data_4IA8
# 
_entry.id   4IA8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IA8         
RCSB  RCSB076499   
WWPDB D_1000076499 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4FN3 'S52A Mutant Free Protein'        unspecified 
PDB 4FBI 'R46A Mutant Free Protein'        unspecified 
PDB 4F8D 'R46A Mutant Free Protein'        unspecified 
PDB 3G5G 'Native Free Protein'             unspecified 
PDB 3FYA 'R35A Mutant Free Protein'        unspecified 
PDB 3CLC 'DNA Bound Tetramer'              unspecified 
PDB 3S8Q 'DNA Bound Dimer (OL)'            unspecified 
PDB 3UFD 'DNA Bound Dimer (OM'             unspecified 
PDB 4I6R 'Native Free Protein (Triclinic)' unspecified 
PDB 4I6T 'T36A Mutant Free Protein'        unspecified 
PDB 4I6U 'Y37F Mutant Free Protein'        unspecified 
PDB 4I8T 'Dimer and 19bp DNA co-crystal'   unspecified 
# 
_pdbx_database_status.entry_id                        4IA8 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-06 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Martin, R.N.A.' 1 
'McGeehan, J.E.' 2 
'Kneale, G.G.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.' 'Plos One'                 9  e98365 e98365 
2014 ?      US 1932-6203 ?    ? 24887147 10.1371/journal.pone.0098365 
1       'Structure of the restriction-modification controller protein C.Esp1396I.' 'Acta Crystallogr.,Sect.D' 65 900    905    
2009 ABCRE6 DK 0907-4449 0766 ? 19690367 10.1107/S0907444909020514    
2       
'Recognition of dual symmetry by the controller protein C.Esp1396I based on the structure of the transcriptional activation complex.' 
'Nucleic Acids Res.'       40 4158   4167   2012 NARHAD UK 0305-1048 0389 ? 22210861 10.1093/nar/gkr1250          
3       'The structural basis of differential DNA sequence recognition by restriction-modification controller proteins.' 
'Nucleic Acids Res.'       40 10532  10542  2012 NARHAD UK 0305-1048 0389 ? 22941636 10.1093/nar/gks718           
4       'Structure of the restriction-modification controller protein C.Esp1396I.' 'Acta Crystallogr.,Sect.D' 65 900    905    
2009 ABCRE6 DK 0907-4449 0766 ? 19690367 10.1107/S0907444909020514    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Martin, R.N.'   1  
primary 'McGeehan, J.E.' 2  
primary 'Kneale, G.'     3  
1       'Ball, N.'       4  
1       'Streeter, S.D.' 5  
1       'Kneale, G.G.'   6  
1       'McGeehan, J.E.' 7  
2       'McGeehan, J.E.' 8  
2       'Ball, N.J.'     9  
2       'Streeter, S.D.' 10 
2       'Thresh, S.J.'   11 
2       'Kneale, G.G.'   12 
3       'Ball, N.J.'     13 
3       'McGeehan, J.E.' 14 
3       'Streeter, S.D.' 15 
3       'Thresh, S.J.'   16 
3       'Kneale, G.G.'   17 
4       'Ball, N.'       18 
4       'Streeter, S.D.' 19 
4       'Kneale, G.G.'   20 
4       'McGeehan, J.E.' 21 
# 
_cell.length_a           34.260 
_cell.length_b           34.280 
_cell.length_c           41.120 
_cell.angle_alpha        104.440 
_cell.angle_beta         108.920 
_cell.angle_gamma        97.420 
_cell.entry_id           4IA8 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         4IA8 
_symmetry.Int_Tables_number                1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Regulatory protein' 9429.078 2  ? A37W ? ? 
2 non-polymer syn 'SULFATE ION'        96.063   1  ? ?    ? ? 
3 water       nat water                18.015   44 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTAISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTAISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  GLU n 
1 6  SER n 
1 7  PHE n 
1 8  LEU n 
1 9  LEU n 
1 10 SER n 
1 11 LYS n 
1 12 VAL n 
1 13 SER n 
1 14 PHE n 
1 15 VAL n 
1 16 ILE n 
1 17 LYS n 
1 18 LYS n 
1 19 ILE n 
1 20 ARG n 
1 21 LEU n 
1 22 GLU n 
1 23 LYS n 
1 24 GLY n 
1 25 MET n 
1 26 THR n 
1 27 GLN n 
1 28 GLU n 
1 29 ASP n 
1 30 LEU n 
1 31 ALA n 
1 32 TYR n 
1 33 LYS n 
1 34 SER n 
1 35 ASN n 
1 36 LEU n 
1 37 ASP n 
1 38 ARG n 
1 39 THR n 
1 40 ALA n 
1 41 ILE n 
1 42 SER n 
1 43 GLY n 
1 44 ILE n 
1 45 GLU n 
1 46 ARG n 
1 47 ASN n 
1 48 SER n 
1 49 ARG n 
1 50 ASN n 
1 51 LEU n 
1 52 THR n 
1 53 ILE n 
1 54 LYS n 
1 55 SER n 
1 56 LEU n 
1 57 GLU n 
1 58 LEU n 
1 59 ILE n 
1 60 MET n 
1 61 LYS n 
1 62 GLY n 
1 63 LEU n 
1 64 GLU n 
1 65 VAL n 
1 66 SER n 
1 67 ASP n 
1 68 VAL n 
1 69 VAL n 
1 70 PHE n 
1 71 PHE n 
1 72 GLU n 
1 73 MET n 
1 74 LEU n 
1 75 ILE n 
1 76 LYS n 
1 77 GLU n 
1 78 ILE n 
1 79 LEU n 
1 80 LYS n 
1 81 HIS n 
1 82 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 esp1396IC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    RFL1396 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacter sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     211595 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8GGH0_9ENTR 
_struct_ref.pdbx_db_accession          Q8GGH0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IA8 A 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
2 1 4IA8 B 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IA8 GLY A 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 1 
1 4IA8 SER A 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 2 
1 4IA8 HIS A 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  3 
1 4IA8 ALA A 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 4 
2 4IA8 GLY B 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 5 
2 4IA8 SER B 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 6 
2 4IA8 HIS B 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  7 
2 4IA8 ALA B 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4IA8 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.13 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'0.2 M lithium sulfate, 0.1 M sodium acetate, 50 % v/v PEG 400, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M' 
_diffrn_detector.pdbx_collection_date   2011-10-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111) double crystal monochromator' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.917285 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_wavelength_list        0.917285 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
# 
_reflns.entry_id                     4IA8 
_reflns.d_resolution_high            1.850 
_reflns.d_resolution_low             31.550 
_reflns.number_obs                   13243 
_reflns.pdbx_Rmerge_I_obs            0.119 
_reflns.pdbx_netI_over_sigmaI        5.800 
_reflns.pdbx_redundancy              1.900 
_reflns.percent_possible_obs         75.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   19685 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.850 1.890  ? 2927 ? 0.011 1.500  ? ? 1.900 ? 733 79.100 1 1 
9.060 31.550 ? 473  ? 0.011 14.000 ? ? 2.100 ? 115 95.800 2 1 
# 
_refine.entry_id                                 4IA8 
_refine.ls_d_res_high                            1.8500 
_refine.ls_d_res_low                             31.550 
_refine.pdbx_ls_sigma_F                          5.630 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    89.6500 
_refine.ls_number_reflns_obs                     12775 
_refine.ls_number_reflns_all                     19685 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1769 
_refine.ls_R_factor_R_work                       0.1747 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2202 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.2900 
_refine.ls_number_reflns_R_free                  676 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               29.4732 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1400 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'pdb entry 3G5G' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8850 
_refine.B_iso_max                                80.260 
_refine.B_iso_min                                9.820 
_refine.pdbx_overall_phase_error                 18.9900 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.170 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               1293 
_refine_hist.d_res_high                       1.8500 
_refine_hist.d_res_low                        31.550 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           1298 0.018  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          1744 1.732  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     210  0.127  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      214  0.008  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 524  15.347 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.8501 1.9929  5 92.0000 2489 . 0.1182 0.1760 . 152 . 2641 . . 'X-RAY DIFFRACTION' 
1.9929 2.1934  5 91.0000 2463 . 0.1277 0.1946 . 139 . 2602 . . 'X-RAY DIFFRACTION' 
2.1934 2.5107  5 86.0000 2292 . 0.1592 0.2108 . 149 . 2441 . . 'X-RAY DIFFRACTION' 
2.5107 3.1628  5 91.0000 2489 . 0.1964 0.2314 . 115 . 2604 . . 'X-RAY DIFFRACTION' 
3.1628 32.3180 5 87.0000 2366 . 0.1903 0.2354 . 121 . 2487 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IA8 
_struct.title                     
'Crystal Structure of a Y37A mutant of the Restriction-Modification Controller Protein C.Esp1396I' 
_struct.pdbx_descriptor           'Regulatory protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IA8 
_struct_keywords.text            'Restriction-modification, helix-turn-helix, transcriptional regulator, DNA, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 6  ? LYS A 23 ? SER A 3  LYS A 20 1 ? 18 
HELX_P HELX_P2  2  THR A 26 ? ASN A 35 ? THR A 23 ASN A 32 1 ? 10 
HELX_P HELX_P3  3  ASP A 37 ? ASN A 47 ? ASP A 34 ASN A 44 1 ? 11 
HELX_P HELX_P4  4  THR A 52 ? GLU A 64 ? THR A 49 GLU A 61 1 ? 13 
HELX_P HELX_P5  5  SER A 66 ? ASP A 82 ? SER A 63 ASP A 79 1 ? 17 
HELX_P HELX_P6  6  PHE B 7  ? LYS B 23 ? PHE B 4  LYS B 20 1 ? 17 
HELX_P HELX_P7  7  THR B 26 ? ASN B 35 ? THR B 23 ASN B 32 1 ? 10 
HELX_P HELX_P8  8  ASP B 37 ? ARG B 46 ? ASP B 34 ARG B 43 1 ? 10 
HELX_P HELX_P9  9  THR B 52 ? GLU B 64 ? THR B 49 GLU B 61 1 ? 13 
HELX_P HELX_P10 10 SER B 66 ? ASP B 82 ? SER B 63 ASP B 79 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 B 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ARG A 20 ? ARG A 17  . ? 1_666 ? 
2  AC1 10 THR A 26 ? THR A 23  . ? 1_666 ? 
3  AC1 10 GLN A 27 ? GLN A 24  . ? 1_666 ? 
4  AC1 10 ARG A 38 ? ARG A 35  . ? 1_666 ? 
5  AC1 10 THR B 26 ? THR B 23  . ? 1_555 ? 
6  AC1 10 GLN B 27 ? GLN B 24  . ? 1_555 ? 
7  AC1 10 GLU B 28 ? GLU B 25  . ? 1_555 ? 
8  AC1 10 ARG B 38 ? ARG B 35  . ? 1_555 ? 
9  AC1 10 HOH E .  ? HOH B 201 . ? 1_555 ? 
10 AC1 10 HOH E .  ? HOH B 203 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4IA8 
_atom_sites.fract_transf_matrix[1][1]   0.029189 
_atom_sites.fract_transf_matrix[1][2]   0.003801 
_atom_sites.fract_transf_matrix[1][3]   0.011767 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.029418 
_atom_sites.fract_transf_matrix[2][3]   0.009608 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.027044 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 6  ? 15.161  12.591  17.692 1.00 60.96 ? 3   SER A N   1 
ATOM   2    C CA  . SER A 1 6  ? 16.132  12.065  18.653 1.00 65.63 ? 3   SER A CA  1 
ATOM   3    C C   . SER A 1 6  ? 16.406  10.584  18.466 1.00 65.91 ? 3   SER A C   1 
ATOM   4    O O   . SER A 1 6  ? 15.597  9.858   17.891 1.00 64.23 ? 3   SER A O   1 
ATOM   5    C CB  . SER A 1 6  ? 15.635  12.236  20.079 1.00 66.38 ? 3   SER A CB  1 
ATOM   6    O OG  . SER A 1 6  ? 15.506  10.950  20.662 1.00 64.72 ? 3   SER A OG  1 
ATOM   7    N N   . PHE A 1 7  ? 17.523  10.119  19.012 1.00 70.36 ? 4   PHE A N   1 
ATOM   8    C CA  . PHE A 1 7  ? 17.910  8.735   18.790 1.00 72.15 ? 4   PHE A CA  1 
ATOM   9    C C   . PHE A 1 7  ? 17.139  7.728   19.647 1.00 70.79 ? 4   PHE A C   1 
ATOM   10   O O   . PHE A 1 7  ? 16.940  6.596   19.215 1.00 74.70 ? 4   PHE A O   1 
ATOM   11   C CB  . PHE A 1 7  ? 19.426  8.523   18.918 1.00 69.10 ? 4   PHE A CB  1 
ATOM   12   C CG  . PHE A 1 7  ? 19.881  7.180   18.409 1.00 63.75 ? 4   PHE A CG  1 
ATOM   13   C CD1 . PHE A 1 7  ? 20.099  6.978   17.054 1.00 64.29 ? 4   PHE A CD1 1 
ATOM   14   C CD2 . PHE A 1 7  ? 20.053  6.113   19.278 1.00 59.35 ? 4   PHE A CD2 1 
ATOM   15   C CE1 . PHE A 1 7  ? 20.500  5.738   16.566 1.00 63.50 ? 4   PHE A CE1 1 
ATOM   16   C CE2 . PHE A 1 7  ? 20.444  4.865   18.803 1.00 58.47 ? 4   PHE A CE2 1 
ATOM   17   C CZ  . PHE A 1 7  ? 20.674  4.681   17.435 1.00 61.55 ? 4   PHE A CZ  1 
ATOM   18   N N   . LEU A 1 8  ? 16.694  8.129   20.839 1.00 65.07 ? 5   LEU A N   1 
ATOM   19   C CA  . LEU A 1 8  ? 16.054  7.168   21.744 1.00 55.05 ? 5   LEU A CA  1 
ATOM   20   C C   . LEU A 1 8  ? 14.646  6.801   21.296 1.00 48.77 ? 5   LEU A C   1 
ATOM   21   O O   . LEU A 1 8  ? 14.340  5.632   21.094 1.00 43.03 ? 5   LEU A O   1 
ATOM   22   C CB  . LEU A 1 8  ? 16.025  7.649   23.198 1.00 43.49 ? 5   LEU A CB  1 
ATOM   23   C CG  . LEU A 1 8  ? 15.434  6.565   24.090 1.00 41.08 ? 5   LEU A CG  1 
ATOM   24   C CD1 . LEU A 1 8  ? 16.189  5.235   23.862 1.00 29.46 ? 5   LEU A CD1 1 
ATOM   25   C CD2 . LEU A 1 8  ? 15.385  6.977   25.572 1.00 41.74 ? 5   LEU A CD2 1 
ATOM   26   N N   . LEU A 1 9  ? 13.794  7.800   21.128 1.00 46.55 ? 6   LEU A N   1 
ATOM   27   C CA  . LEU A 1 9  ? 12.406  7.513   20.825 1.00 42.21 ? 6   LEU A CA  1 
ATOM   28   C C   . LEU A 1 9  ? 12.268  6.815   19.464 1.00 32.48 ? 6   LEU A C   1 
ATOM   29   O O   . LEU A 1 9  ? 11.396  5.953   19.295 1.00 28.52 ? 6   LEU A O   1 
ATOM   30   C CB  . LEU A 1 9  ? 11.504  8.751   20.926 1.00 44.85 ? 6   LEU A CB  1 
ATOM   31   C CG  . LEU A 1 9  ? 11.810  10.095  21.613 1.00 46.22 ? 6   LEU A CG  1 
ATOM   32   C CD1 . LEU A 1 9  ? 12.629  10.008  22.902 1.00 44.75 ? 6   LEU A CD1 1 
ATOM   33   C CD2 . LEU A 1 9  ? 12.390  11.112  20.615 1.00 46.70 ? 6   LEU A CD2 1 
ATOM   34   N N   . SER A 1 10 ? 13.156  7.152   18.534 1.00 30.14 ? 7   SER A N   1 
ATOM   35   C CA  A SER A 1 10 ? 13.138  6.529   17.224 0.62 31.73 ? 7   SER A CA  1 
ATOM   36   C CA  B SER A 1 10 ? 13.177  6.534   17.221 0.38 32.71 ? 7   SER A CA  1 
ATOM   37   C C   . SER A 1 10 ? 13.611  5.078   17.359 1.00 35.50 ? 7   SER A C   1 
ATOM   38   O O   . SER A 1 10 ? 13.224  4.215   16.569 1.00 25.47 ? 7   SER A O   1 
ATOM   39   C CB  A SER A 1 10 ? 13.900  7.347   16.154 0.62 36.06 ? 7   SER A CB  1 
ATOM   40   C CB  B SER A 1 10 ? 14.094  7.304   16.264 0.38 37.18 ? 7   SER A CB  1 
ATOM   41   O OG  A SER A 1 10 ? 15.303  7.116   16.123 0.62 38.27 ? 7   SER A OG  1 
ATOM   42   O OG  B SER A 1 10 ? 15.361  7.577   16.848 0.38 38.16 ? 7   SER A OG  1 
ATOM   43   N N   . LYS A 1 11 ? 14.401  4.794   18.403 1.00 29.88 ? 8   LYS A N   1 
ATOM   44   C CA  . LYS A 1 11 ? 14.861  3.429   18.589 1.00 29.55 ? 8   LYS A CA  1 
ATOM   45   C C   . LYS A 1 11 ? 13.832  2.606   19.332 1.00 18.65 ? 8   LYS A C   1 
ATOM   46   O O   . LYS A 1 11 ? 13.667  1.378   19.091 1.00 19.67 ? 8   LYS A O   1 
ATOM   47   C CB  . LYS A 1 11 ? 16.221  3.402   19.301 1.00 40.70 ? 8   LYS A CB  1 
ATOM   48   C CG  . LYS A 1 11 ? 17.411  3.177   18.335 1.00 46.87 ? 8   LYS A CG  1 
ATOM   49   C CD  . LYS A 1 11 ? 17.344  4.107   17.136 1.00 50.51 ? 8   LYS A CD  1 
ATOM   50   C CE  . LYS A 1 11 ? 17.472  3.365   15.805 1.00 59.02 ? 8   LYS A CE  1 
ATOM   51   N NZ  . LYS A 1 11 ? 17.085  4.237   14.646 1.00 60.70 ? 8   LYS A NZ  1 
ATOM   52   N N   . VAL A 1 12 ? 13.171  3.240   20.276 1.00 17.95 ? 9   VAL A N   1 
ATOM   53   C CA  . VAL A 1 12 ? 12.068  2.611   20.969 1.00 17.26 ? 9   VAL A CA  1 
ATOM   54   C C   . VAL A 1 12 ? 10.999  2.222   19.929 1.00 20.22 ? 9   VAL A C   1 
ATOM   55   O O   . VAL A 1 12 ? 10.586  1.052   19.878 1.00 17.24 ? 9   VAL A O   1 
ATOM   56   C CB  . VAL A 1 12 ? 11.527  3.480   22.078 1.00 20.09 ? 9   VAL A CB  1 
ATOM   57   C CG1 . VAL A 1 12 ? 10.273  2.842   22.687 1.00 20.17 ? 9   VAL A CG1 1 
ATOM   58   C CG2 . VAL A 1 12 ? 12.605  3.614   23.199 1.00 15.28 ? 9   VAL A CG2 1 
ATOM   59   N N   . SER A 1 13 ? 10.613  3.153   19.055 1.00 20.28 ? 10  SER A N   1 
ATOM   60   C CA  . SER A 1 13 ? 9.576   2.801   18.039 1.00 20.14 ? 10  SER A CA  1 
ATOM   61   C C   . SER A 1 13 ? 10.010  1.675   17.141 1.00 18.76 ? 10  SER A C   1 
ATOM   62   O O   . SER A 1 13 ? 9.191   0.855   16.696 1.00 18.96 ? 10  SER A O   1 
ATOM   63   C CB  . SER A 1 13 ? 9.274   3.968   17.102 1.00 25.42 ? 10  SER A CB  1 
ATOM   64   O OG  . SER A 1 13 ? 9.247   5.223   17.750 1.00 33.62 ? 10  SER A OG  1 
ATOM   65   N N   . PHE A 1 14 ? 11.298  1.693   16.774 1.00 22.53 ? 11  PHE A N   1 
ATOM   66   C CA  . PHE A 1 14 ? 11.822  0.766   15.794 1.00 20.28 ? 11  PHE A CA  1 
ATOM   67   C C   . PHE A 1 14 ? 11.789  -0.605  16.425 1.00 19.04 ? 11  PHE A C   1 
ATOM   68   O O   . PHE A 1 14 ? 11.454  -1.579  15.797 1.00 20.48 ? 11  PHE A O   1 
ATOM   69   C CB  . PHE A 1 14 ? 13.303  1.092   15.464 1.00 17.36 ? 11  PHE A CB  1 
ATOM   70   C CG  . PHE A 1 14 ? 14.017  -0.029  14.686 1.00 24.98 ? 11  PHE A CG  1 
ATOM   71   C CD1 . PHE A 1 14 ? 13.929  -0.115  13.298 1.00 33.02 ? 11  PHE A CD1 1 
ATOM   72   C CD2 . PHE A 1 14 ? 14.759  -1.007  15.371 1.00 26.91 ? 11  PHE A CD2 1 
ATOM   73   C CE1 . PHE A 1 14 ? 14.588  -1.147  12.575 1.00 25.94 ? 11  PHE A CE1 1 
ATOM   74   C CE2 . PHE A 1 14 ? 15.412  -2.037  14.666 1.00 29.71 ? 11  PHE A CE2 1 
ATOM   75   C CZ  . PHE A 1 14 ? 15.325  -2.099  13.263 1.00 34.57 ? 11  PHE A CZ  1 
ATOM   76   N N   . VAL A 1 15 ? 12.199  -0.679  17.672 1.00 17.74 ? 12  VAL A N   1 
ATOM   77   C CA  . VAL A 1 15 ? 12.138  -1.975  18.386 1.00 18.16 ? 12  VAL A CA  1 
ATOM   78   C C   . VAL A 1 15 ? 10.708  -2.466  18.591 1.00 15.46 ? 12  VAL A C   1 
ATOM   79   O O   . VAL A 1 15 ? 10.494  -3.656  18.514 1.00 15.45 ? 12  VAL A O   1 
ATOM   80   C CB  . VAL A 1 15 ? 12.804  -1.928  19.736 1.00 14.21 ? 12  VAL A CB  1 
ATOM   81   C CG1 . VAL A 1 15 ? 12.621  -3.327  20.533 1.00 15.73 ? 12  VAL A CG1 1 
ATOM   82   C CG2 . VAL A 1 15 ? 14.245  -1.700  19.525 1.00 15.05 ? 12  VAL A CG2 1 
ATOM   83   N N   . ILE A 1 16 ? 9.769   -1.570  18.874 1.00 11.80 ? 13  ILE A N   1 
ATOM   84   C CA  . ILE A 1 16 ? 8.313   -1.989  19.031 1.00 13.11 ? 13  ILE A CA  1 
ATOM   85   C C   . ILE A 1 16 ? 7.865   -2.575  17.707 1.00 17.92 ? 13  ILE A C   1 
ATOM   86   O O   . ILE A 1 16 ? 7.258   -3.632  17.675 1.00 15.20 ? 13  ILE A O   1 
ATOM   87   C CB  . ILE A 1 16 ? 7.420   -0.868  19.471 1.00 16.51 ? 13  ILE A CB  1 
ATOM   88   C CG1 . ILE A 1 16 ? 7.837   -0.430  20.894 1.00 13.38 ? 13  ILE A CG1 1 
ATOM   89   C CG2 . ILE A 1 16 ? 5.872   -1.269  19.540 1.00 16.01 ? 13  ILE A CG2 1 
ATOM   90   C CD1 . ILE A 1 16 ? 7.136   0.790   21.352 1.00 13.93 ? 13  ILE A CD1 1 
ATOM   91   N N   . LYS A 1 17 ? 8.150   -1.887  16.602 1.00 16.86 ? 14  LYS A N   1 
ATOM   92   C CA  . LYS A 1 17 ? 7.666   -2.417  15.335 1.00 14.53 ? 14  LYS A CA  1 
ATOM   93   C C   . LYS A 1 17 ? 8.333   -3.760  14.994 1.00 15.43 ? 14  LYS A C   1 
ATOM   94   O O   . LYS A 1 17 ? 7.665   -4.687  14.530 1.00 16.65 ? 14  LYS A O   1 
ATOM   95   C CB  . LYS A 1 17 ? 7.908   -1.409  14.239 1.00 22.71 ? 14  LYS A CB  1 
ATOM   96   C CG  . LYS A 1 17 ? 7.210   -1.716  12.972 1.00 22.18 ? 14  LYS A CG  1 
ATOM   97   C CD  . LYS A 1 17 ? 7.463   -0.601  11.981 1.00 24.91 ? 14  LYS A CD  1 
ATOM   98   C CE  . LYS A 1 17 ? 6.945   -0.983  10.621 1.00 32.51 ? 14  LYS A CE  1 
ATOM   99   N NZ  . LYS A 1 17 ? 7.104   0.175   9.686  1.00 38.52 ? 14  LYS A NZ  1 
ATOM   100  N N   . LYS A 1 18 ? 9.649   -3.827  15.171 1.00 12.91 ? 15  LYS A N   1 
ATOM   101  C CA  . LYS A 1 18 ? 10.441  -5.042  14.888 1.00 17.25 ? 15  LYS A CA  1 
ATOM   102  C C   . LYS A 1 18 ? 9.902   -6.239  15.703 1.00 20.70 ? 15  LYS A C   1 
ATOM   103  O O   . LYS A 1 18 ? 9.712   -7.305  15.132 1.00 19.49 ? 15  LYS A O   1 
ATOM   104  C CB  . LYS A 1 18 ? 11.932  -4.820  15.131 1.00 19.69 ? 15  LYS A CB  1 
ATOM   105  C CG  . LYS A 1 18 ? 12.800  -6.123  14.908 1.00 24.45 ? 15  LYS A CG  1 
ATOM   106  C CD  . LYS A 1 18 ? 14.238  -5.930  15.388 1.00 29.79 ? 15  LYS A CD  1 
ATOM   107  C CE  . LYS A 1 18 ? 15.089  -7.136  14.990 1.00 38.18 ? 15  LYS A CE  1 
ATOM   108  N NZ  . LYS A 1 18 ? 16.465  -6.718  14.534 1.00 44.35 ? 15  LYS A NZ  1 
ATOM   109  N N   . ILE A 1 19 ? 9.666   -6.095  17.014 1.00 16.19 ? 16  ILE A N   1 
ATOM   110  C CA  . ILE A 1 19 ? 9.048   -7.205  17.740 1.00 14.73 ? 16  ILE A CA  1 
ATOM   111  C C   . ILE A 1 19 ? 7.607   -7.560  17.282 1.00 14.92 ? 16  ILE A C   1 
ATOM   112  O O   . ILE A 1 19 ? 7.269   -8.736  17.099 1.00 17.90 ? 16  ILE A O   1 
ATOM   113  C CB  . ILE A 1 19 ? 9.021   -6.926  19.253 1.00 13.11 ? 16  ILE A CB  1 
ATOM   114  C CG1 . ILE A 1 19 ? 10.459  -6.742  19.762 1.00 16.75 ? 16  ILE A CG1 1 
ATOM   115  C CG2 . ILE A 1 19 ? 8.290   -8.120  19.914 1.00 14.87 ? 16  ILE A CG2 1 
ATOM   116  C CD1 . ILE A 1 19 ? 10.473  -6.018  21.180 1.00 15.90 ? 16  ILE A CD1 1 
ATOM   117  N N   . ARG A 1 20 ? 6.785   -6.540  17.012 1.00 11.94 ? 17  ARG A N   1 
ATOM   118  C CA  . ARG A 1 20 ? 5.355   -6.771  16.653 1.00 13.51 ? 17  ARG A CA  1 
ATOM   119  C C   . ARG A 1 20 ? 5.314   -7.631  15.347 1.00 18.79 ? 17  ARG A C   1 
ATOM   120  O O   . ARG A 1 20 ? 4.522   -8.605  15.222 1.00 17.71 ? 17  ARG A O   1 
ATOM   121  C CB  . ARG A 1 20 ? 4.627   -5.423  16.475 1.00 16.20 ? 17  ARG A CB  1 
ATOM   122  C CG  . ARG A 1 20 ? 3.251   -5.541  15.756 1.00 16.56 ? 17  ARG A CG  1 
ATOM   123  C CD  . ARG A 1 20 ? 2.632   -4.172  15.586 1.00 16.00 ? 17  ARG A CD  1 
ATOM   124  N NE  . ARG A 1 20 ? 3.163   -3.224  14.599 1.00 17.00 ? 17  ARG A NE  1 
ATOM   125  C CZ  . ARG A 1 20 ? 2.973   -3.292  13.295 1.00 19.29 ? 17  ARG A CZ  1 
ATOM   126  N NH1 . ARG A 1 20 ? 2.356   -4.358  12.775 1.00 18.12 ? 17  ARG A NH1 1 
ATOM   127  N NH2 . ARG A 1 20 ? 3.364   -2.267  12.509 1.00 15.35 ? 17  ARG A NH2 1 
ATOM   128  N N   . LEU A 1 21 ? 6.195   -7.321  14.417 1.00 18.32 ? 18  LEU A N   1 
ATOM   129  C CA  . LEU A 1 21 ? 6.226   -8.084  13.130 1.00 23.40 ? 18  LEU A CA  1 
ATOM   130  C C   . LEU A 1 21 ? 6.869   -9.489  13.263 1.00 26.97 ? 18  LEU A C   1 
ATOM   131  O O   . LEU A 1 21 ? 6.526   -10.391 12.510 1.00 22.88 ? 18  LEU A O   1 
ATOM   132  C CB  . LEU A 1 21 ? 6.979   -7.327  12.050 1.00 22.12 ? 18  LEU A CB  1 
ATOM   133  C CG  . LEU A 1 21 ? 6.321   -6.051  11.437 1.00 21.97 ? 18  LEU A CG  1 
ATOM   134  C CD1 . LEU A 1 21 ? 7.309   -5.375  10.515 1.00 27.50 ? 18  LEU A CD1 1 
ATOM   135  C CD2 . LEU A 1 21 ? 5.043   -6.390  10.608 1.00 21.12 ? 18  LEU A CD2 1 
ATOM   136  N N   . GLU A 1 22 ? 7.830   -9.640  14.170 1.00 24.80 ? 19  GLU A N   1 
ATOM   137  C CA  . GLU A 1 22 ? 8.369   -10.962 14.495 1.00 22.89 ? 19  GLU A CA  1 
ATOM   138  C C   . GLU A 1 22 ? 7.363   -11.843 15.228 1.00 21.94 ? 19  GLU A C   1 
ATOM   139  O O   . GLU A 1 22 ? 7.449   -13.077 15.184 1.00 30.10 ? 19  GLU A O   1 
ATOM   140  C CB  . GLU A 1 22 ? 9.649   -10.837 15.328 1.00 31.11 ? 19  GLU A CB  1 
ATOM   141  C CG  . GLU A 1 22 ? 10.909  -10.516 14.542 1.00 38.53 ? 19  GLU A CG  1 
ATOM   142  C CD  . GLU A 1 22 ? 12.052  -10.141 15.465 1.00 40.83 ? 19  GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 22 ? 13.158  -9.820  14.987 1.00 42.97 ? 19  GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 22 ? 11.831  -10.117 16.691 1.00 43.92 ? 19  GLU A OE2 1 
ATOM   145  N N   . LYS A 1 23 ? 6.392   -11.241 15.879 1.00 22.63 ? 20  LYS A N   1 
ATOM   146  C CA  . LYS A 1 23 ? 5.328   -12.003 16.511 1.00 19.27 ? 20  LYS A CA  1 
ATOM   147  C C   . LYS A 1 23 ? 4.169   -12.127 15.564 1.00 24.23 ? 20  LYS A C   1 
ATOM   148  O O   . LYS A 1 23 ? 3.116   -12.648 15.929 1.00 29.36 ? 20  LYS A O   1 
ATOM   149  C CB  . LYS A 1 23 ? 4.823   -11.309 17.774 1.00 26.84 ? 20  LYS A CB  1 
ATOM   150  C CG  . LYS A 1 23 ? 5.891   -11.175 18.828 1.00 32.11 ? 20  LYS A CG  1 
ATOM   151  C CD  . LYS A 1 23 ? 6.195   -12.482 19.507 1.00 36.81 ? 20  LYS A CD  1 
ATOM   152  C CE  . LYS A 1 23 ? 7.287   -12.253 20.585 1.00 42.31 ? 20  LYS A CE  1 
ATOM   153  N NZ  . LYS A 1 23 ? 7.112   -13.049 21.833 1.00 44.12 ? 20  LYS A NZ  1 
ATOM   154  N N   . GLY A 1 24 ? 4.323   -11.597 14.358 1.00 24.38 ? 21  GLY A N   1 
ATOM   155  C CA  . GLY A 1 24 ? 3.241   -11.727 13.372 1.00 23.96 ? 21  GLY A CA  1 
ATOM   156  C C   . GLY A 1 24 ? 1.981   -10.912 13.548 1.00 25.00 ? 21  GLY A C   1 
ATOM   157  O O   . GLY A 1 24 ? 0.915   -11.219 12.995 1.00 21.87 ? 21  GLY A O   1 
ATOM   158  N N   . MET A 1 25 ? 2.100   -9.820  14.281 1.00 16.24 ? 22  MET A N   1 
ATOM   159  C CA  . MET A 1 25 ? 0.978   -9.060  14.685 1.00 20.64 ? 22  MET A CA  1 
ATOM   160  C C   . MET A 1 25 ? 0.795   -7.796  13.873 1.00 17.86 ? 22  MET A C   1 
ATOM   161  O O   . MET A 1 25 ? 1.758   -7.093  13.537 1.00 17.04 ? 22  MET A O   1 
ATOM   162  C CB  . MET A 1 25 ? 1.180   -8.620  16.134 1.00 23.13 ? 22  MET A CB  1 
ATOM   163  C CG  . MET A 1 25 ? 1.073   -9.781  17.099 1.00 25.05 ? 22  MET A CG  1 
ATOM   164  S SD  . MET A 1 25 ? 1.440   -9.106  18.723 1.00 39.69 ? 22  MET A SD  1 
ATOM   165  C CE  . MET A 1 25 ? 0.113   -7.951  18.812 1.00 32.35 ? 22  MET A CE  1 
ATOM   166  N N   . THR A 1 26 ? -0.457  -7.509  13.686 1.00 15.13 ? 23  THR A N   1 
ATOM   167  C CA  . THR A 1 26 ? -0.911  -6.270  13.052 1.00 18.24 ? 23  THR A CA  1 
ATOM   168  C C   . THR A 1 26 ? -0.990  -5.156  14.061 1.00 14.64 ? 23  THR A C   1 
ATOM   169  O O   . THR A 1 26 ? -1.001  -5.409  15.277 1.00 14.81 ? 23  THR A O   1 
ATOM   170  C CB  . THR A 1 26 ? -2.327  -6.390  12.477 1.00 18.55 ? 23  THR A CB  1 
ATOM   171  O OG1 . THR A 1 26 ? -3.307  -6.549  13.535 1.00 17.15 ? 23  THR A OG1 1 
ATOM   172  C CG2 . THR A 1 26 ? -2.432  -7.528  11.399 1.00 20.84 ? 23  THR A CG2 1 
ATOM   173  N N   . GLN A 1 27 ? -1.170  -3.924  13.573 1.00 15.30 ? 24  GLN A N   1 
ATOM   174  C CA  . GLN A 1 27 ? -1.234  -2.801  14.508 1.00 15.35 ? 24  GLN A CA  1 
ATOM   175  C C   . GLN A 1 27 ? -2.535  -2.922  15.340 1.00 15.79 ? 24  GLN A C   1 
ATOM   176  O O   . GLN A 1 27 ? -2.523  -2.626  16.527 1.00 18.83 ? 24  GLN A O   1 
ATOM   177  C CB  . GLN A 1 27 ? -1.211  -1.466  13.734 1.00 19.85 ? 24  GLN A CB  1 
ATOM   178  C CG  . GLN A 1 27 ? 0.202   -1.056  13.348 1.00 18.40 ? 24  GLN A CG  1 
ATOM   179  C CD  . GLN A 1 27 ? 0.272   0.333   12.698 1.00 20.49 ? 24  GLN A CD  1 
ATOM   180  O OE1 . GLN A 1 27 ? -0.708  0.855   12.185 1.00 25.82 ? 24  GLN A OE1 1 
ATOM   181  N NE2 . GLN A 1 27 ? 1.448   0.928   12.750 1.00 25.79 ? 24  GLN A NE2 1 
ATOM   182  N N   . GLU A 1 28 ? -3.621  -3.316  14.678 1.00 16.61 ? 25  GLU A N   1 
ATOM   183  C CA  . GLU A 1 28 ? -4.901  -3.576  15.320 1.00 19.40 ? 25  GLU A CA  1 
ATOM   184  C C   . GLU A 1 28 ? -4.744  -4.610  16.405 1.00 18.88 ? 25  GLU A C   1 
ATOM   185  O O   . GLU A 1 28 ? -5.304  -4.438  17.521 1.00 26.51 ? 25  GLU A O   1 
ATOM   186  C CB  . GLU A 1 28 ? -5.979  -4.031  14.287 1.00 22.18 ? 25  GLU A CB  1 
ATOM   187  C CG  . GLU A 1 28 ? -6.503  -2.842  13.499 1.00 29.94 ? 25  GLU A CG  1 
ATOM   188  C CD  . GLU A 1 28 ? -7.839  -3.085  12.845 1.00 39.81 ? 25  GLU A CD  1 
ATOM   189  O OE1 . GLU A 1 28 ? -8.268  -4.260  12.842 1.00 38.16 ? 25  GLU A OE1 1 
ATOM   190  O OE2 . GLU A 1 28 ? -8.461  -2.097  12.357 1.00 42.34 ? 25  GLU A OE2 1 
ATOM   191  N N   . ASP A 1 29 ? -4.079  -5.704  16.075 1.00 19.36 ? 26  ASP A N   1 
ATOM   192  C CA  . ASP A 1 29 ? -3.885  -6.782  17.074 1.00 20.85 ? 26  ASP A CA  1 
ATOM   193  C C   . ASP A 1 29 ? -3.147  -6.236  18.305 1.00 23.33 ? 26  ASP A C   1 
ATOM   194  O O   . ASP A 1 29 ? -3.563  -6.462  19.440 1.00 23.57 ? 26  ASP A O   1 
ATOM   195  C CB  . ASP A 1 29 ? -3.114  -7.946  16.508 1.00 34.83 ? 26  ASP A CB  1 
ATOM   196  C CG  . ASP A 1 29 ? -3.207  -9.179  17.395 1.00 49.34 ? 26  ASP A CG  1 
ATOM   197  O OD1 . ASP A 1 29 ? -4.064  -9.191  18.306 1.00 55.41 ? 26  ASP A OD1 1 
ATOM   198  O OD2 . ASP A 1 29 ? -2.445  -10.140 17.182 1.00 57.60 ? 26  ASP A OD2 1 
ATOM   199  N N   . LEU A 1 30 ? -2.090  -5.459  18.086 1.00 20.44 ? 27  LEU A N   1 
ATOM   200  C CA  . LEU A 1 30 ? -1.339  -4.891  19.234 1.00 18.88 ? 27  LEU A CA  1 
ATOM   201  C C   . LEU A 1 30 ? -2.124  -3.931  20.045 1.00 22.12 ? 27  LEU A C   1 
ATOM   202  O O   . LEU A 1 30 ? -1.983  -3.872  21.293 1.00 24.29 ? 27  LEU A O   1 
ATOM   203  C CB  . LEU A 1 30 ? -0.074  -4.179  18.771 1.00 17.29 ? 27  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 30 ? 0.838   -3.638  19.875 1.00 17.40 ? 27  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 30 ? 1.182   -4.817  20.810 1.00 17.73 ? 27  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 30 ? 2.093   -3.181  19.147 1.00 14.04 ? 27  LEU A CD2 1 
ATOM   207  N N   . ALA A 1 31 ? -2.917  -3.130  19.330 1.00 22.95 ? 28  ALA A N   1 
ATOM   208  C CA  . ALA A 1 31 ? -3.748  -2.119  19.913 1.00 20.99 ? 28  ALA A CA  1 
ATOM   209  C C   . ALA A 1 31 ? -4.680  -2.757  20.918 1.00 28.14 ? 28  ALA A C   1 
ATOM   210  O O   . ALA A 1 31 ? -4.932  -2.223  22.026 1.00 24.56 ? 28  ALA A O   1 
ATOM   211  C CB  . ALA A 1 31 ? -4.568  -1.456  18.831 1.00 20.59 ? 28  ALA A CB  1 
ATOM   212  N N   . TYR A 1 32 ? -5.250  -3.861  20.484 1.00 21.43 ? 29  TYR A N   1 
ATOM   213  C CA  . TYR A 1 32 ? -6.240  -4.553  21.282 1.00 25.35 ? 29  TYR A CA  1 
ATOM   214  C C   . TYR A 1 32 ? -5.604  -5.265  22.496 1.00 27.78 ? 29  TYR A C   1 
ATOM   215  O O   . TYR A 1 32 ? -6.150  -5.218  23.607 1.00 34.59 ? 29  TYR A O   1 
ATOM   216  C CB  . TYR A 1 32 ? -6.989  -5.514  20.397 1.00 34.48 ? 29  TYR A CB  1 
ATOM   217  C CG  . TYR A 1 32 ? -8.119  -6.190  21.101 1.00 30.80 ? 29  TYR A CG  1 
ATOM   218  C CD1 . TYR A 1 32 ? -8.927  -5.505  22.017 1.00 31.21 ? 29  TYR A CD1 1 
ATOM   219  C CD2 . TYR A 1 32 ? -8.375  -7.520  20.863 1.00 35.37 ? 29  TYR A CD2 1 
ATOM   220  C CE1 . TYR A 1 32 ? -9.989  -6.150  22.646 1.00 30.78 ? 29  TYR A CE1 1 
ATOM   221  C CE2 . TYR A 1 32 ? -9.421  -8.160  21.476 1.00 36.59 ? 29  TYR A CE2 1 
ATOM   222  C CZ  . TYR A 1 32 ? -10.204 -7.489  22.377 1.00 38.35 ? 29  TYR A CZ  1 
ATOM   223  O OH  . TYR A 1 32 ? -11.213 -8.208  22.964 1.00 41.82 ? 29  TYR A OH  1 
ATOM   224  N N   . LYS A 1 33 ? -4.437  -5.858  22.288 1.00 28.48 ? 30  LYS A N   1 
ATOM   225  C CA  . LYS A 1 33 ? -3.672  -6.473  23.384 1.00 32.11 ? 30  LYS A CA  1 
ATOM   226  C C   . LYS A 1 33 ? -2.912  -5.514  24.302 1.00 24.53 ? 30  LYS A C   1 
ATOM   227  O O   . LYS A 1 33 ? -2.494  -5.914  25.377 1.00 27.37 ? 30  LYS A O   1 
ATOM   228  C CB  . LYS A 1 33 ? -2.677  -7.463  22.840 1.00 26.09 ? 30  LYS A CB  1 
ATOM   229  C CG  . LYS A 1 33 ? -3.292  -8.577  22.049 1.00 31.22 ? 30  LYS A CG  1 
ATOM   230  C CD  . LYS A 1 33 ? -2.173  -9.392  21.392 1.00 39.66 ? 30  LYS A CD  1 
ATOM   231  C CE  . LYS A 1 33 ? -1.408  -10.213 22.436 1.00 43.51 ? 30  LYS A CE  1 
