74 ? -14.649 27.275  -64.412 1.00 24.45 ? 71  LEU F O   1 
ATOM   3723 C  CB  . LEU F 1 74 ? -12.500 27.723  -61.782 1.00 21.50 ? 71  LEU F CB  1 
ATOM   3724 C  CG  . LEU F 1 74 ? -12.176 26.256  -62.090 1.00 20.93 ? 71  LEU F CG  1 
ATOM   3725 C  CD1 . LEU F 1 74 ? -11.307 26.179  -63.322 1.00 19.95 ? 71  LEU F CD1 1 
ATOM   3726 C  CD2 . LEU F 1 74 ? -11.486 25.596  -60.926 1.00 21.11 ? 71  LEU F CD2 1 
ATOM   3727 N  N   . ILE F 1 75 ? -15.510 27.921  -62.418 1.00 26.10 ? 72  ILE F N   1 
ATOM   3728 C  CA  . ILE F 1 75 ? -16.879 27.391  -62.654 1.00 29.14 ? 72  ILE F CA  1 
ATOM   3729 C  C   . ILE F 1 75 ? -17.451 27.934  -63.971 1.00 28.98 ? 72  ILE F C   1 
ATOM   3730 O  O   . ILE F 1 75 ? -17.939 27.187  -64.787 1.00 27.27 ? 72  ILE F O   1 
ATOM   3731 C  CB  . ILE F 1 75 ? -17.809 27.781  -61.477 1.00 30.43 ? 72  ILE F CB  1 
ATOM   3732 C  CG1 . ILE F 1 75 ? -17.382 27.044  -60.198 1.00 33.48 ? 72  ILE F CG1 1 
ATOM   3733 C  CG2 . ILE F 1 75 ? -19.264 27.464  -61.760 1.00 33.38 ? 72  ILE F CG2 1 
ATOM   3734 C  CD1 . ILE F 1 75 ? -18.015 27.601  -58.933 1.00 33.92 ? 72  ILE F CD1 1 
ATOM   3735 N  N   . LYS F 1 76 ? -17.331 29.241  -64.181 1.00 34.58 ? 73  LYS F N   1 
ATOM   3736 C  CA  . LYS F 1 76 ? -17.806 29.898  -65.417 1.00 33.06 ? 73  LYS F CA  1 
ATOM   3737 C  C   . LYS F 1 76 ? -17.156 29.302  -66.634 1.00 30.19 ? 73  LYS F C   1 
ATOM   3738 O  O   . LYS F 1 76 ? -17.821 29.036  -67.625 1.00 30.83 ? 73  LYS F O   1 
ATOM   3739 C  CB  . LYS F 1 76 ? -17.575 31.409  -65.352 1.00 37.61 ? 73  LYS F CB  1 
ATOM   3740 C  CG  . LYS F 1 76 ? -18.740 32.199  -64.735 1.00 44.33 ? 73  LYS F CG  1 
ATOM   3741 C  CD  . LYS F 1 76 ? -18.355 33.418  -63.891 1.00 50.73 ? 73  LYS F CD  1 
ATOM   3742 C  CE  . LYS F 1 76 ? -17.159 34.216  -64.437 1.00 57.81 ? 73  LYS F CE  1 
ATOM   3743 N  NZ  . LYS F 1 76 ? -17.513 35.541  -65.018 1.00 61.46 ? 73  LYS F NZ  1 
ATOM   3744 N  N   . GLU F 1 77 ? -15.862 29.034  -66.579 1.00 26.73 ? 74  GLU F N   1 
ATOM   3745 C  CA  . GLU F 1 77 ? -15.196 28.435  -67.744 1.00 28.88 ? 74  GLU F CA  1 
ATOM   3746 C  C   . GLU F 1 77 ? -15.626 26.986  -67.994 1.00 33.01 ? 74  GLU F C   1 
ATOM   3747 O  O   . GLU F 1 77 ? -15.855 26.557  -69.144 1.00 32.15 ? 74  GLU F O   1 
ATOM   3748 C  CB  . GLU F 1 77 ? -13.677 28.475  -67.617 1.00 29.95 ? 74  GLU F CB  1 
ATOM   3749 C  CG  . GLU F 1 77 ? -13.057 29.859  -67.685 1.00 32.40 ? 74  GLU F CG  1 
ATOM   3750 C  CD  . GLU F 1 77 ? -13.399 30.626  -68.968 1.00 33.72 ? 74  GLU F CD  1 
ATOM   3751 O  OE1 . GLU F 1 77 ? -13.668 31.841  -68.864 1.00 37.81 ? 74  GLU F OE1 1 
ATOM   3752 O  OE2 . GLU F 1 77 ? -13.439 30.011  -70.058 1.00 33.40 ? 74  GLU F OE2 1 
ATOM   3753 N  N   . ILE F 1 78 ? -15.687 26.218  -66.905 1.00 30.61 ? 75  ILE F N   1 
ATOM   3754 C  CA  . ILE F 1 78 ? -16.117 24.836  -66.963 1.00 27.68 ? 75  ILE F CA  1 
ATOM   3755 C  C   . ILE F 1 78 ? -17.482 24.771  -67.670 1.00 30.10 ? 75  ILE F C   1 
ATOM   3756 O  O   . ILE F 1 78 ? -17.714 23.896  -68.502 1.00 32.32 ? 75  ILE F O   1 
ATOM   3757 C  CB  . ILE F 1 78 ? -16.193 24.239  -65.543 1.00 25.86 ? 75  ILE F CB  1 
ATOM   3758 C  CG1 . ILE F 1 78 ? -14.763 24.058  -64.991 1.00 24.70 ? 75  ILE F CG1 1 
ATOM   3759 C  CG2 . ILE F 1 78 ? -16.974 22.940  -65.544 1.00 24.61 ? 75  ILE F CG2 1 
ATOM   3760 C  CD1 . ILE F 1 78 ? -14.705 23.488  -63.603 1.00 24.46 ? 75  ILE F CD1 1 
ATOM   3761 N  N   . LEU F 1 79 ? -18.379 25.682  -67.341 1.00 28.90 ? 76  LEU F N   1 
ATOM   3762 C  CA  . LEU F 1 79 ? -19.765 25.594  -67.855 1.00 30.99 ? 76  LEU F CA  1 
ATOM   3763 C  C   . LEU F 1 79 ? -20.051 26.264  -69.201 1.00 31.44 ? 76  LEU F C   1 
ATOM   3764 O  O   . LEU F 1 79 ? -21.211 26.309  -69.613 1.00 29.18 ? 76  LEU F O   1 
ATOM   3765 C  CB  . LEU F 1 79 ? -20.733 26.167  -66.849 1.00 31.17 ? 76  LEU F CB  1 
ATOM   3766 C  CG  . LEU F 1 79 ? -20.778 25.535  -65.455 1.00 36.06 ? 76  LEU F CG  1 
ATOM   3767 C  CD1 . LEU F 1 79 ? -21.807 26.306  -64.641 1.00 34.84 ? 76  LEU F CD1 1 
ATOM   3768 C  CD2 . LEU F 1 79 ? -21.074 24.025  -65.468 1.00 36.74 ? 76  LEU F CD2 1 
ATOM   3769 N  N   . LYS F 1 80 ? -19.016 26.778  -69.860 1.00 35.32 ? 77  LYS F N   1 
ATOM   3770 C  CA  . LYS F 1 80 ? -19.118 27.536  -71.109 1.00 39.50 ? 77  LYS F CA  1 
ATOM   3771 C  C   . LYS F 1 80 ? -20.047 26.902  -72.189 1.00 43.01 ? 77  LYS F C   1 
ATOM   3772 O  O   . LYS F 1 80 ? -21.114 27.455  -72.516 1.00 43.20 ? 77  LYS F O   1 
ATOM   3773 C  CB  . LYS F 1 80 ? -17.716 27.783  -71.670 1.00 44.78 ? 77  LYS F CB  1 
ATOM   3774 C  CG  . LYS F 1 80 ? -16.936 26.547  -72.186 1.00 50.26 ? 77  LYS F CG  1 
ATOM   3775 C  CD  . LYS F 1 80 ? -17.065 25.229  -71.375 1.00 50.22 ? 77  LYS F CD  1 
ATOM   3776 C  CE  . LYS F 1 80 ? -16.162 24.095  -71.843 1.00 56.05 ? 77  LYS F CE  1 
ATOM   3777 N  NZ  . LYS F 1 80 ? -15.484 24.293  -73.170 1.00 57.75 ? 77  LYS F NZ  1 
ATOM   3778 N  N   . HIS F 1 81 ? -19.704 25.709  -72.661 1.00 39.48 ? 78  HIS F N   1 
ATOM   3779 C  CA  . HIS F 1 81 ? -20.256 25.171  -73.901 1.00 42.84 ? 78  HIS F CA  1 
ATOM   3780 C  C   . HIS F 1 81 ? -19.571 23.812  -74.102 1.00 40.22 ? 78  HIS F C   1 
ATOM   3781 O  O   . HIS F 1 81 ? -18.352 23.786  -74.289 1.00 39.51 ? 78  HIS F O   1 
ATOM   3782 C  CB  . HIS F 1 81 ? -19.893 26.146  -75.020 1.00 44.82 ? 78  HIS F CB  1 
ATOM   3783 C  CG  . HIS F 1 81 ? -20.468 25.801  -76.343 1.00 43.84 ? 78  HIS F CG  1 
ATOM   3784 N  ND1 . HIS F 1 81 ? -19.792 25.025  -77.265 1.00 43.26 ? 78  HIS F ND1 1 
ATOM   3785 C  CD2 . HIS F 1 81 ? -21.611 26.203  -76.945 1.00 42.95 ? 78  HIS F CD2 1 
ATOM   3786 C  CE1 . HIS F 1 81 ? -20.523 24.920  -78.359 1.00 44.54 ? 78  HIS F CE1 1 
ATOM   3787 N  NE2 . HIS F 1 81 ? -21.629 25.630  -78.195 1.00 44.88 ? 78  HIS F NE2 1 
ATOM   3788 N  N   . ASP F 1 82 ? -20.317 22.706  -74.007 1.00 39.42 ? 79  ASP F N   1 
ATOM   3789 C  CA  . ASP F 1 82 ? -19.754 21.338  -74.177 1.00 39.15 ? 79  ASP F CA  1 
ATOM   3790 C  C   . ASP F 1 82 ? -18.472 21.201  -73.311 1.00 43.44 ? 79  ASP F C   1 
ATOM   3791 O  O   . ASP F 1 82 ? -18.496 21.668  -72.151 1.00 45.29 ? 79  ASP F O   1 
ATOM   3792 C  CB  . ASP F 1 82 ? -19.475 20.996  -75.684 1.00 35.38 ? 79  ASP F CB  1 
