data_4ICK
# 
_entry.id   4ICK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ICK         
RCSB  RCSB076581   
WWPDB D_1000076581 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3u53 
_pdbx_database_related.details        'crystal structure of human AP4A hydrolase' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ICK 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ge, H.'   1 
'Chen, X.' 2 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of wild-type and mutant human Ap4A hydrolase.' 
_citation.journal_abbrev            Biochem.Biophys.Res.Commun. 
_citation.journal_volume            432 
_citation.page_first                16 
_citation.page_last                 21 
_citation.year                      2013 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           0006-291X 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23384440 
_citation.pdbx_database_id_DOI      10.1016/j.bbrc.2013.01.095 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ge, H.'   1 
primary 'Chen, X.' 2 
primary 'Yang, W.' 3 
primary 'Niu, L.'  4 
primary 'Teng, M.' 5 
# 
_cell.entry_id           4ICK 
_cell.length_a           72.190 
_cell.length_b           72.190 
_cell.length_c           133.510 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ICK 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
;
17864.350 2   3.6.1.17 E58A ? ? 
2 non-polymer syn GLYCEROL                                            92.094    1   ?        ?    ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                     94.971    1   ?        ?    ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                     24.305    1   ?        ?    ? ? 
5 water       nat water                                               18.015    185 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase, Ap4A hydrolase, Ap4Aase, Diadenosine tetraphosphatase, Nucleoside diphosphate-linked moiety X motif 2, Nudix motif 2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEALEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEALEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LEU n 
1 4   ARG n 
1 5   ALA n 
1 6   CYS n 
1 7   GLY n 
1 8   LEU n 
1 9   ILE n 
1 10  ILE n 
1 11  PHE n 
1 12  ARG n 
1 13  ARG n 
1 14  CYS n 
1 15  LEU n 
1 16  ILE n 
1 17  PRO n 
1 18  LYS n 
1 19  VAL n 
1 20  ASP n 
1 21  ASN n 
1 22  ASN n 
1 23  ALA n 
1 24  ILE n 
1 25  GLU n 
1 26  PHE n 
1 27  LEU n 
1 28  LEU n 
1 29  LEU n 
1 30  GLN n 
1 31  ALA n 
1 32  SER n 
1 33  ASP n 
1 34  GLY n 
1 35  ILE n 
1 36  HIS n 
1 37  HIS n 
1 38  TRP n 
1 39  THR n 
1 40  PRO n 
1 41  PRO n 
1 42  LYS n 
1 43  GLY n 
1 44  HIS n 
1 45  VAL n 
1 46  GLU n 
1 47  PRO n 
1 48  GLY n 
1 49  GLU n 
1 50  ASP n 
1 51  ASP n 
1 52  LEU n 
1 53  GLU n 
1 54  THR n 
1 55  ALA n 
1 56  LEU n 
1 57  ARG n 
1 58  ALA n 
1 59  THR n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  GLU n 
1 67  ALA n 
1 68  GLY n 
1 69  GLN n 
1 70  LEU n 
1 71  THR n 
1 72  ILE n 
1 73  ILE n 
1 74  GLU n 
1 75  GLY n 
1 76  PHE n 
1 77  LYS n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  TYR n 
1 83  VAL n 
1 84  ALA n 
1 85  ARG n 
1 86  ASN n 
1 87  LYS n 
1 88  PRO n 
1 89  LYS n 
1 90  THR n 
1 91  VAL n 
1 92  ILE n 
1 93  TYR n 
1 94  TRP n 
1 95  LEU n 
1 96  ALA n 
1 97  GLU n 
1 98  VAL n 
1 99  LYS n 
1 100 ASP n 
1 101 TYR n 
1 102 ASP n 
1 103 VAL n 
1 104 GLU n 
1 105 ILE n 
1 106 ARG n 
1 107 LEU n 
1 108 SER n 
1 109 HIS n 
1 110 GLU n 
1 111 HIS n 
1 112 GLN n 
1 113 ALA n 
1 114 TYR n 
1 115 ARG n 
1 116 TRP n 
1 117 LEU n 
1 118 GLY n 
1 119 LEU n 
1 120 GLU n 
1 121 GLU n 
1 122 ALA n 
1 123 CYS n 
1 124 GLN n 
1 125 LEU n 
1 126 ALA n 
1 127 GLN n 
1 128 PHE n 
1 129 LYS n 
1 130 GLU n 
1 131 MET n 
1 132 LYS n 
1 133 ALA n 
1 134 ALA n 
1 135 LEU n 
1 136 GLN n 
1 137 GLU n 
1 138 GLY n 
1 139 HIS n 
1 140 GLN n 
1 141 PHE n 
1 142 LEU n 
1 143 CYS n 
1 144 SER n 
1 145 ILE n 
1 146 GLU n 
1 147 ALA n 
1 148 LEU n 
1 149 GLU n 
1 150 HIS n 
1 151 HIS n 
1 152 HIS n 
1 153 HIS n 
1 154 HIS n 
1 155 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NUDT2, APAH1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AP4A_HUMAN 
_struct_ref.pdbx_db_accession          P50583 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ICK A 1 ? 147 ? P50583 1 ? 147 ? 1 147 
2 1 4ICK B 1 ? 147 ? P50583 1 ? 147 ? 1 147 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ICK ALA A 58  ? UNP P50583 GLU 58 'ENGINEERED MUTATION' 58  1  
1 4ICK LEU A 148 ? UNP P50583 ?   ?  'EXPRESSION TAG'      148 2  
1 4ICK GLU A 149 ? UNP P50583 ?   ?  'EXPRESSION TAG'      149 3  
1 4ICK HIS A 150 ? UNP P50583 ?   ?  'EXPRESSION TAG'      150 4  
1 4ICK HIS A 151 ? UNP P50583 ?   ?  'EXPRESSION TAG'      151 5  
1 4ICK HIS A 152 ? UNP P50583 ?   ?  'EXPRESSION TAG'      152 6  
1 4ICK HIS A 153 ? UNP P50583 ?   ?  'EXPRESSION TAG'      153 7  
1 4ICK HIS A 154 ? UNP P50583 ?   ?  'EXPRESSION TAG'      154 8  
1 4ICK HIS A 155 ? UNP P50583 ?   ?  'EXPRESSION TAG'      155 9  
2 4ICK ALA B 58  ? UNP P50583 GLU 58 'ENGINEERED MUTATION' 58  10 
2 4ICK LEU B 148 ? UNP P50583 ?   ?  'EXPRESSION TAG'      148 11 
2 4ICK GLU B 149 ? UNP P50583 ?   ?  'EXPRESSION TAG'      149 12 
2 4ICK HIS B 150 ? UNP P50583 ?   ?  'EXPRESSION TAG'      150 13 
2 4ICK HIS B 151 ? UNP P50583 ?   ?  'EXPRESSION TAG'      151 14 
2 4ICK HIS B 152 ? UNP P50583 ?   ?  'EXPRESSION TAG'      152 15 
2 4ICK HIS B 153 ? UNP P50583 ?   ?  'EXPRESSION TAG'      153 16 
2 4ICK HIS B 154 ? UNP P50583 ?   ?  'EXPRESSION TAG'      154 17 
2 4ICK HIS B 155 ? UNP P50583 ?   ?  'EXPRESSION TAG'      155 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?                               'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4ICK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            285 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris (pH 8.4), 2.0M Ammonium phosphate monobasic, 5mM magnesium chloride, temperature 285K, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2012-05-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00584 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00584 
# 
_reflns.entry_id                     4ICK 
_reflns.observed_criterion_sigma_I   13.7 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   20197 
_reflns.number_all                   21385 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.1 
_reflns_shell.d_res_low                   2.154 
_reflns_shell.percent_possible_all        99.77 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ICK 
_refine.ls_number_reflns_obs                     20197 
_refine.ls_number_reflns_all                     21385 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.77 
_refine.ls_R_factor_obs                          0.18890 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18645 
_refine.ls_R_factor_R_free                       0.23464 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1094 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.909 
_refine.B_iso_mean                               32.849 
_refine.aniso_B[1][1]                            0.13 
_refine.aniso_B[2][2]                            0.13 
_refine.aniso_B[3][3]                            -0.26 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      3U53 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.179 
_refine.overall_SU_ML                            0.115 
_refine.overall_SU_B                             8.649 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2338 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             185 
_refine_hist.number_atoms_total               2535 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.013  0.019  ? 2422 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.589  1.958  ? 3279 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.824  5.000  ? 295  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 34.023 24.380 ? 121  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 15.753 15.000 ? 431  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 14.385 15.000 ? 15   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.107  0.200  ? 357  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.007  0.021  ? 1838 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             1291 
_refine_ls_shell.R_factor_R_work                  0.212 
_refine_ls_shell.percent_reflns_obs               99.78 
_refine_ls_shell.R_factor_R_free                  0.204 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             69 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  4ICK 
_struct.title                     'Crystal structure of human AP4A hydrolase E58A mutant' 
_struct.pdbx_descriptor           
;Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] (E.C.3.6.1.17)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ICK 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Nudix fold, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 50  ? GLY A 64  ? ASP A 50  GLY A 64  1 ? 15 
HELX_P HELX_P2 2 GLU A 66  ? GLY A 68  ? GLU A 66  GLY A 68  5 ? 3  
HELX_P HELX_P3 3 GLY A 118 ? GLN A 127 ? GLY A 118 GLN A 127 1 ? 10 
HELX_P HELX_P4 4 PHE A 128 ? HIS A 150 ? PHE A 128 HIS A 150 1 ? 23 
HELX_P HELX_P5 5 ASP B 50  ? GLY B 64  ? ASP B 50  GLY B 64  1 ? 15 
HELX_P HELX_P6 6 GLU B 66  ? GLY B 68  ? GLU B 66  GLY B 68  5 ? 3  
HELX_P HELX_P7 7 GLY B 118 ? GLN B 127 ? GLY B 118 GLN B 127 1 ? 10 
HELX_P HELX_P8 8 PHE B 128 ? LEU B 148 ? PHE B 128 LEU B 148 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 38  ? THR A 39  ? TRP A 38  THR A 39  
A 2 ILE A 24  ? ALA A 31  ? ILE A 24  ALA A 31  
A 3 ALA A 5   ? ARG A 13  ? ALA A 5   ARG A 13  
A 4 LYS A 87  ? VAL A 98  ? LYS A 87  VAL A 98  
A 5 LEU A 70  ? ALA A 84  ? LEU A 70  ALA A 84  
B 1 LYS A 42  ? HIS A 44  ? LYS A 42  HIS A 44  
B 2 ALA A 5   ? ARG A 13  ? ALA A 5   ARG A 13  
B 3 ILE A 24  ? ALA A 31  ? ILE A 24  ALA A 31  
B 4 HIS A 111 ? LEU A 117 ? HIS A 111 LEU A 117 
C 1 TRP B 38  ? THR B 39  ? TRP B 38  THR B 39  
C 2 ILE B 24  ? ALA B 31  ? ILE B 24  ALA B 31  
C 3 ARG B 4   ? ARG B 13  ? ARG B 4   ARG B 13  
C 4 PRO B 88  ? VAL B 98  ? PRO B 88  VAL B 98  
C 5 LEU B 70  ? VAL B 83  ? LEU B 70  VAL B 83  
D 1 LYS B 42  ? HIS B 44  ? LYS B 42  HIS B 44  
D 2 ARG B 4   ? ARG B 13  ? ARG B 4   ARG B 13  
D 3 ILE B 24  ? ALA B 31  ? ILE B 24  ALA B 31  
D 4 HIS B 111 ? LEU B 117 ? HIS B 111 LEU B 117 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 39 ? O THR A 39 N LEU A 29  ? N LEU A 29  
A 2 3 O GLU A 25 ? O GLU A 25 N ARG A 12  ? N ARG A 12  
A 3 4 N ILE A 9  ? N ILE A 9  O TRP A 94  ? O TRP A 94  
A 4 5 O VAL A 91 ? O VAL A 91 N LEU A 80  ? N LEU A 80  
B 1 2 O GLY A 43 ? O GLY A 43 N CYS A 6   ? N CYS A 6   
B 2 3 N ARG A 12 ? N ARG A 12 O GLU A 25  ? O GLU A 25  
B 3 4 N PHE A 26 ? N PHE A 26 O LEU A 117 ? O LEU A 117 
C 1 2 O THR B 39 ? O THR B 39 N LEU B 29  ? N LEU B 29  
C 2 3 O GLU B 25 ? O GLU B 25 N ARG B 12  ? N ARG B 12  
C 3 4 N ILE B 9  ? N ILE B 9  O TRP B 94  ? O TRP B 94  
C 4 5 O VAL B 91 ? O VAL B 91 N LEU B 80  ? N LEU B 80  
D 1 2 O GLY B 43 ? O GLY B 43 N CYS B 6   ? N CYS B 6   
D 2 3 N ARG B 12 ? N ARG B 12 O GLU B 25  ? O GLU B 25  
D 3 4 N PHE B 26 ? N PHE B 26 O LEU B 117 ? O LEU B 117 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 201' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PO4 B 201' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG B 202'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASN A 22  ? ASN A 22  . ? 1_555 ? 
2  AC1 6 ALA A 23  ? ALA A 23  . ? 1_555 ? 
3  AC1 6 ILE A 24  ? ILE A 24  . ? 1_555 ? 
4  AC1 6 GLU A 46  ? GLU A 46  . ? 3_554 ? 
5  AC1 6 HIS A 139 ? HIS A 139 . ? 1_555 ? 
6  AC1 6 HOH F .   ? HOH A 314 . ? 1_555 ? 
7  AC2 9 ARG A 12  ? ARG A 12  . ? 7_565 ? 
8  AC2 9 TRP A 116 ? TRP A 116 . ? 7_565 ? 
9  AC2 9 HOH F .   ? HOH A 318 . ? 7_565 ? 
10 AC2 9 TYR B 114 ? TYR B 114 . ? 1_555 ? 
11 AC2 9 TRP B 116 ? TRP B 116 . ? 1_555 ? 
12 AC2 9 HOH G .   ? HOH B 301 . ? 1_555 ? 
13 AC2 9 HOH G .   ? HOH B 303 . ? 1_555 ? 
14 AC2 9 HOH G .   ? HOH B 304 . ? 1_555 ? 
15 AC2 9 HOH G .   ? HOH B 305 . ? 1_555 ? 
16 AC3 5 ASP A 50  ? ASP A 50  . ? 3_554 ? 
17 AC3 5 GLU A 53  ? GLU A 53  . ? 3_554 ? 
18 AC3 5 GLN A 140 ? GLN A 140 . ? 1_555 ? 
19 AC3 5 LYS B 77  ? LYS B 77  . ? 1_555 ? 
20 AC3 5 TRP B 94  ? TRP B 94  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ICK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ICK 
_atom_sites.fract_transf_matrix[1][1]   0.013852 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013852 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007490 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 4   ? -12.494 46.952 15.532  1.00 32.45 ? 4   ARG A N   1 
ATOM   2    C  CA  . ARG A 1 4   ? -11.375 46.193 14.857  1.00 32.45 ? 4   ARG A CA  1 
ATOM   3    C  C   . ARG A 1 4   ? -11.263 44.770 15.363  1.00 29.21 ? 4   ARG A C   1 
ATOM   4    O  O   . ARG A 1 4   ? -11.193 44.540 16.578  1.00 28.42 ? 4   ARG A O   1 
ATOM   5    C  CB  . ARG A 1 4   ? -10.042 46.865 15.073  1.00 35.91 ? 4   ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 4   ? -8.939  46.161 14.303  1.00 39.72 ? 4   ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 4   ? -7.630  46.265 15.048  1.00 44.71 ? 4   ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 4   ? -6.475  46.228 14.155  1.00 46.91 ? 4   ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 4   ? -6.057  47.264 13.444  1.00 48.80 ? 4   ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 4   ? -6.715  48.413 13.497  1.00 55.72 ? 4   ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 4   ? -4.985  47.157 12.681  1.00 50.91 ? 4   ARG A NH2 1 
ATOM   12   N  N   . ALA A 1 5   ? -11.260 43.819 14.433  1.00 26.32 ? 5   ALA A N   1 
ATOM   13   C  CA  . ALA A 1 5   ? -11.247 42.416 14.772  1.00 22.98 ? 5   ALA A CA  1 
ATOM   14   C  C   . ALA A 1 5   ? -10.043 41.709 14.125  1.00 22.10 ? 5   ALA A C   1 
ATOM   15   O  O   . ALA A 1 5   ? -9.530  42.158 13.103  1.00 21.86 ? 5   ALA A O   1 
ATOM   16   C  CB  . ALA A 1 5   ? -12.562 41.762 14.320  1.00 22.48 ? 5   ALA A CB  1 
ATOM   17   N  N   . CYS A 1 6   ? -9.623  40.590 14.702  1.00 19.66 ? 6   CYS A N   1 
ATOM   18   C  CA  . CYS A 1 6   ? -8.559  39.785 14.132  1.00 19.33 ? 6   CYS A CA  1 
ATOM   19   C  C   . CYS A 1 6   ? -9.022  38.351 14.186  1.00 17.60 ? 6   CYS A C   1 
ATOM   20   O  O   . CYS A 1 6   ? -9.731  37.939 15.124  1.00 17.43 ? 6   CYS A O   1 
ATOM   21   C  CB  . CYS A 1 6   ? -7.274  39.939 14.958  1.00 20.96 ? 6   CYS A CB  1 
ATOM   22   S  SG  . CYS A 1 6   ? -6.788  41.670 15.089  1.00 24.39 ? 6   CYS A SG  1 
ATOM   23   N  N   . GLY A 1 7   ? -8.631  37.583 13.195  1.00 16.61 ? 7   GLY A N   1 
ATOM   24   C  CA  . GLY A 1 7   ? -8.972  36.168 13.193  1.00 15.35 ? 7   GLY A CA  1 
ATOM   25   C  C   . GLY A 1 7   ? -8.013  35.324 12.393  1.00 14.66 ? 7   GLY A C   1 
ATOM   26   O  O   . GLY A 1 7   ? -6.976  35.792 11.942  1.00 15.27 ? 7   GLY A O   1 
ATOM   27   N  N   . LEU A 1 8   ? -8.352  34.061 12.271  1.00 13.43 ? 8   LEU A N   1 
ATOM   28   C  CA  . LEU A 1 8   ? -7.529  33.102 11.538  1.00 13.42 ? 8   LEU A CA  1 
ATOM   29   C  C   . LEU A 1 8   ? -8.364  32.459 10.468  1.00 12.78 ? 8   LEU A C   1 
ATOM   30   O  O   . LEU A 1 8   ? -9.457  31.990 10.743  1.00 12.09 ? 8   LEU A O   1 
ATOM   31   C  CB  . LEU A 1 8   ? -6.968  31.998 12.453  1.00 13.39 ? 8   LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 8   ? -6.028  32.486 13.570  1.00 14.45 ? 8   LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 8   ? -5.595  31.298 14.459  1.00 15.06 ? 8   LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 8   ? -4.824  33.209 12.951  1.00 14.61 ? 8   LEU A CD2 1 
ATOM   35   N  N   . ILE A 1 9   ? -7.845  32.456 9.256   1.00 13.37 ? 9   ILE A N   1 
ATOM   36   C  CA  . ILE A 1 9   ? -8.350  31.563 8.231   1.00 13.99 ? 9   ILE A CA  1 
ATOM   37   C  C   . ILE A 1 9   ? -7.807  30.186 8.560   1.00 14.64 ? 9   ILE A C   1 
ATOM   38   O  O   . ILE A 1 9   ? -6.592  29.926 8.461   1.00 17.04 ? 9   ILE A O   1 
ATOM   39   C  CB  . ILE A 1 9   ? -7.909  32.052 6.842   1.00 14.73 ? 9   ILE A CB  1 
ATOM   40   C  CG1 . ILE A 1 9   ? -8.605  33.380 6.533   1.00 14.90 ? 9   ILE A CG1 1 
ATOM   41   C  CG2 . ILE A 1 9   ? -8.255  31.006 5.769   1.00 15.39 ? 9   ILE A CG2 1 
ATOM   42   C  CD1 . ILE A 1 9   ? -7.913  34.191 5.437   1.00 15.94 ? 9   ILE A CD1 1 
ATOM   43   N  N   . ILE A 1 10  ? -8.694  29.312 8.995   1.00 14.33 ? 10  ILE A N   1 
ATOM   44   C  CA  . ILE A 1 10  ? -8.334  28.007 9.488   1.00 14.83 ? 10  ILE A CA  1 
ATOM   45   C  C   . ILE A 1 10  ? -8.543  27.018 8.326   1.00 14.96 ? 10  ILE A C   1 
ATOM   46   O  O   . ILE A 1 10  ? -9.562  27.093 7.631   1.00 14.70 ? 10  ILE A O   1 
ATOM   47   C  CB  . ILE A 1 10  ? -9.218  27.623 10.699  1.00 14.69 ? 10  ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 10  ? -8.854  28.470 11.936  1.00 16.18 ? 10  ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 10  ? -9.109  26.141 11.063  1.00 15.23 ? 10  ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 10  ? -7.421  28.240 12.453  1.00 17.68 ? 10  ILE A CD1 1 
ATOM   51   N  N   . PHE A 1 11  ? -7.567  26.147 8.093   1.00 15.09 ? 11  PHE A N   1 
ATOM   52   C  CA  . PHE A 1 11  ? -7.703  25.107 7.077   1.00 16.17 ? 11  PHE A CA  1 
ATOM   53   C  C   . PHE A 1 11  ? -7.196  23.778 7.608   1.00 16.77 ? 11  PHE A C   1 
ATOM   54   O  O   . PHE A 1 11  ? -6.472  23.730 8.630   1.00 16.41 ? 11  PHE A O   1 
ATOM   55   C  CB  . PHE A 1 11  ? -6.966  25.467 5.777   1.00 17.15 ? 11  PHE A CB  1 
ATOM   56   C  CG  . PHE A 1 11  ? -5.452  25.452 5.891   1.00 18.04 ? 11  PHE A CG  1 
ATOM   57   C  CD1 . PHE A 1 11  ? -4.766  26.552 6.398   1.00 17.41 ? 11  PHE A CD1 1 
ATOM   58   C  CD2 . PHE A 1 11  ? -4.716  24.347 5.447   1.00 19.23 ? 11  PHE A CD2 1 
ATOM   59   C  CE1 . PHE A 1 11  ? -3.379  26.530 6.518   1.00 18.96 ? 11  PHE A CE1 1 
ATOM   60   C  CE2 . PHE A 1 11  ? -3.321  24.346 5.511   1.00 20.23 ? 11  PHE A CE2 1 
ATOM   61   C  CZ  . PHE A 1 11  ? -2.652  25.426 6.056   1.00 19.75 ? 11  PHE A CZ  1 
ATOM   62   N  N   . ARG A 1 12  ? -7.602  22.702 6.931   1.00 17.35 ? 12  ARG A N   1 
ATOM   63   C  CA  . ARG A 1 12  ? -7.077  21.405 7.195   1.00 19.30 ? 12  ARG A CA  1 
ATOM   64   C  C   . ARG A 1 12  ? -6.747  20.810 5.839   1.00 21.39 ? 12  ARG A C   1 
ATOM   65   O  O   . ARG A 1 12  ? -7.325  21.205 4.823   1.00 20.29 ? 12  ARG A O   1 
ATOM   66   C  CB  . ARG A 1 12  ? -8.107  20.499 7.925   1.00 19.87 ? 12  ARG A CB  1 
ATOM   67   C  CG  . ARG A 1 12  ? -9.347  20.113 7.095   1.00 19.49 ? 12  ARG A CG  1 
ATOM   68   C  CD  . ARG A 1 12  ? -10.366 19.384 7.963   1.00 19.11 ? 12  ARG A CD  1 
ATOM   69   N  NE  . ARG A 1 12  ? -11.553 18.939 7.231   1.00 19.42 ? 12  ARG A NE  1 
ATOM   70   C  CZ  . ARG A 1 12  ? -12.538 18.212 7.786   1.00 20.07 ? 12  ARG A CZ  1 
ATOM   71   N  NH1 . ARG A 1 12  ? -12.477 17.897 9.077   1.00 19.43 ? 12  ARG A NH1 1 
ATOM   72   N  NH2 . ARG A 1 12  ? -13.590 17.835 7.065   1.00 20.08 ? 12  ARG A NH2 1 
ATOM   73   N  N   . ARG A 1 13  ? -5.826  19.850 5.856   1.00 24.67 ? 13  ARG A N   1 
ATOM   74   C  CA  . ARG A 1 13  ? -5.363  19.177 4.658   1.00 28.15 ? 13  ARG A CA  1 
ATOM   75   C  C   . ARG A 1 13  ? -6.038  17.830 4.539   1.00 30.59 ? 13  ARG A C   1 
ATOM   76   O  O   . ARG A 1 13  ? -6.198  17.114 5.518   1.00 31.40 ? 13  ARG A O   1 
ATOM   77   C  CB  . ARG A 1 13  ? -3.870  18.943 4.750   1.00 31.05 ? 13  ARG A CB  1 
ATOM   78   C  CG  . ARG A 1 13  ? -3.097  20.232 4.749   1.00 33.64 ? 13  ARG A CG  1 
ATOM   79   C  CD  . ARG A 1 13  ? -1.630  20.010 4.436   1.00 36.92 ? 13  ARG A CD  1 
ATOM   80   N  NE  . ARG A 1 13  ? -0.988  21.315 4.365   1.00 39.54 ? 13  ARG A NE  1 
ATOM   81   C  CZ  . ARG A 1 13  ? -0.827  22.031 3.251   1.00 40.46 ? 13  ARG A CZ  1 
ATOM   82   N  NH1 . ARG A 1 13  ? -1.239  21.569 2.070   1.00 41.72 ? 13  ARG A NH1 1 
ATOM   83   N  NH2 . ARG A 1 13  ? -0.229  23.210 3.329   1.00 39.58 ? 13  ARG A NH2 1 
ATOM   84   N  N   . CYS A 1 14  ? -6.429  17.487 3.329   1.00 32.40 ? 14  CYS A N   1 
ATOM   85   C  CA  . CYS A 1 14  ? -7.146  16.256 3.110   1.00 35.74 ? 14  CYS A CA  1 
ATOM   86   C  C   . CYS A 1 14  ? -6.224  15.422 2.205   1.00 38.09 ? 14  CYS A C   1 
ATOM   87   O  O   . CYS A 1 14  ? -6.021  15.750 1.058   1.00 37.62 ? 14  CYS A O   1 
ATOM   88   C  CB  . CYS A 1 14  ? -8.506  16.567 2.490   1.00 34.46 ? 14  CYS A CB  1 
ATOM   89   S  SG  . CYS A 1 14  ? -9.356  17.883 3.406   1.00 36.29 ? 14  CYS A SG  1 
ATOM   90   N  N   . LEU A 1 15  ? -5.647  14.371 2.765   1.00 42.33 ? 15  LEU A N   1 
ATOM   91   C  CA  . LEU A 1 15  ? -4.524  13.686 2.123   1.00 49.27 ? 15  LEU A CA  1 
ATOM   92   C  C   . LEU A 1 15  ? -4.819  12.241 1.714   1.00 54.17 ? 15  LEU A C   1 
ATOM   93   O  O   . LEU A 1 15  ? -3.975  11.371 1.875   1.00 59.68 ? 15  LEU A O   1 
ATOM   94   C  CB  . LEU A 1 15  ? -3.296  13.742 3.038   1.00 49.50 ? 15  LEU A CB  1 
ATOM   95   C  CG  . LEU A 1 15  ? -2.948  15.134 3.580   1.00 49.61 ? 15  LEU A CG  1 
ATOM   96   C  CD1 . LEU A 1 15  ? -2.224  15.019 4.917   1.00 50.12 ? 15  LEU A CD1 1 
ATOM   97   C  CD2 . LEU A 1 15  ? -2.156  15.953 2.567   1.00 47.59 ? 15  LEU A CD2 1 
ATOM   98   N  N   . ILE A 1 16  ? -6.023  11.999 1.201   1.00 56.38 ? 16  ILE A N   1 
ATOM   99   C  CA  . ILE A 1 16  ? -6.383  10.740 0.546   1.00 58.64 ? 16  ILE A CA  1 
ATOM   100  C  C   . ILE A 1 16  ? -6.634  11.117 -0.913  1.00 61.76 ? 16  ILE A C   1 
ATOM   101  O  O   . ILE A 1 16  ? -7.771  11.442 -1.287  1.00 60.83 ? 16  ILE A O   1 
ATOM   102  C  CB  . ILE A 1 16  ? -7.645  10.099 1.174   1.00 57.84 ? 16  ILE A CB  1 
ATOM   103  C  CG1 . ILE A 1 16  ? -7.451  9.885  2.680   1.00 55.77 ? 16  ILE A CG1 1 
ATOM   104  C  CG2 . ILE A 1 16  ? -8.018  8.802  0.463   1.00 61.05 ? 16  ILE A CG2 1 
ATOM   105  C  CD1 . ILE A 1 16  ? -8.731  9.580  3.436   1.00 57.92 ? 16  ILE A CD1 1 
ATOM   106  N  N   . PRO A 1 17  ? -5.566  11.106 -1.738  1.00 67.16 ? 17  PRO A N   1 
ATOM   107  C  CA  . PRO A 1 17  ? -5.649  11.633 -3.109  1.00 70.38 ? 17  PRO A CA  1 
ATOM   108  C  C   . PRO A 1 17  ? -6.650  10.916 -4.025  1.00 72.69 ? 17  PRO A C   1 
ATOM   109  O  O   . PRO A 1 17  ? -7.212  11.547 -4.919  1.00 74.62 ? 17  PRO A O   1 
ATOM   110  C  CB  . PRO A 1 17  ? -4.215  11.487 -3.642  0.61 70.90 ? 17  PRO A CB  1 
ATOM   111  C  CG  . PRO A 1 17  ? -3.569  10.479 -2.758  1.00 72.29 ? 17  PRO A CG  1 
ATOM   112  C  CD  . PRO A 1 17  ? -4.200  10.656 -1.410  0.22 68.26 ? 17  PRO A CD  1 
ATOM   113  N  N   . LYS A 1 18  ? -6.894  9.628  -3.798  1.00 72.93 ? 18  LYS A N   1 
ATOM   114  C  CA  . LYS A 1 18  ? -7.833  8.896  -4.651  1.00 77.47 ? 18  LYS A CA  1 
ATOM   115  C  C   . LYS A 1 18  ? -9.275  9.408  -4.552  1.00 76.78 ? 18  LYS A C   1 
ATOM   116  O  O   . LYS A 1 18  ? -10.060 9.212  -5.480  1.00 80.73 ? 18  LYS A O   1 
ATOM   117  C  CB  . LYS A 1 18  ? -7.770  7.380  -4.404  1.00 78.88 ? 18  LYS A CB  1 
ATOM   118  C  CG  . LYS A 1 18  ? -6.487  6.710  -4.889  0.50 79.19 ? 18  LYS A CG  1 
ATOM   119  C  CD  . LYS A 1 18  ? -6.220  6.987  -6.366  0.50 80.03 ? 18  LYS A CD  1 
ATOM   120  C  CE  . LYS A 1 18  ? -4.807  6.565  -6.763  0.50 80.36 ? 18  LYS A CE  1 
ATOM   121  N  NZ  . LYS A 1 18  ? -4.480  7.026  -8.145  0.50 81.89 ? 18  LYS A NZ  1 
ATOM   122  N  N   . VAL A 1 19  ? -9.620  10.072 -3.449  1.00 71.97 ? 19  VAL A N   1 
ATOM   123  C  CA  . VAL A 1 19  ? -11.007 10.511 -3.245  1.00 68.96 ? 19  VAL A CA  1 
ATOM   124  C  C   . VAL A 1 19  ? -11.191 11.991 -2.862  1.00 64.63 ? 19  VAL A C   1 
ATOM   125  O  O   . VAL A 1 19  ? -12.143 12.628 -3.323  1.00 64.88 ? 19  VAL A O   1 
ATOM   126  C  CB  . VAL A 1 19  ? -11.775 9.552  -2.288  1.00 70.14 ? 19  VAL A CB  1 
ATOM   127  C  CG1 . VAL A 1 19  ? -12.992 10.222 -1.691  1.00 66.56 ? 19  VAL A CG1 1 
ATOM   128  C  CG2 . VAL A 1 19  ? -12.209 8.292  -3.030  1.00 71.75 ? 19  VAL A CG2 1 
ATOM   129  N  N   . ASP A 1 20  ? -10.289 12.537 -2.048  1.00 59.84 ? 20  ASP A N   1 
ATOM   130  C  CA  . ASP A 1 20  ? -10.405 13.937 -1.608  1.00 54.10 ? 20  ASP A CA  1 
ATOM   131  C  C   . ASP A 1 20  ? -10.419 14.912 -2.790  1.00 53.57 ? 20  ASP A C   1 
ATOM   132  O  O   . ASP A 1 20  ? -9.419  15.067 -3.485  1.00 53.47 ? 20  ASP A O   1 
ATOM   133  C  CB  . ASP A 1 20  ? -9.296  14.286 -0.617  1.00 50.56 ? 20  ASP A CB  1 
ATOM   134  C  CG  . ASP A 1 20  ? -9.525  13.689 0.769   1.00 50.06 ? 20  ASP A CG  1 
ATOM   135  O  OD1 . ASP A 1 20  ? -10.677 13.328 1.113   1.00 52.29 ? 20  ASP A OD1 1 
ATOM   136  O  OD2 . ASP A 1 20  ? -8.547  13.592 1.539   1.00 47.26 ? 20  ASP A OD2 1 
ATOM   137  N  N   . ASN A 1 21  ? -11.572 15.540 -3.026  1.00 51.88 ? 21  ASN A N   1 
ATOM   138  C  CA  . ASN A 1 21  ? -11.716 16.544 -4.082  1.00 53.08 ? 21  ASN A CA  1 
ATOM   139  C  C   . ASN A 1 21  ? -10.805 17.754 -3.845  1.00 50.04 ? 21  ASN A C   1 
ATOM   140  O  O   . ASN A 1 21  ? -10.247 18.311 -4.779  1.00 49.44 ? 21  ASN A O   1 