ATOM   232  N NZ  . LYS A 1 33 ? -0.041  -10.613 21.984 1.00 41.90 ? 30  LYS A NZ  1 
ATOM   233  N N   . SER A 1 34 ? -2.725  -4.265  23.903 1.00 25.01 ? 31  SER A N   1 
ATOM   234  C CA  A SER A 1 34 ? -1.954  -3.322  24.726 0.17 22.06 ? 31  SER A CA  1 
ATOM   235  C CA  B SER A 1 34 ? -1.933  -3.290  24.693 0.83 20.23 ? 31  SER A CA  1 
ATOM   236  C C   . SER A 1 34 ? -2.820  -2.264  25.374 1.00 26.39 ? 31  SER A C   1 
ATOM   237  O O   . SER A 1 34 ? -2.319  -1.419  26.139 1.00 28.85 ? 31  SER A O   1 
ATOM   238  C CB  A SER A 1 34 ? -0.875  -2.640  23.897 0.17 18.53 ? 31  SER A CB  1 
ATOM   239  C CB  B SER A 1 34 ? -0.940  -2.558  23.784 0.83 17.17 ? 31  SER A CB  1 
ATOM   240  O OG  A SER A 1 34 ? -0.109  -3.607  23.230 0.17 15.92 ? 31  SER A OG  1 
ATOM   241  O OG  B SER A 1 34 ? -1.626  -1.539  23.056 0.83 17.75 ? 31  SER A OG  1 
ATOM   242  N N   . ASN A 1 35 ? -4.127  -2.323  25.081 1.00 20.97 ? 32  ASN A N   1 
ATOM   243  C CA  . ASN A 1 35 ? -5.094  -1.404  25.620 1.00 30.70 ? 32  ASN A CA  1 
ATOM   244  C C   . ASN A 1 35 ? -4.865  0.028   25.150 1.00 25.11 ? 32  ASN A C   1 
ATOM   245  O O   . ASN A 1 35 ? -5.285  0.958   25.829 1.00 25.79 ? 32  ASN A O   1 
ATOM   246  C CB  . ASN A 1 35 ? -5.043  -1.449  27.143 1.00 35.03 ? 32  ASN A CB  1 
ATOM   247  C CG  . ASN A 1 35 ? -6.375  -1.231  27.759 1.00 38.02 ? 32  ASN A CG  1 
ATOM   248  O OD1 . ASN A 1 35 ? -7.383  -1.614  27.192 1.00 39.55 ? 32  ASN A OD1 1 
ATOM   249  N ND2 . ASN A 1 35 ? -6.399  -0.600  28.925 1.00 33.18 ? 32  ASN A ND2 1 
ATOM   250  N N   . LEU A 1 36 ? -4.194  0.193   24.003 1.00 22.76 ? 33  LEU A N   1 
ATOM   251  C CA  . LEU A 1 36 ? -3.992  1.556   23.430 1.00 23.23 ? 33  LEU A CA  1 
ATOM   252  C C   . LEU A 1 36 ? -4.655  1.566   22.058 1.00 25.95 ? 33  LEU A C   1 
ATOM   253  O O   . LEU A 1 36 ? -4.592  0.556   21.380 1.00 30.26 ? 33  LEU A O   1 
ATOM   254  C CB  . LEU A 1 36 ? -2.483  1.804   23.232 1.00 23.42 ? 33  LEU A CB  1 
ATOM   255  C CG  . LEU A 1 36 ? -1.646  1.583   24.471 1.00 26.63 ? 33  LEU A CG  1 
ATOM   256  C CD1 . LEU A 1 36 ? -0.167  1.567   24.057 1.00 22.66 ? 33  LEU A CD1 1 
ATOM   257  C CD2 . LEU A 1 36 ? -1.941  2.676   25.434 1.00 27.18 ? 33  LEU A CD2 1 
ATOM   258  N N   . ASP A 1 37 ? -5.239  2.675   21.620 1.00 27.80 ? 34  ASP A N   1 
ATOM   259  C CA  A ASP A 1 37 ? -5.953  2.596   20.347 0.41 31.72 ? 34  ASP A CA  1 
ATOM   260  C CA  B ASP A 1 37 ? -5.921  2.763   20.320 0.59 32.58 ? 34  ASP A CA  1 
ATOM   261  C C   . ASP A 1 37 ? -5.024  2.468   19.131 1.00 26.31 ? 34  ASP A C   1 
ATOM   262  O O   . ASP A 1 37 ? -3.840  2.707   19.204 1.00 23.43 ? 34  ASP A O   1 
ATOM   263  C CB  A ASP A 1 37 ? -6.925  3.755   20.178 0.41 34.46 ? 34  ASP A CB  1 
ATOM   264  C CB  B ASP A 1 37 ? -6.462  4.171   20.134 0.59 34.79 ? 34  ASP A CB  1 
ATOM   265  C CG  A ASP A 1 37 ? -6.225  5.072   20.000 0.41 36.26 ? 34  ASP A CG  1 
ATOM   266  C CG  B ASP A 1 37 ? -7.685  4.418   20.956 0.59 36.75 ? 34  ASP A CG  1 
ATOM   267  O OD1 A ASP A 1 37 ? -5.656  5.583   20.983 0.41 38.83 ? 34  ASP A OD1 1 
ATOM   268  O OD1 B ASP A 1 37 ? -8.270  3.409   21.412 0.59 40.70 ? 34  ASP A OD1 1 
ATOM   269  O OD2 A ASP A 1 37 ? -6.258  5.604   18.876 0.41 41.02 ? 34  ASP A OD2 1 
ATOM   270  O OD2 B ASP A 1 37 ? -8.058  5.599   21.126 0.59 33.07 ? 34  ASP A OD2 1 
ATOM   271  N N   . ARG A 1 38 ? -5.604  2.072   17.994 1.00 29.04 ? 35  ARG A N   1 
ATOM   272  C CA  . ARG A 1 38 ? -4.750  1.839   16.830 1.00 29.49 ? 35  ARG A CA  1 
ATOM   273  C C   . ARG A 1 38 ? -3.995  3.108   16.422 1.00 28.47 ? 35  ARG A C   1 
ATOM   274  O O   . ARG A 1 38 ? -2.810  3.027   16.074 1.00 27.31 ? 35  ARG A O   1 
ATOM   275  C CB  . ARG A 1 38 ? -5.532  1.344   15.629 1.00 29.73 ? 35  ARG A CB  1 
ATOM   276  C CG  . ARG A 1 38 ? -4.572  0.834   14.548 1.00 32.29 ? 35  ARG A CG  1 
ATOM   277  C CD  . ARG A 1 38 ? -5.259  0.479   13.234 1.00 52.14 ? 35  ARG A CD  1 
ATOM   278  N NE  . ARG A 1 38 ? -4.362  -0.335  12.407 1.00 60.55 ? 35  ARG A NE  1 
ATOM   279  C CZ  . ARG A 1 38 ? -4.715  -0.955  11.284 1.00 64.40 ? 35  ARG A CZ  1 
ATOM   280  N NH1 . ARG A 1 38 ? -5.957  -0.855  10.825 1.00 63.19 ? 35  ARG A NH1 1 
ATOM   281  N NH2 . ARG A 1 38 ? -3.821  -1.684  10.626 1.00 66.85 ? 35  ARG A NH2 1 
ATOM   282  N N   . THR A 1 39 ? -4.664  4.254   16.485 1.00 33.66 ? 36  THR A N   1 
ATOM   283  C CA  . THR A 1 39 ? -4.026  5.497   16.056 1.00 36.44 ? 36  THR A CA  1 
ATOM   284  C C   . THR A 1 39 ? -2.848  5.752   16.952 1.00 34.85 ? 36  THR A C   1 
ATOM   285  O O   . THR A 1 39 ? -1.798  6.146   16.460 1.00 30.86 ? 36  THR A O   1 
ATOM   286  C CB  . THR A 1 39 ? -4.934  6.768   16.035 1.00 48.30 ? 36  THR A CB  1 
ATOM   287  O OG1 . THR A 1 39 ? -5.508  7.015   17.328 1.00 46.15 ? 36  THR A OG1 1 
ATOM   288  C CG2 . THR A 1 39 ? -6.002  6.690   14.952 1.00 42.37 ? 36  THR A CG2 1 
ATOM   289  N N   . ALA A 1 40 ? -3.014  5.506   18.261 1.00 27.81 ? 37  ALA A N   1 
ATOM   290  C CA  . ALA A 1 40 ? -1.876  5.564   19.196 1.00 22.93 ? 37  ALA A CA  1 
ATOM   291  C C   . ALA A 1 40 ? -0.689  4.692   18.797 1.00 24.54 ? 37  ALA A C   1 
ATOM   292  O O   . ALA A 1 40 ? 0.470   5.140   18.792 1.00 25.40 ? 37  ALA A O   1 
ATOM   293  C CB  . ALA A 1 40 ? -2.326  5.212   20.627 1.00 25.50 ? 37  ALA A CB  1 
ATOM   294  N N   . ILE A 1 41 ? -0.958  3.421   18.492 1.00 19.10 ? 38  ILE A N   1 
ATOM   295  C CA  . ILE A 1 41 ? 0.085   2.543   18.071 1.00 18.54 ? 38  ILE A CA  1 
ATOM   296  C C   . ILE A 1 41 ? 0.812   3.105   16.819 1.00 16.60 ? 38  ILE A C   1 
ATOM   297  O O   . ILE A 1 41 ? 2.056   3.025   16.750 1.00 16.83 ? 38  ILE A O   1 
ATOM   298  C CB  . ILE A 1 41 ? -0.444  1.132   17.781 1.00 23.25 ? 38  ILE A CB  1 
ATOM   299  C CG1 . ILE A 1 41 ? -0.985  0.456   19.073 1.00 15.11 ? 38  ILE A CG1 1 
ATOM   300  C CG2 . ILE A 1 41 ? 0.664   0.264   17.077 1.00 22.45 ? 38  ILE A CG2 1 
ATOM   301  C CD1 . ILE A 1 41 ? 0.081   0.104   20.005 1.00 18.37 ? 38  ILE A CD1 1 
ATOM   302  N N   . SER A 1 42 ? 0.032   3.493   15.829 1.00 22.66 ? 39  SER A N   1 
ATOM   303  C CA  A SER A 1 42 ? 0.557   4.049   14.572 0.66 29.56 ? 39  SER A CA  1 
ATOM   304  C CA  B SER A 1 42 ? 0.615   4.003   14.591 0.34 29.08 ? 39  SER A CA  1 
ATOM   305  C C   . SER A 1 42 ? 1.450   5.250   14.855 1.00 30.43 ? 39  SER A C   1 
ATOM   306  O O   . SER A 1 42 ? 2.522   5.408   14.267 1.00 25.14 ? 39  SER A O   1 
ATOM   307  C CB  A SER A 1 42 ? -0.598  4.492   13.683 0.66 30.86 ? 39  SER A CB  1 
ATOM   308  C CB  B SER A 1 42 ? -0.463  4.293   13.558 0.34 30.23 ? 39  SER A CB  1 
ATOM   309  O OG  A SER A 1 42 ? -0.170  4.835   12.373 0.66 27.24 ? 39  SER A OG  1 
ATOM   310  O OG  B SER A 1 42 ? -1.473  5.115   14.108 0.34 30.10 ? 39  SER A OG  1 
ATOM   311  N N   . GLY A 1 43 ? 0.970   6.101   15.763 1.00 25.56 ? 40  GLY A N   1 
ATOM   312  C CA  . GLY A 1 43 ? 1.647   7.327   16.126 1.00 23.17 ? 40  GLY A CA  1 
ATOM   313  C C   . GLY A 1 43 ? 2.996   7.046   16.745 1.00 28.82 ? 40  GLY A C   1 
ATOM   314  O O   . GLY A 1 43 ? 3.981   7.716   16.418 1.00 27.88 ? 40  GLY A O   1 
ATOM   315  N N   . ILE A 1 44 ? 3.043   6.044   17.623 1.00 27.05 ? 41  ILE A N   1 
ATOM   316  C CA  . ILE A 1 44 ? 4.245   5.737   18.389 1.00 26.47 ? 41  ILE A CA  1 
ATOM   317  C C   . ILE A 1 44 ? 5.215   5.065   17.454 1.00 31.20 ? 41  ILE A C   1 
ATOM   318  O O   . ILE A 1 44 ? 6.433   5.195   17.613 1.00 24.48 ? 41  ILE A O   1 
ATOM   319  C CB  . ILE A 1 44 ? 3.932   4.836   19.579 1.00 28.85 ? 41  ILE A CB  1 
ATOM   320  C CG1 . ILE A 1 44 ? 3.077   5.589   20.599 1.00 25.93 ? 41  ILE A CG1 1 
ATOM   321  C CG2 . ILE A 1 44 ? 5.205   4.264   20.252 1.00 41.29 ? 41  ILE A CG2 1 
ATOM   322  C CD1 . ILE A 1 44 ? 2.267   4.667   21.449 1.00 31.33 ? 41  ILE A CD1 1 
ATOM   323  N N   . GLU A 1 45 ? 4.675   4.353   16.460 1.00 22.62 ? 42  GLU A N   1 
ATOM   324  C CA  . GLU A 1 45 ? 5.548   3.567   15.646 1.00 26.63 ? 42  GLU A CA  1 
ATOM   325  C C   . GLU A 1 45 ? 6.160   4.533   14.665 1.00 28.74 ? 42  GLU A C   1 
ATOM   326  O O   . GLU A 1 45 ? 7.171   4.215   14.047 1.00 32.05 ? 42  GLU A O   1 
ATOM   327  C CB  . GLU A 1 45 ? 4.814   2.394   14.964 1.00 24.24 ? 42  GLU A CB  1 
ATOM   328  C CG  . GLU A 1 45 ? 4.854   1.099   15.831 1.00 25.85 ? 42  GLU A CG  1 
ATOM   329  C CD  . GLU A 1 45 ? 4.310   -0.078  15.080 1.00 27.36 ? 42  GLU A CD  1 
ATOM   330  O OE1 . GLU A 1 45 ? 4.329   -1.206  15.632 1.00 24.09 ? 42  GLU A OE1 1 
ATOM   331  O OE2 . GLU A 1 45 ? 3.837   0.137   13.928 1.00 29.58 ? 42  GLU A OE2 1 
ATOM   332  N N   . ARG A 1 46 ? 5.531   5.704   14.507 1.00 32.32 ? 43  ARG A N   1 
ATOM   333  C CA  . ARG A 1 46 ? 6.124   6.812   13.751 1.00 40.29 ? 43  ARG A CA  1 
ATOM   334  C C   . ARG A 1 46 ? 6.934   7.778   14.604 1.00 42.99 ? 43  ARG A C   1 
ATOM   335  O O   . ARG A 1 46 ? 7.895   8.354   14.128 1.00 55.60 ? 43  ARG A O   1 
ATOM   336  C CB  . ARG A 1 46 ? 5.069   7.577   12.951 1.00 45.90 ? 43  ARG A CB  1 
ATOM   337  C CG  . ARG A 1 46 ? 4.358   6.730   11.936 1.00 45.28 ? 43  ARG A CG  1 
ATOM   338  C CD  . ARG A 1 46 ? 5.219   6.382   10.722 1.00 51.50 ? 43  ARG A CD  1 
ATOM   339  N NE  . ARG A 1 46 ? 4.372   5.967   9.594  1.00 57.09 ? 43  ARG A NE  1 
ATOM   340  C CZ  . ARG A 1 46 ? 4.187   6.678   8.482  1.00 56.03 ? 43  ARG A CZ  1 
ATOM   341  N NH1 . ARG A 1 46 ? 4.813   7.843   8.325  1.00 53.03 ? 43  ARG A NH1 1 
ATOM   342  N NH2 . ARG A 1 46 ? 3.382   6.220   7.521  1.00 56.51 ? 43  ARG A NH2 1 
ATOM   343  N N   . ASN A 1 47 ? 6.568   7.934   15.870 1.00 39.92 ? 44  ASN A N   1 
ATOM   344  C CA  . ASN A 1 47 ? 7.351   8.746   16.797 1.00 44.40 ? 44  ASN A CA  1 
ATOM   345  C C   . ASN A 1 47 ? 7.004   8.438   18.245 1.00 39.78 ? 44  ASN A C   1 
ATOM   346  O O   . ASN A 1 47 ? 5.882   8.691   18.688 1.00 47.05 ? 44  ASN A O   1 
ATOM   347  C CB  . ASN A 1 47 ? 7.139   10.234  16.529 1.00 46.72 ? 44  ASN A CB  1 
ATOM   348  C CG  . ASN A 1 47 ? 8.016   11.122  17.405 1.00 52.33 ? 44  ASN A CG  1 
ATOM   349  O OD1 . ASN A 1 47 ? 8.949   10.653  18.068 1.00 52.74 ? 44  ASN A OD1 1 
ATOM   350  N ND2 . ASN A 1 47 ? 7.717   12.418  17.410 1.00 56.40 ? 44  ASN A ND2 1 
ATOM   351  N N   . SER A 1 48 ? 7.975   7.927   18.988 1.00 37.72 ? 45  SER A N   1 
ATOM   352  C CA  . SER A 1 48 ? 7.722   7.487   20.350 1.00 39.50 ? 45  SER A CA  1 
ATOM   353  C C   . SER A 1 48 ? 8.025   8.502   21.449 1.00 35.70 ? 45  SER A C   1 
ATOM   354  O O   . SER A 1 48 ? 8.054   8.127   22.622 1.00 35.10 ? 45  SER A O   1 
ATOM   355  C CB  . SER A 1 48 ? 8.438   6.164   20.634 1.00 47.01 ? 45  SER A CB  1 
ATOM   356  O OG  . SER A 1 48 ? 9.675   6.381   21.278 1.00 50.38 ? 45  SER A OG  1 
ATOM   357  N N   . ARG A 1 49 ? 8.222   9.770   21.086 1.00 36.16 ? 46  ARG A N   1 
ATOM   358  C CA  . ARG A 1 49 ? 8.458   10.825  22.087 1.00 39.27 ? 46  ARG A CA  1 
ATOM   359  C C   . ARG A 1 49 ? 7.408   10.827  23.214 1.00 36.11 ? 46  ARG A C   1 
ATOM   360  O O   . ARG A 1 49 ? 7.756   10.771  24.406 1.00 29.61 ? 46  ARG A O   1 
ATOM   361  C CB  . ARG A 1 49 ? 8.582   12.218  21.440 1.00 43.78 ? 46  ARG A CB  1 
ATOM   362  C CG  . ARG A 1 49 ? 7.331   12.745  20.723 1.00 51.46 ? 46  ARG A CG  1 
ATOM   363  C CD  . ARG A 1 49 ? 7.529   14.167  20.238 1.00 55.27 ? 46  ARG A CD  1 
ATOM   364  N NE  . ARG A 1 49 ? 8.224   14.980  21.236 1.00 60.38 ? 46  ARG A NE  1 
ATOM   365  C CZ  . ARG A 1 49 ? 8.666   16.215  21.023 1.00 60.64 ? 46  ARG A CZ  1 
ATOM   366  N NH1 . ARG A 1 49 ? 8.491   16.799  19.841 1.00 68.23 ? 46  ARG A NH1 1 
ATOM   367  N NH2 . ARG A 1 49 ? 9.284   16.869  21.992 1.00 57.19 ? 46  ARG A NH2 1 
ATOM   368  N N   . ASN A 1 50 ? 6.134   10.833  22.838 1.00 30.80 ? 47  ASN A N   1 
ATOM   369  C CA  . ASN A 1 50 ? 5.078   10.940  23.838 1.00 36.61 ? 47  ASN A CA  1 
ATOM   370  C C   . ASN A 1 50 ? 4.555   9.629   24.393 1.00 33.15 ? 47  ASN A C   1 
ATOM   371  O O   . ASN A 1 50 ? 3.514   9.608   25.051 1.00 37.14 ? 47  ASN A O   1 
ATOM   372  C CB  . ASN A 1 50 ? 3.923   11.789  23.343 1.00 43.67 ? 47  ASN A CB  1 
ATOM   373  C CG  . ASN A 1 50 ? 4.249   13.256  23.360 1.00 51.33 ? 47  ASN A CG  1 
ATOM   374  O OD1 . ASN A 1 50 ? 4.944   13.738  24.260 1.00 54.38 ? 47  ASN A OD1 1 
ATOM   375  N ND2 . ASN A 1 50 ? 3.754   13.982  22.368 1.00 48.34 ? 47  ASN A ND2 1 
ATOM   376  N N   . LEU A 1 51 ? 5.267   8.544   24.138 1.00 22.96 ? 48  LEU A N   1 
ATOM   377  C CA  . LEU A 1 51 ? 4.929   7.295   24.808 1.00 26.56 ? 48  LEU A CA  1 
ATOM   378  C C   . LEU A 1 51 ? 5.261   7.415   26.306 1.00 25.55 ? 48  LEU A C   1 
ATOM   379  O O   . LEU A 1 51 ? 6.353   7.796   26.638 1.00 19.47 ? 48  LEU A O   1 
ATOM   380  C CB  . LEU A 1 51 ? 5.742   6.174   24.161 1.00 25.66 ? 48  LEU A CB  1 
ATOM   381  C CG  . LEU A 1 51 ? 5.716   4.773   24.729 1.00 27.17 ? 48  LEU A CG  1 
ATOM   382  C CD1 . LEU A 1 51 ? 4.398   4.134   24.434 1.00 30.72 ? 48  LEU A CD1 1 
ATOM   383  C CD2 . LEU A 1 51 ? 6.862   3.907   24.148 1.00 33.09 ? 48  LEU A CD2 1 
ATOM   384  N N   . THR A 1 52 ? 4.335   7.088   27.209 1.00 21.84 ? 49  THR A N   1 
ATOM   385  C CA  . THR A 1 52 ? 4.696   7.032   28.611 1.00 19.82 ? 49  THR A CA  1 
ATOM   386  C C   . THR A 1 52 ? 5.296   5.674   28.979 1.00 20.94 ? 49  THR A C   1 
ATOM   387  O O   . THR A 1 52 ? 5.125   4.666   28.274 1.00 19.73 ? 49  THR A O   1 
ATOM   388  C CB  . THR A 1 52 ? 3.440   7.276   29.568 1.00 20.51 ? 49  THR A CB  1 
ATOM   389  O OG1 . THR A 1 52 ? 2.498   6.236   29.368 1.00 20.93 ? 49  THR A OG1 1 
ATOM   390  C CG2 . THR A 1 52 ? 2.741   8.579   29.266 1.00 24.56 ? 49  THR A CG2 1 
ATOM   391  N N   . ILE A 1 53 ? 5.966   5.632   30.125 1.00 16.61 ? 50  ILE A N   1 
ATOM   392  C CA  . ILE A 1 53 ? 6.507   4.375   30.606 1.00 18.73 ? 50  ILE A CA  1 
ATOM   393  C C   . ILE A 1 53 ? 5.409   3.334   30.881 1.00 16.08 ? 50  ILE A C   1 
ATOM   394  O O   . ILE A 1 53 ? 5.615   2.124   30.683 1.00 19.26 ? 50  ILE A O   1 
ATOM   395  C CB  . ILE A 1 53 ? 7.279   4.571   31.957 1.00 18.51 ? 50  ILE A CB  1 
ATOM   396  C CG1 . ILE A 1 53 ? 8.364   5.617   31.854 1.00 21.56 ? 50  ILE A CG1 1 
ATOM   397  C CG2 . ILE A 1 53 ? 7.957   3.274   32.386 1.00 18.17 ? 50  ILE A CG2 1 
ATOM   398  C CD1 . ILE A 1 53 ? 9.434   5.295   30.856 1.00 19.21 ? 50  ILE A CD1 1 
ATOM   399  N N   . LYS A 1 54 ? 4.283   3.788   31.434 1.00 16.81 ? 51  LYS A N   1 
ATOM   400  C CA  . LYS A 1 54 ? 3.155   2.899   31.692 1.00 23.14 ? 51  LYS A CA  1 
ATOM   401  C C   . LYS A 1 54 ? 2.604   2.258   30.413 1.00 22.88 ? 51  LYS A C   1 
ATOM   402  O O   . LYS A 1 54 ? 2.287   1.061   30.334 1.00 22.93 ? 51  LYS A O   1 
ATOM   403  C CB  . LYS A 1 54 ? 2.031   3.649   32.376 1.00 26.57 ? 51  LYS A CB  1 
ATOM   404  C CG  . LYS A 1 54 ? 0.960   2.711   32.942 1.00 44.13 ? 51  LYS A CG  1 
ATOM   405  C CD  . LYS A 1 54 ? -0.038  3.479   33.772 1.00 54.35 ? 51  LYS A CD  1 
ATOM   406  C CE  . LYS A 1 54 ? 0.666   4.243   34.883 1.00 58.23 ? 51  LYS A CE  1 
ATOM   407  N NZ  . LYS A 1 54 ? 1.260   3.310   35.874 1.00 62.67 ? 51  LYS A NZ  1 
ATOM   408  N N   . SER A 1 55 ? 2.392   3.094   29.423 1.00 21.39 ? 52  SER A N   1 
ATOM   409  C CA  . SER A 1 55 ? 2.052   2.550   28.099 1.00 18.70 ? 52  SER A CA  1 
ATOM   410  C C   . SER A 1 55 ? 3.061   1.616   27.493 1.00 17.40 ? 52  SER A C   1 
ATOM   411  O O   . SER A 1 55 ? 2.666   0.673   26.787 1.00 14.93 ? 52  SER A O   1 
ATOM   412  C CB  . SER A 1 55 ? 1.845   3.733   27.143 1.00 14.67 ? 52  SER A CB  1 
ATOM   413  O OG  . SER A 1 55 ? 0.649   4.341   27.423 1.00 20.70 ? 52  SER A OG  1 
ATOM   414  N N   . LEU A 1 56 ? 4.374   1.885   27.646 1.00 13.45 ? 53  LEU A N   1 
ATOM   415  C CA  . LEU A 1 56 ? 5.361   1.043   27.078 1.00 14.56 ? 53  LEU A CA  1 
ATOM   416  C C   . LEU A 1 56 ? 5.287   -0.341  27.766 1.00 15.17 ? 53  LEU A C   1 
ATOM   417  O O   . LEU A 1 56 ? 5.473   -1.370  27.152 1.00 12.32 ? 53  LEU A O   1 
ATOM   418  C CB  . LEU A 1 56 ? 6.795   1.639   27.237 1.00 17.33 ? 53  LEU A CB  1 
ATOM   419  C CG  . LEU A 1 56 ? 7.946   0.669   26.877 1.00 18.62 ? 53  LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 56 ? 8.041   0.375   25.374 1.00 14.39 ? 53  LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 56 ? 9.286   1.255   27.358 1.00 20.84 ? 53  LEU A CD2 1 
ATOM   422  N N   . GLU A 1 57 ? 5.028   -0.355  29.048 1.00 12.62 ? 54  GLU A N   1 
ATOM   423  C CA  . GLU A 1 57 ? 4.794   -1.611  29.732 1.00 13.69 ? 54  GLU A CA  1 
ATOM   424  C C   . GLU A 1 57 ? 3.557   -2.378  29.152 1.00 13.38 ? 54  GLU A C   1 
ATOM   425  O O   . GLU A 1 57 ? 3.604   -3.585  28.902 1.00 18.10 ? 54  GLU A O   1 
ATOM   426  C CB  . GLU A 1 57 ? 4.448   -1.239  31.181 1.00 16.39 ? 54  GLU A CB  1 
ATOM   427  C CG  . GLU A 1 57 ? 4.269   -2.443  32.050 1.00 23.73 ? 54  GLU A CG  1 
ATOM   428  C CD  . GLU A 1 57 ? 4.417   -2.028  33.462 1.00 30.81 ? 54  GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 57 ? 3.746   -1.038  33.839 1.00 33.39 ? 54  GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 57 ? 5.236   -2.649  34.160 1.00 37.47 ? 54  GLU A OE2 1 
ATOM   431  N N   . LEU A 1 58 ? 2.487   -1.648  28.907 1.00 13.67 ? 55  LEU A N   1 
ATOM   432  C CA  . LEU A 1 58 ? 1.251   -2.218  28.326 1.00 16.13 ? 55  LEU A CA  1 
ATOM   433  C C   . LEU A 1 58 ? 1.595   -2.823  26.944 1.00 17.72 ? 55  LEU A C   1 
ATOM   434  O O   . LEU A 1 58 ? 1.171   -3.968  26.606 1.00 16.80 ? 55  LEU A O   1 
ATOM   435  C CB  . LEU A 1 58 ? 0.213   -1.093  28.144 1.00 22.79 ? 55  LEU A CB  1 
ATOM   436  C CG  . LEU A 1 58 ? -0.441  -0.494  29.384 1.00 26.08 ? 55  LEU A CG  1 
ATOM   437  C CD1 . LEU A 1 58 ? -1.499  0.487   29.002 1.00 28.43 ? 55  LEU A CD1 1 
ATOM   438  C CD2 . LEU A 1 58 ? -1.076  -1.639  30.159 1.00 30.99 ? 55  LEU A CD2 1 
ATOM   439  N N   . ILE A 1 59 ? 2.399   -2.075  26.166 1.00 14.48 ? 56  ILE A N   1 
ATOM   440  C CA  . ILE A 1 59 ? 2.932   -2.607  24.841 1.00 12.67 ? 56  ILE A CA  1 
ATOM   441  C C   . ILE A 1 59 ? 3.763   -3.848  24.964 1.00 17.42 ? 56  ILE A C   1 
ATOM   442  O O   . ILE A 1 59 ? 3.573   -4.787  24.203 1.00 16.13 ? 56  ILE A O   1 
ATOM   443  C CB  . ILE A 1 59 ? 3.689   -1.510  24.040 1.00 14.82 ? 56  ILE A CB  1 
ATOM   444  C CG1 . ILE A 1 59 ? 2.652   -0.515  23.461 1.00 18.99 ? 56  ILE A CG1 1 
ATOM   445  C CG2 . ILE A 1 59 ? 4.503   -2.072  22.862 1.00 13.69 ? 56  ILE A CG2 1 
ATOM   446  C CD1 . ILE A 1 59 ? 3.229   0.961   23.388 1.00 18.07 ? 56  ILE A CD1 1 
ATOM   447  N N   . MET A 1 60 ? 4.692   -3.875  25.933 1.00 12.67 ? 57  MET A N   1 
ATOM   448  C CA  A MET A 1 60 ? 5.430   -5.107  26.143 0.57 15.38 ? 57  MET A CA  1 
ATOM   449  C CA  B MET A 1 60 ? 5.452   -5.079  26.299 0.43 15.26 ? 57  MET A CA  1 
ATOM   450  C C   . MET A 1 60 ? 4.533   -6.273  26.516 1.00 11.94 ? 57  MET A C   1 
ATOM   451  O O   . MET A 1 60 ? 4.691   -7.373  25.930 1.00 17.58 ? 57  MET A O   1 
ATOM   452  C CB  A MET A 1 60 ? 6.588   -4.932  27.119 0.57 19.99 ? 57  MET A CB  1 
ATOM   453  C CB  B MET A 1 60 ? 6.263   -4.821  27.595 0.43 21.21 ? 57  MET A CB  1 
ATOM   454  C CG  A MET A 1 60 ? 7.563   -3.896  26.640 0.57 16.52 ? 57  MET A CG  1 
ATOM   455  C CG  B MET A 1 60 ? 7.650   -4.192  27.383 0.43 20.35 ? 57  MET A CG  1 
ATOM   456  S SD  A MET A 1 60 ? 8.874   -3.652  27.841 0.57 18.00 ? 57  MET A SD  1 
ATOM   457  S SD  B MET A 1 60 ? 8.209   -3.125  28.755 0.43 20.07 ? 57  MET A SD  1 
ATOM   458  C CE  A MET A 1 60 ? 7.996   -3.842  29.416 0.57 17.11 ? 57  MET A CE  1 
ATOM   459  C CE  B MET A 1 60 ? 9.884   -2.730  28.229 0.43 11.41 ? 57  MET A CE  1 
ATOM   460  N N   . LYS A 1 61 ? 3.602   -6.090  27.418 1.00 19.59 ? 58  LYS A N   1 
ATOM   461  C CA  . LYS A 1 61 ? 2.651   -7.167  27.714 1.00 24.54 ? 58  LYS A CA  1 
ATOM   462  C C   . LYS A 1 61 ? 1.878   -7.629  26.466 1.00 26.59 ? 58  LYS A C   1 
ATOM   463  O O   . LYS A 1 61 ? 1.616   -8.824  26.303 1.00 26.94 ? 58  LYS A O   1 
ATOM   464  C CB  . LYS A 1 61 ? 1.707   -6.700  28.813 1.00 30.04 ? 58  LYS A CB  1 
ATOM   465  C CG  . LYS A 1 61 ? 2.435   -6.675  30.145 1.00 32.61 ? 58  LYS A CG  1 
ATOM   466  C CD  . LYS A 1 61 ? 1.547   -6.481  31.368 1.00 39.61 ? 58  LYS A CD  1 
ATOM   467  C CE  . LYS A 1 61 ? 2.461   -6.239  32.582 1.00 41.37 ? 58  LYS A CE  1 
ATOM   468  N NZ  . LYS A 1 61 ? 1.689   -5.976  33.840 1.00 41.74 ? 58  LYS A NZ  1 
ATOM   469  N N   . GLY A 1 62 ? 1.538   -6.688  25.592 1.00 21.22 ? 59  GLY A N   1 
ATOM   470  C CA  . GLY A 1 62 ? 0.797   -7.009  24.384 1.00 18.59 ? 59  GLY A CA  1 
ATOM   471  C C   . GLY A 1 62 ? 1.628   -7.707  23.329 1.00 25.22 ? 59  GLY A C   1 
ATOM   472  O O   . GLY A 1 62 ? 1.137   -8.589  22.651 1.00 25.10 ? 59  GLY A O   1 
ATOM   473  N N   . LEU A 1 63 ? 2.904   -7.349  23.201 1.00 19.46 ? 60  LEU A N   1 
ATOM   474  C CA  . LEU A 1 63 ? 3.822   -8.135  22.386 1.00 19.35 ? 60  LEU A CA  1 
ATOM   475  C C   . LEU A 1 63 ? 4.157   -9.500  23.029 1.00 23.93 ? 60  LEU A C   1 
ATOM   476  O O   . LEU A 1 63 ? 4.772   -10.354 22.392 1.00 24.48 ? 60  LEU A O   1 
ATOM   477  C CB  . LEU A 1 63 ? 5.133   -7.357  22.215 1.00 20.85 ? 60  LEU A CB  1 
ATOM   478  C CG  . LEU A 1 63 ? 4.957   -5.989  21.542 1.00 21.42 ? 60  LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 63 ? 6.229   -5.154  21.670 1.00 23.50 ? 60  LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 63 ? 4.672   -6.225  20.037 1.00 22.14 ? 60  LEU A CD2 1 
ATOM   481  N N   . GLU A 1 64 ? 3.764   -9.696  24.282 1.00 19.00 ? 61  GLU A N   1 
ATOM   482  C CA  . GLU A 1 64 ? 4.273   -10.840 25.096 1.00 23.93 ? 61  GLU A CA  1 
ATOM   483  C C   . GLU A 1 64 ? 5.800   -10.966 25.124 1.00 25.88 ? 61  GLU A C   1 
ATOM   484  O O   . GLU A 1 64 ? 6.371   -12.033 24.841 1.00 26.57 ? 61  GLU A O   1 
ATOM   485  C CB  . GLU A 1 64 ? 3.650   -12.182 24.646 1.00 34.52 ? 61  GLU A CB  1 
ATOM   486  C CG  . GLU A 1 64 ? 2.148   -12.233 24.900 1.00 44.42 ? 61  GLU A CG  1 
ATOM   487  C CD  . GLU A 1 64 ? 1.506   -13.562 24.543 1.00 55.36 ? 61  GLU A CD  1 
ATOM   488  O OE1 . GLU A 1 64 ? 1.759   -14.082 23.436 1.00 56.61 ? 61  GLU A OE1 1 
ATOM   489  O OE2 . GLU A 1 64 ? 0.732   -14.083 25.376 1.00 63.07 ? 61  GLU A OE2 1 
ATOM   490  N N   . VAL A 1 65 ? 6.465   -9.878  25.476 1.00 21.71 ? 62  VAL A N   1 
ATOM   491  C CA  . VAL A 1 65 ? 7.914   -9.862  25.511 1.00 18.19 ? 62  VAL A CA  1 
ATOM   492  C C   . VAL A 1 65 ? 8.214   -9.305  26.870 1.00 19.82 ? 62  VAL A C   1 
ATOM   493  O O   . VAL A 1 65 ? 7.498   -8.421  27.317 1.00 25.37 ? 62  VAL A O   1 
ATOM   494  C CB  . VAL A 1 65 ? 8.483   -8.956  24.394 1.00 23.74 ? 62  VAL A CB  1 
ATOM   495  C CG1 . VAL A 1 65 ? 8.111   -7.466  24.664 1.00 28.42 ? 62  VAL A CG1 1 
ATOM   496  C CG2 . VAL A 1 65 ? 9.960   -9.096  24.292 1.00 25.30 ? 62  VAL A CG2 1 
ATOM   497  N N   . SER A 1 66 ? 9.209   -9.872  27.551 1.00 22.19 ? 63  SER A N   1 
ATOM   498  C CA  . SER A 1 66 ? 9.578   -9.422  28.897 1.00 23.87 ? 63  SER A CA  1 
ATOM   499  C C   . SER A 1 66 ? 10.276  -8.080  28.751 1.00 21.69 ? 63  SER A C   1 
ATOM   500  O O   . SER A 1 66 ? 10.836  -7.783  27.705 1.00 20.08 ? 63  SER A O   1 
ATOM   501  C CB  . SER A 1 66 ? 10.550  -10.417 29.578 1.00 20.58 ? 63  SER A CB  1 
ATOM   502  O OG  . SER A 1 66 ? 11.864  -10.351 28.982 1.00 20.79 ? 63  SER A OG  1 
ATOM   503  N N   . ASP A 1 67 ? 10.213  -7.266  29.795 1.00 18.95 ? 64  ASP A N   1 
ATOM   504  C CA  . ASP A 1 67 ? 10.848  -5.977  29.780 1.00 25.22 ? 64  ASP A CA  1 
ATOM   505  C C   . ASP A 1 67 ? 12.312  -6.092  29.520 1.00 21.92 ? 64  ASP A C   1 
ATOM   506  O O   . ASP A 1 67 ? 12.864  -5.294  28.754 1.00 18.09 ? 64  ASP A O   1 
ATOM   507  C CB  . ASP A 1 67 ? 10.620  -5.198  31.097 1.00 31.36 ? 64  ASP A CB  1 
ATOM   508  C CG  . ASP A 1 67 ? 10.712  -6.061  32.372 1.00 39.26 ? 64  ASP A CG  1 
ATOM   509  O OD1 . ASP A 1 67 ? 11.302  -7.175  32.397 1.00 38.67 ? 64  ASP A OD1 1 
ATOM   510  O OD2 . ASP A 1 67 ? 10.193  -5.562  33.402 1.00 40.68 ? 64  ASP A OD2 1 
ATOM   511  N N   . VAL A 1 68 ? 12.926  -7.071  30.178 1.00 18.94 ? 65  VAL A N   1 
ATOM   512  C CA  . VAL A 1 68 ? 14.387  -7.289  30.095 1.00 17.03 ? 65  VAL A CA  1 
ATOM   513  C C   . VAL A 1 68 ? 14.798  -7.533  28.621 1.00 21.83 ? 65  VAL A C   1 
ATOM   514  O O   . VAL A 1 68 ? 15.790  -6.997  28.187 1.00 15.45 ? 65  VAL A O   1 
ATOM   515  C CB  . VAL A 1 68 ? 14.749  -8.483  30.920 1.00 18.47 ? 65  VAL A CB  1 
ATOM   516  C CG1 . VAL A 1 68 ? 15.983  -9.255  30.407 1.00 20.22 ? 65  VAL A CG1 1 
ATOM   517  C CG2 . VAL A 1 68 ? 14.844  -8.100  32.447 1.00 20.76 ? 65  VAL A CG2 1 
ATOM   518  N N   . VAL A 1 69 ? 14.049  -8.371  27.916 1.00 16.78 ? 66  VAL A N   1 
ATOM   519  C CA  . VAL A 1 69 ? 14.320  -8.689  26.481 1.00 20.22 ? 66  VAL A CA  1 
ATOM   520  C C   . VAL A 1 69 ? 14.195  -7.450  25.585 1.00 16.49 ? 66  VAL A C   1 
ATOM   521  O O   . VAL A 1 69 ? 15.109  -7.113  24.819 1.00 17.85 ? 66  VAL A O   1 
ATOM   522  C CB  . VAL A 1 69 ? 13.413  -9.805  25.957 1.00 25.46 ? 66  VAL A CB  1 
ATOM   523  C CG1 . VAL A 1 69 ? 13.546  -9.930  24.438 1.00 25.34 ? 66  VAL A CG1 1 
ATOM   524  C CG2 . VAL A 1 69 ? 13.879  -11.152 26.587 1.00 31.78 ? 66  VAL A CG2 1 
ATOM   525  N N   . PHE A 1 70 ? 13.082  -6.788  25.731 1.00 15.80 ? 67  PHE A N   1 
ATOM   526  C CA  . PHE A 1 70 ? 12.875  -5.461  25.112 1.00 12.60 ? 67  PHE A CA  1 
ATOM   527  C C   . PHE A 1 70 ? 14.045  -4.504  25.318 1.00 15.62 ? 67  PHE A C   1 
ATOM   528  O O   . PHE A 1 70 ? 14.527  -3.843  24.353 1.00 12.11 ? 67  PHE A O   1 
ATOM   529  C CB  . PHE A 1 70 ? 11.608  -4.819  25.614 1.00 10.42 ? 67  PHE A CB  1 
ATOM   530  C CG  . PHE A 1 70 ? 11.239  -3.560  24.841 1.00 12.59 ? 67  PHE A CG  1 
ATOM   531  C CD1 . PHE A 1 70 ? 10.447  -3.630  23.710 1.00 17.05 ? 67  PHE A CD1 1 
ATOM   532  C CD2 . PHE A 1 70 ? 11.684  -2.315  25.291 1.00 10.42 ? 67  PHE A CD2 1 
ATOM   533  C CE1 . PHE A 1 70 ? 10.088  -2.494  22.984 1.00 18.99 ? 67  PHE A CE1 1 
ATOM   534  C CE2 . PHE A 1 70 ? 11.417  -1.171  24.541 1.00 9.82  ? 67  PHE A CE2 1 
ATOM   535  C CZ  . PHE A 1 70 ? 10.594  -1.258  23.388 1.00 15.79 ? 67  PHE A CZ  1 
ATOM   536  N N   . PHE A 1 71 ? 14.411  -4.280  26.584 1.00 14.82 ? 68  PHE A N   1 
ATOM   537  C CA  . PHE A 1 71 ? 15.589  -3.425  26.845 1.00 14.35 ? 68  PHE A CA  1 
ATOM   538  C C   . PHE A 1 71 ? 16.866  -3.955  26.258 1.00 12.79 ? 68  PHE A C   1 
ATOM   539  O O   . PHE A 1 71 ? 17.743  -3.172  25.821 1.00 14.76 ? 68  PHE A O   1 
ATOM   540  C CB  . PHE A 1 71 ? 15.702  -3.033  28.357 1.00 14.79 ? 68  PHE A CB  1 
ATOM   541  C CG  . PHE A 1 71 ? 14.526  -2.220  28.818 1.00 23.02 ? 68  PHE A CG  1 
ATOM   542  C CD1 . PHE A 1 71 ? 14.243  -1.021  28.199 1.00 21.34 ? 68  PHE A CD1 1 
ATOM   543  C CD2 . PHE A 1 71 ? 13.695  -2.645  29.859 1.00 29.53 ? 68  PHE A CD2 1 
ATOM   544  C CE1 . PHE A 1 71 ? 13.116  -0.259  28.560 1.00 23.24 ? 68  PHE A CE1 1 
ATOM   545  C CE2 . PHE A 1 71 ? 12.585  -1.885  30.245 1.00 28.50 ? 68  PHE A CE2 1 
ATOM   546  C CZ  . PHE A 1 71 ? 12.309  -0.669  29.593 1.00 23.93 ? 68  PHE A CZ  1 
ATOM   547  N N   . GLU A 1 72 ? 17.017  -5.275  26.203 1.00 14.96 ? 69  GLU A N   1 
ATOM   548  C CA  . GLU A 1 72 ? 18.262  -5.811  25.662 1.00 18.49 ? 69  GLU A CA  1 
ATOM   549  C C   . GLU A 1 72 ? 18.279  -5.631  24.150 1.00 13.40 ? 69  GLU A C   1 
ATOM   550  O O   . GLU A 1 72 ? 19.337  -5.418  23.522 1.00 14.46 ? 69  GLU A O   1 
ATOM   551  C CB  . GLU A 1 72 ? 18.413  -7.294  25.968 1.00 19.82 ? 69  GLU A CB  1 
ATOM   552  C CG  . GLU A 1 72 ? 19.041  -7.571  27.315 1.00 22.82 ? 69  GLU A CG  1 
ATOM   553  C CD  . GLU A 1 72 ? 18.607  -8.884  27.945 1.00 24.15 ? 69  GLU A CD  1 
ATOM   554  O OE1 . GLU A 1 72 ? 17.954  -9.741  27.315 1.00 28.06 ? 69  GLU A OE1 1 
ATOM   555  O OE2 . GLU A 1 72 ? 18.956  -9.049  29.134 1.00 26.89 ? 69  GLU A OE2 1 
ATOM   556  N N   . MET A 1 73 ? 17.127  -5.730  23.561 1.00 14.41 ? 70  MET A N   1 
ATOM   557  C CA  . MET A 1 73 ? 17.105  -5.437  22.102 1.00 15.48 ? 70  MET A CA  1 
ATOM   558  C C   . MET A 1 73 ? 17.298  -3.944  21.808 1.00 13.74 ? 70  MET A C   1 
ATOM   559  O O   . MET A 1 73 ? 17.890  -3.598  20.757 1.00 16.90 ? 70  MET A O   1 
ATOM   560  C CB  . MET A 1 73 ? 15.770  -5.845  21.482 1.00 18.52 ? 70  MET A CB  1 
ATOM   561  C CG  . MET A 1 73 ? 15.526  -7.381  21.399 1.00 26.03 ? 70  MET A CG  1 
ATOM   562  S SD  . MET A 1 73 ? 13.766  -7.751  20.954 1.00 32.30 ? 70  MET A SD  1 
ATOM   563  C CE  . MET A 1 73 ? 13.773  -9.546  21.072 1.00 30.95 ? 70  MET A CE  1 
ATOM   564  N N   . LEU A 1 74 ? 16.745  -3.103  22.688 1.00 13.27 ? 71  LEU A N   1 
ATOM   565  C CA  . LEU A 1 74 ? 16.894  -1.649  22.541 1.00 12.42 ? 71  LEU A CA  1 
ATOM   566  C C   . LEU A 1 74 ? 18.390  -1.298  22.685 1.00 13.32 ? 71  LEU A C   1 
ATOM   567  O O   . LEU A 1 74 ? 18.935  -0.601  21.885 1.00 13.30 ? 71  LEU A O   1 
ATOM   568  C CB  . LEU A 1 74 ? 16.015  -0.939  23.552 1.00 11.12 ? 71  LEU A CB  1 
ATOM   569  C CG  . LEU A 1 74 ? 16.102  0.608   23.606 1.00 13.28 ? 71  LEU A CG  1 
ATOM   570  C CD1 . LEU A 1 74 ? 15.700  1.209   22.299 1.00 11.85 ? 71  LEU A CD1 1 
ATOM   571  C CD2 . LEU A 1 74 ? 15.221  1.196   24.739 1.00 17.27 ? 71  LEU A CD2 1 
ATOM   572  N N   . ILE A 1 75 ? 19.081  -1.856  23.677 1.00 12.82 ? 72  ILE A N   1 
ATOM   573  C CA  . ILE A 1 75 ? 20.529  -1.598  23.829 1.00 14.91 ? 72  ILE A CA  1 
ATOM   574  C C   . ILE A 1 75 ? 21.375  -2.120  22.622 1.00 18.99 ? 72  ILE A C   1 
ATOM   575  O O   . ILE A 1 75 ? 22.260  -1.429  22.101 1.00 22.00 ? 72  ILE A O   1 
ATOM   576  C CB  . ILE A 1 75 ? 21.055  -2.308  25.099 1.00 15.72 ? 72  ILE A CB  1 
ATOM   577  C CG1 . ILE A 1 75 ? 20.544  -1.630  26.380 1.00 19.54 ? 72  ILE A CG1 1 
ATOM   578  C CG2 . ILE A 1 75 ? 22.609  -2.394  25.044 1.00 22.34 ? 72  ILE A CG2 1 
ATOM   579  C CD1 . ILE A 1 75 ? 20.421  -2.668  27.580 1.00 19.70 ? 72  ILE A CD1 1 
ATOM   580  N N   . LYS A 1 76 ? 21.093  -3.353  22.172 1.00 15.58 ? 73  LYS A N   1 
ATOM   581  C CA  . LYS A 1 76 ? 21.757  -3.941  21.036 1.00 29.36 ? 73  LYS A CA  1 
ATOM   582  C C   . LYS A 1 76 ? 21.575  -3.038  19.800 1.00 19.05 ? 73  LYS A C   1 
ATOM   583  O O   . LYS A 1 76 ? 22.543  -2.842  19.051 1.00 19.69 ? 73  LYS A O   1 
ATOM   584  C CB  . LYS A 1 76 ? 21.150  -5.335  20.716 1.00 22.18 ? 73  LYS A CB  1 
ATOM   585  C CG  . LYS A 1 76 ? 21.871  -6.022  19.535 1.00 31.92 ? 73  LYS A CG  1 
ATOM   586  C CD  . LYS A 1 76 ? 21.437  -7.480  19.299 1.00 31.36 ? 73  LYS A CD  1 
ATOM   587  C CE  . LYS A 1 76 ? 21.885  -7.967  17.916 1.00 33.69 ? 73  LYS A CE  1 
ATOM   588  N NZ  . LYS A 1 76 ? 21.497  -9.381  17.556 1.00 41.01 ? 73  LYS A NZ  1 
ATOM   589  N N   . GLU A 1 77 ? 20.339  -2.555  19.592 1.00 19.85 ? 74  GLU A N   1 