ATOM   3793 C  CG  . ASP F 1 82 ? -20.600 20.156  -76.348 1.00 31.68 ? 79  ASP F CG  1 
ATOM   3794 O  OD1 . ASP F 1 82 ? -21.556 19.708  -75.707 1.00 28.67 ? 79  ASP F OD1 1 
ATOM   3795 O  OD2 . ASP F 1 82 ? -20.550 19.945  -77.570 1.00 36.23 ? 79  ASP F OD2 1 
ATOM   3796 O  OXT . ASP F 1 82 ? -17.408 20.659  -73.711 1.00 39.72 ? 79  ASP F OXT 1 
HETATM 3797 NA NA  . NA  G 2 .  ? -22.193 13.369  -20.420 1.00 27.77 ? 101 NA  A NA  1 
HETATM 3798 C  C   . ACT H 3 .  ? -6.522  24.456  -3.893  1.00 39.38 ? 102 ACT A C   1 
HETATM 3799 O  O   . ACT H 3 .  ? -7.027  23.325  -3.879  1.00 36.44 ? 102 ACT A O   1 
HETATM 3800 O  OXT . ACT H 3 .  ? -5.787  24.884  -4.822  1.00 37.83 ? 102 ACT A OXT 1 
HETATM 3801 C  CH3 . ACT H 3 .  ? -6.834  25.313  -2.740  1.00 36.63 ? 102 ACT A CH3 1 
HETATM 3802 C  C1  . PEG I 4 .  ? -29.294 11.099  -18.469 1.00 28.17 ? 103 PEG A C1  1 
HETATM 3803 O  O1  . PEG I 4 .  ? -28.275 11.240  -17.488 1.00 25.58 ? 103 PEG A O1  1 
HETATM 3804 C  C2  . PEG I 4 .  ? -29.734 12.439  -19.060 1.00 29.06 ? 103 PEG A C2  1 
HETATM 3805 O  O2  . PEG I 4 .  ? -28.754 13.323  -19.610 1.00 27.44 ? 103 PEG A O2  1 
HETATM 3806 C  C3  . PEG I 4 .  ? -27.981 12.937  -20.737 1.00 30.09 ? 103 PEG A C3  1 
HETATM 3807 C  C4  . PEG I 4 .  ? -28.075 13.763  -21.988 1.00 27.98 ? 103 PEG A C4  1 
HETATM 3808 O  O4  . PEG I 4 .  ? -28.216 15.182  -21.856 1.00 27.21 ? 103 PEG A O4  1 
HETATM 3809 C  C1  . PEG J 4 .  ? -21.674 29.665  -25.106 1.00 44.33 ? 104 PEG A C1  1 
HETATM 3810 O  O1  . PEG J 4 .  ? -22.510 29.004  -26.060 1.00 53.04 ? 104 PEG A O1  1 
HETATM 3811 C  C2  . PEG J 4 .  ? -20.251 29.189  -25.393 1.00 43.21 ? 104 PEG A C2  1 
HETATM 3812 O  O2  . PEG J 4 .  ? -19.280 29.833  -24.550 1.00 40.17 ? 104 PEG A O2  1 
HETATM 3813 C  C3  . PEG J 4 .  ? -18.115 30.215  -25.304 1.00 42.34 ? 104 PEG A C3  1 
HETATM 3814 C  C4  . PEG J 4 .  ? -17.026 30.799  -24.423 1.00 40.70 ? 104 PEG A C4  1 
HETATM 3815 O  O4  . PEG J 4 .  ? -15.775 30.768  -25.125 1.00 45.66 ? 104 PEG A O4  1 
HETATM 3816 C  C1  . GOL K 5 .  ? -4.106  20.449  -6.015  1.00 40.19 ? 105 GOL A C1  1 
HETATM 3817 O  O1  . GOL K 5 .  ? -3.401  19.635  -6.974  1.00 41.66 ? 105 GOL A O1  1 
HETATM 3818 C  C2  . GOL K 5 .  ? -3.400  21.790  -5.851  1.00 39.01 ? 105 GOL A C2  1 
HETATM 3819 O  O2  . GOL K 5 .  ? -2.403  22.020  -6.852  1.00 34.49 ? 105 GOL A O2  1 
HETATM 3820 C  C3  . GOL K 5 .  ? -4.450  22.856  -5.901  1.00 40.27 ? 105 GOL A C3  1 
HETATM 3821 O  O3  . GOL K 5 .  ? -3.896  24.158  -5.736  1.00 44.65 ? 105 GOL A O3  1 
HETATM 3822 C  C   . ACT L 3 .  ? -22.123 -10.276 -43.880 1.00 28.17 ? 101 ACT C C   1 
HETATM 3823 O  O   . ACT L 3 .  ? -23.248 -10.716 -43.985 1.00 41.00 ? 101 ACT C O   1 
HETATM 3824 O  OXT . ACT L 3 .  ? -21.528 -10.448 -42.810 1.00 43.74 ? 101 ACT C OXT 1 
HETATM 3825 C  CH3 . ACT L 3 .  ? -21.483 -9.508  -44.945 1.00 30.37 ? 101 ACT C CH3 1 
HETATM 3826 C  C   . ACT M 3 .  ? -32.390 19.279  -16.523 1.00 43.84 ? 101 ACT D C   1 
HETATM 3827 O  O   . ACT M 3 .  ? -31.493 18.541  -16.045 1.00 42.11 ? 101 ACT D O   1 
HETATM 3828 O  OXT . ACT M 3 .  ? -33.202 19.894  -15.765 1.00 44.75 ? 101 ACT D OXT 1 
HETATM 3829 C  CH3 . ACT M 3 .  ? -32.462 19.410  -18.015 1.00 38.43 ? 101 ACT D CH3 1 
HETATM 3830 C  C1  . GOL N 5 .  ? 6.817   43.096  -57.268 1.00 45.05 ? 101 GOL F C1  1 
HETATM 3831 O  O1  . GOL N 5 .  ? 5.932   43.663  -56.284 1.00 45.76 ? 101 GOL F O1  1 
HETATM 3832 C  C2  . GOL N 5 .  ? 5.903   42.502  -58.298 1.00 41.35 ? 101 GOL F C2  1 
HETATM 3833 O  O2  . GOL N 5 .  ? 4.704   43.219  -58.102 1.00 40.09 ? 101 GOL F O2  1 
HETATM 3834 C  C3  . GOL N 5 .  ? 6.230   42.722  -59.742 1.00 44.76 ? 101 GOL F C3  1 
HETATM 3835 O  O3  . GOL N 5 .  ? 5.166   42.034  -60.421 1.00 50.59 ? 101 GOL F O3  1 
HETATM 3836 O  O   . HOH O 6 .  ? -8.627  5.077   -22.084 1.00 11.76 ? 201 HOH A O   1 
HETATM 3837 O  O   . HOH O 6 .  ? -10.677 3.528   -21.003 1.00 13.72 ? 202 HOH A O   1 
HETATM 3838 O  O   . HOH O 6 .  ? -25.098 11.495  -10.807 1.00 16.30 ? 203 HOH A O   1 
HETATM 3839 O  O   . HOH O 6 .  ? -17.072 6.588   -23.372 1.00 16.69 ? 204 HOH A O   1 
HETATM 3840 O  O   . HOH O 6 .  ? -24.122 17.701  -23.447 1.00 19.25 ? 205 HOH A O   1 
HETATM 3841 O  O   . HOH O 6 .  ? -26.323 14.418  -25.245 1.00 20.85 ? 206 HOH A O   1 
HETATM 3842 O  O   . HOH O 6 .  ? -6.333  4.762   -20.856 1.00 18.25 ? 207 HOH A O   1 
HETATM 3843 O  O   . HOH O 6 .  ? -1.572  3.808   -17.991 1.00 20.98 ? 208 HOH A O   1 
HETATM 3844 O  O   . HOH O 6 .  ? -21.484 4.539   -23.155 1.00 21.69 ? 209 HOH A O   1 
HETATM 3845 O  O   . HOH O 6 .  ? -8.656  -0.989  -16.952 1.00 32.37 ? 210 HOH A O   1 
HETATM 3846 O  O   . HOH O 6 .  ? -20.053 13.119  -2.986  1.00 35.50 ? 211 HOH A O   1 
HETATM 3847 O  O   . HOH O 6 .  ? -10.197 22.544  -3.729  1.00 26.56 ? 212 HOH A O   1 
HETATM 3848 O  O   . HOH O 6 .  ? -22.278 15.158  -28.435 1.00 26.48 ? 213 HOH A O   1 
HETATM 3849 O  O   . HOH O 6 .  ? -15.993 8.755   -25.523 1.00 39.21 ? 214 HOH A O   1 
HETATM 3850 O  O   . HOH O 6 .  ? -25.998 6.851   -21.357 1.00 28.40 ? 215 HOH A O   1 
HETATM 3851 O  O   . HOH O 6 .  ? -23.463 2.577   -23.123 1.00 54.59 ? 216 HOH A O   1 
HETATM 3852 O  O   . HOH O 6 .  ? -3.929  25.597  -9.312  1.00 39.31 ? 217 HOH A O   1 
HETATM 3853 O  O   . HOH O 6 .  ? -26.663 16.748  -23.602 1.00 21.26 ? 218 HOH A O   1 
HETATM 3854 O  O   . HOH O 6 .  ? -25.982 24.633  -23.628 1.00 22.13 ? 219 HOH A O   1 
HETATM 3855 O  O   . HOH O 6 .  ? -18.195 -0.986  -12.816 1.00 27.52 ? 220 HOH A O   1 
HETATM 3856 O  O   . HOH O 6 .  ? -28.881 16.492  -0.388  1.00 41.29 ? 221 HOH A O   1 
HETATM 3857 O  O   . HOH O 6 .  ? -12.586 2.098   -3.803  1.00 45.13 ? 222 HOH A O   1 
HETATM 3858 O  O   . HOH O 6 .  ? -22.606 4.153   -10.686 1.00 29.54 ? 223 HOH A O   1 
HETATM 3859 O  O   . HOH O 6 .  ? -15.024 0.746   -6.376  1.00 29.28 ? 224 HOH A O   1 
HETATM 3860 O  O   . HOH O 6 .  ? -5.274  18.720  -7.699  1.00 31.20 ? 225 HOH A O   1 
HETATM 3861 O  O   . HOH O 6 .  ? -29.234 11.516  -15.121 1.00 36.53 ? 226 HOH A O   1 
HETATM 3862 O  O   . HOH O 6 .  ? -17.911 16.964  0.308   1.00 30.67 ? 227 HOH A O   1 
HETATM 3863 O  O   . HOH P 6 .  ? -38.138 -2.369  -21.760 1.00 20.00 ? 101 HOH B O   1 