ATOM   141  C  CB  . ASN A 1 21  ? -13.169 17.037 -4.176  1.00 55.53 ? 21  ASN A CB  1 
ATOM   142  C  CG  . ASN A 1 21  ? -14.120 15.988 -4.729  1.00 60.85 ? 21  ASN A CG  1 
ATOM   143  O  OD1 . ASN A 1 21  ? -13.670 15.242 -5.730  1.00 64.09 ? 21  ASN A OD1 1 
ATOM   144  N  ND2 . ASN A 1 21  ? -15.256 15.859 -4.262  1.00 63.63 ? 21  ASN A ND2 1 
ATOM   145  N  N   . ASN A 1 22  ? -10.678 18.152 -2.583  1.00 44.42 ? 22  ASN A N   1 
ATOM   146  C  CA  . ASN A 1 22  ? -9.921  19.341 -2.216  1.00 42.93 ? 22  ASN A CA  1 
ATOM   147  C  C   . ASN A 1 22  ? -8.828  18.964 -1.231  1.00 39.51 ? 22  ASN A C   1 
ATOM   148  O  O   . ASN A 1 22  ? -9.116  18.391 -0.180  1.00 40.35 ? 22  ASN A O   1 
ATOM   149  C  CB  . ASN A 1 22  ? -10.853 20.397 -1.613  1.00 41.11 ? 22  ASN A CB  1 
ATOM   150  C  CG  . ASN A 1 22  ? -12.021 20.731 -2.528  1.00 43.49 ? 22  ASN A CG  1 
ATOM   151  O  OD1 . ASN A 1 22  ? -11.785 21.597 -3.504  1.00 45.16 ? 22  ASN A OD1 1 
ATOM   152  N  ND2 . ASN A 1 22  ? -13.125 20.196 -2.362  1.00 42.31 ? 22  ASN A ND2 1 
ATOM   153  N  N   . ALA A 1 23  ? -7.581  19.267 -1.564  1.00 36.72 ? 23  ALA A N   1 
ATOM   154  C  CA  . ALA A 1 23  ? -6.477  18.956 -0.663  1.00 34.95 ? 23  ALA A CA  1 
ATOM   155  C  C   . ALA A 1 23  ? -6.482  19.886 0.562   1.00 31.20 ? 23  ALA A C   1 
ATOM   156  O  O   . ALA A 1 23  ? -5.912  19.558 1.606   1.00 31.96 ? 23  ALA A O   1 
ATOM   157  C  CB  . ALA A 1 23  ? -5.136  19.026 -1.402  1.00 36.15 ? 23  ALA A CB  1 
ATOM   158  N  N   . ILE A 1 24  ? -7.121  21.037 0.409   1.00 28.42 ? 24  ILE A N   1 
ATOM   159  C  CA  . ILE A 1 24  ? -7.224  22.078 1.444   1.00 25.98 ? 24  ILE A CA  1 
ATOM   160  C  C   . ILE A 1 24  ? -8.719  22.363 1.666   1.00 24.13 ? 24  ILE A C   1 
ATOM   161  O  O   . ILE A 1 24  ? -9.447  22.609 0.712   1.00 24.24 ? 24  ILE A O   1 
ATOM   162  C  CB  . ILE A 1 24  ? -6.524  23.394 0.999   1.00 25.96 ? 24  ILE A CB  1 
ATOM   163  C  CG1 . ILE A 1 24  ? -4.979  23.229 0.897   1.00 27.44 ? 24  ILE A CG1 1 
ATOM   164  C  CG2 . ILE A 1 24  ? -6.850  24.518 1.973   1.00 23.89 ? 24  ILE A CG2 1 
ATOM   165  C  CD1 . ILE A 1 24  ? -4.272  24.240 -0.006  1.00 27.06 ? 24  ILE A CD1 1 
ATOM   166  N  N   . GLU A 1 25  ? -9.173  22.316 2.916   1.00 22.04 ? 25  GLU A N   1 
ATOM   167  C  CA  . GLU A 1 25  ? -10.529 22.717 3.243   1.00 21.45 ? 25  GLU A CA  1 
ATOM   168  C  C   . GLU A 1 25  ? -10.463 23.836 4.268   1.00 20.30 ? 25  GLU A C   1 
ATOM   169  O  O   . GLU A 1 25  ? -9.631  23.778 5.172   1.00 19.38 ? 25  GLU A O   1 
ATOM   170  C  CB  . GLU A 1 25  ? -11.365 21.523 3.770   1.00 22.85 ? 25  GLU A CB  1 
ATOM   171  C  CG  . GLU A 1 25  ? -11.730 20.509 2.677   1.00 26.08 ? 25  GLU A CG  1 
ATOM   172  C  CD  . GLU A 1 25  ? -12.500 19.281 3.207   1.00 28.27 ? 25  GLU A CD  1 
ATOM   173  O  OE1 . GLU A 1 25  ? -12.955 18.506 2.361   1.00 33.18 ? 25  GLU A OE1 1 
ATOM   174  O  OE2 . GLU A 1 25  ? -12.633 19.057 4.434   1.00 26.17 ? 25  GLU A OE2 1 
ATOM   175  N  N   . PHE A 1 26  ? -11.356 24.824 4.144   1.00 19.17 ? 26  PHE A N   1 
ATOM   176  C  CA  . PHE A 1 26  ? -11.394 25.974 5.032   1.00 17.63 ? 26  PHE A CA  1 
ATOM   177  C  C   . PHE A 1 26  ? -12.586 25.858 6.004   1.00 17.40 ? 26  PHE A C   1 
ATOM   178  O  O   . PHE A 1 26  ? -13.693 25.446 5.592   1.00 17.45 ? 26  PHE A O   1 
ATOM   179  C  CB  . PHE A 1 26  ? -11.589 27.232 4.193   1.00 18.45 ? 26  PHE A CB  1 
ATOM   180  C  CG  . PHE A 1 26  ? -10.416 27.560 3.313   1.00 19.80 ? 26  PHE A CG  1 
ATOM   181  C  CD1 . PHE A 1 26  ? -9.292  28.166 3.850   1.00 19.25 ? 26  PHE A CD1 1 
ATOM   182  C  CD2 . PHE A 1 26  ? -10.420 27.224 1.970   1.00 21.81 ? 26  PHE A CD2 1 
ATOM   183  C  CE1 . PHE A 1 26  ? -8.197  28.472 3.059   1.00 20.87 ? 26  PHE A CE1 1 
ATOM   184  C  CE2 . PHE A 1 26  ? -9.322  27.507 1.171   1.00 23.45 ? 26  PHE A CE2 1 
ATOM   185  C  CZ  . PHE A 1 26  ? -8.212  28.145 1.715   1.00 22.64 ? 26  PHE A CZ  1 
ATOM   186  N  N   . LEU A 1 27  ? -12.370 26.276 7.252   1.00 12.33 ? 27  LEU A N   1 
ATOM   187  C  CA  . LEU A 1 27  ? -13.434 26.312 8.265   1.00 12.62 ? 27  LEU A CA  1 
ATOM   188  C  C   . LEU A 1 27  ? -14.225 27.627 8.205   1.00 13.72 ? 27  LEU A C   1 
ATOM   189  O  O   . LEU A 1 27  ? -13.639 28.731 8.318   1.00 14.33 ? 27  LEU A O   1 
ATOM   190  C  CB  . LEU A 1 27  ? -12.803 26.174 9.663   1.00 12.05 ? 27  LEU A CB  1 
ATOM   191  C  CG  . LEU A 1 27  ? -13.733 26.221 10.903  1.00 11.86 ? 27  LEU A CG  1 
ATOM   192  C  CD1 . LEU A 1 27  ? -14.710 25.052 10.905  1.00 11.78 ? 27  LEU A CD1 1 
ATOM   193  C  CD2 . LEU A 1 27  ? -12.923 26.284 12.207  1.00 11.44 ? 27  LEU A CD2 1 
ATOM   194  N  N   . LEU A 1 28  ? -15.544 27.549 8.035   1.00 14.13 ? 28  LEU A N   1 
ATOM   195  C  CA  . LEU A 1 28  ? -16.395 28.751 8.131   1.00 14.99 ? 28  LEU A CA  1 
ATOM   196  C  C   . LEU A 1 28  ? -17.413 28.534 9.231   1.00 15.87 ? 28  LEU A C   1 
ATOM   197  O  O   . LEU A 1 28  ? -17.954 27.436 9.363   1.00 15.67 ? 28  LEU A O   1 
ATOM   198  C  CB  . LEU A 1 28  ? -17.147 29.036 6.825   1.00 15.30 ? 28  LEU A CB  1 
ATOM   199  C  CG  . LEU A 1 28  ? -16.270 29.431 5.621   1.00 16.34 ? 28  LEU A CG  1 
ATOM   200  C  CD1 . LEU A 1 28  ? -17.061 29.561 4.338   1.00 17.67 ? 28  LEU A CD1 1 
ATOM   201  C  CD2 . LEU A 1 28  ? -15.565 30.745 5.899   1.00 16.84 ? 28  LEU A CD2 1 
ATOM   202  N  N   . LEU A 1 29  ? -17.721 29.599 9.971   1.00 16.75 ? 29  LEU A N   1 
ATOM   203  C  CA  . LEU A 1 29  ? -18.711 29.539 11.046  1.00 17.90 ? 29  LEU A CA  1 
ATOM   204  C  C   . LEU A 1 29  ? -19.863 30.416 10.642  1.00 20.21 ? 29  LEU A C   1 
ATOM   205  O  O   . LEU A 1 29  ? -19.646 31.498 10.106  1.00 19.74 ? 29  LEU A O   1 
ATOM   206  C  CB  . LEU A 1 29  ? -18.150 30.088 12.368  1.00 17.91 ? 29  LEU A CB  1 
ATOM   207  C  CG  . LEU A 1 29  ? -16.758 29.632 12.875  1.00 16.66 ? 29  LEU A CG  1 
ATOM   208  C  CD1 . LEU A 1 29  ? -16.454 30.246 14.241  1.00 16.65 ? 29  LEU A CD1 1 
ATOM   209  C  CD2 . LEU A 1 29  ? -16.661 28.112 12.954  1.00 15.85 ? 29  LEU A CD2 1 
ATOM   210  N  N   . GLN A 1 30  ? -21.082 29.958 10.936  1.00 21.82 ? 30  GLN A N   1 
ATOM   211  C  CA  . GLN A 1 30  ? -22.290 30.711 10.629  1.00 25.33 ? 30  GLN A CA  1 
ATOM   212  C  C   . GLN A 1 30  ? -22.776 31.486 11.837  1.00 27.33 ? 30  GLN A C   1 
ATOM   213  O  O   . GLN A 1 30  ? -23.082 30.890 12.881  1.00 28.43 ? 30  GLN A O   1 
ATOM   214  C  CB  . GLN A 1 30  ? -23.398 29.762 10.148  1.00 26.21 ? 30  GLN A CB  1 
ATOM   215  C  CG  . GLN A 1 30  ? -24.654 30.466 9.648   1.00 29.20 ? 30  GLN A CG  1 
ATOM   216  C  CD  . GLN A 1 30  ? -25.719 29.472 9.224   1.00 30.15 ? 30  GLN A CD  1 
ATOM   217  O  OE1 . GLN A 1 30  ? -25.879 28.418 9.842   1.00 32.01 ? 30  GLN A OE1 1 
ATOM   218  N  NE2 . GLN A 1 30  ? -26.450 29.797 8.175   1.00 31.47 ? 30  GLN A NE2 1 
ATOM   219  N  N   . ALA A 1 31  ? -22.887 32.805 11.682  1.00 29.19 ? 31  ALA A N   1 
ATOM   220  C  CA  . ALA A 1 31  ? -23.411 33.660 12.756  1.00 34.14 ? 31  ALA A CA  1 
ATOM   221  C  C   . ALA A 1 31  ? -24.833 33.253 13.215  1.00 37.56 ? 31  ALA A C   1 
ATOM   222  O  O   . ALA A 1 31  ? -25.663 32.821 12.408  1.00 37.12 ? 31  ALA A O   1 
ATOM   223  C  CB  . ALA A 1 31  ? -23.377 35.131 12.349  1.00 33.93 ? 31  ALA A CB  1 
ATOM   224  N  N   . SER A 1 32  ? -25.081 33.398 14.520  1.00 42.41 ? 32  SER A N   1 
ATOM   225  C  CA  . SER A 1 32  ? -26.384 33.108 15.148  1.00 46.53 ? 32  SER A CA  1 
ATOM   226  C  C   . SER A 1 32  ? -27.443 34.161 14.867  1.00 50.85 ? 32  SER A C   1 
ATOM   227  O  O   . SER A 1 32  ? -28.629 33.839 14.773  1.00 55.05 ? 32  SER A O   1 
ATOM   228  C  CB  . SER A 1 32  ? -26.225 32.992 16.662  1.00 45.99 ? 32  SER A CB  1 
ATOM   229  O  OG  . SER A 1 32  ? -25.601 31.770 16.982  1.00 45.56 ? 32  SER A OG  1 
ATOM   230  N  N   . ASP A 1 33  ? -27.009 35.412 14.745  1.00 54.01 ? 33  ASP A N   1 
ATOM   231  C  CA  . ASP A 1 33  ? -27.913 36.556 14.580  1.00 60.92 ? 33  ASP A CA  1 
ATOM   232  C  C   . ASP A 1 33  ? -27.960 37.059 13.127  1.00 61.35 ? 33  ASP A C   1 
ATOM   233  O  O   . ASP A 1 33  ? -27.564 36.344 12.203  1.00 58.10 ? 33  ASP A O   1 
ATOM   234  C  CB  . ASP A 1 33  ? -27.474 37.684 15.526  1.00 62.82 ? 33  ASP A CB  1 
ATOM   235  C  CG  . ASP A 1 33  ? -26.067 38.187 15.225  1.00 61.77 ? 33  ASP A CG  1 
ATOM   236  O  OD1 . ASP A 1 33  ? -25.414 37.649 14.298  1.00 61.53 ? 33  ASP A OD1 1 
ATOM   237  O  OD2 . ASP A 1 33  ? -25.606 39.117 15.916  1.00 62.90 ? 33  ASP A OD2 1 
ATOM   238  N  N   . GLY A 1 34  ? -28.441 38.290 12.936  1.00 64.06 ? 34  GLY A N   1 
ATOM   239  C  CA  . GLY A 1 34  ? -28.396 38.961 11.633  1.00 65.11 ? 34  GLY A CA  1 
ATOM   240  C  C   . GLY A 1 34  ? -28.913 38.099 10.498  1.00 66.20 ? 34  GLY A C   1 
ATOM   241  O  O   . GLY A 1 34  ? -29.920 37.410 10.651  1.00 68.10 ? 34  GLY A O   1 
ATOM   242  N  N   . ILE A 1 35  ? -28.224 38.127 9.359   1.00 67.72 ? 35  ILE A N   1 
ATOM   243  C  CA  . ILE A 1 35  ? -28.572 37.234 8.240   0.50 65.89 ? 35  ILE A CA  1 
ATOM   244  C  C   . ILE A 1 35  ? -27.695 35.971 8.204   1.00 60.78 ? 35  ILE A C   1 
ATOM   245  O  O   . ILE A 1 35  ? -27.575 35.313 7.168   1.00 61.11 ? 35  ILE A O   1 
ATOM   246  C  CB  . ILE A 1 35  ? -28.595 37.951 6.858   1.00 68.72 ? 35  ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 35  ? -27.218 38.544 6.510   1.00 68.44 ? 35  ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 35  ? -29.715 38.990 6.812   1.00 73.25 ? 35  ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 35  ? -26.987 38.734 5.021   1.00 68.24 ? 35  ILE A CD1 1 
ATOM   250  N  N   . HIS A 1 36  ? -27.101 35.633 9.347   1.00 56.16 ? 36  HIS A N   1 
ATOM   251  C  CA  . HIS A 1 36  ? -26.305 34.413 9.484   1.00 49.74 ? 36  HIS A CA  1 
ATOM   252  C  C   . HIS A 1 36  ? -25.206 34.336 8.441   1.00 44.80 ? 36  HIS A C   1 
ATOM   253  O  O   . HIS A 1 36  ? -25.203 33.440 7.583   1.00 45.26 ? 36  HIS A O   1 
ATOM   254  C  CB  . HIS A 1 36  ? -27.196 33.156 9.442   1.00 50.38 ? 36  HIS A CB  1 
ATOM   255  C  CG  . HIS A 1 36  ? -28.501 33.277 10.223  1.00 55.24 ? 36  HIS A CG  1 
ATOM   256  N  ND1 . HIS A 1 36  ? -28.543 33.491 11.555  1.00 55.97 ? 36  HIS A ND1 1 
ATOM   257  C  CD2 . HIS A 1 36  ? -29.826 33.157 9.809   1.00 55.99 ? 36  HIS A CD2 1 
ATOM   258  C  CE1 . HIS A 1 36  ? -29.828 33.527 11.966  1.00 57.39 ? 36  HIS A CE1 1 
ATOM   259  N  NE2 . HIS A 1 36  ? -30.609 33.317 10.901  1.00 57.48 ? 36  HIS A NE2 1 
ATOM   260  N  N   . HIS A 1 37  ? -24.283 35.295 8.498   1.00 41.77 ? 37  HIS A N   1 
ATOM   261  C  CA  . HIS A 1 37  ? -23.085 35.306 7.657   1.00 39.25 ? 37  HIS A CA  1 
ATOM   262  C  C   . HIS A 1 37  ? -22.185 34.139 7.968   1.00 33.92 ? 37  HIS A C   1 
ATOM   263  O  O   . HIS A 1 37  ? -22.217 33.588 9.079   1.00 32.25 ? 37  HIS A O   1 
ATOM   264  C  CB  . HIS A 1 37  ? -22.301 36.621 7.827   1.00 42.00 ? 37  HIS A CB  1 
ATOM   265  C  CG  . HIS A 1 37  ? -22.733 37.722 6.872   1.00 46.27 ? 37  HIS A CG  1 
ATOM   266  N  ND1 . HIS A 1 37  ? -22.379 37.972 5.548   0.40 47.67 ? 37  HIS A ND1 1 
ATOM   267  C  CD2 . HIS A 1 37  ? -23.595 38.692 7.225   0.10 45.89 ? 37  HIS A CD2 1 
ATOM   268  C  CE1 . HIS A 1 37  ? -23.041 39.078 5.158   0.40 49.13 ? 37  HIS A CE1 1 
ATOM   269  N  NE2 . HIS A 1 37  ? -23.786 39.520 6.184   0.40 48.12 ? 37  HIS A NE2 1 
ATOM   270  N  N   . TRP A 1 38  ? -21.354 33.775 6.989   1.00 30.30 ? 38  TRP A N   1 
ATOM   271  C  CA  . TRP A 1 38  ? -20.361 32.727 7.160   1.00 26.59 ? 38  TRP A CA  1 
ATOM   272  C  C   . TRP A 1 38  ? -18.964 33.285 7.059   1.00 25.25 ? 38  TRP A C   1 
ATOM   273  O  O   . TRP A 1 38  ? -18.575 33.792 5.978   1.00 25.86 ? 38  TRP A O   1 
ATOM   274  C  CB  . TRP A 1 38  ? -20.538 31.684 6.074   1.00 24.64 ? 38  TRP A CB  1 
ATOM   275  C  CG  . TRP A 1 38  ? -21.775 30.831 6.159   1.00 25.04 ? 38  TRP A CG  1 
ATOM   276  C  CD1 . TRP A 1 38  ? -23.042 31.092 5.616   1.00 26.32 ? 38  TRP A CD1 1 
ATOM   277  C  CD2 . TRP A 1 38  ? -21.894 29.523 6.802   1.00 24.55 ? 38  TRP A CD2 1 
ATOM   278  N  NE1 . TRP A 1 38  ? -23.903 30.045 5.863   1.00 26.61 ? 38  TRP A NE1 1 
ATOM   279  C  CE2 . TRP A 1 38  ? -23.274 29.070 6.567   1.00 25.63 ? 38  TRP A CE2 1 
ATOM   280  C  CE3 . TRP A 1 38  ? -21.014 28.688 7.501   1.00 23.58 ? 38  TRP A CE3 1 
ATOM   281  C  CZ2 . TRP A 1 38  ? -23.727 27.850 7.027   1.00 24.86 ? 38  TRP A CZ2 1 
ATOM   282  C  CZ3 . TRP A 1 38  ? -21.489 27.460 7.951   1.00 23.10 ? 38  TRP A CZ3 1 
ATOM   283  C  CH2 . TRP A 1 38  ? -22.825 27.058 7.724   1.00 23.60 ? 38  TRP A CH2 1 
ATOM   284  N  N   . THR A 1 39  ? -18.189 33.211 8.147   1.00 22.60 ? 39  THR A N   1 
ATOM   285  C  CA  . THR A 1 39  ? -16.781 33.679 8.118   1.00 21.62 ? 39  THR A CA  1 
ATOM   286  C  C   . THR A 1 39  ? -15.856 32.745 8.891   1.00 19.85 ? 39  THR A C   1 
ATOM   287  O  O   . THR A 1 39  ? -16.307 31.947 9.734   1.00 19.03 ? 39  THR A O   1 
ATOM   288  C  CB  . THR A 1 39  ? -16.571 35.089 8.763   1.00 22.70 ? 39  THR A CB  1 
ATOM   289  O  OG1 . THR A 1 39  ? -16.611 34.978 10.196  1.00 24.01 ? 39  THR A OG1 1 
ATOM   290  C  CG2 . THR A 1 39  ? -17.620 36.094 8.297   1.00 24.47 ? 39  THR A CG2 1 
ATOM   291  N  N   . PRO A 1 40  ? -14.545 32.876 8.650   1.00 18.90 ? 40  PRO A N   1 
ATOM   292  C  CA  . PRO A 1 40  ? -13.630 32.223 9.573   1.00 17.91 ? 40  PRO A CA  1 
ATOM   293  C  C   . PRO A 1 40  ? -13.746 32.824 10.975  1.00 17.92 ? 40  PRO A C   1 
ATOM   294  O  O   . PRO A 1 40  ? -14.362 33.864 11.141  1.00 19.51 ? 40  PRO A O   1 
ATOM   295  C  CB  . PRO A 1 40  ? -12.238 32.508 8.978   1.00 17.06 ? 40  PRO A CB  1 
ATOM   296  C  CG  . PRO A 1 40  ? -12.496 32.919 7.570   1.00 17.98 ? 40  PRO A CG  1 
ATOM   297  C  CD  . PRO A 1 40  ? -13.840 33.596 7.565   1.00 18.85 ? 40  PRO A CD  1 
ATOM   298  N  N   . PRO A 1 41  ? -13.174 32.158 11.983  1.00 17.37 ? 41  PRO A N   1 
ATOM   299  C  CA  . PRO A 1 41  ? -13.179 32.674 13.359  1.00 18.45 ? 41  PRO A CA  1 
ATOM   300  C  C   . PRO A 1 41  ? -12.438 34.031 13.496  1.00 18.81 ? 41  PRO A C   1 
ATOM   301  O  O   . PRO A 1 41  ? -11.380 34.248 12.900  1.00 18.27 ? 41  PRO A O   1 
ATOM   302  C  CB  . PRO A 1 41  ? -12.453 31.580 14.169  1.00 17.34 ? 41  PRO A CB  1 
ATOM   303  C  CG  . PRO A 1 41  ? -12.367 30.394 13.294  1.00 17.49 ? 41  PRO A CG  1 
ATOM   304  C  CD  . PRO A 1 41  ? -12.490 30.856 11.855  1.00 16.53 ? 41  PRO A CD  1 
ATOM   305  N  N   . LYS A 1 42  ? -13.022 34.940 14.261  1.00 20.23 ? 42  LYS A N   1 
ATOM   306  C  CA  . LYS A 1 42  ? -12.498 36.295 14.407  1.00 20.82 ? 42  LYS A CA  1 
ATOM   307  C  C   . LYS A 1 42  ? -13.107 36.902 15.669  1.00 22.21 ? 42  LYS A C   1 
ATOM   308  O  O   . LYS A 1 42  ? -14.170 36.448 16.119  1.00 22.88 ? 42  LYS A O   1 
ATOM   309  C  CB  . LYS A 1 42  ? -12.844 37.158 13.186  1.00 21.98 ? 42  LYS A CB  1 
ATOM   310  C  CG  . LYS A 1 42  ? -14.350 37.326 12.985  1.00 24.77 ? 42  LYS A CG  1 
ATOM   311  C  CD  . LYS A 1 42  ? -14.685 38.366 11.928  1.00 26.49 ? 42  LYS A CD  1 
ATOM   312  C  CE  . LYS A 1 42  ? -16.189 38.384 11.651  1.00 28.84 ? 42  LYS A CE  1 
ATOM   313  N  NZ  . LYS A 1 42  ? -16.948 39.032 12.776  1.00 32.31 ? 42  LYS A NZ  1 
ATOM   314  N  N   . GLY A 1 43  ? -12.462 37.941 16.210  1.00 21.83 ? 43  GLY A N   1 
ATOM   315  C  CA  . GLY A 1 43  ? -12.935 38.607 17.422  1.00 22.90 ? 43  GLY A CA  1 
ATOM   316  C  C   . GLY A 1 43  ? -12.252 39.933 17.637  1.00 23.56 ? 43  GLY A C   1 
ATOM   317  O  O   . GLY A 1 43  ? -11.209 40.210 17.050  1.00 21.60 ? 43  GLY A O   1 
ATOM   318  N  N   . HIS A 1 44  ? -12.847 40.764 18.491  1.00 25.67 ? 44  HIS A N   1 
ATOM   319  C  CA  . HIS A 1 44  ? -12.393 42.143 18.679  1.00 27.10 ? 44  HIS A CA  1 
ATOM   320  C  C   . HIS A 1 44  ? -11.128 42.224 19.477  1.00 26.21 ? 44  HIS A C   1 
ATOM   321  O  O   . HIS A 1 44  ? -10.879 41.393 20.351  1.00 25.19 ? 44  HIS A O   1 
ATOM   322  C  CB  . HIS A 1 44  ? -13.540 43.004 19.251  1.00 31.09 ? 44  HIS A CB  1 
ATOM   323  C  CG  . HIS A 1 44  ? -14.759 43.043 18.330  0.50 33.09 ? 44  HIS A CG  1 
ATOM   324  N  ND1 . HIS A 1 44  ? -15.462 41.921 17.999  0.50 33.40 ? 44  HIS A ND1 1 
ATOM   325  C  CD2 . HIS A 1 44  ? -15.347 44.097 17.629  0.50 35.24 ? 44  HIS A CD2 1 
ATOM   326  C  CE1 . HIS A 1 44  ? -16.463 42.255 17.158  0.50 34.05 ? 44  HIS A CE1 1 
ATOM   327  N  NE2 . HIS A 1 44  ? -16.390 43.583 16.929  0.50 35.80 ? 44  HIS A NE2 1 
ATOM   328  N  N   . VAL A 1 45  ? -10.292 43.199 19.153  1.00 26.82 ? 45  VAL A N   1 
ATOM   329  C  CA  . VAL A 1 45  ? -9.038  43.426 19.892  1.00 28.41 ? 45  VAL A CA  1 
ATOM   330  C  C   . VAL A 1 45  ? -9.296  43.904 21.330  1.00 31.24 ? 45  VAL A C   1 
ATOM   331  O  O   . VAL A 1 45  ? -10.378 44.396 21.656  1.00 32.35 ? 45  VAL A O   1 
ATOM   332  C  CB  . VAL A 1 45  ? -8.120  44.438 19.173  1.00 28.01 ? 45  VAL A CB  1 
ATOM   333  C  CG1 . VAL A 1 45  ? -7.914  44.001 17.732  1.00 27.35 ? 45  VAL A CG1 1 
ATOM   334  C  CG2 . VAL A 1 45  ? -8.703  45.858 19.216  1.00 30.23 ? 45  VAL A CG2 1 
ATOM   335  N  N   . GLU A 1 46  ? -8.273  43.748 22.166  1.00 33.35 ? 46  GLU A N   1 
ATOM   336  C  CA  . GLU A 1 46  ? -8.288  44.168 23.546  1.00 34.81 ? 46  GLU A CA  1 
ATOM   337  C  C   . GLU A 1 46  ? -7.146  45.140 23.777  1.00 35.17 ? 46  GLU A C   1 
ATOM   338  O  O   . GLU A 1 46  ? -6.109  45.028 23.131  1.00 32.55 ? 46  GLU A O   1 
ATOM   339  C  CB  . GLU A 1 46  ? -8.135  42.961 24.449  1.00 36.05 ? 46  GLU A CB  1 
ATOM   340  C  CG  . GLU A 1 46  ? -9.369  42.107 24.510  1.00 38.20 ? 46  GLU A CG  1 
ATOM   341  C  CD  . GLU A 1 46  ? -10.288 42.521 25.644  1.00 43.80 ? 46  GLU A CD  1 
ATOM   342  O  OE1 . GLU A 1 46  ? -11.159 41.698 25.995  1.00 45.77 ? 46  GLU A OE1 1 
ATOM   343  O  OE2 . GLU A 1 46  ? -10.128 43.642 26.198  1.00 42.54 ? 46  GLU A OE2 1 
ATOM   344  N  N   . PRO A 1 47  ? -7.332  46.106 24.706  1.00 37.31 ? 47  PRO A N   1 
ATOM   345  C  CA  . PRO A 1 47  ? -6.262  47.059 24.989  1.00 37.65 ? 47  PRO A CA  1 
ATOM   346  C  C   . PRO A 1 47  ? -4.963  46.332 25.345  1.00 37.18 ? 47  PRO A C   1 
ATOM   347  O  O   . PRO A 1 47  ? -4.958  45.411 26.180  1.00 36.79 ? 47  PRO A O   1 
ATOM   348  C  CB  . PRO A 1 47  ? -6.796  47.846 26.196  1.00 39.68 ? 47  PRO A CB  1 
ATOM   349  C  CG  . PRO A 1 47  ? -8.276  47.748 26.078  1.00 40.15 ? 47  PRO A CG  1 
ATOM   350  C  CD  . PRO A 1 47  ? -8.566  46.411 25.450  1.00 38.43 ? 47  PRO A CD  1 
ATOM   351  N  N   . GLY A 1 48  ? -3.882  46.725 24.680  1.00 37.63 ? 48  GLY A N   1 
ATOM   352  C  CA  . GLY A 1 48  ? -2.570  46.119 24.887  1.00 37.06 ? 48  GLY A CA  1 
ATOM   353  C  C   . GLY A 1 48  ? -2.353  44.729 24.312  1.00 36.80 ? 48  GLY A C   1 
ATOM   354  O  O   . GLY A 1 48  ? -1.247  44.226 24.400  1.00 39.68 ? 48  GLY A O   1 
ATOM   355  N  N   . GLU A 1 49  ? -3.384  44.092 23.740  1.00 33.14 ? 49  GLU A N   1 
ATOM   356  C  CA  . GLU A 1 49  ? -3.207  42.760 23.139  1.00 31.09 ? 49  GLU A CA  1 
ATOM   357  C  C   . GLU A 1 49  ? -2.628  42.865 21.727  1.00 28.64 ? 49  GLU A C   1 
ATOM   358  O  O   . GLU A 1 49  ? -2.995  43.732 20.957  1.00 28.05 ? 49  GLU A O   1 
ATOM   359  C  CB  . GLU A 1 49  ? -4.530  41.993 23.126  1.00 31.35 ? 49  GLU A CB  1 
ATOM   360  C  CG  . GLU A 1 49  ? -4.411  40.487 22.969  1.00 32.47 ? 49  GLU A CG  1 
ATOM   361  C  CD  . GLU A 1 49  ? -5.784  39.813 23.061  1.00 34.10 ? 49  GLU A CD  1 
ATOM   362  O  OE1 . GLU A 1 49  ? -6.715  40.249 22.346  1.00 35.83 ? 49  GLU A OE1 1 
ATOM   363  O  OE2 . GLU A 1 49  ? -5.939  38.905 23.901  1.00 35.44 ? 49  GLU A OE2 1 
ATOM   364  N  N   . ASP A 1 50  ? -1.674  42.001 21.419  1.00 26.39 ? 50  ASP A N   1 
ATOM   365  C  CA  . ASP A 1 50  ? -1.099  41.924 20.081  1.00 26.01 ? 50  ASP A CA  1 
ATOM   366  C  C   . ASP A 1 50  ? -2.169  41.343 19.105  1.00 23.85 ? 50  ASP A C   1 
ATOM   367  O  O   . ASP A 1 50  ? -2.912  40.446 19.476  1.00 22.86 ? 50  ASP A O   1 
ATOM   368  C  CB  . ASP A 1 50  ? 0.089   40.972 20.194  1.00 26.11 ? 50  ASP A CB  1 
ATOM   369  C  CG  . ASP A 1 50  ? 0.839   40.841 18.941  1.00 26.16 ? 50  ASP A CG  1 
ATOM   370  O  OD1 . ASP A 1 50  ? 0.376   40.131 18.050  1.00 25.59 ? 50  ASP A OD1 1 
ATOM   371  O  OD2 . ASP A 1 50  ? 1.923   41.437 18.845  1.00 28.27 ? 50  ASP A OD2 1 
ATOM   372  N  N   . ASP A 1 51  ? -2.261  41.892 17.893  1.00 22.53 ? 51  ASP A N   1 
ATOM   373  C  CA  . ASP A 1 51  ? -3.269  41.510 16.924  1.00 21.88 ? 51  ASP A CA  1 
ATOM   374  C  C   . ASP A 1 51  ? -3.255  39.997 16.649  1.00 19.42 ? 51  ASP A C   1 
ATOM   375  O  O   . ASP A 1 51  ? -4.300  39.393 16.568  1.00 19.00 ? 51  ASP A O   1 
ATOM   376  C  CB  . ASP A 1 51  ? -3.132  42.312 15.618  1.00 24.13 ? 51  ASP A CB  1 
ATOM   377  C  CG  . ASP A 1 51  ? -3.768  43.710 15.707  1.00 28.31 ? 51  ASP A CG  1 
ATOM   378  O  OD1 . ASP A 1 51  ? -4.263  44.101 16.782  1.00 31.46 ? 51  ASP A OD1 1 
ATOM   379  O  OD2 . ASP A 1 51  ? -3.797  44.412 14.690  1.00 31.52 ? 51  ASP A OD2 1 
ATOM   380  N  N   . LEU A 1 52  ? -2.082  39.392 16.537  1.00 17.67 ? 52  LEU A N   1 
ATOM   381  C  CA  . LEU A 1 52  ? -2.010  37.959 16.311  1.00 16.95 ? 52  LEU A CA  1 
ATOM   382  C  C   . LEU A 1 52  ? -2.491  37.171 17.542  1.00 17.24 ? 52  LEU A C   1 
ATOM   383  O  O   . LEU A 1 52  ? -3.164  36.151 17.414  1.00 16.11 ? 52  LEU A O   1 
ATOM   384  C  CB  . LEU A 1 52  ? -0.582  37.560 15.921  1.00 16.56 ? 52  LEU A CB  1 
ATOM   385  C  CG  . LEU A 1 52  ? -0.332  36.085 15.688  1.00 16.12 ? 52  LEU A CG  1 
ATOM   386  C  CD1 . LEU A 1 52  ? -1.310  35.534 14.628  1.00 15.03 ? 52  LEU A CD1 1 
ATOM   387  C  CD2 . LEU A 1 52  ? 1.124   35.895 15.258  1.00 16.67 ? 52  LEU A CD2 1 
ATOM   388  N  N   . GLU A 1 53  ? -2.212  37.673 18.744  1.00 18.13 ? 53  GLU A N   1 
ATOM   389  C  CA  . GLU A 1 53  ? -2.756  37.017 19.937  1.00 19.64 ? 53  GLU A CA  1 
ATOM   390  C  C   . GLU A 1 53  ? -4.301  37.127 20.004  1.00 17.83 ? 53  GLU A C   1 
ATOM   391  O  O   . GLU A 1 53  ? -4.969  36.194 20.398  1.00 17.38 ? 53  GLU A O   1 
ATOM   392  C  CB  . GLU A 1 53  ? -2.070  37.521 21.239  1.00 22.84 ? 53  GLU A CB  1 
ATOM   393  C  CG  . GLU A 1 53  ? -2.631  36.905 22.539  1.00 27.16 ? 53  GLU A CG  1 
ATOM   394  C  CD  . GLU A 1 53  ? -2.678  35.354 22.596  0.80 29.71 ? 53  GLU A CD  1 
ATOM   395  O  OE1 . GLU A 1 53  ? -1.840  34.657 21.963  0.80 29.95 ? 53  GLU A OE1 1 
ATOM   396  O  OE2 . GLU A 1 53  ? -3.557  34.810 23.321  0.80 30.66 ? 53  GLU A OE2 1 
ATOM   397  N  N   . THR A 1 54  ? -4.858  38.245 19.589  1.00 17.58 ? 54  THR A N   1 
ATOM   398  C  CA  . THR A 1 54  ? -6.319  38.365 19.438  1.00 18.15 ? 54  THR A CA  1 
ATOM   399  C  C   . THR A 1 54  ? -6.868  37.281 18.493  1.00 17.12 ? 54  THR A C   1 
ATOM   400  O  O   . THR A 1 54  ? -7.892  36.673 18.796  1.00 17.91 ? 54  THR A O   1 
ATOM   401  C  CB  . THR A 1 54  ? -6.716  39.734 18.846  1.00 19.16 ? 54  THR A CB  1 
ATOM   402  O  OG1 . THR A 1 54  ? -6.168  40.774 19.663  1.00 20.33 ? 54  THR A OG1 1 
ATOM   403  C  CG2 . THR A 1 54  ? -8.280  39.910 18.715  1.00 19.04 ? 54  THR A CG2 1 
ATOM   404  N  N   . ALA A 1 55  ? -6.194  37.046 17.365  1.00 15.59 ? 55  ALA A N   1 
ATOM   405  C  CA  . ALA A 1 55  ? -6.658  36.074 16.368  1.00 14.75 ? 55  ALA A CA  1 
ATOM   406  C  C   . ALA A 1 55  ? -6.692  34.681 16.995  1.00 15.15 ? 55  ALA A C   1 
ATOM   407  O  O   . ALA A 1 55  ? -7.632  33.894 16.774  1.00 15.18 ? 55  ALA A O   1 
ATOM   408  C  CB  . ALA A 1 55  ? -5.728  36.069 15.149  1.00 13.52 ? 55  ALA A CB  1 
ATOM   409  N  N   . LEU A 1 56  ? -5.632  34.360 17.733  1.00 15.69 ? 56  LEU A N   1 
ATOM   410  C  CA  . LEU A 1 56  ? -5.514  33.072 18.436  1.00 16.24 ? 56  LEU A CA  1 
ATOM   411  C  C   . LEU A 1 56  ? -6.577  32.954 19.523  1.00 16.78 ? 56  LEU A C   1 
ATOM   412  O  O   . LEU A 1 56  ? -7.288  31.947 19.607  1.00 16.53 ? 56  LEU A O   1 
ATOM   413  C  CB  . LEU A 1 56  ? -4.123  32.951 19.060  1.00 16.67 ? 56  LEU A CB  1 
ATOM   414  C  CG  . LEU A 1 56  ? -3.035  32.642 18.022  1.00 17.28 ? 56  LEU A CG  1 
ATOM   415  C  CD1 . LEU A 1 56  ? -1.670  32.954 18.635  1.00 18.23 ? 56  LEU A CD1 1 
ATOM   416  C  CD2 . LEU A 1 56  ? -3.098  31.171 17.548  1.00 17.12 ? 56  LEU A CD2 1 
ATOM   417  N  N   . ARG A 1 57  ? -6.711  33.991 20.346  1.00 17.99 ? 57  ARG A N   1 
ATOM   418  C  CA  . ARG A 1 57  ? -7.739  33.979 21.378  1.00 19.72 ? 57  ARG A CA  1 
ATOM   419  C  C   . ARG A 1 57  ? -9.147  33.878 20.759  1.00 19.81 ? 57  ARG A C   1 
ATOM   420  O  O   . ARG A 1 57  ? -9.953  33.069 21.208  1.00 19.57 ? 57  ARG A O   1 
ATOM   421  C  CB  . ARG A 1 57  ? -7.620  35.189 22.315  1.00 21.36 ? 57  ARG A CB  1 
ATOM   422  C  CG  . ARG A 1 57  ? -8.757  35.295 23.346  1.00 24.10 ? 57  ARG A CG  1 
ATOM   423  C  CD  . ARG A 1 57  ? -8.622  36.539 24.234  1.00 26.63 ? 57  ARG A CD  1 
ATOM   424  N  NE  . ARG A 1 57  ? -8.613  37.785 23.472  1.00 27.18 ? 57  ARG A NE  1 
ATOM   425  C  CZ  . ARG A 1 57  ? -9.675  38.345 22.880  1.00 28.72 ? 57  ARG A CZ  1 