ATOM   590  C CA  . GLU A 1 77 ? 20.049  -1.645  18.471 1.00 22.63 ? 74  GLU A CA  1 
ATOM   591  C C   . GLU A 1 77 ? 20.813  -0.328  18.612 1.00 28.42 ? 74  GLU A C   1 
ATOM   592  O O   . GLU A 1 77 ? 21.445  0.171   17.667 1.00 25.06 ? 74  GLU A O   1 
ATOM   593  C CB  . GLU A 1 77 ? 18.549  -1.369  18.398 1.00 39.41 ? 74  GLU A CB  1 
ATOM   594  C CG  . GLU A 1 77 ? 18.108  -0.639  17.167 1.00 38.63 ? 74  GLU A CG  1 
ATOM   595  C CD  . GLU A 1 77 ? 18.363  -1.428  15.883 1.00 41.03 ? 74  GLU A CD  1 
ATOM   596  O OE1 . GLU A 1 77 ? 18.298  -2.678  15.896 1.00 39.33 ? 74  GLU A OE1 1 
ATOM   597  O OE2 . GLU A 1 77 ? 18.635  -0.779  14.858 1.00 46.87 ? 74  GLU A OE2 1 
ATOM   598  N N   . ILE A 1 78 ? 20.752  0.262   19.784 1.00 28.23 ? 75  ILE A N   1 
ATOM   599  C CA  . ILE A 1 78 ? 21.545  1.466   19.994 1.00 28.44 ? 75  ILE A CA  1 
ATOM   600  C C   . ILE A 1 78 ? 23.028  1.231   19.800 1.00 23.91 ? 75  ILE A C   1 
ATOM   601  O O   . ILE A 1 78 ? 23.682  2.000   19.062 1.00 20.76 ? 75  ILE A O   1 
ATOM   602  C CB  . ILE A 1 78 ? 21.315  2.008   21.369 1.00 29.32 ? 75  ILE A CB  1 
ATOM   603  C CG1 . ILE A 1 78 ? 19.887  2.521   21.436 1.00 22.48 ? 75  ILE A CG1 1 
ATOM   604  C CG2 . ILE A 1 78 ? 22.336  3.105   21.667 1.00 26.03 ? 75  ILE A CG2 1 
ATOM   605  C CD1 . ILE A 1 78 ? 19.436  2.830   22.874 1.00 23.16 ? 75  ILE A CD1 1 
ATOM   606  N N   . LEU A 1 79 ? 23.577  0.154   20.386 1.00 20.90 ? 76  LEU A N   1 
ATOM   607  C CA  . LEU A 1 79 ? 25.059  -0.046  20.328 1.00 26.64 ? 76  LEU A CA  1 
ATOM   608  C C   . LEU A 1 79 ? 25.563  -0.344  18.909 1.00 27.66 ? 76  LEU A C   1 
ATOM   609  O O   . LEU A 1 79 ? 26.625  0.132   18.500 1.00 22.95 ? 76  LEU A O   1 
ATOM   610  C CB  . LEU A 1 79 ? 25.551  -1.185  21.275 1.00 23.44 ? 76  LEU A CB  1 
ATOM   611  C CG  . LEU A 1 79 ? 25.431  -0.802  22.734 1.00 19.74 ? 76  LEU A CG  1 
ATOM   612  C CD1 . LEU A 1 79 ? 25.739  -2.044  23.638 1.00 24.42 ? 76  LEU A CD1 1 
ATOM   613  C CD2 . LEU A 1 79 ? 26.444  0.313   23.003 1.00 20.07 ? 76  LEU A CD2 1 
ATOM   614  N N   . LYS A 1 80 ? 24.795  -1.146  18.174 1.00 25.37 ? 77  LYS A N   1 
ATOM   615  C CA  . LYS A 1 80 ? 25.227  -1.610  16.891 1.00 28.60 ? 77  LYS A CA  1 
ATOM   616  C C   . LYS A 1 80 ? 24.974  -0.555  15.825 1.00 33.81 ? 77  LYS A C   1 
ATOM   617  O O   . LYS A 1 80 ? 25.641  -0.543  14.800 1.00 34.54 ? 77  LYS A O   1 
ATOM   618  C CB  . LYS A 1 80 ? 24.564  -2.963  16.543 1.00 34.17 ? 77  LYS A CB  1 
ATOM   619  C CG  . LYS A 1 80 ? 25.145  -4.135  17.379 1.00 29.39 ? 77  LYS A CG  1 
ATOM   620  C CD  . LYS A 1 80 ? 24.445  -5.448  17.024 1.00 29.02 ? 77  LYS A CD  1 
ATOM   621  C CE  . LYS A 1 80 ? 25.189  -6.240  15.968 1.00 40.13 ? 77  LYS A CE  1 
ATOM   622  N NZ  . LYS A 1 80 ? 25.621  -7.576  16.480 1.00 47.87 ? 77  LYS A NZ  1 
ATOM   623  N N   . HIS A 1 81 ? 24.025  0.341   16.068 1.00 34.40 ? 78  HIS A N   1 
ATOM   624  C CA  . HIS A 1 81 ? 23.637  1.290   15.020 1.00 38.70 ? 78  HIS A CA  1 
ATOM   625  C C   . HIS A 1 81 ? 23.725  2.769   15.394 1.00 45.23 ? 78  HIS A C   1 
ATOM   626  O O   . HIS A 1 81 ? 23.494  3.623   14.550 1.00 47.07 ? 78  HIS A O   1 
ATOM   627  C CB  . HIS A 1 81 ? 22.255  0.921   14.470 1.00 39.16 ? 78  HIS A CB  1 
ATOM   628  C CG  . HIS A 1 81 ? 22.216  -0.458  13.884 1.00 41.50 ? 78  HIS A CG  1 
ATOM   629  N ND1 . HIS A 1 81 ? 21.724  -1.544  14.574 1.00 39.59 ? 78  HIS A ND1 1 
ATOM   630  C CD2 . HIS A 1 81 ? 22.676  -0.933  12.706 1.00 42.76 ? 78  HIS A CD2 1 
ATOM   631  C CE1 . HIS A 1 81 ? 21.862  -2.629  13.834 1.00 38.98 ? 78  HIS A CE1 1 
ATOM   632  N NE2 . HIS A 1 81 ? 22.435  -2.285  12.696 1.00 44.40 ? 78  HIS A NE2 1 
ATOM   633  N N   . ASP A 1 82 ? 24.078  3.085   16.639 1.00 50.51 ? 79  ASP A N   1 
ATOM   634  C CA  . ASP A 1 82 ? 24.305  4.488   16.991 1.00 62.10 ? 79  ASP A CA  1 
ATOM   635  C C   . ASP A 1 82 ? 25.766  4.890   16.815 1.00 68.18 ? 79  ASP A C   1 
ATOM   636  O O   . ASP A 1 82 ? 26.093  6.071   16.906 1.00 72.94 ? 79  ASP A O   1 
ATOM   637  C CB  . ASP A 1 82 ? 23.865  4.788   18.425 1.00 67.89 ? 79  ASP A CB  1 
ATOM   638  C CG  . ASP A 1 82 ? 23.678  6.267   18.683 1.00 73.37 ? 79  ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 82 ? 23.551  7.030   17.700 1.00 76.09 ? 79  ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 82 ? 23.643  6.659   19.872 1.00 74.03 ? 79  ASP A OD2 1 
ATOM   641  O OXT . ASP A 1 82 ? 26.651  4.063   16.592 1.00 67.60 ? 79  ASP A OXT 1 
ATOM   642  N N   . SER B 1 6  ? 2.736   0.948   39.124 1.00 49.52 ? 3   SER B N   1 
ATOM   643  C CA  . SER B 1 6  ? 3.008   -0.054  38.098 1.00 46.37 ? 3   SER B CA  1 
ATOM   644  C C   . SER B 1 6  ? 4.479   -0.447  38.067 1.00 43.46 ? 3   SER B C   1 
ATOM   645  O O   . SER B 1 6  ? 5.364   0.372   38.348 1.00 44.48 ? 3   SER B O   1 
ATOM   646  C CB  . SER B 1 6  ? 2.549   0.439   36.735 1.00 51.64 ? 3   SER B CB  1 
ATOM   647  O OG  . SER B 1 6  ? 1.202   0.866   36.809 1.00 57.98 ? 3   SER B OG  1 
ATOM   648  N N   . PHE B 1 7  ? 4.740   -1.699  37.707 1.00 41.14 ? 4   PHE B N   1 
ATOM   649  C CA  . PHE B 1 7  ? 6.047   -2.291  37.961 1.00 42.70 ? 4   PHE B CA  1 
ATOM   650  C C   . PHE B 1 7  ? 7.197   -1.613  37.230 1.00 32.58 ? 4   PHE B C   1 
ATOM   651  O O   . PHE B 1 7  ? 8.215   -1.288  37.839 1.00 36.24 ? 4   PHE B O   1 
ATOM   652  C CB  . PHE B 1 7  ? 6.051   -3.779  37.630 1.00 44.45 ? 4   PHE B CB  1 
ATOM   653  C CG  . PHE B 1 7  ? 7.406   -4.408  37.735 1.00 47.90 ? 4   PHE B CG  1 
ATOM   654  C CD1 . PHE B 1 7  ? 7.891   -4.821  38.959 1.00 50.98 ? 4   PHE B CD1 1 
ATOM   655  C CD2 . PHE B 1 7  ? 8.195   -4.580  36.614 1.00 51.02 ? 4   PHE B CD2 1 
ATOM   656  C CE1 . PHE B 1 7  ? 9.140   -5.394  39.069 1.00 52.09 ? 4   PHE B CE1 1 
ATOM   657  C CE2 . PHE B 1 7  ? 9.454   -5.157  36.712 1.00 50.48 ? 4   PHE B CE2 1 
ATOM   658  C CZ  . PHE B 1 7  ? 9.924   -5.569  37.951 1.00 50.82 ? 4   PHE B CZ  1 
ATOM   659  N N   . LEU B 1 8  ? 7.054   -1.424  35.928 1.00 28.22 ? 5   LEU B N   1 
ATOM   660  C CA  . LEU B 1 8  ? 8.170   -0.881  35.136 1.00 30.87 ? 5   LEU B CA  1 
ATOM   661  C C   . LEU B 1 8  ? 8.622   0.447   35.711 1.00 33.97 ? 5   LEU B C   1 
ATOM   662  O O   . LEU B 1 8  ? 9.803   0.623   36.046 1.00 27.69 ? 5   LEU B O   1 
ATOM   663  C CB  . LEU B 1 8  ? 7.789   -0.683  33.676 1.00 28.50 ? 5   LEU B CB  1 
ATOM   664  C CG  . LEU B 1 8  ? 8.984   -0.221  32.827 1.00 27.94 ? 5   LEU B CG  1 
ATOM   665  C CD1 . LEU B 1 8  ? 10.181  -1.099  33.132 1.00 26.26 ? 5   LEU B CD1 1 
ATOM   666  C CD2 . LEU B 1 8  ? 8.680   -0.095  31.277 1.00 24.25 ? 5   LEU B CD2 1 
ATOM   667  N N   . LEU B 1 9  ? 7.639   1.333   35.882 1.00 41.20 ? 6   LEU B N   1 
ATOM   668  C CA  . LEU B 1 9  ? 7.836   2.723   36.274 1.00 38.54 ? 6   LEU B CA  1 
ATOM   669  C C   . LEU B 1 9  ? 8.490   2.819   37.665 1.00 37.64 ? 6   LEU B C   1 
ATOM   670  O O   . LEU B 1 9  ? 9.288   3.734   37.914 1.00 33.41 ? 6   LEU B O   1 
ATOM   671  C CB  . LEU B 1 9  ? 6.491   3.480   36.206 1.00 34.51 ? 6   LEU B CB  1 
ATOM   672  C CG  . LEU B 1 9  ? 6.329   4.928   36.730 1.00 45.67 ? 6   LEU B CG  1 
ATOM   673  C CD1 . LEU B 1 9  ? 6.864   6.004   35.801 1.00 43.77 ? 6   LEU B CD1 1 
ATOM   674  C CD2 . LEU B 1 9  ? 4.863   5.237   37.040 1.00 53.42 ? 6   LEU B CD2 1 
ATOM   675  N N   . SER B 1 10 ? 8.169   1.865   38.539 1.00 28.40 ? 7   SER B N   1 
ATOM   676  C CA  . SER B 1 10 ? 8.738   1.833   39.884 1.00 37.60 ? 7   SER B CA  1 
ATOM   677  C C   . SER B 1 10 ? 10.225  1.475   39.875 1.00 35.16 ? 7   SER B C   1 
ATOM   678  O O   . SER B 1 10 ? 10.981  1.908   40.743 1.00 24.58 ? 7   SER B O   1 
ATOM   679  C CB  . SER B 1 10 ? 7.954   0.903   40.825 1.00 36.80 ? 7   SER B CB  1 
ATOM   680  O OG  . SER B 1 10 ? 8.262   -0.468  40.597 1.00 48.10 ? 7   SER B OG  1 
ATOM   681  N N   . LYS B 1 11 ? 10.639  0.670   38.896 1.00 25.60 ? 8   LYS B N   1 
ATOM   682  C CA  . LYS B 1 11 ? 12.053  0.367   38.736 1.00 26.75 ? 8   LYS B CA  1 
ATOM   683  C C   . LYS B 1 11 ? 12.833  1.484   38.010 1.00 18.92 ? 8   LYS B C   1 
ATOM   684  O O   . LYS B 1 11 ? 13.997  1.752   38.281 1.00 20.26 ? 8   LYS B O   1 
ATOM   685  C CB  . LYS B 1 11 ? 12.223  -1.009  38.058 1.00 33.78 ? 8   LYS B CB  1 
ATOM   686  C CG  . LYS B 1 11 ? 11.985  -2.176  39.048 1.00 45.17 ? 8   LYS B CG  1 
ATOM   687  C CD  . LYS B 1 11 ? 12.864  -2.047  40.301 1.00 48.97 ? 8   LYS B CD  1 
ATOM   688  C CE  . LYS B 1 11 ? 12.050  -1.921  41.585 1.00 56.07 ? 8   LYS B CE  1 
ATOM   689  N NZ  . LYS B 1 11 ? 12.859  -1.370  42.721 1.00 53.88 ? 8   LYS B NZ  1 
ATOM   690  N N   . VAL B 1 12 ? 12.156  2.152   37.100 1.00 17.19 ? 9   VAL B N   1 
ATOM   691  C CA  . VAL B 1 12 ? 12.689  3.294   36.394 1.00 16.80 ? 9   VAL B CA  1 
ATOM   692  C C   . VAL B 1 12 ? 12.910  4.404   37.408 1.00 19.38 ? 9   VAL B C   1 
ATOM   693  O O   . VAL B 1 12 ? 14.015  4.951   37.509 1.00 15.89 ? 9   VAL B O   1 
ATOM   694  C CB  . VAL B 1 12 ? 11.688  3.680   35.325 1.00 16.73 ? 9   VAL B CB  1 
ATOM   695  C CG1 . VAL B 1 12 ? 11.974  5.073   34.739 1.00 17.66 ? 9   VAL B CG1 1 
ATOM   696  C CG2 . VAL B 1 12 ? 11.769  2.609   34.168 1.00 17.45 ? 9   VAL B CG2 1 
ATOM   697  N N   . SER B 1 13 ? 11.892  4.652   38.221 1.00 20.34 ? 10  SER B N   1 
ATOM   698  C CA  . SER B 1 13 ? 11.998  5.667   39.294 1.00 18.79 ? 10  SER B CA  1 
ATOM   699  C C   . SER B 1 13 ? 13.108  5.361   40.310 1.00 19.41 ? 10  SER B C   1 
ATOM   700  O O   . SER B 1 13 ? 13.848  6.237   40.733 1.00 19.66 ? 10  SER B O   1 
ATOM   701  C CB  . SER B 1 13 ? 10.648  5.781   39.988 1.00 20.85 ? 10  SER B CB  1 
ATOM   702  O OG  . SER B 1 13 ? 10.801  6.081   41.365 1.00 31.55 ? 10  SER B OG  1 
ATOM   703  N N   . PHE B 1 14 ? 13.225  4.084   40.712 1.00 16.53 ? 11  PHE B N   1 
ATOM   704  C CA  . PHE B 1 14 ? 14.343  3.654   41.532 1.00 16.92 ? 11  PHE B CA  1 
ATOM   705  C C   . PHE B 1 14 ? 15.722  3.907   40.908 1.00 15.32 ? 11  PHE B C   1 
ATOM   706  O O   . PHE B 1 14 ? 16.632  4.343   41.592 1.00 14.22 ? 11  PHE B O   1 
ATOM   707  C CB  . PHE B 1 14 ? 14.224  2.136   41.812 1.00 19.54 ? 11  PHE B CB  1 
ATOM   708  C CG  . PHE B 1 14 ? 15.320  1.614   42.666 1.00 31.64 ? 11  PHE B CG  1 
ATOM   709  C CD1 . PHE B 1 14 ? 15.240  1.712   44.046 1.00 37.03 ? 11  PHE B CD1 1 
ATOM   710  C CD2 . PHE B 1 14 ? 16.463  1.076   42.092 1.00 39.11 ? 11  PHE B CD2 1 
ATOM   711  C CE1 . PHE B 1 14 ? 16.257  1.239   44.843 1.00 42.93 ? 11  PHE B CE1 1 
ATOM   712  C CE2 . PHE B 1 14 ? 17.488  0.598   42.884 1.00 43.04 ? 11  PHE B CE2 1 
ATOM   713  C CZ  . PHE B 1 14 ? 17.385  0.682   44.267 1.00 44.55 ? 11  PHE B CZ  1 
ATOM   714  N N   . VAL B 1 15 ? 15.889  3.595   39.621 1.00 14.61 ? 12  VAL B N   1 
ATOM   715  C CA  . VAL B 1 15 ? 17.190  3.780   38.936 1.00 16.67 ? 12  VAL B CA  1 
ATOM   716  C C   . VAL B 1 15 ? 17.552  5.255   38.801 1.00 15.17 ? 12  VAL B C   1 
ATOM   717  O O   . VAL B 1 15 ? 18.730  5.613   38.980 1.00 17.47 ? 12  VAL B O   1 
ATOM   718  C CB  . VAL B 1 15 ? 17.199  3.150   37.530 1.00 15.16 ? 12  VAL B CB  1 
ATOM   719  C CG1 . VAL B 1 15 ? 18.557  3.395   36.836 1.00 18.12 ? 12  VAL B CG1 1 
ATOM   720  C CG2 . VAL B 1 15 ? 17.050  1.654   37.662 1.00 21.47 ? 12  VAL B CG2 1 
ATOM   721  N N   . ILE B 1 16 ? 16.556  6.093   38.522 1.00 11.29 ? 13  ILE B N   1 
ATOM   722  C CA  . ILE B 1 16 ? 16.805  7.576   38.446 1.00 11.87 ? 13  ILE B CA  1 
ATOM   723  C C   . ILE B 1 16 ? 17.358  8.137   39.764 1.00 17.15 ? 13  ILE B C   1 
ATOM   724  O O   . ILE B 1 16 ? 18.335  8.953   39.813 1.00 18.02 ? 13  ILE B O   1 
ATOM   725  C CB  . ILE B 1 16 ? 15.554  8.307   38.048 1.00 12.16 ? 13  ILE B CB  1 
ATOM   726  C CG1 . ILE B 1 16 ? 15.176  7.904   36.622 1.00 12.25 ? 13  ILE B CG1 1 
ATOM   727  C CG2 . ILE B 1 16 ? 15.744  9.848   38.030 1.00 12.59 ? 13  ILE B CG2 1 
ATOM   728  C CD1 . ILE B 1 16 ? 13.756  8.319   36.323 1.00 18.37 ? 13  ILE B CD1 1 
ATOM   729  N N   . LYS B 1 17 ? 16.709  7.721   40.830 1.00 18.37 ? 14  LYS B N   1 
ATOM   730  C CA  . LYS B 1 17 ? 17.054  8.216   42.172 1.00 18.72 ? 14  LYS B CA  1 
ATOM   731  C C   . LYS B 1 17 ? 18.405  7.697   42.541 1.00 17.26 ? 14  LYS B C   1 
ATOM   732  O O   . LYS B 1 17 ? 19.243  8.466   43.030 1.00 15.10 ? 14  LYS B O   1 
ATOM   733  C CB  . LYS B 1 17 ? 16.013  7.775   43.179 1.00 22.25 ? 14  LYS B CB  1 
ATOM   734  C CG  . LYS B 1 17 ? 16.262  8.264   44.648 1.00 27.87 ? 14  LYS B CG  1 
ATOM   735  C CD  . LYS B 1 17 ? 15.055  7.934   45.523 1.00 31.11 ? 14  LYS B CD  1 
ATOM   736  C CE  . LYS B 1 17 ? 15.229  8.458   46.947 1.00 32.83 ? 14  LYS B CE  1 
ATOM   737  N NZ  . LYS B 1 17 ? 14.016  8.276   47.803 1.00 39.77 ? 14  LYS B NZ  1 
ATOM   738  N N   . LYS B 1 18 ? 18.638  6.404   42.268 1.00 15.78 ? 15  LYS B N   1 
ATOM   739  C CA  . LYS B 1 18 ? 19.934  5.762   42.554 1.00 20.01 ? 15  LYS B CA  1 
ATOM   740  C C   . LYS B 1 18 ? 21.089  6.464   41.841 1.00 17.97 ? 15  LYS B C   1 
ATOM   741  O O   . LYS B 1 18 ? 22.109  6.749   42.445 1.00 16.20 ? 15  LYS B O   1 
ATOM   742  C CB  . LYS B 1 18 ? 19.943  4.274   42.175 1.00 20.32 ? 15  LYS B CB  1 
ATOM   743  C CG  . LYS B 1 18 ? 21.308  3.584   42.431 1.00 28.07 ? 15  LYS B CG  1 
ATOM   744  C CD  . LYS B 1 18 ? 21.225  2.070   42.336 1.00 38.01 ? 15  LYS B CD  1 
ATOM   745  C CE  . LYS B 1 18 ? 22.474  1.419   42.980 1.00 40.27 ? 15  LYS B CE  1 
ATOM   746  N NZ  . LYS B 1 18 ? 22.135  0.123   43.670 1.00 45.03 ? 15  LYS B NZ  1 
ATOM   747  N N   . ILE B 1 19 ? 20.947  6.689   40.550 1.00 16.25 ? 16  ILE B N   1 
ATOM   748  C CA  . ILE B 1 19 ? 21.967  7.389   39.831 1.00 14.58 ? 16  ILE B CA  1 
ATOM   749  C C   . ILE B 1 19 ? 22.087  8.836   40.333 1.00 16.27 ? 16  ILE B C   1 
ATOM   750  O O   . ILE B 1 19 ? 23.213  9.340   40.545 1.00 16.69 ? 16  ILE B O   1 
ATOM   751  C CB  . ILE B 1 19 ? 21.665  7.417   38.325 1.00 18.67 ? 16  ILE B CB  1 
ATOM   752  C CG1 . ILE B 1 19 ? 21.617  5.974   37.788 1.00 19.51 ? 16  ILE B CG1 1 
ATOM   753  C CG2 . ILE B 1 19 ? 22.770  8.214   37.611 1.00 17.97 ? 16  ILE B CG2 1 
ATOM   754  C CD1 . ILE B 1 19 ? 20.961  5.884   36.420 1.00 18.87 ? 16  ILE B CD1 1 
ATOM   755  N N   . ARG B 1 20 ? 20.957  9.527   40.499 1.00 17.50 ? 17  ARG B N   1 
ATOM   756  C CA  . ARG B 1 20 ? 21.023  10.923  40.992 1.00 20.77 ? 17  ARG B CA  1 
ATOM   757  C C   . ARG B 1 20 ? 21.878  11.103  42.294 1.00 21.72 ? 17  ARG B C   1 
ATOM   758  O O   . ARG B 1 20 ? 22.724  12.014  42.369 1.00 18.85 ? 17  ARG B O   1 
ATOM   759  C CB  . ARG B 1 20 ? 19.628  11.517  41.196 1.00 20.33 ? 17  ARG B CB  1 
ATOM   760  C CG  . ARG B 1 20 ? 19.663  12.932  41.750 1.00 18.53 ? 17  ARG B CG  1 
ATOM   761  C CD  . ARG B 1 20 ? 18.251  13.463  41.939 1.00 21.41 ? 17  ARG B CD  1 
ATOM   762  N NE  . ARG B 1 20 ? 17.469  12.827  43.008 1.00 22.61 ? 17  ARG B NE  1 
ATOM   763  C CZ  . ARG B 1 20 ? 17.695  12.963  44.300 1.00 17.67 ? 17  ARG B CZ  1 
ATOM   764  N NH1 . ARG B 1 20 ? 18.682  13.763  44.769 1.00 17.58 ? 17  ARG B NH1 1 
ATOM   765  N NH2 . ARG B 1 20 ? 16.823  12.414  45.140 1.00 22.55 ? 17  ARG B NH2 1 
ATOM   766  N N   . LEU B 1 21 ? 21.660  10.217  43.263 1.00 19.79 ? 18  LEU B N   1 
ATOM   767  C CA  . LEU B 1 21 ? 22.351  10.195  44.562 1.00 18.87 ? 18  LEU B CA  1 
ATOM   768  C C   . LEU B 1 21 ? 23.804  9.691   44.438 1.00 25.79 ? 18  LEU B C   1 
ATOM   769  O O   . LEU B 1 21 ? 24.678  10.249  45.049 1.00 22.17 ? 18  LEU B O   1 
ATOM   770  C CB  . LEU B 1 21 ? 21.584  9.293   45.536 1.00 19.83 ? 18  LEU B CB  1 
ATOM   771  C CG  . LEU B 1 21 ? 20.256  9.939   45.938 1.00 22.92 ? 18  LEU B CG  1 
ATOM   772  C CD1 . LEU B 1 21 ? 19.451  9.066   46.868 1.00 30.87 ? 18  LEU B CD1 1 
ATOM   773  C CD2 . LEU B 1 21 ? 20.511  11.280  46.597 1.00 28.39 ? 18  LEU B CD2 1 
ATOM   774  N N   . GLU B 1 22 ? 24.061  8.661   43.634 1.00 27.35 ? 19  GLU B N   1 
ATOM   775  C CA  . GLU B 1 22 ? 25.456  8.288   43.291 1.00 30.24 ? 19  GLU B CA  1 
ATOM   776  C C   . GLU B 1 22 ? 26.254  9.472   42.764 1.00 26.95 ? 19  GLU B C   1 
ATOM   777  O O   . GLU B 1 22 ? 27.428  9.678   43.090 1.00 36.36 ? 19  GLU B O   1 
ATOM   778  C CB  . GLU B 1 22 ? 25.482  7.200   42.208 1.00 28.64 ? 19  GLU B CB  1 
ATOM   779  C CG  . GLU B 1 22 ? 25.239  5.810   42.698 1.00 39.06 ? 19  GLU B CG  1 
ATOM   780  C CD  . GLU B 1 22 ? 24.966  4.817   41.583 1.00 42.11 ? 19  GLU B CD  1 
ATOM   781  O OE1 . GLU B 1 22 ? 24.634  3.678   41.922 1.00 48.49 ? 19  GLU B OE1 1 
ATOM   782  O OE2 . GLU B 1 22 ? 25.038  5.166   40.374 1.00 43.13 ? 19  GLU B OE2 1 
ATOM   783  N N   . LYS B 1 23 ? 25.601  10.291  41.978 1.00 22.27 ? 20  LYS B N   1 
ATOM   784  C CA  . LYS B 1 23 ? 26.239  11.476  41.434 1.00 23.28 ? 20  LYS B CA  1 
ATOM   785  C C   . LYS B 1 23 ? 26.280  12.650  42.436 1.00 26.61 ? 20  LYS B C   1 
ATOM   786  O O   . LYS B 1 23 ? 26.890  13.672  42.162 1.00 28.05 ? 20  LYS B O   1 
ATOM   787  C CB  . LYS B 1 23 ? 25.547  11.889  40.140 1.00 26.81 ? 20  LYS B CB  1 
ATOM   788  C CG  . LYS B 1 23 ? 25.580  10.769  39.050 1.00 31.86 ? 20  LYS B CG  1 
ATOM   789  C CD  . LYS B 1 23 ? 26.802  10.817  38.134 1.00 35.81 ? 20  LYS B CD  1 
ATOM   790  C CE  . LYS B 1 23 ? 26.602  9.808   36.991 1.00 32.91 ? 20  LYS B CE  1 
ATOM   791  N NZ  . LYS B 1 23 ? 27.346  10.073  35.726 1.00 39.26 ? 20  LYS B NZ  1 
ATOM   792  N N   . GLY B 1 24 ? 25.631  12.507  43.588 1.00 25.93 ? 21  GLY B N   1 
ATOM   793  C CA  . GLY B 1 24 ? 25.596  13.599  44.545 1.00 28.42 ? 21  GLY B CA  1 
ATOM   794  C C   . GLY B 1 24 ? 24.845  14.842  44.075 1.00 26.31 ? 21  GLY B C   1 
ATOM   795  O O   . GLY B 1 24 ? 25.168  15.979  44.437 1.00 24.46 ? 21  GLY B O   1 
ATOM   796  N N   . MET B 1 25 ? 23.792  14.620  43.297 1.00 21.69 ? 22  MET B N   1 
ATOM   797  C CA  . MET B 1 25 ? 22.999  15.681  42.788 1.00 15.81 ? 22  MET B CA  1 
ATOM   798  C C   . MET B 1 25 ? 21.692  15.839  43.558 1.00 20.58 ? 22  MET B C   1 
ATOM   799  O O   . MET B 1 25 ? 21.057  14.874  43.838 1.00 14.03 ? 22  MET B O   1 
ATOM   800  C CB  . MET B 1 25 ? 22.612  15.405  41.345 1.00 23.76 ? 22  MET B CB  1 
ATOM   801  C CG  . MET B 1 25 ? 23.679  15.822  40.338 1.00 35.11 ? 22  MET B CG  1 
ATOM   802  S SD  . MET B 1 25 ? 23.131  15.211  38.729 1.00 38.67 ? 22  MET B SD  1 
ATOM   803  C CE  . MET B 1 25 ? 21.756  16.279  38.416 1.00 26.86 ? 22  MET B CE  1 
ATOM   804  N N   . THR B 1 26 ? 21.266  17.065  43.766 1.00 20.33 ? 23  THR B N   1 
ATOM   805  C CA  . THR B 1 26 ? 19.935  17.313  44.333 1.00 20.89 ? 23  THR B CA  1 
ATOM   806  C C   . THR B 1 26 ? 18.842  17.160  43.279 1.00 14.37 ? 23  THR B C   1 
ATOM   807  O O   . THR B 1 26 ? 19.126  17.126  42.067 1.00 13.96 ? 23  THR B O   1 
ATOM   808  C CB  . THR B 1 26 ? 19.814  18.718  44.900 1.00 20.12 ? 23  THR B CB  1 
ATOM   809  O OG1 . THR B 1 26 ? 19.881  19.677  43.816 1.00 16.50 ? 23  THR B OG1 1 
ATOM   810  C CG2 . THR B 1 26 ? 20.946  19.016  45.929 1.00 20.82 ? 23  THR B CG2 1 
ATOM   811  N N   . GLN B 1 27 ? 17.611  17.063  43.736 1.00 14.81 ? 24  GLN B N   1 
ATOM   812  C CA  . GLN B 1 27 ? 16.452  17.069  42.822 1.00 14.85 ? 24  GLN B CA  1 
ATOM   813  C C   . GLN B 1 27 ? 16.373  18.388  42.048 1.00 15.29 ? 24  GLN B C   1 
ATOM   814  O O   . GLN B 1 27 ? 16.033  18.372  40.884 1.00 17.49 ? 24  GLN B O   1 
ATOM   815  C CB  . GLN B 1 27 ? 15.181  16.932  43.654 1.00 15.71 ? 24  GLN B CB  1 
ATOM   816  C CG  . GLN B 1 27 ? 15.025  15.472  44.229 1.00 15.82 ? 24  GLN B CG  1 
ATOM   817  C CD  . GLN B 1 27 ? 13.592  15.206  44.754 1.00 16.38 ? 24  GLN B CD  1 
ATOM   818  O OE1 . GLN B 1 27 ? 12.920  16.089  45.220 1.00 19.97 ? 24  GLN B OE1 1 
ATOM   819  N NE2 . GLN B 1 27 ? 13.159  13.966  44.656 1.00 21.75 ? 24  GLN B NE2 1 
ATOM   820  N N   . GLU B 1 28 ? 16.636  19.500  42.724 1.00 16.02 ? 25  GLU B N   1 
ATOM   821  C CA  . GLU B 1 28 ? 16.673  20.823  42.131 1.00 23.05 ? 25  GLU B CA  1 
ATOM   822  C C   . GLU B 1 28 ? 17.702  20.891  40.984 1.00 20.74 ? 25  GLU B C   1 
ATOM   823  O O   . GLU B 1 28 ? 17.443  21.464  39.944 1.00 22.05 ? 25  GLU B O   1 
ATOM   824  C CB  . GLU B 1 28 ? 16.992  21.875  43.219 1.00 24.36 ? 25  GLU B CB  1 
ATOM   825  C CG  . GLU B 1 28 ? 16.204  23.130  43.163 1.00 33.62 ? 25  GLU B CG  1 
ATOM   826  C CD  . GLU B 1 28 ? 16.779  24.222  44.099 1.00 36.87 ? 25  GLU B CD  1 
ATOM   827  O OE1 . GLU B 1 28 ? 16.298  25.359  44.039 1.00 49.02 ? 25  GLU B OE1 1 
ATOM   828  O OE2 . GLU B 1 28 ? 17.720  23.935  44.860 1.00 36.99 ? 25  GLU B OE2 1 
ATOM   829  N N   . ASP B 1 29 ? 18.863  20.313  41.200 1.00 21.53 ? 26  ASP B N   1 
ATOM   830  C CA  . ASP B 1 29 ? 19.910  20.252  40.184 1.00 21.69 ? 26  ASP B CA  1 
ATOM   831  C C   . ASP B 1 29 ? 19.459  19.411  38.981 1.00 24.79 ? 26  ASP B C   1 
ATOM   832  O O   . ASP B 1 29 ? 19.690  19.759  37.825 1.00 24.31 ? 26  ASP B O   1 
ATOM   833  C CB  . ASP B 1 29 ? 21.121  19.575  40.791 1.00 31.09 ? 26  ASP B CB  1 
ATOM   834  C CG  . ASP B 1 29 ? 22.415  19.895  40.063 1.00 48.68 ? 26  ASP B CG  1 
ATOM   835  O OD1 . ASP B 1 29 ? 22.555  21.005  39.494 1.00 55.57 ? 26  ASP B OD1 1 
ATOM   836  O OD2 . ASP B 1 29 ? 23.312  19.019  40.081 1.00 52.39 ? 26  ASP B OD2 1 
ATOM   837  N N   . LEU B 1 30 ? 18.853  18.276  39.265 1.00 18.45 ? 27  LEU B N   1 
ATOM   838  C CA  . LEU B 1 30 ? 18.431  17.395  38.165 1.00 22.44 ? 27  LEU B CA  1 
ATOM   839  C C   . LEU B 1 30 ? 17.341  18.067  37.401 1.00 21.86 ? 27  LEU B C   1 
ATOM   840  O O   . LEU B 1 30 ? 17.326  18.033  36.148 1.00 23.44 ? 27  LEU B O   1 
ATOM   841  C CB  . LEU B 1 30 ? 18.003  16.013  38.659 1.00 19.05 ? 27  LEU B CB  1 
ATOM   842  C CG  . LEU B 1 30 ? 17.475  15.076  37.558 1.00 22.66 ? 27  LEU B CG  1 
ATOM   843  C CD1 . LEU B 1 30 ? 18.592  14.926  36.448 1.00 16.52 ? 27  LEU B CD1 1 
ATOM   844  C CD2 . LEU B 1 30 ? 17.093  13.760  38.256 1.00 16.76 ? 27  LEU B CD2 1 
ATOM   845  N N   . ALA B 1 31 ? 16.425  18.722  38.119 1.00 19.44 ? 28  ALA B N   1 
ATOM   846  C CA  . ALA B 1 31 ? 15.299  19.389  37.473 1.00 23.70 ? 28  ALA B CA  1 
ATOM   847  C C   . ALA B 1 31 ? 15.799  20.413  36.462 1.00 28.60 ? 28  ALA B C   1 
ATOM   848  O O   . ALA B 1 31 ? 15.281  20.535  35.307 1.00 25.50 ? 28  ALA B O   1 
ATOM   849  C CB  . ALA B 1 31 ? 14.421  20.117  38.518 1.00 20.88 ? 28  ALA B CB  1 
ATOM   850  N N   . TYR B 1 32 ? 16.779  21.186  36.917 1.00 24.65 ? 29  TYR B N   1 
ATOM   851  C CA  . TYR B 1 32 ? 17.280  22.299  36.098 1.00 32.07 ? 29  TYR B CA  1 
ATOM   852  C C   . TYR B 1 32 ? 17.955  21.752  34.842 1.00 33.30 ? 29  TYR B C   1 
ATOM   853  O O   . TYR B 1 32 ? 17.667  22.215  33.724 1.00 30.48 ? 29  TYR B O   1 
ATOM   854  C CB  . TYR B 1 32 ? 18.238  23.176  36.886 1.00 37.61 ? 29  TYR B CB  1 
ATOM   855  C CG  . TYR B 1 32 ? 18.694  24.378  36.123 1.00 38.20 ? 29  TYR B CG  1 
ATOM   856  C CD1 . TYR B 1 32 ? 17.781  25.201  35.470 1.00 34.69 ? 29  TYR B CD1 1 
ATOM   857  C CD2 . TYR B 1 32 ? 20.036  24.693  36.029 1.00 43.72 ? 29  TYR B CD2 1 
ATOM   858  C CE1 . TYR B 1 32 ? 18.186  26.289  34.779 1.00 32.51 ? 29  TYR B CE1 1 
ATOM   859  C CE2 . TYR B 1 32 ? 20.443  25.801  35.327 1.00 43.52 ? 29  TYR B CE2 1 
ATOM   860  C CZ  . TYR B 1 32 ? 19.514  26.582  34.699 1.00 40.13 ? 29  TYR B CZ  1 
ATOM   861  O OH  . TYR B 1 32 ? 19.908  27.701  33.997 1.00 52.49 ? 29  TYR B OH  1 
ATOM   862  N N   . LYS B 1 33 ? 18.815  20.745  35.043 1.00 33.98 ? 30  LYS B N   1 
ATOM   863  C CA  . LYS B 1 33 ? 19.594  20.111  33.964 1.00 26.90 ? 30  LYS B CA  1 
ATOM   864  C C   . LYS B 1 33 ? 18.756  19.228  33.056 1.00 23.39 ? 30  LYS B C   1 
ATOM   865  O O   . LYS B 1 33 ? 19.174  18.911  31.935 1.00 31.10 ? 30  LYS B O   1 
ATOM   866  C CB  . LYS B 1 33 ? 20.677  19.232  34.553 1.00 29.85 ? 30  LYS B CB  1 
ATOM   867  C CG  . LYS B 1 33 ? 21.834  19.959  35.149 1.00 32.44 ? 30  LYS B CG  1 
ATOM   868  C CD  . LYS B 1 33 ? 22.994  18.985  35.398 1.00 44.18 ? 30  LYS B CD  1 
ATOM   869  C CE  . LYS B 1 33 ? 24.214  19.686  35.986 1.00 47.55 ? 30  LYS B CE  1 
ATOM   870  N NZ  . LYS B 1 33 ? 24.862  18.811  37.019 1.00 51.32 ? 30  LYS B NZ  1 
ATOM   871  N N   . SER B 1 34 ? 17.573  18.834  33.519 1.00 23.26 ? 31  SER B N   1 
ATOM   872  C CA  A SER B 1 34 ? 16.679  17.923  32.782 0.47 22.34 ? 31  SER B CA  1 
ATOM   873  C CA  B SER B 1 34 ? 16.721  17.932  32.738 0.53 23.38 ? 31  SER B CA  1 
ATOM   874  C C   . SER B 1 34 ? 15.536  18.627  32.076 1.00 24.32 ? 31  SER B C   1 
ATOM   875  O O   . SER B 1 34 ? 14.763  17.971  31.339 1.00 29.73 ? 31  SER B O   1 
ATOM   876  C CB  A SER B 1 34 ? 16.029  16.917  33.731 0.47 16.85 ? 31  SER B CB  1 
ATOM   877  C CB  B SER B 1 34 ? 16.161  16.848  33.637 0.53 18.45 ? 31  SER B CB  1 
ATOM   878  O OG  A SER B 1 34 ? 16.989  16.111  34.377 0.47 13.34 ? 31  SER B OG  1 
ATOM   879  O OG  B SER B 1 34 ? 15.101  17.386  34.394 0.53 17.05 ? 31  SER B OG  1 
ATOM   880  N N   . ASN B 1 35 ? 15.371  19.934  32.347 1.00 25.84 ? 32  ASN B N   1 
ATOM   881  C CA  . ASN B 1 35 ? 14.234  20.697  31.838 1.00 28.08 ? 32  ASN B CA  1 
ATOM   882  C C   . ASN B 1 35 ? 12.876  20.309  32.436 1.00 24.72 ? 32  ASN B C   1 
ATOM   883  O O   . ASN B 1 35 ? 11.854  20.560  31.824 1.00 27.06 ? 32  ASN B O   1 
ATOM   884  C CB  . ASN B 1 35 ? 14.138  20.562  30.310 1.00 31.63 ? 32  ASN B CB  1 
ATOM   885  C CG  . ASN B 1 35 ? 13.897  21.876  29.641 1.00 34.09 ? 32  ASN B CG  1 
ATOM   886  O OD1 . ASN B 1 35 ? 14.393  22.886  30.111 1.00 25.54 ? 32  ASN B OD1 1 
ATOM   887  N ND2 . ASN B 1 35 ? 13.131  21.881  28.539 1.00 26.48 ? 32  ASN B ND2 1 
ATOM   888  N N   . LEU B 1 36 ? 12.870  19.663  33.602 1.00 25.81 ? 33  LEU B N   1 
ATOM   889  C CA  . LEU B 1 36 ? 11.627  19.186  34.228 1.00 23.13 ? 33  LEU B CA  1 
ATOM   890  C C   . LEU B 1 36 ? 11.517  19.824  35.571 1.00 29.03 ? 33  LEU B C   1 
ATOM   891  O O   . LEU B 1 36 ? 12.502  19.833  36.280 1.00 29.40 ? 33  LEU B O   1 
ATOM   892  C CB  . LEU B 1 36 ? 11.727  17.666  34.501 1.00 20.25 ? 33  LEU B CB  1 
ATOM   893  C CG  . LEU B 1 36 ? 12.014  16.865  33.241 1.00 30.55 ? 33  LEU B CG  1 
ATOM   894  C CD1 . LEU B 1 36 ? 11.814  15.385  33.485 1.00 28.37 ? 33  LEU B CD1 1 
ATOM   895  C CD2 . LEU B 1 36 ? 11.112  17.333  32.162 1.00 33.11 ? 33  LEU B CD2 1 
ATOM   896  N N   . ASP B 1 37 ? 10.319  20.243  35.955 1.00 25.74 ? 34  ASP B N   1 
ATOM   897  C CA  . ASP B 1 37 ? 10.092  20.936  37.233 1.00 28.23 ? 34  ASP B CA  1 
ATOM   898  C C   . ASP B 1 37 ? 10.613  20.091  38.394 1.00 22.70 ? 34  ASP B C   1 
ATOM   899  O O   . ASP B 1 37 ? 10.621  18.863  38.319 1.00 21.56 ? 34  ASP B O   1 
ATOM   900  C CB  . ASP B 1 37 ? 8.600   21.140  37.452 1.00 30.84 ? 34  ASP B CB  1 
ATOM   901  C CG  . ASP B 1 37 ? 8.073   22.387  36.765 1.00 42.02 ? 34  ASP B CG  1 
ATOM   902  O OD1 . ASP B 1 37 ? 8.897   23.149  36.214 1.00 48.40 ? 34  ASP B OD1 1 
ATOM   903  O OD2 . ASP B 1 37 ? 6.837   22.611  36.788 1.00 43.18 ? 34  ASP B OD2 1 
ATOM   904  N N   . ARG B 1 38 ? 10.973  20.731  39.502 1.00 23.57 ? 35  ARG B N   1 
ATOM   905  C CA  . ARG B 1 38 ? 11.410  19.956  40.660 1.00 28.46 ? 35  ARG B CA  1 
ATOM   906  C C   . ARG B 1 38 ? 10.210  19.109  41.192 1.00 28.68 ? 35  ARG B C   1 
ATOM   907  O O   . ARG B 1 38 ? 10.392  17.972  41.632 1.00 22.75 ? 35  ARG B O   1 
ATOM   908  C CB  . ARG B 1 38 ? 11.899  20.939  41.737 1.00 29.18 ? 35  ARG B CB  1 
ATOM   909  C CG  . ARG B 1 38 ? 12.833  20.410  42.784 1.00 28.58 ? 35  ARG B CG  1 
ATOM   910  C CD  . ARG B 1 38 ? 13.004  21.568  43.776 1.00 34.80 ? 35  ARG B CD  1 
ATOM   911  N NE  . ARG B 1 38 ? 13.886  21.281  44.888 1.00 44.54 ? 35  ARG B NE  1 
ATOM   912  C CZ  . ARG B 1 38 ? 14.229  22.163  45.819 1.00 42.50 ? 35  ARG B CZ  1 
ATOM   913  N NH1 . ARG B 1 38 ? 13.768  23.413  45.772 1.00 43.09 ? 35  ARG B NH1 1 
ATOM   914  N NH2 . ARG B 1 38 ? 15.037  21.786  46.802 1.00 35.00 ? 35  ARG B NH2 1 
ATOM   915  N N   . THR B 1 39 ? 9.007   19.681  41.144 1.00 27.86 ? 36  THR B N   1 
ATOM   916  C CA  . THR B 1 39 ? 7.760   18.967  41.499 1.00 33.39 ? 36  THR B CA  1 
ATOM   917  C C   . THR B 1 39 ? 7.576   17.683  40.688 1.00 29.73 ? 36  THR B C   1 
ATOM   918  O O   . THR B 1 39 ? 7.253   16.616  41.230 1.00 25.63 ? 36  THR B O   1 
ATOM   919  C CB  . THR B 1 39 ? 6.508   19.841  41.259 1.00 32.22 ? 36  THR B CB  1 
ATOM   920  O OG1 . THR B 1 39 ? 6.638   20.513  40.000 1.00 44.01 ? 36  THR B OG1 1 
ATOM   921  C CG2 . THR B 1 39 ? 6.310   20.838  42.368 1.00 37.67 ? 36  THR B CG2 1 
ATOM   922  N N   . ALA B 1 40 ? 7.816   17.807  39.383 1.00 24.07 ? 37  ALA B N   1 
ATOM   923  C CA  . ALA B 1 40 ? 7.935   16.677  38.484 1.00 20.94 ? 37  ALA B CA  1 
ATOM   924  C C   . ALA B 1 40 ? 8.953   15.589  38.871 1.00 20.14 ? 37  ALA B C   1 
ATOM   925  O O   . ALA B 1 40 ? 8.638   14.384  38.882 1.00 22.04 ? 37  ALA B O   1 
ATOM   926  C CB  . ALA B 1 40 ? 8.219   17.195  37.042 1.00 25.07 ? 37  ALA B CB  1 
ATOM   927  N N   . ILE B 1 41 ? 10.200  15.982  39.161 1.00 16.33 ? 38  ILE B N   1 
ATOM   928  C CA  . ILE B 1 41 ? 11.224  15.055  39.496 1.00 16.09 ? 38  ILE B CA  1 
ATOM   929  C C   . ILE B 1 41 ? 10.816  14.302  40.787 1.00 18.90 ? 38  ILE B C   1 
ATOM   930  O O   . ILE B 1 41 ? 11.010  13.071  40.902 1.00 16.86 ? 38  ILE B O   1 
ATOM   931  C CB  . ILE B 1 41 ? 12.539  15.808  39.762 1.00 17.68 ? 38  ILE B CB  1 
ATOM   932  C CG1 . ILE B 1 41 ? 13.060  16.485  38.488 1.00 19.77 ? 38  ILE B CG1 1 
ATOM   933  C CG2 . ILE B 1 41 ? 13.647  14.851  40.295 1.00 20.74 ? 38  ILE B CG2 1 
ATOM   934  C CD1 . ILE B 1 41 ? 13.613  15.575  37.504 1.00 24.74 ? 38  ILE B CD1 1 
ATOM   935  N N   . SER B 1 42 ? 10.278  15.053  41.720 1.00 18.20 ? 39  SER B N   1 
ATOM   936  C CA  . SER B 1 42 ? 9.949   14.486  43.045 1.00 29.76 ? 39  SER B CA  1 
ATOM   937  C C   . SER B 1 42 ? 8.837   13.455  42.895 1.00 30.17 ? 39  SER B C   1 
ATOM   938  O O   . SER B 1 42 ? 8.888   12.325  43.465 1.00 25.49 ? 39  SER B O   1 
ATOM   939  C CB  . SER B 1 42 ? 9.556   15.602  43.997 1.00 31.81 ? 39  SER B CB  1 
ATOM   940  O OG  . SER B 1 42 ? 9.048   15.099  45.226 1.00 38.26 ? 39  SER B OG  1 
ATOM   941  N N   . GLY B 1 43 ? 7.862   13.807  42.053 1.00 24.76 ? 40  GLY B N   1 
ATOM   942  C CA  . GLY B 1 43 ? 6.770   12.902  41.767 1.00 20.85 ? 40  GLY B CA  1 
ATOM   943  C C   . GLY B 1 43 ? 7.227   11.641  41.052 1.00 25.70 ? 40  GLY B C   1 
ATOM   944  O O   . GLY B 1 43 ? 6.681   10.581  41.333 1.00 25.93 ? 40  GLY B O   1 
ATOM   945  N N   . ILE B 1 44 ? 8.154   11.758  40.083 1.00 23.21 ? 41  ILE B N   1 
ATOM   946  C CA  . ILE B 1 44 ? 8.678   10.598  39.348 1.00 23.52 ? 41  ILE B CA  1 
ATOM   947  C C   . ILE B 1 44 ? 9.404   9.670   40.329 1.00 28.79 ? 41  ILE B C   1 
ATOM   948  O O   . ILE B 1 44 ? 9.294   8.422   40.263 1.00 24.08 ? 41  ILE B O   1 