HETATM 3864 O  O   . HOH P 6 .  ? -30.898 18.643  -10.591 1.00 17.75 ? 102 HOH B O   1 
HETATM 3865 O  O   . HOH P 6 .  ? -42.864 -9.172  -20.445 1.00 18.12 ? 103 HOH B O   1 
HETATM 3866 O  O   . HOH P 6 .  ? -53.122 0.321   -20.106 1.00 15.88 ? 104 HOH B O   1 
HETATM 3867 O  O   . HOH P 6 .  ? -44.797 -11.476 -24.656 1.00 17.33 ? 105 HOH B O   1 
HETATM 3868 O  O   . HOH P 6 .  ? -58.953 7.263   -24.083 1.00 15.04 ? 106 HOH B O   1 
HETATM 3869 O  O   . HOH P 6 .  ? -52.943 3.509   -19.541 1.00 14.74 ? 107 HOH B O   1 
HETATM 3870 O  O   . HOH P 6 .  ? -46.417 -2.071  -17.678 1.00 19.69 ? 108 HOH B O   1 
HETATM 3871 O  O   . HOH P 6 .  ? -47.756 -13.681 -20.804 1.00 21.18 ? 109 HOH B O   1 
HETATM 3872 O  O   . HOH P 6 .  ? -59.556 2.679   -25.084 1.00 31.37 ? 110 HOH B O   1 
HETATM 3873 O  O   . HOH P 6 .  ? -43.805 -11.126 -27.942 1.00 33.31 ? 111 HOH B O   1 
HETATM 3874 O  O   . HOH P 6 .  ? -35.963 14.032  -15.378 1.00 33.82 ? 112 HOH B O   1 
HETATM 3875 O  O   . HOH P 6 .  ? -41.815 3.202   -19.352 1.00 31.91 ? 113 HOH B O   1 
HETATM 3876 O  O   . HOH P 6 .  ? -49.948 -11.419 -23.803 1.00 26.88 ? 114 HOH B O   1 
HETATM 3877 O  O   . HOH P 6 .  ? -46.609 11.490  -36.990 1.00 27.28 ? 115 HOH B O   1 
HETATM 3878 O  O   . HOH P 6 .  ? -38.878 4.025   -18.835 1.00 26.59 ? 116 HOH B O   1 
HETATM 3879 O  O   . HOH P 6 .  ? -53.923 -7.240  -33.450 1.00 25.64 ? 117 HOH B O   1 
HETATM 3880 O  O   . HOH P 6 .  ? -46.841 1.740   -17.884 1.00 27.14 ? 118 HOH B O   1 
HETATM 3881 O  O   . HOH P 6 .  ? -37.623 12.542  -20.192 1.00 27.57 ? 119 HOH B O   1 
HETATM 3882 O  O   . HOH P 6 .  ? -37.712 7.954   -18.368 1.00 34.86 ? 120 HOH B O   1 
HETATM 3883 O  O   . HOH P 6 .  ? -29.203 -1.803  -16.572 1.00 51.14 ? 121 HOH B O   1 
HETATM 3884 O  O   . HOH P 6 .  ? -48.301 12.400  -29.950 1.00 40.81 ? 122 HOH B O   1 
HETATM 3885 O  O   . HOH P 6 .  ? -46.126 -10.321 -30.042 1.00 33.45 ? 123 HOH B O   1 
HETATM 3886 O  O   . HOH P 6 .  ? -52.327 -9.966  -26.277 1.00 30.17 ? 124 HOH B O   1 
HETATM 3887 O  O   . HOH P 6 .  ? -49.064 11.563  -34.319 1.00 48.23 ? 125 HOH B O   1 
HETATM 3888 O  O   . HOH P 6 .  ? -44.868 -9.708  -15.890 1.00 36.55 ? 126 HOH B O   1 
HETATM 3889 O  O   . HOH P 6 .  ? -45.131 -7.735  -18.814 1.00 29.38 ? 127 HOH B O   1 
HETATM 3890 O  O   . HOH P 6 .  ? -58.223 -1.605  -23.202 1.00 24.77 ? 128 HOH B O   1 
HETATM 3891 O  O   . HOH P 6 .  ? -42.614 6.097   -40.098 1.00 32.01 ? 129 HOH B O   1 
HETATM 3892 O  O   . HOH P 6 .  ? -41.022 7.149   -42.491 1.00 46.70 ? 130 HOH B O   1 
HETATM 3893 O  O   . HOH P 6 .  ? -40.832 9.272   -41.999 1.00 34.64 ? 131 HOH B O   1 
HETATM 3894 O  O   . HOH P 6 .  ? -55.023 -6.609  -27.347 1.00 33.71 ? 132 HOH B O   1 
HETATM 3895 O  O   . HOH Q 6 .  ? -29.591 -2.789  -39.653 1.00 18.02 ? 201 HOH C O   1 
HETATM 3896 O  O   . HOH Q 6 .  ? -29.282 -7.493  -31.175 1.00 16.38 ? 202 HOH C O   1 
HETATM 3897 O  O   . HOH Q 6 .  ? -27.256 11.856  -25.761 1.00 14.15 ? 203 HOH C O   1 
HETATM 3898 O  O   . HOH Q 6 .  ? -14.287 -2.564  -42.549 1.00 23.43 ? 204 HOH C O   1 
HETATM 3899 O  O   . HOH Q 6 .  ? -21.379 12.697  -29.847 1.00 20.15 ? 205 HOH C O   1 
HETATM 3900 O  O   . HOH Q 6 .  ? -13.576 6.456   -43.460 1.00 23.90 ? 206 HOH C O   1 
HETATM 3901 O  O   . HOH Q 6 .  ? -12.819 -4.946  -40.675 1.00 23.47 ? 207 HOH C O   1 
HETATM 3902 O  O   . HOH Q 6 .  ? -22.307 -10.297 -31.063 1.00 27.91 ? 208 HOH C O   1 
HETATM 3903 O  O   . HOH Q 6 .  ? -27.176 2.748   -20.268 1.00 25.94 ? 209 HOH C O   1 
HETATM 3904 O  O   . HOH Q 6 .  ? -28.242 10.138  -23.524 1.00 23.79 ? 210 HOH C O   1 
HETATM 3905 O  O   . HOH Q 6 .  ? -9.403  -3.565  -39.018 1.00 27.85 ? 211 HOH C O   1 
HETATM 3906 O  O   . HOH Q 6 .  ? -20.392 11.939  -35.928 1.00 47.34 ? 212 HOH C O   1 
HETATM 3907 O  O   . HOH Q 6 .  ? -20.638 -5.659  -44.473 1.00 21.37 ? 213 HOH C O   1 
HETATM 3908 O  O   . HOH Q 6 .  ? -27.374 5.615   -23.414 1.00 27.07 ? 214 HOH C O   1 
HETATM 3909 O  O   . HOH Q 6 .  ? -7.284  -1.865  -37.144 1.00 40.06 ? 215 HOH C O   1 
HETATM 3910 O  O   . HOH Q 6 .  ? -26.932 -1.793  -23.855 1.00 42.46 ? 216 HOH C O   1 
HETATM 3911 O  O   . HOH Q 6 .  ? -15.451 -10.422 -34.086 1.00 31.16 ? 217 HOH C O   1 
HETATM 3912 O  O   . HOH Q 6 .  ? -9.568  2.715   -35.396 1.00 35.02 ? 218 HOH C O   1 
HETATM 3913 O  O   . HOH Q 6 .  ? -12.184 4.630   -32.095 1.00 43.73 ? 219 HOH C O   1 
HETATM 3914 O  O   . HOH Q 6 .  ? -15.644 -8.175  -30.377 1.00 37.55 ? 220 HOH C O   1 
HETATM 3915 O  O   . HOH Q 6 .  ? -20.100 -1.781  -45.172 1.00 36.42 ? 221 HOH C O   1 
HETATM 3916 O  O   . HOH Q 6 .  ? -14.730 -0.486  -44.276 1.00 45.30 ? 222 HOH C O   1 
HETATM 3917 O  O   . HOH Q 6 .  ? -27.207 8.831   -47.715 1.00 38.38 ? 223 HOH C O   1 
HETATM 3918 O  O   . HOH Q 6 .  ? -14.265 -6.391  -27.829 1.00 37.63 ? 224 HOH C O   1 
HETATM 3919 O  O   . HOH Q 6 .  ? -10.727 1.987   -32.944 1.00 40.83 ? 225 HOH C O   1 
HETATM 3920 O  O   . HOH Q 6 .  ? -27.547 18.256  -31.265 1.00 40.23 ? 226 HOH C O   1 
HETATM 3921 O  O   . HOH R 6 .  ? -36.762 42.087  -6.717  1.00 16.29 ? 201 HOH D O   1 
HETATM 3922 O  O   . HOH R 6 .  ? -18.282 31.697  -20.056 1.00 19.03 ? 202 HOH D O   1 
HETATM 3923 O  O   . HOH R 6 .  ? -23.488 27.143  -20.793 1.00 16.53 ? 203 HOH D O   1 
HETATM 3924 O  O   . HOH R 6 .  ? -21.475 37.377  -16.334 1.00 17.64 ? 204 HOH D O   1 
HETATM 3925 O  O   . HOH R 6 .  ? -24.051 16.385  3.263   1.00 30.61 ? 205 HOH D O   1 
HETATM 3926 O  O   . HOH R 6 .  ? -24.290 19.758  0.942   1.00 37.38 ? 206 HOH D O   1 
HETATM 3927 O  O   . HOH R 6 .  ? -28.799 22.680  -19.301 1.00 24.36 ? 207 HOH D O   1 
HETATM 3928 O  O   . HOH R 6 .  ? -28.493 21.897  -2.543  1.00 30.45 ? 208 HOH D O   1 
HETATM 3929 O  O   . HOH R 6 .  ? -19.647 29.607  -21.648 1.00 32.09 ? 209 HOH D O   1 
HETATM 3930 O  O   . HOH R 6 .  ? -37.586 34.779  -2.814  1.00 32.92 ? 210 HOH D O   1 
HETATM 3931 O  O   . HOH R 6 .  ? -39.959 33.833  -4.334  1.00 30.77 ? 211 HOH D O   1 
HETATM 3932 O  O   . HOH R 6 .  ? -38.320 40.969  -7.927  1.00 24.56 ? 212 HOH D O   1 
HETATM 3933 O  O   . HOH R 6 .  ? -29.465 40.997  -18.183 1.00 28.04 ? 213 HOH D O   1 
HETATM 3934 O  O   . HOH R 6 .  ? -11.409 32.971  -8.691  1.00 34.80 ? 214 HOH D O   1 