ATOM   426  N  NH1 . ARG A 1 57  ? -10.875 37.786 22.954  1.00 29.24 ? 57  ARG A NH1 1 
ATOM   427  N  NH2 . ARG A 1 57  ? -9.533  39.499 22.235  1.00 28.08 ? 57  ARG A NH2 1 
ATOM   428  N  N   . ALA A 1 58  ? -9.446  34.678 19.726  1.00 19.56 ? 58  ALA A N   1 
ATOM   429  C  CA  . ALA A 1 58  ? -10.784 34.627 19.126  1.00 19.42 ? 58  ALA A CA  1 
ATOM   430  C  C   . ALA A 1 58  ? -11.048 33.230 18.521  1.00 19.02 ? 58  ALA A C   1 
ATOM   431  O  O   . ALA A 1 58  ? -12.157 32.696 18.569  1.00 19.73 ? 58  ALA A O   1 
ATOM   432  C  CB  . ALA A 1 58  ? -10.954 35.724 18.088  1.00 19.07 ? 58  ALA A CB  1 
ATOM   433  N  N   . THR A 1 59  ? -10.023 32.621 17.957  1.00 18.31 ? 59  THR A N   1 
ATOM   434  C  CA  . THR A 1 59  ? -10.195 31.246 17.445  1.00 18.38 ? 59  THR A CA  1 
ATOM   435  C  C   . THR A 1 59  ? -10.532 30.214 18.543  1.00 19.82 ? 59  THR A C   1 
ATOM   436  O  O   . THR A 1 59  ? -11.381 29.349 18.332  1.00 19.77 ? 59  THR A O   1 
ATOM   437  C  CB  . THR A 1 59  ? -9.009  30.835 16.586  1.00 17.87 ? 59  THR A CB  1 
ATOM   438  O  OG1 . THR A 1 59  ? -8.881  31.806 15.520  1.00 17.26 ? 59  THR A OG1 1 
ATOM   439  C  CG2 . THR A 1 59  ? -9.240  29.409 15.949  1.00 17.14 ? 59  THR A CG2 1 
ATOM   440  N  N   . GLN A 1 60  ? -9.878  30.318 19.705  1.00 20.41 ? 60  GLN A N   1 
ATOM   441  C  CA  . GLN A 1 60  ? -10.231 29.488 20.870  1.00 22.45 ? 60  GLN A CA  1 
ATOM   442  C  C   . GLN A 1 60  ? -11.679 29.765 21.320  1.00 22.99 ? 60  GLN A C   1 
ATOM   443  O  O   . GLN A 1 60  ? -12.453 28.834 21.567  1.00 23.19 ? 60  GLN A O   1 
ATOM   444  C  CB  . GLN A 1 60  ? -9.213  29.707 22.011  1.00 23.61 ? 60  GLN A CB  1 
ATOM   445  C  CG  . GLN A 1 60  ? -9.602  29.112 23.376  1.00 27.18 ? 60  GLN A CG  1 
ATOM   446  C  CD  . GLN A 1 60  ? -10.415 30.111 24.193  0.80 29.00 ? 60  GLN A CD  1 
ATOM   447  O  OE1 . GLN A 1 60  ? -9.944  31.224 24.533  0.80 29.23 ? 60  GLN A OE1 1 
ATOM   448  N  NE2 . GLN A 1 60  ? -11.653 29.754 24.461  1.00 29.66 ? 60  GLN A NE2 1 
ATOM   449  N  N   . GLU A 1 61  ? -12.043 31.043 21.400  1.00 23.08 ? 61  GLU A N   1 
ATOM   450  C  CA  . GLU A 1 61  ? -13.380 31.448 21.865  1.00 25.72 ? 61  GLU A CA  1 
ATOM   451  C  C   . GLU A 1 61  ? -14.516 31.089 20.878  1.00 24.22 ? 61  GLU A C   1 
ATOM   452  O  O   . GLU A 1 61  ? -15.549 30.615 21.273  1.00 25.43 ? 61  GLU A O   1 
ATOM   453  C  CB  . GLU A 1 61  ? -13.430 32.956 22.174  1.00 27.96 ? 61  GLU A CB  1 
ATOM   454  C  CG  . GLU A 1 61  ? -12.498 33.418 23.312  1.00 30.92 ? 61  GLU A CG  1 
ATOM   455  C  CD  . GLU A 1 61  ? -12.528 34.936 23.527  1.00 34.45 ? 61  GLU A CD  1 
ATOM   456  O  OE1 . GLU A 1 61  ? -13.212 35.667 22.767  0.80 36.29 ? 61  GLU A OE1 1 
ATOM   457  O  OE2 . GLU A 1 61  ? -11.869 35.420 24.462  1.00 36.53 ? 61  GLU A OE2 1 
ATOM   458  N  N   . GLU A 1 62  ? -14.324 31.339 19.602  1.00 22.45 ? 62  GLU A N   1 
ATOM   459  C  CA  . GLU A 1 62  ? -15.409 31.141 18.630  1.00 22.48 ? 62  GLU A CA  1 
ATOM   460  C  C   . GLU A 1 62  ? -15.498 29.701 18.131  1.00 20.95 ? 62  GLU A C   1 
ATOM   461  O  O   . GLU A 1 62  ? -16.582 29.222 17.814  1.00 21.68 ? 62  GLU A O   1 
ATOM   462  C  CB  . GLU A 1 62  ? -15.254 32.135 17.467  1.00 22.26 ? 62  GLU A CB  1 
ATOM   463  C  CG  . GLU A 1 62  ? -15.238 33.603 17.918  1.00 25.72 ? 62  GLU A CG  1 
ATOM   464  C  CD  . GLU A 1 62  ? -16.508 34.015 18.658  1.00 29.24 ? 62  GLU A CD  1 
ATOM   465  O  OE1 . GLU A 1 62  ? -16.416 34.759 19.662  1.00 34.04 ? 62  GLU A OE1 1 
ATOM   466  O  OE2 . GLU A 1 62  ? -17.601 33.584 18.256  1.00 29.85 ? 62  GLU A OE2 1 
ATOM   467  N  N   . ALA A 1 63  ? -14.356 29.013 18.046  1.00 19.89 ? 63  ALA A N   1 
ATOM   468  C  CA  . ALA A 1 63  ? -14.314 27.676 17.405  1.00 18.68 ? 63  ALA A CA  1 
ATOM   469  C  C   . ALA A 1 63  ? -13.881 26.555 18.346  1.00 18.98 ? 63  ALA A C   1 
ATOM   470  O  O   . ALA A 1 63  ? -13.925 25.389 17.958  1.00 18.60 ? 63  ALA A O   1 
ATOM   471  C  CB  . ALA A 1 63  ? -13.407 27.709 16.159  1.00 16.46 ? 63  ALA A CB  1 
ATOM   472  N  N   . GLY A 1 64  ? -13.443 26.902 19.563  1.00 19.59 ? 64  GLY A N   1 
ATOM   473  C  CA  . GLY A 1 64  ? -12.973 25.908 20.529  1.00 20.51 ? 64  GLY A CA  1 
ATOM   474  C  C   . GLY A 1 64  ? -11.618 25.293 20.198  1.00 21.08 ? 64  GLY A C   1 
ATOM   475  O  O   . GLY A 1 64  ? -11.237 24.257 20.769  1.00 22.25 ? 64  GLY A O   1 
ATOM   476  N  N   . ILE A 1 65  ? -10.870 25.931 19.293  1.00 19.79 ? 65  ILE A N   1 
ATOM   477  C  CA  . ILE A 1 65  ? -9.565  25.433 18.871  1.00 19.45 ? 65  ILE A CA  1 
ATOM   478  C  C   . ILE A 1 65  ? -8.465  26.155 19.630  1.00 21.65 ? 65  ILE A C   1 
ATOM   479  O  O   . ILE A 1 65  ? -8.219  27.378 19.466  1.00 19.07 ? 65  ILE A O   1 
ATOM   480  C  CB  . ILE A 1 65  ? -9.326  25.628 17.353  1.00 18.66 ? 65  ILE A CB  1 
ATOM   481  C  CG1 . ILE A 1 65  ? -10.466 24.972 16.540  1.00 18.44 ? 65  ILE A CG1 1 
ATOM   482  C  CG2 . ILE A 1 65  ? -8.005  24.997 16.934  1.00 18.07 ? 65  ILE A CG2 1 
ATOM   483  C  CD1 . ILE A 1 65  ? -10.487 25.365 15.063  1.00 16.90 ? 65  ILE A CD1 1 
ATOM   484  N  N   . GLU A 1 66  ? -7.767  25.437 20.355  1.00 23.79 ? 66  GLU A N   1 
ATOM   485  C  CA  . GLU A 1 66  ? -6.707  25.834 21.273  1.00 26.57 ? 66  GLU A CA  1 
ATOM   486  C  C   . GLU A 1 66  ? -5.381  25.940 20.533  1.00 24.67 ? 66  GLU A C   1 
ATOM   487  O  O   . GLU A 1 66  ? -5.226  25.419 19.430  1.00 21.73 ? 66  GLU A O   1 
ATOM   488  C  CB  . GLU A 1 66  ? -6.660  24.843 22.452  1.00 32.29 ? 66  GLU A CB  1 
ATOM   489  C  CG  . GLU A 1 66  ? -7.970  24.946 23.231  1.00 41.89 ? 66  GLU A CG  1 
ATOM   490  C  CD  . GLU A 1 66  ? -8.107  23.930 24.335  1.00 51.16 ? 66  GLU A CD  1 
ATOM   491  O  OE1 . GLU A 1 66  ? -7.283  22.991 24.381  0.80 58.40 ? 66  GLU A OE1 1 
ATOM   492  O  OE2 . GLU A 1 66  ? -9.042  24.073 25.161  1.00 57.56 ? 66  GLU A OE2 1 
ATOM   493  N  N   . ALA A 1 67  ? -4.460  26.715 21.110  1.00 24.03 ? 67  ALA A N   1 
ATOM   494  C  CA  . ALA A 1 67  ? -3.209  27.036 20.418  1.00 23.97 ? 67  ALA A CA  1 
ATOM   495  C  C   . ALA A 1 67  ? -2.378  25.791 20.084  1.00 24.06 ? 67  ALA A C   1 
ATOM   496  O  O   . ALA A 1 67  ? -1.810  25.722 18.990  1.00 24.00 ? 67  ALA A O   1 
ATOM   497  C  CB  . ALA A 1 67  ? -2.392  28.055 21.218  1.00 24.62 ? 67  ALA A CB  1 
ATOM   498  N  N   . GLY A 1 68  ? -2.392  24.784 20.962  1.00 24.26 ? 68  GLY A N   1 
ATOM   499  C  CA  . GLY A 1 68  ? -1.718  23.497 20.702  1.00 25.95 ? 68  GLY A CA  1 
ATOM   500  C  C   . GLY A 1 68  ? -2.283  22.717 19.527  1.00 26.06 ? 68  GLY A C   1 
ATOM   501  O  O   . GLY A 1 68  ? -1.664  21.787 19.022  1.00 27.62 ? 68  GLY A O   1 
ATOM   502  N  N   . GLN A 1 69  ? -3.471  23.093 19.082  1.00 24.49 ? 69  GLN A N   1 
ATOM   503  C  CA  . GLN A 1 69  ? -4.122  22.383 17.984  1.00 26.02 ? 69  GLN A CA  1 
ATOM   504  C  C   . GLN A 1 69  ? -3.900  23.055 16.612  1.00 25.25 ? 69  GLN A C   1 
ATOM   505  O  O   . GLN A 1 69  ? -4.442  22.573 15.639  1.00 26.00 ? 69  GLN A O   1 
ATOM   506  C  CB  . GLN A 1 69  ? -5.640  22.231 18.261  1.00 26.69 ? 69  GLN A CB  1 
ATOM   507  C  CG  . GLN A 1 69  ? -5.956  21.424 19.521  1.00 30.48 ? 69  GLN A CG  1 
ATOM   508  C  CD  . GLN A 1 69  ? -7.415  21.497 20.004  1.00 31.97 ? 69  GLN A CD  1 
ATOM   509  O  OE1 . GLN A 1 69  ? -8.024  22.567 20.143  0.80 28.73 ? 69  GLN A OE1 1 
ATOM   510  N  NE2 . GLN A 1 69  ? -7.959  20.328 20.311  0.80 35.27 ? 69  GLN A NE2 1 
ATOM   511  N  N   . LEU A 1 70  ? -3.124  24.137 16.551  1.00 24.36 ? 70  LEU A N   1 
ATOM   512  C  CA  . LEU A 1 70  ? -3.012  25.007 15.363  1.00 25.54 ? 70  LEU A CA  1 
ATOM   513  C  C   . LEU A 1 70  ? -1.556  25.211 14.994  1.00 25.76 ? 70  LEU A C   1 
ATOM   514  O  O   . LEU A 1 70  ? -0.695  25.105 15.853  1.00 25.19 ? 70  LEU A O   1 
ATOM   515  C  CB  . LEU A 1 70  ? -3.475  26.439 15.686  1.00 26.23 ? 70  LEU A CB  1 
ATOM   516  C  CG  . LEU A 1 70  ? -4.919  26.704 15.944  1.00 27.43 ? 70  LEU A CG  1 
ATOM   517  C  CD1 . LEU A 1 70  ? -5.136  28.138 16.336  1.00 26.62 ? 70  LEU A CD1 1 
ATOM   518  C  CD2 . LEU A 1 70  ? -5.634  26.360 14.665  1.00 29.23 ? 70  LEU A CD2 1 
ATOM   519  N  N   . THR A 1 71  ? -1.290  25.547 13.740  1.00 24.35 ? 71  THR A N   1 
ATOM   520  C  CA  . THR A 1 71  ? 0.053   26.038 13.397  1.00 26.80 ? 71  THR A CA  1 
ATOM   521  C  C   . THR A 1 71  ? -0.157  27.255 12.515  1.00 24.41 ? 71  THR A C   1 
ATOM   522  O  O   . THR A 1 71  ? -0.798  27.133 11.461  1.00 22.58 ? 71  THR A O   1 
ATOM   523  C  CB  . THR A 1 71  ? 0.892   24.986 12.646  1.00 27.49 ? 71  THR A CB  1 
ATOM   524  O  OG1 . THR A 1 71  ? 1.042   23.840 13.476  1.00 30.53 ? 71  THR A OG1 1 
ATOM   525  C  CG2 . THR A 1 71  ? 2.310   25.538 12.291  1.00 29.50 ? 71  THR A CG2 1 
ATOM   526  N  N   . ILE A 1 72  ? 0.344   28.402 12.978  1.00 23.67 ? 72  ILE A N   1 
ATOM   527  C  CA  . ILE A 1 72  ? 0.373   29.643 12.210  1.00 24.00 ? 72  ILE A CA  1 
ATOM   528  C  C   . ILE A 1 72  ? 1.322   29.482 11.031  1.00 23.93 ? 72  ILE A C   1 
ATOM   529  O  O   . ILE A 1 72  ? 2.471   29.030 11.180  1.00 24.06 ? 72  ILE A O   1 
ATOM   530  C  CB  . ILE A 1 72  ? 0.830   30.871 13.046  1.00 26.47 ? 72  ILE A CB  1 
ATOM   531  C  CG1 . ILE A 1 72  ? -0.044  31.031 14.311  1.00 27.90 ? 72  ILE A CG1 1 
ATOM   532  C  CG2 . ILE A 1 72  ? 0.724   32.168 12.226  1.00 26.06 ? 72  ILE A CG2 1 
ATOM   533  C  CD1 . ILE A 1 72  ? -1.464  31.482 14.004  1.00 27.10 ? 72  ILE A CD1 1 
ATOM   534  N  N   . ILE A 1 73  ? 0.824   29.838 9.854   1.00 22.35 ? 73  ILE A N   1 
ATOM   535  C  CA  . ILE A 1 73  ? 1.621   29.733 8.649   1.00 22.08 ? 73  ILE A CA  1 
ATOM   536  C  C   . ILE A 1 73  ? 2.245   31.121 8.387   1.00 23.02 ? 73  ILE A C   1 
ATOM   537  O  O   . ILE A 1 73  ? 1.530   32.081 8.123   1.00 22.06 ? 73  ILE A O   1 
ATOM   538  C  CB  . ILE A 1 73  ? 0.775   29.238 7.452   1.00 21.03 ? 73  ILE A CB  1 
ATOM   539  C  CG1 . ILE A 1 73  ? -0.022  27.937 7.803   1.00 20.23 ? 73  ILE A CG1 1 
ATOM   540  C  CG2 . ILE A 1 73  ? 1.669   29.008 6.234   1.00 20.26 ? 73  ILE A CG2 1 
ATOM   541  C  CD1 . ILE A 1 73  ? 0.880   26.744 8.160   1.00 20.16 ? 73  ILE A CD1 1 
ATOM   542  N  N   . GLU A 1 74  ? 3.566   31.249 8.498   1.00 23.85 ? 74  GLU A N   1 
ATOM   543  C  CA  . GLU A 1 74  ? 4.178   32.573 8.399   1.00 24.70 ? 74  GLU A CA  1 
ATOM   544  C  C   . GLU A 1 74  ? 4.163   33.060 6.957   1.00 23.36 ? 74  GLU A C   1 
ATOM   545  O  O   . GLU A 1 74  ? 4.288   32.279 6.019   1.00 22.90 ? 74  GLU A O   1 
ATOM   546  C  CB  . GLU A 1 74  ? 5.634   32.574 8.910   1.00 28.86 ? 74  GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 74  ? 5.893   31.753 10.172  1.00 31.60 ? 74  GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 74  ? 5.477   32.454 11.449  0.50 32.40 ? 74  GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 74  ? 4.255   32.642 11.651  0.50 31.02 ? 74  GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 74  ? 6.375   32.790 12.264  0.50 33.84 ? 74  GLU A OE2 1 
ATOM   551  N  N   . GLY A 1 75  ? 4.026   34.363 6.789   1.00 22.48 ? 75  GLY A N   1 
ATOM   552  C  CA  . GLY A 1 75  ? 4.101   34.946 5.453   1.00 21.08 ? 75  GLY A CA  1 
ATOM   553  C  C   . GLY A 1 75  ? 2.792   35.395 4.842   1.00 20.67 ? 75  GLY A C   1 
ATOM   554  O  O   . GLY A 1 75  ? 2.805   36.054 3.790   1.00 20.67 ? 75  GLY A O   1 
ATOM   555  N  N   . PHE A 1 76  ? 1.666   35.082 5.490   1.00 18.39 ? 76  PHE A N   1 
ATOM   556  C  CA  . PHE A 1 76  ? 0.388   35.541 5.003   1.00 18.39 ? 76  PHE A CA  1 
ATOM   557  C  C   . PHE A 1 76  ? -0.359  36.374 6.045   1.00 18.39 ? 76  PHE A C   1 
ATOM   558  O  O   . PHE A 1 76  ? -0.538  35.966 7.182   1.00 18.86 ? 76  PHE A O   1 
ATOM   559  C  CB  . PHE A 1 76  ? -0.489  34.355 4.622   1.00 17.21 ? 76  PHE A CB  1 
ATOM   560  C  CG  . PHE A 1 76  ? -1.826  34.744 4.065   1.00 16.90 ? 76  PHE A CG  1 
ATOM   561  C  CD1 . PHE A 1 76  ? -1.963  34.980 2.691   1.00 17.28 ? 76  PHE A CD1 1 
ATOM   562  C  CD2 . PHE A 1 76  ? -2.944  34.856 4.899   1.00 16.23 ? 76  PHE A CD2 1 
ATOM   563  C  CE1 . PHE A 1 76  ? -3.189  35.323 2.137   1.00 17.35 ? 76  PHE A CE1 1 
ATOM   564  C  CE2 . PHE A 1 76  ? -4.161  35.202 4.367   1.00 16.99 ? 76  PHE A CE2 1 
ATOM   565  C  CZ  . PHE A 1 76  ? -4.290  35.424 2.979   1.00 17.66 ? 76  PHE A CZ  1 
ATOM   566  N  N   . LYS A 1 77  ? -0.827  37.524 5.621   1.00 18.38 ? 77  LYS A N   1 
ATOM   567  C  CA  . LYS A 1 77  ? -1.719  38.321 6.414   1.00 19.68 ? 77  LYS A CA  1 
ATOM   568  C  C   . LYS A 1 77  ? -2.576  39.124 5.466   1.00 18.85 ? 77  LYS A C   1 
ATOM   569  O  O   . LYS A 1 77  ? -2.124  39.506 4.389   1.00 19.21 ? 77  LYS A O   1 
ATOM   570  C  CB  . LYS A 1 77  ? -0.942  39.242 7.353   1.00 21.30 ? 77  LYS A CB  1 
ATOM   571  C  CG  . LYS A 1 77  ? -1.879  40.209 8.040   1.00 24.12 ? 77  LYS A CG  1 
ATOM   572  C  CD  . LYS A 1 77  ? -1.363  40.662 9.380   1.00 26.07 ? 77  LYS A CD  1 
ATOM   573  C  CE  . LYS A 1 77  ? -0.256  41.657 9.231   1.00 28.61 ? 77  LYS A CE  1 
ATOM   574  N  NZ  . LYS A 1 77  ? -0.506  42.775 10.197  1.00 30.38 ? 77  LYS A NZ  1 
ATOM   575  N  N   . ARG A 1 78  ? -3.829  39.322 5.831   1.00 19.11 ? 78  ARG A N   1 
ATOM   576  C  CA  . ARG A 1 78  ? -4.771  39.998 4.963   1.00 20.74 ? 78  ARG A CA  1 
ATOM   577  C  C   . ARG A 1 78  ? -5.716  40.831 5.813   1.00 22.12 ? 78  ARG A C   1 
ATOM   578  O  O   . ARG A 1 78  ? -6.396  40.326 6.741   1.00 20.64 ? 78  ARG A O   1 
ATOM   579  C  CB  . ARG A 1 78  ? -5.486  38.936 4.113   1.00 23.05 ? 78  ARG A CB  1 
ATOM   580  C  CG  . ARG A 1 78  ? -6.563  39.412 3.174   1.00 26.20 ? 78  ARG A CG  1 
ATOM   581  C  CD  . ARG A 1 78  ? -6.112  40.403 2.096   1.00 31.34 ? 78  ARG A CD  1 
ATOM   582  N  NE  . ARG A 1 78  ? -7.330  41.139 1.793   1.00 37.40 ? 78  ARG A NE  1 
ATOM   583  C  CZ  . ARG A 1 78  ? -7.915  41.283 0.609   1.00 39.17 ? 78  ARG A CZ  1 
ATOM   584  N  NH1 . ARG A 1 78  ? -7.339  40.851 -0.517  1.00 37.22 ? 78  ARG A NH1 1 
ATOM   585  N  NH2 . ARG A 1 78  ? -9.073  41.942 0.566   0.60 37.28 ? 78  ARG A NH2 1 
ATOM   586  N  N   . GLU A 1 79  ? -5.718  42.124 5.540   1.00 23.80 ? 79  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 79  ? -6.600  43.035 6.209   1.00 25.45 ? 79  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 79  ? -7.779  43.352 5.306   1.00 26.85 ? 79  GLU A C   1 
ATOM   589  O  O   . GLU A 1 79  ? -7.596  43.732 4.144   1.00 26.08 ? 79  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 79  ? -5.861  44.317 6.549   1.00 29.74 ? 79  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 79  ? -6.820  45.397 7.040   1.00 34.08 ? 79  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 79  ? -6.115  46.576 7.682   1.00 38.73 ? 79  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 79  ? -4.967  46.405 8.130   1.00 42.79 ? 79  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 79  ? -6.719  47.672 7.756   1.00 44.33 ? 79  GLU A OE2 1 
ATOM   595  N  N   . LEU A 1 80  ? -8.990  43.176 5.840   1.00 26.38 ? 80  LEU A N   1 
ATOM   596  C  CA  . LEU A 1 80  ? -10.222 43.484 5.142   1.00 26.81 ? 80  LEU A CA  1 
ATOM   597  C  C   . LEU A 1 80  ? -10.840 44.772 5.706   1.00 29.57 ? 80  LEU A C   1 
ATOM   598  O  O   . LEU A 1 80  ? -10.965 44.928 6.938   1.00 27.46 ? 80  LEU A O   1 
ATOM   599  C  CB  . LEU A 1 80  ? -11.210 42.316 5.291   1.00 26.73 ? 80  LEU A CB  1 
ATOM   600  C  CG  . LEU A 1 80  ? -11.082 41.019 4.475   1.00 26.65 ? 80  LEU A CG  1 
ATOM   601  C  CD1 . LEU A 1 80  ? -9.916  40.159 4.884   1.00 25.61 ? 80  LEU A CD1 1 
ATOM   602  C  CD2 . LEU A 1 80  ? -12.339 40.165 4.551   1.00 27.80 ? 80  LEU A CD2 1 
ATOM   603  N  N   . ASN A 1 81  ? -11.192 45.703 4.815   1.00 31.91 ? 81  ASN A N   1 
ATOM   604  C  CA  . ASN A 1 81  ? -11.921 46.919 5.198   1.00 36.86 ? 81  ASN A CA  1 
ATOM   605  C  C   . ASN A 1 81  ? -13.169 46.992 4.362   1.00 39.56 ? 81  ASN A C   1 
ATOM   606  O  O   . ASN A 1 81  ? -13.092 47.003 3.111   1.00 36.44 ? 81  ASN A O   1 
ATOM   607  C  CB  . ASN A 1 81  ? -11.113 48.214 4.987   1.00 37.99 ? 81  ASN A CB  1 
ATOM   608  C  CG  . ASN A 1 81  ? -9.764  48.177 5.674   1.00 38.96 ? 81  ASN A CG  1 
ATOM   609  O  OD1 . ASN A 1 81  ? -9.633  48.560 6.828   1.00 39.00 ? 81  ASN A OD1 1 
ATOM   610  N  ND2 . ASN A 1 81  ? -8.764  47.655 4.978   1.00 41.63 ? 81  ASN A ND2 1 
ATOM   611  N  N   . TYR A 1 82  ? -14.310 47.020 5.048   1.00 38.23 ? 82  TYR A N   1 
ATOM   612  C  CA  . TYR A 1 82  ? -15.594 47.074 4.372   1.00 41.31 ? 82  TYR A CA  1 
ATOM   613  C  C   . TYR A 1 82  ? -16.674 47.694 5.246   1.00 44.80 ? 82  TYR A C   1 
ATOM   614  O  O   . TYR A 1 82  ? -16.514 47.845 6.463   1.00 42.01 ? 82  TYR A O   1 
ATOM   615  C  CB  . TYR A 1 82  ? -16.009 45.681 3.885   1.00 39.61 ? 82  TYR A CB  1 
ATOM   616  C  CG  . TYR A 1 82  ? -16.105 44.634 4.980   1.00 39.03 ? 82  TYR A CG  1 
ATOM   617  C  CD1 . TYR A 1 82  ? -14.975 43.918 5.398   1.00 37.39 ? 82  TYR A CD1 1 
ATOM   618  C  CD2 . TYR A 1 82  ? -17.317 44.346 5.585   1.00 39.23 ? 82  TYR A CD2 1 
ATOM   619  C  CE1 . TYR A 1 82  ? -15.053 42.957 6.392   1.00 34.79 ? 82  TYR A CE1 1 
ATOM   620  C  CE2 . TYR A 1 82  ? -17.405 43.381 6.577   1.00 38.83 ? 82  TYR A CE2 1 
ATOM   621  C  CZ  . TYR A 1 82  ? -16.270 42.689 6.965   1.00 37.90 ? 82  TYR A CZ  1 
ATOM   622  O  OH  . TYR A 1 82  ? -16.353 41.732 7.957   1.00 38.43 ? 82  TYR A OH  1 
ATOM   623  N  N   . VAL A 1 83  ? -17.778 48.059 4.599   1.00 48.54 ? 83  VAL A N   1 
ATOM   624  C  CA  . VAL A 1 83  ? -18.920 48.637 5.291   1.00 52.62 ? 83  VAL A CA  1 
ATOM   625  C  C   . VAL A 1 83  ? -20.031 47.590 5.377   1.00 54.96 ? 83  VAL A C   1 
ATOM   626  O  O   . VAL A 1 83  ? -20.439 47.031 4.366   1.00 58.46 ? 83  VAL A O   1 
ATOM   627  C  CB  . VAL A 1 83  ? -19.412 49.921 4.582   1.00 54.75 ? 83  VAL A CB  1 
ATOM   628  C  CG1 . VAL A 1 83  ? -20.680 50.452 5.241   1.00 53.70 ? 83  VAL A CG1 1 
ATOM   629  C  CG2 . VAL A 1 83  ? -18.307 50.978 4.546   1.00 52.59 ? 83  VAL A CG2 1 
ATOM   630  N  N   . ALA A 1 84  ? -20.488 47.298 6.590   1.00 57.00 ? 84  ALA A N   1 
ATOM   631  C  CA  . ALA A 1 84  ? -21.609 46.384 6.785   1.00 57.05 ? 84  ALA A CA  1 
ATOM   632  C  C   . ALA A 1 84  ? -22.674 47.063 7.642   1.00 60.53 ? 84  ALA A C   1 
ATOM   633  O  O   . ALA A 1 84  ? -22.400 47.443 8.788   1.00 60.90 ? 84  ALA A O   1 
ATOM   634  C  CB  . ALA A 1 84  ? -21.148 45.088 7.427   1.00 50.97 ? 84  ALA A CB  1 
ATOM   635  N  N   . ARG A 1 85  ? -23.878 47.212 7.076   1.00 62.82 ? 85  ARG A N   1 
ATOM   636  C  CA  . ARG A 1 85  ? -25.036 47.815 7.768   1.00 63.51 ? 85  ARG A CA  1 
ATOM   637  C  C   . ARG A 1 85  ? -24.712 49.264 8.094   1.00 62.36 ? 85  ARG A C   1 
ATOM   638  O  O   . ARG A 1 85  ? -24.935 49.736 9.212   1.00 62.21 ? 85  ARG A O   1 
ATOM   639  C  CB  . ARG A 1 85  ? -25.412 47.046 9.047   1.00 65.08 ? 85  ARG A CB  1 
ATOM   640  C  CG  . ARG A 1 85  ? -25.757 45.575 8.845   1.00 69.18 ? 85  ARG A CG  1 
ATOM   641  C  CD  . ARG A 1 85  ? -25.945 44.860 10.179  1.00 72.34 ? 85  ARG A CD  1 
ATOM   642  N  NE  . ARG A 1 85  ? -27.152 45.305 10.884  1.00 75.70 ? 85  ARG A NE  1 
ATOM   643  C  CZ  . ARG A 1 85  ? -27.585 44.803 12.042  1.00 78.23 ? 85  ARG A CZ  1 
ATOM   644  N  NH1 . ARG A 1 85  ? -26.918 43.829 12.651  1.00 77.14 ? 85  ARG A NH1 1 
ATOM   645  N  NH2 . ARG A 1 85  ? -28.694 45.274 12.598  1.00 78.36 ? 85  ARG A NH2 1 
ATOM   646  N  N   . ASN A 1 86  ? -24.158 49.948 7.095   1.00 63.47 ? 86  ASN A N   1 
ATOM   647  C  CA  . ASN A 1 86  ? -23.748 51.350 7.185   1.00 62.55 ? 86  ASN A CA  1 
ATOM   648  C  C   . ASN A 1 86  ? -22.683 51.602 8.277   1.00 57.75 ? 86  ASN A C   1 
ATOM   649  O  O   . ASN A 1 86  ? -22.481 52.733 8.703   1.00 57.74 ? 86  ASN A O   1 
ATOM   650  C  CB  . ASN A 1 86  ? -24.978 52.278 7.339   1.00 68.93 ? 86  ASN A CB  1 
ATOM   651  C  CG  . ASN A 1 86  ? -26.129 51.915 6.396   1.00 73.66 ? 86  ASN A CG  1 
ATOM   652  O  OD1 . ASN A 1 86  ? -26.555 50.654 6.418   1.00 79.55 ? 86  ASN A OD1 1 
ATOM   653  N  ND2 . ASN A 1 86  ? -26.640 52.771 5.672   1.00 74.29 ? 86  ASN A ND2 1 
ATOM   654  N  N   . LYS A 1 87  ? -22.002 50.539 8.716   1.00 53.31 ? 87  LYS A N   1 
ATOM   655  C  CA  . LYS A 1 87  ? -20.919 50.648 9.708   1.00 50.22 ? 87  LYS A CA  1 
ATOM   656  C  C   . LYS A 1 87  ? -19.563 50.128 9.190   1.00 46.02 ? 87  LYS A C   1 
ATOM   657  O  O   . LYS A 1 87  ? -19.513 49.096 8.513   1.00 44.28 ? 87  LYS A O   1 
ATOM   658  C  CB  . LYS A 1 87  ? -21.293 49.942 11.018  1.00 51.32 ? 87  LYS A CB  1 
ATOM   659  C  CG  . LYS A 1 87  ? -22.508 50.526 11.741  1.00 54.30 ? 87  LYS A CG  1 
ATOM   660  C  CD  . LYS A 1 87  ? -22.668 49.985 13.164  1.00 55.70 ? 87  LYS A CD  1 
ATOM   661  C  CE  . LYS A 1 87  ? -22.293 48.510 13.306  0.50 55.54 ? 87  LYS A CE  1 
ATOM   662  N  NZ  . LYS A 1 87  ? -22.985 47.599 12.346  0.50 57.44 ? 87  LYS A NZ  1 
ATOM   663  N  N   . PRO A 1 88  ? -18.462 50.847 9.506   1.00 43.24 ? 88  PRO A N   1 
ATOM   664  C  CA  . PRO A 1 88  ? -17.128 50.421 9.043   1.00 40.80 ? 88  PRO A CA  1 
ATOM   665  C  C   . PRO A 1 88  ? -16.581 49.222 9.835   1.00 38.55 ? 88  PRO A C   1 
ATOM   666  O  O   . PRO A 1 88  ? -16.684 49.191 11.068  1.00 39.88 ? 88  PRO A O   1 
ATOM   667  C  CB  . PRO A 1 88  ? -16.250 51.657 9.263   1.00 41.92 ? 88  PRO A CB  1 
ATOM   668  C  CG  . PRO A 1 88  ? -16.982 52.513 10.270  1.00 45.06 ? 88  PRO A CG  1 
ATOM   669  C  CD  . PRO A 1 88  ? -18.428 52.098 10.294  1.00 44.82 ? 88  PRO A CD  1 
ATOM   670  N  N   . LYS A 1 89  ? -16.037 48.244 9.116   1.00 34.91 ? 89  LYS A N   1 
ATOM   671  C  CA  . LYS A 1 89  ? -15.430 47.068 9.730   1.00 33.47 ? 89  LYS A CA  1 
ATOM   672  C  C   . LYS A 1 89  ? -14.022 46.799 9.198   1.00 30.86 ? 89  LYS A C   1 
ATOM   673  O  O   . LYS A 1 89  ? -13.788 46.832 7.990   1.00 29.59 ? 89  LYS A O   1 
ATOM   674  C  CB  . LYS A 1 89  ? -16.314 45.837 9.517   1.00 34.49 ? 89  LYS A CB  1 
ATOM   675  C  CG  . LYS A 1 89  ? -17.805 46.121 9.608   1.00 36.75 ? 89  LYS A CG  1 
ATOM   676  C  CD  . LYS A 1 89  ? -18.367 45.692 10.954  1.00 38.24 ? 89  LYS A CD  1 
ATOM   677  C  CE  . LYS A 1 89  ? -19.838 46.056 11.079  1.00 41.76 ? 89  LYS A CE  1 
ATOM   678  N  NZ  . LYS A 1 89  ? -20.247 46.231 12.500  0.00 20.00 ? 89  LYS A NZ  1 
ATOM   679  N  N   . THR A 1 90  ? -13.091 46.524 10.107  1.00 28.38 ? 90  THR A N   1 
ATOM   680  C  CA  . THR A 1 90  ? -11.747 46.120 9.742   1.00 27.27 ? 90  THR A CA  1 
ATOM   681  C  C   . THR A 1 90  ? -11.506 44.776 10.400  1.00 25.28 ? 90  THR A C   1 
ATOM   682  O  O   . THR A 1 90  ? -11.728 44.638 11.609  1.00 26.35 ? 90  THR A O   1 
ATOM   683  C  CB  . THR A 1 90  ? -10.676 47.116 10.239  1.00 27.54 ? 90  THR A CB  1 
ATOM   684  O  OG1 . THR A 1 90  ? -10.934 48.406 9.683   1.00 30.15 ? 90  THR A OG1 1 
ATOM   685  C  CG2 . THR A 1 90  ? -9.281  46.671 9.797   1.00 25.99 ? 90  THR A CG2 1 
ATOM   686  N  N   . VAL A 1 91  ? -11.086 43.792 9.611   1.00 22.90 ? 91  VAL A N   1 
ATOM   687  C  CA  . VAL A 1 91  ? -10.718 42.492 10.140  1.00 21.31 ? 91  VAL A CA  1 
ATOM   688  C  C   . VAL A 1 91  ? -9.370  42.128 9.552   1.00 20.35 ? 91  VAL A C   1 
ATOM   689  O  O   . VAL A 1 91  ? -9.136  42.299 8.343   1.00 19.49 ? 91  VAL A O   1 
ATOM   690  C  CB  . VAL A 1 91  ? -11.704 41.363 9.774   1.00 22.00 ? 91  VAL A CB  1 
ATOM   691  C  CG1 . VAL A 1 91  ? -11.355 40.093 10.568  1.00 21.01 ? 91  VAL A CG1 1 
ATOM   692  C  CG2 . VAL A 1 91  ? -13.142 41.770 10.081  1.00 24.24 ? 91  VAL A CG2 1 
ATOM   693  N  N   . ILE A 1 92  ? -8.481  41.659 10.418  1.00 18.98 ? 92  ILE A N   1 
ATOM   694  C  CA  . ILE A 1 92  ? -7.159  41.204 9.976   1.00 18.31 ? 92  ILE A CA  1 
ATOM   695  C  C   . ILE A 1 92  ? -7.090  39.675 10.150  1.00 16.25 ? 92  ILE A C   1 
ATOM   696  O  O   . ILE A 1 92  ? -7.372  39.187 11.247  1.00 15.26 ? 92  ILE A O   1 
ATOM   697  C  CB  . ILE A 1 92  ? -6.062  41.787 10.875  1.00 19.78 ? 92  ILE A CB  1 
ATOM   698  C  CG1 . ILE A 1 92  ? -6.227  43.306 11.088  1.00 22.13 ? 92  ILE A CG1 1 
ATOM   699  C  CG2 . ILE A 1 92  ? -4.701  41.407 10.312  1.00 19.09 ? 92  ILE A CG2 1 
ATOM   700  C  CD1 . ILE A 1 92  ? -6.124  44.061 9.802   1.00 24.67 ? 92  ILE A CD1 1 
ATOM   701  N  N   . TYR A 1 93  ? -6.712  38.929 9.112   1.00 14.42 ? 93  TYR A N   1 
ATOM   702  C  CA  . TYR A 1 93  ? -6.631  37.490 9.220   1.00 13.71 ? 93  TYR A CA  1 
ATOM   703  C  C   . TYR A 1 93  ? -5.204  37.010 8.988   1.00 14.25 ? 93  TYR A C   1 
ATOM   704  O  O   . TYR A 1 93  ? -4.496  37.510 8.073   1.00 13.16 ? 93  TYR A O   1 
ATOM   705  C  CB  . TYR A 1 93  ? -7.511  36.829 8.145   1.00 14.10 ? 93  TYR A CB  1 
ATOM   706  C  CG  . TYR A 1 93  ? -9.000  36.858 8.422   1.00 14.76 ? 93  TYR A CG  1 
ATOM   707  C  CD1 . TYR A 1 93  ? -9.551  36.019 9.378   1.00 15.03 ? 93  TYR A CD1 1 
ATOM   708  C  CD2 . TYR A 1 93  ? -9.850  37.712 7.705   1.00 15.76 ? 93  TYR A CD2 1 
ATOM   709  C  CE1 . TYR A 1 93  ? -10.916 36.018 9.639   1.00 16.03 ? 93  TYR A CE1 1 
ATOM   710  C  CE2 . TYR A 1 93  ? -11.231 37.712 7.932   1.00 16.88 ? 93  TYR A CE2 1 