ATOM   949  C CB  . ILE B 1 44 ? 9.639   11.013  38.214 1.00 22.82 ? 41  ILE B CB  1 
ATOM   950  C CG1 . ILE B 1 44 ? 8.853   11.690  37.077 1.00 19.85 ? 41  ILE B CG1 1 
ATOM   951  C CG2 . ILE B 1 44 ? 10.398  9.827   37.665 1.00 27.32 ? 41  ILE B CG2 1 
ATOM   952  C CD1 . ILE B 1 44 ? 9.676   12.698  36.358 1.00 25.70 ? 41  ILE B CD1 1 
ATOM   953  N N   . GLU B 1 45 ? 10.170  10.270  41.231 1.00 23.70 ? 42  GLU B N   1 
ATOM   954  C CA  . GLU B 1 45 ? 10.876  9.447   42.181 1.00 26.58 ? 42  GLU B CA  1 
ATOM   955  C C   . GLU B 1 45 ? 9.927   8.867   43.218 1.00 36.02 ? 42  GLU B C   1 
ATOM   956  O O   . GLU B 1 45 ? 10.255  7.875   43.856 1.00 33.18 ? 42  GLU B O   1 
ATOM   957  C CB  . GLU B 1 45 ? 11.997  10.258  42.851 1.00 28.76 ? 42  GLU B CB  1 
ATOM   958  C CG  . GLU B 1 45 ? 13.164  10.442  41.917 1.00 29.39 ? 42  GLU B CG  1 
ATOM   959  C CD  . GLU B 1 45 ? 14.304  11.165  42.587 1.00 28.32 ? 42  GLU B CD  1 
ATOM   960  O OE1 . GLU B 1 45 ? 15.392  11.185  41.994 1.00 29.77 ? 42  GLU B OE1 1 
ATOM   961  O OE2 . GLU B 1 45 ? 14.101  11.724  43.680 1.00 34.38 ? 42  GLU B OE2 1 
ATOM   962  N N   . ARG B 1 46 ? 8.768   9.499   43.400 1.00 32.47 ? 43  ARG B N   1 
ATOM   963  C CA  . ARG B 1 46 ? 7.835   9.090   44.449 1.00 43.38 ? 43  ARG B CA  1 
ATOM   964  C C   . ARG B 1 46 ? 6.811   8.168   43.845 1.00 48.48 ? 43  ARG B C   1 
ATOM   965  O O   . ARG B 1 46 ? 5.818   7.818   44.492 1.00 47.15 ? 43  ARG B O   1 
ATOM   966  C CB  . ARG B 1 46 ? 7.112   10.287  45.069 1.00 49.96 ? 43  ARG B CB  1 
ATOM   967  C CG  . ARG B 1 46 ? 7.201   10.379  46.579 1.00 54.82 ? 43  ARG B CG  1 
ATOM   968  C CD  . ARG B 1 46 ? 6.312   11.508  47.138 1.00 56.77 ? 43  ARG B CD  1 
ATOM   969  N NE  . ARG B 1 46 ? 6.585   12.806  46.512 1.00 56.21 ? 43  ARG B NE  1 
ATOM   970  C CZ  . ARG B 1 46 ? 5.745   13.454  45.702 1.00 59.10 ? 43  ARG B CZ  1 
ATOM   971  N NH1 . ARG B 1 46 ? 4.553   12.934  45.401 1.00 63.70 ? 43  ARG B NH1 1 
ATOM   972  N NH2 . ARG B 1 46 ? 6.099   14.622  45.180 1.00 54.55 ? 43  ARG B NH2 1 
ATOM   973  N N   . ASN B 1 47 ? 7.041   7.804   42.587 1.00 44.98 ? 44  ASN B N   1 
ATOM   974  C CA  . ASN B 1 47 ? 6.168   6.881   41.891 1.00 48.72 ? 44  ASN B CA  1 
ATOM   975  C C   . ASN B 1 47 ? 4.754   7.428   41.671 1.00 50.62 ? 44  ASN B C   1 
ATOM   976  O O   . ASN B 1 47 ? 3.908   6.759   41.106 1.00 50.78 ? 44  ASN B O   1 
ATOM   977  C CB  . ASN B 1 47 ? 6.173   5.521   42.604 1.00 51.24 ? 44  ASN B CB  1 
ATOM   978  C CG  . ASN B 1 47 ? 7.431   4.725   42.308 1.00 50.71 ? 44  ASN B CG  1 
ATOM   979  O OD1 . ASN B 1 47 ? 7.751   4.483   41.143 1.00 45.07 ? 44  ASN B OD1 1 
ATOM   980  N ND2 . ASN B 1 47 ? 8.159   4.324   43.358 1.00 52.33 ? 44  ASN B ND2 1 
ATOM   981  N N   . SER B 1 48 ? 4.530   8.668   42.094 1.00 54.68 ? 45  SER B N   1 
ATOM   982  C CA  . SER B 1 48 ? 3.243   9.330   41.946 1.00 58.44 ? 45  SER B CA  1 
ATOM   983  C C   . SER B 1 48 ? 3.117   10.046  40.595 1.00 59.23 ? 45  SER B C   1 
ATOM   984  O O   . SER B 1 48 ? 2.322   10.975  40.450 1.00 62.95 ? 45  SER B O   1 
ATOM   985  C CB  . SER B 1 48 ? 3.030   10.333  43.090 1.00 56.83 ? 45  SER B CB  1 
ATOM   986  O OG  . SER B 1 48 ? 3.692   11.559  42.826 1.00 54.03 ? 45  SER B OG  1 
ATOM   987  N N   . ARG B 1 49 ? 3.881   9.617   39.598 1.00 58.93 ? 46  ARG B N   1 
ATOM   988  C CA  . ARG B 1 49 ? 3.878   10.337  38.327 1.00 55.36 ? 46  ARG B CA  1 
ATOM   989  C C   . ARG B 1 49 ? 4.453   9.537   37.170 1.00 48.33 ? 46  ARG B C   1 
ATOM   990  O O   . ARG B 1 49 ? 5.573   9.059   37.260 1.00 49.65 ? 46  ARG B O   1 
ATOM   991  C CB  . ARG B 1 49 ? 4.683   11.629  38.486 1.00 57.56 ? 46  ARG B CB  1 
ATOM   992  C CG  . ARG B 1 49 ? 4.576   12.599  37.328 1.00 58.06 ? 46  ARG B CG  1 
ATOM   993  C CD  . ARG B 1 49 ? 5.486   13.789  37.551 1.00 56.28 ? 46  ARG B CD  1 
ATOM   994  N NE  . ARG B 1 49 ? 4.987   14.990  36.892 1.00 59.22 ? 46  ARG B NE  1 
ATOM   995  C CZ  . ARG B 1 49 ? 4.293   15.950  37.501 1.00 65.84 ? 46  ARG B CZ  1 
ATOM   996  N NH1 . ARG B 1 49 ? 4.011   15.857  38.798 1.00 66.79 ? 46  ARG B NH1 1 
ATOM   997  N NH2 . ARG B 1 49 ? 3.885   17.011  36.813 1.00 67.91 ? 46  ARG B NH2 1 
ATOM   998  N N   . ASN B 1 50 ? 3.703   9.410   36.076 1.00 45.59 ? 47  ASN B N   1 
ATOM   999  C CA  A ASN B 1 50 ? 4.219   8.804   34.838 0.73 42.11 ? 47  ASN B CA  1 
ATOM   1000 C CA  B ASN B 1 50 ? 4.259   8.798   34.880 0.27 42.16 ? 47  ASN B CA  1 
ATOM   1001 C C   . ASN B 1 50 ? 5.318   9.708   34.264 1.00 41.00 ? 47  ASN B C   1 
ATOM   1002 O O   . ASN B 1 50 ? 5.634   10.774  34.808 1.00 48.58 ? 47  ASN B O   1 
ATOM   1003 C CB  A ASN B 1 50 ? 3.114   8.652   33.790 0.73 39.03 ? 47  ASN B CB  1 
ATOM   1004 C CB  B ASN B 1 50 ? 3.170   8.438   33.872 0.27 39.05 ? 47  ASN B CB  1 
ATOM   1005 C CG  A ASN B 1 50 ? 3.115   7.274   33.058 0.73 36.32 ? 47  ASN B CG  1 
ATOM   1006 C CG  B ASN B 1 50 ? 2.162   9.550   33.676 0.27 34.79 ? 47  ASN B CG  1 
ATOM   1007 O OD1 A ASN B 1 50 ? 4.078   6.492   33.076 0.73 25.16 ? 47  ASN B OD1 1 
ATOM   1008 O OD1 B ASN B 1 50 ? 2.522   10.720  33.572 0.27 30.80 ? 47  ASN B OD1 1 
ATOM   1009 N ND2 A ASN B 1 50 ? 2.002   7.006   32.378 0.73 39.11 ? 47  ASN B ND2 1 
ATOM   1010 N ND2 B ASN B 1 50 ? 0.886   9.185   33.625 0.27 33.71 ? 47  ASN B ND2 1 
ATOM   1011 N N   . LEU B 1 51 ? 5.858   9.287   33.142 1.00 22.68 ? 48  LEU B N   1 
ATOM   1012 C CA  . LEU B 1 51 ? 7.042   9.904   32.546 1.00 25.73 ? 48  LEU B CA  1 
ATOM   1013 C C   . LEU B 1 51 ? 7.005   9.492   31.089 1.00 25.56 ? 48  LEU B C   1 
ATOM   1014 O O   . LEU B 1 51 ? 6.749   8.333   30.811 1.00 26.34 ? 48  LEU B O   1 
ATOM   1015 C CB  . LEU B 1 51 ? 8.301   9.260   33.147 1.00 30.39 ? 48  LEU B CB  1 
ATOM   1016 C CG  . LEU B 1 51 ? 9.688   9.706   32.691 1.00 29.40 ? 48  LEU B CG  1 
ATOM   1017 C CD1 . LEU B 1 51 ? 9.944   11.074  33.207 1.00 36.55 ? 48  LEU B CD1 1 
ATOM   1018 C CD2 . LEU B 1 51 ? 10.784  8.778   33.152 1.00 31.59 ? 48  LEU B CD2 1 
ATOM   1019 N N   . THR B 1 52 ? 7.317   10.406  30.169 1.00 24.53 ? 49  THR B N   1 
ATOM   1020 C CA  . THR B 1 52 ? 7.413   10.007  28.751 1.00 20.49 ? 49  THR B CA  1 
ATOM   1021 C C   . THR B 1 52 ? 8.848   9.619   28.456 1.00 21.31 ? 49  THR B C   1 
ATOM   1022 O O   . THR B 1 52 ? 9.749   9.850   29.236 1.00 21.72 ? 49  THR B O   1 
ATOM   1023 C CB  . THR B 1 52 ? 6.960   11.141  27.748 1.00 17.62 ? 49  THR B CB  1 
ATOM   1024 O OG1 . THR B 1 52 ? 7.783   12.252  27.942 1.00 18.97 ? 49  THR B OG1 1 
ATOM   1025 C CG2 . THR B 1 52 ? 5.527   11.615  28.027 1.00 18.41 ? 49  THR B CG2 1 
ATOM   1026 N N   . ILE B 1 53 ? 9.051   8.976   27.321 1.00 17.22 ? 50  ILE B N   1 
ATOM   1027 C CA  . ILE B 1 53 ? 10.354  8.550   26.917 1.00 16.41 ? 50  ILE B CA  1 
ATOM   1028 C C   . ILE B 1 53 ? 11.181  9.769   26.666 1.00 13.90 ? 50  ILE B C   1 
ATOM   1029 O O   . ILE B 1 53 ? 12.342  9.771   26.911 1.00 20.94 ? 50  ILE B O   1 
ATOM   1030 C CB  . ILE B 1 53 ? 10.229  7.802   25.533 1.00 21.11 ? 50  ILE B CB  1 
ATOM   1031 C CG1 . ILE B 1 53 ? 9.251   6.632   25.633 1.00 24.81 ? 50  ILE B CG1 1 
ATOM   1032 C CG2 . ILE B 1 53 ? 11.608  7.395   24.993 1.00 18.33 ? 50  ILE B CG2 1 
ATOM   1033 C CD1 . ILE B 1 53 ? 9.552   5.608   26.683 1.00 20.83 ? 50  ILE B CD1 1 
ATOM   1034 N N   . LYS B 1 54 ? 10.594  10.793  26.067 1.00 17.05 ? 51  LYS B N   1 
ATOM   1035 C CA  . LYS B 1 54 ? 11.361  12.044  25.874 1.00 18.73 ? 51  LYS B CA  1 
ATOM   1036 C C   . LYS B 1 54 ? 11.769  12.650  27.208 1.00 20.12 ? 51  LYS B C   1 
ATOM   1037 O O   . LYS B 1 54 ? 12.848  13.180  27.378 1.00 15.55 ? 51  LYS B O   1 
ATOM   1038 C CB  . LYS B 1 54 ? 10.584  13.065  25.075 1.00 23.74 ? 51  LYS B CB  1 
ATOM   1039 C CG  . LYS B 1 54 ? 11.468  14.240  24.659 1.00 39.15 ? 51  LYS B CG  1 
ATOM   1040 C CD  . LYS B 1 54 ? 10.735  15.574  24.672 1.00 49.33 ? 51  LYS B CD  1 
ATOM   1041 C CE  . LYS B 1 54 ? 11.726  16.753  24.613 1.00 47.38 ? 51  LYS B CE  1 
ATOM   1042 N NZ  . LYS B 1 54 ? 12.966  16.411  23.834 1.00 47.71 ? 51  LYS B NZ  1 
ATOM   1043 N N   . SER B 1 55 ? 10.870  12.602  28.164 1.00 17.30 ? 52  SER B N   1 
ATOM   1044 C CA  . SER B 1 55 ? 11.243  13.021  29.523 1.00 17.34 ? 52  SER B CA  1 
ATOM   1045 C C   . SER B 1 55 ? 12.344  12.228  30.112 1.00 12.54 ? 52  SER B C   1 
ATOM   1046 O O   . SER B 1 55 ? 13.258  12.790  30.719 1.00 13.07 ? 52  SER B O   1 
ATOM   1047 C CB  . SER B 1 55 ? 9.965   12.972  30.411 1.00 14.74 ? 52  SER B CB  1 
ATOM   1048 O OG  . SER B 1 55 ? 9.330   14.224  30.254 1.00 20.96 ? 52  SER B OG  1 
ATOM   1049 N N   . LEU B 1 56 ? 12.301  10.903  29.937 1.00 13.11 ? 53  LEU B N   1 
ATOM   1050 C CA  . LEU B 1 56 ? 13.345  10.006  30.424 1.00 13.41 ? 53  LEU B CA  1 
ATOM   1051 C C   . LEU B 1 56 ? 14.657  10.296  29.689 1.00 13.83 ? 53  LEU B C   1 
ATOM   1052 O O   . LEU B 1 56 ? 15.741  10.350  30.273 1.00 11.65 ? 53  LEU B O   1 
ATOM   1053 C CB  . LEU B 1 56 ? 12.919  8.535   30.172 1.00 13.53 ? 53  LEU B CB  1 
ATOM   1054 C CG  . LEU B 1 56 ? 13.939  7.485   30.609 1.00 18.89 ? 53  LEU B CG  1 
ATOM   1055 C CD1 . LEU B 1 56 ? 14.174  7.560   32.137 1.00 19.55 ? 53  LEU B CD1 1 
ATOM   1056 C CD2 . LEU B 1 56 ? 13.455  6.094   30.185 1.00 20.79 ? 53  LEU B CD2 1 
ATOM   1057 N N   . GLU B 1 57 ? 14.554  10.581  28.403 1.00 12.48 ? 54  GLU B N   1 
ATOM   1058 C CA  . GLU B 1 57 ? 15.758  10.990  27.684 1.00 12.24 ? 54  GLU B CA  1 
ATOM   1059 C C   . GLU B 1 57 ? 16.453  12.228  28.303 1.00 16.72 ? 54  GLU B C   1 
ATOM   1060 O O   . GLU B 1 57 ? 17.680  12.275  28.512 1.00 15.40 ? 54  GLU B O   1 
ATOM   1061 C CB  . GLU B 1 57 ? 15.374  11.310  26.236 1.00 20.23 ? 54  GLU B CB  1 
ATOM   1062 C CG  . GLU B 1 57 ? 16.538  11.588  25.374 1.00 26.78 ? 54  GLU B CG  1 
ATOM   1063 C CD  . GLU B 1 57 ? 16.176  11.520  23.908 1.00 41.80 ? 54  GLU B CD  1 
ATOM   1064 O OE1 . GLU B 1 57 ? 15.305  12.307  23.461 1.00 46.94 ? 54  GLU B OE1 1 
ATOM   1065 O OE2 . GLU B 1 57 ? 16.752  10.664  23.204 1.00 42.65 ? 54  GLU B OE2 1 
ATOM   1066 N N   . LEU B 1 58 ? 15.662  13.245  28.573 1.00 15.34 ? 55  LEU B N   1 
ATOM   1067 C CA  . LEU B 1 58 ? 16.178  14.520  29.113 1.00 17.25 ? 55  LEU B CA  1 
ATOM   1068 C C   . LEU B 1 58 ? 16.761  14.261  30.526 1.00 16.81 ? 55  LEU B C   1 
ATOM   1069 O O   . LEU B 1 58 ? 17.749  14.861  30.941 1.00 14.71 ? 55  LEU B O   1 
ATOM   1070 C CB  . LEU B 1 58 ? 14.982  15.419  29.266 1.00 18.70 ? 55  LEU B CB  1 
ATOM   1071 C CG  . LEU B 1 58 ? 14.493  16.142  28.031 1.00 20.82 ? 55  LEU B CG  1 
ATOM   1072 C CD1 . LEU B 1 58 ? 13.285  16.999  28.396 1.00 25.45 ? 55  LEU B CD1 1 
ATOM   1073 C CD2 . LEU B 1 58 ? 15.673  17.015  27.584 1.00 27.27 ? 55  LEU B CD2 1 
ATOM   1074 N N   . ILE B 1 59 ? 16.091  13.407  31.289 1.00 12.63 ? 56  ILE B N   1 
ATOM   1075 C CA  . ILE B 1 59 ? 16.705  12.970  32.595 1.00 12.58 ? 56  ILE B CA  1 
ATOM   1076 C C   . ILE B 1 59 ? 18.039  12.300  32.507 1.00 17.76 ? 56  ILE B C   1 
ATOM   1077 O O   . ILE B 1 59 ? 18.919  12.556  33.308 1.00 16.62 ? 56  ILE B O   1 
ATOM   1078 C CB  . ILE B 1 59 ? 15.685  12.135  33.400 1.00 15.55 ? 56  ILE B CB  1 
ATOM   1079 C CG1 . ILE B 1 59 ? 14.557  13.070  33.799 1.00 15.13 ? 56  ILE B CG1 1 
ATOM   1080 C CG2 . ILE B 1 59 ? 16.365  11.395  34.544 1.00 15.85 ? 56  ILE B CG2 1 
ATOM   1081 C CD1 . ILE B 1 59 ? 13.364  12.338  34.538 1.00 25.71 ? 56  ILE B CD1 1 
ATOM   1082 N N   . MET B 1 60 ? 18.203  11.404  31.525 1.00 15.57 ? 57  MET B N   1 
ATOM   1083 C CA  A MET B 1 60 ? 19.498  10.798  31.330 0.55 15.34 ? 57  MET B CA  1 
ATOM   1084 C CA  B MET B 1 60 ? 19.477  10.774  31.194 0.45 16.01 ? 57  MET B CA  1 
ATOM   1085 C C   . MET B 1 60 ? 20.548  11.830  30.991 1.00 14.00 ? 57  MET B C   1 
ATOM   1086 O O   . MET B 1 60 ? 21.605  11.811  31.593 1.00 16.75 ? 57  MET B O   1 
ATOM   1087 C CB  A MET B 1 60 ? 19.453  9.712   30.271 0.55 18.19 ? 57  MET B CB  1 
ATOM   1088 C CB  B MET B 1 60 ? 19.338  9.959   29.885 0.45 17.34 ? 57  MET B CB  1 
ATOM   1089 C CG  A MET B 1 60 ? 18.478  8.652   30.649 0.55 10.91 ? 57  MET B CG  1 
ATOM   1090 C CG  B MET B 1 60 ? 18.667  8.582   30.052 0.45 16.03 ? 57  MET B CG  1 
ATOM   1091 S SD  A MET B 1 60 ? 18.592  7.332   29.479 0.55 14.86 ? 57  MET B SD  1 
ATOM   1092 S SD  B MET B 1 60 ? 17.759  7.942   28.579 0.45 13.52 ? 57  MET B SD  1 
ATOM   1093 C CE  A MET B 1 60 ? 18.684  8.285   27.945 0.55 11.58 ? 57  MET B CE  1 
ATOM   1094 C CE  B MET B 1 60 ? 17.563  6.251   29.187 0.45 10.44 ? 57  MET B CE  1 
ATOM   1095 N N   . LYS B 1 61 ? 20.248  12.740  30.097 1.00 15.35 ? 58  LYS B N   1 
ATOM   1096 C CA  . LYS B 1 61 ? 21.165  13.847  29.819 1.00 22.17 ? 58  LYS B CA  1 
ATOM   1097 C C   . LYS B 1 61 ? 21.481  14.649  31.102 1.00 22.13 ? 58  LYS B C   1 
ATOM   1098 O O   . LYS B 1 61 ? 22.625  15.021  31.337 1.00 25.59 ? 58  LYS B O   1 
ATOM   1099 C CB  . LYS B 1 61 ? 20.586  14.751  28.740 1.00 24.92 ? 58  LYS B CB  1 
ATOM   1100 C CG  . LYS B 1 61 ? 20.502  14.037  27.357 1.00 37.32 ? 58  LYS B CG  1 
ATOM   1101 C CD  . LYS B 1 61 ? 20.043  14.985  26.255 1.00 38.91 ? 58  LYS B CD  1 
ATOM   1102 C CE  . LYS B 1 61 ? 20.306  14.391  24.869 1.00 38.68 ? 58  LYS B CE  1 
ATOM   1103 N NZ  . LYS B 1 61 ? 19.893  15.401  23.867 1.00 40.21 ? 58  LYS B NZ  1 
ATOM   1104 N N   . GLY B 1 62 ? 20.455  14.895  31.904 1.00 21.35 ? 59  GLY B N   1 
ATOM   1105 C CA  . GLY B 1 62 ? 20.606  15.633  33.156 1.00 16.62 ? 59  GLY B CA  1 
ATOM   1106 C C   . GLY B 1 62 ? 21.414  14.832  34.167 1.00 23.32 ? 59  GLY B C   1 
ATOM   1107 O O   . GLY B 1 62 ? 22.186  15.413  34.931 1.00 31.48 ? 59  GLY B O   1 
ATOM   1108 N N   . LEU B 1 63 ? 21.251  13.510  34.204 1.00 20.84 ? 60  LEU B N   1 
ATOM   1109 C CA  . LEU B 1 63 ? 22.184  12.667  34.995 1.00 19.70 ? 60  LEU B CA  1 
ATOM   1110 C C   . LEU B 1 63 ? 23.595  12.494  34.327 1.00 29.13 ? 60  LEU B C   1 
ATOM   1111 O O   . LEU B 1 63 ? 24.552  12.051  34.976 1.00 30.78 ? 60  LEU B O   1 
ATOM   1112 C CB  . LEU B 1 63 ? 21.542  11.312  35.280 1.00 20.60 ? 60  LEU B CB  1 
ATOM   1113 C CG  . LEU B 1 63 ? 20.239  11.474  36.099 1.00 23.43 ? 60  LEU B CG  1 
ATOM   1114 C CD1 . LEU B 1 63 ? 19.383  10.253  35.952 1.00 23.55 ? 60  LEU B CD1 1 
ATOM   1115 C CD2 . LEU B 1 63 ? 20.520  11.696  37.589 1.00 20.11 ? 60  LEU B CD2 1 
ATOM   1116 N N   . GLU B 1 64 ? 23.731  12.879  33.058 1.00 20.03 ? 61  GLU B N   1 
ATOM   1117 C CA  . GLU B 1 64 ? 24.973  12.604  32.321 1.00 23.64 ? 61  GLU B CA  1 
ATOM   1118 C C   . GLU B 1 64 ? 25.318  11.109  32.314 1.00 26.24 ? 61  GLU B C   1 
ATOM   1119 O O   . GLU B 1 64 ? 26.492  10.711  32.525 1.00 23.79 ? 61  GLU B O   1 
ATOM   1120 C CB  . GLU B 1 64 ? 26.155  13.406  32.903 1.00 32.37 ? 61  GLU B CB  1 
ATOM   1121 C CG  . GLU B 1 64 ? 26.282  14.818  32.337 1.00 42.61 ? 61  GLU B CG  1 
ATOM   1122 C CD  . GLU B 1 64 ? 27.479  15.598  32.905 1.00 48.93 ? 61  GLU B CD  1 
ATOM   1123 O OE1 . GLU B 1 64 ? 28.174  15.085  33.815 1.00 50.65 ? 61  GLU B OE1 1 
ATOM   1124 O OE2 . GLU B 1 64 ? 27.718  16.734  32.433 1.00 51.81 ? 61  GLU B OE2 1 
ATOM   1125 N N   . VAL B 1 65 ? 24.304  10.288  32.065 1.00 21.54 ? 62  VAL B N   1 
ATOM   1126 C CA  . VAL B 1 65 ? 24.524  8.867   31.835 1.00 20.67 ? 62  VAL B CA  1 
ATOM   1127 C C   . VAL B 1 65 ? 23.978  8.503   30.477 1.00 20.84 ? 62  VAL B C   1 
ATOM   1128 O O   . VAL B 1 65 ? 22.976  9.060   30.074 1.00 20.71 ? 62  VAL B O   1 
ATOM   1129 C CB  . VAL B 1 65 ? 23.881  7.997   32.932 1.00 25.31 ? 62  VAL B CB  1 
ATOM   1130 C CG1 . VAL B 1 65 ? 24.435  8.449   34.293 1.00 31.32 ? 62  VAL B CG1 1 
ATOM   1131 C CG2 . VAL B 1 65 ? 22.302  8.068   32.925 1.00 25.09 ? 62  VAL B CG2 1 
ATOM   1132 N N   . SER B 1 66 ? 24.629  7.557   29.804 1.00 19.85 ? 63  SER B N   1 
ATOM   1133 C CA  . SER B 1 66 ? 24.155  7.082   28.501 1.00 21.73 ? 63  SER B CA  1 
ATOM   1134 C C   . SER B 1 66 ? 22.884  6.277   28.663 1.00 22.27 ? 63  SER B C   1 
ATOM   1135 O O   . SER B 1 66 ? 22.677  5.648   29.690 1.00 20.32 ? 63  SER B O   1 
ATOM   1136 C CB  . SER B 1 66 ? 25.237  6.235   27.793 1.00 27.49 ? 63  SER B CB  1 
ATOM   1137 O OG  . SER B 1 66 ? 25.486  4.979   28.465 1.00 22.74 ? 63  SER B OG  1 
ATOM   1138 N N   . ASP B 1 67 ? 22.042  6.243   27.628 1.00 19.14 ? 64  ASP B N   1 
ATOM   1139 C CA  . ASP B 1 67 ? 20.836  5.460   27.708 1.00 20.45 ? 64  ASP B CA  1 
ATOM   1140 C C   . ASP B 1 67 ? 21.127  3.990   27.928 1.00 23.91 ? 64  ASP B C   1 
ATOM   1141 O O   . ASP B 1 67 ? 20.391  3.332   28.665 1.00 18.92 ? 64  ASP B O   1 
ATOM   1142 C CB  . ASP B 1 67 ? 19.952  5.618   26.456 1.00 30.01 ? 64  ASP B CB  1 
ATOM   1143 C CG  . ASP B 1 67 ? 20.743  5.670   25.157 1.00 33.08 ? 64  ASP B CG  1 
ATOM   1144 O OD1 . ASP B 1 67 ? 21.964  5.381   25.126 1.00 37.25 ? 64  ASP B OD1 1 
ATOM   1145 O OD2 . ASP B 1 67 ? 20.117  6.037   24.138 1.00 38.39 ? 64  ASP B OD2 1 
ATOM   1146 N N   . VAL B 1 68 ? 22.169  3.496   27.252 1.00 23.67 ? 65  VAL B N   1 
ATOM   1147 C CA  . VAL B 1 68 ? 22.638  2.103   27.381 1.00 21.47 ? 65  VAL B CA  1 
ATOM   1148 C C   . VAL B 1 68 ? 23.002  1.776   28.824 1.00 22.03 ? 65  VAL B C   1 
ATOM   1149 O O   . VAL B 1 68 ? 22.538  0.769   29.386 1.00 22.19 ? 65  VAL B O   1 
ATOM   1150 C CB  . VAL B 1 68 ? 23.862  1.945   26.493 1.00 21.90 ? 65  VAL B CB  1 
ATOM   1151 C CG1 . VAL B 1 68 ? 24.832  0.844   26.906 1.00 22.04 ? 65  VAL B CG1 1 
ATOM   1152 C CG2 . VAL B 1 68 ? 23.424  1.852   25.015 1.00 18.60 ? 65  VAL B CG2 1 
ATOM   1153 N N   . VAL B 1 69 ? 23.794  2.652   29.443 1.00 16.44 ? 66  VAL B N   1 
ATOM   1154 C CA  . VAL B 1 69 ? 24.120  2.438   30.862 1.00 17.90 ? 66  VAL B CA  1 
ATOM   1155 C C   . VAL B 1 69 ? 22.876  2.474   31.733 1.00 17.44 ? 66  VAL B C   1 
ATOM   1156 O O   . VAL B 1 69 ? 22.678  1.569   32.564 1.00 16.19 ? 66  VAL B O   1 
ATOM   1157 C CB  . VAL B 1 69 ? 25.171  3.435   31.355 1.00 25.48 ? 66  VAL B CB  1 
ATOM   1158 C CG1 . VAL B 1 69 ? 25.324  3.349   32.870 1.00 25.67 ? 66  VAL B CG1 1 
ATOM   1159 C CG2 . VAL B 1 69 ? 26.504  3.086   30.684 1.00 24.93 ? 66  VAL B CG2 1 
ATOM   1160 N N   . PHE B 1 70 ? 22.025  3.484   31.543 1.00 15.71 ? 67  PHE B N   1 
ATOM   1161 C CA  . PHE B 1 70 ? 20.693  3.491   32.198 1.00 13.63 ? 67  PHE B CA  1 
ATOM   1162 C C   . PHE B 1 70 ? 19.899  2.211   32.082 1.00 14.06 ? 67  PHE B C   1 
ATOM   1163 O O   . PHE B 1 70 ? 19.316  1.691   33.111 1.00 11.09 ? 67  PHE B O   1 
ATOM   1164 C CB  . PHE B 1 70 ? 19.813  4.670   31.750 1.00 14.42 ? 67  PHE B CB  1 
ATOM   1165 C CG  . PHE B 1 70 ? 18.569  4.851   32.567 1.00 15.83 ? 67  PHE B CG  1 
ATOM   1166 C CD1 . PHE B 1 70 ? 17.360  4.184   32.234 1.00 14.41 ? 67  PHE B CD1 1 
ATOM   1167 C CD2 . PHE B 1 70 ? 18.575  5.717   33.700 1.00 14.03 ? 67  PHE B CD2 1 
ATOM   1168 C CE1 . PHE B 1 70 ? 16.200  4.339   33.032 1.00 12.89 ? 67  PHE B CE1 1 
ATOM   1169 C CE2 . PHE B 1 70 ? 17.425  5.916   34.476 1.00 13.41 ? 67  PHE B CE2 1 
ATOM   1170 C CZ  . PHE B 1 70 ? 16.233  5.234   34.163 1.00 16.42 ? 67  PHE B CZ  1 
ATOM   1171 N N   . PHE B 1 71 ? 19.720  1.756   30.850 1.00 16.53 ? 68  PHE B N   1 
ATOM   1172 C CA  . PHE B 1 71 ? 18.922  0.535   30.623 1.00 17.73 ? 68  PHE B CA  1 
ATOM   1173 C C   . PHE B 1 71 ? 19.592  -0.715  31.166 1.00 17.53 ? 68  PHE B C   1 
ATOM   1174 O O   . PHE B 1 71 ? 18.946  -1.703  31.589 1.00 16.96 ? 68  PHE B O   1 
ATOM   1175 C CB  . PHE B 1 71 ? 18.584  0.388   29.121 1.00 16.77 ? 68  PHE B CB  1 
ATOM   1176 C CG  . PHE B 1 71 ? 17.623  1.471   28.624 1.00 20.19 ? 68  PHE B CG  1 
ATOM   1177 C CD1 . PHE B 1 71 ? 16.436  1.734   29.292 1.00 25.75 ? 68  PHE B CD1 1 
ATOM   1178 C CD2 . PHE B 1 71 ? 17.905  2.176   27.456 1.00 29.57 ? 68  PHE B CD2 1 
ATOM   1179 C CE1 . PHE B 1 71 ? 15.527  2.746   28.851 1.00 24.57 ? 68  PHE B CE1 1 
ATOM   1180 C CE2 . PHE B 1 71 ? 17.028  3.186   27.007 1.00 30.01 ? 68  PHE B CE2 1 
ATOM   1181 C CZ  . PHE B 1 71 ? 15.843  3.454   27.706 1.00 30.68 ? 68  PHE B CZ  1 
ATOM   1182 N N   . GLU B 1 72 ? 20.897  -0.713  31.150 1.00 14.68 ? 69  GLU B N   1 
ATOM   1183 C CA  . GLU B 1 72 ? 21.622  -1.840  31.739 1.00 17.48 ? 69  GLU B CA  1 
ATOM   1184 C C   . GLU B 1 72 ? 21.451  -1.841  33.252 1.00 15.12 ? 69  GLU B C   1 
ATOM   1185 O O   . GLU B 1 72 ? 21.310  -2.894  33.900 1.00 15.17 ? 69  GLU B O   1 
ATOM   1186 C CB  . GLU B 1 72 ? 23.109  -1.699  31.411 1.00 19.07 ? 69  GLU B CB  1 
ATOM   1187 C CG  . GLU B 1 72 ? 23.370  -2.434  30.170 1.00 24.78 ? 69  GLU B CG  1 
ATOM   1188 C CD  . GLU B 1 72 ? 24.596  -1.940  29.455 1.00 29.51 ? 69  GLU B CD  1 
ATOM   1189 O OE1 . GLU B 1 72 ? 25.441  -1.282  30.064 1.00 31.31 ? 69  GLU B OE1 1 
ATOM   1190 O OE2 . GLU B 1 72 ? 24.673  -2.221  28.254 1.00 27.36 ? 69  GLU B OE2 1 
ATOM   1191 N N   . MET B 1 73 ? 21.430  -0.662  33.810 1.00 13.46 ? 70  MET B N   1 
ATOM   1192 C CA  . MET B 1 73 ? 21.172  -0.605  35.271 1.00 15.04 ? 70  MET B CA  1 
ATOM   1193 C C   . MET B 1 73 ? 19.711  -1.033  35.578 1.00 14.81 ? 70  MET B C   1 
ATOM   1194 O O   . MET B 1 73 ? 19.435  -1.644  36.611 1.00 19.70 ? 70  MET B O   1 
ATOM   1195 C CB  . MET B 1 73 ? 21.440  0.800   35.830 1.00 18.60 ? 70  MET B CB  1 
ATOM   1196 C CG  . MET B 1 73 ? 22.945  1.113   35.929 1.00 24.01 ? 70  MET B CG  1 
ATOM   1197 S SD  . MET B 1 73 ? 23.190  2.889   36.277 1.00 35.03 ? 70  MET B SD  1 
ATOM   1198 C CE  . MET B 1 73 ? 24.981  2.882   36.337 1.00 30.55 ? 70  MET B CE  1 
ATOM   1199 N N   . LEU B 1 74 ? 18.782  -0.663  34.706 1.00 12.93 ? 71  LEU B N   1 
ATOM   1200 C CA  . LEU B 1 74 ? 17.407  -1.022  34.916 1.00 13.96 ? 71  LEU B CA  1 
ATOM   1201 C C   . LEU B 1 74 ? 17.303  -2.545  34.807 1.00 14.11 ? 71  LEU B C   1 
ATOM   1202 O O   . LEU B 1 74 ? 16.602  -3.168  35.578 1.00 13.18 ? 71  LEU B O   1 
ATOM   1203 C CB  . LEU B 1 74 ? 16.506  -0.317  33.872 1.00 11.11 ? 71  LEU B CB  1 
ATOM   1204 C CG  . LEU B 1 74 ? 15.006  -0.709  33.844 1.00 11.04 ? 71  LEU B CG  1 
ATOM   1205 C CD1 . LEU B 1 74 ? 14.417  -0.281  35.131 1.00 15.11 ? 71  LEU B CD1 1 
ATOM   1206 C CD2 . LEU B 1 74 ? 14.320  0.046   32.662 1.00 19.34 ? 71  LEU B CD2 1 
ATOM   1207 N N   . ILE B 1 75 ? 17.939  -3.131  33.794 1.00 12.77 ? 72  ILE B N   1 
ATOM   1208 C CA  . ILE B 1 75 ? 17.918  -4.628  33.645 1.00 13.61 ? 72  ILE B CA  1 
ATOM   1209 C C   . ILE B 1 75 ? 18.486  -5.386  34.861 1.00 18.98 ? 72  ILE B C   1 
ATOM   1210 O O   . ILE B 1 75 ? 17.861  -6.321  35.356 1.00 19.80 ? 72  ILE B O   1 
ATOM   1211 C CB  . ILE B 1 75 ? 18.691  -5.040  32.349 1.00 13.76 ? 72  ILE B CB  1 
ATOM   1212 C CG1 . ILE B 1 75 ? 17.875  -4.613  31.080 1.00 17.84 ? 72  ILE B CG1 1 
ATOM   1213 C CG2 . ILE B 1 75 ? 19.018  -6.516  32.333 1.00 19.01 ? 72  ILE B CG2 1 
ATOM   1214 C CD1 . ILE B 1 75 ? 18.766  -4.483  29.888 1.00 20.31 ? 72  ILE B CD1 1 
ATOM   1215 N N   . LYS B 1 76 ? 19.694  -5.015  35.302 1.00 20.73 ? 73  LYS B N   1 
ATOM   1216 C CA  . LYS B 1 76 ? 20.256  -5.533  36.540 1.00 28.93 ? 73  LYS B CA  1 
ATOM   1217 C C   . LYS B 1 76 ? 19.260  -5.434  37.711 1.00 27.15 ? 73  LYS B C   1 
ATOM   1218 O O   . LYS B 1 76 ? 19.043  -6.416  38.423 1.00 25.50 ? 73  LYS B O   1 
ATOM   1219 C CB  . LYS B 1 76 ? 21.534  -4.758  36.884 1.00 28.86 ? 73  LYS B CB  1 
ATOM   1220 C CG  . LYS B 1 76 ? 22.227  -5.239  38.145 1.00 36.10 ? 73  LYS B CG  1 
ATOM   1221 C CD  . LYS B 1 76 ? 23.683  -4.816  38.187 1.00 39.84 ? 73  LYS B CD  1 
ATOM   1222 C CE  . LYS B 1 76 ? 23.901  -3.698  39.196 1.00 47.60 ? 73  LYS B CE  1 
ATOM   1223 N NZ  . LYS B 1 76 ? 25.367  -3.504  39.500 1.00 51.37 ? 73  LYS B NZ  1 
ATOM   1224 N N   . GLU B 1 77 ? 18.652  -4.262  37.885 1.00 24.02 ? 74  GLU B N   1 
ATOM   1225 C CA  . GLU B 1 77 ? 17.653  -4.065  38.930 1.00 29.78 ? 74  GLU B CA  1 
ATOM   1226 C C   . GLU B 1 77 ? 16.440  -4.987  38.827 1.00 31.76 ? 74  GLU B C   1 
ATOM   1227 O O   . GLU B 1 77 ? 16.006  -5.551  39.833 1.00 30.48 ? 74  GLU B O   1 
ATOM   1228 C CB  . GLU B 1 77 ? 17.198  -2.619  38.977 1.00 35.51 ? 74  GLU B CB  1 
ATOM   1229 C CG  . GLU B 1 77 ? 16.375  -2.298  40.162 1.00 32.46 ? 74  GLU B CG  1 
ATOM   1230 C CD  . GLU B 1 77 ? 17.088  -2.627  41.473 1.00 41.56 ? 74  GLU B CD  1 
ATOM   1231 O OE1 . GLU B 1 77 ? 18.329  -2.462  41.578 1.00 38.83 ? 74  GLU B OE1 1 
ATOM   1232 O OE2 . GLU B 1 77 ? 16.391  -3.067  42.401 1.00 47.34 ? 74  GLU B OE2 1 
ATOM   1233 N N   . ILE B 1 78 ? 15.883  -5.129  37.632 1.00 23.56 ? 75  ILE B N   1 
ATOM   1234 C CA  . ILE B 1 78 ? 14.748  -6.035  37.458 1.00 24.39 ? 75  ILE B CA  1 
ATOM   1235 C C   . ILE B 1 78 ? 15.230  -7.459  37.694 1.00 20.67 ? 75  ILE B C   1 
ATOM   1236 O O   . ILE B 1 78 ? 14.638  -8.225  38.492 1.00 19.41 ? 75  ILE B O   1 
ATOM   1237 C CB  . ILE B 1 78 ? 14.118  -5.857  36.062 1.00 23.92 ? 75  ILE B CB  1 
ATOM   1238 C CG1 . ILE B 1 78 ? 13.388  -4.507  36.027 1.00 30.19 ? 75  ILE B CG1 1 
ATOM   1239 C CG2 . ILE B 1 78 ? 13.178  -7.032  35.701 1.00 27.46 ? 75  ILE B CG2 1 
ATOM   1240 C CD1 . ILE B 1 78 ? 12.958  -4.084  34.625 1.00 24.98 ? 75  ILE B CD1 1 
ATOM   1241 N N   . LEU B 1 79 ? 16.356  -7.803  37.092 1.00 20.65 ? 76  LEU B N   1 
ATOM   1242 C CA  . LEU B 1 79 ? 16.873  -9.186  37.192 1.00 28.25 ? 76  LEU B CA  1 
ATOM   1243 C C   . LEU B 1 79 ? 17.266  -9.674  38.604 1.00 29.54 ? 76  LEU B C   1 
ATOM   1244 O O   . LEU B 1 79 ? 16.960  -10.809 39.000 1.00 25.15 ? 76  LEU B O   1 
ATOM   1245 C CB  . LEU B 1 79 ? 18.058  -9.411  36.220 1.00 29.07 ? 76  LEU B CB  1 
ATOM   1246 C CG  . LEU B 1 79 ? 17.665  -9.619  34.745 1.00 26.70 ? 76  LEU B CG  1 
ATOM   1247 C CD1 . LEU B 1 79 ? 18.968  -9.800  33.975 1.00 25.72 ? 76  LEU B CD1 1 
ATOM   1248 C CD2 . LEU B 1 79 ? 16.796  -10.873 34.627 1.00 25.21 ? 76  LEU B CD2 1 
ATOM   1249 N N   . LYS B 1 80 ? 17.971  -8.828  39.336 1.00 31.58 ? 77  LYS B N   1 
ATOM   1250 C CA  . LYS B 1 80 ? 18.524  -9.246  40.598 1.00 39.37 ? 77  LYS B CA  1 
ATOM   1251 C C   . LYS B 1 80 ? 17.454  -9.119  41.676 1.00 38.64 ? 77  LYS B C   1 
ATOM   1252 O O   . LYS B 1 80 ? 17.496  -9.805  42.696 1.00 48.81 ? 77  LYS B O   1 
ATOM   1253 C CB  . LYS B 1 80 ? 19.758  -8.403  40.923 1.00 43.37 ? 77  LYS B CB  1 
ATOM   1254 C CG  . LYS B 1 80 ? 20.919  -8.575  39.932 1.00 41.50 ? 77  LYS B CG  1 
ATOM   1255 C CD  . LYS B 1 80 ? 22.202  -7.937  40.497 1.00 47.45 ? 77  LYS B CD  1 
ATOM   1256 C CE  . LYS B 1 80 ? 23.452  -8.417  39.756 1.00 54.52 ? 77  LYS B CE  1 
ATOM   1257 N NZ  . LYS B 1 80 ? 23.712  -9.880  39.943 1.00 63.09 ? 77  LYS B NZ  1 
ATOM   1258 N N   . HIS B 1 81 ? 16.465  -8.275  41.440 1.00 30.61 ? 78  HIS B N   1 
ATOM   1259 C CA  . HIS B 1 81 ? 15.579  -7.898  42.529 1.00 48.06 ? 78  HIS B CA  1 
ATOM   1260 C C   . HIS B 1 81 ? 14.120  -7.944  42.146 1.00 59.17 ? 78  HIS B C   1 
ATOM   1261 O O   . HIS B 1 81 ? 13.271  -7.564  42.943 1.00 66.02 ? 78  HIS B O   1 
ATOM   1262 C CB  . HIS B 1 81 ? 15.923  -6.499  43.037 1.00 51.98 ? 78  HIS B CB  1 
ATOM   1263 C CG  . HIS B 1 81 ? 17.333  -6.359  43.535 1.00 55.12 ? 78  HIS B CG  1 
ATOM   1264 N ND1 . HIS B 1 81 ? 18.268  -5.569  42.906 1.00 51.06 ? 78  HIS B ND1 1 
ATOM   1265 C CD2 . HIS B 1 81 ? 17.961  -6.906  44.607 1.00 60.21 ? 78  HIS B CD2 1 
ATOM   1266 C CE1 . HIS B 1 81 ? 19.415  -5.637  43.562 1.00 56.05 ? 78  HIS B CE1 1 
ATOM   1267 N NE2 . HIS B 1 81 ? 19.256  -6.443  44.594 1.00 60.46 ? 78  HIS B NE2 1 
ATOM   1268 N N   . ASP B 1 82 ? 13.839  -8.362  40.915 1.00 63.71 ? 79  ASP B N   1 
ATOM   1269 C CA  . ASP B 1 82 ? 12.468  -8.605  40.458 1.00 68.17 ? 79  ASP B CA  1 
ATOM   1270 C C   . ASP B 1 82 ? 11.503  -7.419  40.602 1.00 75.63 ? 79  ASP B C   1 
ATOM   1271 O O   . ASP B 1 82 ? 10.291  -7.609  40.730 1.00 80.26 ? 79  ASP B O   1 
ATOM   1272 C CB  . ASP B 1 82 ? 11.933  -9.843  41.155 1.00 68.17 ? 79  ASP B CB  1 
ATOM   1273 C CG  . ASP B 1 82 ? 12.953  -10.957 41.176 1.00 68.17 ? 79  ASP B CG  1 
ATOM   1274 O OD1 . ASP B 1 82 ? 13.462  -11.304 40.093 1.00 68.09 ? 79  ASP B OD1 1 
ATOM   1275 O OD2 . ASP B 1 82 ? 13.286  -11.449 42.271 1.00 70.89 ? 79  ASP B OD2 1 
ATOM   1276 O OXT . ASP B 1 82 ? 11.901  -6.252  40.590 1.00 74.84 ? 79  ASP B OXT 1 
HETATM 1277 S S   . SO4 C 2 .  ? 16.689  18.439  46.901 1.00 26.32 ? 101 SO4 B S   1 
HETATM 1278 O O1  . SO4 C 2 .  ? 17.027  17.030  46.616 1.00 21.18 ? 101 SO4 B O1  1 
HETATM 1279 O O2  . SO4 C 2 .  ? 15.547  18.588  47.815 1.00 27.87 ? 101 SO4 B O2  1 
HETATM 1280 O O3  . SO4 C 2 .  ? 17.798  19.147  47.536 1.00 35.96 ? 101 SO4 B O3  1 
HETATM 1281 O O4  . SO4 C 2 .  ? 16.432  19.207  45.682 1.00 22.26 ? 101 SO4 B O4  1 
HETATM 1282 O O   . HOH D 3 .  ? 4.727   10.242  20.757 1.00 41.80 ? 101 HOH A O   1 
HETATM 1283 O O   . HOH D 3 .  ? 1.030   7.044   26.494 1.00 32.64 ? 102 HOH A O   1 
HETATM 1284 O O   . HOH D 3 .  ? 10.447  -12.330 26.303 1.00 30.67 ? 103 HOH A O   1 
HETATM 1285 O O   . HOH D 3 .  ? -0.958  -5.186  27.817 1.00 30.49 ? 104 HOH A O   1 
HETATM 1286 O O   . HOH D 3 .  ? 22.578  -7.233  29.681 1.00 48.40 ? 105 HOH A O   1 
HETATM 1287 O O   . HOH D 3 .  ? 8.780   -8.733  31.909 1.00 42.61 ? 106 HOH A O   1 
HETATM 1288 O O   . HOH D 3 .  ? 13.210  -12.807 29.507 1.00 34.82 ? 107 HOH A O   1 
HETATM 1289 O O   . HOH D 3 .  ? -1.610  8.528   15.188 1.00 40.45 ? 108 HOH A O   1 
HETATM 1290 O O   . HOH D 3 .  ? 12.983  -8.300  17.141 1.00 39.88 ? 109 HOH A O   1 
HETATM 1291 O O   . HOH D 3 .  ? 4.299   0.921   11.558 1.00 35.92 ? 110 HOH A O   1 
HETATM 1292 O O   . HOH D 3 .  ? -8.255  5.933   23.552 1.00 56.71 ? 111 HOH A O   1 
HETATM 1293 O O   . HOH D 3 .  ? -4.596  2.247   28.529 1.00 31.26 ? 112 HOH A O   1 
HETATM 1294 O O   . HOH D 3 .  ? 7.810   -11.884 32.043 1.00 54.61 ? 113 HOH A O   1 
HETATM 1295 O O   . HOH D 3 .  ? 0.180   10.110  16.253 1.00 53.16 ? 114 HOH A O   1 
HETATM 1296 O O   . HOH D 3 .  ? 5.854   -7.992  32.136 1.00 56.71 ? 115 HOH A O   1 
HETATM 1297 O O   . HOH D 3 .  ? 8.983   2.273   14.006 1.00 54.11 ? 116 HOH A O   1 
HETATM 1298 O O   . HOH D 3 .  ? -5.361  -8.251  12.582 1.00 51.73 ? 117 HOH A O   1 
HETATM 1299 O O   . HOH D 3 .  ? 5.789   -15.026 21.573 1.00 58.92 ? 118 HOH A O   1 
HETATM 1300 O O   . HOH D 3 .  ? 17.894  6.322   13.504 1.00 51.87 ? 119 HOH A O   1 
HETATM 1301 O O   . HOH D 3 .  ? 0.932   7.962   23.296 1.00 38.49 ? 120 HOH A O   1 
HETATM 1302 O O   . HOH E 3 .  ? 18.662  21.790  46.674 1.00 24.27 ? 201 HOH B O   1 
HETATM 1303 O O   . HOH E 3 .  ? 6.599   13.479  31.205 1.00 26.96 ? 202 HOH B O   1 
HETATM 1304 O O   . HOH E 3 .  ? 17.972  14.918  47.370 1.00 22.45 ? 203 HOH B O   1 
HETATM 1305 O O   . HOH E 3 .  ? 18.691  16.912  30.051 1.00 31.77 ? 204 HOH B O   1 
HETATM 1306 O O   . HOH E 3 .  ? 27.349  6.602   30.876 1.00 34.14 ? 205 HOH B O   1 
HETATM 1307 O O   . HOH E 3 .  ? 23.171  -5.781  27.922 1.00 50.55 ? 206 HOH B O   1 