HETATM 3935 O  O   . HOH R 6 .  ? -29.245 32.831  -21.149 1.00 40.57 ? 215 HOH D O   1 
HETATM 3936 O  O   . HOH R 6 .  ? -38.045 21.801  -11.481 1.00 34.12 ? 216 HOH D O   1 
HETATM 3937 O  O   . HOH R 6 .  ? -16.693 32.728  -21.838 1.00 31.04 ? 217 HOH D O   1 
HETATM 3938 O  O   . HOH R 6 .  ? -34.844 21.204  3.262   1.00 35.31 ? 218 HOH D O   1 
HETATM 3939 O  O   . HOH R 6 .  ? -34.085 39.460  -4.086  1.00 27.05 ? 219 HOH D O   1 
HETATM 3940 O  O   . HOH R 6 .  ? -32.388 41.075  -3.671  1.00 36.21 ? 220 HOH D O   1 
HETATM 3941 O  O   . HOH S 6 .  ? -12.162 31.837  -43.256 1.00 17.39 ? 101 HOH E O   1 
HETATM 3942 O  O   . HOH S 6 .  ? -13.475 23.223  -43.056 1.00 36.28 ? 102 HOH E O   1 
HETATM 3943 O  O   . HOH S 6 .  ? -12.321 28.714  -42.683 1.00 23.20 ? 103 HOH E O   1 
HETATM 3944 O  O   . HOH S 6 .  ? -17.220 1.814   -55.402 1.00 27.56 ? 104 HOH E O   1 
HETATM 3945 O  O   . HOH S 6 .  ? -19.061 30.052  -45.156 1.00 30.57 ? 105 HOH E O   1 
HETATM 3946 O  O   . HOH S 6 .  ? -12.940 3.685   -45.360 1.00 26.97 ? 106 HOH E O   1 
HETATM 3947 O  O   . HOH S 6 .  ? -23.973 16.962  -57.340 1.00 30.02 ? 107 HOH E O   1 
HETATM 3948 O  O   . HOH S 6 .  ? -15.202 -0.791  -49.327 1.00 33.40 ? 108 HOH E O   1 
HETATM 3949 O  O   . HOH S 6 .  ? -17.079 22.714  -41.693 1.00 32.70 ? 109 HOH E O   1 
HETATM 3950 O  O   . HOH S 6 .  ? -9.512  15.820  -44.859 1.00 29.01 ? 110 HOH E O   1 
HETATM 3951 O  O   . HOH S 6 .  ? -8.668  18.582  -43.970 1.00 27.95 ? 111 HOH E O   1 
HETATM 3952 O  O   . HOH S 6 .  ? -1.642  17.645  -69.583 1.00 44.45 ? 112 HOH E O   1 
HETATM 3953 O  O   . HOH S 6 .  ? -8.308  13.592  -64.683 1.00 30.47 ? 113 HOH E O   1 
HETATM 3954 O  O   . HOH S 6 .  ? -18.597 32.974  -44.935 1.00 36.23 ? 114 HOH E O   1 
HETATM 3955 O  O   . HOH S 6 .  ? -3.672  16.218  -48.119 1.00 36.63 ? 115 HOH E O   1 
HETATM 3956 O  O   . HOH S 6 .  ? -9.877  14.854  -68.065 1.00 29.04 ? 116 HOH E O   1 
HETATM 3957 O  O   . HOH S 6 .  ? -11.899 22.475  -42.530 1.00 44.31 ? 117 HOH E O   1 
HETATM 3958 O  O   . HOH S 6 .  ? -1.924  13.343  -57.592 1.00 34.70 ? 118 HOH E O   1 
HETATM 3959 O  O   . HOH S 6 .  ? -14.186 17.400  -65.020 1.00 33.59 ? 119 HOH E O   1 
HETATM 3960 O  O   . HOH T 6 .  ? -0.965  22.532  -67.439 1.00 32.59 ? 201 HOH F O   1 
HETATM 3961 O  O   . HOH T 6 .  ? 7.878   23.092  -68.031 1.00 24.88 ? 202 HOH F O   1 
HETATM 3962 O  O   . HOH T 6 .  ? 5.260   37.148  -69.594 1.00 24.25 ? 203 HOH F O   1 
HETATM 3963 O  O   . HOH T 6 .  ? 5.060   30.424  -72.263 1.00 23.23 ? 204 HOH F O   1 
HETATM 3964 O  O   . HOH T 6 .  ? -8.224  32.076  -48.472 1.00 22.15 ? 205 HOH F O   1 
HETATM 3965 O  O   . HOH T 6 .  ? 10.457  34.598  -55.505 1.00 29.76 ? 206 HOH F O   1 
HETATM 3966 O  O   . HOH T 6 .  ? -4.757  29.894  -49.393 1.00 28.03 ? 207 HOH F O   1 
HETATM 3967 O  O   . HOH T 6 .  ? 10.418  24.196  -63.504 1.00 26.45 ? 208 HOH F O   1 
HETATM 3968 O  O   . HOH T 6 .  ? -19.740 23.055  -70.476 1.00 29.31 ? 209 HOH F O   1 
HETATM 3969 O  O   . HOH T 6 .  ? 8.916   40.940  -66.292 1.00 31.23 ? 210 HOH F O   1 
HETATM 3970 O  O   . HOH T 6 .  ? -9.577  39.238  -56.198 1.00 33.90 ? 211 HOH F O   1 
HETATM 3971 O  O   . HOH T 6 .  ? 4.471   41.741  -51.735 1.00 29.81 ? 212 HOH F O   1 
HETATM 3972 O  O   . HOH T 6 .  ? 1.018   25.868  -50.844 1.00 36.90 ? 213 HOH F O   1 
HETATM 3973 O  O   . HOH T 6 .  ? -4.222  19.087  -69.581 1.00 43.33 ? 214 HOH F O   1 
HETATM 3974 O  O   . HOH T 6 .  ? -5.727  25.793  -71.131 1.00 28.53 ? 215 HOH F O   1 
HETATM 3975 O  O   . HOH T 6 .  ? -6.413  29.750  -51.450 1.00 46.12 ? 216 HOH F O   1 
HETATM 3976 O  O   . HOH T 6 .  ? 6.501   21.506  -69.406 1.00 32.39 ? 217 HOH F O   1 
HETATM 3977 O  O   . HOH T 6 .  ? -3.012  40.972  -51.346 1.00 29.86 ? 218 HOH F O   1 
HETATM 3978 O  O   . HOH T 6 .  ? -2.563  18.219  -62.669 1.00 17.44 ? 219 HOH F O   1 
HETATM 3979 O  O   . HOH T 6 .  ? 8.749   26.043  -69.477 1.00 37.04 ? 220 HOH F O   1 
HETATM 3980 O  O   . HOH T 6 .  ? 13.543  31.494  -68.233 1.00 36.25 ? 221 HOH F O   1 
HETATM 3981 O  O   . HOH T 6 .  ? 12.647  29.458  -64.880 1.00 36.16 ? 222 HOH F O   1 
HETATM 3982 O  O   . HOH T 6 .  ? 12.257  31.893  -62.556 1.00 35.82 ? 223 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -2 ?  ?   ?   A . n 
A 1 2  SER 2  -1 ?  ?   ?   A . n 
A 1 3  HIS 3  0  ?  ?   ?   A . n 
A 1 4  MET 4  1  1  MET MET A . n 
A 1 5  GLU 5  2  2  GLU GLU A . n 
A 1 6  SER 6  3  3  SER SER A . n 
A 1 7  PHE 7  4  4  PHE PHE A . n 
A 1 8  LEU 8  5  5  LEU LEU A . n 
A 1 9  LEU 9  6  6  LEU LEU A . n 
A 1 10 SER 10 7  7  SER SER A . n 
A 1 11 LYS 11 8  8  LYS LYS A . n 
A 1 12 VAL 12 9  9  VAL VAL A . n 
A 1 13 SER 13 10 10 SER SER A . n 
A 1 14 PHE 14 11 11 PHE PHE A . n 
A 1 15 VAL 15 12 12 VAL VAL A . n 
A 1 16 ILE 16 13 13 ILE ILE A . n 
A 1 17 LYS 17 14 14 LYS LYS A . n 
A 1 18 LYS 18 15 15 LYS LYS A . n 
A 1 19 ILE 19 16 16 ILE ILE A . n 
A 1 20 ARG 20 17 17 ARG ARG A . n 
A 1 21 LEU 21 18 18 LEU LEU A . n 
A 1 22 GLU 22 19 19 GLU GLU A . n 
A 1 23 LYS 23 20 20 LYS LYS A . n 
A 1 24 GLY 24 21 21 GLY GLY A . n 
A 1 25 MET 25 22 22 MET MET A . n 
A 1 26 THR 26 23 23 THR THR A . n 
A 1 27 GLN 27 24 24 GLN GLN A . n 
A 1 28 GLU 28 25 25 GLU GLU A . n 
A 1 29 ASP 29 26 26 ASP ASP A . n 
A 1 30 LEU 30 27 27 LEU LEU A . n 
A 1 31 ALA 31 28 28 ALA ALA A . n 
A 1 32 TYR 32 29 29 TYR TYR A . n 
A 1 33 LYS 33 30 30 LYS LYS A . n 
A 1 34 SER 34 31 31 SER SER A . n 
A 1 35 ASN 35 32 32 ASN ASN A . n 
A 1 36 LEU 36 33 33 LEU LEU A . n 
A 1 37 ASP 37 34 34 ASP ASP A . n 
A 1 38 ARG 38 35 35 ARG ARG A . n 
A 1 39 THR 39 36 36 THR THR A . n 
A 1 40 PHE 40 37 37 PHE PHE A . n 
A 1 41 ILE 41 38 38 ILE ILE A . n 
A 1 42 SER 42 39 39 SER SER A . n 
A 1 43 GLY 43 40 40 GLY GLY A . n 
A 1 44 ILE 44 41 41 ILE ILE A . n 
A 1 45 GLU 45 42 42 GLU GLU A . n 
A 1 46 ARG 46 43 43 ARG ARG A . n 
A 1 47 ASN 47 44 44 ASN ASN A . n 
A 1 48 SER 48 45 45 SER SER A . n 
A 1 49 ARG 49 46 46 ARG ARG A . n 
A 1 50 ASN 50 47 47 ASN ASN A . n 
A 1 51 LEU 51 48 48 LEU LEU A . n 
A 1 52 THR 52 49 49 THR THR A . n 
A 1 53 ILE 53 50 50 ILE ILE A . n 
A 1 54 LYS 54 51 51 LYS LYS A . n 
A 1 55 SER 55 52 52 SER SER A . n 
A 1 56 LEU 56 53 53 LEU LEU A . n 
A 1 57 GLU 57 54 54 GLU GLU A . n 