ATOM   711  C  CZ  . TYR A 1 93  ? -11.750 36.867 8.918   1.00 17.00 ? 93  TYR A CZ  1 
ATOM   712  O  OH  . TYR A 1 93  ? -13.090 36.861 9.209   1.00 17.69 ? 93  TYR A OH  1 
ATOM   713  N  N   . TRP A 1 94  ? -4.800  36.021 9.786   1.00 13.75 ? 94  TRP A N   1 
ATOM   714  C  CA  . TRP A 1 94  ? -3.651  35.221 9.463   1.00 14.43 ? 94  TRP A CA  1 
ATOM   715  C  C   . TRP A 1 94  ? -4.171  33.881 9.038   1.00 14.90 ? 94  TRP A C   1 
ATOM   716  O  O   . TRP A 1 94  ? -5.372  33.618 9.039   1.00 14.87 ? 94  TRP A O   1 
ATOM   717  C  CB  . TRP A 1 94  ? -2.724  35.026 10.677  1.00 15.10 ? 94  TRP A CB  1 
ATOM   718  C  CG  . TRP A 1 94  ? -1.883  36.238 11.029  1.00 16.19 ? 94  TRP A CG  1 
ATOM   719  C  CD1 . TRP A 1 94  ? -0.530  36.459 10.726  1.00 17.16 ? 94  TRP A CD1 1 
ATOM   720  C  CD2 . TRP A 1 94  ? -2.312  37.442 11.738  1.00 16.72 ? 94  TRP A CD2 1 
ATOM   721  N  NE1 . TRP A 1 94  ? -0.118  37.676 11.182  1.00 17.41 ? 94  TRP A NE1 1 
ATOM   722  C  CE2 . TRP A 1 94  ? -1.132  38.310 11.823  1.00 18.04 ? 94  TRP A CE2 1 
ATOM   723  C  CE3 . TRP A 1 94  ? -3.509  37.864 12.325  1.00 17.33 ? 94  TRP A CE3 1 
ATOM   724  C  CZ2 . TRP A 1 94  ? -1.161  39.535 12.485  1.00 18.52 ? 94  TRP A CZ2 1 
ATOM   725  C  CZ3 . TRP A 1 94  ? -3.529  39.118 12.966  1.00 17.99 ? 94  TRP A CZ3 1 
ATOM   726  C  CH2 . TRP A 1 94  ? -2.385  39.930 13.035  1.00 18.75 ? 94  TRP A CH2 1 
ATOM   727  N  N   . LEU A 1 95  ? -3.257  32.988 8.755   1.00 15.08 ? 95  LEU A N   1 
ATOM   728  C  CA  . LEU A 1 95  ? -3.615  31.734 8.206   1.00 16.12 ? 95  LEU A CA  1 
ATOM   729  C  C   . LEU A 1 95  ? -3.108  30.683 9.169   1.00 17.06 ? 95  LEU A C   1 
ATOM   730  O  O   . LEU A 1 95  ? -1.989  30.812 9.674   1.00 17.55 ? 95  LEU A O   1 
ATOM   731  C  CB  . LEU A 1 95  ? -2.878  31.594 6.902   1.00 17.48 ? 95  LEU A CB  1 
ATOM   732  C  CG  . LEU A 1 95  ? -3.173  30.452 5.946   1.00 19.45 ? 95  LEU A CG  1 
ATOM   733  C  CD1 . LEU A 1 95  ? -4.630  30.453 5.477   1.00 17.89 ? 95  LEU A CD1 1 
ATOM   734  C  CD2 . LEU A 1 95  ? -2.272  30.651 4.708   1.00 19.87 ? 95  LEU A CD2 1 
ATOM   735  N  N   . ALA A 1 96  ? -3.916  29.675 9.466   1.00 16.63 ? 96  ALA A N   1 
ATOM   736  C  CA  . ALA A 1 96  ? -3.455  28.603 10.351  1.00 16.04 ? 96  ALA A CA  1 
ATOM   737  C  C   . ALA A 1 96  ? -4.019  27.235 10.010  1.00 15.75 ? 96  ALA A C   1 
ATOM   738  O  O   . ALA A 1 96  ? -5.204  27.090 9.706   1.00 15.24 ? 96  ALA A O   1 
ATOM   739  C  CB  . ALA A 1 96  ? -3.787  28.956 11.804  1.00 16.02 ? 96  ALA A CB  1 
ATOM   740  N  N   . GLU A 1 97  ? -3.160  26.227 10.106  1.00 16.57 ? 97  GLU A N   1 
ATOM   741  C  CA  . GLU A 1 97  ? -3.511  24.841 9.835   1.00 17.67 ? 97  GLU A CA  1 
ATOM   742  C  C   . GLU A 1 97  ? -3.859  24.116 11.134  1.00 17.94 ? 97  GLU A C   1 
ATOM   743  O  O   . GLU A 1 97  ? -3.112  24.211 12.105  1.00 18.27 ? 97  GLU A O   1 
ATOM   744  C  CB  . GLU A 1 97  ? -2.337  24.087 9.227   1.00 19.17 ? 97  GLU A CB  1 
ATOM   745  C  CG  . GLU A 1 97  ? -2.781  22.736 8.662   1.00 20.70 ? 97  GLU A CG  1 
ATOM   746  C  CD  . GLU A 1 97  ? -1.660  21.961 7.984   1.00 23.29 ? 97  GLU A CD  1 
ATOM   747  O  OE1 . GLU A 1 97  ? -0.569  22.488 7.789   1.00 24.28 ? 97  GLU A OE1 1 
ATOM   748  O  OE2 . GLU A 1 97  ? -1.863  20.781 7.667   1.00 27.24 ? 97  GLU A OE2 1 
ATOM   749  N  N   . VAL A 1 98  ? -4.970  23.392 11.159  1.00 17.87 ? 98  VAL A N   1 
ATOM   750  C  CA  . VAL A 1 98  ? -5.228  22.509 12.323  1.00 19.56 ? 98  VAL A CA  1 
ATOM   751  C  C   . VAL A 1 98  ? -4.326  21.265 12.292  1.00 21.27 ? 98  VAL A C   1 
ATOM   752  O  O   . VAL A 1 98  ? -4.041  20.717 11.242  1.00 21.75 ? 98  VAL A O   1 
ATOM   753  C  CB  . VAL A 1 98  ? -6.715  22.200 12.528  1.00 18.62 ? 98  VAL A CB  1 
ATOM   754  C  CG1 . VAL A 1 98  ? -7.478  23.517 12.724  1.00 17.95 ? 98  VAL A CG1 1 
ATOM   755  C  CG2 . VAL A 1 98  ? -7.291  21.463 11.327  1.00 18.55 ? 98  VAL A CG2 1 
ATOM   756  N  N   . LYS A 1 99  ? -3.853  20.856 13.465  1.00 24.06 ? 99  LYS A N   1 
ATOM   757  C  CA  . LYS A 1 99  ? -3.006  19.670 13.588  1.00 27.70 ? 99  LYS A CA  1 
ATOM   758  C  C   . LYS A 1 99  ? -3.726  18.376 13.201  1.00 27.49 ? 99  LYS A C   1 
ATOM   759  O  O   . LYS A 1 99  ? -3.151  17.503 12.551  1.00 28.00 ? 99  LYS A O   1 
ATOM   760  C  CB  . LYS A 1 99  ? -2.454  19.554 15.011  1.00 31.25 ? 99  LYS A CB  1 
ATOM   761  C  CG  . LYS A 1 99  ? -1.005  19.988 15.152  1.00 36.93 ? 99  LYS A CG  1 
ATOM   762  C  CD  . LYS A 1 99  ? -0.891  21.289 15.929  1.00 36.33 ? 99  LYS A CD  1 
ATOM   763  C  CE  . LYS A 1 99  ? 0.562   21.686 16.133  1.00 39.26 ? 99  LYS A CE  1 
ATOM   764  N  NZ  . LYS A 1 99  ? 1.426   21.225 15.012  0.30 32.95 ? 99  LYS A NZ  1 
ATOM   765  N  N   . ASP A 1 100 ? -4.984  18.265 13.614  1.00 27.03 ? 100 ASP A N   1 
ATOM   766  C  CA  . ASP A 1 100 ? -5.780  17.062 13.411  1.00 26.91 ? 100 ASP A CA  1 
ATOM   767  C  C   . ASP A 1 100 ? -7.030  17.369 12.585  1.00 24.53 ? 100 ASP A C   1 
ATOM   768  O  O   . ASP A 1 100 ? -7.805  18.262 12.916  1.00 22.53 ? 100 ASP A O   1 
ATOM   769  C  CB  . ASP A 1 100 ? -6.206  16.507 14.771  1.00 28.78 ? 100 ASP A CB  1 
ATOM   770  C  CG  . ASP A 1 100 ? -5.012  16.072 15.642  1.00 33.24 ? 100 ASP A CG  1 
ATOM   771  O  OD1 . ASP A 1 100 ? -3.906  15.851 15.116  1.00 35.52 ? 100 ASP A OD1 1 
ATOM   772  O  OD2 . ASP A 1 100 ? -5.195  15.901 16.869  1.00 36.70 ? 100 ASP A OD2 1 
ATOM   773  N  N   . TYR A 1 101 ? -7.215  16.621 11.507  1.00 24.66 ? 101 TYR A N   1 
ATOM   774  C  CA  . TYR A 1 101 ? -8.425  16.694 10.664  1.00 23.59 ? 101 TYR A CA  1 
ATOM   775  C  C   . TYR A 1 101 ? -9.720  16.675 11.489  1.00 23.63 ? 101 TYR A C   1 
ATOM   776  O  O   . TYR A 1 101 ? -10.661 17.416 11.194  1.00 22.38 ? 101 TYR A O   1 
ATOM   777  C  CB  . TYR A 1 101 ? -8.392  15.496 9.740   1.00 24.34 ? 101 TYR A CB  1 
ATOM   778  C  CG  . TYR A 1 101 ? -9.519  15.378 8.749   1.00 24.05 ? 101 TYR A CG  1 
ATOM   779  C  CD1 . TYR A 1 101 ? -10.721 14.748 9.104   1.00 24.40 ? 101 TYR A CD1 1 
ATOM   780  C  CD2 . TYR A 1 101 ? -9.367  15.832 7.457   1.00 23.63 ? 101 TYR A CD2 1 
ATOM   781  C  CE1 . TYR A 1 101 ? -11.744 14.597 8.193   1.00 24.55 ? 101 TYR A CE1 1 
ATOM   782  C  CE2 . TYR A 1 101 ? -10.382 15.672 6.521   1.00 24.62 ? 101 TYR A CE2 1 
ATOM   783  C  CZ  . TYR A 1 101 ? -11.563 15.046 6.902   1.00 24.54 ? 101 TYR A CZ  1 
ATOM   784  O  OH  . TYR A 1 101 ? -12.565 14.879 5.997   1.00 25.17 ? 101 TYR A OH  1 
ATOM   785  N  N   . ASP A 1 102 ? -9.730  15.854 12.540  1.00 24.90 ? 102 ASP A N   1 
ATOM   786  C  CA  . ASP A 1 102 ? -10.894 15.613 13.366  1.00 26.08 ? 102 ASP A CA  1 
ATOM   787  C  C   . ASP A 1 102 ? -10.979 16.556 14.597  1.00 26.57 ? 102 ASP A C   1 
ATOM   788  O  O   . ASP A 1 102 ? -11.749 16.278 15.528  1.00 27.51 ? 102 ASP A O   1 
ATOM   789  C  CB  . ASP A 1 102 ? -10.890 14.137 13.842  1.00 28.81 ? 102 ASP A CB  1 
ATOM   790  C  CG  . ASP A 1 102 ? -9.956  13.914 15.051  1.00 32.58 ? 102 ASP A CG  1 
ATOM   791  O  OD1 . ASP A 1 102 ? -9.035  14.742 15.302  1.00 31.83 ? 102 ASP A OD1 1 
ATOM   792  O  OD2 . ASP A 1 102 ? -10.148 12.922 15.771  0.80 35.02 ? 102 ASP A OD2 1 
ATOM   793  N  N   . VAL A 1 103 ? -10.189 17.635 14.628  1.00 24.74 ? 103 VAL A N   1 
ATOM   794  C  CA  . VAL A 1 103 ? -10.243 18.604 15.743  1.00 23.78 ? 103 VAL A CA  1 
ATOM   795  C  C   . VAL A 1 103 ? -11.697 18.938 16.090  1.00 23.93 ? 103 VAL A C   1 
ATOM   796  O  O   . VAL A 1 103 ? -12.521 19.165 15.196  1.00 22.38 ? 103 VAL A O   1 
ATOM   797  C  CB  . VAL A 1 103 ? -9.450  19.909 15.427  1.00 22.60 ? 103 VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 103 ? -9.984  20.606 14.180  1.00 21.15 ? 103 VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 103 ? -9.473  20.879 16.597  1.00 21.87 ? 103 VAL A CG2 1 
ATOM   800  N  N   . GLU A 1 104 ? -12.008 18.948 17.383  1.00 24.01 ? 104 GLU A N   1 
ATOM   801  C  CA  . GLU A 1 104 ? -13.356 19.198 17.825  1.00 26.23 ? 104 GLU A CA  1 
ATOM   802  C  C   . GLU A 1 104 ? -13.696 20.673 17.704  1.00 25.52 ? 104 GLU A C   1 
ATOM   803  O  O   . GLU A 1 104 ? -13.036 21.535 18.314  1.00 24.15 ? 104 GLU A O   1 
ATOM   804  C  CB  . GLU A 1 104 ? -13.558 18.734 19.278  1.00 29.04 ? 104 GLU A CB  1 
ATOM   805  C  CG  . GLU A 1 104 ? -14.974 19.024 19.773  1.00 31.50 ? 104 GLU A CG  1 
ATOM   806  C  CD  . GLU A 1 104 ? -15.293 18.506 21.185  0.80 35.88 ? 104 GLU A CD  1 
ATOM   807  O  OE1 . GLU A 1 104 ? -14.376 18.087 21.941  1.00 38.34 ? 104 GLU A OE1 1 
ATOM   808  O  OE2 . GLU A 1 104 ? -16.491 18.549 21.557  1.00 38.63 ? 104 GLU A OE2 1 
ATOM   809  N  N   . ILE A 1 105 ? -14.725 20.986 16.932  1.00 23.80 ? 105 ILE A N   1 
ATOM   810  C  CA  . ILE A 1 105 ? -15.135 22.382 16.827  1.00 22.72 ? 105 ILE A CA  1 
ATOM   811  C  C   . ILE A 1 105 ? -16.206 22.620 17.884  1.00 24.95 ? 105 ILE A C   1 
ATOM   812  O  O   . ILE A 1 105 ? -17.201 21.894 17.909  1.00 24.97 ? 105 ILE A O   1 
ATOM   813  C  CB  . ILE A 1 105 ? -15.670 22.701 15.401  1.00 21.12 ? 105 ILE A CB  1 
ATOM   814  C  CG1 . ILE A 1 105 ? -14.582 22.400 14.329  1.00 20.01 ? 105 ILE A CG1 1 
ATOM   815  C  CG2 . ILE A 1 105 ? -16.219 24.127 15.348  1.00 19.02 ? 105 ILE A CG2 1 
ATOM   816  C  CD1 . ILE A 1 105 ? -13.267 23.145 14.504  1.00 19.26 ? 105 ILE A CD1 1 
ATOM   817  N  N   . ARG A 1 106 ? -16.003 23.595 18.784  1.00 24.66 ? 106 ARG A N   1 
ATOM   818  C  CA  . ARG A 1 106 ? -17.052 23.904 19.778  1.00 25.74 ? 106 ARG A CA  1 
ATOM   819  C  C   . ARG A 1 106 ? -17.446 25.354 19.632  1.00 25.16 ? 106 ARG A C   1 
ATOM   820  O  O   . ARG A 1 106 ? -16.606 26.245 19.790  1.00 24.07 ? 106 ARG A O   1 
ATOM   821  C  CB  . ARG A 1 106 ? -16.586 23.656 21.214  1.00 28.27 ? 106 ARG A CB  1 
ATOM   822  C  CG  . ARG A 1 106 ? -15.564 22.549 21.379  1.00 30.13 ? 106 ARG A CG  1 
ATOM   823  C  CD  . ARG A 1 106 ? -16.034 21.503 22.379  0.40 33.42 ? 106 ARG A CD  1 
ATOM   824  N  NE  . ARG A 1 106 ? -16.535 22.035 23.644  0.40 35.96 ? 106 ARG A NE  1 
ATOM   825  C  CZ  . ARG A 1 106 ? -17.373 21.379 24.448  0.40 39.24 ? 106 ARG A CZ  1 
ATOM   826  N  NH1 . ARG A 1 106 ? -17.810 20.158 24.123  1.00 42.55 ? 106 ARG A NH1 1 
ATOM   827  N  NH2 . ARG A 1 106 ? -17.774 21.936 25.581  0.40 39.50 ? 106 ARG A NH2 1 
ATOM   828  N  N   . LEU A 1 107 ? -18.709 25.599 19.317  1.00 23.42 ? 107 LEU A N   1 
ATOM   829  C  CA  . LEU A 1 107 ? -19.150 26.956 19.057  1.00 24.24 ? 107 LEU A CA  1 
ATOM   830  C  C   . LEU A 1 107 ? -19.598 27.642 20.360  1.00 26.04 ? 107 LEU A C   1 
ATOM   831  O  O   . LEU A 1 107 ? -19.952 26.980 21.319  1.00 28.02 ? 107 LEU A O   1 
ATOM   832  C  CB  . LEU A 1 107 ? -20.270 26.939 18.015  1.00 23.15 ? 107 LEU A CB  1 
ATOM   833  C  CG  . LEU A 1 107 ? -19.849 26.211 16.726  1.00 23.01 ? 107 LEU A CG  1 
ATOM   834  C  CD1 . LEU A 1 107 ? -21.037 25.984 15.774  1.00 22.47 ? 107 LEU A CD1 1 
ATOM   835  C  CD2 . LEU A 1 107 ? -18.702 26.957 16.054  1.00 20.78 ? 107 LEU A CD2 1 
ATOM   836  N  N   . SER A 1 108 ? -19.554 28.962 20.389  1.00 26.49 ? 108 SER A N   1 
ATOM   837  C  CA  . SER A 1 108 ? -20.210 29.725 21.436  1.00 28.91 ? 108 SER A CA  1 
ATOM   838  C  C   . SER A 1 108 ? -21.596 30.134 20.920  1.00 30.21 ? 108 SER A C   1 
ATOM   839  O  O   . SER A 1 108 ? -21.956 29.830 19.778  1.00 28.57 ? 108 SER A O   1 
ATOM   840  C  CB  . SER A 1 108 ? -19.371 30.969 21.777  1.00 28.68 ? 108 SER A CB  1 
ATOM   841  O  OG  . SER A 1 108 ? -19.313 31.857 20.666  1.00 26.88 ? 108 SER A OG  1 
ATOM   842  N  N   . HIS A 1 109 ? -22.356 30.830 21.767  1.00 33.79 ? 109 HIS A N   1 
ATOM   843  C  CA  . HIS A 1 109 ? -23.648 31.451 21.406  1.00 35.34 ? 109 HIS A CA  1 
ATOM   844  C  C   . HIS A 1 109 ? -23.600 32.318 20.139  1.00 33.56 ? 109 HIS A C   1 
ATOM   845  O  O   . HIS A 1 109 ? -24.613 32.505 19.462  1.00 33.74 ? 109 HIS A O   1 
ATOM   846  C  CB  . HIS A 1 109 ? -24.129 32.298 22.591  1.00 40.02 ? 109 HIS A CB  1 
ATOM   847  C  CG  . HIS A 1 109 ? -23.241 33.485 22.873  0.07 44.09 ? 109 HIS A CG  1 
ATOM   848  N  ND1 . HIS A 1 109 ? -22.146 33.401 23.660  0.87 47.21 ? 109 HIS A ND1 1 
ATOM   849  C  CD2 . HIS A 1 109 ? -23.298 34.800 22.405  1.00 47.06 ? 109 HIS A CD2 1 
ATOM   850  C  CE1 . HIS A 1 109 ? -21.537 34.610 23.709  0.70 49.46 ? 109 HIS A CE1 1 
ATOM   851  N  NE2 . HIS A 1 109 ? -22.245 35.466 22.940  0.70 50.59 ? 109 HIS A NE2 1 
ATOM   852  N  N   . GLU A 1 110 ? -22.427 32.852 19.800  1.00 31.94 ? 110 GLU A N   1 
ATOM   853  C  CA  . GLU A 1 110 ? -22.283 33.721 18.616  1.00 30.55 ? 110 GLU A CA  1 
ATOM   854  C  C   . GLU A 1 110 ? -22.482 32.973 17.285  1.00 29.20 ? 110 GLU A C   1 
ATOM   855  O  O   . GLU A 1 110 ? -22.806 33.594 16.271  1.00 28.16 ? 110 GLU A O   1 
ATOM   856  C  CB  . GLU A 1 110 ? -20.931 34.438 18.608  1.00 30.60 ? 110 GLU A CB  1 
ATOM   857  C  CG  . GLU A 1 110 ? -20.814 35.620 19.561  1.00 35.44 ? 110 GLU A CG  1 
ATOM   858  C  CD  . GLU A 1 110 ? -19.599 36.495 19.269  0.50 35.35 ? 110 GLU A CD  1 
ATOM   859  O  OE1 . GLU A 1 110 ? -19.325 36.749 18.075  0.50 35.07 ? 110 GLU A OE1 1 
ATOM   860  O  OE2 . GLU A 1 110 ? -18.920 36.930 20.227  0.50 35.85 ? 110 GLU A OE2 1 
ATOM   861  N  N   . HIS A 1 111 ? -22.305 31.643 17.285  1.00 27.19 ? 111 HIS A N   1 
ATOM   862  C  CA  . HIS A 1 111 ? -22.392 30.871 16.019  1.00 26.60 ? 111 HIS A CA  1 
ATOM   863  C  C   . HIS A 1 111 ? -23.263 29.657 16.130  1.00 26.87 ? 111 HIS A C   1 
ATOM   864  O  O   . HIS A 1 111 ? -23.338 29.034 17.187  1.00 28.29 ? 111 HIS A O   1 
ATOM   865  C  CB  . HIS A 1 111 ? -20.992 30.562 15.463  1.00 22.99 ? 111 HIS A CB  1 
ATOM   866  C  CG  . HIS A 1 111 ? -20.187 31.810 15.151  1.00 22.61 ? 111 HIS A CG  1 
ATOM   867  N  ND1 . HIS A 1 111 ? -19.373 32.404 16.060  1.00 23.26 ? 111 HIS A ND1 1 
ATOM   868  C  CD2 . HIS A 1 111 ? -20.122 32.598 13.994  1.00 22.48 ? 111 HIS A CD2 1 
ATOM   869  C  CE1 . HIS A 1 111 ? -18.807 33.505 15.513  1.00 22.22 ? 111 HIS A CE1 1 
ATOM   870  N  NE2 . HIS A 1 111 ? -19.265 33.624 14.252  1.00 22.29 ? 111 HIS A NE2 1 
ATOM   871  N  N   . GLN A 1 112 ? -23.948 29.307 15.048  1.00 26.70 ? 112 GLN A N   1 
ATOM   872  C  CA  . GLN A 1 112 ? -24.907 28.220 15.131  1.00 27.09 ? 112 GLN A CA  1 
ATOM   873  C  C   . GLN A 1 112 ? -24.483 26.994 14.321  1.00 26.01 ? 112 GLN A C   1 
ATOM   874  O  O   . GLN A 1 112 ? -25.037 25.928 14.491  1.00 27.88 ? 112 GLN A O   1 
ATOM   875  C  CB  . GLN A 1 112 ? -26.295 28.702 14.708  1.00 29.46 ? 112 GLN A CB  1 
ATOM   876  C  CG  . GLN A 1 112 ? -26.357 29.155 13.255  1.00 31.94 ? 112 GLN A CG  1 
ATOM   877  C  CD  . GLN A 1 112 ? -27.744 29.631 12.844  1.00 35.35 ? 112 GLN A CD  1 
ATOM   878  O  OE1 . GLN A 1 112 ? -28.440 30.290 13.755  1.00 36.56 ? 112 GLN A OE1 1 
ATOM   879  N  NE2 . GLN A 1 112 ? -28.175 29.406 11.711  1.00 35.09 ? 112 GLN A NE2 1 
ATOM   880  N  N   . ALA A 1 113 ? -23.526 27.129 13.411  1.00 23.84 ? 113 ALA A N   1 
ATOM   881  C  CA  . ALA A 1 113 ? -23.073 25.947 12.676  1.00 21.89 ? 113 ALA A CA  1 
ATOM   882  C  C   . ALA A 1 113 ? -21.677 26.171 12.145  1.00 20.08 ? 113 ALA A C   1 
ATOM   883  O  O   . ALA A 1 113 ? -21.192 27.299 12.138  1.00 18.97 ? 113 ALA A O   1 
ATOM   884  C  CB  . ALA A 1 113 ? -24.042 25.601 11.534  1.00 22.76 ? 113 ALA A CB  1 
ATOM   885  N  N   . TYR A 1 114 ? -21.041 25.101 11.654  1.00 19.58 ? 114 TYR A N   1 
ATOM   886  C  CA  . TYR A 1 114 ? -19.776 25.261 10.939  1.00 18.26 ? 114 TYR A CA  1 
ATOM   887  C  C   . TYR A 1 114 ? -19.717 24.306 9.740   1.00 18.43 ? 114 TYR A C   1 
ATOM   888  O  O   . TYR A 1 114 ? -20.433 23.289 9.707   1.00 18.25 ? 114 TYR A O   1 
ATOM   889  C  CB  . TYR A 1 114 ? -18.594 25.032 11.881  1.00 17.53 ? 114 TYR A CB  1 
ATOM   890  C  CG  . TYR A 1 114 ? -18.343 23.585 12.242  1.00 18.51 ? 114 TYR A CG  1 
ATOM   891  C  CD1 . TYR A 1 114 ? -17.533 22.800 11.442  1.00 18.83 ? 114 TYR A CD1 1 
ATOM   892  C  CD2 . TYR A 1 114 ? -18.949 22.998 13.387  1.00 19.50 ? 114 TYR A CD2 1 
ATOM   893  C  CE1 . TYR A 1 114 ? -17.302 21.463 11.751  1.00 20.55 ? 114 TYR A CE1 1 
ATOM   894  C  CE2 . TYR A 1 114 ? -18.703 21.665 13.724  1.00 20.74 ? 114 TYR A CE2 1 
ATOM   895  C  CZ  . TYR A 1 114 ? -17.875 20.919 12.894  1.00 21.57 ? 114 TYR A CZ  1 
ATOM   896  O  OH  . TYR A 1 114 ? -17.596 19.613 13.166  1.00 24.43 ? 114 TYR A OH  1 
ATOM   897  N  N   . ARG A 1 115 ? -18.869 24.655 8.765   1.00 17.02 ? 115 ARG A N   1 
ATOM   898  C  CA  . ARG A 1 115 ? -18.574 23.784 7.618   1.00 18.48 ? 115 ARG A CA  1 
ATOM   899  C  C   . ARG A 1 115 ? -17.082 23.859 7.332   1.00 16.79 ? 115 ARG A C   1 
ATOM   900  O  O   . ARG A 1 115 ? -16.447 24.918 7.545   1.00 14.97 ? 115 ARG A O   1 
ATOM   901  C  CB  . ARG A 1 115 ? -19.344 24.201 6.334   1.00 21.00 ? 115 ARG A CB  1 
ATOM   902  C  CG  . ARG A 1 115 ? -20.869 24.310 6.441   1.00 24.61 ? 115 ARG A CG  1 
ATOM   903  C  CD  . ARG A 1 115 ? -21.627 22.994 6.276   1.00 28.58 ? 115 ARG A CD  1 
ATOM   904  N  NE  . ARG A 1 115 ? -23.092 23.158 6.427   1.00 33.42 ? 115 ARG A NE  1 
ATOM   905  C  CZ  . ARG A 1 115 ? -23.770 23.175 7.589   1.00 34.31 ? 115 ARG A CZ  1 
ATOM   906  N  NH1 . ARG A 1 115 ? -23.171 23.019 8.778   1.00 31.38 ? 115 ARG A NH1 1 
ATOM   907  N  NH2 . ARG A 1 115 ? -25.078 23.342 7.566   1.00 37.16 ? 115 ARG A NH2 1 
ATOM   908  N  N   . TRP A 1 116 ? -16.558 22.732 6.863   1.00 16.85 ? 116 TRP A N   1 
ATOM   909  C  CA  . TRP A 1 116 ? -15.230 22.587 6.279   1.00 16.60 ? 116 TRP A CA  1 
ATOM   910  C  C   . TRP A 1 116 ? -15.458 22.427 4.792   1.00 18.95 ? 116 TRP A C   1 
ATOM   911  O  O   . TRP A 1 116 ? -16.158 21.481 4.350   1.00 19.61 ? 116 TRP A O   1 
ATOM   912  C  CB  . TRP A 1 116 ? -14.617 21.291 6.774   1.00 16.12 ? 116 TRP A CB  1 
ATOM   913  C  CG  . TRP A 1 116 ? -14.054 21.331 8.172   1.00 14.76 ? 116 TRP A CG  1 
ATOM   914  C  CD1 . TRP A 1 116 ? -14.548 20.707 9.308   1.00 15.31 ? 116 TRP A CD1 1 
ATOM   915  C  CD2 . TRP A 1 116 ? -12.832 21.973 8.587   1.00 13.68 ? 116 TRP A CD2 1 
ATOM   916  N  NE1 . TRP A 1 116 ? -13.713 20.905 10.377  1.00 14.65 ? 116 TRP A NE1 1 
ATOM   917  C  CE2 . TRP A 1 116 ? -12.673 21.682 10.012  1.00 13.93 ? 116 TRP A CE2 1 
ATOM   918  C  CE3 . TRP A 1 116 ? -11.865 22.749 7.938   1.00 12.51 ? 116 TRP A CE3 1 
ATOM   919  C  CZ2 . TRP A 1 116 ? -11.601 22.175 10.747  1.00 13.19 ? 116 TRP A CZ2 1 
ATOM   920  C  CZ3 . TRP A 1 116 ? -10.798 23.223 8.681   1.00 12.01 ? 116 TRP A CZ3 1 
ATOM   921  C  CH2 . TRP A 1 116 ? -10.658 22.924 10.057  1.00 12.50 ? 116 TRP A CH2 1 
ATOM   922  N  N   . LEU A 1 117 ? -14.899 23.345 4.007   1.00 18.71 ? 117 LEU A N   1 
ATOM   923  C  CA  . LEU A 1 117 ? -15.213 23.396 2.559   1.00 20.28 ? 117 LEU A CA  1 
ATOM   924  C  C   . LEU A 1 117 ? -14.005 23.673 1.731   1.00 19.05 ? 117 LEU A C   1 
ATOM   925  O  O   . LEU A 1 117 ? -13.112 24.437 2.137   1.00 16.96 ? 117 LEU A O   1 
ATOM   926  C  CB  . LEU A 1 117 ? -16.282 24.483 2.278   1.00 22.32 ? 117 LEU A CB  1 
ATOM   927  C  CG  . LEU A 1 117 ? -17.692 24.085 2.802   1.00 24.34 ? 117 LEU A CG  1 
ATOM   928  C  CD1 . LEU A 1 117 ? -18.742 25.170 2.641   1.00 25.23 ? 117 LEU A CD1 1 
ATOM   929  C  CD2 . LEU A 1 117 ? -18.187 22.814 2.109   1.00 26.92 ? 117 LEU A CD2 1 
ATOM   930  N  N   . GLY A 1 118 ? -13.984 23.078 0.551   1.00 20.46 ? 118 GLY A N   1 
ATOM   931  C  CA  . GLY A 1 118 ? -12.996 23.435 -0.474  1.00 21.15 ? 118 GLY A CA  1 
ATOM   932  C  C   . GLY A 1 118 ? -13.177 24.876 -0.906  1.00 21.20 ? 118 GLY A C   1 
ATOM   933  O  O   . GLY A 1 118 ? -14.260 25.471 -0.700  1.00 20.00 ? 118 GLY A O   1 
ATOM   934  N  N   . LEU A 1 119 ? -12.126 25.427 -1.539  1.00 20.83 ? 119 LEU A N   1 
ATOM   935  C  CA  . LEU A 1 119 ? -12.060 26.870 -1.849  1.00 20.82 ? 119 LEU A CA  1 
ATOM   936  C  C   . LEU A 1 119 ? -13.298 27.390 -2.597  1.00 23.32 ? 119 LEU A C   1 
ATOM   937  O  O   . LEU A 1 119 ? -13.882 28.369 -2.166  1.00 22.94 ? 119 LEU A O   1 
ATOM   938  C  CB  . LEU A 1 119 ? -10.786 27.227 -2.660  1.00 20.16 ? 119 LEU A CB  1 
ATOM   939  C  CG  . LEU A 1 119 ? -10.734 28.715 -3.078  1.00 20.57 ? 119 LEU A CG  1 
ATOM   940  C  CD1 . LEU A 1 119 ? -10.582 29.627 -1.859  1.00 19.02 ? 119 LEU A CD1 1 
ATOM   941  C  CD2 . LEU A 1 119 ? -9.584  28.956 -4.035  1.00 19.94 ? 119 LEU A CD2 1 
ATOM   942  N  N   . GLU A 1 120 ? -13.677 26.752 -3.718  1.00 25.93 ? 120 GLU A N   1 
ATOM   943  C  CA  . GLU A 1 120 ? -14.823 27.219 -4.480  1.00 29.45 ? 120 GLU A CA  1 
ATOM   944  C  C   . GLU A 1 120 ? -16.087 27.285 -3.632  1.00 28.79 ? 120 GLU A C   1 
ATOM   945  O  O   . GLU A 1 120 ? -16.762 28.306 -3.618  1.00 29.31 ? 120 GLU A O   1 
ATOM   946  C  CB  . GLU A 1 120 ? -15.088 26.398 -5.758  1.00 33.70 ? 120 GLU A CB  1 
ATOM   947  C  CG  . GLU A 1 120 ? -16.319 26.883 -6.538  1.00 38.01 ? 120 GLU A CG  1 
ATOM   948  C  CD  . GLU A 1 120 ? -16.268 28.375 -6.922  0.90 42.30 ? 120 GLU A CD  1 
ATOM   949  O  OE1 . GLU A 1 120 ? -17.320 28.931 -7.295  0.90 47.59 ? 120 GLU A OE1 1 
ATOM   950  O  OE2 . GLU A 1 120 ? -15.188 29.013 -6.871  0.90 41.57 ? 120 GLU A OE2 1 
ATOM   951  N  N   . GLU A 1 121 ? -16.425 26.193 -2.961  1.00 28.53 ? 121 GLU A N   1 
ATOM   952  C  CA  . GLU A 1 121 ? -17.620 26.185 -2.106  1.00 29.07 ? 121 GLU A CA  1 
ATOM   953  C  C   . GLU A 1 121 ? -17.511 27.127 -0.911  1.00 27.75 ? 121 GLU A C   1 
ATOM   954  O  O   . GLU A 1 121 ? -18.520 27.737 -0.526  1.00 28.13 ? 121 GLU A O   1 
ATOM   955  C  CB  . GLU A 1 121 ? -17.924 24.773 -1.644  1.00 31.31 ? 121 GLU A CB  1 
ATOM   956  C  CG  . GLU A 1 121 ? -18.419 23.932 -2.813  1.00 36.18 ? 121 GLU A CG  1 
ATOM   957  C  CD  . GLU A 1 121 ? -18.174 22.464 -2.615  0.60 38.48 ? 121 GLU A CD  1 
ATOM   958  O  OE1 . GLU A 1 121 ? -17.030 22.027 -2.885  0.60 39.97 ? 121 GLU A OE1 1 
ATOM   959  O  OE2 . GLU A 1 121 ? -19.125 21.757 -2.210  0.60 40.13 ? 121 GLU A OE2 1 
ATOM   960  N  N   . ALA A 1 122 ? -16.301 27.262 -0.339  1.00 23.07 ? 122 ALA A N   1 
ATOM   961  C  CA  . ALA A 1 122 ? -16.078 28.243 0.743   1.00 22.18 ? 122 ALA A CA  1 
ATOM   962  C  C   . ALA A 1 122 ? -16.382 29.650 0.256   1.00 22.21 ? 122 ALA A C   1 
ATOM   963  O  O   . ALA A 1 122 ? -17.009 30.436 0.968   1.00 21.57 ? 122 ALA A O   1 
ATOM   964  C  CB  . ALA A 1 122 ? -14.638 28.194 1.295   1.00 20.14 ? 122 ALA A CB  1 
ATOM   965  N  N   . CYS A 1 123 ? -15.898 29.975 -0.945  1.00 22.75 ? 123 CYS A N   1 
ATOM   966  C  CA  . CYS A 1 123 ? -16.166 31.281 -1.551  1.00 24.45 ? 123 CYS A CA  1 
ATOM   967  C  C   . CYS A 1 123 ? -17.660 31.538 -1.748  1.00 27.29 ? 123 CYS A C   1 
ATOM   968  O  O   . CYS A 1 123 ? -18.173 32.598 -1.373  1.00 28.69 ? 123 CYS A O   1 
ATOM   969  C  CB  . CYS A 1 123 ? -15.423 31.412 -2.873  1.00 24.22 ? 123 CYS A CB  1 
ATOM   970  S  SG  . CYS A 1 123 ? -13.659 31.663 -2.545  1.00 23.78 ? 123 CYS A SG  1 
ATOM   971  N  N   . GLN A 1 124 ? -18.364 30.548 -2.285  1.00 29.70 ? 124 GLN A N   1 
ATOM   972  C  CA  . GLN A 1 124 ? -19.795 30.676 -2.527  1.00 34.40 ? 124 GLN A CA  1 
ATOM   973  C  C   . GLN A 1 124 ? -20.569 30.886 -1.226  1.00 32.78 ? 124 GLN A C   1 
ATOM   974  O  O   . GLN A 1 124 ? -21.507 31.682 -1.177  1.00 34.33 ? 124 GLN A O   1 
ATOM   975  C  CB  . GLN A 1 124 ? -20.327 29.444 -3.261  1.00 37.20 ? 124 GLN A CB  1 
ATOM   976  C  CG  . GLN A 1 124 ? -19.749 29.254 -4.654  1.00 43.08 ? 124 GLN A CG  1 
ATOM   977  C  CD  . GLN A 1 124 ? -20.168 27.941 -5.285  1.00 48.24 ? 124 GLN A CD  1 
ATOM   978  O  OE1 . GLN A 1 124 ? -19.780 26.867 -4.826  1.00 54.88 ? 124 GLN A OE1 1 
ATOM   979  N  NE2 . GLN A 1 124 ? -20.964 28.021 -6.345  0.00 20.00 ? 124 GLN A NE2 1 
ATOM   980  N  N   . LEU A 1 125 ? -20.176 30.171 -0.176  1.00 30.99 ? 125 LEU A N   1 
ATOM   981  C  CA  . LEU A 1 125 ? -20.860 30.282 1.129   1.00 30.91 ? 125 LEU A CA  1 
ATOM   982  C  C   . LEU A 1 125 ? -20.464 31.574 1.818   1.00 29.92 ? 125 LEU A C   1 
ATOM   983  O  O   . LEU A 1 125 ? -21.297 32.234 2.395   1.00 30.52 ? 125 LEU A O   1 
ATOM   984  C  CB  . LEU A 1 125 ? -20.501 29.108 2.028   1.00 30.36 ? 125 LEU A CB  1 
ATOM   985  C  CG  . LEU A 1 125 ? -21.514 28.203 2.712   1.00 32.60 ? 125 LEU A CG  1 
ATOM   986  C  CD1 . LEU A 1 125 ? -20.995 27.895 4.103   1.00 28.07 ? 125 LEU A CD1 1 
ATOM   987  C  CD2 . LEU A 1 125 ? -22.946 28.749 2.738   1.00 34.95 ? 125 LEU A CD2 1 
ATOM   988  N  N   . ALA A 1 126 ? -19.173 31.928 1.779   1.00 28.47 ? 126 ALA A N   1 
ATOM   989  C  CA  . ALA A 1 126 ? -18.726 33.211 2.344   1.00 28.20 ? 126 ALA A CA  1 
ATOM   990  C  C   . ALA A 1 126 ? -19.460 34.340 1.618   1.00 31.06 ? 126 ALA A C   1 
ATOM   991  O  O   . ALA A 1 126 ? -19.874 35.306 2.240   1.00 32.08 ? 126 ALA A O   1 
ATOM   992  C  CB  . ALA A 1 126 ? -17.221 33.377 2.200   1.00 25.99 ? 126 ALA A CB  1 
ATOM   993  N  N   . GLN A 1 127 ? -19.616 34.182 0.299   1.00 33.35 ? 127 GLN A N   1 
ATOM   994  C  CA  . GLN A 1 127 ? -20.361 35.125 -0.571  1.00 37.60 ? 127 GLN A CA  1 
ATOM   995  C  C   . GLN A 1 127 ? -19.718 36.518 -0.731  1.00 38.09 ? 127 GLN A C   1 