HETATM 1308 O O   . HOH E 3 .  ? 29.450  7.929   41.624 1.00 40.22 ? 207 HOH B O   1 
HETATM 1309 O O   . HOH E 3 .  ? 18.224  28.864  32.759 1.00 33.79 ? 208 HOH B O   1 
HETATM 1310 O O   . HOH E 3 .  ? 6.159   15.568  30.596 1.00 43.05 ? 209 HOH B O   1 
HETATM 1311 O O   . HOH E 3 .  ? 28.566  8.216   39.477 1.00 46.67 ? 210 HOH B O   1 
HETATM 1312 O O   . HOH E 3 .  ? 9.411   15.441  27.520 1.00 40.61 ? 211 HOH B O   1 
HETATM 1313 O O   . HOH E 3 .  ? 16.284  11.895  47.854 1.00 38.16 ? 212 HOH B O   1 
HETATM 1314 O O   . HOH E 3 .  ? 28.993  11.066  34.301 1.00 51.29 ? 213 HOH B O   1 
HETATM 1315 O O   . HOH E 3 .  ? 23.325  19.010  42.656 1.00 34.14 ? 214 HOH B O   1 
HETATM 1316 O O   . HOH E 3 .  ? 4.097   11.309  31.871 1.00 62.33 ? 215 HOH B O   1 
HETATM 1317 O O   . HOH E 3 .  ? 20.758  0.598   45.831 1.00 56.50 ? 216 HOH B O   1 
HETATM 1318 O O   . HOH E 3 .  ? 19.063  10.031  23.517 1.00 60.07 ? 217 HOH B O   1 
HETATM 1319 O O   . HOH E 3 .  ? 1.844   14.581  43.546 1.00 45.83 ? 218 HOH B O   1 
HETATM 1320 O O   . HOH E 3 .  ? 3.575   14.343  41.476 1.00 52.55 ? 219 HOH B O   1 
HETATM 1321 O O   . HOH E 3 .  ? 14.300  -2.747  43.652 1.00 57.39 ? 220 HOH B O   1 
HETATM 1322 O O   . HOH E 3 .  ? 11.150  16.170  47.322 1.00 61.00 ? 221 HOH B O   1 
HETATM 1323 O O   . HOH E 3 .  ? 2.644   -3.550  36.739 1.00 40.47 ? 222 HOH B O   1 
HETATM 1324 O O   . HOH E 3 .  ? 6.517   7.333   38.929 1.00 46.23 ? 223 HOH B O   1 
HETATM 1325 O O   . HOH E 3 .  ? 8.986   22.106  31.991 1.00 55.32 ? 224 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 6  ? 0.8718 0.7635 0.6811 -0.0983 -0.0329 0.0885  3   SER A N   
2    C CA  . SER A 6  ? 0.9165 0.8342 0.7429 -0.0963 -0.0165 0.0819  3   SER A CA  
3    C C   . SER A 6  ? 0.9051 0.8552 0.7439 -0.0943 -0.0010 0.0732  3   SER A C   
4    O O   . SER A 6  ? 0.8833 0.8353 0.7219 -0.0889 -0.0032 0.0737  3   SER A O   
5    C CB  . SER A 6  ? 0.9220 0.8332 0.7667 -0.0781 -0.0208 0.0840  3   SER A CB  
6    O OG  . SER A 6  ? 0.8860 0.8218 0.7513 -0.0660 -0.0097 0.0778  3   SER A OG  
7    N N   . PHE A 7  ? 0.9483 0.9246 0.8006 -0.0971 0.0134  0.0638  4   PHE A N   
8    C CA  . PHE A 7  ? 0.9553 0.9640 0.8223 -0.0950 0.0265  0.0517  4   PHE A CA  
9    C C   . PHE A 7  ? 0.9276 0.9435 0.8184 -0.0726 0.0263  0.0491  4   PHE A C   
10   O O   . PHE A 7  ? 0.9687 1.0011 0.8687 -0.0678 0.0307  0.0418  4   PHE A O   
11   C CB  . PHE A 7  ? 0.9032 0.9404 0.7821 -0.1044 0.0395  0.0369  4   PHE A CB  
12   C CG  . PHE A 7  ? 0.8191 0.8890 0.7142 -0.1030 0.0496  0.0206  4   PHE A CG  
13   C CD1 . PHE A 7  ? 0.8271 0.9047 0.7109 -0.1165 0.0517  0.0147  4   PHE A CD1 
14   C CD2 . PHE A 7  ? 0.7473 0.8388 0.6690 -0.0879 0.0551  0.0102  4   PHE A CD2 
15   C CE1 . PHE A 7  ? 0.8016 0.9088 0.7022 -0.1143 0.0593  -0.0020 4   PHE A CE1 
16   C CE2 . PHE A 7  ? 0.7211 0.8401 0.6605 -0.0842 0.0609  -0.0067 4   PHE A CE2 
17   C CZ  . PHE A 7  ? 0.7607 0.8878 0.6901 -0.0972 0.0630  -0.0131 4   PHE A CZ  
18   N N   . LEU A 8  ? 0.8555 0.8584 0.7584 -0.0580 0.0201  0.0527  5   LEU A N   
19   C CA  . LEU A 8  ? 0.7186 0.7284 0.6448 -0.0382 0.0205  0.0478  5   LEU A CA  
20   C C   . LEU A 8  ? 0.6424 0.6430 0.5676 -0.0303 0.0136  0.0521  5   LEU A C   
21   O O   . LEU A 8  ? 0.5621 0.5758 0.4971 -0.0243 0.0173  0.0465  5   LEU A O   
22   C CB  . LEU A 8  ? 0.5708 0.5727 0.5087 -0.0274 0.0180  0.0482  5   LEU A CB  
23   C CG  . LEU A 8  ? 0.5320 0.5408 0.4879 -0.0120 0.0196  0.0431  5   LEU A CG  
24   C CD1 . LEU A 8  ? 0.3748 0.4043 0.3402 -0.0116 0.0265  0.0332  5   LEU A CD1 
25   C CD2 . LEU A 8  ? 0.5399 0.5418 0.5042 -0.0034 0.0181  0.0427  5   LEU A CD2 
26   N N   . LEU A 9  ? 0.6255 0.6031 0.5401 -0.0299 0.0018  0.0609  6   LEU A N   
27   C CA  . LEU A 9  ? 0.5715 0.5418 0.4903 -0.0204 -0.0063 0.0623  6   LEU A CA  
28   C C   . LEU A 9  ? 0.4504 0.4265 0.3572 -0.0282 -0.0054 0.0626  6   LEU A C   
29   O O   . LEU A 9  ? 0.3944 0.3771 0.3119 -0.0194 -0.0060 0.0593  6   LEU A O   
30   C CB  . LEU A 9  ? 0.6152 0.5596 0.5292 -0.0161 -0.0226 0.0683  6   LEU A CB  
31   C CG  . LEU A 9  ? 0.6399 0.5662 0.5502 -0.0169 -0.0303 0.0719  6   LEU A CG  
32   C CD1 . LEU A 9  ? 0.6120 0.5519 0.5363 -0.0133 -0.0190 0.0665  6   LEU A CD1 
33   C CD2 . LEU A 9  ? 0.6640 0.5673 0.5430 -0.0351 -0.0395 0.0823  6   LEU A CD2 
34   N N   . SER A 10 ? 0.4282 0.4039 0.3130 -0.0461 -0.0028 0.0655  7   SER A N   
35   C CA  A SER A 10 ? 0.4507 0.4337 0.3213 -0.0563 -0.0005 0.0644  7   SER A CA  
36   C CA  B SER A 10 ? 0.4631 0.4464 0.3334 -0.0568 -0.0002 0.0643  7   SER A CA  
37   C C   . SER A 10 ? 0.4811 0.4952 0.3727 -0.0507 0.0131  0.0513  7   SER A C   
38   O O   . SER A 10 ? 0.3511 0.3742 0.2424 -0.0505 0.0143  0.0476  7   SER A O   
39   C CB  A SER A 10 ? 0.5187 0.4924 0.3589 -0.0793 -0.0012 0.0687  7   SER A CB  
40   C CB  B SER A 10 ? 0.5309 0.5084 0.3732 -0.0798 0.0011  0.0674  7   SER A CB  
41   O OG  A SER A 10 ? 0.5370 0.5350 0.3820 -0.0903 0.0135  0.0582  7   SER A OG  
42   O OG  B SER A 10 ? 0.5367 0.5276 0.3857 -0.0862 0.0115  0.0613  7   SER A OG  
43   N N   . LYS A 11 ? 0.3990 0.4269 0.3093 -0.0447 0.0209  0.0440  8   LYS A N   
44   C CA  . LYS A 11 ? 0.3801 0.4322 0.3105 -0.0378 0.0291  0.0311  8   LYS A CA  
45   C C   . LYS A 11 ? 0.2377 0.2858 0.1850 -0.0206 0.0253  0.0310  8   LYS A C   
46   O O   . LYS A 11 ? 0.2432 0.3032 0.2010 -0.0152 0.0273  0.0237  8   LYS A O   
47   C CB  . LYS A 11 ? 0.5122 0.5797 0.4546 -0.0394 0.0364  0.0216  8   LYS A CB  
48   C CG  . LYS A 11 ? 0.5831 0.6755 0.5221 -0.0550 0.0459  0.0091  8   LYS A CG  
49   C CD  . LYS A 11 ? 0.6425 0.7260 0.5504 -0.0759 0.0463  0.0174  8   LYS A CD  
50   C CE  . LYS A 11 ? 0.7464 0.8464 0.6498 -0.0847 0.0505  0.0077  8   LYS A CE  
51   N NZ  . LYS A 11 ? 0.7846 0.8634 0.6583 -0.1002 0.0441  0.0182  8   LYS A NZ  
52   N N   . VAL A 12 ? 0.2330 0.2657 0.1835 -0.0129 0.0201  0.0376  9   VAL A N   
53   C CA  . VAL A 12 ? 0.2211 0.2504 0.1845 -0.0006 0.0175  0.0373  9   VAL A CA  
54   C C   . VAL A 12 ? 0.2602 0.2880 0.2201 -0.0002 0.0129  0.0387  9   VAL A C   
55   O O   . VAL A 12 ? 0.2164 0.2525 0.1860 0.0048  0.0149  0.0337  9   VAL A O   
56   C CB  . VAL A 12 ? 0.2597 0.2764 0.2272 0.0054  0.0137  0.0412  9   VAL A CB  
57   C CG1 . VAL A 12 ? 0.2565 0.2735 0.2364 0.0144  0.0129  0.0386  9   VAL A CG1 
58   C CG2 . VAL A 12 ? 0.1964 0.2159 0.1683 0.0060  0.0184  0.0386  9   VAL A CG2 
59   N N   . SER A 13 ? 0.2703 0.2857 0.2148 -0.0063 0.0054  0.0454  10  SER A N   
60   C CA  . SER A 13 ? 0.2708 0.2831 0.2113 -0.0055 -0.0013 0.0464  10  SER A CA  
61   C C   . SER A 13 ? 0.2487 0.2771 0.1870 -0.0105 0.0052  0.0405  10  SER A C   
62   O O   . SER A 13 ? 0.2479 0.2804 0.1923 -0.0058 0.0031  0.0376  10  SER A O   
63   C CB  . SER A 13 ? 0.3519 0.3438 0.2700 -0.0135 -0.0137 0.0551  10  SER A CB  
64   O OG  . SER A 13 ? 0.4625 0.4371 0.3779 -0.0122 -0.0213 0.0603  10  SER A OG  
65   N N   . PHE A 14 ? 0.2959 0.3348 0.2254 -0.0213 0.0127  0.0371  11  PHE A N   
66   C CA  . PHE A 14 ? 0.2621 0.3193 0.1893 -0.0280 0.0189  0.0283  11  PHE A CA  
67   C C   . PHE A 14 ? 0.2338 0.3044 0.1852 -0.0155 0.0225  0.0186  11  PHE A C   
68   O O   . PHE A 14 ? 0.2477 0.3268 0.2036 -0.0135 0.0225  0.0127  11  PHE A O   
69   C CB  . PHE A 14 ? 0.2232 0.2948 0.1417 -0.0425 0.0279  0.0221  11  PHE A CB  
70   C CG  . PHE A 14 ? 0.3082 0.4072 0.2339 -0.0470 0.0364  0.0062  11  PHE A CG  
71   C CD1 . PHE A 14 ? 0.4145 0.5192 0.3209 -0.0605 0.0378  0.0044  11  PHE A CD1 
72   C CD2 . PHE A 14 ? 0.3177 0.4354 0.2695 -0.0373 0.0409  -0.0081 11  PHE A CD2 
73   C CE1 . PHE A 14 ? 0.3122 0.4457 0.2275 -0.0647 0.0461  -0.0135 11  PHE A CE1 
74   C CE2 . PHE A 14 ? 0.3408 0.4846 0.3035 -0.0394 0.0464  -0.0261 11  PHE A CE2 
75   C CZ  . PHE A 14 ? 0.4046 0.5585 0.3503 -0.0532 0.0501  -0.0297 11  PHE A CZ  
76   N N   . VAL A 15 ? 0.2130 0.2831 0.1778 -0.0083 0.0243  0.0169  12  VAL A N   
77   C CA  . VAL A 15 ? 0.2106 0.2857 0.1936 0.0023  0.0243  0.0096  12  VAL A CA  
78   C C   . VAL A 15 ? 0.1783 0.2436 0.1655 0.0093  0.0198  0.0142  12  VAL A C   
79   O O   . VAL A 15 ? 0.1740 0.2435 0.1697 0.0134  0.0188  0.0083  12  VAL A O   
80   C CB  . VAL A 15 ? 0.1589 0.2305 0.1505 0.0075  0.0248  0.0083  12  VAL A CB  
81   C CG1 . VAL A 15 ? 0.1750 0.2432 0.1794 0.0169  0.0209  0.0031  12  VAL A CG1 
82   C CG2 . VAL A 15 ? 0.1641 0.2501 0.1576 0.0017  0.0291  -0.0004 12  VAL A CG2 
83   N N   . ILE A 16 ? 0.1374 0.1907 0.1204 0.0103  0.0164  0.0225  13  ILE A N   
84   C CA  . ILE A 16 ? 0.1530 0.2017 0.1436 0.0159  0.0128  0.0235  13  ILE A CA  
85   C C   . ILE A 16 ? 0.2130 0.2673 0.2005 0.0140  0.0101  0.0210  13  ILE A C   
86   O O   . ILE A 16 ? 0.1745 0.2323 0.1708 0.0174  0.0098  0.0169  13  ILE A O   
87   C CB  . ILE A 16 ? 0.1990 0.2382 0.1903 0.0183  0.0085  0.0283  13  ILE A CB  
88   C CG1 . ILE A 16 ? 0.1593 0.1947 0.1545 0.0201  0.0122  0.0290  13  ILE A CG1 
89   C CG2 . ILE A 16 ? 0.1881 0.2285 0.1915 0.0231  0.0053  0.0250  13  ILE A CG2 
90   C CD1 . ILE A 16 ? 0.1678 0.1957 0.1656 0.0228  0.0077  0.0311  13  ILE A CD1 
91   N N   . LYS A 17 ? 0.2049 0.2583 0.1774 0.0070  0.0075  0.0239  14  LYS A N   
92   C CA  . LYS A 17 ? 0.1759 0.2334 0.1427 0.0043  0.0042  0.0216  14  LYS A CA  
93   C C   . LYS A 17 ? 0.1796 0.2531 0.1537 0.0042  0.0100  0.0112  14  LYS A C   
94   O O   . LYS A 17 ? 0.1917 0.2690 0.1720 0.0074  0.0078  0.0070  14  LYS A O   
95   C CB  . LYS A 17 ? 0.2900 0.3399 0.2329 -0.0065 -0.0004 0.0274  14  LYS A CB  
96   C CG  . LYS A 17 ? 0.2872 0.3358 0.2198 -0.0096 -0.0068 0.0272  14  LYS A CG  
97   C CD  . LYS A 17 ? 0.3368 0.3711 0.2386 -0.0232 -0.0135 0.0353  14  LYS A CD  
98   C CE  . LYS A 17 ? 0.4386 0.4717 0.3250 -0.0291 -0.0197 0.0345  14  LYS A CE  
99   N NZ  . LYS A 17 ? 0.5341 0.5459 0.3836 -0.0448 -0.0293 0.0448  14  LYS A NZ  
100  N N   . LYS A 18 ? 0.1442 0.2276 0.1188 0.0006  0.0162  0.0054  15  LYS A N   
101  C CA  . LYS A 18 ? 0.1897 0.2900 0.1755 0.0020  0.0195  -0.0085 15  LYS A CA  
102  C C   . LYS A 18 ? 0.2298 0.3246 0.2322 0.0128  0.0155  -0.0113 15  LYS A C   
103  O O   . LYS A 18 ? 0.2101 0.3113 0.2192 0.0152  0.0133  -0.0193 15  LYS A O   
104  C CB  . LYS A 18 ? 0.2154 0.3285 0.2042 -0.0021 0.0254  -0.0169 15  LYS A CB  
105  C CG  . LYS A 18 ? 0.2632 0.3958 0.2701 0.0022  0.0261  -0.0360 15  LYS A CG  
106  C CD  . LYS A 18 ? 0.3229 0.4691 0.3398 0.0011  0.0299  -0.0471 15  LYS A CD  
107  C CE  . LYS A 18 ? 0.4149 0.5832 0.4525 0.0059  0.0285  -0.0701 15  LYS A CE  
108  N NZ  . LYS A 18 ? 0.4819 0.6785 0.5248 -0.0037 0.0372  -0.0868 15  LYS A NZ  
109  N N   . ILE A 19 ? 0.1754 0.2574 0.1824 0.0176  0.0143  -0.0052 16  ILE A N   
110  C CA  . ILE A 19 ? 0.1569 0.2299 0.1728 0.0232  0.0102  -0.0062 16  ILE A CA  
111  C C   . ILE A 19 ? 0.1600 0.2301 0.1766 0.0232  0.0081  -0.0033 16  ILE A C   
112  O O   . ILE A 19 ? 0.1960 0.2654 0.2186 0.0251  0.0047  -0.0084 16  ILE A O   
113  C CB  . ILE A 19 ? 0.1411 0.2004 0.1566 0.0247  0.0102  0.0000  16  ILE A CB  
114  C CG1 . ILE A 19 ? 0.1860 0.2474 0.2032 0.0261  0.0101  -0.0045 16  ILE A CG1 
115  C CG2 . ILE A 19 ? 0.1664 0.2138 0.1849 0.0259  0.0060  -0.0001 16  ILE A CG2 
116  C CD1 . ILE A 19 ? 0.1811 0.2295 0.1936 0.0260  0.0112  0.0033  16  ILE A CD1 
117  N N   . ARG A 20 ? 0.1246 0.1929 0.1360 0.0213  0.0084  0.0034  17  ARG A N   
118  C CA  . ARG A 20 ? 0.1433 0.2107 0.1592 0.0222  0.0053  0.0041  17  ARG A CA  
119  C C   . ARG A 20 ? 0.2077 0.2832 0.2232 0.0217  0.0025  -0.0022 17  ARG A C   
120  O O   . ARG A 20 ? 0.1913 0.2669 0.2146 0.0232  0.0002  -0.0058 17  ARG A O   
121  C CB  . ARG A 20 ? 0.1798 0.2435 0.1921 0.0222  0.0022  0.0096  17  ARG A CB  
122  C CG  . ARG A 20 ? 0.1819 0.2472 0.2001 0.0242  -0.0040 0.0075  17  ARG A CG  
123  C CD  . ARG A 20 ? 0.1777 0.2364 0.1937 0.0261  -0.0115 0.0111  17  ARG A CD  
124  N NE  . ARG A 20 ? 0.1998 0.2500 0.1963 0.0223  -0.0182 0.0171  17  ARG A NE  
125  C CZ  . ARG A 20 ? 0.2336 0.2816 0.2178 0.0191  -0.0253 0.0177  17  ARG A CZ  
126  N NH1 . ARG A 20 ? 0.2132 0.2695 0.2057 0.0210  -0.0258 0.0117  17  ARG A NH1 
127  N NH2 . ARG A 20 ? 0.1956 0.2309 0.1568 0.0126  -0.0328 0.0247  17  ARG A NH2 
128  N N   . LEU A 21 ? 0.2025 0.2854 0.2083 0.0181  0.0035  -0.0045 18  LEU A N   
129  C CA  . LEU A 21 ? 0.2640 0.3572 0.2678 0.0161  0.0019  -0.0124 18  LEU A CA  
130  C C   . LEU A 21 ? 0.3027 0.4028 0.3191 0.0200  0.0020  -0.0240 18  LEU A C   
131  O O   . LEU A 21 ? 0.2477 0.3533 0.2684 0.0212  -0.0010 -0.0311 18  LEU A O   
132  C CB  . LEU A 21 ? 0.2512 0.3519 0.2374 0.0073  0.0041  -0.0131 18  LEU A CB  
133  C CG  . LEU A 21 ? 0.2596 0.3487 0.2266 0.0016  -0.0013 -0.0022 18  LEU A CG  
134  C CD1 . LEU A 21 ? 0.3354 0.4296 0.2797 -0.0117 0.0021  -0.0026 18  LEU A CD1 
135  C CD2 . LEU A 21 ? 0.2503 0.3355 0.2166 0.0038  -0.0098 -0.0019 18  LEU A CD2 
136  N N   . GLU A 22 ? 0.2737 0.3726 0.2962 0.0226  0.0035  -0.0269 19  GLU A N   
137  C CA  . GLU A 22 ? 0.2452 0.3440 0.2807 0.0283  -0.0014 -0.0377 19  GLU A CA  
138  C C   . GLU A 22 ? 0.2374 0.3189 0.2772 0.0310  -0.0072 -0.0332 19  GLU A C   
139  O O   . GLU A 22 ? 0.3395 0.4168 0.3873 0.0346  -0.0144 -0.0412 19  GLU A O   
140  C CB  . GLU A 22 ? 0.3475 0.4466 0.3881 0.0309  -0.0015 -0.0424 19  GLU A CB  
141  C CG  . GLU A 22 ? 0.4329 0.5549 0.4762 0.0280  0.0035  -0.0553 19  GLU A CG  
142  C CD  . GLU A 22 ? 0.4600 0.5824 0.5090 0.0302  0.0037  -0.0586 19  GLU A CD  
143  O OE1 . GLU A 22 ? 0.4785 0.6219 0.5322 0.0266  0.0088  -0.0710 19  GLU A OE1 
144  O OE2 . GLU A 22 ? 0.5060 0.6085 0.5541 0.0341  -0.0007 -0.0493 19  GLU A OE2 
145  N N   . LYS A 23 ? 0.2510 0.3229 0.2859 0.0282  -0.0047 -0.0218 20  LYS A N   
146  C CA  . LYS A 23 ? 0.2119 0.2710 0.2491 0.0264  -0.0076 -0.0186 20  LYS A CA  
147  C C   . LYS A 23 ? 0.2713 0.3378 0.3116 0.0251  -0.0078 -0.0196 20  LYS A C   
148  O O   . LYS A 23 ? 0.3370 0.3976 0.3808 0.0219  -0.0086 -0.0183 20  LYS A O   
149  C CB  . LYS A 23 ? 0.3124 0.3620 0.3452 0.0225  -0.0032 -0.0095 20  LYS A CB  
150  C CG  . LYS A 23 ? 0.3842 0.4237 0.4120 0.0233  -0.0041 -0.0075 20  LYS A CG  
151  C CD  . LYS A 23 ? 0.4506 0.4718 0.4762 0.0227  -0.0128 -0.0097 20  LYS A CD  
152  C CE  . LYS A 23 ? 0.5262 0.5354 0.5459 0.0243  -0.0162 -0.0078 20  LYS A CE  
153  N NZ  . LYS A 23 ? 0.5624 0.5444 0.5696 0.0182  -0.0234 -0.0027 20  LYS A NZ  
154  N N   . GLY A 24 ? 0.2699 0.3492 0.3073 0.0259  -0.0071 -0.0222 21  GLY A N   
155  C CA  . GLY A 24 ? 0.2622 0.3469 0.3013 0.0253  -0.0098 -0.0237 21  GLY A CA  
156  C C   . GLY A 24 ? 0.2751 0.3585 0.3164 0.0244  -0.0099 -0.0180 21  GLY A C   
157  O O   . GLY A 24 ? 0.2323 0.3189 0.2798 0.0246  -0.0137 -0.0209 21  GLY A O   
158  N N   . MET A 25 ? 0.1663 0.2461 0.2045 0.0241  -0.0070 -0.0118 22  MET A N   
159  C CA  . MET A 25 ? 0.2199 0.2995 0.2650 0.0246  -0.0078 -0.0099 22  MET A CA  
160  C C   . MET A 25 ? 0.1872 0.2661 0.2252 0.0268  -0.0142 -0.0067 22  MET A C   
161  O O   . MET A 25 ? 0.1829 0.2582 0.2063 0.0251  -0.0143 -0.0020 22  MET A O   
162  C CB  . MET A 25 ? 0.2526 0.3272 0.2992 0.0230  -0.0018 -0.0065 22  MET A CB  
163  C CG  . MET A 25 ? 0.2776 0.3472 0.3272 0.0182  0.0021  -0.0083 22  MET A CG  
164  S SD  . MET A 25 ? 0.4668 0.5294 0.5120 0.0147  0.0086  -0.0036 22  MET A SD  
165  C CE  . MET A 25 ? 0.3653 0.4397 0.4241 0.0160  0.0097  -0.0078 22  MET A CE  
166  N N   . THR A 26 ? 0.1483 0.2296 0.1971 0.0295  -0.0201 -0.0100 23  THR A N   
167  C CA  . THR A 26 ? 0.1911 0.2666 0.2353 0.0329  -0.0312 -0.0078 23  THR A CA  
168  C C   . THR A 26 ? 0.1449 0.2166 0.1948 0.0354  -0.0309 -0.0061 23  THR A C   
169  O O   . THR A 26 ? 0.1417 0.2188 0.2021 0.0341  -0.0211 -0.0085 23  THR A O   
170  C CB  . THR A 26 ? 0.1885 0.2688 0.2475 0.0373  -0.0411 -0.0154 23  THR A CB  
171  O OG1 . THR A 26 ? 0.1587 0.2501 0.2427 0.0388  -0.0364 -0.0242 23  THR A OG1 
172  C CG2 . THR A 26 ? 0.2174 0.3020 0.2724 0.0353  -0.0429 -0.0184 23  THR A CG2 
173  N N   . GLN A 27 ? 0.1593 0.2201 0.2020 0.0387  -0.0433 -0.0029 24  GLN A N   
174  C CA  . GLN A 27 ? 0.1591 0.2156 0.2087 0.0422  -0.0450 -0.0027 24  GLN A CA  
175  C C   . GLN A 27 ? 0.1495 0.2209 0.2297 0.0473  -0.0437 -0.0162 24  GLN A C   
176  O O   . GLN A 27 ? 0.1826 0.2598 0.2730 0.0471  -0.0356 -0.0197 24  GLN A O   
177  C CB  . GLN A 27 ? 0.2278 0.2645 0.2618 0.0445  -0.0627 0.0033  24  GLN A CB  
178  C CG  . GLN A 27 ? 0.2238 0.2478 0.2275 0.0355  -0.0597 0.0157  24  GLN A CG  
179  C CD  . GLN A 27 ? 0.2656 0.2646 0.2482 0.0341  -0.0780 0.0237  24  GLN A CD  
180  O OE1 . GLN A 27 ? 0.3357 0.3233 0.3219 0.0403  -0.0967 0.0209  24  GLN A OE1 
181  N NE2 . GLN A 27 ? 0.3436 0.3326 0.3039 0.0253  -0.0737 0.0330  24  GLN A NE2 
182  N N   . GLU A 28 ? 0.1528 0.2313 0.2469 0.0509  -0.0518 -0.0248 25  GLU A N   
183  C CA  . GLU A 28 ? 0.1713 0.2693 0.2967 0.0535  -0.0493 -0.0409 25  GLU A CA  
184  C C   . GLU A 28 ? 0.1590 0.2698 0.2887 0.0440  -0.0294 -0.0430 25  GLU A C   
185  O O   . GLU A 28 ? 0.2451 0.3697 0.3926 0.0416  -0.0212 -0.0533 25  GLU A O   
186  C CB  . GLU A 28 ? 0.2001 0.3044 0.3383 0.0576  -0.0610 -0.0498 25  GLU A CB  
187  C CG  . GLU A 28 ? 0.3019 0.3932 0.4424 0.0684  -0.0850 -0.0525 25  GLU A CG  
188  C CD  . GLU A 28 ? 0.4155 0.5174 0.5798 0.0752  -0.0984 -0.0673 25  GLU A CD  
189  O OE1 . GLU A 28 ? 0.3852 0.5042 0.5604 0.0699  -0.0875 -0.0735 25  GLU A OE1 
190  O OE2 . GLU A 28 ? 0.4497 0.5395 0.6196 0.0846  -0.1196 -0.0728 25  GLU A OE2 
191  N N   . ASP A 29 ? 0.1719 0.2780 0.2858 0.0378  -0.0228 -0.0351 26  ASP A N   
192  C CA  . ASP A 29 ? 0.1895 0.3003 0.3026 0.0277  -0.0078 -0.0354 26  ASP A CA  
193  C C   . ASP A 29 ? 0.2250 0.3309 0.3305 0.0246  0.0006  -0.0307 26  ASP A C   
194  O O   . ASP A 29 ? 0.2231 0.3369 0.3357 0.0171  0.0106  -0.0366 26  ASP A O   
195  C CB  . ASP A 29 ? 0.3747 0.4769 0.4718 0.0240  -0.0062 -0.0281 26  ASP A CB  
196  C CG  . ASP A 29 ? 0.5585 0.6610 0.6553 0.0135  0.0037  -0.0297 26  ASP A CG  
197  O OD1 . ASP A 29 ? 0.6281 0.7404 0.7367 0.0066  0.0107  -0.0373 26  ASP A OD1 
198  O OD2 . ASP A 29 ? 0.6707 0.7630 0.7550 0.0110  0.0037  -0.0245 26  ASP A OD2 
199  N N   . LEU A 30 ? 0.1976 0.2911 0.2880 0.0290  -0.0034 -0.0210 27  LEU A N   
200  C CA  . LEU A 30 ? 0.1818 0.2702 0.2652 0.0268  0.0036  -0.0168 27  LEU A CA  
201  C C   . LEU A 30 ? 0.2142 0.3120 0.3143 0.0290  0.0043  -0.0261 27  LEU A C   
202  O O   . LEU A 30 ? 0.2409 0.3416 0.3406 0.0232  0.0142  -0.0280 27  LEU A O   
203  C CB  . LEU A 30 ? 0.1721 0.2473 0.2377 0.0301  -0.0010 -0.0061 27  LEU A CB  
204  C CG  . LEU A 30 ? 0.1781 0.2473 0.2358 0.0282  0.0053  -0.0013 27  LEU A CG  
205  C CD1 . LEU A 30 ? 0.1841 0.2523 0.2371 0.0208  0.0149  -0.0008 27  LEU A CD1 
206  C CD2 . LEU A 30 ? 0.1446 0.2037 0.1851 0.0292  0.0013  0.0077  27  LEU A CD2 
207  N N   . ALA A 31 ? 0.2187 0.3203 0.3329 0.0377  -0.0080 -0.0330 28  ALA A N   
208  C CA  . ALA A 31 ? 0.1832 0.2953 0.3191 0.0431  -0.0117 -0.0460 28  ALA A CA  
209  C C   . ALA A 31 ? 0.2598 0.3948 0.4147 0.0347  0.0019  -0.0610 28  ALA A C   
210  O O   . ALA A 31 ? 0.2071 0.3533 0.3728 0.0322  0.0092  -0.0707 28  ALA A O   
211  C CB  . ALA A 31 ? 0.1741 0.2848 0.3235 0.0542  -0.0309 -0.0528 28  ALA A CB  
212  N N   . TYR A 32 ? 0.1709 0.3136 0.3299 0.0292  0.0049  -0.0643 29  TYR A N   
213  C CA  . TYR A 32 ? 0.2076 0.3725 0.3831 0.0177  0.0177  -0.0792 29  TYR A CA  
214  C C   . TYR A 32 ? 0.2475 0.4064 0.4018 0.0017  0.0341  -0.0717 29  TYR A C   
215  O O   . TYR A 32 ? 0.3258 0.5006 0.4880 -0.0092 0.0462  -0.0835 29  TYR A O   
216  C CB  . TYR A 32 ? 0.3180 0.4899 0.5021 0.0159  0.0146  -0.0838 29  TYR A CB  
217  C CG  . TYR A 32 ? 0.2569 0.4538 0.4595 0.0022  0.0273  -0.1011 29  TYR A CG  
218  C CD1 . TYR A 32 ? 0.2496 0.4657 0.4704 -0.0010 0.0333  -0.1191 29  TYR A CD1 
219  C CD2 . TYR A 32 ? 0.3173 0.5136 0.5131 -0.0094 0.0327  -0.0989 29  TYR A CD2 
220  C CE1 . TYR A 32 ? 0.2376 0.4685 0.4635 -0.0166 0.0446  -0.1332 29  TYR A CE1 
221  C CE2 . TYR A 32 ? 0.3204 0.5391 0.5307 -0.0254 0.0450  -0.1147 29  TYR A CE2 
222  C CZ  . TYR A 32 ? 0.3352 0.5671 0.5550 -0.0294 0.0509  -0.1301 29  TYR A CZ  
223  O OH  . TYR A 32 ? 0.3748 0.6187 0.5955 -0.0469 0.0619  -0.1428 29  TYR A OH  
224  N N   . LYS A 33 ? 0.2729 0.4089 0.4004 0.0002  0.0333  -0.0537 30  LYS A N   
225  C CA  . LYS A 33 ? 0.3309 0.4540 0.4352 -0.0125 0.0433  -0.0449 30  LYS A CA  
226  C C   . LYS A 33 ? 0.2397 0.3568 0.3356 -0.0107 0.0461  -0.0410 30  LYS A C   
227  O O   . LYS A 33 ? 0.2842 0.3929 0.3627 -0.0225 0.0542  -0.0368 30  LYS A O   
228  C CB  . LYS A 33 ? 0.2688 0.3704 0.3520 -0.0126 0.0385  -0.0305 30  LYS A CB  
229  C CG  . LYS A 33 ? 0.3315 0.4354 0.4192 -0.0160 0.0360  -0.0332 30  LYS A CG  
230  C CD  . LYS A 33 ? 0.4508 0.5349 0.5212 -0.0122 0.0288  -0.0215 30  LYS A CD  
231  C CE  . LYS A 33 ? 0.5136 0.5776 0.5621 -0.0229 0.0316  -0.0137 30  LYS A CE  
232  N NZ  . LYS A 33 ? 0.5030 0.5499 0.5390 -0.0151 0.0231  -0.0053 30  LYS A NZ  
233  N N   . SER A 34 ? 0.2420 0.3606 0.3476 0.0029  0.0381  -0.0420 31  SER A N   
234  C CA  A SER A 34 ? 0.2096 0.3213 0.3074 0.0051  0.0397  -0.0381 31  SER A CA  
235  C CA  B SER A 34 ? 0.1864 0.2979 0.2843 0.0056  0.0393  -0.0379 31  SER A CA  
236  C C   . SER A 34 ? 0.2506 0.3814 0.3708 0.0076  0.0418  -0.0548 31  SER A C   
237  O O   . SER A 34 ? 0.2840 0.4117 0.4007 0.0093  0.0434  -0.0543 31  SER A O   
238  C CB  A SER A 34 ? 0.1736 0.2689 0.2614 0.0166  0.0287  -0.0257 31  SER A CB  
239  C CB  B SER A 34 ? 0.1557 0.2515 0.2451 0.0178  0.0275  -0.0263 31  SER A CB  
240  O OG  A SER A 34 ? 0.1500 0.2332 0.2219 0.0149  0.0270  -0.0148 31  SER A OG  
241  O OG  B SER A 34 ? 0.1551 0.2569 0.2625 0.0287  0.0161  -0.0337 31  SER A OG  
242  N N   . ASN A 35 ? 0.1661 0.3187 0.3120 0.0081  0.0413  -0.0717 32  ASN A N   
243  C CA  . ASN A 35 ? 0.2718 0.4482 0.4464 0.0116  0.0421  -0.0934 32  ASN A CA  
244  C C   . ASN A 35 ? 0.2002 0.3683 0.3855 0.0298  0.0252  -0.0942 32  ASN A C   
245  O O   . ASN A 35 ? 0.2008 0.3784 0.4008 0.0330  0.0241  -0.1080 32  ASN A O   
246  C CB  . ASN A 35 ? 0.3265 0.5115 0.4928 -0.0035 0.0588  -0.0993 32  ASN A CB  
247  C CG  . ASN A 35 ? 0.3530 0.5566 0.5349 -0.0101 0.0619  -0.1204 32  ASN A CG  
248  O OD1 . ASN A 35 ? 0.3637 0.5784 0.5606 -0.0104 0.0587  -0.1309 32  ASN A OD1 
249  N ND2 . ASN A 35 ? 0.2910 0.4994 0.4701 -0.0158 0.0680  -0.1283 32  ASN A ND2 
250  N N   . LEU A 36 ? 0.1829 0.3278 0.3541 0.0391  0.0111  -0.0778 33  LEU A N   
251  C CA  . LEU A 36 ? 0.1921 0.3227 0.3677 0.0540  -0.0081 -0.0764 33  LEU A CA  
252  C C   . LEU A 36 ? 0.2249 0.3513 0.4097 0.0631  -0.0257 -0.0784 33  LEU A C   
253  O O   . LEU A 36 ? 0.2839 0.4081 0.4577 0.0580  -0.0226 -0.0705 33  LEU A O   
254  C CB  . LEU A 36 ? 0.2144 0.3179 0.3578 0.0529  -0.0097 -0.0536 33  LEU A CB  
255  C CG  . LEU A 36 ? 0.2598 0.3629 0.3889 0.0435  0.0062  -0.0482 33  LEU A CG  
256  C CD1 . LEU A 36 ? 0.2268 0.3069 0.3272 0.0422  0.0044  -0.0275 33  LEU A CD1 
257  C CD2 . LEU A 36 ? 0.2588 0.3704 0.4037 0.0476  0.0059  -0.0612 33  LEU A CD2 
258  N N   . ASP A 37 ? 0.2442 0.3660 0.4461 0.0763  -0.0459 -0.0882 34  ASP A N   
259  C CA  A ASP A 37 ? 0.2959 0.4092 0.4999 0.0818  -0.0628 -0.0894 34  ASP A CA  
260  C CA  B ASP A 37 ? 0.3082 0.4186 0.5113 0.0829  -0.0651 -0.0890 34  ASP A CA  
261  C C   . ASP A 37 ? 0.2463 0.3330 0.4204 0.0825  -0.0736 -0.0671 34  ASP A C   
262  O O   . ASP A 37 ? 0.2248 0.2938 0.3716 0.0774  -0.0695 -0.0501 34  ASP A O   
263  C CB  A ASP A 37 ? 0.3288 0.4341 0.5463 0.0900  -0.0813 -0.1043 34  ASP A CB  
264  C CB  B ASP A 37 ? 0.3397 0.4335 0.5485 0.0918  -0.0858 -0.0976 34  ASP A CB  
265  C CG  A ASP A 37 ? 0.3667 0.4426 0.5686 0.0963  -0.0982 -0.0943 34  ASP A CG  
266  C CG  B ASP A 37 ? 0.3477 0.4640 0.5847 0.0915  -0.0817 -0.1234 34  ASP A CG  
267  O OD1 A ASP A 37 ? 0.3986 0.4765 0.6002 0.0952  -0.0904 -0.0940 34  ASP A OD1 
268  O OD1 B ASP A 37 ? 0.3849 0.5275 0.6341 0.0831  -0.0645 -0.1336 34  ASP A OD1 
269  O OD2 A ASP A 37 ? 0.4408 0.4897 0.6282 0.1009  -0.1194 -0.0867 34  ASP A OD2 
270  O OD2 B ASP A 37 ? 0.3013 0.4083 0.5468 0.0984  -0.0963 -0.1341 34  ASP A OD2 
271  N N   . ARG A 38 ? 0.2817 0.3651 0.4568 0.0857  -0.0859 -0.0678 35  ARG A N   
272  C CA  . ARG A 38 ? 0.3074 0.3662 0.4469 0.0809  -0.0919 -0.0470 35  ARG A CA  
273  C C   . ARG A 38 ? 0.3133 0.3401 0.4282 0.0829  -0.1088 -0.0339 35  ARG A C   
274  O O   . ARG A 38 ? 0.3145 0.3263 0.3970 0.0734  -0.1028 -0.0161 35  ARG A O   
275  C CB  . ARG A 38 ? 0.3098 0.3674 0.4522 0.0841  -0.1051 -0.0503 35  ARG A CB  
276  C CG  . ARG A 38 ? 0.3610 0.4004 0.4655 0.0751  -0.1043 -0.0308 35  ARG A CG  
277  C CD  . ARG A 38 ? 0.6156 0.6488 0.7166 0.0778  -0.1203 -0.0322 35  ARG A CD  
278  N NE  . ARG A 38 ? 0.7346 0.7614 0.8045 0.0668  -0.1117 -0.0180 35  ARG A NE  
279  C CZ  . ARG A 38 ? 0.7869 0.8115 0.8485 0.0654  -0.1192 -0.0176 35  ARG A CZ  
280  N NH1 . ARG A 38 ? 0.7644 0.7908 0.8458 0.0747  -0.1368 -0.0293 35  ARG A NH1 
281  N NH2 . ARG A 38 ? 0.8273 0.8499 0.8628 0.0551  -0.1094 -0.0075 35  ARG A NH2 
282  N N   . THR A 39 ? 0.3786 0.3946 0.5059 0.0917  -0.1269 -0.0435 36  THR A N   
283  C CA  . THR A 39 ? 0.4348 0.4155 0.5344 0.0901  -0.1431 -0.0308 36  THR A CA  
284  C C   . THR A 39 ? 0.4179 0.3982 0.5081 0.0864  -0.1313 -0.0211 36  THR A C   
285  O O   . THR A 39 ? 0.3867 0.3428 0.4431 0.0784  -0.1353 -0.0030 36  THR A O   
286  C CB  . THR A 39 ? 0.5866 0.5511 0.6973 0.0968  -0.1624 -0.0441 36  THR A CB  
287  O OG1 . THR A 39 ? 0.5402 0.5291 0.6841 0.1026  -0.1533 -0.0638 36  THR A OG1 
288  C CG2 . THR A 39 ? 0.5137 0.4689 0.6273 0.1004  -0.1792 -0.0519 36  THR A CG2 
289  N N   . ALA A 40 ? 0.3109 0.3182 0.4276 0.0890  -0.1142 -0.0336 37  ALA A N   
290  C CA  . ALA A 40 ? 0.2531 0.2616 0.3565 0.0810  -0.0958 -0.0247 37  ALA A CA  
291  C C   . ALA A 40 ? 0.2848 0.2897 0.3578 0.0679  -0.0802 -0.0070 37  ALA A C   
292  O O   . ALA A 40 ? 0.3090 0.2984 0.3579 0.0611  -0.0780 0.0063  37  ALA A O   
293  C CB  . ALA A 40 ? 0.2661 0.3051 0.3978 0.0820  -0.0773 -0.0412 37  ALA A CB  
294  N N   . ILE A 41 ? 0.2095 0.2303 0.2857 0.0642  -0.0694 -0.0087 38  ILE A N   
295  C CA  . ILE A 41 ? 0.2108 0.2303 0.2635 0.0539  -0.0570 0.0038  38  ILE A CA  
296  C C   . ILE A 41 ? 0.2046 0.2001 0.2261 0.0483  -0.0695 0.0177  38  ILE A C   
297  O O   . ILE A 41 ? 0.2160 0.2073 0.2163 0.0389  -0.0602 0.0277  38  ILE A O   
298  C CB  . ILE A 41 ? 0.2617 0.2985 0.3232 0.0519  -0.0481 -0.0014 38  ILE A CB  
299  C CG1 . ILE A 41 ? 0.1439 0.2024 0.2279 0.0512  -0.0328 -0.0129 38  ILE A CG1 
300  C CG2 . ILE A 41 ? 0.2606 0.2942 0.2981 0.0428  -0.0399 0.0097  38  ILE A CG2 
301  C CD1 . ILE A 41 ? 0.1888 0.2475 0.2615 0.0444  -0.0179 -0.0064 38  ILE A CD1 
302  N N   . SER A 42 ? 0.2866 0.2689 0.3052 0.0522  -0.0890 0.0168  39  SER A N   
303  C CA  A SER A 42 ? 0.3945 0.3503 0.3784 0.0440  -0.1032 0.0301  39  SER A CA  
304  C CA  B SER A 42 ? 0.3883 0.3450 0.3717 0.0435  -0.1019 0.0303  39  SER A CA  
305  C C   . SER A 42 ? 0.4191 0.3536 0.3833 0.0384  -0.1081 0.0398  39  SER A C   
306  O O   . SER A 42 ? 0.3666 0.2896 0.2991 0.0244  -0.1047 0.0518  39  SER A O   
307  C CB  A SER A 42 ? 0.4157 0.3552 0.4016 0.0515  -0.1291 0.0263  39  SER A CB  
308  C CB  B SER A 42 ? 0.4084 0.3496 0.3905 0.0492  -0.1261 0.0277  39  SER A CB  
309  O OG  A SER A 42 ? 0.3920 0.3044 0.3386 0.0404  -0.1428 0.0397  39  SER A OG  
310  O OG  B SER A 42 ? 0.3992 0.3364 0.4080 0.0635  -0.1427 0.0161  39  SER A OG  
311  N N   . GLY A 43 ? 0.3518 0.2829 0.3365 0.0489  -0.1161 0.0325  40  GLY A N   
312  C CA  . GLY A 43 ? 0.3334 0.2428 0.3040 0.0459  -0.1238 0.0398  40  GLY A CA  
313  C C   . GLY A 43 ? 0.4050 0.3254 0.3649 0.0354  -0.1010 0.0465  40  GLY A C   
314  O O   . GLY A 43 ? 0.4086 0.3105 0.3404 0.0236  -0.1034 0.0582  40  GLY A O   
315  N N   . ILE A 44 ? 0.3658 0.3151 0.3469 0.0385  -0.0802 0.0386  41  ILE A N   
316  C CA  . ILE A 44 ? 0.3564 0.3165 0.3328 0.0317  -0.0610 0.0421  41  ILE A CA  
317  C C   . ILE A 44 ? 0.4234 0.3858 0.3764 0.0189  -0.0527 0.0500  41  ILE A C   
318  O O   . ILE A 44 ? 0.3424 0.3056 0.2823 0.0098  -0.0435 0.0549  41  ILE A O   
319  C CB  . ILE A 44 ? 0.3698 0.3547 0.3716 0.0377  -0.0450 0.0318  41  ILE A CB  
320  C CG1 . ILE A 44 ? 0.3244 0.3116 0.3494 0.0478  -0.0504 0.0212  41  ILE A CG1 
321  C CG2 . ILE A 44 ? 0.5265 0.5206 0.5216 0.0309  -0.0276 0.0355  41  ILE A CG2 
322  C CD1 . ILE A 44 ? 0.3767 0.3881 0.4256 0.0514  -0.0381 0.0085  41  ILE A CD1 
323  N N   . GLU A 45 ? 0.3148 0.2803 0.2643 0.0181  -0.0561 0.0490  42  GLU A N   
324  C CA  . GLU A 45 ? 0.3686 0.3425 0.3009 0.0067  -0.0461 0.0522  42  GLU A CA  
325  C C   . GLU A 45 ? 0.4139 0.3659 0.3122 -0.0074 -0.0558 0.0626  42  GLU A C   
326  O O   . GLU A 45 ? 0.4597 0.4187 0.3394 -0.0212 -0.0461 0.0647  42  GLU A O   
327  C CB  . GLU A 45 ? 0.3315 0.3177 0.2716 0.0099  -0.0451 0.0465  42  GLU A CB  
328  C CG  . GLU A 45 ? 0.3364 0.3460 0.2998 0.0155  -0.0293 0.0381  42  GLU A CG  
329  C CD  . GLU A 45 ? 0.3504 0.3706 0.3185 0.0164  -0.0282 0.0331  42  GLU A CD  
330  O OE1 . GLU A 45 ? 0.2992 0.3338 0.2821 0.0193  -0.0180 0.0271  42  GLU A OE1 
331  O OE2 . GLU A 45 ? 0.3859 0.3971 0.3410 0.0138  -0.0393 0.0355  42  GLU A OE2 
332  N N   . ARG A 46 ? 0.4711 0.3962 0.3609 -0.0048 -0.0759 0.0678  43  ARG A N   
333  C CA  . ARG A 46 ? 0.5939 0.4901 0.4467 -0.0204 -0.0880 0.0799  43  ARG A CA  
334  C C   . ARG A 46 ? 0.6321 0.5196 0.4819 -0.0240 -0.0858 0.0839  43  ARG A C   
335  O O   . ARG A 46 ? 0.8015 0.6818 0.6293 -0.0406 -0.0813 0.0882  43  ARG A O   
336  C CB  . ARG A 46 ? 0.6768 0.5454 0.5219 -0.0171 -0.1120 0.0813  43  ARG A CB  
337  C CG  . ARG A 46 ? 0.6689 0.5415 0.5098 -0.0165 -0.1168 0.0794  43  ARG A CG  
338  C CD  . ARG A 46 ? 0.7580 0.6321 0.5665 -0.0375 -0.1072 0.0843  43  ARG A CD  
339  N NE  . ARG A 46 ? 0.8338 0.7012 0.6342 -0.0374 -0.1182 0.0831  43  ARG A NE  
340  C CZ  . ARG A 46 ? 0.8373 0.6785 0.6132 -0.0483 -0.1314 0.0874  43  ARG A CZ  
341  N NH1 . ARG A 46 ? 0.8133 0.6321 0.5695 -0.0616 -0.1356 0.0933  43  ARG A NH1 
342  N NH2 . ARG A 46 ? 0.8470 0.6830 0.6173 -0.0469 -0.1413 0.0859  43  ARG A NH2 
343  N N   . ASN A 47 ? 0.5802 0.4759 0.4605 -0.0085 -0.0837 0.0767  44  ASN A N   
344  C CA  . ASN A 47 ? 0.6385 0.5294 0.5193 -0.0106 -0.0799 0.0788  44  ASN A CA  
345  C C   . ASN A 47 ? 0.5612 0.4724 0.4777 0.0054  -0.0703 0.0678  44  ASN A C   
346  O O   . ASN A 47 ? 0.6468 0.5561 0.5847 0.0195  -0.0807 0.0601  44  ASN A O   
347  C CB  . ASN A 47 ? 0.6830 0.5418 0.5505 -0.0133 -0.0997 0.0830  44  ASN A CB  
348  C CG  . ASN A 47 ? 0.7559 0.6097 0.6228 -0.0170 -0.0957 0.0846  44  ASN A CG  
349  O OD1 . ASN A 47 ? 0.7546 0.6255 0.6237 -0.0208 -0.0789 0.0856  44  ASN A OD1 