A 1 58 LEU 58 55 55 LEU LEU A . n 
A 1 59 ILE 59 56 56 ILE ILE A . n 
A 1 60 MET 60 57 57 MET MET A . n 
A 1 61 LYS 61 58 58 LYS LYS A . n 
A 1 62 GLY 62 59 59 GLY GLY A . n 
A 1 63 LEU 63 60 60 LEU LEU A . n 
A 1 64 GLU 64 61 61 GLU GLU A . n 
A 1 65 VAL 65 62 62 VAL VAL A . n 
A 1 66 SER 66 63 63 SER SER A . n 
A 1 67 ASP 67 64 64 ASP ASP A . n 
A 1 68 VAL 68 65 65 VAL VAL A . n 
A 1 69 VAL 69 66 66 VAL VAL A . n 
A 1 70 PHE 70 67 67 PHE PHE A . n 
A 1 71 PHE 71 68 68 PHE PHE A . n 
A 1 72 GLU 72 69 69 GLU GLU A . n 
A 1 73 MET 73 70 70 MET MET A . n 
A 1 74 LEU 74 71 71 LEU LEU A . n 
A 1 75 ILE 75 72 72 ILE ILE A . n 
A 1 76 LYS 76 73 73 LYS LYS A . n 
A 1 77 GLU 77 74 74 GLU GLU A . n 
A 1 78 ILE 78 75 75 ILE ILE A . n 
A 1 79 LEU 79 76 76 LEU LEU A . n 
A 1 80 LYS 80 77 77 LYS LYS A . n 
A 1 81 HIS 81 78 78 HIS HIS A . n 
A 1 82 ASP 82 79 79 ASP ASP A . n 
B 1 1  GLY 1  -2 ?  ?   ?   B . n 
B 1 2  SER 2  -1 ?  ?   ?   B . n 
B 1 3  HIS 3  0  ?  ?   ?   B . n 
B 1 4  MET 4  1  ?  ?   ?   B . n 
B 1 5  GLU 5  2  ?  ?   ?   B . n 
B 1 6  SER 6  3  3  SER SER B . n 
B 1 7  PHE 7  4  4  PHE PHE B . n 
B 1 8  LEU 8  5  5  LEU LEU B . n 
B 1 9  LEU 9  6  6  LEU LEU B . n 
B 1 10 SER 10 7  7  SER SER B . n 
B 1 11 LYS 11 8  8  LYS LYS B . n 
B 1 12 VAL 12 9  9  VAL VAL B . n 
B 1 13 SER 13 10 10 SER SER B . n 
B 1 14 PHE 14 11 11 PHE PHE B . n 
B 1 15 VAL 15 12 12 VAL VAL B . n 
B 1 16 ILE 16 13 13 ILE ILE B . n 
B 1 17 LYS 17 14 14 LYS LYS B . n 
B 1 18 LYS 18 15 15 LYS LYS B . n 
B 1 19 ILE 19 16 16 ILE ILE B . n 
B 1 20 ARG 20 17 17 ARG ARG B . n 
B 1 21 LEU 21 18 18 LEU LEU B . n 
B 1 22 GLU 22 19 19 GLU GLU B . n 
B 1 23 LYS 23 20 20 LYS LYS B . n 
B 1 24 GLY 24 21 21 GLY GLY B . n 
B 1 25 MET 25 22 22 MET MET B . n 
B 1 26 THR 26 23 23 THR THR B . n 
B 1 27 GLN 27 24 24 GLN GLN B . n 
B 1 28 GLU 28 25 25 GLU GLU B . n 
B 1 29 ASP 29 26 26 ASP ASP B . n 
B 1 30 LEU 30 27 27 LEU LEU B . n 
B 1 31 ALA 31 28 28 ALA ALA B . n 
B 1 32 TYR 32 29 29 TYR TYR B . n 
B 1 33 LYS 33 30 30 LYS LYS B . n 
B 1 34 SER 34 31 31 SER SER B . n 
B 1 35 ASN 35 32 32 ASN ASN B . n 
B 1 36 LEU 36 33 33 LEU LEU B . n 
B 1 37 ASP 37 34 34 ASP ASP B . n 
B 1 38 ARG 38 35 35 ARG ARG B . n 
B 1 39 THR 39 36 36 THR THR B . n 
B 1 40 PHE 40 37 37 PHE PHE B . n 
B 1 41 ILE 41 38 38 ILE ILE B . n 
B 1 42 SER 42 39 39 SER SER B . n 
B 1 43 GLY 43 40 40 GLY GLY B . n 
B 1 44 ILE 44 41 41 ILE ILE B . n 
B 1 45 GLU 45 42 42 GLU GLU B . n 
B 1 46 ARG 46 43 43 ARG ARG B . n 
B 1 47 ASN 47 44 44 ASN ASN B . n 
B 1 48 SER 48 45 45 SER SER B . n 
B 1 49 ARG 49 46 46 ARG ARG B . n 
B 1 50 ASN 50 47 47 ASN ASN B . n 
B 1 51 LEU 51 48 48 LEU LEU B . n 
B 1 52 THR 52 49 49 THR THR B . n 
B 1 53 ILE 53 50 50 ILE ILE B . n 
B 1 54 LYS 54 51 51 LYS LYS B . n 
B 1 55 SER 55 52 52 SER SER B . n 
B 1 56 LEU 56 53 53 LEU LEU B . n 
B 1 57 GLU 57 54 54 GLU GLU B . n 
B 1 58 LEU 58 55 55 LEU LEU B . n 
B 1 59 ILE 59 56 56 ILE ILE B . n 
B 1 60 MET 60 57 57 MET MET B . n 
B 1 61 LYS 61 58 58 LYS LYS B . n 
B 1 62 GLY 62 59 59 GLY GLY B . n 
B 1 63 LEU 63 60 60 LEU LEU B . n 
B 1 64 GLU 64 61 61 GLU GLU B . n 
B 1 65 VAL 65 62 62 VAL VAL B . n 
B 1 66 SER 66 63 63 SER SER B . n 
B 1 67 ASP 67 64 64 ASP ASP B . n 
B 1 68 VAL 68 65 65 VAL VAL B . n 
B 1 69 VAL 69 66 66 VAL VAL B . n 
B 1 70 PHE 70 67 67 PHE PHE B . n 
B 1 71 PHE 71 68 68 PHE PHE B . n 
B 1 72 GLU 72 69 69 GLU GLU B . n 
B 1 73 MET 73 70 70 MET MET B . n 
B 1 74 LEU 74 71 71 LEU LEU B . n 
B 1 75 ILE 75 72 72 ILE ILE B . n 
B 1 76 LYS 76 73 73 LYS LYS B . n 
B 1 77 GLU 77 74 74 GLU GLU B . n 
B 1 78 ILE 78 75 75 ILE ILE B . n 
B 1 79 LEU 79 76 76 LEU LEU B . n 
B 1 80 LYS 80 77 77 LYS LYS B . n 
B 1 81 HIS 81 78 78 HIS HIS B . n 
B 1 82 ASP 82 79 79 ASP ASP B . n 
C 1 1  GLY 1  -2 ?  ?   ?   C . n 
C 1 2  SER 2  -1 ?  ?   ?   C . n 
C 1 3  HIS 3  0  ?  ?   ?   C . n 
C 1 4  MET 4  1  ?  ?   ?   C . n 
C 1 5  GLU 5  2  ?  ?   ?   C . n 
C 1 6  SER 6  3  3  SER SER C . n 
C 1 7  PHE 7  4  4  PHE PHE C . n 
C 1 8  LEU 8  5  5  LEU LEU C . n 
C 1 9  LEU 9  6  6  LEU LEU C . n 
C 1 10 SER 10 7  7  SER SER C . n 
C 1 11 LYS 11 8  8  LYS LYS C . n 
C 1 12 VAL 12 9  9  VAL VAL C . n 
C 1 13 SER 13 10 10 SER SER C . n 
C 1 14 PHE 14 11 11 PHE PHE C . n 
C 1 15 VAL 15 12 12 VAL VAL C . n 
C 1 16 ILE 16 13 13 ILE ILE C . n 
C 1 17 LYS 17 14 14 LYS LYS C . n 
C 1 18 LYS 18 15 15 LYS LYS C . n 
C 1 19 ILE 19 16 16 ILE ILE C . n 
C 1 20 ARG 20 17 17 ARG ARG C . n 
C 1 21 LEU 21 18 18 LEU LEU C . n 
C 1 22 GLU 22 19 19 GLU GLU C . n 
C 1 23 LYS 23 20 20 LYS LYS C . n 
C 1 24 GLY 24 21 21 GLY GLY C . n 
C 1 25 MET 25 22 22 MET MET C . n 
C 1 26 THR 26 23 23 THR THR C . n 
C 1 27 GLN 27 24 24 GLN GLN C . n 
C 1 28 GLU 28 25 25 GLU GLU C . n 
C 1 29 ASP 29 26 26 ASP ASP C . n 
C 1 30 LEU 30 27 27 LEU LEU C . n 
C 1 31 ALA 31 28 28 ALA ALA C . n 
C 1 32 TYR 32 29 29 TYR TYR C . n 
C 1 33 LYS 33 30 30 LYS LYS C . n 
C 1 34 SER 34 31 31 SER SER C . n 
C 1 35 ASN 35 32 32 ASN ASN C . n 
C 1 36 LEU 36 33 33 LEU LEU C . n 
C 1 37 ASP 37 34 34 ASP ASP C . n 
C 1 38 ARG 38 35 35 ARG ARG C . n 
C 1 39 THR 39 36 36 THR THR C . n 
C 1 40 PHE 40 37 37 PHE PHE C . n 
C 1 41 ILE 41 38 38 ILE ILE C . n 
C 1 42 SER 42 39 39 SER SER C . n 
C 1 43 GLY 43 40 40 GLY GLY C . n 
C 1 44 ILE 44 41 41 ILE ILE C . n 
C 1 45 GLU 45 42 42 GLU GLU C . n 
C 1 46 ARG 46 43 43 ARG ARG C . n 
C 1 47 ASN 47 44 44 ASN ASN C . n 
C 1 48 SER 48 45 45 SER SER C . n 
C 1 49 ARG 49 46 46 ARG ARG C . n 
C 1 50 ASN 50 47 47 ASN ASN C . n 
C 1 51 LEU 51 48 48 LEU LEU C . n 
C 1 52 THR 52 49 49 THR THR C . n 
C 1 53 ILE 53 50 50 ILE ILE C . n 
C 1 54 LYS 54 51 51 LYS LYS C . n 
C 1 55 SER 55 52 52 SER SER C . n 
C 1 56 LEU 56 53 53 LEU LEU C . n 
C 1 57 GLU 57 54 54 GLU GLU C . n 
C 1 58 LEU 58 55 55 LEU LEU C . n 
C 1 59 ILE 59 56 56 ILE ILE C . n 
C 1 60 MET 60 57 57 MET MET C . n 
C 1 61 LYS 61 58 58 LYS LYS C . n 
C 1 62 GLY 62 59 59 GLY GLY C . n 
C 1 63 LEU 63 60 60 LEU LEU C . n 
C 1 64 GLU 64 61 61 GLU GLU C . n 
C 1 65 VAL 65 62 62 VAL VAL C . n 
C 1 66 SER 66 63 63 SER SER C . n 
C 1 67 ASP 67 64 64 ASP ASP C . n 
C 1 68 VAL 68 65 65 VAL VAL C . n 
C 1 69 VAL 69 66 66 VAL VAL C . n 
C 1 70 PHE 70 67 67 PHE PHE C . n 
C 1 71 PHE 71 68 68 PHE PHE C . n 