ATOM   996  O  O   . GLN A 1 127 ? -19.486 36.974 -1.851  1.00 39.40 ? 127 GLN A O   1 
ATOM   997  C  CB  . GLN A 1 127 ? -21.838 35.211 -0.168  1.00 39.43 ? 127 GLN A CB  1 
ATOM   998  C  CG  . GLN A 1 127 ? -22.726 35.958 -1.159  1.00 46.36 ? 127 GLN A CG  1 
ATOM   999  C  CD  . GLN A 1 127 ? -22.888 37.429 -0.817  0.01 47.78 ? 127 GLN A CD  1 
ATOM   1000 O  OE1 . GLN A 1 127 ? -23.032 37.725 0.471   0.01 49.78 ? 127 GLN A OE1 1 
ATOM   1001 N  NE2 . GLN A 1 127 ? -22.884 38.287 -1.700  1.00 51.03 ? 127 GLN A NE2 1 
ATOM   1002 N  N   . PHE A 1 128 ? -19.413 37.179 0.384   1.00 37.86 ? 128 PHE A N   1 
ATOM   1003 C  CA  . PHE A 1 128 ? -18.935 38.564 0.365   1.00 36.95 ? 128 PHE A CA  1 
ATOM   1004 C  C   . PHE A 1 128 ? -17.571 38.686 -0.359  1.00 34.44 ? 128 PHE A C   1 
ATOM   1005 O  O   . PHE A 1 128 ? -16.654 37.935 -0.059  1.00 30.54 ? 128 PHE A O   1 
ATOM   1006 C  CB  . PHE A 1 128 ? -18.837 39.067 1.807   1.00 38.41 ? 128 PHE A CB  1 
ATOM   1007 C  CG  . PHE A 1 128 ? -18.075 40.345 1.948   1.00 40.58 ? 128 PHE A CG  1 
ATOM   1008 C  CD1 . PHE A 1 128 ? -18.367 41.441 1.130   1.00 45.19 ? 128 PHE A CD1 1 
ATOM   1009 C  CD2 . PHE A 1 128 ? -17.063 40.463 2.898   1.00 41.31 ? 128 PHE A CD2 1 
ATOM   1010 C  CE1 . PHE A 1 128 ? -17.654 42.634 1.241   1.00 48.07 ? 128 PHE A CE1 1 
ATOM   1011 C  CE2 . PHE A 1 128 ? -16.361 41.653 3.031   0.80 42.49 ? 128 PHE A CE2 1 
ATOM   1012 C  CZ  . PHE A 1 128 ? -16.658 42.738 2.199   1.00 45.42 ? 128 PHE A CZ  1 
ATOM   1013 N  N   . LYS A 1 129 ? -17.444 39.656 -1.265  1.00 34.53 ? 129 LYS A N   1 
ATOM   1014 C  CA  . LYS A 1 129 ? -16.308 39.715 -2.190  1.00 34.26 ? 129 LYS A CA  1 
ATOM   1015 C  C   . LYS A 1 129 ? -14.916 39.814 -1.564  1.00 30.23 ? 129 LYS A C   1 
ATOM   1016 O  O   . LYS A 1 129 ? -13.997 39.189 -2.060  1.00 29.62 ? 129 LYS A O   1 
ATOM   1017 C  CB  . LYS A 1 129 ? -16.488 40.775 -3.278  1.00 38.26 ? 129 LYS A CB  1 
ATOM   1018 C  CG  . LYS A 1 129 ? -16.253 42.200 -2.808  1.00 42.91 ? 129 LYS A CG  1 
ATOM   1019 C  CD  . LYS A 1 129 ? -16.421 43.197 -3.945  1.00 47.13 ? 129 LYS A CD  1 
ATOM   1020 C  CE  . LYS A 1 129 ? -16.680 44.583 -3.392  1.00 50.17 ? 129 LYS A CE  1 
ATOM   1021 N  NZ  . LYS A 1 129 ? -17.248 45.456 -4.459  1.00 53.02 ? 129 LYS A NZ  1 
ATOM   1022 N  N   . GLU A 1 130 ? -14.757 40.574 -0.489  1.00 28.75 ? 130 GLU A N   1 
ATOM   1023 C  CA  . GLU A 1 130 ? -13.458 40.663 0.175   1.00 28.41 ? 130 GLU A CA  1 
ATOM   1024 C  C   . GLU A 1 130 ? -13.033 39.403 0.939   1.00 24.86 ? 130 GLU A C   1 
ATOM   1025 O  O   . GLU A 1 130 ? -11.836 39.139 1.086   1.00 23.05 ? 130 GLU A O   1 
ATOM   1026 C  CB  . GLU A 1 130 ? -13.414 41.866 1.075   1.00 31.54 ? 130 GLU A CB  1 
ATOM   1027 C  CG  . GLU A 1 130 ? -14.033 43.066 0.381   1.00 39.24 ? 130 GLU A CG  1 
ATOM   1028 C  CD  . GLU A 1 130 ? -13.614 44.356 1.011   1.00 43.48 ? 130 GLU A CD  1 
ATOM   1029 O  OE1 . GLU A 1 130 ? -12.487 44.380 1.563   1.00 48.87 ? 130 GLU A OE1 1 
ATOM   1030 O  OE2 . GLU A 1 130 ? -14.396 45.329 0.935   0.50 45.51 ? 130 GLU A OE2 1 
ATOM   1031 N  N   . MET A 1 131 ? -14.020 38.651 1.412   1.00 24.15 ? 131 MET A N   1 
ATOM   1032 C  CA  A MET A 1 131 ? -13.774 37.400 2.126   0.50 22.71 ? 131 MET A CA  1 
ATOM   1033 C  CA  B MET A 1 131 ? -13.793 37.395 2.126   0.50 22.20 ? 131 MET A CA  1 
ATOM   1034 C  C   . MET A 1 131 ? -13.420 36.351 1.091   1.00 21.77 ? 131 MET A C   1 
ATOM   1035 O  O   . MET A 1 131 ? -12.507 35.573 1.304   1.00 19.64 ? 131 MET A O   1 
ATOM   1036 C  CB  A MET A 1 131 ? -15.002 36.974 2.942   0.50 23.29 ? 131 MET A CB  1 
ATOM   1037 C  CB  B MET A 1 131 ? -15.062 36.962 2.865   0.50 21.98 ? 131 MET A CB  1 
ATOM   1038 C  CG  A MET A 1 131 ? -14.871 35.634 3.668   0.50 22.74 ? 131 MET A CG  1 
ATOM   1039 C  CG  B MET A 1 131 ? -14.876 35.835 3.878   0.50 20.54 ? 131 MET A CG  1 
ATOM   1040 S  SD  A MET A 1 131 ? -13.324 35.500 4.575   0.50 23.13 ? 131 MET A SD  1 
ATOM   1041 S  SD  B MET A 1 131 ? -13.961 36.418 5.309   0.50 19.81 ? 131 MET A SD  1 
ATOM   1042 C  CE  A MET A 1 131 ? -13.375 37.015 5.533   0.50 23.18 ? 131 MET A CE  1 
ATOM   1043 C  CE  B MET A 1 131 ? -12.308 35.721 5.025   0.50 17.83 ? 131 MET A CE  1 
ATOM   1044 N  N   . LYS A 1 132 ? -14.155 36.348 -0.032  1.00 22.43 ? 132 LYS A N   1 
ATOM   1045 C  CA  . LYS A 1 132 ? -13.839 35.476 -1.164  1.00 22.50 ? 132 LYS A CA  1 
ATOM   1046 C  C   . LYS A 1 132 ? -12.396 35.727 -1.641  1.00 20.54 ? 132 LYS A C   1 
ATOM   1047 O  O   . LYS A 1 132 ? -11.623 34.782 -1.828  1.00 20.01 ? 132 LYS A O   1 
ATOM   1048 C  CB  . LYS A 1 132 ? -14.797 35.752 -2.348  1.00 25.46 ? 132 LYS A CB  1 
ATOM   1049 C  CG  . LYS A 1 132 ? -16.206 35.164 -2.239  1.00 28.41 ? 132 LYS A CG  1 
ATOM   1050 C  CD  . LYS A 1 132 ? -16.981 35.392 -3.560  1.00 33.25 ? 132 LYS A CD  1 
ATOM   1051 C  CE  . LYS A 1 132 ? -18.293 34.614 -3.598  1.00 37.31 ? 132 LYS A CE  1 
ATOM   1052 N  NZ  . LYS A 1 132 ? -19.134 34.805 -4.833  1.00 42.23 ? 132 LYS A NZ  1 
ATOM   1053 N  N   . ALA A 1 133 ? -12.037 36.990 -1.862  1.00 20.36 ? 133 ALA A N   1 
ATOM   1054 C  CA  . ALA A 1 133 ? -10.655 37.333 -2.249  1.00 19.87 ? 133 ALA A CA  1 
ATOM   1055 C  C   . ALA A 1 133 ? -9.656  36.790 -1.223  1.00 17.36 ? 133 ALA A C   1 
ATOM   1056 O  O   . ALA A 1 133 ? -8.684  36.191 -1.607  1.00 17.23 ? 133 ALA A O   1 
ATOM   1057 C  CB  . ALA A 1 133 ? -10.470 38.852 -2.448  1.00 20.53 ? 133 ALA A CB  1 
ATOM   1058 N  N   . ALA A 1 134 ? -9.915  36.974 0.065   1.00 16.54 ? 134 ALA A N   1 
ATOM   1059 C  CA  . ALA A 1 134 ? -8.969  36.590 1.135   1.00 14.89 ? 134 ALA A CA  1 
ATOM   1060 C  C   . ALA A 1 134 ? -8.743  35.090 1.172   1.00 14.02 ? 134 ALA A C   1 
ATOM   1061 O  O   . ALA A 1 134 ? -7.612  34.627 1.365   1.00 13.89 ? 134 ALA A O   1 
ATOM   1062 C  CB  . ALA A 1 134 ? -9.494  37.065 2.507   1.00 15.18 ? 134 ALA A CB  1 
ATOM   1063 N  N   . LEU A 1 135 ? -9.811  34.327 1.022   1.00 13.45 ? 135 LEU A N   1 
ATOM   1064 C  CA  . LEU A 1 135 ? -9.703  32.889 0.941   1.00 12.98 ? 135 LEU A CA  1 
ATOM   1065 C  C   . LEU A 1 135 ? -8.967  32.436 -0.321  1.00 13.63 ? 135 LEU A C   1 
ATOM   1066 O  O   . LEU A 1 135 ? -8.133  31.521 -0.237  1.00 13.45 ? 135 LEU A O   1 
ATOM   1067 C  CB  . LEU A 1 135 ? -11.106 32.263 0.961   1.00 13.38 ? 135 LEU A CB  1 
ATOM   1068 C  CG  . LEU A 1 135 ? -11.900 32.369 2.272   1.00 12.94 ? 135 LEU A CG  1 
ATOM   1069 C  CD1 . LEU A 1 135 ? -13.309 31.862 1.960   1.00 13.43 ? 135 LEU A CD1 1 
ATOM   1070 C  CD2 . LEU A 1 135 ? -11.254 31.586 3.408   1.00 11.79 ? 135 LEU A CD2 1 
ATOM   1071 N  N   . GLN A 1 136 ? -9.256  33.055 -1.466  1.00 14.75 ? 136 GLN A N   1 
ATOM   1072 C  CA  . GLN A 1 136 ? -8.562  32.717 -2.716  1.00 16.58 ? 136 GLN A CA  1 
ATOM   1073 C  C   . GLN A 1 136 ? -7.064  32.977 -2.596  1.00 15.99 ? 136 GLN A C   1 
ATOM   1074 O  O   . GLN A 1 136 ? -6.223  32.164 -3.014  1.00 16.62 ? 136 GLN A O   1 
ATOM   1075 C  CB  . GLN A 1 136 ? -9.177  33.496 -3.897  1.00 18.53 ? 136 GLN A CB  1 
ATOM   1076 C  CG  . GLN A 1 136 ? -10.520 32.923 -4.344  1.00 20.40 ? 136 GLN A CG  1 
ATOM   1077 C  CD  . GLN A 1 136 ? -11.293 33.908 -5.188  1.00 22.77 ? 136 GLN A CD  1 
ATOM   1078 O  OE1 . GLN A 1 136 ? -10.861 35.025 -5.369  1.00 24.62 ? 136 GLN A OE1 1 
ATOM   1079 N  NE2 . GLN A 1 136 ? -12.399 33.484 -5.735  1.00 24.11 ? 136 GLN A NE2 1 
ATOM   1080 N  N   . GLU A 1 137 ? -6.741  34.124 -2.026  1.00 15.98 ? 137 GLU A N   1 
ATOM   1081 C  CA  . GLU A 1 137 ? -5.361  34.553 -1.819  1.00 15.59 ? 137 GLU A CA  1 
ATOM   1082 C  C   . GLU A 1 137 ? -4.623  33.671 -0.831  1.00 14.43 ? 137 GLU A C   1 
ATOM   1083 O  O   . GLU A 1 137 ? -3.418  33.400 -1.008  1.00 15.12 ? 137 GLU A O   1 
ATOM   1084 C  CB  . GLU A 1 137 ? -5.375  36.019 -1.332  1.00 16.28 ? 137 GLU A CB  1 
ATOM   1085 C  CG  . GLU A 1 137 ? -5.817  36.987 -2.443  1.00 17.92 ? 137 GLU A CG  1 
ATOM   1086 C  CD  . GLU A 1 137 ? -6.167  38.385 -1.904  1.00 19.19 ? 137 GLU A CD  1 
ATOM   1087 O  OE1 . GLU A 1 137 ? -5.920  38.631 -0.722  1.00 18.48 ? 137 GLU A OE1 1 
ATOM   1088 O  OE2 . GLU A 1 137 ? -6.709  39.232 -2.644  1.00 20.38 ? 137 GLU A OE2 1 
ATOM   1089 N  N   . GLY A 1 138 ? -5.324  33.218 0.207   1.00 13.22 ? 138 GLY A N   1 
ATOM   1090 C  CA  . GLY A 1 138 ? -4.772  32.281 1.189   1.00 12.67 ? 138 GLY A CA  1 
ATOM   1091 C  C   . GLY A 1 138 ? -4.420  30.968 0.533   1.00 13.00 ? 138 GLY A C   1 
ATOM   1092 O  O   . GLY A 1 138 ? -3.340  30.435 0.746   1.00 13.27 ? 138 GLY A O   1 
ATOM   1093 N  N   . HIS A 1 139 ? -5.342  30.444 -0.268  1.00 13.46 ? 139 HIS A N   1 
ATOM   1094 C  CA  . HIS A 1 139 ? -5.126  29.188 -0.960  1.00 14.35 ? 139 HIS A CA  1 
ATOM   1095 C  C   . HIS A 1 139 ? -3.981  29.285 -1.925  1.00 15.69 ? 139 HIS A C   1 
ATOM   1096 O  O   . HIS A 1 139 ? -3.160  28.350 -2.039  1.00 15.60 ? 139 HIS A O   1 
ATOM   1097 C  CB  . HIS A 1 139 ? -6.391  28.756 -1.691  1.00 15.52 ? 139 HIS A CB  1 
ATOM   1098 C  CG  . HIS A 1 139 ? -6.306  27.375 -2.295  1.00 17.32 ? 139 HIS A CG  1 
ATOM   1099 N  ND1 . HIS A 1 139 ? -5.811  27.153 -3.526  1.00 18.88 ? 139 HIS A ND1 1 
ATOM   1100 C  CD2 . HIS A 1 139 ? -6.674  26.130 -1.789  1.00 17.58 ? 139 HIS A CD2 1 
ATOM   1101 C  CE1 . HIS A 1 139 ? -5.858  25.835 -3.797  1.00 20.17 ? 139 HIS A CE1 1 
ATOM   1102 N  NE2 . HIS A 1 139 ? -6.387  25.210 -2.733  1.00 19.29 ? 139 HIS A NE2 1 
ATOM   1103 N  N   . GLN A 1 140 ? -3.901  30.408 -2.631  1.00 16.22 ? 140 GLN A N   1 
ATOM   1104 C  CA  . GLN A 1 140 ? -2.825  30.635 -3.588  1.00 16.54 ? 140 GLN A CA  1 
ATOM   1105 C  C   . GLN A 1 140 ? -1.476  30.665 -2.879  1.00 16.34 ? 140 GLN A C   1 
ATOM   1106 O  O   . GLN A 1 140 ? -0.487  30.126 -3.376  1.00 16.65 ? 140 GLN A O   1 
ATOM   1107 C  CB  . GLN A 1 140 ? -3.050  31.943 -4.349  1.00 18.22 ? 140 GLN A CB  1 
ATOM   1108 C  CG  . GLN A 1 140 ? -2.040  32.198 -5.456  0.70 19.76 ? 140 GLN A CG  1 
ATOM   1109 C  CD  . GLN A 1 140 ? -2.288  33.507 -6.180  0.70 21.43 ? 140 GLN A CD  1 
ATOM   1110 O  OE1 . GLN A 1 140 ? -3.171  34.279 -5.806  0.70 21.52 ? 140 GLN A OE1 1 
ATOM   1111 N  NE2 . GLN A 1 140 ? -1.507  33.764 -7.222  0.70 22.39 ? 140 GLN A NE2 1 
ATOM   1112 N  N   . PHE A 1 141 ? -1.448  31.300 -1.712  1.00 15.31 ? 141 PHE A N   1 
ATOM   1113 C  CA  . PHE A 1 141 ? -0.228  31.392 -0.906  1.00 15.75 ? 141 PHE A CA  1 
ATOM   1114 C  C   . PHE A 1 141 ? 0.224   29.998 -0.434  1.00 16.27 ? 141 PHE A C   1 
ATOM   1115 O  O   . PHE A 1 141 ? 1.406   29.652 -0.487  1.00 17.38 ? 141 PHE A O   1 
ATOM   1116 C  CB  . PHE A 1 141 ? -0.499  32.315 0.305   1.00 15.33 ? 141 PHE A CB  1 
ATOM   1117 C  CG  . PHE A 1 141 ? 0.554   32.226 1.382   1.00 16.85 ? 141 PHE A CG  1 
ATOM   1118 C  CD1 . PHE A 1 141 ? 1.717   32.978 1.300   1.00 16.98 ? 141 PHE A CD1 1 
ATOM   1119 C  CD2 . PHE A 1 141 ? 0.385   31.367 2.470   1.00 16.16 ? 141 PHE A CD2 1 
ATOM   1120 C  CE1 . PHE A 1 141 ? 2.698   32.866 2.287   1.00 18.33 ? 141 PHE A CE1 1 
ATOM   1121 C  CE2 . PHE A 1 141 ? 1.352   31.278 3.457   1.00 16.92 ? 141 PHE A CE2 1 
ATOM   1122 C  CZ  . PHE A 1 141 ? 2.504   32.033 3.359   1.00 17.67 ? 141 PHE A CZ  1 
ATOM   1123 N  N   . LEU A 1 142 ? -0.724  29.184 0.029   1.00 15.68 ? 142 LEU A N   1 
ATOM   1124 C  CA  . LEU A 1 142 ? -0.409  27.831 0.447   1.00 17.01 ? 142 LEU A CA  1 
ATOM   1125 C  C   . LEU A 1 142 ? 0.165   26.992 -0.693  1.00 18.54 ? 142 LEU A C   1 
ATOM   1126 O  O   . LEU A 1 142 ? 1.151   26.239 -0.515  1.00 19.58 ? 142 LEU A O   1 
ATOM   1127 C  CB  . LEU A 1 142 ? -1.675  27.158 0.995   1.00 16.25 ? 142 LEU A CB  1 
ATOM   1128 C  CG  . LEU A 1 142 ? -2.116  27.724 2.342   1.00 15.45 ? 142 LEU A CG  1 
ATOM   1129 C  CD1 . LEU A 1 142 ? -3.494  27.218 2.723   1.00 15.31 ? 142 LEU A CD1 1 
ATOM   1130 C  CD2 . LEU A 1 142 ? -1.116  27.395 3.459   1.00 15.55 ? 142 LEU A CD2 1 
ATOM   1131 N  N   . CYS A 1 143 ? -0.427  27.114 -1.870  1.00 19.27 ? 143 CYS A N   1 
ATOM   1132 C  CA  . CYS A 1 143 ? 0.128   26.411 -3.028  1.00 21.42 ? 143 CYS A CA  1 
ATOM   1133 C  C   . CYS A 1 143 ? 1.554   26.882 -3.371  1.00 22.06 ? 143 CYS A C   1 
ATOM   1134 O  O   . CYS A 1 143 ? 2.406   26.070 -3.715  1.00 23.45 ? 143 CYS A O   1 
ATOM   1135 C  CB  . CYS A 1 143 ? -0.808  26.552 -4.227  1.00 23.45 ? 143 CYS A CB  1 
ATOM   1136 S  SG  . CYS A 1 143 ? -2.372  25.730 -3.896  1.00 28.66 ? 143 CYS A SG  1 
ATOM   1137 N  N   . SER A 1 144 ? 1.831   28.181 -3.266  1.00 21.53 ? 144 SER A N   1 
ATOM   1138 C  CA  . SER A 1 144 ? 3.156   28.685 -3.634  1.00 22.85 ? 144 SER A CA  1 
ATOM   1139 C  C   . SER A 1 144 ? 4.227   28.194 -2.647  1.00 24.52 ? 144 SER A C   1 
ATOM   1140 O  O   . SER A 1 144 ? 5.340   27.858 -3.056  1.00 25.41 ? 144 SER A O   1 
ATOM   1141 C  CB  . SER A 1 144 ? 3.185   30.211 -3.764  1.00 22.69 ? 144 SER A CB  1 
ATOM   1142 O  OG  . SER A 1 144 ? 3.224   30.848 -2.475  1.00 23.38 ? 144 SER A OG  1 
ATOM   1143 N  N   . ILE A 1 145 ? 3.887   28.105 -1.363  1.00 24.81 ? 145 ILE A N   1 
ATOM   1144 C  CA  A ILE A 1 145 ? 4.791   27.582 -0.320  0.60 26.82 ? 145 ILE A CA  1 
ATOM   1145 C  CA  B ILE A 1 145 ? 4.888   27.616 -0.419  0.40 26.09 ? 145 ILE A CA  1 
ATOM   1146 C  C   . ILE A 1 145 ? 5.123   26.107 -0.571  1.00 27.82 ? 145 ILE A C   1 
ATOM   1147 O  O   . ILE A 1 145 ? 6.281   25.679 -0.538  1.00 30.23 ? 145 ILE A O   1 
ATOM   1148 C  CB  A ILE A 1 145 ? 4.145   27.702 1.086   0.60 26.44 ? 145 ILE A CB  1 
ATOM   1149 C  CB  B ILE A 1 145 ? 4.677   28.084 1.042   0.40 25.03 ? 145 ILE A CB  1 
ATOM   1150 C  CG1 A ILE A 1 145 ? 3.948   29.173 1.482   0.60 25.85 ? 145 ILE A CG1 1 
ATOM   1151 C  CG1 B ILE A 1 145 ? 3.456   27.433 1.687   0.40 23.65 ? 145 ILE A CG1 1 
ATOM   1152 C  CG2 A ILE A 1 145 ? 4.947   26.924 2.135   0.60 28.75 ? 145 ILE A CG2 1 
ATOM   1153 C  CG2 B ILE A 1 145 ? 4.553   29.598 1.103   0.40 24.83 ? 145 ILE A CG2 1 
ATOM   1154 C  CD1 A ILE A 1 145 ? 5.086   30.101 1.095   0.60 28.17 ? 145 ILE A CD1 1 
ATOM   1155 C  CD1 B ILE A 1 145 ? 3.220   27.943 3.092   0.40 22.30 ? 145 ILE A CD1 1 
ATOM   1156 N  N   . GLU A 1 146 ? 4.072   25.325 -0.799  1.00 28.39 ? 146 GLU A N   1 
ATOM   1157 C  CA  . GLU A 1 146 ? 4.235   23.906 -1.090  1.00 32.83 ? 146 GLU A CA  1 
ATOM   1158 C  C   . GLU A 1 146 ? 5.154   23.718 -2.296  1.00 34.75 ? 146 GLU A C   1 
ATOM   1159 O  O   . GLU A 1 146 ? 6.003   22.842 -2.273  1.00 37.47 ? 146 GLU A O   1 
ATOM   1160 C  CB  . GLU A 1 146 ? 2.897   23.213 -1.362  1.00 34.03 ? 146 GLU A CB  1 
ATOM   1161 C  CG  . GLU A 1 146 ? 1.957   23.113 -0.169  0.97 37.79 ? 146 GLU A CG  1 
ATOM   1162 C  CD  . GLU A 1 146 ? 0.512   22.835 -0.577  0.30 36.52 ? 146 GLU A CD  1 
ATOM   1163 O  OE1 . GLU A 1 146 ? -0.409  23.306 0.124   0.80 37.80 ? 146 GLU A OE1 1 
ATOM   1164 O  OE2 . GLU A 1 146 ? 0.288   22.152 -1.599  0.30 37.37 ? 146 GLU A OE2 1 
ATOM   1165 N  N   . ALA A 1 147 ? 4.996   24.540 -3.339  1.00 33.84 ? 147 ALA A N   1 
ATOM   1166 C  CA  . ALA A 1 147 ? 5.899   24.463 -4.500  1.00 37.65 ? 147 ALA A CA  1 
ATOM   1167 C  C   . ALA A 1 147 ? 7.357   24.793 -4.150  1.00 40.43 ? 147 ALA A C   1 
ATOM   1168 O  O   . ALA A 1 147 ? 8.270   24.111 -4.614  1.00 43.51 ? 147 ALA A O   1 
ATOM   1169 C  CB  . ALA A 1 147 ? 5.416   25.334 -5.663  1.00 35.95 ? 147 ALA A CB  1 
ATOM   1170 N  N   . LEU A 1 148 ? 7.572   25.840 -3.354  1.00 41.16 ? 148 LEU A N   1 
ATOM   1171 C  CA  . LEU A 1 148 ? 8.923   26.211 -2.938  1.00 44.84 ? 148 LEU A CA  1 
ATOM   1172 C  C   . LEU A 1 148 ? 9.590   25.114 -2.095  1.00 49.13 ? 148 LEU A C   1 
ATOM   1173 O  O   . LEU A 1 148 ? 10.783  24.826 -2.273  1.00 49.85 ? 148 LEU A O   1 
ATOM   1174 C  CB  . LEU A 1 148 ? 8.942   27.555 -2.204  1.00 43.72 ? 148 LEU A CB  1 
ATOM   1175 C  CG  . LEU A 1 148 ? 8.725   28.789 -3.075  1.00 44.48 ? 148 LEU A CG  1 
ATOM   1176 C  CD1 . LEU A 1 148 ? 8.773   30.033 -2.204  1.00 44.34 ? 148 LEU A CD1 1 
ATOM   1177 C  CD2 . LEU A 1 148 ? 9.731   28.888 -4.212  1.00 44.41 ? 148 LEU A CD2 1 
ATOM   1178 N  N   . GLU A 1 149 ? 8.810   24.490 -1.211  1.00 50.55 ? 149 GLU A N   1 
ATOM   1179 C  CA  . GLU A 1 149 ? 9.316   23.394 -0.382  1.00 53.70 ? 149 GLU A CA  1 
ATOM   1180 C  C   . GLU A 1 149 ? 9.541   22.139 -1.219  1.00 56.16 ? 149 GLU A C   1 
ATOM   1181 O  O   . GLU A 1 149 ? 10.509  21.415 -0.991  1.00 57.72 ? 149 GLU A O   1 
ATOM   1182 C  CB  . GLU A 1 149 ? 8.376   23.092 0.784   1.00 53.91 ? 149 GLU A CB  1 
ATOM   1183 C  CG  . GLU A 1 149 ? 8.187   24.238 1.771   1.00 55.85 ? 149 GLU A CG  1 
ATOM   1184 C  CD  . GLU A 1 149 ? 7.037   23.992 2.741   1.00 58.88 ? 149 GLU A CD  1 
ATOM   1185 O  OE1 . GLU A 1 149 ? 6.227   23.061 2.503   1.00 61.90 ? 149 GLU A OE1 1 
ATOM   1186 O  OE2 . GLU A 1 149 ? 6.934   24.733 3.747   1.00 60.71 ? 149 GLU A OE2 1 
ATOM   1187 N  N   . HIS A 1 150 ? 8.645   21.893 -2.180  1.00 57.96 ? 150 HIS A N   1 
ATOM   1188 C  CA  . HIS A 1 150 ? 8.763   20.779 -3.129  1.00 60.02 ? 150 HIS A CA  1 
ATOM   1189 C  C   . HIS A 1 150 ? 10.042  20.854 -3.914  1.00 62.68 ? 150 HIS A C   1 
ATOM   1190 O  O   . HIS A 1 150 ? 10.739  19.852 -4.034  1.00 65.23 ? 150 HIS A O   1 
ATOM   1191 C  CB  . HIS A 1 150 ? 7.561   20.741 -4.076  0.50 58.87 ? 150 HIS A CB  1 
ATOM   1192 C  CG  . HIS A 1 150 ? 7.609   19.614 -5.089  0.80 61.45 ? 150 HIS A CG  1 
ATOM   1193 N  ND1 . HIS A 1 150 ? 7.931   19.815 -6.386  0.50 62.38 ? 150 HIS A ND1 1 
ATOM   1194 C  CD2 . HIS A 1 150 ? 7.373   18.245 -4.951  0.80 62.33 ? 150 HIS A CD2 1 
ATOM   1195 C  CE1 . HIS A 1 150 ? 7.896   18.640 -7.044  0.50 63.17 ? 150 HIS A CE1 1 
ATOM   1196 N  NE2 . HIS A 1 150 ? 7.555   17.679 -6.165  0.80 63.04 ? 150 HIS A NE2 1 
ATOM   1197 N  N   . LEU B 1 3   ? -14.874 51.330 -11.669 1.00 55.58 ? 3   LEU B N   1 
ATOM   1198 C  CA  . LEU B 1 3   ? -13.464 51.563 -11.958 1.00 53.83 ? 3   LEU B CA  1 
ATOM   1199 C  C   . LEU B 1 3   ? -12.649 50.389 -11.441 1.00 52.90 ? 3   LEU B C   1 
ATOM   1200 O  O   . LEU B 1 3   ? -12.523 50.177 -10.238 1.00 52.34 ? 3   LEU B O   1 
ATOM   1201 C  CB  . LEU B 1 3   ? -13.003 52.818 -11.272 1.00 43.95 ? 3   LEU B CB  1 
ATOM   1202 C  CG  . LEU B 1 3   ? -11.998 53.738 -11.945 1.00 44.13 ? 3   LEU B CG  1 
ATOM   1203 C  CD1 . LEU B 1 3   ? -10.630 53.627 -11.305 1.00 42.61 ? 3   LEU B CD1 1 
ATOM   1204 C  CD2 . LEU B 1 3   ? -11.946 53.524 -13.441 1.00 44.38 ? 3   LEU B CD2 1 
ATOM   1205 N  N   . ARG B 1 4   ? -12.112 49.629 -12.371 1.00 48.19 ? 4   ARG B N   1 
ATOM   1206 C  CA  . ARG B 1 4   ? -11.270 48.522 -12.038 1.00 46.62 ? 4   ARG B CA  1 
ATOM   1207 C  C   . ARG B 1 4   ? -9.881  48.810 -12.591 1.00 41.46 ? 4   ARG B C   1 
ATOM   1208 O  O   . ARG B 1 4   ? -9.723  49.097 -13.769 1.00 41.56 ? 4   ARG B O   1 
ATOM   1209 C  CB  . ARG B 1 4   ? -11.851 47.249 -12.634 1.00 46.94 ? 4   ARG B CB  1 
ATOM   1210 C  CG  . ARG B 1 4   ? -11.112 45.998 -12.221 1.00 49.13 ? 4   ARG B CG  1 
ATOM   1211 C  CD  . ARG B 1 4   ? -11.868 44.754 -12.651 1.00 50.79 ? 4   ARG B CD  1 
ATOM   1212 N  NE  . ARG B 1 4   ? -11.302 43.533 -12.090 1.00 50.16 ? 4   ARG B NE  1 
ATOM   1213 C  CZ  . ARG B 1 4   ? -11.740 42.951 -10.982 1.00 51.93 ? 4   ARG B CZ  1 
ATOM   1214 N  NH1 . ARG B 1 4   ? -12.739 43.476 -10.301 1.00 53.84 ? 4   ARG B NH1 1 
ATOM   1215 N  NH2 . ARG B 1 4   ? -11.181 41.837 -10.549 1.00 52.86 ? 4   ARG B NH2 1 
ATOM   1216 N  N   . ALA B 1 5   ? -8.889  48.759 -11.722 1.00 36.28 ? 5   ALA B N   1 
ATOM   1217 C  CA  . ALA B 1 5   ? -7.515  48.931 -12.126 1.00 32.74 ? 5   ALA B CA  1 
ATOM   1218 C  C   . ALA B 1 5   ? -6.628  47.787 -11.631 1.00 30.21 ? 5   ALA B C   1 
ATOM   1219 O  O   . ALA B 1 5   ? -7.007  47.058 -10.738 1.00 30.50 ? 5   ALA B O   1 
ATOM   1220 C  CB  . ALA B 1 5   ? -6.994  50.281 -11.677 1.00 31.92 ? 5   ALA B CB  1 
ATOM   1221 N  N   . CYS B 1 6   ? -5.462  47.634 -12.239 1.00 27.97 ? 6   CYS B N   1 
ATOM   1222 C  CA  . CYS B 1 6   ? -4.546  46.548 -11.924 1.00 26.69 ? 6   CYS B CA  1 
ATOM   1223 C  C   . CYS B 1 6   ? -3.146  47.089 -12.041 1.00 24.23 ? 6   CYS B C   1 
ATOM   1224 O  O   . CYS B 1 6   ? -2.869  47.945 -12.882 1.00 24.12 ? 6   CYS B O   1 
ATOM   1225 C  CB  . CYS B 1 6   ? -4.683  45.376 -12.876 1.00 28.80 ? 6   CYS B CB  1 
ATOM   1226 S  SG  . CYS B 1 6   ? -6.362  44.756 -13.013 1.00 33.97 ? 6   CYS B SG  1 
ATOM   1227 N  N   . GLY B 1 7   ? -2.265  46.588 -11.185 1.00 21.24 ? 7   GLY B N   1 
ATOM   1228 C  CA  . GLY B 1 7   ? -0.910  47.086 -11.179 1.00 19.38 ? 7   GLY B CA  1 
ATOM   1229 C  C   . GLY B 1 7   ? 0.023   46.124 -10.539 1.00 18.08 ? 7   GLY B C   1 
ATOM   1230 O  O   . GLY B 1 7   ? -0.366  45.007 -10.168 1.00 17.63 ? 7   GLY B O   1 
ATOM   1231 N  N   . LEU B 1 8   ? 1.271   46.553 -10.439 1.00 16.98 ? 8   LEU B N   1 
ATOM   1232 C  CA  . LEU B 1 8   ? 2.294   45.747 -9.844  1.00 16.72 ? 8   LEU B CA  1 
ATOM   1233 C  C   . LEU B 1 8   ? 2.924   46.516 -8.701  1.00 16.81 ? 8   LEU B C   1 
ATOM   1234 O  O   . LEU B 1 8   ? 3.318   47.669 -8.864  1.00 17.70 ? 8   LEU B O   1 
ATOM   1235 C  CB  . LEU B 1 8   ? 3.346   45.357 -10.897 1.00 16.92 ? 8   LEU B CB  1 
ATOM   1236 C  CG  . LEU B 1 8   ? 2.887   44.471 -12.076 1.00 18.22 ? 8   LEU B CG  1 
ATOM   1237 C  CD1 . LEU B 1 8   ? 4.005   44.291 -13.123 1.00 18.69 ? 8   LEU B CD1 1 
ATOM   1238 C  CD2 . LEU B 1 8   ? 2.363   43.103 -11.613 1.00 17.81 ? 8   LEU B CD2 1 
ATOM   1239 N  N   . ILE B 1 9   ? 3.030   45.882 -7.542  1.00 16.75 ? 9   ILE B N   1 
ATOM   1240 C  CA  . ILE B 1 9   ? 3.927   46.379 -6.518  1.00 16.80 ? 9   ILE B CA  1 
ATOM   1241 C  C   . ILE B 1 9   ? 5.358   46.007 -6.937  1.00 16.76 ? 9   ILE B C   1 
ATOM   1242 O  O   . ILE B 1 9   ? 5.815   44.891 -6.724  1.00 16.39 ? 9   ILE B O   1 
ATOM   1243 C  CB  . ILE B 1 9   ? 3.558   45.794 -5.128  1.00 17.79 ? 9   ILE B CB  1 
ATOM   1244 C  CG1 . ILE B 1 9   ? 2.168   46.321 -4.698  1.00 18.51 ? 9   ILE B CG1 1 
ATOM   1245 C  CG2 . ILE B 1 9   ? 4.629   46.138 -4.077  1.00 18.04 ? 9   ILE B CG2 1 
ATOM   1246 C  CD1 . ILE B 1 9   ? 1.501   45.422 -3.654  1.00 20.04 ? 9   ILE B CD1 1 
ATOM   1247 N  N   . ILE B 1 10  ? 6.025   46.971 -7.567  1.00 16.68 ? 10  ILE B N   1 
ATOM   1248 C  CA  . ILE B 1 10  ? 7.368   46.826 -8.105  1.00 16.79 ? 10  ILE B CA  1 
ATOM   1249 C  C   . ILE B 1 10  ? 8.361   46.954 -6.949  1.00 16.76 ? 10  ILE B C   1 
ATOM   1250 O  O   . ILE B 1 10  ? 8.265   47.899 -6.124  1.00 17.26 ? 10  ILE B O   1 
ATOM   1251 C  CB  . ILE B 1 10  ? 7.644   47.933 -9.145  1.00 17.57 ? 10  ILE B CB  1 
ATOM   1252 C  CG1 . ILE B 1 10  ? 6.691   47.794 -10.361 1.00 18.00 ? 10  ILE B CG1 1 
ATOM   1253 C  CG2 . ILE B 1 10  ? 9.101   47.917 -9.598  1.00 18.33 ? 10  ILE B CG2 1 
ATOM   1254 C  CD1 . ILE B 1 10  ? 6.926   46.568 -11.211 1.00 19.07 ? 10  ILE B CD1 1 
ATOM   1255 N  N   . PHE B 1 11  ? 9.271   45.992 -6.839  1.00 16.23 ? 11  PHE B N   1 
ATOM   1256 C  CA  . PHE B 1 11  ? 10.297  46.098 -5.808  1.00 17.83 ? 11  PHE B CA  1 
ATOM   1257 C  C   . PHE B 1 11  ? 11.659  45.714 -6.362  1.00 18.51 ? 11  PHE B C   1 
ATOM   1258 O  O   . PHE B 1 11  ? 11.752  45.058 -7.393  1.00 17.81 ? 11  PHE B O   1 
ATOM   1259 C  CB  . PHE B 1 11  ? 9.967   45.265 -4.540  1.00 18.24 ? 11  PHE B CB  1 
ATOM   1260 C  CG  . PHE B 1 11  ? 10.147  43.780 -4.717  1.00 18.83 ? 11  PHE B CG  1 
ATOM   1261 C  CD1 . PHE B 1 11  ? 9.142   43.012 -5.282  1.00 18.65 ? 11  PHE B CD1 1 
ATOM   1262 C  CD2 . PHE B 1 11  ? 11.306  43.155 -4.288  1.00 20.09 ? 11  PHE B CD2 1 
ATOM   1263 C  CE1 . PHE B 1 11  ? 9.310   41.639 -5.424  1.00 20.19 ? 11  PHE B CE1 1 
ATOM   1264 C  CE2 . PHE B 1 11  ? 11.490  41.791 -4.427  1.00 21.45 ? 11  PHE B CE2 1 
ATOM   1265 C  CZ  . PHE B 1 11  ? 10.495  41.033 -5.010  1.00 21.36 ? 11  PHE B CZ  1 
ATOM   1266 N  N   . ARG B 1 12  ? 12.704  46.144 -5.667  1.00 20.39 ? 12  ARG B N   1 
ATOM   1267 C  CA  . ARG B 1 12  ? 14.056  45.715 -5.982  1.00 23.29 ? 12  ARG B CA  1 
ATOM   1268 C  C   . ARG B 1 12  ? 14.691  45.313 -4.677  1.00 25.76 ? 12  ARG B C   1 
ATOM   1269 O  O   . ARG B 1 12  ? 14.255  45.753 -3.601  1.00 25.55 ? 12  ARG B O   1 
ATOM   1270 C  CB  . ARG B 1 12  ? 14.867  46.858 -6.624  1.00 24.23 ? 12  ARG B CB  1 
ATOM   1271 C  CG  . ARG B 1 12  ? 15.090  48.106 -5.744  1.00 24.25 ? 12  ARG B CG  1 
ATOM   1272 C  CD  . ARG B 1 12  ? 15.845  49.180 -6.521  1.00 26.22 ? 12  ARG B CD  1 
ATOM   1273 N  NE  . ARG B 1 12  ? 16.192  50.350 -5.706  1.00 27.81 ? 12  ARG B NE  1 
ATOM   1274 C  CZ  . ARG B 1 12  ? 16.728  51.483 -6.163  1.00 29.84 ? 12  ARG B CZ  1 
ATOM   1275 N  NH1 . ARG B 1 12  ? 17.008  51.636 -7.456  1.00 30.25 ? 12  ARG B NH1 1 
ATOM   1276 N  NH2 . ARG B 1 12  ? 16.986  52.475 -5.315  1.00 30.25 ? 12  ARG B NH2 1 
ATOM   1277 N  N   . ARG B 1 13  ? 15.727  44.501 -4.772  1.00 29.49 ? 13  ARG B N   1 
ATOM   1278 C  CA  . ARG B 1 13  ? 16.423  44.017 -3.593  1.00 35.54 ? 13  ARG B CA  1 
ATOM   1279 C  C   . ARG B 1 13  ? 17.910  44.351 -3.681  1.00 40.51 ? 13  ARG B C   1 
ATOM   1280 O  O   . ARG B 1 13  ? 18.548  44.123 -4.705  1.00 41.48 ? 13  ARG B O   1 
ATOM   1281 C  CB  . ARG B 1 13  ? 16.213  42.522 -3.470  1.00 37.70 ? 13  ARG B CB  1 