350  N ND2 . ASN A 47 ? 0.8164 0.6460 0.6805 -0.0162 -0.1122 0.0840  44  ASN A ND2 
351  N N   . SER A 48 ? 0.5269 0.4572 0.4492 0.0022  -0.0514 0.0657  45  SER A N   
352  C CA  . SER A 48 ? 0.5343 0.4826 0.4840 0.0139  -0.0412 0.0564  45  SER A CA  
353  C C   . SER A 48 ? 0.4867 0.4274 0.4423 0.0173  -0.0432 0.0555  45  SER A C   
354  O O   . SER A 48 ? 0.4685 0.4241 0.4411 0.0233  -0.0326 0.0486  45  SER A O   
355  C CB  . SER A 48 ? 0.6199 0.5915 0.5748 0.0112  -0.0227 0.0530  45  SER A CB  
356  O OG  . SER A 48 ? 0.6628 0.6377 0.6137 0.0059  -0.0141 0.0544  45  SER A OG  
357  N N   . ARG A 49 ? 0.5062 0.4218 0.4459 0.0127  -0.0579 0.0624  46  ARG A N   
358  C CA  . ARG A 49 ? 0.5467 0.4528 0.4926 0.0166  -0.0623 0.0608  46  ARG A CA  
359  C C   . ARG A 49 ? 0.4924 0.4106 0.4692 0.0327  -0.0627 0.0469  46  ARG A C   
360  O O   . ARG A 49 ? 0.4021 0.3328 0.3903 0.0355  -0.0515 0.0415  46  ARG A O   
361  C CB  . ARG A 49 ? 0.6229 0.4941 0.5466 0.0099  -0.0832 0.0700  46  ARG A CB  
362  C CG  . ARG A 49 ? 0.7255 0.5782 0.6516 0.0173  -0.1053 0.0671  46  ARG A CG  
363  C CD  . ARG A 49 ? 0.7889 0.6138 0.6974 0.0086  -0.1207 0.0702  46  ARG A CD  
364  N NE  . ARG A 49 ? 0.8537 0.6749 0.7657 0.0083  -0.1185 0.0696  46  ARG A NE  
365  C CZ  . ARG A 49 ? 0.8700 0.6680 0.7660 -0.0010 -0.1297 0.0732  46  ARG A CZ  
366  N NH1 . ARG A 49 ? 0.9814 0.7559 0.8550 -0.0117 -0.1446 0.0778  46  ARG A NH1 
367  N NH2 . ARG A 49 ? 0.8250 0.6218 0.7261 -0.0003 -0.1270 0.0719  46  ARG A NH2 
368  N N   . ASN A 50 ? 0.4211 0.3379 0.4114 0.0422  -0.0749 0.0397  47  ASN A N   
369  C CA  . ASN A 50 ? 0.4792 0.4109 0.5009 0.0557  -0.0755 0.0228  47  ASN A CA  
370  C C   . ASN A 50 ? 0.4195 0.3816 0.4586 0.0576  -0.0571 0.0133  47  ASN A C   
371  O O   . ASN A 50 ? 0.4562 0.4342 0.5208 0.0660  -0.0567 -0.0027 47  ASN A O   
372  C CB  . ASN A 50 ? 0.5695 0.4860 0.6037 0.0667  -0.1004 0.0147  47  ASN A CB  
373  C CG  . ASN A 50 ? 0.6793 0.5675 0.7035 0.0664  -0.1181 0.0180  47  ASN A CG  
374  O OD1 . ASN A 50 ? 0.7181 0.6055 0.7427 0.0658  -0.1127 0.0185  47  ASN A OD1 
375  N ND2 . ASN A 50 ? 0.6522 0.5188 0.6657 0.0639  -0.1368 0.0190  47  ASN A ND2 
376  N N   . LEU A 51 ? 0.2921 0.2625 0.3176 0.0488  -0.0426 0.0216  48  LEU A N   
377  C CA  . LEU A 51 ? 0.3261 0.3199 0.3633 0.0484  -0.0261 0.0144  48  LEU A CA  
378  C C   . LEU A 51 ? 0.3084 0.3108 0.3517 0.0480  -0.0151 0.0088  48  LEU A C   
379  O O   . LEU A 51 ? 0.2383 0.2323 0.2692 0.0442  -0.0128 0.0161  48  LEU A O   
380  C CB  . LEU A 51 ? 0.3192 0.3157 0.3401 0.0401  -0.0170 0.0241  48  LEU A CB  
381  C CG  . LEU A 51 ? 0.3316 0.3442 0.3566 0.0373  -0.0024 0.0208  48  LEU A CG  
382  C CD1 . LEU A 51 ? 0.3680 0.3917 0.4074 0.0403  -0.0031 0.0124  48  LEU A CD1 
383  C CD2 . LEU A 51 ? 0.4120 0.4239 0.4215 0.0306  0.0032  0.0290  48  LEU A CD2 
384  N N   . THR A 52 ? 0.2495 0.2696 0.3108 0.0504  -0.0079 -0.0050 49  THR A N   
385  C CA  . THR A 52 ? 0.2215 0.2491 0.2823 0.0466  0.0040  -0.0092 49  THR A CA  
386  C C   . THR A 52 ? 0.2394 0.2706 0.2855 0.0375  0.0173  -0.0024 49  THR A C   
387  O O   . THR A 52 ? 0.2244 0.2581 0.2671 0.0349  0.0192  0.0012  49  THR A O   
388  C CB  . THR A 52 ? 0.2158 0.2634 0.3001 0.0494  0.0081  -0.0298 49  THR A CB  
389  O OG1 . THR A 52 ? 0.2129 0.2767 0.3056 0.0457  0.0149  -0.0367 49  THR A OG1 
390  C CG2 . THR A 52 ? 0.2611 0.3062 0.3658 0.0611  -0.0083 -0.0410 49  THR A CG2 
391  N N   . ILE A 53 ? 0.1881 0.2179 0.2253 0.0330  0.0248  -0.0016 50  ILE A N   
392  C CA  . ILE A 53 ? 0.2204 0.2487 0.2426 0.0249  0.0334  0.0039  50  ILE A CA  
393  C C   . ILE A 53 ? 0.1818 0.2219 0.2074 0.0183  0.0412  -0.0034 50  ILE A C   
394  O O   . ILE A 53 ? 0.2271 0.2628 0.2418 0.0128  0.0436  0.0025  50  ILE A O   
395  C CB  . ILE A 53 ? 0.2234 0.2461 0.2340 0.0206  0.0381  0.0045  50  ILE A CB  
396  C CG1 . ILE A 53 ? 0.2661 0.2787 0.2743 0.0255  0.0316  0.0100  50  ILE A CG1 
397  C CG2 . ILE A 53 ? 0.2279 0.2420 0.2203 0.0132  0.0415  0.0113  50  ILE A CG2 
398  C CD1 . ILE A 53 ? 0.2414 0.2464 0.2419 0.0260  0.0272  0.0203  50  ILE A CD1 
399  N N   . LYS A 54 ? 0.1809 0.2363 0.2216 0.0176  0.0452  -0.0178 51  LYS A N   
400  C CA  . LYS A 54 ? 0.2543 0.3248 0.3002 0.0088  0.0541  -0.0274 51  LYS A CA  
401  C C   . LYS A 54 ? 0.2472 0.3207 0.3013 0.0121  0.0494  -0.0256 51  LYS A C   
402  O O   . LYS A 54 ? 0.2498 0.3246 0.2968 0.0035  0.0547  -0.0239 51  LYS A O   
403  C CB  . LYS A 54 ? 0.2832 0.3758 0.3504 0.0085  0.0590  -0.0479 51  LYS A CB  
404  C CG  . LYS A 54 ? 0.4989 0.6103 0.5677 -0.0063 0.0723  -0.0599 51  LYS A CG  
405  C CD  . LYS A 54 ? 0.6119 0.7503 0.7029 -0.0085 0.0796  -0.0841 51  LYS A CD  
406  C CE  . LYS A 54 ? 0.6665 0.7995 0.7466 -0.0101 0.0824  -0.0847 51  LYS A CE  
407  N NZ  . LYS A 54 ? 0.7389 0.8587 0.7834 -0.0287 0.0929  -0.0740 51  LYS A NZ  
408  N N   . SER A 55 ? 0.2235 0.2969 0.2924 0.0240  0.0381  -0.0270 52  SER A N   
409  C CA  . SER A 55 ? 0.1885 0.2609 0.2611 0.0275  0.0316  -0.0231 52  SER A CA  
410  C C   . SER A 55 ? 0.1833 0.2418 0.2359 0.0242  0.0315  -0.0079 52  SER A C   
411  O O   . SER A 55 ? 0.1509 0.2124 0.2041 0.0222  0.0315  -0.0071 52  SER A O   
412  C CB  . SER A 55 ? 0.1355 0.2023 0.2198 0.0396  0.0160  -0.0244 52  SER A CB  
413  O OG  . SER A 55 ? 0.1981 0.2806 0.3078 0.0449  0.0128  -0.0425 52  SER A OG  
414  N N   . LEU A 56 ? 0.1428 0.1878 0.1803 0.0246  0.0301  0.0024  53  LEU A N   
415  C CA  . LEU A 56 ? 0.1644 0.2006 0.1881 0.0226  0.0293  0.0122  53  LEU A CA  
416  C C   . LEU A 56 ? 0.1754 0.2105 0.1907 0.0143  0.0360  0.0122  53  LEU A C   
417  O O   . LEU A 56 ? 0.1417 0.1738 0.1526 0.0130  0.0343  0.0154  53  LEU A O   
418  C CB  . LEU A 56 ? 0.2065 0.2324 0.2195 0.0238  0.0270  0.0196  53  LEU A CB  
419  C CG  . LEU A 56 ? 0.2281 0.2489 0.2306 0.0217  0.0269  0.0251  53  LEU A CG  
420  C CD1 . LEU A 56 ? 0.1731 0.1973 0.1763 0.0230  0.0229  0.0270  53  LEU A CD1 
421  C CD2 . LEU A 56 ? 0.2604 0.2751 0.2563 0.0220  0.0260  0.0283  53  LEU A CD2 
422  N N   . GLU A 57 ? 0.1444 0.1799 0.1552 0.0076  0.0424  0.0083  54  GLU A N   
423  C CA  . GLU A 57 ? 0.1640 0.1941 0.1618 -0.0037 0.0473  0.0088  54  GLU A CA  
424  C C   . GLU A 57 ? 0.1533 0.1944 0.1605 -0.0080 0.0500  0.0028  54  GLU A C   
425  O O   . GLU A 57 ? 0.2190 0.2517 0.2170 -0.0132 0.0485  0.0069  54  GLU A O   
426  C CB  . GLU A 57 ? 0.1996 0.2322 0.1908 -0.0129 0.0553  0.0030  54  GLU A CB  
427  C CG  . GLU A 57 ? 0.3035 0.3250 0.2731 -0.0289 0.0596  0.0052  54  GLU A CG  
428  C CD  . GLU A 57 ? 0.3995 0.4171 0.3543 -0.0383 0.0653  0.0030  54  GLU A CD  
429  O OE1 . GLU A 57 ? 0.4207 0.4576 0.3902 -0.0378 0.0725  -0.0086 54  GLU A OE1 
430  O OE2 . GLU A 57 ? 0.4997 0.4944 0.4294 -0.0449 0.0608  0.0118  54  GLU A OE2 
431  N N   . LEU A 58 ? 0.1441 0.2036 0.1715 -0.0048 0.0522  -0.0079 55  LEU A N   
432  C CA  . LEU A 58 ? 0.1660 0.2396 0.2073 -0.0076 0.0542  -0.0163 55  LEU A CA  
433  C C   . LEU A 58 ? 0.1887 0.2551 0.2294 -0.0007 0.0456  -0.0085 55  LEU A C   
434  O O   . LEU A 58 ? 0.1780 0.2441 0.2163 -0.0067 0.0467  -0.0085 55  LEU A O   
435  C CB  . LEU A 58 ? 0.2345 0.3286 0.3028 -0.0002 0.0530  -0.0312 55  LEU A CB  
436  C CG  . LEU A 58 ? 0.2675 0.3782 0.3451 -0.0067 0.0625  -0.0461 55  LEU A CG  
437  C CD1 . LEU A 58 ? 0.2796 0.4112 0.3895 0.0036  0.0573  -0.0639 55  LEU A CD1 
438  C CD2 . LEU A 58 ? 0.3307 0.4487 0.3982 -0.0263 0.0756  -0.0512 55  LEU A CD2 
439  N N   . ILE A 59 ? 0.1499 0.2099 0.1906 0.0101  0.0374  -0.0021 56  ILE A N   
440  C CA  . ILE A 59 ? 0.1303 0.1844 0.1668 0.0147  0.0304  0.0047  56  ILE A CA  
441  C C   . ILE A 59 ? 0.1989 0.2420 0.2211 0.0101  0.0310  0.0106  56  ILE A C   
442  O O   . ILE A 59 ? 0.1822 0.2256 0.2052 0.0096  0.0285  0.0104  56  ILE A O   
443  C CB  . ILE A 59 ? 0.1598 0.2090 0.1942 0.0226  0.0229  0.0100  56  ILE A CB  
444  C CG1 . ILE A 59 ? 0.2058 0.2610 0.2546 0.0288  0.0158  0.0039  56  ILE A CG1 
445  C CG2 . ILE A 59 ? 0.1499 0.1948 0.1755 0.0235  0.0188  0.0157  56  ILE A CG2 
446  C CD1 . ILE A 59 ? 0.1986 0.2443 0.2436 0.0337  0.0084  0.0079  56  ILE A CD1 
447  N N   . MET A 60 ? 0.1464 0.1786 0.1564 0.0073  0.0324  0.0147  57  MET A N   
448  C CA  A MET A 60 ? 0.1894 0.2079 0.1871 0.0039  0.0290  0.0185  57  MET A CA  
449  C CA  B MET A 60 ? 0.1885 0.2061 0.1851 0.0033  0.0294  0.0186  57  MET A CA  
450  C C   . MET A 60 ? 0.1491 0.1630 0.1416 -0.0062 0.0309  0.0167  57  MET A C   
451  O O   . MET A 60 ? 0.2236 0.2306 0.2137 -0.0061 0.0252  0.0175  57  MET A O   
452  C CB  A MET A 60 ? 0.2561 0.2616 0.2417 0.0036  0.0270  0.0224  57  MET A CB  
453  C CB  B MET A 60 ? 0.2725 0.2775 0.2558 0.0001  0.0297  0.0220  57  MET A CB  
454  C CG  A MET A 60 ? 0.2088 0.2194 0.1995 0.0118  0.0251  0.0235  57  MET A CG  
455  C CG  B MET A 60 ? 0.2622 0.2651 0.2459 0.0083  0.0251  0.0244  57  MET A CG  
456  S SD  A MET A 60 ? 0.2356 0.2330 0.2153 0.0118  0.0224  0.0262  57  MET A SD  
457  S SD  B MET A 60 ? 0.2632 0.2601 0.2392 0.0069  0.0278  0.0262  57  MET A SD  
458  C CE  A MET A 60 ? 0.2323 0.2196 0.1981 0.0005  0.0274  0.0270  57  MET A CE  
459  C CE  B MET A 60 ? 0.1526 0.1492 0.1317 0.0152  0.0216  0.0272  57  MET A CE  
460  N N   . LYS A 61 ? 0.2450 0.2634 0.2358 -0.0159 0.0388  0.0130  58  LYS A N   
461  C CA  . LYS A 61 ? 0.3105 0.3265 0.2953 -0.0293 0.0422  0.0105  58  LYS A CA  
462  C C   . LYS A 61 ? 0.3272 0.3553 0.3278 -0.0254 0.0405  0.0060  58  LYS A C   
463  O O   . LYS A 61 ? 0.3370 0.3560 0.3307 -0.0326 0.0378  0.0071  58  LYS A O   
464  C CB  . LYS A 61 ? 0.3767 0.4039 0.3607 -0.0420 0.0539  0.0033  58  LYS A CB  
465  C CG  . LYS A 61 ? 0.4235 0.4323 0.3832 -0.0509 0.0547  0.0091  58  LYS A CG  
466  C CD  . LYS A 61 ? 0.5121 0.5296 0.4633 -0.0691 0.0675  0.0015  58  LYS A CD  
467  C CE  . LYS A 61 ? 0.5493 0.5472 0.4756 -0.0747 0.0661  0.0082  58  LYS A CE  
468  N NZ  . LYS A 61 ? 0.5547 0.5620 0.4693 -0.0945 0.0797  -0.0001 58  LYS A NZ  
469  N N   . GLY A 62 ? 0.2469 0.2924 0.2669 -0.0144 0.0400  0.0014  59  GLY A N   
470  C CA  . GLY A 62 ? 0.2053 0.2615 0.2394 -0.0100 0.0367  -0.0031 59  GLY A CA  
471  C C   . GLY A 62 ? 0.2940 0.3410 0.3232 -0.0034 0.0283  0.0024  59  GLY A C   
472  O O   . GLY A 62 ? 0.2907 0.3393 0.3236 -0.0049 0.0258  0.0000  59  GLY A O   
473  N N   . LEU A 63 ? 0.2261 0.2654 0.2480 0.0032  0.0244  0.0079  60  LEU A N   
474  C CA  . LEU A 63 ? 0.2279 0.2611 0.2460 0.0078  0.0176  0.0094  60  LEU A CA  
475  C C   . LEU A 63 ? 0.2954 0.3109 0.3028 0.0019  0.0132  0.0107  60  LEU A C   
476  O O   . LEU A 63 ? 0.3040 0.3145 0.3117 0.0060  0.0058  0.0087  60  LEU A O   
477  C CB  . LEU A 63 ? 0.2482 0.2811 0.2631 0.0142  0.0158  0.0119  60  LEU A CB  
478  C CG  . LEU A 63 ? 0.2503 0.2937 0.2700 0.0184  0.0169  0.0127  60  LEU A CG  
479  C CD1 . LEU A 63 ? 0.2793 0.3206 0.2930 0.0207  0.0168  0.0158  60  LEU A CD1 
480  C CD2 . LEU A 63 ? 0.2556 0.3069 0.2787 0.0209  0.0129  0.0102  60  LEU A CD2 
481  N N   . GLU A 64 ? 0.2402 0.2449 0.2368 -0.0086 0.0166  0.0131  61  GLU A N   
482  C CA  . GLU A 64 ? 0.3173 0.2961 0.2959 -0.0157 0.0090  0.0170  61  GLU A CA  
483  C C   . GLU A 64 ? 0.3471 0.3140 0.3223 -0.0062 -0.0014 0.0180  61  GLU A C   
484  O O   . GLU A 64 ? 0.3611 0.3142 0.3344 -0.0029 -0.0134 0.0159  61  GLU A O   
485  C CB  . GLU A 64 ? 0.4548 0.4251 0.4317 -0.0216 0.0036  0.0153  61  GLU A CB  
486  C CG  . GLU A 64 ? 0.5764 0.5566 0.5547 -0.0350 0.0138  0.0128  61  GLU A CG  
487  C CD  . GLU A 64 ? 0.7194 0.6897 0.6943 -0.0434 0.0089  0.0115  61  GLU A CD  
488  O OE1 . GLU A 64 ? 0.7309 0.7036 0.7163 -0.0333 0.0012  0.0086  61  GLU A OE1 
489  O OE2 . GLU A 64 ? 0.8251 0.7857 0.7857 -0.0619 0.0132  0.0128  61  GLU A OE2 
490  N N   . VAL A 65 ? 0.2918 0.2648 0.2683 -0.0014 0.0022  0.0193  62  VAL A N   
491  C CA  . VAL A 65 ? 0.2490 0.2160 0.2261 0.0074  -0.0063 0.0176  62  VAL A CA  
492  C C   . VAL A 65 ? 0.2785 0.2329 0.2417 0.0024  -0.0051 0.0229  62  VAL A C   
493  O O   . VAL A 65 ? 0.3462 0.3095 0.3081 -0.0030 0.0057  0.0252  62  VAL A O   
494  C CB  . VAL A 65 ? 0.3063 0.2968 0.2991 0.0168  -0.0020 0.0130  62  VAL A CB  
495  C CG1 . VAL A 65 ? 0.3616 0.3631 0.3551 0.0153  0.0082  0.0170  62  VAL A CG1 
496  C CG2 . VAL A 65 ? 0.3245 0.3146 0.3222 0.0245  -0.0098 0.0072  62  VAL A CG2 
497  N N   . SER A 66 ? 0.3190 0.2521 0.2721 0.0041  -0.0176 0.0234  63  SER A N   
498  C CA  . SER A 66 ? 0.3510 0.2686 0.2875 -0.0011 -0.0187 0.0286  63  SER A CA  
499  C C   . SER A 66 ? 0.3127 0.2496 0.2620 0.0071  -0.0118 0.0264  63  SER A C   
500  O O   . SER A 66 ? 0.2803 0.2355 0.2473 0.0164  -0.0112 0.0206  63  SER A O   
501  C CB  . SER A 66 ? 0.3244 0.2105 0.2471 0.0004  -0.0386 0.0291  63  SER A CB  
502  O OG  . SER A 66 ? 0.3175 0.2129 0.2595 0.0157  -0.0474 0.0198  63  SER A OG  
503  N N   . ASP A 67 ? 0.2827 0.2158 0.2215 0.0019  -0.0064 0.0305  64  ASP A N   
504  C CA  . ASP A 67 ? 0.3540 0.3017 0.3027 0.0083  -0.0010 0.0290  64  ASP A CA  
505  C C   . ASP A 67 ? 0.3095 0.2566 0.2666 0.0181  -0.0111 0.0239  64  ASP A C   
506  O O   . ASP A 67 ? 0.2495 0.2163 0.2216 0.0240  -0.0064 0.0197  64  ASP A O   
507  C CB  . ASP A 67 ? 0.4386 0.3795 0.3735 0.0010  0.0044  0.0329  64  ASP A CB  
508  C CG  . ASP A 67 ? 0.5573 0.4688 0.4657 -0.0089 -0.0042 0.0375  64  ASP A CG  
509  O OD1 . ASP A 67 ? 0.5595 0.4500 0.4599 -0.0073 -0.0193 0.0381  64  ASP A OD1 
510  O OD2 . ASP A 67 ? 0.5812 0.4893 0.4753 -0.0191 0.0032  0.0399  64  ASP A OD2 
511  N N   . VAL A 68 ? 0.2829 0.2067 0.2298 0.0187  -0.0259 0.0233  65  VAL A N   
512  C CA  . VAL A 68 ? 0.2554 0.1781 0.2135 0.0293  -0.0388 0.0146  65  VAL A CA  
513  C C   . VAL A 68 ? 0.3000 0.2472 0.2822 0.0375  -0.0377 0.0035  65  VAL A C   
514  O O   . VAL A 68 ? 0.2077 0.1734 0.2059 0.0434  -0.0365 -0.0054 65  VAL A O   
515  C CB  . VAL A 68 ? 0.2899 0.1790 0.2326 0.0291  -0.0591 0.0151  65  VAL A CB  
516  C CG1 . VAL A 68 ? 0.3055 0.1950 0.2677 0.0426  -0.0770 0.0008  65  VAL A CG1 
517  C CG2 . VAL A 68 ? 0.3355 0.2004 0.2530 0.0215  -0.0628 0.0236  65  VAL A CG2 
518  N N   . VAL A 69 ? 0.2358 0.1828 0.2192 0.0360  -0.0382 0.0032  66  VAL A N   
519  C CA  . VAL A 69 ? 0.2647 0.2351 0.2684 0.0421  -0.0366 -0.0080 66  VAL A CA  
520  C C   . VAL A 69 ? 0.2055 0.2040 0.2171 0.0398  -0.0200 -0.0077 66  VAL A C   
521  O O   . VAL A 69 ? 0.2109 0.2307 0.2366 0.0430  -0.0176 -0.0180 66  VAL A O   
522  C CB  . VAL A 69 ? 0.3345 0.2970 0.3357 0.0401  -0.0405 -0.0073 66  VAL A CB  
523  C CG1 . VAL A 69 ? 0.3178 0.3076 0.3376 0.0445  -0.0355 -0.0182 66  VAL A CG1 
524  C CG2 . VAL A 69 ? 0.4263 0.3593 0.4221 0.0439  -0.0623 -0.0113 66  VAL A CG2 
525  N N   . PHE A 70 ? 0.2005 0.1978 0.2021 0.0332  -0.0101 0.0032  67  PHE A N   
526  C CA  . PHE A 70 ? 0.1532 0.1681 0.1573 0.0306  0.0017  0.0062  67  PHE A CA  
527  C C   . PHE A 70 ? 0.1877 0.2105 0.1956 0.0317  0.0034  0.0031  67  PHE A C   
528  O O   . PHE A 70 ? 0.1353 0.1761 0.1488 0.0296  0.0091  -0.0008 67  PHE A O   
529  C CB  . PHE A 70 ? 0.1305 0.1395 0.1259 0.0255  0.0084  0.0157  67  PHE A CB  
530  C CG  . PHE A 70 ? 0.1528 0.1749 0.1508 0.0241  0.0156  0.0183  67  PHE A CG  
531  C CD1 . PHE A 70 ? 0.2055 0.2359 0.2064 0.0233  0.0172  0.0182  67  PHE A CD1 
532  C CD2 . PHE A 70 ? 0.1259 0.1482 0.1217 0.0234  0.0183  0.0211  67  PHE A CD2 
533  C CE1 . PHE A 70 ? 0.2286 0.2648 0.2283 0.0217  0.0196  0.0214  67  PHE A CE1 
534  C CE2 . PHE A 70 ? 0.1163 0.1449 0.1117 0.0215  0.0211  0.0241  67  PHE A CE2 
535  C CZ  . PHE A 70 ? 0.1899 0.2238 0.1860 0.0205  0.0209  0.0247  67  PHE A CZ  
536  N N   . PHE A 71 ? 0.1841 0.1931 0.1859 0.0324  -0.0003 0.0061  68  PHE A N   
537  C CA  . PHE A 71 ? 0.1740 0.1904 0.1809 0.0336  0.0003  0.0020  68  PHE A CA  
538  C C   . PHE A 71 ? 0.1440 0.1751 0.1669 0.0382  -0.0050 -0.0128 68  PHE A C   
539  O O   . PHE A 71 ? 0.1603 0.2094 0.1911 0.0358  0.0004  -0.0192 68  PHE A O   
540  C CB  . PHE A 71 ? 0.1891 0.1875 0.1853 0.0333  -0.0031 0.0078  68  PHE A CB  
541  C CG  . PHE A 71 ? 0.2987 0.2918 0.2842 0.0280  0.0052  0.0179  68  PHE A CG  
542  C CD1 . PHE A 71 ? 0.2723 0.2774 0.2611 0.0258  0.0133  0.0205  68  PHE A CD1 
543  C CD2 . PHE A 71 ? 0.3914 0.3675 0.3631 0.0239  0.0040  0.0234  68  PHE A CD2 
544  C CE1 . PHE A 71 ? 0.2990 0.3010 0.2830 0.0231  0.0185  0.0262  68  PHE A CE1 
545  C CE2 . PHE A 71 ? 0.3795 0.3571 0.3463 0.0190  0.0127  0.0279  68  PHE A CE2 
546  C CZ  . PHE A 71 ? 0.3141 0.3055 0.2898 0.0203  0.0191  0.0283  68  PHE A CZ  
547  N N   . GLU A 72 ? 0.1715 0.1965 0.2004 0.0440  -0.0159 -0.0205 69  GLU A N   
548  C CA  . GLU A 72 ? 0.2035 0.2459 0.2531 0.0501  -0.0224 -0.0395 69  GLU A CA  
549  C C   . GLU A 72 ? 0.1264 0.1975 0.1850 0.0453  -0.0112 -0.0474 69  GLU A C   
550  O O   . GLU A 72 ? 0.1260 0.2231 0.2003 0.0441  -0.0076 -0.0632 69  GLU A O   
551  C CB  . GLU A 72 ? 0.2241 0.2498 0.2791 0.0590  -0.0406 -0.0475 69  GLU A CB  
552  C CG  . GLU A 72 ? 0.2719 0.2728 0.3225 0.0647  -0.0570 -0.0477 69  GLU A CG  
553  C CD  . GLU A 72 ? 0.3044 0.2706 0.3426 0.0681  -0.0760 -0.0438 69  GLU A CD  
554  O OE1 . GLU A 72 ? 0.3550 0.3181 0.3931 0.0679  -0.0781 -0.0442 69  GLU A OE1 
555  O OE2 . GLU A 72 ? 0.3522 0.2911 0.3782 0.0698  -0.0902 -0.0399 69  GLU A OE2 
556  N N   . MET A 73 ? 0.1438 0.2115 0.1923 0.0412  -0.0056 -0.0378 70  MET A N   
557  C CA  . MET A 73 ? 0.1483 0.2405 0.1995 0.0344  0.0047  -0.0433 70  MET A CA  
558  C C   . MET A 73 ? 0.1263 0.2276 0.1679 0.0239  0.0162  -0.0367 70  MET A C   
559  O O   . MET A 73 ? 0.1580 0.2821 0.2019 0.0155  0.0239  -0.0457 70  MET A O   
560  C CB  . MET A 73 ? 0.1921 0.2773 0.2341 0.0326  0.0064  -0.0345 70  MET A CB  
561  C CG  . MET A 73 ? 0.2867 0.3651 0.3372 0.0402  -0.0043 -0.0422 70  MET A CG  
562  S SD  . MET A 73 ? 0.3741 0.4408 0.4125 0.0370  -0.0020 -0.0292 70  MET A SD  
563  C CE  . MET A 73 ? 0.3580 0.4125 0.4057 0.0450  -0.0170 -0.0390 70  MET A CE  
564  N N   . LEU A 74 ? 0.1306 0.2136 0.1600 0.0230  0.0170  -0.0217 71  LEU A N   
565  C CA  . LEU A 74 ? 0.1224 0.2079 0.1417 0.0140  0.0244  -0.0144 71  LEU A CA  
566  C C   . LEU A 74 ? 0.1249 0.2265 0.1545 0.0112  0.0264  -0.0267 71  LEU A C   
567  O O   . LEU A 74 ? 0.1208 0.2378 0.1469 0.0001  0.0340  -0.0304 71  LEU A O   
568  C CB  . LEU A 74 ? 0.1165 0.1805 0.1254 0.0160  0.0230  0.0002  71  LEU A CB  
569  C CG  . LEU A 74 ? 0.1484 0.2087 0.1474 0.0089  0.0270  0.0082  71  LEU A CG  
570  C CD1 . LEU A 74 ? 0.1329 0.1968 0.1207 -0.0005 0.0301  0.0126  71  LEU A CD1 
571  C CD2 . LEU A 74 ? 0.2069 0.2486 0.2006 0.0131  0.0246  0.0183  71  LEU A CD2 
572  N N   . ILE A 75 ? 0.1156 0.2138 0.1578 0.0205  0.0185  -0.0345 72  ILE A N   
573  C CA  . ILE A 75 ? 0.1310 0.2474 0.1880 0.0193  0.0189  -0.0497 72  ILE A CA  
574  C C   . ILE A 75 ? 0.1661 0.3156 0.2398 0.0147  0.0236  -0.0712 72  ILE A C   
575  O O   . ILE A 75 ? 0.1951 0.3677 0.2729 0.0034  0.0328  -0.0810 72  ILE A O   
576  C CB  . ILE A 75 ? 0.1419 0.2453 0.2101 0.0324  0.0048  -0.0558 72  ILE A CB  
577  C CG1 . ILE A 75 ? 0.2046 0.2813 0.2566 0.0337  0.0023  -0.0388 72  ILE A CG1 
578  C CG2 . ILE A 75 ? 0.2092 0.3378 0.3018 0.0342  0.0023  -0.0789 72  ILE A CG2 
579  C CD1 . ILE A 75 ? 0.2158 0.2669 0.2657 0.0444  -0.0137 -0.0376 72  ILE A CD1 
580  N N   . LYS A 76 ? 0.1187 0.2715 0.2018 0.0222  0.0177  -0.0798 73  LYS A N   
581  C CA  . LYS A 76 ? 0.2769 0.4618 0.3768 0.0188  0.0219  -0.1021 73  LYS A CA  
582  C C   . LYS A 76 ? 0.1468 0.3478 0.2291 -0.0007 0.0383  -0.0976 73  LYS A C   
583  O O   . LYS A 76 ? 0.1467 0.3685 0.2330 -0.0125 0.0436  -0.1118 73  LYS A O   
584  C CB  . LYS A 76 ? 0.1855 0.3644 0.2927 0.0294  0.0124  -0.1072 73  LYS A CB  
585  C CG  . LYS A 76 ? 0.2949 0.5011 0.4167 0.0250  0.0138  -0.1301 73  LYS A CG  
586  C CD  . LYS A 76 ? 0.2871 0.4857 0.4188 0.0366  0.0012  -0.1378 73  LYS A CD  
587  C CE  . LYS A 76 ? 0.3063 0.5298 0.4440 0.0277  0.0052  -0.1557 73  LYS A CE  
588  N NZ  . LYS A 76 ? 0.3973 0.6155 0.5452 0.0377  -0.0069 -0.1649 73  LYS A NZ  
589  N N   . GLU A 77 ? 0.1728 0.3514 0.2300 -0.0052 0.0404  -0.0749 74  GLU A N   
590  C CA  . GLU A 77 ? 0.2138 0.3978 0.2481 -0.0237 0.0513  -0.0670 74  GLU A CA  
591  C C   . GLU A 77 ? 0.2892 0.4770 0.3137 -0.0380 0.0585  -0.0642 74  GLU A C   
592  O O   . GLU A 77 ? 0.2464 0.4446 0.2611 -0.0550 0.0642  -0.0694 74  GLU A O   
593  C CB  . GLU A 77 ? 0.4429 0.5984 0.4561 -0.0221 0.0475  -0.0444 74  GLU A CB  
594  C CG  . GLU A 77 ? 0.4416 0.5965 0.4296 -0.0389 0.0532  -0.0361 74  GLU A CG  
595  C CD  . GLU A 77 ? 0.4631 0.6430 0.4530 -0.0465 0.0588  -0.0516 74  GLU A CD  
596  O OE1 . GLU A 77 ? 0.4318 0.6211 0.4416 -0.0340 0.0550  -0.0637 74  GLU A OE1 
597  O OE2 . GLU A 77 ? 0.5430 0.7238 0.5141 -0.0642 0.0624  -0.0501 74  GLU A OE2 
598  N N   . ILE A 78 ? 0.2937 0.4616 0.3175 -0.0310 0.0533  -0.0531 75  ILE A N   
599  C CA  . ILE A 78 ? 0.2975 0.4687 0.3145 -0.0437 0.0590  -0.0518 75  ILE A CA  
600  C C   . ILE A 78 ? 0.2233 0.4246 0.2604 -0.0491 0.0632  -0.0757 75  ILE A C   
601  O O   . ILE A 78 ? 0.1856 0.3929 0.2104 -0.0675 0.0687  -0.0781 75  ILE A O   
602  C CB  . ILE A 78 ? 0.3168 0.4636 0.3337 -0.0331 0.0517  -0.0394 75  ILE A CB  
603  C CG1 . ILE A 78 ? 0.2470 0.3641 0.2432 -0.0311 0.0473  -0.0174 75  ILE A CG1 
604  C CG2 . ILE A 78 ? 0.2733 0.4269 0.2888 -0.0446 0.0566  -0.0421 75  ILE A CG2 
605  C CD1 . ILE A 78 ? 0.2624 0.3571 0.2607 -0.0186 0.0402  -0.0073 75  ILE A CD1 
606  N N   . LEU A 79 ? 0.1717 0.3848 0.2377 -0.0328 0.0559  -0.0931 76  LEU A N   
607  C CA  . LEU A 79 ? 0.2303 0.4653 0.3167 -0.0355 0.0543  -0.1167 76  LEU A CA  
608  C C   . LEU A 79 ? 0.2372 0.4925 0.3214 -0.0500 0.0594  -0.1315 76  LEU A C   
609  O O   . LEU A 79 ? 0.1713 0.4438 0.2570 -0.0641 0.0644  -0.1450 76  LEU A O   
610  C CB  . LEU A 79 ? 0.1794 0.4157 0.2955 -0.0139 0.0399  -0.1326 76  LEU A CB  
611  C CG  . LEU A 79 ? 0.1367 0.3564 0.2570 -0.0018 0.0336  -0.1229 76  LEU A CG  
612  C CD1 . LEU A 79 ? 0.1920 0.4015 0.3342 0.0198  0.0140  -0.1348 76  LEU A CD1 
613  C CD2 . LEU A 79 ? 0.1371 0.3670 0.2582 -0.0133 0.0396  -0.1273 76  LEU A CD2 
614  N N   . LYS A 80 ? 0.2097 0.4639 0.2903 -0.0469 0.0581  -0.1302 77  LYS A N   
615  C CA  . LYS A 80 ? 0.2433 0.5184 0.3251 -0.0585 0.0614  -0.1464 77  LYS A CA  
616  C C   . LYS A 80 ? 0.3208 0.5927 0.3711 -0.0825 0.0717  -0.1341 77  LYS A C   
617  O O   . LYS A 80 ? 0.3243 0.6159 0.3721 -0.0989 0.0767  -0.1486 77  LYS A O   
618  C CB  . LYS A 80 ? 0.3101 0.5855 0.4027 -0.0451 0.0544  -0.1518 77  LYS A CB  
619  C CG  . LYS A 80 ? 0.2378 0.5167 0.3621 -0.0246 0.0402  -0.1705 77  LYS A CG  
620  C CD  . LYS A 80 ? 0.2318 0.5068 0.3641 -0.0124 0.0317  -0.1745 77  LYS A CD  
621  C CE  . LYS A 80 ? 0.3584 0.6603 0.5059 -0.0183 0.0301  -0.2008 77  LYS A CE  
622  N NZ  . LYS A 80 ? 0.4478 0.7483 0.6227 0.0003  0.0119  -0.2200 77  LYS A NZ  
623  N N   . HIS A 81 ? 0.3454 0.5909 0.3708 -0.0852 0.0731  -0.1082 78  HIS A N   
624  C CA  . HIS A 81 ? 0.4148 0.6489 0.4069 -0.1066 0.0779  -0.0945 78  HIS A CA  
625  C C   . HIS A 81 ? 0.5113 0.7255 0.4816 -0.1184 0.0791  -0.0783 78  HIS A C   
626  O O   . HIS A 81 ? 0.5489 0.7493 0.4903 -0.1368 0.0799  -0.0675 78  HIS A O   
627  C CB  . HIS A 81 ? 0.4312 0.6487 0.4080 -0.1022 0.0749  -0.0797 78  HIS A CB  
628  C CG  . HIS A 81 ? 0.4482 0.6855 0.4432 -0.0945 0.0739  -0.0964 78  HIS A CG  
629  N ND1 . HIS A 81 ? 0.4171 0.6540 0.4331 -0.0724 0.0680  -0.0996 78  HIS A ND1 
630  C CD2 . HIS A 81 ? 0.4566 0.7151 0.4530 -0.1065 0.0772  -0.1123 78  HIS A CD2 
631  C CE1 . HIS A 81 ? 0.3990 0.6538 0.4284 -0.0702 0.0666  -0.1162 78  HIS A CE1 
632  N NE2 . HIS A 81 ? 0.4661 0.7359 0.4849 -0.0905 0.0727  -0.1246 78  HIS A NE2 
633  N N   . ASP A 82 ? 0.5749 0.7860 0.5583 -0.1085 0.0778  -0.0771 79  ASP A N   
634  C CA  . ASP A 82 ? 0.7335 0.9278 0.6983 -0.1206 0.0786  -0.0645 79  ASP A CA  
635  C C   . ASP A 82 ? 0.8011 1.0172 0.7724 -0.1355 0.0842  -0.0828 79  ASP A C   
636  O O   . ASP A 82 ? 0.8712 1.0753 0.8248 -0.1495 0.0853  -0.0747 79  ASP A O   
637  C CB  . ASP A 82 ? 0.8098 0.9880 0.7819 -0.1048 0.0746  -0.0522 79  ASP A CB  
638  C CG  . ASP A 82 ? 0.8962 1.0480 0.8437 -0.1159 0.0725  -0.0338 79  ASP A CG  
639  O OD1 . ASP A 82 ? 0.9441 1.0823 0.8647 -0.1336 0.0713  -0.0259 79  ASP A OD1 
640  O OD2 . ASP A 82 ? 0.9049 1.0483 0.8597 -0.1070 0.0706  -0.0277 79  ASP A OD2 
641  O OXT . ASP A 82 ? 0.7764 1.0218 0.7705 -0.1341 0.0868  -0.1070 79  ASP A OXT 
642  N N   . SER B 6  ? 0.6276 0.6903 0.5635 -0.0812 0.1037  -0.0452 3   SER B N   
643  C CA  . SER B 6  ? 0.5946 0.6430 0.5243 -0.0788 0.0985  -0.0320 3   SER B CA  
644  C C   . SER B 6  ? 0.5770 0.5932 0.4811 -0.0751 0.0887  -0.0130 3   SER B C   
645  O O   . SER B 6  ? 0.5918 0.6016 0.4967 -0.0649 0.0833  -0.0101 3   SER B O   
646  C CB  . SER B 6  ? 0.6430 0.7116 0.6076 -0.0624 0.0979  -0.0385 3   SER B CB  
647  O OG  . SER B 6  ? 0.7050 0.8024 0.6957 -0.0639 0.1036  -0.0581 3   SER B OG  
648  N N   . PHE B 7  ? 0.5606 0.5555 0.4469 -0.0804 0.0818  -0.0011 4   PHE B N   
649  C CA  . PHE B 7  ? 0.6000 0.5610 0.4612 -0.0784 0.0677  0.0141  4   PHE B CA  
650  C C   . PHE B 7  ? 0.4663 0.4254 0.3460 -0.0559 0.0571  0.0189  4   PHE B C   
651  O O   . PHE B 7  ? 0.5214 0.4659 0.3897 -0.0526 0.0503  0.0235  4   PHE B O   
652  C CB  . PHE B 7  ? 0.6353 0.5742 0.4793 -0.0859 0.0590  0.0232  4   PHE B CB  
653  C CG  . PHE B 7  ? 0.6969 0.6018 0.5214 -0.0802 0.0410  0.0357  4   PHE B CG  
654  C CD1 . PHE B 7  ? 0.7523 0.6335 0.5513 -0.0892 0.0315  0.0390  4   PHE B CD1 
655  C CD2 . PHE B 7  ? 0.7303 0.6339 0.5742 -0.0614 0.0300  0.0390  4   PHE B CD2 
656  C CE1 . PHE B 7  ? 0.7803 0.6321 0.5667 -0.0818 0.0122  0.0471  4   PHE B CE1 
657  C CE2 . PHE B 7  ? 0.7362 0.6131 0.5687 -0.0544 0.0121  0.0458  4   PHE B CE2 
658  C CZ  . PHE B 7  ? 0.7611 0.6084 0.5615 -0.0652 0.0026  0.0511  4   PHE B CZ  
659  N N   . LEU B 8  ? 0.3976 0.3709 0.3039 -0.0423 0.0554  0.0176  5   LEU B N   
660  C CA  . LEU B 8  ? 0.4272 0.3986 0.3473 -0.0250 0.0463  0.0221  5   LEU B CA  
661  C C   . LEU B 8  ? 0.4628 0.4395 0.3883 -0.0197 0.0479  0.0189  5   LEU B C   
662  O O   . LEU B 8  ? 0.3902 0.3538 0.3080 -0.0153 0.0405  0.0238  5   LEU B O   
663  C CB  . LEU B 8  ? 0.3838 0.3710 0.3282 -0.0145 0.0459  0.0201  5   LEU B CB  
664  C CG  . LEU B 8  ? 0.3742 0.3594 0.3278 -0.0016 0.0378  0.0246  5   LEU B CG  
665  C CD1 . LEU B 8  ? 0.3640 0.3304 0.3032 -0.0016 0.0287  0.0302  5   LEU B CD1 
666  C CD2 . LEU B 8  ? 0.3176 0.3150 0.2889 0.0061  0.0363  0.0241  5   LEU B CD2 
667  N N   . LEU B 9  ? 0.5431 0.5393 0.4829 -0.0205 0.0567  0.0086  6   LEU B N   
668  C CA  . LEU B 9  ? 0.5033 0.5071 0.4539 -0.0139 0.0575  0.0029  6   LEU B CA  
669  C C   . LEU B 9  ? 0.5034 0.4946 0.4320 -0.0216 0.0582  0.0042  6   LEU B C   
670  O O   . LEU B 9  ? 0.4499 0.4377 0.3819 -0.0142 0.0541  0.0049  6   LEU B O   
671  C CB  . LEU B 9  ? 0.4368 0.4647 0.4097 -0.0130 0.0648  -0.0122 6   LEU B CB  
672  C CG  . LEU B 9  ? 0.5694 0.6084 0.5575 -0.0068 0.0655  -0.0235 6   LEU B CG  
673  C CD1 . LEU B 9  ? 0.5414 0.5761 0.5457 0.0087  0.0544  -0.0198 6   LEU B CD1 
674  C CD2 . LEU B 9  ? 0.6526 0.7176 0.6598 -0.0108 0.0743  -0.0435 6   LEU B CD2 
675  N N   . SER B 10 ? 0.3979 0.3796 0.3015 -0.0376 0.0623  0.0052  7   SER B N   
676  C CA  . SER B 10 ? 0.5290 0.4944 0.4052 -0.0476 0.0614  0.0074  7   SER B CA  
677  C C   . SER B 10 ? 0.5106 0.4506 0.3746 -0.0402 0.0464  0.0194  7   SER B C   
678  O O   . SER B 10 ? 0.3843 0.3134 0.2360 -0.0405 0.0422  0.0205  7   SER B O   
679  C CB  . SER B 10 ? 0.5311 0.4896 0.3777 -0.0708 0.0690  0.0059  7   SER B CB  
680  O OG  . SER B 10 ? 0.6893 0.6229 0.5153 -0.0766 0.0593  0.0177  7   SER B OG  
681  N N   . LYS B 11 ? 0.3903 0.3226 0.2596 -0.0333 0.0379  0.0262  8   LYS B N   
682  C CA  . LYS B 11 ? 0.4116 0.3265 0.2781 -0.0240 0.0233  0.0327  8   LYS B CA  
683  C C   . LYS B 11 ? 0.2990 0.2284 0.1915 -0.0089 0.0221  0.0303  8   LYS B C   
684  O O   . LYS B 11 ? 0.3189 0.2402 0.2107 -0.0031 0.0138  0.0314  8   LYS B O   
685  C CB  . LYS B 11 ? 0.5067 0.4081 0.3685 -0.0235 0.0137  0.0378  8   LYS B CB  
686  C CG  . LYS B 11 ? 0.6726 0.5451 0.4985 -0.0396 0.0072  0.0433  8   LYS B CG  
687  C CD  . LYS B 11 ? 0.7368 0.5857 0.5383 -0.0433 -0.0030 0.0464  8   LYS B CD  
688  C CE  . LYS B 11 ? 0.8355 0.6817 0.6131 -0.0624 0.0061  0.0444  8   LYS B CE  
689  N NZ  . LYS B 11 ? 0.8166 0.6504 0.5802 -0.0630 -0.0003 0.0442  8   LYS B NZ  
690  N N   . VAL B 12 ? 0.2632 0.2128 0.1771 -0.0040 0.0296  0.0266  9   VAL B N   
691  C CA  . VAL B 12 ? 0.2481 0.2085 0.1816 0.0062  0.0287  0.0253  9   VAL B CA  
692  C C   . VAL B 12 ? 0.2817 0.2417 0.2128 0.0059  0.0305  0.0217  9   VAL B C   
693  O O   . VAL B 12 ? 0.2382 0.1939 0.1716 0.0108  0.0249  0.0231  9   VAL B O   
694  C CB  . VAL B 12 ? 0.2362 0.2123 0.1871 0.0093  0.0337  0.0226  9   VAL B CB  
695  C CG1 . VAL B 12 ? 0.2408 0.2235 0.2067 0.0166  0.0319  0.0215  9   VAL B CG1 
696  C CG2 . VAL B 12 ? 0.2443 0.2205 0.1981 0.0110  0.0305  0.0265  9   VAL B CG2 
697  N N   . SER B 13 ? 0.2937 0.2591 0.2199 -0.0011 0.0383  0.0156  10  SER B N   
698  C CA  . SER B 13 ? 0.2746 0.2411 0.1980 -0.0023 0.0407  0.0097  10  SER B CA  
699  C C   . SER B 13 ? 0.2961 0.2437 0.1978 -0.0058 0.0340  0.0144  10  SER B C   
700  O O   . SER B 13 ? 0.2990 0.2445 0.2036 -0.0013 0.0306  0.0130  10  SER B O   
701  C CB  . SER B 13 ? 0.2967 0.2765 0.2188 -0.0115 0.0517  -0.0012 10  SER B CB  
702  O OG  . SER B 13 ? 0.4395 0.4147 0.3445 -0.0196 0.0548  -0.0058 10  SER B OG  
703  N N   . PHE B 14 ? 0.2727 0.2037 0.1515 -0.0142 0.0299  0.0200  11  PHE B N   
704  C CA  . PHE B 14 ? 0.2922 0.2004 0.1503 -0.0157 0.0184  0.0249  11  PHE B CA  
705  C C   . PHE B 14 ? 0.2669 0.1737 0.1415 -0.0023 0.0076  0.0267  11  PHE B C   
706  O O   . PHE B 14 ? 0.2573 0.1559 0.1273 0.0002  0.0009  0.0258  11  PHE B O   
707  C CB  . PHE B 14 ? 0.3417 0.2275 0.1734 -0.0257 0.0112  0.0314  11  PHE B CB  
708  C CG  . PHE B 14 ? 0.5121 0.3693 0.3206 -0.0268 -0.0052 0.0362  11  PHE B CG  
709  C CD1 . PHE B 14 ? 0.5961 0.4372 0.3737 -0.0396 -0.0058 0.0368  11  PHE B CD1 
710  C CD2 . PHE B 14 ? 0.6065 0.4541 0.4253 -0.0148 -0.0210 0.0380  11  PHE B CD2 
711  C CE1 . PHE B 14 ? 0.6886 0.4996 0.4428 -0.0403 -0.0242 0.0414  11  PHE B CE1 
712  C CE2 . PHE B 14 ? 0.6714 0.4919 0.4720 -0.0138 -0.0396 0.0401  11  PHE B CE2 
713  C CZ  . PHE B 14 ? 0.7087 0.5085 0.4756 -0.0263 -0.0423 0.0429  11  PHE B CZ  
714  N N   . VAL B 15 ? 0.2487 0.1647 0.1419 0.0049  0.0063  0.0278  12  VAL B N   
715  C CA  . VAL B 15 ? 0.2677 0.1877 0.1779 0.0148  -0.0016 0.0264  12  VAL B CA  
716  C C   . VAL B 15 ? 0.2395 0.1722 0.1647 0.0187  0.0030  0.0235  12  VAL B C   