C 1 72 GLU 72 69 69 GLU GLU C . n 
C 1 73 MET 73 70 70 MET MET C . n 
C 1 74 LEU 74 71 71 LEU LEU C . n 
C 1 75 ILE 75 72 72 ILE ILE C . n 
C 1 76 LYS 76 73 73 LYS LYS C . n 
C 1 77 GLU 77 74 74 GLU GLU C . n 
C 1 78 ILE 78 75 75 ILE ILE C . n 
C 1 79 LEU 79 76 76 LEU LEU C . n 
C 1 80 LYS 80 77 77 LYS LYS C . n 
C 1 81 HIS 81 78 ?  ?   ?   C . n 
C 1 82 ASP 82 79 ?  ?   ?   C . n 
D 1 1  GLY 1  -2 ?  ?   ?   D . n 
D 1 2  SER 2  -1 ?  ?   ?   D . n 
D 1 3  HIS 3  0  ?  ?   ?   D . n 
D 1 4  MET 4  1  ?  ?   ?   D . n 
D 1 5  GLU 5  2  ?  ?   ?   D . n 
D 1 6  SER 6  3  3  SER SER D . n 
D 1 7  PHE 7  4  4  PHE PHE D . n 
D 1 8  LEU 8  5  5  LEU LEU D . n 
D 1 9  LEU 9  6  6  LEU LEU D . n 
D 1 10 SER 10 7  7  SER SER D . n 
D 1 11 LYS 11 8  8  LYS LYS D . n 
D 1 12 VAL 12 9  9  VAL VAL D . n 
D 1 13 SER 13 10 10 SER SER D . n 
D 1 14 PHE 14 11 11 PHE PHE D . n 
D 1 15 VAL 15 12 12 VAL VAL D . n 
D 1 16 ILE 16 13 13 ILE ILE D . n 
D 1 17 LYS 17 14 14 LYS LYS D . n 
D 1 18 LYS 18 15 15 LYS LYS D . n 
D 1 19 ILE 19 16 16 ILE ILE D . n 
D 1 20 ARG 20 17 17 ARG ARG D . n 
D 1 21 LEU 21 18 18 LEU LEU D . n 
D 1 22 GLU 22 19 19 GLU GLU D . n 
D 1 23 LYS 23 20 20 LYS LYS D . n 
D 1 24 GLY 24 21 21 GLY GLY D . n 
D 1 25 MET 25 22 22 MET MET D . n 
D 1 26 THR 26 23 23 THR THR D . n 
D 1 27 GLN 27 24 24 GLN GLN D . n 
D 1 28 GLU 28 25 25 GLU GLU D . n 
D 1 29 ASP 29 26 26 ASP ASP D . n 
D 1 30 LEU 30 27 27 LEU LEU D . n 
D 1 31 ALA 31 28 28 ALA ALA D . n 
D 1 32 TYR 32 29 29 TYR TYR D . n 
D 1 33 LYS 33 30 30 LYS LYS D . n 
D 1 34 SER 34 31 31 SER SER D . n 
D 1 35 ASN 35 32 32 ASN ASN D . n 
D 1 36 LEU 36 33 33 LEU LEU D . n 
D 1 37 ASP 37 34 34 ASP ASP D . n 
D 1 38 ARG 38 35 35 ARG ARG D . n 
D 1 39 THR 39 36 36 THR THR D . n 
D 1 40 PHE 40 37 37 PHE PHE D . n 
D 1 41 ILE 41 38 38 ILE ILE D . n 
D 1 42 SER 42 39 39 SER SER D . n 
D 1 43 GLY 43 40 40 GLY GLY D . n 
D 1 44 ILE 44 41 41 ILE ILE D . n 
D 1 45 GLU 45 42 42 GLU GLU D . n 
D 1 46 ARG 46 43 43 ARG ARG D . n 
D 1 47 ASN 47 44 44 ASN ASN D . n 
D 1 48 SER 48 45 45 SER SER D . n 
D 1 49 ARG 49 46 46 ARG ARG D . n 
D 1 50 ASN 50 47 47 ASN ASN D . n 
D 1 51 LEU 51 48 48 LEU LEU D . n 
D 1 52 THR 52 49 49 THR THR D . n 
D 1 53 ILE 53 50 50 ILE ILE D . n 
D 1 54 LYS 54 51 51 LYS LYS D . n 
D 1 55 SER 55 52 52 SER SER D . n 
D 1 56 LEU 56 53 53 LEU LEU D . n 
D 1 57 GLU 57 54 54 GLU GLU D . n 
D 1 58 LEU 58 55 55 LEU LEU D . n 
D 1 59 ILE 59 56 56 ILE ILE D . n 
D 1 60 MET 60 57 57 MET MET D . n 
D 1 61 LYS 61 58 58 LYS LYS D . n 
D 1 62 GLY 62 59 59 GLY GLY D . n 
D 1 63 LEU 63 60 60 LEU LEU D . n 
D 1 64 GLU 64 61 61 GLU GLU D . n 
D 1 65 VAL 65 62 62 VAL VAL D . n 
D 1 66 SER 66 63 63 SER SER D . n 
D 1 67 ASP 67 64 64 ASP ASP D . n 
D 1 68 VAL 68 65 65 VAL VAL D . n 
D 1 69 VAL 69 66 66 VAL VAL D . n 
D 1 70 PHE 70 67 67 PHE PHE D . n 
D 1 71 PHE 71 68 68 PHE PHE D . n 
D 1 72 GLU 72 69 69 GLU GLU D . n 
D 1 73 MET 73 70 70 MET MET D . n 
D 1 74 LEU 74 71 71 LEU LEU D . n 
D 1 75 ILE 75 72 72 ILE ILE D . n 
D 1 76 LYS 76 73 73 LYS LYS D . n 
D 1 77 GLU 77 74 74 GLU GLU D . n 
D 1 78 ILE 78 75 75 ILE ILE D . n 
D 1 79 LEU 79 76 76 LEU LEU D . n 
D 1 80 LYS 80 77 77 LYS LYS D . n 
D 1 81 HIS 81 78 78 HIS HIS D . n 
D 1 82 ASP 82 79 ?  ?   ?   D . n 
E 1 1  GLY 1  -2 ?  ?   ?   E . n 
E 1 2  SER 2  -1 ?  ?   ?   E . n 
E 1 3  HIS 3  0  ?  ?   ?   E . n 
E 1 4  MET 4  1  ?  ?   ?   E . n 
E 1 5  GLU 5  2  ?  ?   ?   E . n 
E 1 6  SER 6  3  3  SER SER E . n 
E 1 7  PHE 7  4  4  PHE PHE E . n 
E 1 8  LEU 8  5  5  LEU LEU E . n 
E 1 9  LEU 9  6  6  LEU LEU E . n 
E 1 10 SER 10 7  7  SER SER E . n 
E 1 11 LYS 11 8  8  LYS LYS E . n 
E 1 12 VAL 12 9  9  VAL VAL E . n 
E 1 13 SER 13 10 10 SER SER E . n 
E 1 14 PHE 14 11 11 PHE PHE E . n 
E 1 15 VAL 15 12 12 VAL VAL E . n 
E 1 16 ILE 16 13 13 ILE ILE E . n 
E 1 17 LYS 17 14 14 LYS LYS E . n 
E 1 18 LYS 18 15 15 LYS LYS E . n 
E 1 19 ILE 19 16 16 ILE ILE E . n 
E 1 20 ARG 20 17 17 ARG ARG E . n 
E 1 21 LEU 21 18 18 LEU LEU E . n 
E 1 22 GLU 22 19 19 GLU GLU E . n 
E 1 23 LYS 23 20 20 LYS LYS E . n 
E 1 24 GLY 24 21 21 GLY GLY E . n 
E 1 25 MET 25 22 22 MET MET E . n 
E 1 26 THR 26 23 23 THR THR E . n 
E 1 27 GLN 27 24 24 GLN GLN E . n 
E 1 28 GLU 28 25 25 GLU GLU E . n 
E 1 29 ASP 29 26 26 ASP ASP E . n 
E 1 30 LEU 30 27 27 LEU LEU E . n 
E 1 31 ALA 31 28 28 ALA ALA E . n 
E 1 32 TYR 32 29 29 TYR TYR E . n 
E 1 33 LYS 33 30 30 LYS LYS E . n 
E 1 34 SER 34 31 31 SER SER E . n 
E 1 35 ASN 35 32 32 ASN ASN E . n 
E 1 36 LEU 36 33 33 LEU LEU E . n 
E 1 37 ASP 37 34 34 ASP ASP E . n 
E 1 38 ARG 38 35 35 ARG ARG E . n 
E 1 39 THR 39 36 36 THR THR E . n 
E 1 40 PHE 40 37 37 PHE PHE E . n 
E 1 41 ILE 41 38 38 ILE ILE E . n 
E 1 42 SER 42 39 39 SER SER E . n 
E 1 43 GLY 43 40 40 GLY GLY E . n 
E 1 44 ILE 44 41 41 ILE ILE E . n 
E 1 45 GLU 45 42 42 GLU GLU E . n 
E 1 46 ARG 46 43 43 ARG ARG E . n 
E 1 47 ASN 47 44 44 ASN ASN E . n 
E 1 48 SER 48 45 45 SER SER E . n 
E 1 49 ARG 49 46 46 ARG ARG E . n 
E 1 50 ASN 50 47 47 ASN ASN E . n 
E 1 51 LEU 51 48 48 LEU LEU E . n 
E 1 52 THR 52 49 49 THR THR E . n 
E 1 53 ILE 53 50 50 ILE ILE E . n 
E 1 54 LYS 54 51 51 LYS LYS E . n 
E 1 55 SER 55 52 52 SER SER E . n 
E 1 56 LEU 56 53 53 LEU LEU E . n 
E 1 57 GLU 57 54 54 GLU GLU E . n 
E 1 58 LEU 58 55 55 LEU LEU E . n 
E 1 59 ILE 59 56 56 ILE ILE E . n 
E 1 60 MET 60 57 57 MET MET E . n 
E 1 61 LYS 61 58 58 LYS LYS E . n 
E 1 62 GLY 62 59 59 GLY GLY E . n 
E 1 63 LEU 63 60 60 LEU LEU E . n 
E 1 64 GLU 64 61 61 GLU GLU E . n 
E 1 65 VAL 65 62 62 VAL VAL E . n 
E 1 66 SER 66 63 63 SER SER E . n 
E 1 67 ASP 67 64 64 ASP ASP E . n 
E 1 68 VAL 68 65 65 VAL VAL E . n 
E 1 69 VAL 69 66 66 VAL VAL E . n 
E 1 70 PHE 70 67 67 PHE PHE E . n 
E 1 71 PHE 71 68 68 PHE PHE E . n 
E 1 72 GLU 72 69 69 GLU GLU E . n 
E 1 73 MET 73 70 70 MET MET E . n 
E 1 74 LEU 74 71 71 LEU LEU E . n 
E 1 75 ILE 75 72 72 ILE ILE E . n 
E 1 76 LYS 76 73 73 LYS LYS E . n 
E 1 77 GLU 77 74 74 GLU GLU E . n 
E 1 78 ILE 78 75 75 ILE ILE E . n 
E 1 79 LEU 79 76 76 LEU LEU E . n 
E 1 80 LYS 80 77 77 LYS LYS E . n 
E 1 81 HIS 81 78 78 HIS HIS E . n 
E 1 82 ASP 82 79 79 ASP ASP E . n 
F 1 1  GLY 1  -2 ?  ?   ?   F . n 
F 1 2  SER 2  -1 ?  ?   ?   F . n 
F 1 3  HIS 3  0  ?  ?   ?   F . n 
F 1 4  MET 4  1  ?  ?   ?   F . n 