ATOM   1282 C  CG  . ARG B 1 13  ? 16.095  41.999 -2.064  1.00 43.10 ? 13  ARG B CG  1 
ATOM   1283 C  CD  . ARG B 1 13  ? 16.153  40.469 -2.035  1.00 46.74 ? 13  ARG B CD  1 
ATOM   1284 N  NE  . ARG B 1 13  ? 15.250  39.814 -2.992  1.00 43.70 ? 13  ARG B NE  1 
ATOM   1285 C  CZ  . ARG B 1 13  ? 14.094  39.231 -2.667  0.80 45.24 ? 13  ARG B CZ  1 
ATOM   1286 N  NH1 . ARG B 1 13  ? 13.657  39.228 -1.408  0.80 46.05 ? 13  ARG B NH1 1 
ATOM   1287 N  NH2 . ARG B 1 13  ? 13.357  38.649 -3.604  0.80 43.01 ? 13  ARG B NH2 1 
ATOM   1288 N  N   . CYS B 1 14  ? 18.462  44.864 -2.592  1.00 47.82 ? 14  CYS B N   1 
ATOM   1289 C  CA  . CYS B 1 14  ? 19.884  45.211 -2.538  1.00 56.70 ? 14  CYS B CA  1 
ATOM   1290 C  C   . CYS B 1 14  ? 20.737  44.110 -1.924  1.00 60.01 ? 14  CYS B C   1 
ATOM   1291 O  O   . CYS B 1 14  ? 20.649  43.858 -0.737  1.00 61.48 ? 14  CYS B O   1 
ATOM   1292 C  CB  . CYS B 1 14  ? 20.074  46.499 -1.729  1.00 60.61 ? 14  CYS B CB  1 
ATOM   1293 S  SG  . CYS B 1 14  ? 21.797  46.968 -1.448  0.90 73.47 ? 14  CYS B SG  1 
ATOM   1294 N  N   . LEU B 1 15  ? 21.588  43.480 -2.723  1.00 66.51 ? 15  LEU B N   1 
ATOM   1295 C  CA  . LEU B 1 15  ? 22.526  42.492 -2.180  1.00 76.61 ? 15  LEU B CA  1 
ATOM   1296 C  C   . LEU B 1 15  ? 23.567  43.134 -1.246  1.00 79.91 ? 15  LEU B C   1 
ATOM   1297 O  O   . LEU B 1 15  ? 23.895  42.568 -0.200  0.50 82.49 ? 15  LEU B O   1 
ATOM   1298 C  CB  . LEU B 1 15  ? 23.207  41.685 -3.301  1.00 77.71 ? 15  LEU B CB  1 
ATOM   1299 C  CG  . LEU B 1 15  ? 24.245  40.614 -2.923  0.60 76.83 ? 15  LEU B CG  1 
ATOM   1300 C  CD1 . LEU B 1 15  ? 23.721  39.651 -1.862  0.60 77.65 ? 15  LEU B CD1 1 
ATOM   1301 C  CD2 . LEU B 1 15  ? 24.692  39.849 -4.162  0.30 77.81 ? 15  LEU B CD2 1 
ATOM   1302 N  N   . ILE B 1 16  ? 24.072  44.311 -1.626  1.00 81.62 ? 16  ILE B N   1 
ATOM   1303 C  CA  . ILE B 1 16  ? 25.020  45.067 -0.794  1.00 85.77 ? 16  ILE B CA  1 
ATOM   1304 C  C   . ILE B 1 16  ? 24.286  45.595 0.450   1.00 91.59 ? 16  ILE B C   1 
ATOM   1305 O  O   . ILE B 1 16  ? 23.048  45.665 0.448   0.50 92.91 ? 16  ILE B O   1 
ATOM   1306 C  CB  . ILE B 1 16  ? 25.716  46.217 -1.586  1.00 83.92 ? 16  ILE B CB  1 
ATOM   1307 C  CG1 . ILE B 1 16  ? 24.884  47.511 -1.570  1.00 84.55 ? 16  ILE B CG1 1 
ATOM   1308 C  CG2 . ILE B 1 16  ? 26.032  45.806 -3.023  1.00 80.78 ? 16  ILE B CG2 1 
ATOM   1309 C  CD1 . ILE B 1 16  ? 25.436  48.594 -0.662  1.00 85.35 ? 16  ILE B CD1 1 
ATOM   1310 N  N   . PRO B 1 17  ? 25.039  45.956 1.484   1.00 95.59 ? 17  PRO B N   1 
ATOM   1311 C  CA  . PRO B 1 17  ? 24.449  46.475 2.723   1.00 96.09 ? 17  PRO B CA  1 
ATOM   1312 C  C   . PRO B 1 17  ? 23.707  47.787 2.490   1.00 93.03 ? 17  PRO B C   1 
ATOM   1313 O  O   . PRO B 1 17  ? 24.320  48.781 2.101   1.00 98.11 ? 17  PRO B O   1 
ATOM   1314 C  CB  . PRO B 1 17  ? 25.670  46.712 3.613   1.00 99.21 ? 17  PRO B CB  1 
ATOM   1315 C  CG  . PRO B 1 17  ? 26.677  45.726 3.130   1.00 99.27 ? 17  PRO B CG  1 
ATOM   1316 C  CD  . PRO B 1 17  ? 26.463  45.616 1.647   1.00 98.60 ? 17  PRO B CD  1 
ATOM   1317 N  N   . LYS B 1 18  ? 22.400  47.783 2.729   1.00 87.28 ? 18  LYS B N   1 
ATOM   1318 C  CA  . LYS B 1 18  ? 21.583  48.977 2.544   1.00 83.00 ? 18  LYS B CA  1 
ATOM   1319 C  C   . LYS B 1 18  ? 20.399  48.990 3.505   1.00 81.37 ? 18  LYS B C   1 
ATOM   1320 O  O   . LYS B 1 18  ? 20.131  48.002 4.188   1.00 82.97 ? 18  LYS B O   1 
ATOM   1321 C  CB  . LYS B 1 18  ? 21.089  49.068 1.099   1.00 77.77 ? 18  LYS B CB  1 
ATOM   1322 C  CG  . LYS B 1 18  ? 21.962  49.926 0.197   0.01 76.21 ? 18  LYS B CG  1 
ATOM   1323 C  CD  . LYS B 1 18  ? 21.566  49.773 -1.263  0.01 71.73 ? 18  LYS B CD  1 
ATOM   1324 C  CE  . LYS B 1 18  ? 22.600  50.400 -2.184  1.00 70.73 ? 18  LYS B CE  1 
ATOM   1325 N  NZ  . LYS B 1 18  ? 22.793  49.603 -3.426  1.00 67.16 ? 18  LYS B NZ  1 
ATOM   1326 N  N   . ASN B 1 22  ? 17.244  48.849 4.819   0.60 57.76 ? 22  ASN B N   1 
ATOM   1327 C  CA  . ASN B 1 22  ? 16.296  47.914 4.212   0.30 55.60 ? 22  ASN B CA  1 
ATOM   1328 C  C   . ASN B 1 22  ? 16.867  47.189 3.000   0.30 52.17 ? 22  ASN B C   1 
ATOM   1329 O  O   . ASN B 1 22  ? 17.497  47.803 2.130   0.30 50.51 ? 22  ASN B O   1 
ATOM   1330 C  CB  . ASN B 1 22  ? 14.978  48.607 3.822   0.30 56.83 ? 22  ASN B CB  1 
ATOM   1331 C  CG  . ASN B 1 22  ? 15.120  50.116 3.696   1.00 59.99 ? 22  ASN B CG  1 
ATOM   1332 O  OD1 . ASN B 1 22  ? 14.898  50.848 4.666   1.00 62.22 ? 22  ASN B OD1 1 
ATOM   1333 N  ND2 . ASN B 1 22  ? 15.481  50.592 2.496   1.00 57.24 ? 22  ASN B ND2 1 
ATOM   1334 N  N   . ALA B 1 23  ? 16.651  45.876 2.960   1.00 51.54 ? 23  ALA B N   1 
ATOM   1335 C  CA  . ALA B 1 23  ? 16.960  45.094 1.782   1.00 48.53 ? 23  ALA B CA  1 
ATOM   1336 C  C   . ALA B 1 23  ? 15.942  45.398 0.669   1.00 43.73 ? 23  ALA B C   1 
ATOM   1337 O  O   . ALA B 1 23  ? 16.323  45.484 -0.492  1.00 42.05 ? 23  ALA B O   1 
ATOM   1338 C  CB  . ALA B 1 23  ? 16.978  43.604 2.108   1.00 50.67 ? 23  ALA B CB  1 
ATOM   1339 N  N   . ILE B 1 24  ? 14.666  45.577 1.019   1.00 34.46 ? 24  ILE B N   1 
ATOM   1340 C  CA  . ILE B 1 24  ? 13.623  45.740 -0.009  1.00 29.76 ? 24  ILE B CA  1 
ATOM   1341 C  C   . ILE B 1 24  ? 13.181  47.192 -0.190  1.00 27.37 ? 24  ILE B C   1 
ATOM   1342 O  O   . ILE B 1 24  ? 12.892  47.902 0.788   1.00 27.15 ? 24  ILE B O   1 
ATOM   1343 C  CB  . ILE B 1 24  ? 12.391  44.820 0.258   1.00 29.21 ? 24  ILE B CB  1 
ATOM   1344 C  CG1 . ILE B 1 24  ? 12.810  43.347 0.243   1.00 29.91 ? 24  ILE B CG1 1 
ATOM   1345 C  CG2 . ILE B 1 24  ? 11.287  45.080 -0.761  1.00 26.50 ? 24  ILE B CG2 1 
ATOM   1346 C  CD1 . ILE B 1 24  ? 11.958  42.443 1.117   1.00 32.24 ? 24  ILE B CD1 1 
ATOM   1347 N  N   . GLU B 1 25  ? 13.141  47.630 -1.443  1.00 23.99 ? 25  GLU B N   1 
ATOM   1348 C  CA  . GLU B 1 25  ? 12.597  48.926 -1.775  1.00 23.10 ? 25  GLU B CA  1 
ATOM   1349 C  C   . GLU B 1 25  ? 11.483  48.791 -2.792  1.00 20.09 ? 25  GLU B C   1 
ATOM   1350 O  O   . GLU B 1 25  ? 11.566  47.982 -3.692  1.00 18.87 ? 25  GLU B O   1 
ATOM   1351 C  CB  . GLU B 1 25  ? 13.680  49.897 -2.289  1.00 23.72 ? 25  GLU B CB  1 
ATOM   1352 C  CG  . GLU B 1 25  ? 14.757  50.175 -1.244  1.00 27.86 ? 25  GLU B CG  1 
ATOM   1353 C  CD  . GLU B 1 25  ? 15.826  51.125 -1.760  1.00 30.36 ? 25  GLU B CD  1 
ATOM   1354 O  OE1 . GLU B 1 25  ? 16.282  51.953 -0.959  1.00 34.38 ? 25  GLU B OE1 1 
ATOM   1355 O  OE2 . GLU B 1 25  ? 16.189  51.073 -2.953  1.00 29.57 ? 25  GLU B OE2 1 
ATOM   1356 N  N   . PHE B 1 26  ? 10.475  49.639 -2.654  1.00 18.95 ? 26  PHE B N   1 
ATOM   1357 C  CA  . PHE B 1 26  ? 9.312   49.662 -3.508  1.00 17.45 ? 26  PHE B CA  1 
ATOM   1358 C  C   . PHE B 1 26  ? 9.300   50.934 -4.312  1.00 18.11 ? 26  PHE B C   1 
ATOM   1359 O  O   . PHE B 1 26  ? 9.667   52.014 -3.776  1.00 18.48 ? 26  PHE B O   1 
ATOM   1360 C  CB  . PHE B 1 26  ? 8.057   49.664 -2.632  1.00 17.60 ? 26  PHE B CB  1 
ATOM   1361 C  CG  . PHE B 1 26  ? 7.937   48.451 -1.761  1.00 18.52 ? 26  PHE B CG  1 
ATOM   1362 C  CD1 . PHE B 1 26  ? 7.435   47.277 -2.291  1.00 18.14 ? 26  PHE B CD1 1 
ATOM   1363 C  CD2 . PHE B 1 26  ? 8.327   48.479 -0.402  1.00 20.50 ? 26  PHE B CD2 1 
ATOM   1364 C  CE1 . PHE B 1 26  ? 7.304   46.138 -1.508  1.00 19.27 ? 26  PHE B CE1 1 
ATOM   1365 C  CE2 . PHE B 1 26  ? 8.209   47.332 0.387   1.00 20.98 ? 26  PHE B CE2 1 
ATOM   1366 C  CZ  . PHE B 1 26  ? 7.717   46.155 -0.186  1.00 20.64 ? 26  PHE B CZ  1 
ATOM   1367 N  N   . LEU B 1 27  ? 8.867   50.822 -5.572  1.00 16.96 ? 27  LEU B N   1 
ATOM   1368 C  CA  . LEU B 1 27  ? 8.740   51.957 -6.456  1.00 17.75 ? 27  LEU B CA  1 
ATOM   1369 C  C   . LEU B 1 27  ? 7.353   52.550 -6.308  1.00 17.77 ? 27  LEU B C   1 
ATOM   1370 O  O   . LEU B 1 27  ? 6.358   51.832 -6.412  1.00 16.43 ? 27  LEU B O   1 
ATOM   1371 C  CB  . LEU B 1 27  ? 8.970   51.531 -7.923  1.00 17.96 ? 27  LEU B CB  1 
ATOM   1372 C  CG  . LEU B 1 27  ? 8.806   52.578 -9.030  1.00 18.86 ? 27  LEU B CG  1 
ATOM   1373 C  CD1 . LEU B 1 27  ? 9.948   53.597 -8.977  1.00 21.00 ? 27  LEU B CD1 1 
ATOM   1374 C  CD2 . LEU B 1 27  ? 8.806   51.866 -10.379 1.00 19.64 ? 27  LEU B CD2 1 
ATOM   1375 N  N   . LEU B 1 28  ? 7.285   53.859 -6.040  1.00 18.29 ? 28  LEU B N   1 
ATOM   1376 C  CA  . LEU B 1 28  ? 6.012   54.568 -5.991  1.00 18.78 ? 28  LEU B CA  1 
ATOM   1377 C  C   . LEU B 1 28  ? 6.088   55.747 -6.940  1.00 20.59 ? 28  LEU B C   1 
ATOM   1378 O  O   . LEU B 1 28  ? 7.130   56.386 -7.072  1.00 20.11 ? 28  LEU B O   1 
ATOM   1379 C  CB  . LEU B 1 28  ? 5.681   55.075 -4.568  1.00 19.81 ? 28  LEU B CB  1 
ATOM   1380 C  CG  . LEU B 1 28  ? 5.379   54.080 -3.432  1.00 20.23 ? 28  LEU B CG  1 
ATOM   1381 C  CD1 . LEU B 1 28  ? 5.078   54.800 -2.113  1.00 21.55 ? 28  LEU B CD1 1 
ATOM   1382 C  CD2 . LEU B 1 28  ? 4.210   53.164 -3.743  1.00 19.63 ? 28  LEU B CD2 1 
ATOM   1383 N  N   . LEU B 1 29  ? 4.966   56.041 -7.589  1.00 21.31 ? 29  LEU B N   1 
ATOM   1384 C  CA  . LEU B 1 29  ? 4.898   57.132 -8.568  1.00 23.09 ? 29  LEU B CA  1 
ATOM   1385 C  C   . LEU B 1 29  ? 3.976   58.191 -7.998  1.00 24.82 ? 29  LEU B C   1 
ATOM   1386 O  O   . LEU B 1 29  ? 2.980   57.852 -7.365  1.00 24.24 ? 29  LEU B O   1 
ATOM   1387 C  CB  . LEU B 1 29  ? 4.351   56.624 -9.891  1.00 22.37 ? 29  LEU B CB  1 
ATOM   1388 C  CG  . LEU B 1 29  ? 4.993   55.368 -10.482 1.00 21.66 ? 29  LEU B CG  1 
ATOM   1389 C  CD1 . LEU B 1 29  ? 4.238   54.978 -11.770 1.00 22.50 ? 29  LEU B CD1 1 
ATOM   1390 C  CD2 . LEU B 1 29  ? 6.469   55.547 -10.746 1.00 21.93 ? 29  LEU B CD2 1 
ATOM   1391 N  N   . GLN B 1 30  ? 4.315   59.469 -8.166  1.00 27.11 ? 30  GLN B N   1 
ATOM   1392 C  CA  . GLN B 1 30  ? 3.453   60.544 -7.652  1.00 29.23 ? 30  GLN B CA  1 
ATOM   1393 C  C   . GLN B 1 30  ? 2.567   61.087 -8.770  1.00 30.89 ? 30  GLN B C   1 
ATOM   1394 O  O   . GLN B 1 30  ? 3.086   61.560 -9.774  1.00 30.40 ? 30  GLN B O   1 
ATOM   1395 C  CB  . GLN B 1 30  ? 4.288   61.701 -7.090  1.00 29.55 ? 30  GLN B CB  1 
ATOM   1396 C  CG  . GLN B 1 30  ? 3.422   62.824 -6.549  1.00 30.98 ? 30  GLN B CG  1 
ATOM   1397 C  CD  . GLN B 1 30  ? 4.233   63.958 -5.951  1.00 33.16 ? 30  GLN B CD  1 
ATOM   1398 O  OE1 . GLN B 1 30  ? 5.316   64.300 -6.438  1.00 33.43 ? 30  GLN B OE1 1 
ATOM   1399 N  NE2 . GLN B 1 30  ? 3.701   64.555 -4.899  1.00 35.31 ? 30  GLN B NE2 1 
ATOM   1400 N  N   . ALA B 1 31  ? 1.244   61.022 -8.593  1.00 32.76 ? 31  ALA B N   1 
ATOM   1401 C  CA  . ALA B 1 31  ? 0.307   61.536 -9.609  1.00 34.85 ? 31  ALA B CA  1 
ATOM   1402 C  C   . ALA B 1 31  ? 0.540   63.037 -9.928  1.00 38.02 ? 31  ALA B C   1 
ATOM   1403 O  O   . ALA B 1 31  ? 0.843   63.829 -9.037  1.00 37.25 ? 31  ALA B O   1 
ATOM   1404 C  CB  . ALA B 1 31  ? -1.128  61.288 -9.168  1.00 34.01 ? 31  ALA B CB  1 
ATOM   1405 N  N   . SER B 1 32  ? 0.409   63.399 -11.203 1.00 41.15 ? 32  SER B N   1 
ATOM   1406 C  CA  . SER B 1 32  ? 0.467   64.805 -11.649 1.00 46.62 ? 32  SER B CA  1 
ATOM   1407 C  C   . SER B 1 32  ? -0.720  65.670 -11.221 1.00 49.82 ? 32  SER B C   1 
ATOM   1408 O  O   . SER B 1 32  ? -0.565  66.862 -10.971 1.00 51.08 ? 32  SER B O   1 
ATOM   1409 C  CB  . SER B 1 32  ? 0.529   64.859 -13.164 1.00 47.05 ? 32  SER B CB  1 
ATOM   1410 O  OG  . SER B 1 32  ? 1.744   64.328 -13.603 1.00 48.84 ? 32  SER B OG  1 
ATOM   1411 N  N   . ASP B 1 33  ? -1.905  65.069 -11.183 1.00 53.87 ? 33  ASP B N   1 
ATOM   1412 C  CA  . ASP B 1 33  ? -3.142  65.801 -10.920 1.00 58.32 ? 33  ASP B CA  1 
ATOM   1413 C  C   . ASP B 1 33  ? -3.598  65.653 -9.470  1.00 60.39 ? 33  ASP B C   1 
ATOM   1414 O  O   . ASP B 1 33  ? -2.962  64.948 -8.676  1.00 56.70 ? 33  ASP B O   1 
ATOM   1415 C  CB  . ASP B 1 33  ? -4.249  65.345 -11.879 1.00 62.01 ? 33  ASP B CB  1 
ATOM   1416 C  CG  . ASP B 1 33  ? -4.563  63.852 -11.759 1.00 64.30 ? 33  ASP B CG  1 
ATOM   1417 O  OD1 . ASP B 1 33  ? -4.323  63.254 -10.678 1.00 65.20 ? 33  ASP B OD1 1 
ATOM   1418 O  OD2 . ASP B 1 33  ? -5.052  63.266 -12.756 1.00 65.47 ? 33  ASP B OD2 1 
ATOM   1419 N  N   . GLY B 1 34  ? -4.694  66.340 -9.139  1.00 61.65 ? 34  GLY B N   1 
ATOM   1420 C  CA  . GLY B 1 34  ? -5.361  66.204 -7.847  1.00 60.06 ? 34  GLY B CA  1 
ATOM   1421 C  C   . GLY B 1 34  ? -4.457  66.502 -6.663  1.00 59.37 ? 34  GLY B C   1 
ATOM   1422 O  O   . GLY B 1 34  ? -3.697  67.477 -6.678  1.00 61.51 ? 34  GLY B O   1 
ATOM   1423 N  N   . ILE B 1 35  ? -4.542  65.638 -5.652  1.00 58.33 ? 35  ILE B N   1 
ATOM   1424 C  CA  . ILE B 1 35  ? -3.801  65.781 -4.390  1.00 58.81 ? 35  ILE B CA  1 
ATOM   1425 C  C   . ILE B 1 35  ? -2.349  65.240 -4.495  1.00 55.09 ? 35  ILE B C   1 
ATOM   1426 O  O   . ILE B 1 35  ? -1.586  65.274 -3.515  1.00 56.08 ? 35  ILE B O   1 
ATOM   1427 C  CB  . ILE B 1 35  ? -4.564  65.091 -3.212  1.00 59.09 ? 35  ILE B CB  1 
ATOM   1428 C  CG1 . ILE B 1 35  ? -6.083  65.095 -3.433  0.01 60.31 ? 35  ILE B CG1 1 
ATOM   1429 C  CG2 . ILE B 1 35  ? -4.228  65.744 -1.883  1.00 60.89 ? 35  ILE B CG2 1 
ATOM   1430 C  CD1 . ILE B 1 35  ? -6.634  63.804 -4.006  0.01 59.04 ? 35  ILE B CD1 1 
ATOM   1431 N  N   . HIS B 1 36  ? -1.981  64.762 -5.688  1.00 50.63 ? 36  HIS B N   1 
ATOM   1432 C  CA  . HIS B 1 36  ? -0.658  64.170 -5.979  1.00 46.80 ? 36  HIS B CA  1 
ATOM   1433 C  C   . HIS B 1 36  ? -0.374  62.954 -5.129  1.00 42.22 ? 36  HIS B C   1 
ATOM   1434 O  O   . HIS B 1 36  ? 0.646   62.893 -4.446  1.00 41.39 ? 36  HIS B O   1 
ATOM   1435 C  CB  . HIS B 1 36  ? 0.462   65.201 -5.821  1.00 48.50 ? 36  HIS B CB  1 
ATOM   1436 C  CG  . HIS B 1 36  ? 0.207   66.507 -6.536  1.00 53.40 ? 36  HIS B CG  1 
ATOM   1437 N  ND1 . HIS B 1 36  ? 0.355   66.647 -7.867  1.00 54.59 ? 36  HIS B ND1 1 
ATOM   1438 C  CD2 . HIS B 1 36  ? -0.172  67.756 -6.050  1.00 56.03 ? 36  HIS B CD2 1 
ATOM   1439 C  CE1 . HIS B 1 36  ? 0.068   67.918 -8.216  1.00 57.01 ? 36  HIS B CE1 1 
ATOM   1440 N  NE2 . HIS B 1 36  ? -0.254  68.592 -7.104  1.00 57.90 ? 36  HIS B NE2 1 
ATOM   1441 N  N   . HIS B 1 37  ? -1.292  61.990 -5.161  1.00 39.73 ? 37  HIS B N   1 
ATOM   1442 C  CA  . HIS B 1 37  ? -1.151  60.710 -4.466  1.00 37.98 ? 37  HIS B CA  1 
ATOM   1443 C  C   . HIS B 1 37  ? 0.008   59.861 -4.978  1.00 33.75 ? 37  HIS B C   1 
ATOM   1444 O  O   . HIS B 1 37  ? 0.376   59.920 -6.148  1.00 32.90 ? 37  HIS B O   1 
ATOM   1445 C  CB  . HIS B 1 37  ? -2.448  59.912 -4.572  1.00 38.37 ? 37  HIS B CB  1 
ATOM   1446 C  CG  . HIS B 1 37  ? -3.617  60.534 -3.842  0.70 42.90 ? 37  HIS B CG  1 
ATOM   1447 N  ND1 . HIS B 1 37  ? -4.902  60.253 -4.160  0.70 43.67 ? 37  HIS B ND1 1 
ATOM   1448 C  CD2 . HIS B 1 37  ? -3.661  61.460 -2.792  0.70 44.36 ? 37  HIS B CD2 1 
ATOM   1449 C  CE1 . HIS B 1 37  ? -5.724  60.945 -3.347  0.70 46.18 ? 37  HIS B CE1 1 
ATOM   1450 N  NE2 . HIS B 1 37  ? -4.961  61.684 -2.509  0.70 46.47 ? 37  HIS B NE2 1 
ATOM   1451 N  N   . TRP B 1 38  ? 0.573   59.058 -4.080  1.00 30.91 ? 38  TRP B N   1 
ATOM   1452 C  CA  . TRP B 1 38  ? 1.658   58.129 -4.399  1.00 27.92 ? 38  TRP B CA  1 
ATOM   1453 C  C   . TRP B 1 38  ? 1.149   56.722 -4.404  1.00 25.75 ? 38  TRP B C   1 
ATOM   1454 O  O   . TRP B 1 38  ? 0.592   56.262 -3.403  1.00 25.25 ? 38  TRP B O   1 
ATOM   1455 C  CB  . TRP B 1 38  ? 2.743   58.225 -3.343  1.00 27.26 ? 38  TRP B CB  1 
ATOM   1456 C  CG  . TRP B 1 38  ? 3.531   59.509 -3.337  1.00 28.36 ? 38  TRP B CG  1 
ATOM   1457 C  CD1 . TRP B 1 38  ? 3.229   60.704 -2.663  1.00 29.40 ? 38  TRP B CD1 1 
ATOM   1458 C  CD2 . TRP B 1 38  ? 4.825   59.758 -4.010  1.00 27.51 ? 38  TRP B CD2 1 
ATOM   1459 N  NE1 . TRP B 1 38  ? 4.209   61.637 -2.870  1.00 30.26 ? 38  TRP B NE1 1 
ATOM   1460 C  CE2 . TRP B 1 38  ? 5.203   61.140 -3.669  1.00 29.38 ? 38  TRP B CE2 1 
ATOM   1461 C  CE3 . TRP B 1 38  ? 5.672   59.001 -4.821  1.00 25.84 ? 38  TRP B CE3 1 
ATOM   1462 C  CZ2 . TRP B 1 38  ? 6.383   61.718 -4.139  1.00 29.04 ? 38  TRP B CZ2 1 
ATOM   1463 C  CZ3 . TRP B 1 38  ? 6.869   59.585 -5.279  1.00 26.40 ? 38  TRP B CZ3 1 
ATOM   1464 C  CH2 . TRP B 1 38  ? 7.216   60.912 -4.936  1.00 28.76 ? 38  TRP B CH2 1 
ATOM   1465 N  N   . THR B 1 39  ? 1.353   56.014 -5.515  1.00 24.36 ? 39  THR B N   1 
ATOM   1466 C  CA  . THR B 1 39  ? 0.949   54.596 -5.614  1.00 23.87 ? 39  THR B CA  1 
ATOM   1467 C  C   . THR B 1 39  ? 1.970   53.839 -6.478  1.00 21.93 ? 39  THR B C   1 
ATOM   1468 O  O   . THR B 1 39  ? 2.720   54.461 -7.249  1.00 21.04 ? 39  THR B O   1 
ATOM   1469 C  CB  . THR B 1 39  ? -0.450  54.413 -6.265  1.00 25.25 ? 39  THR B CB  1 
ATOM   1470 O  OG1 . THR B 1 39  ? -0.384  54.802 -7.637  1.00 27.89 ? 39  THR B OG1 1 
ATOM   1471 C  CG2 . THR B 1 39  ? -1.550  55.256 -5.577  1.00 27.77 ? 39  THR B CG2 1 
ATOM   1472 N  N   . PRO B 1 40  ? 1.986   52.491 -6.379  1.00 21.06 ? 40  PRO B N   1 
ATOM   1473 C  CA  . PRO B 1 40  ? 2.797   51.686 -7.309  1.00 19.88 ? 40  PRO B CA  1 
ATOM   1474 C  C   . PRO B 1 40  ? 2.202   51.789 -8.701  1.00 20.07 ? 40  PRO B C   1 
ATOM   1475 O  O   . PRO B 1 40  ? 1.097   52.271 -8.830  1.00 19.83 ? 40  PRO B O   1 
ATOM   1476 C  CB  . PRO B 1 40  ? 2.638   50.245 -6.771  1.00 18.88 ? 40  PRO B CB  1 
ATOM   1477 C  CG  . PRO B 1 40  ? 2.122   50.395 -5.376  1.00 19.56 ? 40  PRO B CG  1 
ATOM   1478 C  CD  . PRO B 1 40  ? 1.244   51.628 -5.428  1.00 20.19 ? 40  PRO B CD  1 
ATOM   1479 N  N   . PRO B 1 41  ? 2.916   51.327 -9.760  1.00 20.44 ? 41  PRO B N   1 
ATOM   1480 C  CA  . PRO B 1 41  ? 2.310   51.518 -11.088 1.00 21.16 ? 41  PRO B CA  1 
ATOM   1481 C  C   . PRO B 1 41  ? 0.970   50.785 -11.266 1.00 22.76 ? 41  PRO B C   1 
ATOM   1482 O  O   . PRO B 1 41  ? 0.844   49.624 -10.849 1.00 20.79 ? 41  PRO B O   1 
ATOM   1483 C  CB  . PRO B 1 41  ? 3.351   50.905 -12.035 1.00 21.83 ? 41  PRO B CB  1 
ATOM   1484 C  CG  . PRO B 1 41  ? 4.646   51.037 -11.304 1.00 21.83 ? 41  PRO B CG  1 
ATOM   1485 C  CD  . PRO B 1 41  ? 4.278   50.775 -9.847  1.00 20.15 ? 41  PRO B CD  1 
ATOM   1486 N  N   . LYS B 1 42  ? 0.002   51.420 -11.935 1.00 24.02 ? 42  LYS B N   1 
ATOM   1487 C  CA  . LYS B 1 42  ? -1.301  50.795 -12.153 1.00 24.82 ? 42  LYS B CA  1 
ATOM   1488 C  C   . LYS B 1 42  ? -2.060  51.493 -13.265 1.00 27.75 ? 42  LYS B C   1 
ATOM   1489 O  O   . LYS B 1 42  ? -1.742  52.629 -13.612 1.00 28.70 ? 42  LYS B O   1 
ATOM   1490 C  CB  . LYS B 1 42  ? -2.140  50.841 -10.881 1.00 24.50 ? 42  LYS B CB  1 
ATOM   1491 C  CG  . LYS B 1 42  ? -2.490  52.243 -10.406 1.00 25.65 ? 42  LYS B CG  1 
ATOM   1492 C  CD  . LYS B 1 42  ? -3.457  52.164 -9.245  1.00 27.08 ? 42  LYS B CD  1 
ATOM   1493 C  CE  . LYS B 1 42  ? -3.561  53.506 -8.529  1.00 29.42 ? 42  LYS B CE  1 
ATOM   1494 N  NZ  . LYS B 1 42  ? -4.524  54.345 -9.257  1.00 32.26 ? 42  LYS B NZ  1 
ATOM   1495 N  N   . GLY B 1 43  ? -3.066  50.819 -13.815 1.00 28.04 ? 43  GLY B N   1 
ATOM   1496 C  CA  . GLY B 1 43  ? -3.988  51.474 -14.757 1.00 31.63 ? 43  GLY B CA  1 
ATOM   1497 C  C   . GLY B 1 43  ? -5.276  50.684 -14.951 1.00 32.89 ? 43  GLY B C   1 
ATOM   1498 O  O   . GLY B 1 43  ? -5.385  49.512 -14.525 1.00 29.32 ? 43  GLY B O   1 
ATOM   1499 N  N   . HIS B 1 44  ? -6.242  51.322 -15.608 1.00 35.29 ? 44  HIS B N   1 
ATOM   1500 C  CA  . HIS B 1 44  ? -7.555  50.719 -15.813 1.00 37.94 ? 44  HIS B CA  1 
ATOM   1501 C  C   . HIS B 1 44  ? -7.462  49.535 -16.731 1.00 37.00 ? 44  HIS B C   1 
ATOM   1502 O  O   . HIS B 1 44  ? -6.559  49.437 -17.562 1.00 38.19 ? 44  HIS B O   1 
ATOM   1503 C  CB  . HIS B 1 44  ? -8.567  51.747 -16.315 1.00 41.35 ? 44  HIS B CB  1 
ATOM   1504 C  CG  . HIS B 1 44  ? -8.219  52.329 -17.663 1.00 47.42 ? 44  HIS B CG  1 
ATOM   1505 N  ND1 . HIS B 1 44  ? -7.587  53.516 -17.799 1.00 49.77 ? 44  HIS B ND1 1 
ATOM   1506 C  CD2 . HIS B 1 44  ? -8.428  51.845 -18.959 1.00 49.93 ? 44  HIS B CD2 1 
ATOM   1507 C  CE1 . HIS B 1 44  ? -7.407  53.781 -19.107 0.01 51.12 ? 44  HIS B CE1 1 
ATOM   1508 N  NE2 . HIS B 1 44  ? -7.922  52.762 -19.817 1.00 52.41 ? 44  HIS B NE2 1 
ATOM   1509 N  N   . VAL B 1 45  ? -8.378  48.600 -16.541 1.00 39.39 ? 45  VAL B N   1 
ATOM   1510 C  CA  . VAL B 1 45  ? -8.447  47.397 -17.341 1.00 41.59 ? 45  VAL B CA  1 
ATOM   1511 C  C   . VAL B 1 45  ? -9.045  47.769 -18.688 1.00 46.53 ? 45  VAL B C   1 
ATOM   1512 O  O   . VAL B 1 45  ? -9.813  48.725 -18.797 1.00 46.31 ? 45  VAL B O   1 
ATOM   1513 C  CB  . VAL B 1 45  ? -9.320  46.330 -16.663 1.00 41.39 ? 45  VAL B CB  1 
ATOM   1514 C  CG1 . VAL B 1 45  ? -8.695  45.897 -15.347 1.00 38.51 ? 45  VAL B CG1 1 
ATOM   1515 C  CG2 . VAL B 1 45  ? -10.718 46.869 -16.417 1.00 43.84 ? 45  VAL B CG2 1 
ATOM   1516 N  N   . GLU B 1 46  ? -8.684  47.013 -19.714 1.00 49.38 ? 46  GLU B N   1 
ATOM   1517 C  CA  . GLU B 1 46  ? -9.157  47.288 -21.058 1.00 52.79 ? 46  GLU B CA  1 
ATOM   1518 C  C   . GLU B 1 46  ? -9.866  46.046 -21.581 1.00 56.22 ? 46  GLU B C   1 
ATOM   1519 O  O   . GLU B 1 46  ? -9.563  44.942 -21.118 1.00 53.92 ? 46  GLU B O   1 
ATOM   1520 C  CB  . GLU B 1 46  ? -7.996  47.729 -21.956 1.00 53.75 ? 46  GLU B CB  1 
ATOM   1521 C  CG  . GLU B 1 46  ? -7.601  49.196 -21.739 1.00 54.82 ? 46  GLU B CG  1 
ATOM   1522 C  CD  . GLU B 1 46  ? -6.347  49.633 -22.497 1.00 55.27 ? 46  GLU B CD  1 
ATOM   1523 O  OE1 . GLU B 1 46  ? -5.773  50.680 -22.090 1.00 55.17 ? 46  GLU B OE1 1 
ATOM   1524 O  OE2 . GLU B 1 46  ? -5.941  48.957 -23.476 0.01 56.80 ? 46  GLU B OE2 1 
ATOM   1525 N  N   . PRO B 1 47  ? -10.696 46.172 -22.609 1.00 61.24 ? 47  PRO B N   1 
ATOM   1526 C  CA  . PRO B 1 47  ? -11.742 45.180 -22.897 1.00 63.18 ? 47  PRO B CA  1 
ATOM   1527 C  C   . PRO B 1 47  ? -11.310 43.722 -23.157 1.00 60.76 ? 47  PRO B C   1 
ATOM   1528 O  O   . PRO B 1 47  ? -12.003 42.835 -22.658 1.00 61.00 ? 47  PRO B O   1 
ATOM   1529 C  CB  . PRO B 1 47  ? -12.415 45.748 -24.151 1.00 67.07 ? 47  PRO B CB  1 
ATOM   1530 C  CG  . PRO B 1 47  ? -12.204 47.219 -24.050 1.00 67.35 ? 47  PRO B CG  1 
ATOM   1531 C  CD  . PRO B 1 47  ? -10.855 47.397 -23.413 1.00 62.79 ? 47  PRO B CD  1 
ATOM   1532 N  N   . GLY B 1 48  ? -10.234 43.458 -23.894 1.00 59.61 ? 48  GLY B N   1 
ATOM   1533 C  CA  . GLY B 1 48  ? -9.846  42.061 -24.162 1.00 60.20 ? 48  GLY B CA  1 
ATOM   1534 C  C   . GLY B 1 48  ? -8.621  41.618 -23.387 1.00 58.38 ? 48  GLY B C   1 
ATOM   1535 O  O   . GLY B 1 48  ? -7.895  40.730 -23.831 1.00 58.99 ? 48  GLY B O   1 
ATOM   1536 N  N   . GLU B 1 49  ? -8.410  42.247 -22.229 1.00 51.69 ? 49  GLU B N   1 
ATOM   1537 C  CA  . GLU B 1 49  ? -7.239  42.037 -21.398 1.00 47.87 ? 49  GLU B CA  1 
ATOM   1538 C  C   . GLU B 1 49  ? -7.546  41.185 -20.177 1.00 43.27 ? 49  GLU B C   1 
ATOM   1539 O  O   . GLU B 1 49  ? -8.547  41.340 -19.492 1.00 41.02 ? 49  GLU B O   1 
ATOM   1540 C  CB  . GLU B 1 49  ? -6.710  43.376 -20.885 1.00 48.55 ? 49  GLU B CB  1 
ATOM   1541 C  CG  . GLU B 1 49  ? -5.462  43.919 -21.554 1.00 50.59 ? 49  GLU B CG  1 
ATOM   1542 C  CD  . GLU B 1 49  ? -5.094  45.301 -21.017 0.90 50.90 ? 49  GLU B CD  1 
ATOM   1543 O  OE1 . GLU B 1 49  ? -5.848  45.856 -20.163 0.90 48.89 ? 49  GLU B OE1 1 
ATOM   1544 O  OE2 . GLU B 1 49  ? -4.055  45.845 -21.454 0.90 50.89 ? 49  GLU B OE2 1 
ATOM   1545 N  N   . ASP B 1 50  ? -6.640  40.273 -19.930 1.00 40.33 ? 50  ASP B N   1 
ATOM   1546 C  CA  . ASP B 1 50  ? -6.536  39.553 -18.704 1.00 38.64 ? 50  ASP B CA  1 
ATOM   1547 C  C   . ASP B 1 50  ? -6.001  40.600 -17.636 1.00 35.24 ? 50  ASP B C   1 
ATOM   1548 O  O   . ASP B 1 50  ? -5.255  41.514 -17.990 1.00 34.94 ? 50  ASP B O   1 
ATOM   1549 C  CB  . ASP B 1 50  ? -5.590  38.413 -19.095 1.00 40.13 ? 50  ASP B CB  1 
ATOM   1550 C  CG  . ASP B 1 50  ? -4.985  37.706 -17.952 1.00 37.03 ? 50  ASP B CG  1 
ATOM   1551 O  OD1 . ASP B 1 50  ? -4.164  38.316 -17.278 1.00 35.11 ? 50  ASP B OD1 1 
ATOM   1552 O  OD2 . ASP B 1 50  ? -5.259  36.501 -17.801 1.00 39.23 ? 50  ASP B OD2 1 
ATOM   1553 N  N   . ASP B 1 51  ? -6.439  40.501 -16.379 1.00 31.74 ? 51  ASP B N   1 
ATOM   1554 C  CA  . ASP B 1 51  ? -6.083  41.475 -15.337 1.00 30.40 ? 51  ASP B CA  1 
ATOM   1555 C  C   . ASP B 1 51  ? -4.575  41.566 -15.070 1.00 28.10 ? 51  ASP B C   1 
ATOM   1556 O  O   . ASP B 1 51  ? -4.042  42.656 -14.916 1.00 27.34 ? 51  ASP B O   1 
ATOM   1557 C  CB  . ASP B 1 51  ? -6.809  41.187 -14.024 1.00 30.49 ? 51  ASP B CB  1 
ATOM   1558 C  CG  . ASP B 1 51  ? -8.270  41.656 -14.047 1.00 34.42 ? 51  ASP B CG  1 
ATOM   1559 O  OD1 . ASP B 1 51  ? -8.695  42.261 -15.049 1.00 34.26 ? 51  ASP B OD1 1 
ATOM   1560 O  OD2 . ASP B 1 51  ? -8.980  41.414 -13.049 1.00 35.19 ? 51  ASP B OD2 1 
ATOM   1561 N  N   . LEU B 1 52  ? -3.890  40.425 -15.049 1.00 26.90 ? 52  LEU B N   1 
ATOM   1562 C  CA  . LEU B 1 52  ? -2.431  40.444 -14.916 1.00 25.68 ? 52  LEU B CA  1 
ATOM   1563 C  C   . LEU B 1 52  ? -1.789  41.110 -16.152 1.00 27.42 ? 52  LEU B C   1 
ATOM   1564 O  O   . LEU B 1 52  ? -0.856  41.892 -16.014 1.00 25.41 ? 52  LEU B O   1 
ATOM   1565 C  CB  . LEU B 1 52  ? -1.871  39.043 -14.625 1.00 24.56 ? 52  LEU B CB  1 
ATOM   1566 C  CG  . LEU B 1 52  ? -0.347  38.989 -14.461 1.00 24.59 ? 52  LEU B CG  1 