717  O O   . VAL B 15 ? 0.2672 0.1986 0.1978 0.0227  -0.0036 0.0210  12  VAL B O   
718  C CB  . VAL B 15 ? 0.2401 0.1704 0.1656 0.0191  -0.0018 0.0264  12  VAL B CB  
719  C CG1 . VAL B 15 ? 0.2682 0.2082 0.2120 0.0264  -0.0074 0.0215  12  VAL B CG1 
720  C CG2 . VAL B 15 ? 0.3298 0.2443 0.2416 0.0166  -0.0100 0.0287  12  VAL B CG2 
721  N N   . ILE B 16 ? 0.1845 0.1279 0.1167 0.0175  0.0124  0.0226  13  ILE B N   
722  C CA  . ILE B 16 ? 0.1855 0.1358 0.1297 0.0206  0.0141  0.0201  13  ILE B CA  
723  C C   . ILE B 16 ? 0.2582 0.2002 0.1932 0.0197  0.0112  0.0172  13  ILE B C   
724  O O   . ILE B 16 ? 0.2667 0.2088 0.2090 0.0227  0.0072  0.0159  13  ILE B O   
725  C CB  . ILE B 16 ? 0.1832 0.1425 0.1364 0.0209  0.0205  0.0177  13  ILE B CB  
726  C CG1 . ILE B 16 ? 0.1790 0.1451 0.1412 0.0223  0.0212  0.0211  13  ILE B CG1 
727  C CG2 . ILE B 16 ? 0.1847 0.1453 0.1483 0.0242  0.0186  0.0151  13  ILE B CG2 
728  C CD1 . ILE B 16 ? 0.2513 0.2248 0.2217 0.0231  0.0252  0.0172  13  ILE B CD1 
729  N N   . LYS B 17 ? 0.2817 0.2169 0.1995 0.0138  0.0138  0.0157  14  LYS B N   
730  C CA  . LYS B 17 ? 0.2932 0.2201 0.1979 0.0109  0.0119  0.0124  14  LYS B CA  
731  C C   . LYS B 17 ? 0.2823 0.1949 0.1788 0.0131  -0.0002 0.0151  14  LYS B C   
732  O O   . LYS B 17 ? 0.2545 0.1652 0.1542 0.0162  -0.0046 0.0124  14  LYS B O   
733  C CB  . LYS B 17 ? 0.3462 0.2696 0.2298 0.0001  0.0185  0.0095  14  LYS B CB  
734  C CG  . LYS B 17 ? 0.4261 0.3412 0.2914 -0.0057 0.0178  0.0050  14  LYS B CG  
735  C CD  . LYS B 17 ? 0.4730 0.3910 0.3181 -0.0201 0.0284  -0.0006 14  LYS B CD  
736  C CE  . LYS B 17 ? 0.5034 0.4154 0.3286 -0.0278 0.0293  -0.0066 14  LYS B CE  
737  N NZ  . LYS B 17 ? 0.5946 0.5154 0.4012 -0.0448 0.0427  -0.0157 14  LYS B NZ  
738  N N   . LYS B 18 ? 0.2694 0.1723 0.1578 0.0125  -0.0071 0.0192  15  LYS B N   
739  C CA  . LYS B 18 ? 0.3291 0.2179 0.2134 0.0168  -0.0225 0.0191  15  LYS B CA  
740  C C   . LYS B 18 ? 0.2896 0.1928 0.2005 0.0255  -0.0253 0.0141  15  LYS B C   
741  O O   . LYS B 18 ? 0.2687 0.1665 0.1805 0.0286  -0.0342 0.0102  15  LYS B O   
742  C CB  . LYS B 18 ? 0.3395 0.2162 0.2162 0.0168  -0.0315 0.0222  15  LYS B CB  
743  C CG  . LYS B 18 ? 0.4424 0.3044 0.3197 0.0239  -0.0515 0.0187  15  LYS B CG  
744  C CD  . LYS B 18 ? 0.5794 0.4212 0.4434 0.0233  -0.0647 0.0215  15  LYS B CD  
745  C CE  . LYS B 18 ? 0.6175 0.4364 0.4761 0.0302  -0.0897 0.0170  15  LYS B CE  
746  N NZ  . LYS B 18 ? 0.7016 0.4833 0.5259 0.0230  -0.1060 0.0240  15  LYS B NZ  
747  N N   . ILE B 19 ? 0.2553 0.1762 0.1859 0.0276  -0.0181 0.0137  16  ILE B N   
748  C CA  . ILE B 19 ? 0.2221 0.1578 0.1741 0.0311  -0.0183 0.0088  16  ILE B CA  
749  C C   . ILE B 19 ? 0.2423 0.1797 0.1963 0.0295  -0.0145 0.0080  16  ILE B C   
750  O O   . ILE B 19 ? 0.2436 0.1840 0.2065 0.0311  -0.0195 0.0028  16  ILE B O   
751  C CB  . ILE B 19 ? 0.2636 0.2157 0.2299 0.0300  -0.0104 0.0098  16  ILE B CB  
752  C CG1 . ILE B 19 ? 0.2742 0.2260 0.2410 0.0323  -0.0149 0.0088  16  ILE B CG1 
753  C CG2 . ILE B 19 ? 0.2439 0.2113 0.2278 0.0288  -0.0093 0.0043  16  ILE B CG2 
754  C CD1 . ILE B 19 ? 0.2590 0.2241 0.2338 0.0301  -0.0063 0.0112  16  ILE B CD1 
755  N N   . ARG B 20 ? 0.2598 0.1966 0.2085 0.0268  -0.0066 0.0111  17  ARG B N   
756  C CA  . ARG B 20 ? 0.3001 0.2369 0.2520 0.0265  -0.0050 0.0088  17  ARG B CA  
757  C C   . ARG B 20 ? 0.3182 0.2453 0.2618 0.0274  -0.0124 0.0048  17  ARG B C   
758  O O   . ARG B 20 ? 0.2779 0.2076 0.2309 0.0282  -0.0151 0.0016  17  ARG B O   
759  C CB  . ARG B 20 ? 0.2952 0.2328 0.2443 0.0253  0.0020  0.0085  17  ARG B CB  
760  C CG  . ARG B 20 ? 0.2713 0.2075 0.2253 0.0264  0.0012  0.0040  17  ARG B CG  
761  C CD  . ARG B 20 ? 0.3057 0.2458 0.2621 0.0270  0.0065  -0.0008 17  ARG B CD  
762  N NE  . ARG B 20 ? 0.3254 0.2663 0.2674 0.0230  0.0119  -0.0057 17  ARG B NE  
763  C CZ  . ARG B 20 ? 0.2690 0.2047 0.1976 0.0199  0.0116  -0.0105 17  ARG B CZ  
764  N NH1 . ARG B 20 ? 0.2691 0.1990 0.1997 0.0225  0.0054  -0.0120 17  ARG B NH1 
765  N NH2 . ARG B 20 ? 0.3355 0.2731 0.2483 0.0125  0.0184  -0.0154 17  ARG B NH2 
766  N N   . LEU B 21 ? 0.3046 0.2190 0.2283 0.0258  -0.0164 0.0054  18  LEU B N   
767  C CA  . LEU B 21 ? 0.3026 0.2029 0.2116 0.0255  -0.0256 0.0027  18  LEU B CA  
768  C C   . LEU B 21 ? 0.3880 0.2858 0.3062 0.0310  -0.0389 -0.0007 18  LEU B C   
769  O O   . LEU B 21 ? 0.3420 0.2373 0.2631 0.0332  -0.0456 -0.0055 18  LEU B O   
770  C CB  . LEU B 21 ? 0.3303 0.2141 0.2092 0.0184  -0.0267 0.0058  18  LEU B CB  
771  C CG  . LEU B 21 ? 0.3692 0.2602 0.2415 0.0120  -0.0131 0.0036  18  LEU B CG  
772  C CD1 . LEU B 21 ? 0.4848 0.3628 0.3252 0.0004  -0.0111 0.0053  18  LEU B CD1 
773  C CD2 . LEU B 21 ? 0.4351 0.3302 0.3133 0.0138  -0.0118 -0.0030 18  LEU B CD2 
774  N N   . GLU B 22 ? 0.4043 0.3049 0.3300 0.0339  -0.0433 -0.0006 19  GLU B N   
775  C CA  . GLU B 22 ? 0.4327 0.3393 0.3771 0.0404  -0.0549 -0.0091 19  GLU B CA  
776  C C   . GLU B 22 ? 0.3763 0.3030 0.3444 0.0403  -0.0493 -0.0154 19  GLU B C   
777  O O   . GLU B 22 ? 0.4903 0.4208 0.4704 0.0436  -0.0582 -0.0244 19  GLU B O   
778  C CB  . GLU B 22 ? 0.4060 0.3205 0.3617 0.0433  -0.0566 -0.0108 19  GLU B CB  
779  C CG  . GLU B 22 ? 0.5518 0.4436 0.4884 0.0451  -0.0698 -0.0079 19  GLU B CG  
780  C CD  . GLU B 22 ? 0.5846 0.4841 0.5312 0.0471  -0.0690 -0.0086 19  GLU B CD  
781  O OE1 . GLU B 22 ? 0.6784 0.5567 0.6075 0.0473  -0.0799 -0.0050 19  GLU B OE1 
782  O OE2 . GLU B 22 ? 0.5816 0.5064 0.5507 0.0471  -0.0578 -0.0123 19  GLU B OE2 
783  N N   . LYS B 23 ? 0.3114 0.2494 0.2852 0.0354  -0.0357 -0.0108 20  LYS B N   
784  C CA  . LYS B 23 ? 0.3141 0.2662 0.3044 0.0316  -0.0305 -0.0144 20  LYS B CA  
785  C C   . LYS B 23 ? 0.3613 0.3044 0.3453 0.0306  -0.0315 -0.0143 20  LYS B C   
786  O O   . LYS B 23 ? 0.3732 0.3239 0.3687 0.0267  -0.0295 -0.0172 20  LYS B O   
787  C CB  . LYS B 23 ? 0.3539 0.3158 0.3488 0.0257  -0.0192 -0.0087 20  LYS B CB  
788  C CG  . LYS B 23 ? 0.4115 0.3852 0.4140 0.0259  -0.0175 -0.0104 20  LYS B CG  
789  C CD  . LYS B 23 ? 0.4475 0.4430 0.4702 0.0213  -0.0161 -0.0206 20  LYS B CD  
790  C CE  . LYS B 23 ? 0.4046 0.4125 0.4333 0.0208  -0.0125 -0.0226 20  LYS B CE  
791  N NZ  . LYS B 23 ? 0.4719 0.5043 0.5154 0.0107  -0.0048 -0.0304 20  LYS B NZ  
792  N N   . GLY B 24 ? 0.3644 0.2916 0.3292 0.0325  -0.0343 -0.0116 21  GLY B N   
793  C CA  . GLY B 24 ? 0.4001 0.3204 0.3592 0.0317  -0.0347 -0.0132 21  GLY B CA  
794  C C   . GLY B 24 ? 0.3702 0.2943 0.3352 0.0287  -0.0261 -0.0108 21  GLY B C   
795  O O   . GLY B 24 ? 0.3458 0.2681 0.3155 0.0279  -0.0275 -0.0138 21  GLY B O   
796  N N   . MET B 25 ? 0.3107 0.2381 0.2753 0.0277  -0.0191 -0.0058 22  MET B N   
797  C CA  . MET B 25 ? 0.2343 0.1620 0.2045 0.0264  -0.0149 -0.0041 22  MET B CA  
798  C C   . MET B 25 ? 0.2986 0.2229 0.2605 0.0285  -0.0113 -0.0070 22  MET B C   
799  O O   . MET B 25 ? 0.2189 0.1438 0.1705 0.0280  -0.0078 -0.0064 22  MET B O   
800  C CB  . MET B 25 ? 0.3307 0.2648 0.3072 0.0239  -0.0109 0.0016  22  MET B CB  
801  C CG  . MET B 25 ? 0.4693 0.4092 0.4554 0.0176  -0.0118 0.0029  22  MET B CG  
802  S SD  . MET B 25 ? 0.5116 0.4587 0.4990 0.0134  -0.0066 0.0093  22  MET B SD  
803  C CE  . MET B 25 ? 0.3671 0.3017 0.3515 0.0144  -0.0083 0.0139  22  MET B CE  
804  N N   . THR B 26 ? 0.2941 0.2159 0.2624 0.0301  -0.0124 -0.0113 23  THR B N   
805  C CA  . THR B 26 ? 0.3007 0.2253 0.2679 0.0324  -0.0084 -0.0186 23  THR B CA  
806  C C   . THR B 26 ? 0.2137 0.1434 0.1891 0.0339  -0.0055 -0.0166 23  THR B C   
807  O O   . THR B 26 ? 0.2073 0.1352 0.1879 0.0327  -0.0078 -0.0085 23  THR B O   
808  C CB  . THR B 26 ? 0.2894 0.2102 0.2650 0.0357  -0.0130 -0.0273 23  THR B CB  
809  O OG1 . THR B 26 ? 0.2415 0.1555 0.2299 0.0369  -0.0199 -0.0233 23  THR B OG1 
810  C CG2 . THR B 26 ? 0.3025 0.2177 0.2711 0.0345  -0.0170 -0.0299 23  THR B CG2 
811  N N   . GLN B 27 ? 0.2162 0.1537 0.1927 0.0353  -0.0003 -0.0253 24  GLN B N   
812  C CA  . GLN B 27 ? 0.2107 0.1544 0.1991 0.0383  0.0007  -0.0269 24  GLN B CA  
813  C C   . GLN B 27 ? 0.2144 0.1488 0.2179 0.0436  -0.0103 -0.0274 24  GLN B C   
814  O O   . GLN B 27 ? 0.2417 0.1726 0.2501 0.0444  -0.0142 -0.0212 24  GLN B O   
815  C CB  . GLN B 27 ? 0.2161 0.1738 0.2070 0.0383  0.0083  -0.0417 24  GLN B CB  
816  C CG  . GLN B 27 ? 0.2225 0.1855 0.1929 0.0292  0.0188  -0.0391 24  GLN B CG  
817  C CD  . GLN B 27 ? 0.2228 0.2037 0.1959 0.0252  0.0290  -0.0539 24  GLN B CD  
818  O OE1 . GLN B 27 ? 0.2596 0.2517 0.2473 0.0286  0.0297  -0.0702 24  GLN B OE1 
819  N NE2 . GLN B 27 ? 0.2938 0.2784 0.2540 0.0172  0.0365  -0.0495 24  GLN B NE2 
820  N N   . GLU B 28 ? 0.2238 0.1522 0.2326 0.0466  -0.0165 -0.0348 25  GLU B N   
821  C CA  . GLU B 28 ? 0.3143 0.2276 0.3338 0.0505  -0.0303 -0.0348 25  GLU B CA  
822  C C   . GLU B 28 ? 0.2926 0.1919 0.3037 0.0432  -0.0352 -0.0180 25  GLU B C   
823  O O   . GLU B 28 ? 0.3128 0.1988 0.3261 0.0427  -0.0451 -0.0126 25  GLU B O   
824  C CB  . GLU B 28 ? 0.3308 0.2398 0.3550 0.0537  -0.0355 -0.0456 25  GLU B CB  
825  C CG  . GLU B 28 ? 0.4447 0.3458 0.4867 0.0626  -0.0489 -0.0577 25  GLU B CG  
826  C CD  . GLU B 28 ? 0.4875 0.3805 0.5330 0.0648  -0.0560 -0.0662 25  GLU B CD  
827  O OE1 . GLU B 28 ? 0.6400 0.5220 0.7004 0.0726  -0.0705 -0.0761 25  GLU B OE1 
828  O OE2 . GLU B 28 ? 0.4920 0.3881 0.5256 0.0594  -0.0488 -0.0632 25  GLU B OE2 
829  N N   . ASP B 29 ? 0.3047 0.2074 0.3059 0.0368  -0.0291 -0.0116 26  ASP B N   
830  C CA  . ASP B 29 ? 0.3107 0.2077 0.3057 0.0277  -0.0304 0.0003  26  ASP B CA  
831  C C   . ASP B 29 ? 0.3495 0.2510 0.3416 0.0250  -0.0268 0.0078  26  ASP B C   
832  O O   . ASP B 29 ? 0.3479 0.2403 0.3356 0.0178  -0.0313 0.0161  26  ASP B O   
833  C CB  . ASP B 29 ? 0.4283 0.3343 0.4186 0.0240  -0.0243 0.0004  26  ASP B CB  
834  C CG  . ASP B 29 ? 0.6523 0.5560 0.6413 0.0137  -0.0260 0.0063  26  ASP B CG  
835  O OD1 . ASP B 29 ? 0.7445 0.6344 0.7326 0.0077  -0.0332 0.0100  26  ASP B OD1 
836  O OD2 . ASP B 29 ? 0.6953 0.6111 0.6843 0.0109  -0.0209 0.0058  26  ASP B OD2 
837  N N   . LEU B 30 ? 0.2649 0.1794 0.2568 0.0289  -0.0186 0.0051  27  LEU B N   
838  C CA  . LEU B 30 ? 0.3143 0.2341 0.3042 0.0268  -0.0150 0.0114  27  LEU B CA  
839  C C   . LEU B 30 ? 0.3083 0.2191 0.3033 0.0301  -0.0230 0.0116  27  LEU B C   
840  O O   . LEU B 30 ? 0.3320 0.2367 0.3221 0.0249  -0.0263 0.0200  27  LEU B O   
841  C CB  . LEU B 30 ? 0.2679 0.2009 0.2550 0.0293  -0.0059 0.0088  27  LEU B CB  
842  C CG  . LEU B 30 ? 0.3120 0.2506 0.2983 0.0280  -0.0025 0.0141  27  LEU B CG  
843  C CD1 . LEU B 30 ? 0.2355 0.1739 0.2184 0.0203  -0.0031 0.0219  27  LEU B CD1 
844  C CD2 . LEU B 30 ? 0.2360 0.1836 0.2172 0.0290  0.0050  0.0112  27  LEU B CD2 
845  N N   . ALA B 31 ? 0.2746 0.1842 0.2797 0.0384  -0.0275 0.0009  28  ALA B N   
846  C CA  . ALA B 31 ? 0.3283 0.2292 0.3429 0.0444  -0.0388 -0.0027 28  ALA B CA  
847  C C   . ALA B 31 ? 0.4014 0.2772 0.4080 0.0387  -0.0534 0.0077  28  ALA B C   
848  O O   . ALA B 31 ? 0.3674 0.2311 0.3703 0.0373  -0.0626 0.0139  28  ALA B O   
849  C CB  . ALA B 31 ? 0.2856 0.1910 0.3167 0.0547  -0.0431 -0.0205 28  ALA B CB  
850  N N   . TYR B 32 ? 0.3562 0.2221 0.3582 0.0340  -0.0566 0.0093  29  TYR B N   
851  C CA  . TYR B 32 ? 0.4629 0.3014 0.4541 0.0255  -0.0714 0.0188  29  TYR B CA  
852  C C   . TYR B 32 ? 0.4850 0.3218 0.4585 0.0105  -0.0665 0.0331  29  TYR B C   
853  O O   . TYR B 32 ? 0.4603 0.2761 0.4218 0.0040  -0.0784 0.0418  29  TYR B O   
854  C CB  . TYR B 32 ? 0.5361 0.3665 0.5262 0.0219  -0.0743 0.0169  29  TYR B CB  
855  C CG  . TYR B 32 ? 0.5587 0.3576 0.5353 0.0111  -0.0906 0.0264  29  TYR B CG  
856  C CD1 . TYR B 32 ? 0.5238 0.2955 0.4989 0.0150  -0.1112 0.0277  29  TYR B CD1 
857  C CD2 . TYR B 32 ? 0.6341 0.4286 0.5984 -0.0044 -0.0870 0.0336  29  TYR B CD2 
858  C CE1 . TYR B 32 ? 0.5089 0.2585 0.4679 0.0024  -0.1243 0.0358  29  TYR B CE1 
859  C CE2 . TYR B 32 ? 0.6474 0.4109 0.5952 -0.0182 -0.1018 0.0430  29  TYR B CE2 
860  C CZ  . TYR B 32 ? 0.6132 0.3548 0.5566 -0.0148 -0.1200 0.0447  29  TYR B CZ  
861  O OH  . TYR B 32 ? 0.7831 0.5031 0.7081 -0.0292 -0.1329 0.0523  29  TYR B OH  
862  N N   . LYS B 33 ? 0.4868 0.3456 0.4588 0.0054  -0.0501 0.0339  30  LYS B N   
863  C CA  . LYS B 33 ? 0.3990 0.2643 0.3587 -0.0089 -0.0426 0.0427  30  LYS B CA  
864  C C   . LYS B 33 ? 0.3533 0.2245 0.3108 -0.0069 -0.0400 0.0460  30  LYS B C   
865  O O   . LYS B 33 ? 0.4549 0.3269 0.4000 -0.0196 -0.0370 0.0533  30  LYS B O   
866  C CB  . LYS B 33 ? 0.4267 0.3156 0.3917 -0.0108 -0.0287 0.0381  30  LYS B CB  
867  C CG  . LYS B 33 ? 0.4602 0.3470 0.4255 -0.0173 -0.0294 0.0357  30  LYS B CG  
868  C CD  . LYS B 33 ? 0.5988 0.5097 0.5702 -0.0206 -0.0179 0.0303  30  LYS B CD  
869  C CE  . LYS B 33 ? 0.6401 0.5518 0.6146 -0.0273 -0.0187 0.0260  30  LYS B CE  
870  N NZ  . LYS B 33 ? 0.6781 0.6078 0.6642 -0.0186 -0.0138 0.0164  30  LYS B NZ  
871  N N   . SER B 34 ? 0.3457 0.2226 0.3153 0.0074  -0.0407 0.0394  31  SER B N   
872  C CA  A SER B 34 ? 0.3311 0.2159 0.3018 0.0107  -0.0379 0.0406  31  SER B CA  
873  C CA  B SER B 34 ? 0.3446 0.2290 0.3145 0.0100  -0.0380 0.0411  31  SER B CA  
874  C C   . SER B 34 ? 0.3627 0.2281 0.3332 0.0151  -0.0540 0.0419  31  SER B C   
875  O O   . SER B 34 ? 0.4297 0.2993 0.4006 0.0174  -0.0539 0.0432  31  SER B O   
876  C CB  A SER B 34 ? 0.2503 0.1557 0.2343 0.0217  -0.0278 0.0311  31  SER B CB  
877  C CB  B SER B 34 ? 0.2709 0.1768 0.2535 0.0203  -0.0270 0.0322  31  SER B CB  
878  O OG  A SER B 34 ? 0.2016 0.1213 0.1842 0.0190  -0.0163 0.0300  31  SER B OG  
879  O OG  B SER B 34 ? 0.2494 0.1535 0.2448 0.0314  -0.0328 0.0221  31  SER B OG  
880  N N   . ASN B 35 ? 0.3888 0.2323 0.3606 0.0180  -0.0695 0.0400  32  ASN B N   
881  C CA  . ASN B 35 ? 0.4230 0.2452 0.3988 0.0258  -0.0898 0.0377  32  ASN B CA  
882  C C   . ASN B 35 ? 0.3660 0.2059 0.3674 0.0431  -0.0893 0.0216  32  ASN B C   
883  O O   . ASN B 35 ? 0.3968 0.2269 0.4046 0.0501  -0.1037 0.0181  32  ASN B O   
884  C CB  . ASN B 35 ? 0.4802 0.2861 0.4354 0.0150  -0.0974 0.0509  32  ASN B CB  
885  C CG  . ASN B 35 ? 0.5226 0.3049 0.4675 0.0097  -0.1167 0.0523  32  ASN B CG  
886  O OD1 . ASN B 35 ? 0.4192 0.1892 0.3619 0.0069  -0.1237 0.0513  32  ASN B OD1 
887  N ND2 . ASN B 35 ? 0.4315 0.2055 0.3690 0.0081  -0.1270 0.0545  32  ASN B ND2 
888  N N   . LEU B 36 ? 0.3665 0.2333 0.3810 0.0483  -0.0726 0.0111  33  LEU B N   
889  C CA  . LEU B 36 ? 0.3180 0.2066 0.3544 0.0601  -0.0678 -0.0057 33  LEU B CA  
890  C C   . LEU B 36 ? 0.3853 0.2815 0.4363 0.0672  -0.0670 -0.0212 33  LEU B C   
891  O O   . LEU B 36 ? 0.3924 0.2902 0.4344 0.0615  -0.0586 -0.0176 33  LEU B O   
892  C CB  . LEU B 36 ? 0.2741 0.1882 0.3069 0.0556  -0.0462 -0.0042 33  LEU B CB  
893  C CG  . LEU B 36 ? 0.4105 0.3214 0.4288 0.0478  -0.0438 0.0101  33  LEU B CG  
894  C CD1 . LEU B 36 ? 0.3751 0.3087 0.3940 0.0462  -0.0270 0.0086  33  LEU B CD1 
895  C CD2 . LEU B 36 ? 0.4466 0.3431 0.4682 0.0520  -0.0602 0.0108  33  LEU B CD2 
896  N N   . ASP B 37 ? 0.3328 0.2377 0.4077 0.0791  -0.0743 -0.0405 34  ASP B N   
897  C CA  . ASP B 37 ? 0.3553 0.2703 0.4470 0.0862  -0.0742 -0.0597 34  ASP B CA  
898  C C   . ASP B 37 ? 0.2807 0.2180 0.3637 0.0787  -0.0511 -0.0613 34  ASP B C   
899  O O   . ASP B 37 ? 0.2651 0.2161 0.3381 0.0719  -0.0360 -0.0549 34  ASP B O   
900  C CB  . ASP B 37 ? 0.3722 0.3071 0.4923 0.0965  -0.0789 -0.0832 34  ASP B CB  
901  C CG  . ASP B 37 ? 0.5175 0.4348 0.6441 0.1000  -0.1036 -0.0851 34  ASP B CG  
902  O OD1 . ASP B 37 ? 0.6142 0.5014 0.7231 0.0953  -0.1169 -0.0695 34  ASP B OD1 
903  O OD2 . ASP B 37 ? 0.5193 0.4532 0.6681 0.1061  -0.1102 -0.1033 34  ASP B OD2 
904  N N   . ARG B 38 ? 0.2899 0.2294 0.3761 0.0801  -0.0499 -0.0709 35  ARG B N   
905  C CA  . ARG B 38 ? 0.3499 0.3070 0.4245 0.0723  -0.0306 -0.0729 35  ARG B CA  
906  C C   . ARG B 38 ? 0.3394 0.3262 0.4240 0.0714  -0.0164 -0.0896 35  ARG B C   
907  O O   . ARG B 38 ? 0.2665 0.2637 0.3341 0.0613  -0.0006 -0.0843 35  ARG B O   
908  C CB  . ARG B 38 ? 0.3592 0.3128 0.4368 0.0747  -0.0341 -0.0827 35  ARG B CB  
909  C CG  . ARG B 38 ? 0.3566 0.3149 0.4145 0.0657  -0.0207 -0.0780 35  ARG B CG  
910  C CD  . ARG B 38 ? 0.4330 0.3895 0.4998 0.0705  -0.0268 -0.0925 35  ARG B CD  
911  N NE  . ARG B 38 ? 0.5617 0.5203 0.6103 0.0630  -0.0174 -0.0905 35  ARG B NE  
912  C CZ  . ARG B 38 ? 0.5354 0.4920 0.5873 0.0654  -0.0211 -0.1010 35  ARG B CZ  
913  N NH1 . ARG B 38 ? 0.5370 0.4891 0.6112 0.0757  -0.0347 -0.1151 35  ARG B NH1 
914  N NH2 . ARG B 38 ? 0.4467 0.4040 0.4792 0.0579  -0.0132 -0.0981 35  ARG B NH2 
915  N N   . THR B 39 ? 0.3158 0.3149 0.4278 0.0811  -0.0235 -0.1108 36  THR B N   
916  C CA  . THR B 39 ? 0.3706 0.4013 0.4967 0.0791  -0.0104 -0.1299 36  THR B CA  
917  C C   . THR B 39 ? 0.3275 0.3606 0.4414 0.0721  -0.0021 -0.1153 36  THR B C   
918  O O   . THR B 39 ? 0.2728 0.3244 0.3765 0.0610  0.0157  -0.1182 36  THR B O   
919  C CB  . THR B 39 ? 0.3414 0.3838 0.4990 0.0884  -0.0244 -0.1495 36  THR B CB  
920  O OG1 . THR B 39 ? 0.4992 0.5136 0.6595 0.0968  -0.0470 -0.1367 36  THR B OG1 
921  C CG2 . THR B 39 ? 0.4023 0.4566 0.5726 0.0894  -0.0271 -0.1675 36  THR B CG2 
922  N N   . ALA B 40 ? 0.2635 0.2755 0.3755 0.0770  -0.0159 -0.0992 37  ALA B N   
923  C CA  . ALA B 40 ? 0.2299 0.2387 0.3272 0.0706  -0.0104 -0.0818 37  ALA B CA  
924  C C   . ALA B 40 ? 0.2301 0.2364 0.2987 0.0580  0.0042  -0.0650 37  ALA B C   
925  O O   . ALA B 40 ? 0.2533 0.2707 0.3134 0.0504  0.0162  -0.0625 37  ALA B O   
926  C CB  . ALA B 40 ? 0.2915 0.2742 0.3868 0.0761  -0.0291 -0.0668 37  ALA B CB  
927  N N   . ILE B 41 ? 0.1923 0.1823 0.2461 0.0557  0.0015  -0.0539 38  ILE B N   
928  C CA  . ILE B 41 ? 0.1983 0.1841 0.2289 0.0465  0.0106  -0.0403 38  ILE B CA  
929  C C   . ILE B 41 ? 0.2318 0.2330 0.2533 0.0384  0.0249  -0.0503 38  ILE B C   
930  O O   . ILE B 41 ? 0.2118 0.2131 0.2155 0.0298  0.0329  -0.0421 38  ILE B O   
931  C CB  . ILE B 41 ? 0.2267 0.1962 0.2488 0.0464  0.0042  -0.0325 38  ILE B CB  
932  C CG1 . ILE B 41 ? 0.2584 0.2106 0.2822 0.0488  -0.0085 -0.0209 38  ILE B CG1 
933  C CG2 . ILE B 41 ? 0.2735 0.2399 0.2745 0.0384  0.0115  -0.0223 38  ILE B CG2 
934  C CD1 . ILE B 41 ? 0.3259 0.2754 0.3386 0.0433  -0.0057 -0.0065 38  ILE B CD1 
935  N N   . SER B 42 ? 0.2157 0.2282 0.2478 0.0402  0.0267  -0.0681 39  SER B N   
936  C CA  . SER B 42 ? 0.3619 0.3883 0.3806 0.0289  0.0409  -0.0787 39  SER B CA  
937  C C   . SER B 42 ? 0.3610 0.4049 0.3803 0.0210  0.0519  -0.0848 39  SER B C   
938  O O   . SER B 42 ? 0.3102 0.3538 0.3043 0.0068  0.0624  -0.0795 39  SER B O   
939  C CB  . SER B 42 ? 0.3788 0.4175 0.4121 0.0324  0.0409  -0.1000 39  SER B CB  
940  O OG  . SER B 42 ? 0.4591 0.5153 0.4794 0.0188  0.0562  -0.1135 39  SER B OG  
941  N N   . GLY B 43 ? 0.2794 0.3353 0.3261 0.0298  0.0474  -0.0948 40  GLY B N   
942  C CA  . GLY B 43 ? 0.2220 0.2962 0.2740 0.0235  0.0567  -0.1020 40  GLY B CA  
943  C C   . GLY B 43 ? 0.2952 0.3551 0.3263 0.0174  0.0582  -0.0802 40  GLY B C   
944  O O   . GLY B 43 ? 0.2989 0.3681 0.3183 0.0048  0.0696  -0.0818 40  GLY B O   
945  N N   . ILE B 44 ? 0.2718 0.3107 0.2994 0.0253  0.0466  -0.0618 41  ILE B N   
946  C CA  . ILE B 44 ? 0.2852 0.3123 0.2962 0.0210  0.0469  -0.0435 41  ILE B CA  
947  C C   . ILE B 44 ? 0.3649 0.3824 0.3464 0.0089  0.0535  -0.0357 41  ILE B C   
948  O O   . ILE B 44 ? 0.3116 0.3258 0.2775 0.0001  0.0579  -0.0289 41  ILE B O   
949  C CB  . ILE B 44 ? 0.2815 0.2913 0.2941 0.0295  0.0346  -0.0287 41  ILE B CB  
950  C CG1 . ILE B 44 ? 0.2358 0.2484 0.2701 0.0390  0.0253  -0.0330 41  ILE B CG1 
951  C CG2 . ILE B 44 ? 0.3473 0.3475 0.3432 0.0248  0.0355  -0.0132 41  ILE B CG2 
952  C CD1 . ILE B 44 ? 0.3155 0.3102 0.3506 0.0451  0.0122  -0.0238 41  ILE B CD1 
953  N N   . GLU B 45 ? 0.3060 0.3159 0.2785 0.0085  0.0517  -0.0362 42  GLU B N   
954  C CA  . GLU B 45 ? 0.3567 0.3536 0.2997 -0.0023 0.0543  -0.0289 42  GLU B CA  
955  C C   . GLU B 45 ? 0.4779 0.4851 0.4054 -0.0181 0.0667  -0.0394 42  GLU B C   
956  O O   . GLU B 45 ? 0.4570 0.4495 0.3543 -0.0307 0.0679  -0.0315 42  GLU B O   
957  C CB  . GLU B 45 ? 0.3900 0.3754 0.3274 0.0015  0.0479  -0.0269 42  GLU B CB  
958  C CG  . GLU B 45 ? 0.4001 0.3731 0.3436 0.0109  0.0372  -0.0144 42  GLU B CG  
959  C CD  . GLU B 45 ? 0.3915 0.3543 0.3302 0.0134  0.0311  -0.0131 42  GLU B CD  
960  O OE1 . GLU B 45 ? 0.4119 0.3662 0.3529 0.0179  0.0237  -0.0045 42  GLU B OE1 
961  O OE2 . GLU B 45 ? 0.4691 0.4346 0.4028 0.0104  0.0342  -0.0224 42  GLU B OE2 
962  N N   . ARG B 46 ? 0.4182 0.4498 0.3657 -0.0184 0.0747  -0.0583 43  ARG B N   
963  C CA  . ARG B 46 ? 0.5554 0.6030 0.4899 -0.0363 0.0892  -0.0727 43  ARG B CA  
964  C C   . ARG B 46 ? 0.6143 0.6742 0.5534 -0.0437 0.0965  -0.0752 43  ARG B C   
965  O O   . ARG B 46 ? 0.5928 0.6695 0.5291 -0.0585 0.1067  -0.0873 43  ARG B O   
966  C CB  . ARG B 46 ? 0.6222 0.6958 0.5802 -0.0334 0.0951  -0.0977 43  ARG B CB  
967  C CG  . ARG B 46 ? 0.6910 0.7667 0.6250 -0.0490 0.1034  -0.1059 43  ARG B CG  
968  C CD  . ARG B 46 ? 0.6959 0.7998 0.6614 -0.0451 0.1052  -0.1299 43  ARG B CD  
969  N NE  . ARG B 46 ? 0.6773 0.7838 0.6747 -0.0224 0.0951  -0.1385 43  ARG B NE  
970  C CZ  . ARG B 46 ? 0.6956 0.8180 0.7321 -0.0084 0.0880  -0.1507 43  ARG B CZ  
971  N NH1 . ARG B 46 ? 0.7428 0.8842 0.7933 -0.0145 0.0920  -0.1580 43  ARG B NH1 
972  N NH2 . ARG B 46 ? 0.6321 0.7480 0.6924 0.0112  0.0744  -0.1549 43  ARG B NH2 
973  N N   . ASN B 47 ? 0.5697 0.6203 0.5191 -0.0328 0.0877  -0.0622 44  ASN B N   
974  C CA  . ASN B 47 ? 0.6127 0.6721 0.5665 -0.0382 0.0925  -0.0625 44  ASN B CA  
975  C C   . ASN B 47 ? 0.6142 0.7073 0.6016 -0.0357 0.0998  -0.0862 44  ASN B C   
976  O O   . ASN B 47 ? 0.6100 0.7134 0.6059 -0.0396 0.1028  -0.0889 44  ASN B O   
977  C CB  . ASN B 47 ? 0.6617 0.7079 0.5774 -0.0602 0.0994  -0.0543 44  ASN B CB  
978  C CG  . ASN B 47 ? 0.6740 0.6867 0.5661 -0.0574 0.0868  -0.0313 44  ASN B CG  
979  O OD1 . ASN B 47 ? 0.5999 0.6071 0.5054 -0.0451 0.0785  -0.0221 44  ASN B OD1 
980  N ND2 . ASN B 47 ? 0.7135 0.7039 0.5710 -0.0687 0.0841  -0.0236 44  ASN B ND2 
981  N N   . SER B 48 ? 0.6534 0.7616 0.6624 -0.0275 0.0990  -0.1034 45  SER B N   
982  C CA  . SER B 48 ? 0.6804 0.8146 0.7254 -0.0217 0.0966  -0.1241 45  SER B CA  
983  C C   . SER B 48 ? 0.6796 0.8142 0.7566 0.0004  0.0832  -0.1264 45  SER B C   
984  O O   . SER B 48 ? 0.7119 0.8604 0.8194 0.0103  0.0744  -0.1429 45  SER B O   
985  C CB  . SER B 48 ? 0.6528 0.8000 0.7066 -0.0235 0.0975  -0.1410 45  SER B CB  
986  O OG  . SER B 48 ? 0.6147 0.7541 0.6842 -0.0047 0.0864  -0.1432 45  SER B OG  
987  N N   . ARG B 49 ? 0.6869 0.7991 0.7532 0.0066  0.0756  -0.1049 46  ARG B N   
988  C CA  . ARG B 49 ? 0.6372 0.7407 0.7255 0.0249  0.0585  -0.1010 46  ARG B CA  
989  C C   . ARG B 49 ? 0.5596 0.6433 0.6334 0.0259  0.0527  -0.0779 46  ARG B C   
990  O O   . ARG B 49 ? 0.5910 0.6557 0.6396 0.0212  0.0532  -0.0597 46  ARG B O   
991  C CB  . ARG B 49 ? 0.6690 0.7572 0.7608 0.0359  0.0463  -0.0988 46  ARG B CB  
992  C CG  . ARG B 49 ? 0.6726 0.7488 0.7846 0.0525  0.0263  -0.0977 46  ARG B CG  
993  C CD  . ARG B 49 ? 0.6573 0.7143 0.7667 0.0596  0.0148  -0.0929 46  ARG B CD  
994  N NE  . ARG B 49 ? 0.6888 0.7385 0.8228 0.0746  -0.0054 -0.1024 46  ARG B NE  
995  C CZ  . ARG B 49 ? 0.7599 0.8223 0.9194 0.0826  -0.0116 -0.1261 46  ARG B CZ  
996  N NH1 . ARG B 49 ? 0.7637 0.8492 0.9246 0.0742  0.0034  -0.1412 46  ARG B NH1 
997  N NH2 . ARG B 49 ? 0.7864 0.8347 0.9592 0.0920  -0.0342 -0.1283 46  ARG B NH2 
998  N N   . ASN B 50 ? 0.5173 0.6063 0.6085 0.0327  0.0461  -0.0805 47  ASN B N   
999  C CA  A ASN B 50 ? 0.4828 0.5543 0.5627 0.0349  0.0392  -0.0607 47  ASN B CA  
1000 C CA  B ASN B 50 ? 0.4840 0.5551 0.5630 0.0346  0.0395  -0.0604 47  ASN B CA  
1001 C C   . ASN B 50 ? 0.4789 0.5268 0.5521 0.0433  0.0255  -0.0467 47  ASN B C   
1002 O O   . ASN B 50 ? 0.5750 0.6182 0.6528 0.0480  0.0204  -0.0516 47  ASN B O   
1003 C CB  A ASN B 50 ? 0.4334 0.5152 0.5342 0.0411  0.0330  -0.0683 47  ASN B CB  
1004 C CB  B ASN B 50 ? 0.4348 0.5169 0.5320 0.0388  0.0355  -0.0669 47  ASN B CB  
1005 C CG  A ASN B 50 ? 0.4044 0.4836 0.4919 0.0341  0.0380  -0.0560 47  ASN B CG  
1006 C CG  B ASN B 50 ? 0.3660 0.4602 0.4957 0.0513  0.0242  -0.0873 47  ASN B CG  
1007 O OD1 A ASN B 50 ? 0.2757 0.3411 0.3391 0.0272  0.0421  -0.0397 47  ASN B OD1 
1008 O OD1 B ASN B 50 ? 0.3179 0.3988 0.4536 0.0613  0.0106  -0.0874 47  ASN B OD1 
1009 N ND2 A ASN B 50 ? 0.4289 0.5219 0.5353 0.0371  0.0356  -0.0661 47  ASN B ND2 
1010 N ND2 B ASN B 50 ? 0.3366 0.4557 0.4887 0.0507  0.0285  -0.1060 47  ASN B ND2 
1011 N N   . LEU B 51 ? 0.2551 0.2891 0.3177 0.0439  0.0199  -0.0308 48  LEU B N   
1012 C CA  . LEU B 51 ? 0.3048 0.3178 0.3551 0.0461  0.0104  -0.0161 48  LEU B CA  
1013 C C   . LEU B 51 ? 0.3063 0.3123 0.3526 0.0468  0.0038  -0.0063 48  LEU B C   
1014 O O   . LEU B 51 ? 0.3146 0.3286 0.3577 0.0426  0.0110  -0.0044 48  LEU B O   
1015 C CB  . LEU B 51 ? 0.3726 0.3798 0.4023 0.0384  0.0190  -0.0056 48  LEU B CB  
1016 C CG  . LEU B 51 ? 0.3694 0.3609 0.3869 0.0375  0.0132  0.0072  48  LEU B CG  
1017 C CD1 . LEU B 51 ? 0.4610 0.4448 0.4830 0.0413  0.0065  0.0034  48  LEU B CD1 
1018 C CD2 . LEU B 51 ? 0.4027 0.3925 0.4052 0.0315  0.0203  0.0140  48  LEU B CD2 
1019 N N   . THR B 52 ? 0.2999 0.2890 0.3431 0.0501  -0.0101 0.0006  49  THR B N   
1020 C CA  . THR B 52 ? 0.2547 0.2357 0.2881 0.0476  -0.0158 0.0110  49  THR B CA  
1021 C C   . THR B 52 ? 0.2738 0.2488 0.2872 0.0389  -0.0099 0.0241  49  THR B C   
1022 O O   . THR B 52 ? 0.2812 0.2546 0.2895 0.0363  -0.0052 0.0256  49  THR B O   
1023 C CB  . THR B 52 ? 0.2243 0.1863 0.2588 0.0526  -0.0362 0.0125  49  THR B CB  
1024 O OG1 . THR B 52 ? 0.2506 0.1947 0.2756 0.0508  -0.0437 0.0181  49  THR B OG1 
1025 C CG2 . THR B 52 ? 0.2232 0.1925 0.2838 0.0641  -0.0456 -0.0048 49  THR B CG2 
1026 N N   . ILE B 53 ? 0.2255 0.1994 0.2294 0.0344  -0.0101 0.0313  50  ILE B N   
1027 C CA  . ILE B 53 ? 0.2202 0.1937 0.2095 0.0260  -0.0043 0.0394  50  ILE B CA  
1028 C C   . ILE B 53 ? 0.1974 0.1556 0.1753 0.0207  -0.0115 0.0455  50  ILE B C   
1029 O O   . ILE B 53 ? 0.2880 0.2483 0.2594 0.0148  -0.0058 0.0479  50  ILE B O   
1030 C CB  . ILE B 53 ? 0.2815 0.2573 0.2634 0.0218  -0.0051 0.0436  50  ILE B CB  
1031 C CG1 . ILE B 53 ? 0.3202 0.3090 0.3135 0.0266  -0.0002 0.0377  50  ILE B CG1 
1032 C CG2 . ILE B 53 ? 0.2489 0.2291 0.2184 0.0122  0.0012  0.0480  50  ILE B CG2 
1033 C CD1 . ILE B 53 ? 0.2651 0.2643 0.2622 0.0267  0.0107  0.0339  50  ILE B CD1 
1034 N N   . LYS B 54 ? 0.2441 0.1851 0.2185 0.0218  -0.0258 0.0480  51  LYS B N   
1035 C CA  . LYS B 54 ? 0.2768 0.1979 0.2368 0.0145  -0.0347 0.0549  51  LYS B CA  
1036 C C   . LYS B 54 ? 0.2912 0.2131 0.2603 0.0188  -0.0321 0.0500  51  LYS B C   
1037 O O   . LYS B 54 ? 0.2385 0.1545 0.1979 0.0110  -0.0306 0.0543  51  LYS B O   
1038 C CB  . LYS B 54 ? 0.3511 0.2469 0.3039 0.0157  -0.0552 0.0586  51  LYS B CB  
1039 C CG  . LYS B 54 ? 0.5625 0.4328 0.4922 0.0031  -0.0651 0.0688  51  LYS B CG  
1040 C CD  . LYS B 54 ? 0.7010 0.5420 0.6312 0.0097  -0.0888 0.0683  51  LYS B CD  
1041 C CE  . LYS B 54 ? 0.6880 0.5116 0.6005 -0.0036 -0.0931 0.0739  51  LYS B CE  
1042 N NZ  . LYS B 54 ? 0.6990 0.5269 0.5869 -0.0243 -0.0808 0.0833  51  LYS B NZ  
1043 N N   . SER B 55 ? 0.2463 0.1766 0.2342 0.0302  -0.0314 0.0394  52  SER B N   
1044 C CA  . SER B 55 ? 0.2430 0.1773 0.2386 0.0335  -0.0268 0.0333  52  SER B CA  
1045 C C   . SER B 55 ? 0.1801 0.1262 0.1702 0.0281  -0.0129 0.0353  52  SER B C   
1046 O O   . SER B 55 ? 0.1895 0.1313 0.1759 0.0253  -0.0121 0.0363  52  SER B O   
1047 C CB  . SER B 55 ? 0.1990 0.1455 0.2157 0.0444  -0.0262 0.0186  52  SER B CB  
1048 O OG  . SER B 55 ? 0.2798 0.2115 0.3051 0.0514  -0.0433 0.0134  52  SER B OG  
1049 N N   . LEU B 56 ? 0.1828 0.1426 0.1727 0.0269  -0.0035 0.0353  53  LEU B N   
1050 C CA  . LEU B 56 ? 0.1851 0.1537 0.1706 0.0231  0.0061  0.0360  53  LEU B CA  
1051 C C   . LEU B 56 ? 0.1945 0.1605 0.1706 0.0145  0.0056  0.0417  53  LEU B C   
1052 O O   . LEU B 56 ? 0.1661 0.1349 0.1415 0.0119  0.0087  0.0404  53  LEU B O   
1053 C CB  . LEU B 56 ? 0.1825 0.1622 0.1695 0.0238  0.0123  0.0348  53  LEU B CB  
1054 C CG  . LEU B 56 ? 0.2496 0.2350 0.2331 0.0216  0.0178  0.0342  53  LEU B CG  
1055 C CD1 . LEU B 56 ? 0.2594 0.2418 0.2416 0.0235  0.0195  0.0306  53  LEU B CD1 
1056 C CD2 . LEU B 56 ? 0.2714 0.2633 0.2554 0.0220  0.0207  0.0335  53  LEU B CD2 
1057 N N   . GLU B 57 ? 0.1818 0.1423 0.1500 0.0085  0.0011  0.0472  54  GLU B N   
1058 C CA  . GLU B 57 ? 0.1831 0.1423 0.1397 -0.0040 0.0020  0.0512  54  GLU B CA  
1059 C C   . GLU B 57 ? 0.2447 0.1926 0.1980 -0.0077 -0.0020 0.0525  54  GLU B C   
1060 O O   . GLU B 57 ? 0.2256 0.1812 0.1782 -0.0146 0.0033  0.0504  54  GLU B O   
1061 C CB  . GLU B 57 ? 0.2925 0.2415 0.2345 -0.0127 -0.0043 0.0582  54  GLU B CB  
1062 C CG  . GLU B 57 ? 0.3800 0.3308 0.3067 -0.0299 -0.0008 0.0613  54  GLU B CG  
1063 C CD  . GLU B 57 ? 0.5783 0.5227 0.4871 -0.0404 -0.0044 0.0672  54  GLU B CD  
1064 O OE1 . GLU B 57 ? 0.6553 0.5755 0.5526 -0.0404 -0.0183 0.0747  54  GLU B OE1 
1065 O OE2 . GLU B 57 ? 0.5835 0.5467 0.4903 -0.0483 0.0052  0.0632  54  GLU B OE2 
1066 N N   . LEU B 58 ? 0.2330 0.1633 0.1865 -0.0027 -0.0126 0.0542  55  LEU B N   
1067 C CA  . LEU B 58 ? 0.2632 0.1789 0.2133 -0.0056 -0.0192 0.0555  55  LEU B CA  
1068 C C   . LEU B 58 ? 0.2495 0.1776 0.2115 0.0006  -0.0114 0.0481  55  LEU B C   
1069 O O   . LEU B 58 ? 0.2246 0.1502 0.1842 -0.0048 -0.0111 0.0479  55  LEU B O   
1070 C CB  . LEU B 58 ? 0.2862 0.1836 0.2408 0.0036  -0.0335 0.0545  55  LEU B CB  
1071 C CG  . LEU B 58 ? 0.3260 0.1994 0.2655 -0.0025 -0.0490 0.0627  55  LEU B CG  
1072 C CD1 . LEU B 58 ? 0.3861 0.2433 0.3377 0.0111  -0.0660 0.0568  55  LEU B CD1 
1073 C CD2 . LEU B 58 ? 0.4203 0.2774 0.3386 -0.0201 -0.0522 0.0715  55  LEU B CD2 
1074 N N   . ILE B 59 ? 0.1893 0.1287 0.1620 0.0109  -0.0062 0.0419  56  ILE B N   
1075 C CA  . ILE B 59 ? 0.1839 0.1325 0.1618 0.0146  0.0004  0.0360  56  ILE B CA  
1076 C C   . ILE B 59 ? 0.2466 0.2055 0.2228 0.0088  0.0060  0.0355  56  ILE B C   
1077 O O   . ILE B 59 ? 0.2313 0.1911 0.2092 0.0085  0.0063  0.0323  56  ILE B O   
1078 C CB  . ILE B 59 ? 0.2171 0.1730 0.2008 0.0226  0.0047  0.0303  56  ILE B CB  
1079 C CG1 . ILE B 59 ? 0.2111 0.1612 0.2024 0.0288  -0.0010 0.0250  56  ILE B CG1 
1080 C CG2 . ILE B 59 ? 0.2197 0.1811 0.2013 0.0233  0.0099  0.0268  56  ILE B CG2 
1081 C CD1 . ILE B 59 ? 0.3391 0.3006 0.3372 0.0337  0.0051  0.0163  56  ILE B CD1 
1082 N N   . MET B 60 ? 0.2160 0.1846 0.1909 0.0050  0.0098  0.0367  57  MET B N   
1083 C CA  A MET B 60 ? 0.2075 0.1896 0.1856 0.0001  0.0140  0.0321  57  MET B CA  
1084 C CA  B MET B 60 ? 0.2161 0.1986 0.1937 -0.0006 0.0142  0.0324  57  MET B CA  