F 1 5  GLU 5  2  ?  ?   ?   F . n 
F 1 6  SER 6  3  3  SER SER F . n 
F 1 7  PHE 7  4  4  PHE PHE F . n 
F 1 8  LEU 8  5  5  LEU LEU F . n 
F 1 9  LEU 9  6  6  LEU LEU F . n 
F 1 10 SER 10 7  7  SER SER F . n 
F 1 11 LYS 11 8  8  LYS LYS F . n 
F 1 12 VAL 12 9  9  VAL VAL F . n 
F 1 13 SER 13 10 10 SER SER F . n 
F 1 14 PHE 14 11 11 PHE PHE F . n 
F 1 15 VAL 15 12 12 VAL VAL F . n 
F 1 16 ILE 16 13 13 ILE ILE F . n 
F 1 17 LYS 17 14 14 LYS LYS F . n 
F 1 18 LYS 18 15 15 LYS LYS F . n 
F 1 19 ILE 19 16 16 ILE ILE F . n 
F 1 20 ARG 20 17 17 ARG ARG F . n 
F 1 21 LEU 21 18 18 LEU LEU F . n 
F 1 22 GLU 22 19 19 GLU GLU F . n 
F 1 23 LYS 23 20 20 LYS LYS F . n 
F 1 24 GLY 24 21 21 GLY GLY F . n 
F 1 25 MET 25 22 22 MET MET F . n 
F 1 26 THR 26 23 23 THR THR F . n 
F 1 27 GLN 27 24 24 GLN GLN F . n 
F 1 28 GLU 28 25 25 GLU GLU F . n 
F 1 29 ASP 29 26 26 ASP ASP F . n 
F 1 30 LEU 30 27 27 LEU LEU F . n 
F 1 31 ALA 31 28 28 ALA ALA F . n 
F 1 32 TYR 32 29 29 TYR TYR F . n 
F 1 33 LYS 33 30 30 LYS LYS F . n 
F 1 34 SER 34 31 31 SER SER F . n 
F 1 35 ASN 35 32 32 ASN ASN F . n 
F 1 36 LEU 36 33 33 LEU LEU F . n 
F 1 37 ASP 37 34 34 ASP ASP F . n 
F 1 38 ARG 38 35 35 ARG ARG F . n 
F 1 39 THR 39 36 36 THR THR F . n 
F 1 40 PHE 40 37 37 PHE PHE F . n 
F 1 41 ILE 41 38 38 ILE ILE F . n 
F 1 42 SER 42 39 39 SER SER F . n 
F 1 43 GLY 43 40 40 GLY GLY F . n 
F 1 44 ILE 44 41 41 ILE ILE F . n 
F 1 45 GLU 45 42 42 GLU GLU F . n 
F 1 46 ARG 46 43 43 ARG ARG F . n 
F 1 47 ASN 47 44 44 ASN ASN F . n 
F 1 48 SER 48 45 45 SER SER F . n 
F 1 49 ARG 49 46 46 ARG ARG F . n 
F 1 50 ASN 50 47 47 ASN ASN F . n 
F 1 51 LEU 51 48 48 LEU LEU F . n 
F 1 52 THR 52 49 49 THR THR F . n 
F 1 53 ILE 53 50 50 ILE ILE F . n 
F 1 54 LYS 54 51 51 LYS LYS F . n 
F 1 55 SER 55 52 52 SER SER F . n 
F 1 56 LEU 56 53 53 LEU LEU F . n 
F 1 57 GLU 57 54 54 GLU GLU F . n 
F 1 58 LEU 58 55 55 LEU LEU F . n 
F 1 59 ILE 59 56 56 ILE ILE F . n 
F 1 60 MET 60 57 57 MET MET F . n 
F 1 61 LYS 61 58 58 LYS LYS F . n 
F 1 62 GLY 62 59 59 GLY GLY F . n 
F 1 63 LEU 63 60 60 LEU LEU F . n 
F 1 64 GLU 64 61 61 GLU GLU F . n 
F 1 65 VAL 65 62 62 VAL VAL F . n 
F 1 66 SER 66 63 63 SER SER F . n 
F 1 67 ASP 67 64 64 ASP ASP F . n 
F 1 68 VAL 68 65 65 VAL VAL F . n 
F 1 69 VAL 69 66 66 VAL VAL F . n 
F 1 70 PHE 70 67 67 PHE PHE F . n 
F 1 71 PHE 71 68 68 PHE PHE F . n 
F 1 72 GLU 72 69 69 GLU GLU F . n 
F 1 73 MET 73 70 70 MET MET F . n 
F 1 74 LEU 74 71 71 LEU LEU F . n 
F 1 75 ILE 75 72 72 ILE ILE F . n 
F 1 76 LYS 76 73 73 LYS LYS F . n 
F 1 77 GLU 77 74 74 GLU GLU F . n 
F 1 78 ILE 78 75 75 ILE ILE F . n 
F 1 79 LEU 79 76 76 LEU LEU F . n 
F 1 80 LYS 80 77 77 LYS LYS F . n 
F 1 81 HIS 81 78 78 HIS HIS F . n 
F 1 82 ASP 82 79 79 ASP ASP F . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,G,H,I,J,K,M,O,R 
2 1 B,C,L,P,Q           
3 1 E,F,N,S,T           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3160 ? 
1 MORE         -22  ? 
1 'SSA (A^2)'  8580 ? 
2 'ABSA (A^2)' 2150 ? 
2 MORE         -20  ? 
2 'SSA (A^2)'  7940 ? 
3 'ABSA (A^2)' 1930 ? 
3 MORE         -20  ? 
3 'SSA (A^2)'  8190 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? A ARG 49 ? A ARG 46 ? 1_555 NA ? G NA . ? A NA 101 ? 1_555 O  ? A ILE 44 ? A ILE 41 ? 1_555 127.1 ? 
2 O ? A ARG 49 ? A ARG 46 ? 1_555 NA ? G NA . ? A NA 101 ? 1_555 OG ? A SER 13 ? A SER 10 ? 1_555 121.4 ? 
3 O ? A ILE 44 ? A ILE 41 ? 1_555 NA ? G NA . ? A NA 101 ? 1_555 OG ? A SER 13 ? A SER 10 ? 1_555 58.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-11-13 
2 'Structure model' 1 1 2014-06-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .        ?                package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/          ?          ? 
2 Aimless     .        ?                program 'Phil Evans'         ?                        'data scaling'    
http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ?          ? 
3 REFMAC      5.7.0029 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html        Fortran_77 ? 
4 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/           C++        ? 
5 GDA         .        ?                ?       ?                    ?                        'data collection' ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  E HOH 102 ? ? O E HOH 117 ? ? 1.82 
2 1 NZ E LYS 77  ? ? O E HOH 109 ? ? 2.06 
3 1 O  B HOH 130 ? ? O B HOH 131 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A LEU 5  ? ? CG A LEU 5  ? ? CD2 A LEU 5  ? ? 122.81 111.00 11.81 1.70 N 
2 1 NE B ARG 43 ? ? CZ B ARG 43 ? ? NH1 B ARG 43 ? ? 124.65 120.30 4.35  0.50 N 
3 1 CB D ASP 64 ? ? CG D ASP 64 ? ? OD1 D ASP 64 ? ? 124.84 118.30 6.54  0.90 N 
4 1 CB E LEU 5  ? ? CG E LEU 5  ? ? CD2 E LEU 5  ? ? 122.34 111.00 11.34 1.70 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    HIS 
_pdbx_validate_torsion.auth_asym_id    F 
_pdbx_validate_torsion.auth_seq_id     78 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             178.18 
_pdbx_validate_torsion.psi             112.74 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2 ? A GLY 1  
2  1 Y 1 A SER -1 ? A SER 2  
3  1 Y 1 A HIS 0  ? A HIS 3  
4  1 Y 1 B GLY -2 ? B GLY 1  
5  1 Y 1 B SER -1 ? B SER 2  
6  1 Y 1 B HIS 0  ? B HIS 3  
7  1 Y 1 B MET 1  ? B MET 4  
8  1 Y 1 B GLU 2  ? B GLU 5  
9  1 Y 1 C GLY -2 ? C GLY 1  
10 1 Y 1 C SER -1 ? C SER 2  
11 1 Y 1 C HIS 0  ? C HIS 3  
12 1 Y 1 C MET 1  ? C MET 4  
13 1 Y 1 C GLU 2  ? C GLU 5  
14 1 Y 1 C HIS 78 ? C HIS 81 
15 1 Y 1 C ASP 79 ? C ASP 82 
16 1 Y 1 D GLY -2 ? D GLY 1  
17 1 Y 1 D SER -1 ? D SER 2  
18 1 Y 1 D HIS 0  ? D HIS 3  
19 1 Y 1 D MET 1  ? D MET 4  
20 1 Y 1 D GLU 2  ? D GLU 5  
21 1 Y 1 D ASP 79 ? D ASP 82 
22 1 Y 1 E GLY -2 ? E GLY 1  
23 1 Y 1 E SER -1 ? E SER 2  
24 1 Y 1 E HIS 0  ? E HIS 3  
25 1 Y 1 E MET 1  ? E MET 4  
26 1 Y 1 E GLU 2  ? E GLU 5  
27 1 Y 1 F GLY -2 ? F GLY 1  
28 1 Y 1 F SER -1 ? F SER 2  
29 1 Y 1 F HIS 0  ? F HIS 3  
30 1 Y 1 F MET 1  ? F MET 4  
31 1 Y 1 F GLU 2  ? F GLU 5  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'            NA  
3 'ACETATE ION'           ACT 
4 'DI(HYDROXYETHYL)ETHER' PEG 
5 GLYCEROL                GOL 
6 water                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 2 NA  1  101 1   NA  NA  A . 