ATOM   1567 C  CD1 . LEU B 1 52  ? 0.158   40.057 -13.471 1.00 21.60 ? 52  LEU B CD1 1 
ATOM   1568 C  CD2 . LEU B 1 52  ? 0.127   37.594 -14.043 1.00 23.51 ? 52  LEU B CD2 1 
ATOM   1569 N  N   . GLU B 1 53  ? -2.291  40.829 -17.354 1.00 29.42 ? 53  GLU B N   1 
ATOM   1570 C  CA  . GLU B 1 53  ? -1.811  41.556 -18.535 1.00 31.07 ? 53  GLU B CA  1 
ATOM   1571 C  C   . GLU B 1 53  ? -2.076  43.081 -18.439 1.00 29.81 ? 53  GLU B C   1 
ATOM   1572 O  O   . GLU B 1 53  ? -1.283  43.882 -18.889 1.00 29.85 ? 53  GLU B O   1 
ATOM   1573 C  CB  . GLU B 1 53  ? -2.355  40.937 -19.841 1.00 35.94 ? 53  GLU B CB  1 
ATOM   1574 C  CG  . GLU B 1 53  ? -1.881  39.501 -20.061 1.00 37.56 ? 53  GLU B CG  1 
ATOM   1575 C  CD  . GLU B 1 53  ? -1.970  39.007 -21.505 1.00 43.14 ? 53  GLU B CD  1 
ATOM   1576 O  OE1 . GLU B 1 53  ? -0.905  38.936 -22.169 0.90 44.82 ? 53  GLU B OE1 1 
ATOM   1577 O  OE2 . GLU B 1 53  ? -3.082  38.656 -21.974 1.00 44.48 ? 53  GLU B OE2 1 
ATOM   1578 N  N   . THR B 1 54  ? -3.170  43.485 -17.815 1.00 29.69 ? 54  THR B N   1 
ATOM   1579 C  CA  . THR B 1 54  ? -3.359  44.904 -17.518 1.00 30.66 ? 54  THR B CA  1 
ATOM   1580 C  C   . THR B 1 54  ? -2.236  45.463 -16.627 1.00 27.94 ? 54  THR B C   1 
ATOM   1581 O  O   . THR B 1 54  ? -1.700  46.548 -16.881 1.00 28.43 ? 54  THR B O   1 
ATOM   1582 C  CB  . THR B 1 54  ? -4.716  45.179 -16.846 1.00 31.09 ? 54  THR B CB  1 
ATOM   1583 O  OG1 . THR B 1 54  ? -5.761  44.816 -17.756 1.00 34.57 ? 54  THR B OG1 1 
ATOM   1584 C  CG2 . THR B 1 54  ? -4.840  46.685 -16.470 1.00 30.57 ? 54  THR B CG2 1 
ATOM   1585 N  N   . ALA B 1 55  ? -1.920  44.724 -15.576 1.00 24.73 ? 55  ALA B N   1 
ATOM   1586 C  CA  . ALA B 1 55  ? -0.899  45.131 -14.630 1.00 23.66 ? 55  ALA B CA  1 
ATOM   1587 C  C   . ALA B 1 55  ? 0.453   45.342 -15.361 1.00 24.76 ? 55  ALA B C   1 
ATOM   1588 O  O   . ALA B 1 55  ? 1.097   46.387 -15.190 1.00 24.22 ? 55  ALA B O   1 
ATOM   1589 C  CB  . ALA B 1 55  ? -0.771  44.102 -13.530 1.00 20.73 ? 55  ALA B CB  1 
ATOM   1590 N  N   . LEU B 1 56  ? 0.840   44.375 -16.193 1.00 25.61 ? 56  LEU B N   1 
ATOM   1591 C  CA  . LEU B 1 56  ? 2.088   44.469 -16.966 1.00 28.04 ? 56  LEU B CA  1 
ATOM   1592 C  C   . LEU B 1 56  ? 2.138   45.654 -17.949 1.00 29.88 ? 56  LEU B C   1 
ATOM   1593 O  O   . LEU B 1 56  ? 3.145   46.351 -18.008 1.00 30.09 ? 56  LEU B O   1 
ATOM   1594 C  CB  . LEU B 1 56  ? 2.354   43.168 -17.710 1.00 28.99 ? 56  LEU B CB  1 
ATOM   1595 C  CG  . LEU B 1 56  ? 2.580   41.912 -16.897 1.00 28.57 ? 56  LEU B CG  1 
ATOM   1596 C  CD1 . LEU B 1 56  ? 2.361   40.724 -17.835 1.00 29.78 ? 56  LEU B CD1 1 
ATOM   1597 C  CD2 . LEU B 1 56  ? 3.999   41.921 -16.315 1.00 27.95 ? 56  LEU B CD2 1 
ATOM   1598 N  N   . ARG B 1 57  ? 1.054   45.873 -18.696 1.00 31.99 ? 57  ARG B N   1 
ATOM   1599 C  CA  . ARG B 1 57  ? 0.936   47.008 -19.618 1.00 35.70 ? 57  ARG B CA  1 
ATOM   1600 C  C   . ARG B 1 57  ? 0.976   48.368 -18.907 1.00 35.42 ? 57  ARG B C   1 
ATOM   1601 O  O   . ARG B 1 57  ? 1.641   49.304 -19.372 1.00 36.60 ? 57  ARG B O   1 
ATOM   1602 C  CB  . ARG B 1 57  ? -0.362  46.901 -20.425 1.00 39.72 ? 57  ARG B CB  1 
ATOM   1603 C  CG  . ARG B 1 57  ? -0.512  47.925 -21.538 1.00 45.03 ? 57  ARG B CG  1 
ATOM   1604 C  CD  . ARG B 1 57  ? -1.972  48.198 -21.878 1.00 49.83 ? 57  ARG B CD  1 
ATOM   1605 N  NE  . ARG B 1 57  ? -2.485  49.328 -21.098 1.00 52.06 ? 57  ARG B NE  1 
ATOM   1606 C  CZ  . ARG B 1 57  ? -3.424  49.254 -20.158 1.00 52.06 ? 57  ARG B CZ  1 
ATOM   1607 N  NH1 . ARG B 1 57  ? -4.002  48.101 -19.850 1.00 52.86 ? 57  ARG B NH1 1 
ATOM   1608 N  NH2 . ARG B 1 57  ? -3.794  50.352 -19.517 1.00 53.93 ? 57  ARG B NH2 1 
ATOM   1609 N  N   . ALA B 1 58  ? 0.231   48.482 -17.808 1.00 32.62 ? 58  ALA B N   1 
ATOM   1610 C  CA  . ALA B 1 58  ? 0.176   49.719 -17.012 1.00 32.09 ? 58  ALA B CA  1 
ATOM   1611 C  C   . ALA B 1 58  ? 1.564   50.088 -16.491 1.00 31.08 ? 58  ALA B C   1 
ATOM   1612 O  O   . ALA B 1 58  ? 1.940   51.248 -16.485 1.00 32.25 ? 58  ALA B O   1 
ATOM   1613 C  CB  . ALA B 1 58  ? -0.787  49.561 -15.841 1.00 30.02 ? 58  ALA B CB  1 
ATOM   1614 N  N   . THR B 1 59  ? 2.301   49.085 -16.044 1.00 29.41 ? 59  THR B N   1 
ATOM   1615 C  CA  . THR B 1 59  ? 3.650   49.250 -15.542 1.00 29.35 ? 59  THR B CA  1 
ATOM   1616 C  C   . THR B 1 59  ? 4.576   49.753 -16.641 1.00 33.50 ? 59  THR B C   1 
ATOM   1617 O  O   . THR B 1 59  ? 5.373   50.648 -16.438 1.00 34.60 ? 59  THR B O   1 
ATOM   1618 C  CB  . THR B 1 59  ? 4.155   47.922 -14.979 1.00 26.68 ? 59  THR B CB  1 
ATOM   1619 O  OG1 . THR B 1 59  ? 3.387   47.586 -13.830 1.00 23.89 ? 59  THR B OG1 1 
ATOM   1620 C  CG2 . THR B 1 59  ? 5.613   47.984 -14.617 1.00 27.06 ? 59  THR B CG2 1 
ATOM   1621 N  N   . GLN B 1 60  ? 4.431   49.177 -17.816 1.00 34.39 ? 60  GLN B N   1 
ATOM   1622 C  CA  . GLN B 1 60  ? 5.167   49.607 -18.957 1.00 38.30 ? 60  GLN B CA  1 
ATOM   1623 C  C   . GLN B 1 60  ? 4.817   51.052 -19.368 1.00 39.26 ? 60  GLN B C   1 
ATOM   1624 O  O   . GLN B 1 60  ? 5.685   51.872 -19.556 1.00 39.82 ? 60  GLN B O   1 
ATOM   1625 C  CB  . GLN B 1 60  ? 4.832   48.647 -20.069 1.00 41.23 ? 60  GLN B CB  1 
ATOM   1626 C  CG  . GLN B 1 60  ? 6.015   48.232 -20.871 1.00 46.60 ? 60  GLN B CG  1 
ATOM   1627 C  CD  . GLN B 1 60  ? 6.007   48.926 -22.171 1.00 51.88 ? 60  GLN B CD  1 
ATOM   1628 O  OE1 . GLN B 1 60  ? 5.653   50.100 -22.239 1.00 52.83 ? 60  GLN B OE1 1 
ATOM   1629 N  NE2 . GLN B 1 60  ? 6.367   48.208 -23.233 1.00 57.41 ? 60  GLN B NE2 1 
ATOM   1630 N  N   . GLU B 1 61  ? 3.534   51.348 -19.450 1.00 32.58 ? 61  GLU B N   1 
ATOM   1631 C  CA  . GLU B 1 61  ? 3.061   52.674 -19.778 1.00 35.69 ? 61  GLU B CA  1 
ATOM   1632 C  C   . GLU B 1 61  ? 3.446   53.718 -18.740 1.00 33.78 ? 61  GLU B C   1 
ATOM   1633 O  O   . GLU B 1 61  ? 3.759   54.831 -19.084 1.00 33.67 ? 61  GLU B O   1 
ATOM   1634 C  CB  . GLU B 1 61  ? 1.532   52.680 -19.925 1.00 36.84 ? 61  GLU B CB  1 
ATOM   1635 C  CG  . GLU B 1 61  ? 1.020   52.076 -21.209 1.00 41.58 ? 61  GLU B CG  1 
ATOM   1636 C  CD  . GLU B 1 61  ? -0.495  52.071 -21.299 1.00 45.08 ? 61  GLU B CD  1 
ATOM   1637 O  OE1 . GLU B 1 61  ? -1.037  51.300 -22.106 0.50 46.27 ? 61  GLU B OE1 1 
ATOM   1638 O  OE2 . GLU B 1 61  ? -1.143  52.833 -20.563 1.00 47.65 ? 61  GLU B OE2 1 
ATOM   1639 N  N   . GLU B 1 62  ? 3.388   53.353 -17.469 1.00 31.88 ? 62  GLU B N   1 
ATOM   1640 C  CA  . GLU B 1 62  ? 3.482   54.355 -16.400 1.00 32.39 ? 62  GLU B CA  1 
ATOM   1641 C  C   . GLU B 1 62  ? 4.905   54.548 -15.839 1.00 30.97 ? 62  GLU B C   1 
ATOM   1642 O  O   . GLU B 1 62  ? 5.256   55.621 -15.361 1.00 29.52 ? 62  GLU B O   1 
ATOM   1643 C  CB  . GLU B 1 62  ? 2.498   54.029 -15.253 1.00 31.64 ? 62  GLU B CB  1 
ATOM   1644 C  CG  . GLU B 1 62  ? 1.012   54.097 -15.610 1.00 35.50 ? 62  GLU B CG  1 
ATOM   1645 C  CD  . GLU B 1 62  ? 0.602   55.432 -16.230 1.00 40.02 ? 62  GLU B CD  1 
ATOM   1646 O  OE1 . GLU B 1 62  ? -0.003  55.430 -17.327 1.00 43.56 ? 62  GLU B OE1 1 
ATOM   1647 O  OE2 . GLU B 1 62  ? 0.909   56.492 -15.636 1.00 40.56 ? 62  GLU B OE2 1 
ATOM   1648 N  N   . ALA B 1 63  ? 5.704   53.492 -15.889 1.00 30.78 ? 63  ALA B N   1 
ATOM   1649 C  CA  . ALA B 1 63  ? 7.026   53.471 -15.260 1.00 29.28 ? 63  ALA B CA  1 
ATOM   1650 C  C   . ALA B 1 63  ? 8.110   53.074 -16.264 1.00 30.16 ? 63  ALA B C   1 
ATOM   1651 O  O   . ALA B 1 63  ? 9.300   53.097 -15.942 1.00 30.58 ? 63  ALA B O   1 
ATOM   1652 C  CB  . ALA B 1 63  ? 7.011   52.477 -14.100 1.00 27.70 ? 63  ALA B CB  1 
ATOM   1653 N  N   . GLY B 1 64  ? 7.678   52.652 -17.451 1.00 29.51 ? 64  GLY B N   1 
ATOM   1654 C  CA  . GLY B 1 64  ? 8.560   52.317 -18.552 1.00 30.94 ? 64  GLY B CA  1 
ATOM   1655 C  C   . GLY B 1 64  ? 9.345   51.047 -18.348 1.00 32.25 ? 64  GLY B C   1 
ATOM   1656 O  O   . GLY B 1 64  ? 10.413  50.867 -18.951 1.00 33.21 ? 64  GLY B O   1 
ATOM   1657 N  N   . ILE B 1 65  ? 8.836   50.166 -17.491 1.00 30.73 ? 65  ILE B N   1 
ATOM   1658 C  CA  . ILE B 1 65  ? 9.501   48.883 -17.215 1.00 30.24 ? 65  ILE B CA  1 
ATOM   1659 C  C   . ILE B 1 65  ? 8.796   47.795 -18.025 1.00 32.43 ? 65  ILE B C   1 
ATOM   1660 O  O   . ILE B 1 65  ? 7.620   47.534 -17.809 1.00 30.01 ? 65  ILE B O   1 
ATOM   1661 C  CB  . ILE B 1 65  ? 9.462   48.500 -15.718 1.00 27.82 ? 65  ILE B CB  1 
ATOM   1662 C  CG1 . ILE B 1 65  ? 10.003  49.637 -14.840 1.00 27.00 ? 65  ILE B CG1 1 
ATOM   1663 C  CG2 . ILE B 1 65  ? 10.246  47.210 -15.494 1.00 28.31 ? 65  ILE B CG2 1 
ATOM   1664 C  CD1 . ILE B 1 65  ? 9.735   49.501 -13.343 1.00 25.46 ? 65  ILE B CD1 1 
ATOM   1665 N  N   . GLU B 1 66  ? 9.546   47.170 -18.933 1.00 34.89 ? 66  GLU B N   1 
ATOM   1666 C  CA  . GLU B 1 66  ? 9.075   46.134 -19.856 1.00 39.69 ? 66  GLU B CA  1 
ATOM   1667 C  C   . GLU B 1 66  ? 8.918   44.797 -19.147 1.00 39.66 ? 66  GLU B C   1 
ATOM   1668 O  O   . GLU B 1 66  ? 9.544   44.583 -18.109 1.00 39.01 ? 66  GLU B O   1 
ATOM   1669 C  CB  . GLU B 1 66  ? 10.149  45.931 -20.938 1.00 44.67 ? 66  GLU B CB  1 
ATOM   1670 C  CG  . GLU B 1 66  ? 9.644   45.934 -22.360 1.00 52.26 ? 66  GLU B CG  1 
ATOM   1671 C  CD  . GLU B 1 66  ? 9.872   47.267 -23.040 1.00 57.00 ? 66  GLU B CD  1 
ATOM   1672 O  OE1 . GLU B 1 66  ? 9.482   48.306 -22.466 1.00 59.56 ? 66  GLU B OE1 1 
ATOM   1673 O  OE2 . GLU B 1 66  ? 10.450  47.274 -24.148 1.00 60.59 ? 66  GLU B OE2 1 
ATOM   1674 N  N   . ALA B 1 67  ? 8.144   43.883 -19.743 1.00 42.26 ? 67  ALA B N   1 
ATOM   1675 C  CA  . ALA B 1 67  ? 7.933   42.523 -19.216 1.00 42.92 ? 67  ALA B CA  1 
ATOM   1676 C  C   . ALA B 1 67  ? 9.236   41.777 -18.935 1.00 43.39 ? 67  ALA B C   1 
ATOM   1677 O  O   . ALA B 1 67  ? 9.367   41.100 -17.908 1.00 41.69 ? 67  ALA B O   1 
ATOM   1678 C  CB  . ALA B 1 67  ? 7.070   41.707 -20.171 1.00 46.81 ? 67  ALA B CB  1 
ATOM   1679 N  N   . GLY B 1 68  ? 10.186  41.913 -19.853 1.00 41.27 ? 68  GLY B N   1 
ATOM   1680 C  CA  . GLY B 1 68  ? 11.476  41.260 -19.749 1.00 40.95 ? 68  GLY B CA  1 
ATOM   1681 C  C   . GLY B 1 68  ? 12.362  41.844 -18.676 1.00 39.43 ? 68  GLY B C   1 
ATOM   1682 O  O   . GLY B 1 68  ? 13.410  41.284 -18.348 1.00 38.64 ? 68  GLY B O   1 
ATOM   1683 N  N   . GLN B 1 69  ? 11.936  42.966 -18.112 1.00 37.04 ? 69  GLN B N   1 
ATOM   1684 C  CA  . GLN B 1 69  ? 12.676  43.572 -17.018 1.00 35.31 ? 69  GLN B CA  1 
ATOM   1685 C  C   . GLN B 1 69  ? 12.108  43.165 -15.645 1.00 31.80 ? 69  GLN B C   1 
ATOM   1686 O  O   . GLN B 1 69  ? 12.614  43.623 -14.625 1.00 30.41 ? 69  GLN B O   1 
ATOM   1687 C  CB  . GLN B 1 69  ? 12.706  45.101 -17.191 1.00 37.98 ? 69  GLN B CB  1 
ATOM   1688 C  CG  . GLN B 1 69  ? 13.475  45.586 -18.436 1.00 42.75 ? 69  GLN B CG  1 
ATOM   1689 C  CD  . GLN B 1 69  ? 13.261  47.080 -18.745 1.00 43.36 ? 69  GLN B CD  1 
ATOM   1690 O  OE1 . GLN B 1 69  ? 12.153  47.528 -19.015 1.00 42.67 ? 69  GLN B OE1 1 
ATOM   1691 N  NE2 . GLN B 1 69  ? 14.338  47.840 -18.732 1.00 47.77 ? 69  GLN B NE2 1 
ATOM   1692 N  N   . LEU B 1 70  ? 11.104  42.280 -15.635 1.00 29.46 ? 70  LEU B N   1 
ATOM   1693 C  CA  . LEU B 1 70  ? 10.247  42.004 -14.457 1.00 29.28 ? 70  LEU B CA  1 
ATOM   1694 C  C   . LEU B 1 70  ? 10.088  40.525 -14.203 1.00 28.05 ? 70  LEU B C   1 
ATOM   1695 O  O   . LEU B 1 70  ? 10.057  39.759 -15.141 1.00 27.80 ? 70  LEU B O   1 
ATOM   1696 C  CB  . LEU B 1 70  ? 8.796   42.475 -14.713 1.00 30.37 ? 70  LEU B CB  1 
ATOM   1697 C  CG  . LEU B 1 70  ? 8.542   43.956 -14.711 1.00 30.49 ? 70  LEU B CG  1 
ATOM   1698 C  CD1 . LEU B 1 70  ? 7.069   44.244 -14.899 1.00 30.19 ? 70  LEU B CD1 1 
ATOM   1699 C  CD2 . LEU B 1 70  ? 9.047   44.474 -13.388 1.00 31.32 ? 70  LEU B CD2 1 
ATOM   1700 N  N   . THR B 1 71  ? 9.899   40.151 -12.941 1.00 25.54 ? 71  THR B N   1 
ATOM   1701 C  CA  . THR B 1 71  ? 9.550   38.787 -12.596 1.00 26.34 ? 71  THR B CA  1 
ATOM   1702 C  C   . THR B 1 71  ? 8.320   38.828 -11.704 1.00 24.55 ? 71  THR B C   1 
ATOM   1703 O  O   . THR B 1 71  ? 8.399   39.403 -10.630 1.00 22.14 ? 71  THR B O   1 
ATOM   1704 C  CB  . THR B 1 71  ? 10.705  38.112 -11.825 1.00 26.68 ? 71  THR B CB  1 
ATOM   1705 O  OG1 . THR B 1 71  ? 11.855  38.043 -12.670 1.00 29.45 ? 71  THR B OG1 1 
ATOM   1706 C  CG2 . THR B 1 71  ? 10.321  36.696 -11.391 1.00 27.52 ? 71  THR B CG2 1 
ATOM   1707 N  N   . ILE B 1 72  ? 7.202   38.222 -12.121 1.00 24.69 ? 72  ILE B N   1 
ATOM   1708 C  CA  . ILE B 1 72  ? 5.997   38.146 -11.274 1.00 24.40 ? 72  ILE B CA  1 
ATOM   1709 C  C   . ILE B 1 72  ? 6.220   37.156 -10.135 1.00 24.66 ? 72  ILE B C   1 
ATOM   1710 O  O   . ILE B 1 72  ? 6.569   36.026 -10.389 1.00 24.85 ? 72  ILE B O   1 
ATOM   1711 C  CB  . ILE B 1 72  ? 4.734   37.673 -12.044 1.00 26.39 ? 72  ILE B CB  1 
ATOM   1712 C  CG1 . ILE B 1 72  ? 4.413   38.591 -13.230 1.00 26.86 ? 72  ILE B CG1 1 
ATOM   1713 C  CG2 . ILE B 1 72  ? 3.538   37.608 -11.100 1.00 25.79 ? 72  ILE B CG2 1 
ATOM   1714 C  CD1 . ILE B 1 72  ? 4.087   40.028 -12.812 1.00 26.85 ? 72  ILE B CD1 1 
ATOM   1715 N  N   . ILE B 1 73  ? 6.007   37.574 -8.878  1.00 22.76 ? 73  ILE B N   1 
ATOM   1716 C  CA  . ILE B 1 73  ? 6.249   36.660 -7.745  1.00 21.12 ? 73  ILE B CA  1 
ATOM   1717 C  C   . ILE B 1 73  ? 5.018   35.765 -7.527  1.00 22.69 ? 73  ILE B C   1 
ATOM   1718 O  O   . ILE B 1 73  ? 3.960   36.285 -7.196  1.00 21.60 ? 73  ILE B O   1 
ATOM   1719 C  CB  . ILE B 1 73  ? 6.543   37.461 -6.432  1.00 20.56 ? 73  ILE B CB  1 
ATOM   1720 C  CG1 . ILE B 1 73  ? 7.723   38.448 -6.606  1.00 19.09 ? 73  ILE B CG1 1 
ATOM   1721 C  CG2 . ILE B 1 73  ? 6.857   36.503 -5.269  1.00 22.14 ? 73  ILE B CG2 1 
ATOM   1722 C  CD1 . ILE B 1 73  ? 9.034   37.852 -7.155  1.00 19.73 ? 73  ILE B CD1 1 
ATOM   1723 N  N   . GLU B 1 74  ? 5.146   34.447 -7.711  1.00 22.61 ? 74  GLU B N   1 
ATOM   1724 C  CA  . GLU B 1 74  ? 4.048   33.493 -7.531  1.00 25.04 ? 74  GLU B CA  1 
ATOM   1725 C  C   . GLU B 1 74  ? 3.549   33.446 -6.070  1.00 23.43 ? 74  GLU B C   1 
ATOM   1726 O  O   . GLU B 1 74  ? 4.349   33.440 -5.126  1.00 23.14 ? 74  GLU B O   1 
ATOM   1727 C  CB  . GLU B 1 74  ? 4.537   32.084 -7.989  1.00 28.27 ? 74  GLU B CB  1 
ATOM   1728 C  CG  . GLU B 1 74  ? 3.531   30.945 -7.880  0.50 31.03 ? 74  GLU B CG  1 
ATOM   1729 C  CD  . GLU B 1 74  ? 4.136   29.592 -8.267  0.50 34.98 ? 74  GLU B CD  1 
ATOM   1730 O  OE1 . GLU B 1 74  ? 4.251   28.725 -7.391  1.00 36.82 ? 74  GLU B OE1 1 
ATOM   1731 O  OE2 . GLU B 1 74  ? 4.525   29.387 -9.436  1.00 37.25 ? 74  GLU B OE2 1 
ATOM   1732 N  N   . GLY B 1 75  ? 2.230   33.436 -5.872  1.00 23.73 ? 75  GLY B N   1 
ATOM   1733 C  CA  . GLY B 1 75  ? 1.676   33.218 -4.532  1.00 22.18 ? 75  GLY B CA  1 
ATOM   1734 C  C   . GLY B 1 75  ? 1.227   34.440 -3.774  1.00 23.08 ? 75  GLY B C   1 
ATOM   1735 O  O   . GLY B 1 75  ? 0.850   34.344 -2.580  1.00 25.02 ? 75  GLY B O   1 
ATOM   1736 N  N   . PHE B 1 76  ? 1.269   35.601 -4.423  1.00 20.66 ? 76  PHE B N   1 
ATOM   1737 C  CA  . PHE B 1 76  ? 0.795   36.832 -3.800  1.00 18.79 ? 76  PHE B CA  1 
ATOM   1738 C  C   . PHE B 1 76  ? -0.111  37.622 -4.782  1.00 18.63 ? 76  PHE B C   1 
ATOM   1739 O  O   . PHE B 1 76  ? 0.226   37.836 -5.961  1.00 18.92 ? 76  PHE B O   1 
ATOM   1740 C  CB  . PHE B 1 76  ? 1.986   37.715 -3.397  1.00 16.96 ? 76  PHE B CB  1 
ATOM   1741 C  CG  . PHE B 1 76  ? 1.590   38.957 -2.640  1.00 16.10 ? 76  PHE B CG  1 
ATOM   1742 C  CD1 . PHE B 1 76  ? 1.269   40.119 -3.326  1.00 15.31 ? 76  PHE B CD1 1 
ATOM   1743 C  CD2 . PHE B 1 76  ? 1.513   38.947 -1.241  1.00 16.12 ? 76  PHE B CD2 1 
ATOM   1744 C  CE1 . PHE B 1 76  ? 0.905   41.278 -2.659  1.00 14.76 ? 76  PHE B CE1 1 
ATOM   1745 C  CE2 . PHE B 1 76  ? 1.135   40.097 -0.557  1.00 15.77 ? 76  PHE B CE2 1 
ATOM   1746 C  CZ  . PHE B 1 76  ? 0.837   41.267 -1.266  1.00 14.83 ? 76  PHE B CZ  1 
ATOM   1747 N  N   . LYS B 1 77  ? -1.236  38.078 -4.275  1.00 17.26 ? 77  LYS B N   1 
ATOM   1748 C  CA  . LYS B 1 77  ? -2.113  38.951 -4.998  1.00 17.42 ? 77  LYS B CA  1 
ATOM   1749 C  C   . LYS B 1 77  ? -2.933  39.633 -3.911  1.00 16.77 ? 77  LYS B C   1 
ATOM   1750 O  O   . LYS B 1 77  ? -3.327  38.956 -2.960  1.00 16.22 ? 77  LYS B O   1 
ATOM   1751 C  CB  . LYS B 1 77  ? -3.070  38.142 -5.924  1.00 18.66 ? 77  LYS B CB  1 
ATOM   1752 C  CG  . LYS B 1 77  ? -4.117  39.028 -6.601  1.00 20.41 ? 77  LYS B CG  1 
ATOM   1753 C  CD  . LYS B 1 77  ? -4.706  38.388 -7.864  1.00 22.96 ? 77  LYS B CD  1 
ATOM   1754 C  CE  . LYS B 1 77  ? -5.920  37.540 -7.619  1.00 24.22 ? 77  LYS B CE  1 
ATOM   1755 N  NZ  . LYS B 1 77  ? -6.333  36.807 -8.863  1.00 26.29 ? 77  LYS B NZ  1 
ATOM   1756 N  N   . ARG B 1 78  ? -3.197  40.935 -4.066  1.00 16.31 ? 78  ARG B N   1 
ATOM   1757 C  CA  . ARG B 1 78  ? -4.057  41.655 -3.112  1.00 17.88 ? 78  ARG B CA  1 
ATOM   1758 C  C   . ARG B 1 78  ? -5.045  42.517 -3.865  1.00 18.41 ? 78  ARG B C   1 
ATOM   1759 O  O   . ARG B 1 78  ? -4.682  43.229 -4.806  1.00 17.84 ? 78  ARG B O   1 
ATOM   1760 C  CB  . ARG B 1 78  ? -3.249  42.540 -2.121  1.00 18.22 ? 78  ARG B CB  1 
ATOM   1761 C  CG  . ARG B 1 78  ? -2.483  41.781 -1.021  1.00 20.03 ? 78  ARG B CG  1 
ATOM   1762 C  CD  . ARG B 1 78  ? -3.368  40.781 -0.246  1.00 20.95 ? 78  ARG B CD  1 
ATOM   1763 N  NE  . ARG B 1 78  ? -2.636  40.093 0.832   1.00 20.18 ? 78  ARG B NE  1 
ATOM   1764 C  CZ  . ARG B 1 78  ? -2.014  38.913 0.772   1.00 20.63 ? 78  ARG B CZ  1 
ATOM   1765 N  NH1 . ARG B 1 78  ? -1.972  38.159 -0.336  1.00 19.83 ? 78  ARG B NH1 1 
ATOM   1766 N  NH2 . ARG B 1 78  ? -1.362  38.510 1.844   1.00 19.26 ? 78  ARG B NH2 1 
ATOM   1767 N  N   . GLU B 1 79  ? -6.298  42.447 -3.466  1.00 20.09 ? 79  GLU B N   1 
ATOM   1768 C  CA  . GLU B 1 79  ? -7.342  43.308 -4.040  1.00 21.95 ? 79  GLU B CA  1 
ATOM   1769 C  C   . GLU B 1 79  ? -7.714  44.409 -3.053  1.00 21.97 ? 79  GLU B C   1 
ATOM   1770 O  O   . GLU B 1 79  ? -7.995  44.144 -1.870  1.00 22.48 ? 79  GLU B O   1 
ATOM   1771 C  CB  . GLU B 1 79  ? -8.604  42.501 -4.420  1.00 24.98 ? 79  GLU B CB  1 
ATOM   1772 C  CG  . GLU B 1 79  ? -9.751  43.452 -4.803  1.00 27.97 ? 79  GLU B CG  1 
ATOM   1773 C  CD  . GLU B 1 79  ? -10.879 42.791 -5.581  1.00 33.53 ? 79  GLU B CD  1 
ATOM   1774 O  OE1 . GLU B 1 79  ? -10.621 41.751 -6.236  1.00 37.18 ? 79  GLU B OE1 1 
ATOM   1775 O  OE2 . GLU B 1 79  ? -12.019 43.297 -5.537  0.01 33.11 ? 79  GLU B OE2 1 
ATOM   1776 N  N   . LEU B 1 80  ? -7.675  45.646 -3.515  1.00 21.81 ? 80  LEU B N   1 
ATOM   1777 C  CA  . LEU B 1 80  ? -8.052  46.796 -2.689  1.00 22.06 ? 80  LEU B CA  1 
ATOM   1778 C  C   . LEU B 1 80  ? -9.438  47.198 -3.135  1.00 23.23 ? 80  LEU B C   1 
ATOM   1779 O  O   . LEU B 1 80  ? -9.681  47.261 -4.342  1.00 22.77 ? 80  LEU B O   1 
ATOM   1780 C  CB  . LEU B 1 80  ? -7.093  47.959 -2.921  1.00 22.58 ? 80  LEU B CB  1 
ATOM   1781 C  CG  . LEU B 1 80  ? -5.726  48.003 -2.221  1.00 24.01 ? 80  LEU B CG  1 
ATOM   1782 C  CD1 . LEU B 1 80  ? -4.812  46.886 -2.678  1.00 23.87 ? 80  LEU B CD1 1 
ATOM   1783 C  CD2 . LEU B 1 80  ? -5.077  49.367 -2.467  1.00 24.26 ? 80  LEU B CD2 1 
ATOM   1784 N  N   . ASN B 1 81  ? -10.331 47.426 -2.169  1.00 24.21 ? 81  ASN B N   1 
ATOM   1785 C  CA  . ASN B 1 81  ? -11.707 47.909 -2.386  1.00 27.53 ? 81  ASN B CA  1 
ATOM   1786 C  C   . ASN B 1 81  ? -11.966 49.100 -1.477  1.00 28.87 ? 81  ASN B C   1 
ATOM   1787 O  O   . ASN B 1 81  ? -11.941 48.987 -0.236  1.00 28.39 ? 81  ASN B O   1 
ATOM   1788 C  CB  . ASN B 1 81  ? -12.770 46.838 -2.103  1.00 27.96 ? 81  ASN B CB  1 
ATOM   1789 C  CG  . ASN B 1 81  ? -12.569 45.597 -2.963  1.00 30.63 ? 81  ASN B CG  1 
ATOM   1790 O  OD1 . ASN B 1 81  ? -11.895 44.628 -2.407  1.00 30.51 ? 81  ASN B OD1 1 
ATOM   1791 N  ND2 . ASN B 1 81  ? -12.960 45.543 -4.125  1.00 29.63 ? 81  ASN B ND2 1 
ATOM   1792 N  N   . TYR B 1 82  ? -12.182 50.249 -2.095  1.00 29.24 ? 82  TYR B N   1 
ATOM   1793 C  CA  . TYR B 1 82  ? -12.510 51.463 -1.332  1.00 32.61 ? 82  TYR B CA  1 
ATOM   1794 C  C   . TYR B 1 82  ? -13.374 52.414 -2.181  1.00 32.57 ? 82  TYR B C   1 
ATOM   1795 O  O   . TYR B 1 82  ? -13.500 52.238 -3.382  1.00 30.99 ? 82  TYR B O   1 
ATOM   1796 C  CB  . TYR B 1 82  ? -11.224 52.140 -0.836  1.00 32.50 ? 82  TYR B CB  1 
ATOM   1797 C  CG  . TYR B 1 82  ? -10.297 52.538 -1.964  1.00 33.20 ? 82  TYR B CG  1 
ATOM   1798 C  CD1 . TYR B 1 82  ? -9.335  51.661 -2.450  1.00 31.75 ? 82  TYR B CD1 1 
ATOM   1799 C  CD2 . TYR B 1 82  ? -10.414 53.791 -2.566  1.00 34.01 ? 82  TYR B CD2 1 
ATOM   1800 C  CE1 . TYR B 1 82  ? -8.510  52.021 -3.504  1.00 32.37 ? 82  TYR B CE1 1 
ATOM   1801 C  CE2 . TYR B 1 82  ? -9.589  54.159 -3.608  1.00 33.90 ? 82  TYR B CE2 1 
ATOM   1802 C  CZ  . TYR B 1 82  ? -8.645  53.276 -4.067  1.00 33.89 ? 82  TYR B CZ  1 
ATOM   1803 O  OH  . TYR B 1 82  ? -7.846  53.654 -5.117  1.00 37.42 ? 82  TYR B OH  1 
ATOM   1804 N  N   . VAL B 1 83  ? -13.985 53.397 -1.538  1.00 35.29 ? 83  VAL B N   1 
ATOM   1805 C  CA  . VAL B 1 83  ? -14.876 54.354 -2.205  1.00 39.90 ? 83  VAL B CA  1 
ATOM   1806 C  C   . VAL B 1 83  ? -14.199 55.706 -2.047  1.00 41.82 ? 83  VAL B C   1 
ATOM   1807 O  O   . VAL B 1 83  ? -14.108 56.202 -0.932  1.00 42.25 ? 83  VAL B O   1 
ATOM   1808 C  CB  . VAL B 1 83  ? -16.299 54.338 -1.577  1.00 39.90 ? 83  VAL B CB  1 
ATOM   1809 C  CG1 . VAL B 1 83  ? -17.245 55.295 -2.298  1.00 43.61 ? 83  VAL B CG1 1 
ATOM   1810 C  CG2 . VAL B 1 83  ? -16.887 52.931 -1.583  1.00 39.72 ? 83  VAL B CG2 1 
ATOM   1811 N  N   . ALA B 1 84  ? -13.691 56.263 -3.152  1.00 45.52 ? 84  ALA B N   1 
ATOM   1812 C  CA  . ALA B 1 84  ? -12.826 57.469 -3.138  1.00 49.43 ? 84  ALA B CA  1 
ATOM   1813 C  C   . ALA B 1 84  ? -13.265 58.547 -4.126  1.00 54.82 ? 84  ALA B C   1 
ATOM   1814 O  O   . ALA B 1 84  ? -13.065 58.407 -5.333  1.00 53.25 ? 84  ALA B O   1 
ATOM   1815 C  CB  . ALA B 1 84  ? -11.381 57.095 -3.412  1.00 48.45 ? 84  ALA B CB  1 
ATOM   1816 N  N   . ARG B 1 85  ? -13.801 59.648 -3.585  1.00 61.55 ? 85  ARG B N   1 
ATOM   1817 C  CA  . ARG B 1 85  ? -14.590 60.656 -4.334  1.00 62.31 ? 85  ARG B CA  1 
ATOM   1818 C  C   . ARG B 1 85  ? -16.013 60.123 -4.513  1.00 62.84 ? 85  ARG B C   1 
ATOM   1819 O  O   . ARG B 1 85  ? -16.854 60.731 -5.184  1.00 71.31 ? 85  ARG B O   1 
ATOM   1820 C  CB  . ARG B 1 85  ? -13.966 61.018 -5.689  1.00 61.94 ? 85  ARG B CB  1 
ATOM   1821 C  CG  . ARG B 1 85  ? -12.682 61.836 -5.606  1.00 67.49 ? 85  ARG B CG  1 
ATOM   1822 C  CD  . ARG B 1 85  ? -12.256 62.319 -6.995  1.00 69.46 ? 85  ARG B CD  1 
ATOM   1823 N  NE  . ARG B 1 85  ? -11.096 63.197 -6.953  0.70 70.36 ? 85  ARG B NE  1 
ATOM   1824 C  CZ  . ARG B 1 85  ? -10.391 63.584 -8.033  0.70 71.78 ? 85  ARG B CZ  1 
ATOM   1825 N  NH1 . ARG B 1 85  ? -10.752 63.220 -9.254  0.70 71.07 ? 85  ARG B NH1 1 
ATOM   1826 N  NH2 . ARG B 1 85  ? -9.308  64.345 -7.892  0.70 70.31 ? 85  ARG B NH2 1 
ATOM   1827 N  N   . ASN B 1 86  ? -16.260 58.977 -3.890  1.00 58.65 ? 86  ASN B N   1 
ATOM   1828 C  CA  . ASN B 1 86  ? -17.563 58.266 -3.915  1.00 56.63 ? 86  ASN B CA  1 
ATOM   1829 C  C   . ASN B 1 86  ? -17.946 57.587 -5.195  1.00 51.59 ? 86  ASN B C   1 
ATOM   1830 O  O   . ASN B 1 86  ? -19.101 57.249 -5.480  1.00 51.32 ? 86  ASN B O   1 
ATOM   1831 C  CB  . ASN B 1 86  ? -18.659 59.017 -3.216  1.00 57.08 ? 86  ASN B CB  1 
ATOM   1832 C  CG  . ASN B 1 86  ? -18.440 58.997 -1.735  1.00 56.32 ? 86  ASN B CG  1 
ATOM   1833 O  OD1 . ASN B 1 86  ? -19.117 58.266 -1.017  1.00 51.84 ? 86  ASN B OD1 1 
ATOM   1834 N  ND2 . ASN B 1 86  ? -17.408 59.723 -1.279  1.00 56.21 ? 86  ASN B ND2 1 
ATOM   1835 N  N   . LYS B 1 87  ? -16.869 57.338 -5.907  1.00 47.65 ? 87  LYS B N   1 
ATOM   1836 C  CA  . LYS B 1 87  ? -16.799 56.370 -6.921  1.00 44.41 ? 87  LYS B CA  1 
ATOM   1837 C  C   . LYS B 1 87  ? -16.213 55.143 -6.231  1.00 40.21 ? 87  LYS B C   1 
ATOM   1838 O  O   . LYS B 1 87  ? -15.171 55.227 -5.567  1.00 36.29 ? 87  LYS B O   1 
ATOM   1839 C  CB  . LYS B 1 87  ? -15.917 56.950 -8.014  1.00 46.90 ? 87  LYS B CB  1 
ATOM   1840 C  CG  . LYS B 1 87  ? -16.464 58.321 -8.449  1.00 49.57 ? 87  LYS B CG  1 
ATOM   1841 C  CD  . LYS B 1 87  ? -15.558 59.104 -9.400  1.00 50.41 ? 87  LYS B CD  1 
ATOM   1842 C  CE  . LYS B 1 87  ? -16.266 60.381 -9.842  0.50 52.30 ? 87  LYS B CE  1 
ATOM   1843 N  NZ  . LYS B 1 87  ? -15.420 61.262 -10.694 0.50 54.00 ? 87  LYS B NZ  1 
ATOM   1844 N  N   . PRO B 1 88  ? -16.924 54.007 -6.315  1.00 39.40 ? 88  PRO B N   1 
ATOM   1845 C  CA  . PRO B 1 88  ? -16.324 52.761 -5.819  1.00 36.86 ? 88  PRO B CA  1 
ATOM   1846 C  C   . PRO B 1 88  ? -15.074 52.446 -6.646  1.00 34.44 ? 88  PRO B C   1 
ATOM   1847 O  O   . PRO B 1 88  ? -15.076 52.648 -7.857  1.00 34.52 ? 88  PRO B O   1 
ATOM   1848 C  CB  . PRO B 1 88  ? -17.404 51.709 -6.070  1.00 38.04 ? 88  PRO B CB  1 
ATOM   1849 C  CG  . PRO B 1 88  ? -18.618 52.453 -6.540  1.00 41.98 ? 88  PRO B CG  1 
ATOM   1850 C  CD  . PRO B 1 88  ? -18.167 53.774 -7.064  1.00 40.06 ? 88  PRO B CD  1 
ATOM   1851 N  N   . LYS B 1 89  ? -14.009 51.990 -5.995  1.00 33.08 ? 89  LYS B N   1 
ATOM   1852 C  CA  . LYS B 1 89  ? -12.772 51.628 -6.705  1.00 32.26 ? 89  LYS B CA  1 