1085 C C   . MET B 60 ? 0.1918 0.1735 0.1667 -0.0111 0.0138  0.0323  57  MET B C   
1086 O O   . MET B 60 ? 0.2217 0.2112 0.2033 -0.0118 0.0150  0.0258  57  MET B O   
1087 C CB  A MET B 60 ? 0.2392 0.2336 0.2183 -0.0023 0.0179  0.0307  57  MET B CB  
1088 C CB  B MET B 60 ? 0.2301 0.2228 0.2061 -0.0053 0.0177  0.0328  57  MET B CB  
1089 C CG  A MET B 60 ? 0.1465 0.1401 0.1280 0.0072  0.0179  0.0305  57  MET B CG  
1090 C CG  B MET B 60 ? 0.2101 0.2080 0.1910 0.0036  0.0190  0.0304  57  MET B CG  
1091 S SD  A MET B 60 ? 0.1907 0.1988 0.1753 0.0053  0.0212  0.0270  57  MET B SD  
1092 S SD  B MET B 60 ? 0.1783 0.1802 0.1552 0.0009  0.0205  0.0338  57  MET B SD  
1093 C CE  A MET B 60 ? 0.1521 0.1611 0.1268 -0.0083 0.0227  0.0320  57  MET B CE  
1094 C CE  B MET B 60 ? 0.1344 0.1429 0.1194 0.0103  0.0214  0.0280  57  MET B CE  
1095 N N   . LYS B 61 ? 0.2165 0.1870 0.1799 -0.0205 0.0107  0.0395  58  LYS B N   
1096 C CA  . LYS B 61 ? 0.3073 0.2724 0.2628 -0.0344 0.0095  0.0413  58  LYS B CA  
1097 C C   . LYS B 61 ? 0.3078 0.2642 0.2688 -0.0288 0.0053  0.0392  58  LYS B C   
1098 O O   . LYS B 61 ? 0.3485 0.3116 0.3122 -0.0365 0.0077  0.0348  58  LYS B O   
1099 C CB  . LYS B 61 ? 0.3554 0.3000 0.2917 -0.0454 0.0025  0.0519  58  LYS B CB  
1100 C CG  . LYS B 61 ? 0.5125 0.4665 0.4392 -0.0554 0.0074  0.0537  58  LYS B CG  
1101 C CD  . LYS B 61 ? 0.5494 0.4783 0.4508 -0.0695 -0.0020 0.0654  58  LYS B CD  
1102 C CE  . LYS B 61 ? 0.5473 0.4877 0.4346 -0.0854 0.0050  0.0660  58  LYS B CE  
1103 N NZ  . LYS B 61 ? 0.5868 0.4970 0.4443 -0.1005 -0.0069 0.0784  58  LYS B NZ  
1104 N N   . GLY B 62 ? 0.3010 0.2452 0.2650 -0.0162 -0.0004 0.0405  59  GLY B N   
1105 C CA  . GLY B 62 ? 0.2420 0.1786 0.2109 -0.0101 -0.0044 0.0371  59  GLY B CA  
1106 C C   . GLY B 62 ? 0.3189 0.2702 0.2968 -0.0048 0.0009  0.0291  59  GLY B C   
1107 O O   . GLY B 62 ? 0.4219 0.3716 0.4027 -0.0056 -0.0010 0.0255  59  GLY B O   
1108 N N   . LEU B 63 ? 0.2824 0.2453 0.2641 0.0008  0.0052  0.0262  60  LEU B N   
1109 C CA  . LEU B 63 ? 0.2623 0.2355 0.2508 0.0048  0.0062  0.0185  60  LEU B CA  
1110 C C   . LEU B 63 ? 0.3734 0.3632 0.3701 -0.0037 0.0088  0.0119  60  LEU B C   
1111 O O   . LEU B 63 ? 0.3885 0.3866 0.3944 -0.0002 0.0066  0.0030  60  LEU B O   
1112 C CB  . LEU B 63 ? 0.2733 0.2485 0.2608 0.0126  0.0070  0.0176  60  LEU B CB  
1113 C CG  . LEU B 63 ? 0.3152 0.2792 0.2959 0.0183  0.0066  0.0204  60  LEU B CG  
1114 C CD1 . LEU B 63 ? 0.3172 0.2832 0.2946 0.0212  0.0090  0.0215  60  LEU B CD1 
1115 C CD2 . LEU B 63 ? 0.2767 0.2338 0.2536 0.0218  0.0036  0.0164  60  LEU B CD2 
1116 N N   . GLU B 64 ? 0.2577 0.2526 0.2507 -0.0158 0.0128  0.0146  61  GLU B N   
1117 C CA  . GLU B 64 ? 0.2933 0.3100 0.2949 -0.0263 0.0181  0.0051  61  GLU B CA  
1118 C C   . GLU B 64 ? 0.3156 0.3502 0.3312 -0.0178 0.0187  -0.0057 61  GLU B C   
1119 O O   . GLU B 64 ? 0.2732 0.3257 0.3051 -0.0173 0.0181  -0.0199 61  GLU B O   
1120 C CB  . GLU B 64 ? 0.4000 0.4214 0.4086 -0.0322 0.0173  -0.0019 61  GLU B CB  
1121 C CG  . GLU B 64 ? 0.5378 0.5483 0.5329 -0.0492 0.0183  0.0056  61  GLU B CG  
1122 C CD  . GLU B 64 ? 0.6133 0.6296 0.6161 -0.0565 0.0180  -0.0021 61  GLU B CD  
1123 O OE1 . GLU B 64 ? 0.6255 0.6537 0.6452 -0.0463 0.0158  -0.0135 61  GLU B OE1 
1124 O OE2 . GLU B 64 ? 0.6572 0.6637 0.6475 -0.0732 0.0185  0.0035  61  GLU B OE2 
1125 N N   . VAL B 65 ? 0.2596 0.2887 0.2703 -0.0107 0.0182  -0.0005 62  VAL B N   
1126 C CA  . VAL B 65 ? 0.2403 0.2831 0.2621 -0.0040 0.0173  -0.0097 62  VAL B CA  
1127 C C   . VAL B 65 ? 0.2413 0.2919 0.2584 -0.0107 0.0234  -0.0070 62  VAL B C   
1128 O O   . VAL B 65 ? 0.2491 0.2859 0.2518 -0.0141 0.0247  0.0052  62  VAL B O   
1129 C CB  . VAL B 65 ? 0.3052 0.3324 0.3240 0.0101  0.0095  -0.0070 62  VAL B CB  
1130 C CG1 . VAL B 65 ? 0.3844 0.4019 0.4036 0.0149  0.0030  -0.0092 62  VAL B CG1 
1131 C CG2 . VAL B 65 ? 0.3128 0.3237 0.3167 0.0121  0.0114  0.0062  62  VAL B CG2 
1132 N N   . SER B 66 ? 0.2171 0.2895 0.2476 -0.0115 0.0256  -0.0200 63  SER B N   
1133 C CA  . SER B 66 ? 0.2393 0.3210 0.2654 -0.0178 0.0314  -0.0194 63  SER B CA  
1134 C C   . SER B 66 ? 0.2534 0.3197 0.2731 -0.0066 0.0270  -0.0105 63  SER B C   
1135 O O   . SER B 66 ? 0.2313 0.2867 0.2542 0.0055  0.0198  -0.0106 63  SER B O   
1136 C CB  . SER B 66 ? 0.2950 0.4083 0.3411 -0.0209 0.0349  -0.0400 63  SER B CB  
1137 O OG  . SER B 66 ? 0.2284 0.3438 0.2919 -0.0042 0.0250  -0.0509 63  SER B OG  
1138 N N   . ASP B 67 ? 0.2177 0.2825 0.2269 -0.0121 0.0309  -0.0035 64  ASP B N   
1139 C CA  . ASP B 67 ? 0.2395 0.2928 0.2447 -0.0029 0.0277  0.0032  64  ASP B CA  
1140 C C   . ASP B 67 ? 0.2764 0.3374 0.2948 0.0069  0.0232  -0.0074 64  ASP B C   
1141 O O   . ASP B 67 ? 0.2193 0.2653 0.2343 0.0157  0.0177  -0.0027 64  ASP B O   
1142 C CB  . ASP B 67 ? 0.3649 0.4169 0.3583 -0.0102 0.0311  0.0106  64  ASP B CB  
1143 C CG  . ASP B 67 ? 0.3977 0.4695 0.3899 -0.0242 0.0379  0.0031  64  ASP B CG  
1144 O OD1 . ASP B 67 ? 0.4389 0.5317 0.4447 -0.0274 0.0412  -0.0115 64  ASP B OD1 
1145 O OD2 . ASP B 67 ? 0.4718 0.5385 0.4486 -0.0332 0.0394  0.0108  64  ASP B OD2 
1146 N N   . VAL B 68 ? 0.2609 0.3450 0.2936 0.0038  0.0252  -0.0227 65  VAL B N   
1147 C CA  . VAL B 68 ? 0.2246 0.3171 0.2742 0.0142  0.0176  -0.0368 65  VAL B CA  
1148 C C   . VAL B 68 ? 0.2357 0.3121 0.2893 0.0255  0.0055  -0.0384 65  VAL B C   
1149 O O   . VAL B 68 ? 0.2442 0.3039 0.2949 0.0348  -0.0044 -0.0363 65  VAL B O   
1150 C CB  . VAL B 68 ? 0.2128 0.3380 0.2814 0.0079  0.0225  -0.0573 65  VAL B CB  
1151 C CG1 . VAL B 68 ? 0.2022 0.3390 0.2964 0.0202  0.0111  -0.0784 65  VAL B CG1 
1152 C CG2 . VAL B 68 ? 0.1684 0.3080 0.2302 -0.0030 0.0325  -0.0574 65  VAL B CG2 
1153 N N   . VAL B 69 ? 0.1631 0.2416 0.2199 0.0232  0.0057  -0.0409 66  VAL B N   
1154 C CA  . VAL B 69 ? 0.1877 0.2481 0.2443 0.0329  -0.0068 -0.0411 66  VAL B CA  
1155 C C   . VAL B 69 ? 0.1991 0.2305 0.2330 0.0351  -0.0088 -0.0234 66  VAL B C   
1156 O O   . VAL B 69 ? 0.1918 0.2041 0.2192 0.0422  -0.0204 -0.0221 66  VAL B O   
1157 C CB  . VAL B 69 ? 0.2783 0.3471 0.3427 0.0296  -0.0060 -0.0474 66  VAL B CB  
1158 C CG1 . VAL B 69 ? 0.2907 0.3361 0.3487 0.0385  -0.0189 -0.0443 66  VAL B CG1 
1159 C CG2 . VAL B 69 ? 0.2516 0.3522 0.3435 0.0288  -0.0063 -0.0709 66  VAL B CG2 
1160 N N   . PHE B 70 ? 0.1827 0.2101 0.2040 0.0280  0.0011  -0.0109 67  PHE B N   
1161 C CA  . PHE B 70 ? 0.1690 0.1760 0.1730 0.0290  0.0016  0.0021  67  PHE B CA  
1162 C C   . PHE B 70 ? 0.1788 0.1776 0.1777 0.0322  -0.0021 0.0041  67  PHE B C   
1163 O O   . PHE B 70 ? 0.1524 0.1316 0.1375 0.0337  -0.0074 0.0093  67  PHE B O   
1164 C CB  . PHE B 70 ? 0.1814 0.1883 0.1783 0.0228  0.0106  0.0114  67  PHE B CB  
1165 C CG  . PHE B 70 ? 0.2082 0.2000 0.1932 0.0241  0.0114  0.0194  67  PHE B CG  
1166 C CD1 . PHE B 70 ? 0.1925 0.1817 0.1732 0.0242  0.0136  0.0232  67  PHE B CD1 
1167 C CD2 . PHE B 70 ? 0.1904 0.1729 0.1698 0.0242  0.0107  0.0212  67  PHE B CD2 
1168 C CE1 . PHE B 70 ? 0.1791 0.1594 0.1513 0.0236  0.0160  0.0269  67  PHE B CE1 
1169 C CE2 . PHE B 70 ? 0.1885 0.1620 0.1589 0.0240  0.0131  0.0247  67  PHE B CE2 
1170 C CZ  . PHE B 70 ? 0.2276 0.2013 0.1950 0.0232  0.0162  0.0268  67  PHE B CZ  
1171 N N   . PHE B 71 ? 0.2033 0.2154 0.2095 0.0309  0.0017  0.0011  68  PHE B N   
1172 C CA  . PHE B 71 ? 0.2221 0.2270 0.2244 0.0335  -0.0018 0.0027  68  PHE B CA  
1173 C C   . PHE B 71 ? 0.2218 0.2166 0.2275 0.0404  -0.0160 -0.0051 68  PHE B C   
1174 O O   . PHE B 71 ? 0.2245 0.2008 0.2190 0.0415  -0.0230 -0.0009 68  PHE B O   
1175 C CB  . PHE B 71 ? 0.2020 0.2240 0.2111 0.0303  0.0051  0.0008  68  PHE B CB  
1176 C CG  . PHE B 71 ? 0.2478 0.2706 0.2488 0.0242  0.0142  0.0107  68  PHE B CG  
1177 C CD1 . PHE B 71 ? 0.3260 0.3354 0.3171 0.0243  0.0155  0.0194  68  PHE B CD1 
1178 C CD2 . PHE B 71 ? 0.3612 0.3981 0.3642 0.0174  0.0201  0.0096  68  PHE B CD2 
1179 C CE1 . PHE B 71 ? 0.3121 0.3216 0.2998 0.0211  0.0202  0.0256  68  PHE B CE1 
1180 C CE2 . PHE B 71 ? 0.3717 0.4032 0.3653 0.0125  0.0237  0.0190  68  PHE B CE2 
1181 C CZ  . PHE B 71 ? 0.3864 0.4043 0.3748 0.0161  0.0225  0.0261  68  PHE B CZ  
1182 N N   . GLU B 72 ? 0.1770 0.1827 0.1982 0.0447  -0.0220 -0.0177 69  GLU B N   
1183 C CA  . GLU B 72 ? 0.2148 0.2079 0.2413 0.0535  -0.0403 -0.0272 69  GLU B CA  
1184 C C   . GLU B 72 ? 0.2022 0.1646 0.2075 0.0537  -0.0501 -0.0179 69  GLU B C   
1185 O O   . GLU B 72 ? 0.2158 0.1521 0.2084 0.0565  -0.0655 -0.0160 69  GLU B O   
1186 C CB  . GLU B 72 ? 0.2184 0.2348 0.2712 0.0585  -0.0445 -0.0466 69  GLU B CB  
1187 C CG  . GLU B 72 ? 0.2765 0.3158 0.3491 0.0607  -0.0435 -0.0609 69  GLU B CG  
1188 C CD  . GLU B 72 ? 0.3157 0.3910 0.4144 0.0587  -0.0372 -0.0805 69  GLU B CD  
1189 O OE1 . GLU B 72 ? 0.3348 0.4145 0.4404 0.0590  -0.0392 -0.0860 69  GLU B OE1 
1190 O OE2 . GLU B 72 ? 0.2761 0.3763 0.3874 0.0553  -0.0294 -0.0911 69  GLU B OE2 
1191 N N   . MET B 73 ? 0.1831 0.1466 0.1817 0.0492  -0.0418 -0.0117 70  MET B N   
1192 C CA  . MET B 73 ? 0.2204 0.1558 0.1954 0.0471  -0.0490 -0.0029 70  MET B CA  
1193 C C   . MET B 73 ? 0.2311 0.1494 0.1822 0.0392  -0.0440 0.0098  70  MET B C   
1194 O O   . MET B 73 ? 0.3100 0.2008 0.2376 0.0353  -0.0537 0.0155  70  MET B O   
1195 C CB  . MET B 73 ? 0.2637 0.2052 0.2378 0.0441  -0.0409 -0.0007 70  MET B CB  
1196 C CG  . MET B 73 ? 0.3222 0.2747 0.3155 0.0503  -0.0491 -0.0137 70  MET B CG  
1197 S SD  . MET B 73 ? 0.4577 0.4209 0.4524 0.0450  -0.0369 -0.0108 70  MET B SD  
1198 C CE  . MET B 73 ? 0.3879 0.3653 0.4076 0.0519  -0.0485 -0.0292 70  MET B CE  
1199 N N   . LEU B 74 ? 0.2004 0.1347 0.1562 0.0352  -0.0290 0.0137  71  LEU B N   
1200 C CA  . LEU B 74 ? 0.2224 0.1467 0.1613 0.0276  -0.0231 0.0222  71  LEU B CA  
1201 C C   . LEU B 74 ? 0.2323 0.1398 0.1638 0.0281  -0.0353 0.0219  71  LEU B C   
1202 O O   . LEU B 74 ? 0.2357 0.1212 0.1438 0.0199  -0.0387 0.0286  71  LEU B O   
1203 C CB  . LEU B 74 ? 0.1755 0.1213 0.1255 0.0256  -0.0078 0.0240  71  LEU B CB  
1204 C CG  . LEU B 74 ? 0.1788 0.1217 0.1189 0.0186  -0.0007 0.0291  71  LEU B CG  
1205 C CD1 . LEU B 74 ? 0.2396 0.1722 0.1625 0.0110  0.0033  0.0324  71  LEU B CD1 
1206 C CD2 . LEU B 74 ? 0.2719 0.2358 0.2271 0.0198  0.0098  0.0288  71  LEU B CD2 
1207 N N   . ILE B 75 ? 0.2050 0.1239 0.1562 0.0360  -0.0412 0.0133  72  ILE B N   
1208 C CA  . ILE B 75 ? 0.2230 0.1242 0.1699 0.0384  -0.0562 0.0110  72  ILE B CA  
1209 C C   . ILE B 75 ? 0.3091 0.1751 0.2368 0.0391  -0.0779 0.0121  72  ILE B C   
1210 O O   . ILE B 75 ? 0.3370 0.1746 0.2408 0.0320  -0.0868 0.0195  72  ILE B O   
1211 C CB  . ILE B 75 ? 0.2074 0.1317 0.1836 0.0484  -0.0594 -0.0033 72  ILE B CB  
1212 C CG1 . ILE B 75 ? 0.2473 0.1975 0.2332 0.0446  -0.0411 -0.0016 72  ILE B CG1 
1213 C CG2 . ILE B 75 ? 0.2801 0.1849 0.2571 0.0547  -0.0803 -0.0100 72  ILE B CG2 
1214 C CD1 . ILE B 75 ? 0.2601 0.2396 0.2718 0.0502  -0.0383 -0.0157 72  ILE B CD1 
1215 N N   . LYS B 76 ? 0.3281 0.1945 0.2653 0.0469  -0.0879 0.0042  73  LYS B N   
1216 C CA  . LYS B 76 ? 0.4506 0.2813 0.3672 0.0476  -0.1101 0.0059  73  LYS B CA  
1217 C C   . LYS B 76 ? 0.4495 0.2550 0.3269 0.0309  -0.1047 0.0214  73  LYS B C   
1218 O O   . LYS B 76 ? 0.4445 0.2244 0.2998 0.0217  -0.1158 0.0241  73  LYS B O   
1219 C CB  . LYS B 76 ? 0.4401 0.2822 0.3741 0.0565  -0.1155 -0.0043 73  LYS B CB  
1220 C CG  . LYS B 76 ? 0.5464 0.3614 0.4637 0.0539  -0.1345 -0.0066 73  LYS B CG  
1221 C CD  . LYS B 76 ? 0.5798 0.4103 0.5238 0.0652  -0.1438 -0.0229 73  LYS B CD  
1222 C CE  . LYS B 76 ? 0.6839 0.5095 0.6153 0.0620  -0.1398 -0.0170 73  LYS B CE  
1223 N NZ  . LYS B 76 ? 0.7219 0.5554 0.6747 0.0712  -0.1535 -0.0336 73  LYS B NZ  
1224 N N   . GLU B 77 ? 0.4055 0.2274 0.2796 0.0243  -0.0840 0.0272  74  GLU B N   
1225 C CA  . GLU B 77 ? 0.4954 0.3005 0.3358 0.0080  -0.0760 0.0383  74  GLU B CA  
1226 C C   . GLU B 77 ? 0.5297 0.3245 0.3524 -0.0050 -0.0717 0.0445  74  GLU B C   
1227 O O   . GLU B 77 ? 0.5285 0.3041 0.3254 -0.0195 -0.0747 0.0478  74  GLU B O   
1228 C CB  . GLU B 77 ? 0.5556 0.3881 0.4054 0.0053  -0.0539 0.0382  74  GLU B CB  
1229 C CG  . GLU B 77 ? 0.5312 0.3514 0.3508 -0.0103 -0.0460 0.0445  74  GLU B CG  
1230 C CD  . GLU B 77 ? 0.6649 0.4554 0.4590 -0.0150 -0.0625 0.0461  74  GLU B CD  
1231 O OE1 . GLU B 77 ? 0.6280 0.4141 0.4331 -0.0031 -0.0765 0.0413  74  GLU B OE1 
1232 O OE2 . GLU B 77 ? 0.7509 0.5280 0.5198 -0.0314 -0.0603 0.0488  74  GLU B OE2 
1233 N N   . ILE B 78 ? 0.4125 0.2278 0.2548 -0.0013 -0.0620 0.0427  75  ILE B N   
1234 C CA  . ILE B 78 ? 0.4316 0.2368 0.2583 -0.0131 -0.0589 0.0482  75  ILE B CA  
1235 C C   . ILE B 78 ? 0.3970 0.1746 0.2139 -0.0134 -0.0812 0.0465  75  ILE B C   
1236 O O   . ILE B 78 ? 0.3963 0.1538 0.1874 -0.0291 -0.0846 0.0502  75  ILE B O   
1237 C CB  . ILE B 78 ? 0.4051 0.2431 0.2607 -0.0074 -0.0443 0.0438  75  ILE B CB  
1238 C CG1 . ILE B 78 ? 0.4717 0.3381 0.3374 -0.0104 -0.0226 0.0430  75  ILE B CG1 
1239 C CG2 . ILE B 78 ? 0.4574 0.2838 0.3021 -0.0164 -0.0460 0.0473  75  ILE B CG2 
1240 C CD1 . ILE B 78 ? 0.3859 0.2828 0.2803 -0.0028 -0.0113 0.0386  75  ILE B CD1 
1241 N N   . LEU B 79 ? 0.3890 0.1678 0.2279 0.0032  -0.0968 0.0379  76  LEU B N   
1242 C CA  . LEU B 79 ? 0.4939 0.2502 0.3294 0.0049  -0.1195 0.0322  76  LEU B CA  
1243 C C   . LEU B 79 ? 0.5299 0.2550 0.3375 -0.0049 -0.1356 0.0332  76  LEU B C   
1244 O O   . LEU B 79 ? 0.4901 0.1889 0.2764 -0.0149 -0.1488 0.0351  76  LEU B O   
1245 C CB  . LEU B 79 ? 0.4873 0.2589 0.3585 0.0251  -0.1319 0.0173  76  LEU B CB  
1246 C CG  . LEU B 79 ? 0.4420 0.2352 0.3372 0.0333  -0.1245 0.0132  76  LEU B CG  
1247 C CD1 . LEU B 79 ? 0.4109 0.2242 0.3421 0.0508  -0.1356 -0.0060 76  LEU B CD1 
1248 C CD2 . LEU B 79 ? 0.4355 0.2084 0.3141 0.0238  -0.1308 0.0180  76  LEU B CD2 
1249 N N   . LYS B 80 ? 0.5555 0.2820 0.3624 -0.0021 -0.1361 0.0316  77  LYS B N   
1250 C CA  . LYS B 80 ? 0.6723 0.3685 0.4551 -0.0090 -0.1540 0.0308  77  LYS B CA  
1251 C C   . LYS B 80 ? 0.6802 0.3618 0.4263 -0.0314 -0.1428 0.0417  77  LYS B C   
1252 O O   . LYS B 80 ? 0.8295 0.4793 0.5458 -0.0439 -0.1573 0.0435  77  LYS B O   
1253 C CB  . LYS B 80 ? 0.7149 0.4192 0.5137 0.0034  -0.1598 0.0232  77  LYS B CB  
1254 C CG  . LYS B 80 ? 0.6723 0.3947 0.5099 0.0238  -0.1714 0.0078  77  LYS B CG  
1255 C CD  . LYS B 80 ? 0.7428 0.4678 0.5921 0.0330  -0.1813 -0.0018 77  LYS B CD  
1256 C CE  . LYS B 80 ? 0.8159 0.5545 0.7010 0.0497  -0.1979 -0.0219 77  LYS B CE  
1257 N NZ  . LYS B 80 ? 0.9372 0.6469 0.8130 0.0487  -0.2239 -0.0290 77  LYS B NZ  
1258 N N   . HIS B 81 ? 0.5699 0.2751 0.3180 -0.0376 -0.1174 0.0474  78  HIS B N   
1259 C CA  . HIS B 81 ? 0.8020 0.5022 0.5218 -0.0577 -0.1044 0.0530  78  HIS B CA  
1260 C C   . HIS B 81 ? 0.9384 0.6547 0.6549 -0.0706 -0.0840 0.0565  78  HIS B C   
1261 O O   . HIS B 81 ? 1.0297 0.7501 0.7287 -0.0875 -0.0700 0.0578  78  HIS B O   
1262 C CB  . HIS B 81 ? 0.8447 0.5605 0.5699 -0.0539 -0.0934 0.0522  78  HIS B CB  
1263 C CG  . HIS B 81 ? 0.8883 0.5895 0.6164 -0.0427 -0.1124 0.0478  78  HIS B CG  
1264 N ND1 . HIS B 81 ? 0.8206 0.5411 0.5783 -0.0236 -0.1132 0.0425  78  HIS B ND1 
1265 C CD2 . HIS B 81 ? 0.9712 0.6403 0.6763 -0.0487 -0.1320 0.0468  78  HIS B CD2 
1266 C CE1 . HIS B 81 ? 0.8900 0.5939 0.6457 -0.0176 -0.1318 0.0372  78  HIS B CE1 
1267 N NE2 . HIS B 81 ? 0.9674 0.6388 0.6911 -0.0321 -0.1440 0.0400  78  HIS B NE2 
1268 N N   . ASP B 82 ? 0.9857 0.7136 0.7215 -0.0624 -0.0821 0.0561  79  ASP B N   
1269 C CA  . ASP B 82 ? 1.0384 0.7794 0.7724 -0.0743 -0.0658 0.0583  79  ASP B CA  
1270 C C   . ASP B 82 ? 1.1209 0.8921 0.8606 -0.0816 -0.0397 0.0569  79  ASP B C   
1271 O O   . ASP B 82 ? 1.1789 0.9593 0.9112 -0.0971 -0.0265 0.0557  79  ASP B O   
1272 C CB  . ASP B 82 ? 1.0580 0.7712 0.7610 -0.0934 -0.0757 0.0605  79  ASP B CB  
1273 C CG  . ASP B 82 ? 1.0711 0.7520 0.7669 -0.0862 -0.1046 0.0599  79  ASP B CG  
1274 O OD1 . ASP B 82 ? 1.0603 0.7465 0.7803 -0.0692 -0.1131 0.0569  79  ASP B OD1 
1275 O OD2 . ASP B 82 ? 1.1250 0.7760 0.7924 -0.0971 -0.1197 0.0608  79  ASP B OD2 
1276 O OXT . ASP B 82 ? 1.1008 0.8886 0.8540 -0.0723 -0.0321 0.0551  79  ASP B OXT 
1277 S S   . SO4 C .  ? 0.3595 0.3092 0.3315 0.0351  0.0056  -0.0602 101 SO4 B S   
1278 O O1  . SO4 C .  ? 0.3015 0.2475 0.2557 0.0287  0.0097  -0.0471 101 SO4 B O1  
1279 O O2  . SO4 C .  ? 0.3730 0.3391 0.3469 0.0328  0.0140  -0.0788 101 SO4 B O2  
1280 O O3  . SO4 C .  ? 0.4863 0.4253 0.4545 0.0361  -0.0013 -0.0597 101 SO4 B O3  
1281 O O4  . SO4 C .  ? 0.3021 0.2483 0.2956 0.0428  -0.0024 -0.0579 101 SO4 B O4  
1282 O O   . HOH D .  ? 0.5665 0.4723 0.5495 0.0440  -0.0952 0.0416  101 HOH A O   
1283 O O   . HOH D .  ? 0.3578 0.4084 0.4738 0.0654  -0.0223 -0.0397 102 HOH A O   
1284 O O   . HOH D .  ? 0.4281 0.3422 0.3950 0.0190  -0.0489 0.0090  103 HOH A O   
1285 O O   . HOH D .  ? 0.3427 0.4301 0.3859 -0.0341 0.0645  -0.0266 104 HOH A O   
1286 O O   . HOH D .  ? 0.5899 0.5793 0.6699 0.0863  -0.0964 -0.0784 105 HOH A O   
1287 O O   . HOH D .  ? 0.6150 0.5020 0.5019 -0.0299 -0.0094 0.0415  106 HOH A O   
1288 O O   . HOH D .  ? 0.5180 0.3559 0.4490 0.0246  -0.0945 0.0119  107 HOH A O   
1289 O O   . HOH D .  ? 0.5450 0.4347 0.5571 0.0702  -0.1711 0.0093  108 HOH A O   
1290 O O   . HOH D .  ? 0.4543 0.5662 0.4948 0.0271  0.0095  -0.0449 109 HOH A O   
1291 O O   . HOH D .  ? 0.4922 0.4791 0.3936 -0.0060 -0.0553 0.0472  110 HOH A O   
1292 O O   . HOH D .  ? 0.5809 0.7253 0.8486 0.0888  -0.0695 -0.1576 111 HOH A O   
1293 O O   . HOH D .  ? 0.2723 0.4546 0.4608 0.0220  0.0417  -0.1168 112 HOH A O   
1294 O O   . HOH D .  ? 0.7997 0.6291 0.6461 -0.0542 -0.0323 0.0495  113 HOH A O   
1295 O O   . HOH D .  ? 0.7225 0.5884 0.7091 0.0596  -0.1663 0.0240  114 HOH A O   
1296 O O   . HOH D .  ? 0.7791 0.7045 0.6710 -0.0543 0.0246  0.0352  115 HOH A O   
1297 O O   . HOH D .  ? 0.7198 0.7267 0.6095 -0.0303 -0.0134 0.0509  116 HOH A O   
1298 O O   . HOH D .  ? 0.5800 0.6918 0.6938 0.0390  -0.0421 -0.0426 117 HOH A O   
1299 O O   . HOH D .  ? 0.7585 0.7196 0.7608 0.0091  -0.0335 -0.0036 118 HOH A O   
1300 O O   . HOH D .  ? 0.6953 0.7473 0.5282 -0.1338 0.0380  0.0273  119 HOH A O   
1301 O O   . HOH D .  ? 0.4552 0.4576 0.5497 0.0748  -0.0665 -0.0196 120 HOH A O   
1302 O O   . HOH E .  ? 0.3344 0.2531 0.3346 0.0477  -0.0237 -0.0608 201 HOH B O   
1303 O O   . HOH E .  ? 0.3262 0.2992 0.3987 0.0678  -0.0372 -0.0216 202 HOH B O   
1304 O O   . HOH E .  ? 0.3362 0.2679 0.2489 0.0163  0.0110  -0.0327 203 HOH B O   
1305 O O   . HOH E .  ? 0.4586 0.3533 0.3954 -0.0259 -0.0244 0.0586  204 HOH B O   
1306 O O   . HOH E .  ? 0.3707 0.4787 0.4478 -0.0005 0.0148  -0.0589 205 HOH B O   
1307 O O   . HOH E .  ? 0.5852 0.6425 0.6931 0.0763  -0.0626 -0.0930 206 HOH B O   
1308 O O   . HOH E .  ? 0.5125 0.4744 0.5411 0.0548  -0.0750 -0.0509 207 HOH B O   
1309 O O   . HOH E .  ? 0.5582 0.2505 0.4752 -0.0229 -0.1655 0.0520  208 HOH B O   
1310 O O   . HOH E .  ? 0.5371 0.4776 0.6211 0.0807  -0.0724 -0.0271 209 HOH B O   
1311 O O   . HOH E .  ? 0.5806 0.5721 0.6204 0.0433  -0.0485 -0.0451 210 HOH B O   
1312 O O   . HOH E .  ? 0.5566 0.4366 0.5499 0.0423  -0.0778 0.0357  211 HOH B O   
1313 O O   . HOH E .  ? 0.5524 0.4816 0.4160 -0.0082 0.0261  -0.0264 212 HOH B O   
1314 O O   . HOH E .  ? 0.6047 0.6754 0.6687 -0.0117 0.0076  -0.0464 213 HOH B O   
1315 O O   . HOH E .  ? 0.4657 0.3799 0.4515 0.0227  -0.0231 -0.0072 214 HOH B O   
1316 O O   . HOH E .  ? 0.7428 0.7755 0.8501 0.0669  -0.0116 -0.0524 215 HOH B O   
1317 O O   . HOH E .  ? 0.8757 0.6320 0.6389 -0.0064 -0.0924 0.0357  216 HOH B O   
1318 O O   . HOH E .  ? 0.7870 0.7888 0.7066 -0.0604 0.0246  0.0471  217 HOH B O   
1319 O O   . HOH E .  ? 0.4691 0.6524 0.6197 0.0165  0.0644  -0.1974 218 HOH B O   
1320 O O   . HOH E .  ? 0.5771 0.7089 0.7107 0.0387  0.0487  -0.1590 219 HOH B O   
1321 O O   . HOH E .  ? 0.8857 0.6717 0.6233 -0.0634 -0.0328 0.0500  220 HOH B O   
1322 O O   . HOH E .  ? 0.7669 0.7977 0.7530 0.0145  0.0512  -0.1093 221 HOH B O   
1323 O O   . HOH E .  ? 0.5437 0.5539 0.4401 -0.0977 0.0879  -0.0086 222 HOH B O   
1324 O O   . HOH E .  ? 0.5699 0.6208 0.5660 -0.0047 0.0698  -0.0462 223 HOH B O   
1325 O O   . HOH E .  ? 0.7374 0.5733 0.7913 0.0750  -0.1364 -0.0193 224 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -2 ?  ?   ?   A . n 
A 1 2  SER 2  -1 ?  ?   ?   A . n 
A 1 3  HIS 3  0  ?  ?   ?   A . n 
A 1 4  MET 4  1  ?  ?   ?   A . n 
A 1 5  GLU 5  2  ?  ?   ?   A . n 
A 1 6  SER 6  3  3  SER SER A . n 
A 1 7  PHE 7  4  4  PHE PHE A . n 
A 1 8  LEU 8  5  5  LEU LEU A . n 
A 1 9  LEU 9  6  6  LEU LEU A . n 
A 1 10 SER 10 7  7  SER SER A . n 
A 1 11 LYS 11 8  8  LYS LYS A . n 
A 1 12 VAL 12 9  9  VAL VAL A . n 
A 1 13 SER 13 10 10 SER SER A . n 
A 1 14 PHE 14 11 11 PHE PHE A . n 
A 1 15 VAL 15 12 12 VAL VAL A . n 
A 1 16 ILE 16 13 13 ILE ILE A . n 
A 1 17 LYS 17 14 14 LYS LYS A . n 
A 1 18 LYS 18 15 15 LYS LYS A . n 
A 1 19 ILE 19 16 16 ILE ILE A . n 
A 1 20 ARG 20 17 17 ARG ARG A . n 
A 1 21 LEU 21 18 18 LEU LEU A . n 
A 1 22 GLU 22 19 19 GLU GLU A . n 
A 1 23 LYS 23 20 20 LYS LYS A . n 
A 1 24 GLY 24 21 21 GLY GLY A . n 
A 1 25 MET 25 22 22 MET MET A . n 
A 1 26 THR 26 23 23 THR THR A . n 
A 1 27 GLN 27 24 24 GLN GLN A . n 
A 1 28 GLU 28 25 25 GLU GLU A . n 
A 1 29 ASP 29 26 26 ASP ASP A . n 
A 1 30 LEU 30 27 27 LEU LEU A . n 
A 1 31 ALA 31 28 28 ALA ALA A . n 
A 1 32 TYR 32 29 29 TYR TYR A . n 
A 1 33 LYS 33 30 30 LYS LYS A . n 
A 1 34 SER 34 31 31 SER SER A . n 
A 1 35 ASN 35 32 32 ASN ASN A . n 
A 1 36 LEU 36 33 33 LEU LEU A . n 
A 1 37 ASP 37 34 34 ASP ASP A . n 
A 1 38 ARG 38 35 35 ARG ARG A . n 
A 1 39 THR 39 36 36 THR THR A . n 
A 1 40 ALA 40 37 37 ALA ALA A . n 
A 1 41 ILE 41 38 38 ILE ILE A . n 
A 1 42 SER 42 39 39 SER SER A . n 
A 1 43 GLY 43 40 40 GLY GLY A . n 
A 1 44 ILE 44 41 41 ILE ILE A . n 
A 1 45 GLU 45 42 42 GLU GLU A . n 
A 1 46 ARG 46 43 43 ARG ARG A . n 
A 1 47 ASN 47 44 44 ASN ASN A . n 
A 1 48 SER 48 45 45 SER SER A . n 
A 1 49 ARG 49 46 46 ARG ARG A . n 
A 1 50 ASN 50 47 47 ASN ASN A . n 
A 1 51 LEU 51 48 48 LEU LEU A . n 
A 1 52 THR 52 49 49 THR THR A . n 
A 1 53 ILE 53 50 50 ILE ILE A . n 
A 1 54 LYS 54 51 51 LYS LYS A . n 
A 1 55 SER 55 52 52 SER SER A . n 
A 1 56 LEU 56 53 53 LEU LEU A . n 
A 1 57 GLU 57 54 54 GLU GLU A . n 
A 1 58 LEU 58 55 55 LEU LEU A . n 
A 1 59 ILE 59 56 56 ILE ILE A . n 
A 1 60 MET 60 57 57 MET MET A . n 
A 1 61 LYS 61 58 58 LYS LYS A . n 
A 1 62 GLY 62 59 59 GLY GLY A . n 
A 1 63 LEU 63 60 60 LEU LEU A . n 
A 1 64 GLU 64 61 61 GLU GLU A . n 
A 1 65 VAL 65 62 62 VAL VAL A . n 
A 1 66 SER 66 63 63 SER SER A . n 
A 1 67 ASP 67 64 64 ASP ASP A . n 
A 1 68 VAL 68 65 65 VAL VAL A . n 
A 1 69 VAL 69 66 66 VAL VAL A . n 
A 1 70 PHE 70 67 67 PHE PHE A . n 
A 1 71 PHE 71 68 68 PHE PHE A . n 
A 1 72 GLU 72 69 69 GLU GLU A . n 
A 1 73 MET 73 70 70 MET MET A . n 
A 1 74 LEU 74 71 71 LEU LEU A . n 
A 1 75 ILE 75 72 72 ILE ILE A . n 
A 1 76 LYS 76 73 73 LYS LYS A . n 
A 1 77 GLU 77 74 74 GLU GLU A . n 
A 1 78 ILE 78 75 75 ILE ILE A . n 
A 1 79 LEU 79 76 76 LEU LEU A . n 
A 1 80 LYS 80 77 77 LYS LYS A . n 
A 1 81 HIS 81 78 78 HIS HIS A . n 
A 1 82 ASP 82 79 79 ASP ASP A . n 
B 1 1  GLY 1  -2 ?  ?   ?   B . n 
B 1 2  SER 2  -1 ?  ?   ?   B . n 
B 1 3  HIS 3  0  ?  ?   ?   B . n 
B 1 4  MET 4  1  ?  ?   ?   B . n 
B 1 5  GLU 5  2  ?  ?   ?   B . n 
B 1 6  SER 6  3  3  SER SER B . n 
B 1 7  PHE 7  4  4  PHE PHE B . n 
B 1 8  LEU 8  5  5  LEU LEU B . n 
B 1 9  LEU 9  6  6  LEU LEU B . n 
B 1 10 SER 10 7  7  SER SER B . n 
B 1 11 LYS 11 8  8  LYS LYS B . n 
B 1 12 VAL 12 9  9  VAL VAL B . n 
B 1 13 SER 13 10 10 SER SER B . n 
B 1 14 PHE 14 11 11 PHE PHE B . n 
B 1 15 VAL 15 12 12 VAL VAL B . n 
B 1 16 ILE 16 13 13 ILE ILE B . n 
B 1 17 LYS 17 14 14 LYS LYS B . n 
B 1 18 LYS 18 15 15 LYS LYS B . n 
B 1 19 ILE 19 16 16 ILE ILE B . n 
B 1 20 ARG 20 17 17 ARG ARG B . n 
B 1 21 LEU 21 18 18 LEU LEU B . n 
B 1 22 GLU 22 19 19 GLU GLU B . n 
B 1 23 LYS 23 20 20 LYS LYS B . n 
B 1 24 GLY 24 21 21 GLY GLY B . n 
B 1 25 MET 25 22 22 MET MET B . n 
B 1 26 THR 26 23 23 THR THR B . n 
B 1 27 GLN 27 24 24 GLN GLN B . n 
B 1 28 GLU 28 25 25 GLU GLU B . n 
B 1 29 ASP 29 26 26 ASP ASP B . n 
B 1 30 LEU 30 27 27 LEU LEU B . n 
B 1 31 ALA 31 28 28 ALA ALA B . n 
B 1 32 TYR 32 29 29 TYR TYR B . n 
B 1 33 LYS 33 30 30 LYS LYS B . n 
B 1 34 SER 34 31 31 SER SER B . n 
B 1 35 ASN 35 32 32 ASN ASN B . n 
B 1 36 LEU 36 33 33 LEU LEU B . n 
B 1 37 ASP 37 34 34 ASP ASP B . n 
B 1 38 ARG 38 35 35 ARG ARG B . n 
B 1 39 THR 39 36 36 THR THR B . n 
B 1 40 ALA 40 37 37 ALA ALA B . n 
B 1 41 ILE 41 38 38 ILE ILE B . n 
B 1 42 SER 42 39 39 SER SER B . n 
B 1 43 GLY 43 40 40 GLY GLY B . n 
B 1 44 ILE 44 41 41 ILE ILE B . n 
B 1 45 GLU 45 42 42 GLU GLU B . n 
B 1 46 ARG 46 43 43 ARG ARG B . n 
B 1 47 ASN 47 44 44 ASN ASN B . n 
B 1 48 SER 48 45 45 SER SER B . n 
B 1 49 ARG 49 46 46 ARG ARG B . n 
B 1 50 ASN 50 47 47 ASN ASN B . n 
B 1 51 LEU 51 48 48 LEU LEU B . n 
B 1 52 THR 52 49 49 THR THR B . n 
B 1 53 ILE 53 50 50 ILE ILE B . n 
B 1 54 LYS 54 51 51 LYS LYS B . n 
B 1 55 SER 55 52 52 SER SER B . n 
B 1 56 LEU 56 53 53 LEU LEU B . n 
B 1 57 GLU 57 54 54 GLU GLU B . n 
B 1 58 LEU 58 55 55 LEU LEU B . n 
B 1 59 ILE 59 56 56 ILE ILE B . n 
B 1 60 MET 60 57 57 MET MET B . n 
B 1 61 LYS 61 58 58 LYS LYS B . n 
B 1 62 GLY 62 59 59 GLY GLY B . n 
B 1 63 LEU 63 60 60 LEU LEU B . n 
B 1 64 GLU 64 61 61 GLU GLU B . n 
B 1 65 VAL 65 62 62 VAL VAL B . n 
B 1 66 SER 66 63 63 SER SER B . n 
B 1 67 ASP 67 64 64 ASP ASP B . n 
B 1 68 VAL 68 65 65 VAL VAL B . n 
B 1 69 VAL 69 66 66 VAL VAL B . n 
B 1 70 PHE 70 67 67 PHE PHE B . n 
B 1 71 PHE 71 68 68 PHE PHE B . n 
B 1 72 GLU 72 69 69 GLU GLU B . n 
B 1 73 MET 73 70 70 MET MET B . n 
B 1 74 LEU 74 71 71 LEU LEU B . n 
B 1 75 ILE 75 72 72 ILE ILE B . n 
B 1 76 LYS 76 73 73 LYS LYS B . n 
B 1 77 GLU 77 74 74 GLU GLU B . n 
B 1 78 ILE 78 75 75 ILE ILE B . n 
B 1 79 LEU 79 76 76 LEU LEU B . n 
B 1 80 LYS 80 77 77 LYS LYS B . n 
B 1 81 HIS 81 78 78 HIS HIS B . n 
B 1 82 ASP 82 79 79 ASP ASP B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2150 ? 
1 MORE         -28  ? 
1 'SSA (A^2)'  8240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-11 
2 'Structure model' 1 1 2014-06-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         11.4798 
_pdbx_refine_tls.origin_y         3.8852 
_pdbx_refine_tls.origin_z         28.8809 
_pdbx_refine_tls.T[1][1]          0.1263 
_pdbx_refine_tls.T[2][2]          0.1290 
_pdbx_refine_tls.T[3][3]          0.1152 
_pdbx_refine_tls.T[1][2]          0.0230 
_pdbx_refine_tls.T[1][3]          0.0238 
_pdbx_refine_tls.T[2][3]          0.0319 
_pdbx_refine_tls.L[1][1]          1.6770 
_pdbx_refine_tls.L[2][2]          2.2313 
_pdbx_refine_tls.L[3][3]          2.1654 
_pdbx_refine_tls.L[1][2]          1.1874 
_pdbx_refine_tls.L[1][3]          1.4791 
_pdbx_refine_tls.L[2][3]          1.8303 
_pdbx_refine_tls.S[1][1]          -0.0364 
_pdbx_refine_tls.S[2][2]          -0.0229 
_pdbx_refine_tls.S[3][3]          0.0536 
_pdbx_refine_tls.S[1][2]          0.0428 
_pdbx_refine_tls.S[1][3]          0.0934 
_pdbx_refine_tls.S[2][3]          0.0993 
_pdbx_refine_tls.S[2][1]          0.0326 
_pdbx_refine_tls.S[3][1]          -0.0581 
_pdbx_refine_tls.S[3][2]          -0.0397 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 3 A 79  all ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 B 3 B 79  all ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 1 B 1 B 101 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 1 B 1 B 224 all ? ? ? ? ? 
# 
_pdbx_phasing_MR.entry_id                     4IA8 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          4.270 
_pdbx_phasing_MR.d_res_low_rotation           31.550 
_pdbx_phasing_MR.d_res_high_translation       4.270 
_pdbx_phasing_MR.d_res_low_translation        31.550 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .        ?                                 package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction' 
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/          ?   ? 
2 Aimless     0.1.26   03/07/12                          program 'Phil Evans'         ?                           'data scaling' 
http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ?   ? 
3 PHASER      2.5.1    'Tue Jul 10 12:42:19 2012 (svn )' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing 
http://www-structmed.cimr.cam.ac.uk/phaser/         ?   ? 
4 PHENIX      1.8_1069 ?                                 package 'Paul D. Adams'      PDAdams@lbl.gov             refinement 
http://www.phenix-online.org/                       C++ ? 
5 PDB_EXTRACT 3.11     'April 22, 2011'                  package PDB                  deposit@deposit.rcsb.org    
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/           C++ ? 
6 GDA         .        ?                                 ?       ?                    ?                           
'data collection' ?                                                   ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 44 ? ? -162.27 116.40  
2 1 ASN B 47 ? ? -66.12  -179.32 
3 1 ASN B 47 ? ? -69.14  -177.33 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2 ? A GLY 1 
2  1 Y 1 A SER -1 ? A SER 2 
3  1 Y 1 A HIS 0  ? A HIS 3 
4  1 Y 1 A MET 1  ? A MET 4 
5  1 Y 1 A GLU 2  ? A GLU 5 
6  1 Y 1 B GLY -2 ? B GLY 1 
7  1 Y 1 B SER -1 ? B SER 2 
8  1 Y 1 B HIS 0  ? B HIS 3 
9  1 Y 1 B MET 1  ? B MET 4 
10 1 Y 1 B GLU 2  ? B GLU 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1  101 1  SO4 SO4 B . 
D 3 HOH 1  101 3  HOH HOH A . 
D 3 HOH 2  102 5  HOH HOH A . 
D 3 HOH 3  103 6  HOH HOH A . 
D 3 HOH 4  104 8  HOH HOH A . 
D 3 HOH 5  105 9  HOH HOH A . 
D 3 HOH 6  106 13 HOH HOH A . 
D 3 HOH 7  107 14 HOH HOH A . 
D 3 HOH 8  108 17 HOH HOH A . 
D 3 HOH 9  109 18 HOH HOH A . 
D 3 HOH 10 110 19 HOH HOH A . 
D 3 HOH 11 111 20 HOH HOH A . 
D 3 HOH 12 112 25 HOH HOH A . 
D 3 HOH 13 113 27 HOH HOH A . 
D 3 HOH 14 114 29 HOH HOH A . 
D 3 HOH 15 115 31 HOH HOH A . 
D 3 HOH 16 116 33 HOH HOH A . 
D 3 HOH 17 117 35 HOH HOH A . 
D 3 HOH 18 118 37 HOH HOH A . 
D 3 HOH 19 119 40 HOH HOH A . 
D 3 HOH 20 120 43 HOH HOH A . 
E 3 HOH 1  201 1  HOH HOH B . 
E 3 HOH 2  202 2  HOH HOH B . 
E 3 HOH 3  203 4  HOH HOH B . 
E 3 HOH 4  204 7  HOH HOH B . 
E 3 HOH 5  205 10 HOH HOH B . 
E 3 HOH 6  206 11 HOH HOH B . 
E 3 HOH 7  207 12 HOH HOH B . 
E 3 HOH 8  208 15 HOH HOH B . 
E 3 HOH 9  209 16 HOH HOH B . 
E 3 HOH 10 210 21 HOH HOH B . 
E 3 HOH 11 211 22 HOH HOH B . 
E 3 HOH 12 212 23 HOH HOH B . 
E 3 HOH 13 213 24 HOH HOH B . 
E 3 HOH 14 214 26 HOH HOH B . 
E 3 HOH 15 215 28 HOH HOH B . 
E 3 HOH 16 216 30 HOH HOH B . 
E 3 HOH 17 217 32 HOH HOH B . 
E 3 HOH 18 218 34 HOH HOH B . 
E 3 HOH 19 219 36 HOH HOH B . 
E 3 HOH 20 220 38 HOH HOH B . 
E 3 HOH 21 221 39 HOH HOH B . 
E 3 HOH 22 222 41 HOH HOH B . 
E 3 HOH 23 223 42 HOH HOH B . 
E 3 HOH 24 224 44 HOH HOH B . 
#