H 3 ACT 1  102 1   ACT ACT A . 
I 4 PEG 1  103 1   PEG PEG A . 
J 4 PEG 1  104 2   PEG PEG A . 
K 5 GOL 1  105 1   GOL GOL A . 
L 3 ACT 1  101 3   ACT ACT C . 
M 3 ACT 1  101 2   ACT ACT D . 
N 5 GOL 1  101 2   GOL GOL F . 
O 6 HOH 1  201 5   HOH HOH A . 
O 6 HOH 2  202 6   HOH HOH A . 
O 6 HOH 3  203 11  HOH HOH A . 
O 6 HOH 4  204 12  HOH HOH A . 
O 6 HOH 5  205 20  HOH HOH A . 
O 6 HOH 6  206 25  HOH HOH A . 
O 6 HOH 7  207 38  HOH HOH A . 
O 6 HOH 8  208 44  HOH HOH A . 
O 6 HOH 9  209 56  HOH HOH A . 
O 6 HOH 10 210 63  HOH HOH A . 
O 6 HOH 11 211 73  HOH HOH A . 
O 6 HOH 12 212 88  HOH HOH A . 
O 6 HOH 13 213 89  HOH HOH A . 
O 6 HOH 14 214 100 HOH HOH A . 
O 6 HOH 15 215 101 HOH HOH A . 
O 6 HOH 16 216 102 HOH HOH A . 
O 6 HOH 17 217 104 HOH HOH A . 
O 6 HOH 18 218 108 HOH HOH A . 
O 6 HOH 19 219 109 HOH HOH A . 
O 6 HOH 20 220 116 HOH HOH A . 
O 6 HOH 21 221 123 HOH HOH A . 
O 6 HOH 22 222 125 HOH HOH A . 
O 6 HOH 23 223 130 HOH HOH A . 
O 6 HOH 24 224 133 HOH HOH A . 
O 6 HOH 25 225 139 HOH HOH A . 
O 6 HOH 26 226 144 HOH HOH A . 
O 6 HOH 27 227 99  HOH HOH A . 
P 6 HOH 1  101 7   HOH HOH B . 
P 6 HOH 2  102 13  HOH HOH B . 
P 6 HOH 3  103 14  HOH HOH B . 
P 6 HOH 4  104 16  HOH HOH B . 
P 6 HOH 5  105 17  HOH HOH B . 
P 6 HOH 6  106 18  HOH HOH B . 
P 6 HOH 7  107 24  HOH HOH B . 
P 6 HOH 8  108 35  HOH HOH B . 
P 6 HOH 9  109 37  HOH HOH B . 
P 6 HOH 10 110 39  HOH HOH B . 
P 6 HOH 11 111 40  HOH HOH B . 
P 6 HOH 12 112 43  HOH HOH B . 
P 6 HOH 13 113 45  HOH HOH B . 
P 6 HOH 14 114 46  HOH HOH B . 
P 6 HOH 15 115 53  HOH HOH B . 
P 6 HOH 16 116 65  HOH HOH B . 
P 6 HOH 17 117 67  HOH HOH B . 
P 6 HOH 18 118 68  HOH HOH B . 
P 6 HOH 19 119 70  HOH HOH B . 
P 6 HOH 20 120 71  HOH HOH B . 
P 6 HOH 21 121 76  HOH HOH B . 
P 6 HOH 22 122 78  HOH HOH B . 
P 6 HOH 23 123 82  HOH HOH B . 
P 6 HOH 24 124 83  HOH HOH B . 
P 6 HOH 25 125 91  HOH HOH B . 
P 6 HOH 26 126 113 HOH HOH B . 
P 6 HOH 27 127 114 HOH HOH B . 
P 6 HOH 28 128 129 HOH HOH B . 
P 6 HOH 29 129 134 HOH HOH B . 
P 6 HOH 30 130 145 HOH HOH B . 
P 6 HOH 31 131 146 HOH HOH B . 
P 6 HOH 32 132 147 HOH HOH B . 
Q 6 HOH 1  201 1   HOH HOH C . 
Q 6 HOH 2  202 2   HOH HOH C . 
Q 6 HOH 3  203 3   HOH HOH C . 
Q 6 HOH 4  204 19  HOH HOH C . 
Q 6 HOH 5  205 23  HOH HOH C . 
Q 6 HOH 6  206 28  HOH HOH C . 
Q 6 HOH 7  207 29  HOH HOH C . 
Q 6 HOH 8  208 32  HOH HOH C . 
Q 6 HOH 9  209 47  HOH HOH C . 
Q 6 HOH 10 210 50  HOH HOH C . 
Q 6 HOH 11 211 51  HOH HOH C . 
Q 6 HOH 12 212 52  HOH HOH C . 
Q 6 HOH 13 213 60  HOH HOH C . 
Q 6 HOH 14 214 61  HOH HOH C . 
Q 6 HOH 15 215 75  HOH HOH C . 
Q 6 HOH 16 216 81  HOH HOH C . 
Q 6 HOH 17 217 84  HOH HOH C . 
Q 6 HOH 18 218 92  HOH HOH C . 
Q 6 HOH 19 219 93  HOH HOH C . 
Q 6 HOH 20 220 94  HOH HOH C . 
Q 6 HOH 21 221 96  HOH HOH C . 
Q 6 HOH 22 222 103 HOH HOH C . 
Q 6 HOH 23 223 117 HOH HOH C . 
Q 6 HOH 24 224 136 HOH HOH C . 
Q 6 HOH 25 225 143 HOH HOH C . 
Q 6 HOH 26 226 148 HOH HOH C . 
R 6 HOH 1  201 9   HOH HOH D . 
R 6 HOH 2  202 15  HOH HOH D . 
R 6 HOH 3  203 21  HOH HOH D . 
R 6 HOH 4  204 26  HOH HOH D . 
R 6 HOH 5  205 34  HOH HOH D . 
R 6 HOH 6  206 90  HOH HOH D . 
R 6 HOH 7  207 111 HOH HOH D . 
R 6 HOH 8  208 115 HOH HOH D . 
R 6 HOH 9  209 118 HOH HOH D . 
R 6 HOH 10 210 121 HOH HOH D . 
R 6 HOH 11 211 122 HOH HOH D . 
R 6 HOH 12 212 126 HOH HOH D . 
R 6 HOH 13 213 127 HOH HOH D . 
R 6 HOH 14 214 141 HOH HOH D . 
R 6 HOH 15 215 149 HOH HOH D . 
R 6 HOH 16 216 150 HOH HOH D . 
R 6 HOH 17 217 151 HOH HOH D . 
R 6 HOH 18 218 152 HOH HOH D . 
R 6 HOH 19 219 154 HOH HOH D . 
R 6 HOH 20 220 155 HOH HOH D . 
S 6 HOH 1  101 4   HOH HOH E . 
S 6 HOH 2  102 22  HOH HOH E . 
S 6 HOH 3  103 27  HOH HOH E . 
S 6 HOH 4  104 31  HOH HOH E . 
S 6 HOH 5  105 49  HOH HOH E . 
S 6 HOH 6  106 54  HOH HOH E . 
S 6 HOH 7  107 55  HOH HOH E . 
S 6 HOH 8  108 57  HOH HOH E . 
S 6 HOH 9  109 59  HOH HOH E . 
S 6 HOH 10 110 62  HOH HOH E . 
S 6 HOH 11 111 77  HOH HOH E . 
S 6 HOH 12 112 80  HOH HOH E . 
S 6 HOH 13 113 87  HOH HOH E . 
S 6 HOH 14 114 95  HOH HOH E . 
S 6 HOH 15 115 110 HOH HOH E . 
S 6 HOH 16 116 112 HOH HOH E . 
S 6 HOH 17 117 124 HOH HOH E . 
S 6 HOH 18 118 128 HOH HOH E . 
S 6 HOH 19 119 140 HOH HOH E . 
T 6 HOH 1  201 8   HOH HOH F . 
T 6 HOH 2  202 33  HOH HOH F . 
T 6 HOH 3  203 36  HOH HOH F . 
T 6 HOH 4  204 42  HOH HOH F . 
T 6 HOH 5  205 48  HOH HOH F . 
T 6 HOH 6  206 58  HOH HOH F . 
T 6 HOH 7  207 64  HOH HOH F . 
T 6 HOH 8  208 66  HOH HOH F . 
T 6 HOH 9  209 72  HOH HOH F . 
T 6 HOH 10 210 74  HOH HOH F . 
T 6 HOH 11 211 79  HOH HOH F . 
T 6 HOH 12 212 97  HOH HOH F . 
T 6 HOH 13 213 98  HOH HOH F . 
T 6 HOH 14 214 105 HOH HOH F . 
T 6 HOH 15 215 119 HOH HOH F . 
T 6 HOH 16 216 131 HOH HOH F . 
T 6 HOH 17 217 132 HOH HOH F . 
T 6 HOH 18 218 135 HOH HOH F . 
T 6 HOH 19 219 137 HOH HOH F . 
T 6 HOH 20 220 142 HOH HOH F . 
T 6 HOH 21 221 153 HOH HOH F . 
T 6 HOH 22 222 156 HOH HOH F . 
T 6 HOH 23 223 157 HOH HOH F . 
#