ATOM   1853 C  C   . LYS B 1 89  ? -12.269 50.257 -6.293  1.00 30.10 ? 89  LYS B C   1 
ATOM   1854 O  O   . LYS B 1 89  ? -12.391 49.857 -5.123  1.00 26.84 ? 89  LYS B O   1 
ATOM   1855 C  CB  . LYS B 1 89  ? -11.686 52.676 -6.474  1.00 34.71 ? 89  LYS B CB  1 
ATOM   1856 C  CG  . LYS B 1 89  ? -12.025 53.988 -7.168  1.00 39.19 ? 89  LYS B CG  1 
ATOM   1857 C  CD  . LYS B 1 89  ? -10.786 54.833 -7.402  1.00 40.56 ? 89  LYS B CD  1 
ATOM   1858 C  CE  . LYS B 1 89  ? -11.188 56.275 -7.664  1.00 43.25 ? 89  LYS B CE  1 
ATOM   1859 N  NZ  . LYS B 1 89  ? -12.214 56.353 -8.732  1.00 46.35 ? 89  LYS B NZ  1 
ATOM   1860 N  N   . THR B 1 90  ? -11.727 49.545 -7.280  1.00 27.22 ? 90  THR B N   1 
ATOM   1861 C  CA  . THR B 1 90  ? -11.101 48.240 -7.077  1.00 26.10 ? 90  THR B CA  1 
ATOM   1862 C  C   . THR B 1 90  ? -9.750  48.265 -7.775  1.00 24.07 ? 90  THR B C   1 
ATOM   1863 O  O   . THR B 1 90  ? -9.642  48.697 -8.926  1.00 25.03 ? 90  THR B O   1 
ATOM   1864 C  CB  . THR B 1 90  ? -11.957 47.116 -7.669  1.00 28.43 ? 90  THR B CB  1 
ATOM   1865 O  OG1 . THR B 1 90  ? -13.159 47.012 -6.897  1.00 30.31 ? 90  THR B OG1 1 
ATOM   1866 C  CG2 . THR B 1 90  ? -11.218 45.754 -7.646  1.00 26.78 ? 90  THR B CG2 1 
ATOM   1867 N  N   . VAL B 1 91  ? -8.724  47.846 -7.062  1.00 21.50 ? 91  VAL B N   1 
ATOM   1868 C  CA  . VAL B 1 91  ? -7.391  47.717 -7.643  1.00 20.51 ? 91  VAL B CA  1 
ATOM   1869 C  C   . VAL B 1 91  ? -6.831  46.372 -7.255  1.00 19.50 ? 91  VAL B C   1 
ATOM   1870 O  O   . VAL B 1 91  ? -6.892  45.966 -6.075  1.00 17.81 ? 91  VAL B O   1 
ATOM   1871 C  CB  . VAL B 1 91  ? -6.414  48.803 -7.139  1.00 20.23 ? 91  VAL B CB  1 
ATOM   1872 C  CG1 . VAL B 1 91  ? -5.125  48.734 -7.950  1.00 19.99 ? 91  VAL B CG1 1 
ATOM   1873 C  CG2 . VAL B 1 91  ? -7.015  50.192 -7.320  1.00 22.09 ? 91  VAL B CG2 1 
ATOM   1874 N  N   . ILE B 1 92  ? -6.285  45.666 -8.236  1.00 19.36 ? 92  ILE B N   1 
ATOM   1875 C  CA  . ILE B 1 92  ? -5.675  44.389 -7.959  1.00 18.98 ? 92  ILE B CA  1 
ATOM   1876 C  C   . ILE B 1 92  ? -4.186  44.536 -8.126  1.00 16.64 ? 92  ILE B C   1 
ATOM   1877 O  O   . ILE B 1 92  ? -3.752  45.015 -9.157  1.00 16.68 ? 92  ILE B O   1 
ATOM   1878 C  CB  . ILE B 1 92  ? -6.157  43.346 -8.971  1.00 21.53 ? 92  ILE B CB  1 
ATOM   1879 C  CG1 . ILE B 1 92  ? -7.685  43.344 -9.029  1.00 23.96 ? 92  ILE B CG1 1 
ATOM   1880 C  CG2 . ILE B 1 92  ? -5.591  41.981 -8.617  1.00 21.28 ? 92  ILE B CG2 1 
ATOM   1881 C  CD1 . ILE B 1 92  ? -8.312  42.679 -7.834  1.00 26.70 ? 92  ILE B CD1 1 
ATOM   1882 N  N   . TYR B 1 93  ? -3.405  44.103 -7.137  1.00 15.33 ? 93  TYR B N   1 
ATOM   1883 C  CA  . TYR B 1 93  ? -1.941  44.151 -7.270  1.00 14.93 ? 93  TYR B CA  1 
ATOM   1884 C  C   . TYR B 1 93  ? -1.328  42.783 -7.211  1.00 14.38 ? 93  TYR B C   1 
ATOM   1885 O  O   . TYR B 1 93  ? -1.784  41.929 -6.455  1.00 14.80 ? 93  TYR B O   1 
ATOM   1886 C  CB  . TYR B 1 93  ? -1.313  44.999 -6.137  1.00 14.74 ? 93  TYR B CB  1 
ATOM   1887 C  CG  . TYR B 1 93  ? -1.461  46.492 -6.297  1.00 14.67 ? 93  TYR B CG  1 
ATOM   1888 C  CD1 . TYR B 1 93  ? -0.757  47.184 -7.302  1.00 14.95 ? 93  TYR B CD1 1 
ATOM   1889 C  CD2 . TYR B 1 93  ? -2.292  47.215 -5.444  1.00 15.36 ? 93  TYR B CD2 1 
ATOM   1890 C  CE1 . TYR B 1 93  ? -0.913  48.546 -7.463  1.00 15.41 ? 93  TYR B CE1 1 
ATOM   1891 C  CE2 . TYR B 1 93  ? -2.453  48.603 -5.593  1.00 16.70 ? 93  TYR B CE2 1 
ATOM   1892 C  CZ  . TYR B 1 93  ? -1.736  49.253 -6.584  1.00 16.40 ? 93  TYR B CZ  1 
ATOM   1893 O  OH  . TYR B 1 93  ? -1.877  50.617 -6.708  1.00 18.32 ? 93  TYR B OH  1 
ATOM   1894 N  N   . TRP B 1 94  ? -0.267  42.589 -7.989  1.00 14.48 ? 94  TRP B N   1 
ATOM   1895 C  CA  . TRP B 1 94  ? 0.655   41.444 -7.840  1.00 14.42 ? 94  TRP B CA  1 
ATOM   1896 C  C   . TRP B 1 94  ? 1.986   42.006 -7.421  1.00 14.10 ? 94  TRP B C   1 
ATOM   1897 O  O   . TRP B 1 94  ? 2.184   43.223 -7.507  1.00 14.15 ? 94  TRP B O   1 
ATOM   1898 C  CB  . TRP B 1 94  ? 0.813   40.754 -9.197  1.00 15.05 ? 94  TRP B CB  1 
ATOM   1899 C  CG  . TRP B 1 94  ? -0.400  39.937 -9.598  1.00 16.65 ? 94  TRP B CG  1 
ATOM   1900 C  CD1 . TRP B 1 94  ? -0.591  38.585 -9.416  1.00 17.35 ? 94  TRP B CD1 1 
ATOM   1901 C  CD2 . TRP B 1 94  ? -1.630  40.412 -10.265 1.00 17.40 ? 94  TRP B CD2 1 
ATOM   1902 N  NE1 . TRP B 1 94  ? -1.808  38.191 -9.915  1.00 19.02 ? 94  TRP B NE1 1 
ATOM   1903 C  CE2 . TRP B 1 94  ? -2.478  39.244 -10.435 1.00 19.07 ? 94  TRP B CE2 1 
ATOM   1904 C  CE3 . TRP B 1 94  ? -2.075  41.642 -10.738 1.00 17.84 ? 94  TRP B CE3 1 
ATOM   1905 C  CZ2 . TRP B 1 94  ? -3.727  39.318 -11.051 1.00 19.91 ? 94  TRP B CZ2 1 
ATOM   1906 C  CZ3 . TRP B 1 94  ? -3.329  41.700 -11.373 1.00 18.41 ? 94  TRP B CZ3 1 
ATOM   1907 C  CH2 . TRP B 1 94  ? -4.136  40.574 -11.504 1.00 19.50 ? 94  TRP B CH2 1 
ATOM   1908 N  N   . LEU B 1 95  ? 2.927   41.163 -6.991  1.00 14.29 ? 95  LEU B N   1 
ATOM   1909 C  CA  . LEU B 1 95  ? 4.278   41.626 -6.629  1.00 13.89 ? 95  LEU B CA  1 
ATOM   1910 C  C   . LEU B 1 95  ? 5.164   41.333 -7.820  1.00 14.32 ? 95  LEU B C   1 
ATOM   1911 O  O   . LEU B 1 95  ? 4.995   40.286 -8.447  1.00 15.11 ? 95  LEU B O   1 
ATOM   1912 C  CB  . LEU B 1 95  ? 4.835   40.775 -5.471  1.00 14.19 ? 95  LEU B CB  1 
ATOM   1913 C  CG  . LEU B 1 95  ? 4.699   41.302 -4.061  1.00 15.32 ? 95  LEU B CG  1 
ATOM   1914 C  CD1 . LEU B 1 95  ? 5.133   40.212 -3.079  1.00 15.44 ? 95  LEU B CD1 1 
ATOM   1915 C  CD2 . LEU B 1 95  ? 5.498   42.634 -3.895  1.00 13.62 ? 95  LEU B CD2 1 
ATOM   1916 N  N   . ALA B 1 96  ? 6.088   42.228 -8.153  1.00 14.18 ? 96  ALA B N   1 
ATOM   1917 C  CA  . ALA B 1 96  ? 7.029   41.949 -9.261  1.00 15.88 ? 96  ALA B CA  1 
ATOM   1918 C  C   . ALA B 1 96  ? 8.370   42.542 -8.918  1.00 16.21 ? 96  ALA B C   1 
ATOM   1919 O  O   . ALA B 1 96  ? 8.444   43.733 -8.585  1.00 15.33 ? 96  ALA B O   1 
ATOM   1920 C  CB  . ALA B 1 96  ? 6.523   42.598 -10.558 1.00 15.80 ? 96  ALA B CB  1 
ATOM   1921 N  N   . GLU B 1 97  ? 9.420   41.728 -9.019  1.00 17.62 ? 97  GLU B N   1 
ATOM   1922 C  CA  . GLU B 1 97  ? 10.795  42.179 -8.821  1.00 18.51 ? 97  GLU B CA  1 
ATOM   1923 C  C   . GLU B 1 97  ? 11.437  42.668 -10.135 1.00 19.96 ? 97  GLU B C   1 
ATOM   1924 O  O   . GLU B 1 97  ? 11.303  42.008 -11.158 1.00 18.84 ? 97  GLU B O   1 
ATOM   1925 C  CB  . GLU B 1 97  ? 11.648  41.025 -8.296  1.00 20.24 ? 97  GLU B CB  1 
ATOM   1926 C  CG  . GLU B 1 97  ? 13.005  41.514 -7.806  1.00 22.77 ? 97  GLU B CG  1 
ATOM   1927 C  CD  . GLU B 1 97  ? 13.745  40.487 -6.976  1.00 25.75 ? 97  GLU B CD  1 
ATOM   1928 O  OE1 . GLU B 1 97  ? 14.864  40.787 -6.550  1.00 29.10 ? 97  GLU B OE1 1 
ATOM   1929 O  OE2 . GLU B 1 97  ? 13.224  39.386 -6.764  0.90 26.74 ? 97  GLU B OE2 1 
ATOM   1930 N  N   . VAL B 1 98  ? 12.142  43.811 -10.112 1.00 20.54 ? 98  VAL B N   1 
ATOM   1931 C  CA  . VAL B 1 98  ? 12.917  44.194 -11.321 1.00 22.43 ? 98  VAL B CA  1 
ATOM   1932 C  C   . VAL B 1 98  ? 14.169  43.309 -11.454 1.00 23.94 ? 98  VAL B C   1 
ATOM   1933 O  O   . VAL B 1 98  ? 14.813  42.992 -10.472 1.00 24.24 ? 98  VAL B O   1 
ATOM   1934 C  CB  . VAL B 1 98  ? 13.296  45.692 -11.371 1.00 22.27 ? 98  VAL B CB  1 
ATOM   1935 C  CG1 . VAL B 1 98  ? 12.018  46.527 -11.396 1.00 22.23 ? 98  VAL B CG1 1 
ATOM   1936 C  CG2 . VAL B 1 98  ? 14.194  46.125 -10.197 1.00 20.42 ? 98  VAL B CG2 1 
ATOM   1937 N  N   . LYS B 1 99  ? 14.487  42.913 -12.678 1.00 27.42 ? 99  LYS B N   1 
ATOM   1938 C  CA  . LYS B 1 99  ? 15.685  42.158 -12.971 1.00 31.34 ? 99  LYS B CA  1 
ATOM   1939 C  C   . LYS B 1 99  ? 16.971  42.930 -12.655 1.00 31.87 ? 99  LYS B C   1 
ATOM   1940 O  O   . LYS B 1 99  ? 17.892  42.377 -12.059 1.00 30.65 ? 99  LYS B O   1 
ATOM   1941 C  CB  . LYS B 1 99  ? 15.696  41.767 -14.455 1.00 36.17 ? 99  LYS B CB  1 
ATOM   1942 C  CG  . LYS B 1 99  ? 15.350  40.317 -14.711 1.00 39.37 ? 99  LYS B CG  1 
ATOM   1943 C  CD  . LYS B 1 99  ? 13.854  40.081 -14.901 1.00 39.45 ? 99  LYS B CD  1 
ATOM   1944 C  CE  . LYS B 1 99  ? 13.645  39.069 -16.011 1.00 41.04 ? 99  LYS B CE  1 
ATOM   1945 N  NZ  . LYS B 1 99  ? 12.230  38.884 -16.453 0.30 40.90 ? 99  LYS B NZ  1 
ATOM   1946 N  N   . ASP B 1 100 ? 17.029  44.200 -13.071 1.00 31.75 ? 100 ASP B N   1 
ATOM   1947 C  CA  . ASP B 1 100 ? 18.160  45.056 -12.756 1.00 31.43 ? 100 ASP B CA  1 
ATOM   1948 C  C   . ASP B 1 100 ? 17.745  46.075 -11.742 1.00 29.35 ? 100 ASP B C   1 
ATOM   1949 O  O   . ASP B 1 100 ? 16.813  46.858 -11.979 1.00 29.16 ? 100 ASP B O   1 
ATOM   1950 C  CB  . ASP B 1 100 ? 18.679  45.800 -13.984 1.00 36.01 ? 100 ASP B CB  1 
ATOM   1951 C  CG  . ASP B 1 100 ? 19.560  44.932 -14.861 1.00 40.06 ? 100 ASP B CG  1 
ATOM   1952 O  OD1 . ASP B 1 100 ? 19.622  43.697 -14.648 1.00 40.22 ? 100 ASP B OD1 1 
ATOM   1953 O  OD2 . ASP B 1 100 ? 20.204  45.504 -15.760 1.00 44.04 ? 100 ASP B OD2 1 
ATOM   1954 N  N   . TYR B 1 101 ? 18.488  46.091 -10.648 1.00 26.07 ? 101 TYR B N   1 
ATOM   1955 C  CA  . TYR B 1 101 ? 18.337  47.054 -9.603  1.00 26.38 ? 101 TYR B CA  1 
ATOM   1956 C  C   . TYR B 1 101 ? 18.214  48.477 -10.151 1.00 26.36 ? 101 TYR B C   1 
ATOM   1957 O  O   . TYR B 1 101 ? 17.380  49.267 -9.675  1.00 25.25 ? 101 TYR B O   1 
ATOM   1958 C  CB  . TYR B 1 101 ? 19.548  46.934 -8.674  1.00 27.34 ? 101 TYR B CB  1 
ATOM   1959 C  CG  . TYR B 1 101 ? 19.386  47.678 -7.380  1.00 27.89 ? 101 TYR B CG  1 
ATOM   1960 C  CD1 . TYR B 1 101 ? 19.750  49.022 -7.283  1.00 27.76 ? 101 TYR B CD1 1 
ATOM   1961 C  CD2 . TYR B 1 101 ? 18.842  47.050 -6.255  1.00 26.74 ? 101 TYR B CD2 1 
ATOM   1962 C  CE1 . TYR B 1 101 ? 19.589  49.707 -6.097  1.00 28.83 ? 101 TYR B CE1 1 
ATOM   1963 C  CE2 . TYR B 1 101 ? 18.685  47.736 -5.071  1.00 27.30 ? 101 TYR B CE2 1 
ATOM   1964 C  CZ  . TYR B 1 101 ? 19.069  49.051 -4.997  1.00 27.93 ? 101 TYR B CZ  1 
ATOM   1965 O  OH  . TYR B 1 101 ? 18.903  49.743 -3.822  1.00 31.55 ? 101 TYR B OH  1 
ATOM   1966 N  N   . ASP B 1 102 ? 19.050  48.814 -11.142 1.00 26.94 ? 102 ASP B N   1 
ATOM   1967 C  CA  . ASP B 1 102 ? 19.201  50.196 -11.570 1.00 27.11 ? 102 ASP B CA  1 
ATOM   1968 C  C   . ASP B 1 102 ? 18.384  50.481 -12.858 1.00 27.06 ? 102 ASP B C   1 
ATOM   1969 O  O   . ASP B 1 102 ? 18.674  51.427 -13.615 1.00 28.17 ? 102 ASP B O   1 
ATOM   1970 C  CB  . ASP B 1 102 ? 20.710  50.529 -11.711 1.00 29.45 ? 102 ASP B CB  1 
ATOM   1971 C  CG  . ASP B 1 102 ? 21.391  49.733 -12.820 1.00 31.16 ? 102 ASP B CG  1 
ATOM   1972 O  OD1 . ASP B 1 102 ? 20.650  49.063 -13.580 1.00 31.15 ? 102 ASP B OD1 1 
ATOM   1973 O  OD2 . ASP B 1 102 ? 22.644  49.755 -12.919 1.00 30.92 ? 102 ASP B OD2 1 
ATOM   1974 N  N   . VAL B 1 103 ? 17.372  49.656 -13.113 1.00 25.96 ? 103 VAL B N   1 
ATOM   1975 C  CA  . VAL B 1 103 ? 16.472  49.824 -14.280 1.00 26.29 ? 103 VAL B CA  1 
ATOM   1976 C  C   . VAL B 1 103 ? 15.960  51.269 -14.368 1.00 26.51 ? 103 VAL B C   1 
ATOM   1977 O  O   . VAL B 1 103 ? 15.604  51.896 -13.328 1.00 25.87 ? 103 VAL B O   1 
ATOM   1978 C  CB  . VAL B 1 103 ? 15.283  48.792 -14.236 1.00 26.11 ? 103 VAL B CB  1 
ATOM   1979 C  CG1 . VAL B 1 103 ? 14.351  49.092 -13.079 1.00 24.00 ? 103 VAL B CG1 1 
ATOM   1980 C  CG2 . VAL B 1 103 ? 14.492  48.740 -15.544 1.00 26.26 ? 103 VAL B CG2 1 
ATOM   1981 N  N   . GLU B 1 104 ? 15.958  51.813 -15.582 1.00 27.39 ? 104 GLU B N   1 
ATOM   1982 C  CA  . GLU B 1 104 ? 15.480  53.160 -15.814 1.00 29.55 ? 104 GLU B CA  1 
ATOM   1983 C  C   . GLU B 1 104 ? 13.976  53.304 -15.558 1.00 28.68 ? 104 GLU B C   1 
ATOM   1984 O  O   . GLU B 1 104 ? 13.186  52.508 -16.036 1.00 29.17 ? 104 GLU B O   1 
ATOM   1985 C  CB  . GLU B 1 104 ? 15.808  53.640 -17.246 1.00 32.74 ? 104 GLU B CB  1 
ATOM   1986 C  CG  . GLU B 1 104 ? 15.365  55.085 -17.497 1.00 34.46 ? 104 GLU B CG  1 
ATOM   1987 C  CD  . GLU B 1 104 ? 15.724  55.616 -18.880 1.00 39.14 ? 104 GLU B CD  1 
ATOM   1988 O  OE1 . GLU B 1 104 ? 15.797  56.849 -19.021 1.00 42.34 ? 104 GLU B OE1 1 
ATOM   1989 O  OE2 . GLU B 1 104 ? 15.933  54.825 -19.829 1.00 40.52 ? 104 GLU B OE2 1 
ATOM   1990 N  N   . ILE B 1 105 ? 13.601  54.324 -14.795 1.00 28.07 ? 105 ILE B N   1 
ATOM   1991 C  CA  . ILE B 1 105 ? 12.201  54.697 -14.626 1.00 27.65 ? 105 ILE B CA  1 
ATOM   1992 C  C   . ILE B 1 105 ? 11.854  55.844 -15.590 1.00 30.10 ? 105 ILE B C   1 
ATOM   1993 O  O   . ILE B 1 105 ? 12.423  56.923 -15.519 1.00 31.67 ? 105 ILE B O   1 
ATOM   1994 C  CB  . ILE B 1 105 ? 11.875  55.066 -13.161 1.00 26.29 ? 105 ILE B CB  1 
ATOM   1995 C  CG1 . ILE B 1 105 ? 12.354  53.955 -12.195 1.00 25.09 ? 105 ILE B CG1 1 
ATOM   1996 C  CG2 . ILE B 1 105 ? 10.377  55.363 -13.002 1.00 26.20 ? 105 ILE B CG2 1 
ATOM   1997 C  CD1 . ILE B 1 105 ? 11.743  52.574 -12.488 1.00 23.47 ? 105 ILE B CD1 1 
ATOM   1998 N  N   . ARG B 1 106 ? 10.923  55.582 -16.496 1.00 31.79 ? 106 ARG B N   1 
ATOM   1999 C  CA  . ARG B 1 106 ? 10.437  56.625 -17.377 1.00 35.72 ? 106 ARG B CA  1 
ATOM   2000 C  C   . ARG B 1 106 ? 8.992   56.906 -17.013 1.00 34.30 ? 106 ARG B C   1 
ATOM   2001 O  O   . ARG B 1 106 ? 8.151   56.007 -17.035 1.00 36.17 ? 106 ARG B O   1 
ATOM   2002 C  CB  . ARG B 1 106 ? 10.541  56.189 -18.838 1.00 39.34 ? 106 ARG B CB  1 
ATOM   2003 C  CG  . ARG B 1 106 ? 11.747  55.314 -19.140 1.00 43.36 ? 106 ARG B CG  1 
ATOM   2004 C  CD  . ARG B 1 106 ? 11.636  54.675 -20.515 1.00 47.25 ? 106 ARG B CD  1 
ATOM   2005 N  NE  . ARG B 1 106 ? 12.889  54.757 -21.259 1.00 50.22 ? 106 ARG B NE  1 
ATOM   2006 C  CZ  . ARG B 1 106 ? 13.347  55.866 -21.831 0.00 20.00 ? 106 ARG B CZ  1 
ATOM   2007 N  NH1 . ARG B 1 106 ? 12.654  56.994 -21.745 0.00 20.00 ? 106 ARG B NH1 1 
ATOM   2008 N  NH2 . ARG B 1 106 ? 14.498  55.849 -22.489 0.00 20.00 ? 106 ARG B NH2 1 
ATOM   2009 N  N   . LEU B 1 107 ? 8.702   58.158 -16.683 1.00 33.01 ? 107 LEU B N   1 
ATOM   2010 C  CA  . LEU B 1 107 ? 7.336   58.542 -16.369 1.00 33.60 ? 107 LEU B CA  1 
ATOM   2011 C  C   . LEU B 1 107 ? 6.643   59.074 -17.604 1.00 35.61 ? 107 LEU B C   1 
ATOM   2012 O  O   . LEU B 1 107 ? 7.287   59.423 -18.571 1.00 35.10 ? 107 LEU B O   1 
ATOM   2013 C  CB  . LEU B 1 107 ? 7.326   59.609 -15.277 1.00 32.29 ? 107 LEU B CB  1 
ATOM   2014 C  CG  . LEU B 1 107 ? 7.926   59.165 -13.942 1.00 30.83 ? 107 LEU B CG  1 
ATOM   2015 C  CD1 . LEU B 1 107 ? 7.785   60.284 -12.928 1.00 30.31 ? 107 LEU B CD1 1 
ATOM   2016 C  CD2 . LEU B 1 107 ? 7.228   57.887 -13.463 1.00 28.12 ? 107 LEU B CD2 1 
ATOM   2017 N  N   . SER B 1 108 ? 5.321   59.107 -17.565 1.00 36.98 ? 108 SER B N   1 
ATOM   2018 C  CA  . SER B 1 108 ? 4.545   59.742 -18.611 1.00 40.71 ? 108 SER B CA  1 
ATOM   2019 C  C   . SER B 1 108 ? 3.850   60.933 -17.950 1.00 41.38 ? 108 SER B C   1 
ATOM   2020 O  O   . SER B 1 108 ? 4.091   61.197 -16.765 1.00 37.99 ? 108 SER B O   1 
ATOM   2021 C  CB  . SER B 1 108 ? 3.547   58.749 -19.204 1.00 40.42 ? 108 SER B CB  1 
ATOM   2022 O  OG  . SER B 1 108 ? 2.640   58.319 -18.210 1.00 39.13 ? 108 SER B OG  1 
ATOM   2023 N  N   . HIS B 1 109 ? 2.992   61.631 -18.699 1.00 43.66 ? 109 HIS B N   1 
ATOM   2024 C  CA  . HIS B 1 109 ? 2.359   62.859 -18.206 1.00 46.34 ? 109 HIS B CA  1 
ATOM   2025 C  C   . HIS B 1 109 ? 1.521   62.651 -16.965 1.00 44.14 ? 109 HIS B C   1 
ATOM   2026 O  O   . HIS B 1 109 ? 1.279   63.585 -16.200 1.00 43.62 ? 109 HIS B O   1 
ATOM   2027 C  CB  . HIS B 1 109 ? 1.533   63.526 -19.308 1.00 50.29 ? 109 HIS B CB  1 
ATOM   2028 C  CG  . HIS B 1 109 ? 0.243   62.806 -19.613 0.07 53.12 ? 109 HIS B CG  1 
ATOM   2029 N  ND1 . HIS B 1 109 ? 0.181   61.750 -20.450 0.87 54.44 ? 109 HIS B ND1 1 
ATOM   2030 C  CD2 . HIS B 1 109 ? -1.053  63.018 -19.146 1.00 55.38 ? 109 HIS B CD2 1 
ATOM   2031 C  CE1 . HIS B 1 109 ? -1.090  61.310 -20.523 0.86 56.48 ? 109 HIS B CE1 1 
ATOM   2032 N  NE2 . HIS B 1 109 ? -1.846  62.085 -19.722 0.84 58.25 ? 109 HIS B NE2 1 
ATOM   2033 N  N   . GLU B 1 110 ? 1.080   61.420 -16.742 1.00 43.52 ? 110 GLU B N   1 
ATOM   2034 C  CA  . GLU B 1 110 ? 0.243   61.090 -15.576 1.00 42.66 ? 110 GLU B CA  1 
ATOM   2035 C  C   . GLU B 1 110 ? 0.947   61.181 -14.214 1.00 37.71 ? 110 GLU B C   1 
ATOM   2036 O  O   . GLU B 1 110 ? 0.286   61.303 -13.195 1.00 37.60 ? 110 GLU B O   1 
ATOM   2037 C  CB  . GLU B 1 110 ? -0.389  59.718 -15.774 1.00 44.32 ? 110 GLU B CB  1 
ATOM   2038 C  CG  . GLU B 1 110 ? -0.960  59.591 -17.182 1.00 51.57 ? 110 GLU B CG  1 
ATOM   2039 C  CD  . GLU B 1 110 ? -1.417  58.192 -17.526 0.90 54.18 ? 110 GLU B CD  1 
ATOM   2040 O  OE1 . GLU B 1 110 ? -2.188  57.612 -16.718 1.00 54.23 ? 110 GLU B OE1 1 
ATOM   2041 O  OE2 . GLU B 1 110 ? -1.004  57.690 -18.607 1.00 57.62 ? 110 GLU B OE2 1 
ATOM   2042 N  N   . HIS B 1 111 ? 2.276   61.128 -14.189 1.00 34.76 ? 111 HIS B N   1 
ATOM   2043 C  CA  . HIS B 1 111 ? 2.995   61.226 -12.908 1.00 32.41 ? 111 HIS B CA  1 
ATOM   2044 C  C   . HIS B 1 111 ? 4.138   62.191 -13.028 1.00 32.88 ? 111 HIS B C   1 
ATOM   2045 O  O   . HIS B 1 111 ? 4.708   62.345 -14.105 1.00 33.49 ? 111 HIS B O   1 
ATOM   2046 C  CB  . HIS B 1 111 ? 3.488   59.849 -12.424 1.00 29.05 ? 111 HIS B CB  1 
ATOM   2047 C  CG  . HIS B 1 111 ? 2.384   58.814 -12.306 1.00 28.17 ? 111 HIS B CG  1 
ATOM   2048 N  ND1 . HIS B 1 111 ? 2.023   58.019 -13.331 1.00 27.61 ? 111 HIS B ND1 1 
ATOM   2049 C  CD2 . HIS B 1 111 ? 1.546   58.483 -11.235 1.00 27.58 ? 111 HIS B CD2 1 
ATOM   2050 C  CE1 . HIS B 1 111 ? 1.001   57.225 -12.952 1.00 26.54 ? 111 HIS B CE1 1 
ATOM   2051 N  NE2 . HIS B 1 111 ? 0.718   57.498 -11.664 1.00 26.73 ? 111 HIS B NE2 1 
ATOM   2052 N  N   . GLN B 1 112 ? 4.513   62.802 -11.911 1.00 31.14 ? 112 GLN B N   1 
ATOM   2053 C  CA  . GLN B 1 112 ? 5.486   63.895 -11.927 1.00 33.08 ? 112 GLN B CA  1 
ATOM   2054 C  C   . GLN B 1 112 ? 6.788   63.558 -11.184 1.00 31.61 ? 112 GLN B C   1 
ATOM   2055 O  O   . GLN B 1 112 ? 7.729   64.308 -11.249 1.00 32.65 ? 112 GLN B O   1 
ATOM   2056 C  CB  . GLN B 1 112 ? 4.849   65.156 -11.312 1.00 34.45 ? 112 GLN B CB  1 
ATOM   2057 C  CG  . GLN B 1 112 ? 4.367   64.941 -9.876  1.00 34.94 ? 112 GLN B CG  1 
ATOM   2058 C  CD  . GLN B 1 112 ? 3.737   66.184 -9.269  1.00 37.49 ? 112 GLN B CD  1 
ATOM   2059 O  OE1 . GLN B 1 112 ? 2.795   66.786 -9.988  1.00 37.37 ? 112 GLN B OE1 1 
ATOM   2060 N  NE2 . GLN B 1 112 ? 4.092   66.593 -8.165  1.00 38.45 ? 112 GLN B NE2 1 
ATOM   2061 N  N   . ALA B 1 113 ? 6.812   62.451 -10.438 1.00 28.60 ? 113 ALA B N   1 
ATOM   2062 C  CA  . ALA B 1 113 ? 7.979   62.063 -9.623  1.00 26.53 ? 113 ALA B CA  1 
ATOM   2063 C  C   . ALA B 1 113 ? 7.887   60.565 -9.287  1.00 24.19 ? 113 ALA B C   1 
ATOM   2064 O  O   . ALA B 1 113 ? 6.804   59.970 -9.395  1.00 23.57 ? 113 ALA B O   1 
ATOM   2065 C  CB  . ALA B 1 113 ? 8.064   62.910 -8.348  1.00 26.29 ? 113 ALA B CB  1 
ATOM   2066 N  N   . TYR B 1 114 ? 9.015   59.946 -8.947  1.00 23.16 ? 114 TYR B N   1 
ATOM   2067 C  CA  . TYR B 1 114 ? 9.015   58.568 -8.463  1.00 22.13 ? 114 TYR B CA  1 
ATOM   2068 C  C   . TYR B 1 114 ? 10.038  58.476 -7.344  1.00 22.77 ? 114 TYR B C   1 
ATOM   2069 O  O   . TYR B 1 114 ? 10.976  59.302 -7.277  1.00 23.84 ? 114 TYR B O   1 
ATOM   2070 C  CB  . TYR B 1 114 ? 9.377   57.579 -9.580  1.00 21.85 ? 114 TYR B CB  1 
ATOM   2071 C  CG  . TYR B 1 114 ? 10.808  57.743 -10.098 1.00 22.85 ? 114 TYR B CG  1 
ATOM   2072 C  CD1 . TYR B 1 114 ? 11.871  57.042 -9.510  1.00 22.92 ? 114 TYR B CD1 1 
ATOM   2073 C  CD2 . TYR B 1 114 ? 11.086  58.581 -11.175 1.00 24.57 ? 114 TYR B CD2 1 
ATOM   2074 C  CE1 . TYR B 1 114 ? 13.184  57.180 -9.973  1.00 23.82 ? 114 TYR B CE1 1 
ATOM   2075 C  CE2 . TYR B 1 114 ? 12.387  58.729 -11.640 1.00 26.67 ? 114 TYR B CE2 1 
ATOM   2076 C  CZ  . TYR B 1 114 ? 13.430  58.030 -11.033 1.00 26.10 ? 114 TYR B CZ  1 
ATOM   2077 O  OH  . TYR B 1 114 ? 14.731  58.201 -11.500 1.00 28.86 ? 114 TYR B OH  1 
ATOM   2078 N  N   . ARG B 1 115 ? 9.887   57.462 -6.494  1.00 20.09 ? 115 ARG B N   1 
ATOM   2079 C  CA  . ARG B 1 115 ? 10.867  57.172 -5.465  1.00 19.61 ? 115 ARG B CA  1 
ATOM   2080 C  C   . ARG B 1 115 ? 10.932  55.683 -5.272  1.00 18.83 ? 115 ARG B C   1 
ATOM   2081 O  O   . ARG B 1 115 ? 9.910   54.987 -5.354  1.00 16.96 ? 115 ARG B O   1 
ATOM   2082 C  CB  . ARG B 1 115 ? 10.485  57.795 -4.109  1.00 21.20 ? 115 ARG B CB  1 
ATOM   2083 C  CG  . ARG B 1 115 ? 10.685  59.299 -3.969  1.00 23.47 ? 115 ARG B CG  1 
ATOM   2084 C  CD  . ARG B 1 115 ? 12.184  59.604 -4.126  1.00 25.34 ? 115 ARG B CD  1 
ATOM   2085 N  NE  . ARG B 1 115 ? 12.553  60.981 -3.838  1.00 26.39 ? 115 ARG B NE  1 
ATOM   2086 C  CZ  . ARG B 1 115 ? 12.526  61.983 -4.708  1.00 28.74 ? 115 ARG B CZ  1 
ATOM   2087 N  NH1 . ARG B 1 115 ? 12.099  61.788 -5.952  1.00 28.36 ? 115 ARG B NH1 1 
ATOM   2088 N  NH2 . ARG B 1 115 ? 12.933  63.202 -4.319  1.00 30.09 ? 115 ARG B NH2 1 
ATOM   2089 N  N   . TRP B 1 116 ? 12.128  55.187 -4.984  1.00 18.54 ? 116 TRP B N   1 
ATOM   2090 C  CA  . TRP B 1 116 ? 12.292  53.845 -4.461  1.00 18.56 ? 116 TRP B CA  1 
ATOM   2091 C  C   . TRP B 1 116 ? 12.408  54.019 -2.978  1.00 19.22 ? 116 TRP B C   1 
ATOM   2092 O  O   . TRP B 1 116 ? 13.299  54.712 -2.521  1.00 20.64 ? 116 TRP B O   1 
ATOM   2093 C  CB  . TRP B 1 116 ? 13.593  53.265 -4.968  1.00 18.82 ? 116 TRP B CB  1 
ATOM   2094 C  CG  . TRP B 1 116 ? 13.593  52.792 -6.402  1.00 18.44 ? 116 TRP B CG  1 
ATOM   2095 C  CD1 . TRP B 1 116 ? 14.129  53.440 -7.520  1.00 19.49 ? 116 TRP B CD1 1 
ATOM   2096 C  CD2 . TRP B 1 116 ? 13.049  51.520 -6.911  1.00 18.09 ? 116 TRP B CD2 1 
ATOM   2097 N  NE1 . TRP B 1 116 ? 13.953  52.675 -8.664  1.00 19.08 ? 116 TRP B NE1 1 
ATOM   2098 C  CE2 . TRP B 1 116 ? 13.313  51.506 -8.361  1.00 18.85 ? 116 TRP B CE2 1 
ATOM   2099 C  CE3 . TRP B 1 116 ? 12.380  50.436 -6.333  1.00 17.50 ? 116 TRP B CE3 1 
ATOM   2100 C  CZ2 . TRP B 1 116 ? 12.921  50.443 -9.170  1.00 17.94 ? 116 TRP B CZ2 1 
ATOM   2101 C  CZ3 . TRP B 1 116 ? 12.010  49.364 -7.168  1.00 17.15 ? 116 TRP B CZ3 1 
ATOM   2102 C  CH2 . TRP B 1 116 ? 12.283  49.378 -8.545  1.00 17.32 ? 116 TRP B CH2 1 
ATOM   2103 N  N   . LEU B 1 117 ? 11.556  53.370 -2.201  1.00 18.21 ? 117 LEU B N   1 
ATOM   2104 C  CA  . LEU B 1 117 ? 11.578  53.546 -0.763  1.00 19.73 ? 117 LEU B CA  1 
ATOM   2105 C  C   . LEU B 1 117 ? 11.487  52.253 -0.008  1.00 18.89 ? 117 LEU B C   1 
ATOM   2106 O  O   . LEU B 1 117 ? 10.814  51.322 -0.458  1.00 17.16 ? 117 LEU B O   1 
ATOM   2107 C  CB  . LEU B 1 117 ? 10.411  54.442 -0.300  1.00 20.37 ? 117 LEU B CB  1 
ATOM   2108 C  CG  . LEU B 1 117 ? 10.378  55.841 -0.918  1.00 22.53 ? 117 LEU B CG  1 
ATOM   2109 C  CD1 . LEU B 1 117 ? 8.941   56.314 -1.051  1.00 23.79 ? 117 LEU B CD1 1 
ATOM   2110 C  CD2 . LEU B 1 117 ? 11.226  56.820 -0.135  1.00 24.20 ? 117 LEU B CD2 1 
ATOM   2111 N  N   . GLY B 1 118 ? 12.095  52.237 1.174   1.00 22.74 ? 118 GLY B N   1 
ATOM   2112 C  CA  . GLY B 1 118 ? 11.889  51.166 2.143   1.00 23.56 ? 118 GLY B CA  1 
ATOM   2113 C  C   . GLY B 1 118 ? 10.447  51.146 2.634   1.00 23.19 ? 118 GLY B C   1 
ATOM   2114 O  O   . GLY B 1 118 ? 9.671   52.108 2.412   1.00 23.31 ? 118 GLY B O   1 
ATOM   2115 N  N   . LEU B 1 119 ? 10.076  50.044 3.273   1.00 22.92 ? 119 LEU B N   1 
ATOM   2116 C  CA  . LEU B 1 119 ? 8.689   49.802 3.647   1.00 22.76 ? 119 LEU B CA  1 
ATOM   2117 C  C   . LEU B 1 119 ? 8.046   50.979 4.427   1.00 24.13 ? 119 LEU B C   1 
ATOM   2118 O  O   . LEU B 1 119 ? 6.948   51.457 4.083   1.00 22.46 ? 119 LEU B O   1 
ATOM   2119 C  CB  . LEU B 1 119 ? 8.557   48.492 4.448   1.00 22.04 ? 119 LEU B CB  1 
ATOM   2120 C  CG  . LEU B 1 119 ? 7.143   48.207 4.990   1.00 22.76 ? 119 LEU B CG  1 
ATOM   2121 C  CD1 . LEU B 1 119 ? 6.136   48.096 3.836   1.00 21.14 ? 119 LEU B CD1 1 
ATOM   2122 C  CD2 . LEU B 1 119 ? 7.088   46.963 5.907   1.00 23.08 ? 119 LEU B CD2 1 
ATOM   2123 N  N   . GLU B 1 120 ? 8.713   51.429 5.483   1.00 27.73 ? 120 GLU B N   1 
ATOM   2124 C  CA  . GLU B 1 120 ? 8.102   52.466 6.345   1.00 31.69 ? 120 GLU B CA  1 
ATOM   2125 C  C   . GLU B 1 120 ? 7.905   53.789 5.631   1.00 31.06 ? 120 GLU B C   1 
ATOM   2126 O  O   . GLU B 1 120 ? 6.832   54.387 5.729   1.00 30.95 ? 120 GLU B O   1 
ATOM   2127 C  CB  . GLU B 1 120 ? 8.845   52.645 7.668   1.00 36.25 ? 120 GLU B CB  1 
ATOM   2128 C  CG  . GLU B 1 120 ? 8.624   51.472 8.604   1.00 40.06 ? 120 GLU B CG  1 
ATOM   2129 C  CD  . GLU B 1 120 ? 7.146   51.136 8.822   1.00 42.51 ? 120 GLU B CD  1 
ATOM   2130 O  OE1 . GLU B 1 120 ? 6.442   51.925 9.491   0.60 44.17 ? 120 GLU B OE1 1 
ATOM   2131 O  OE2 . GLU B 1 120 ? 6.690   50.070 8.330   0.60 41.54 ? 120 GLU B OE2 1 
ATOM   2132 N  N   . GLU B 1 121 ? 8.910   54.218 4.876   1.00 30.85 ? 121 GLU B N   1 
ATOM   2133 C  CA  . GLU B 1 121 ? 8.735   55.422 4.063   1.00 32.82 ? 121 GLU B CA  1 
ATOM   2134 C  C   . GLU B 1 121 ? 7.698   55.181 2.952   1.00 29.38 ? 121 GLU B C   1 
ATOM   2135 O  O   . GLU B 1 121 ? 6.850   56.015 2.717   1.00 29.44 ? 121 GLU B O   1 
ATOM   2136 C  CB  . GLU B 1 121 ? 10.089  55.973 3.579   1.00 37.25 ? 121 GLU B CB  1 
ATOM   2137 C  CG  . GLU B 1 121 ? 11.050  56.198 4.766   1.00 43.92 ? 121 GLU B CG  1 
ATOM   2138 C  CD  . GLU B 1 121 ? 12.312  57.003 4.463   0.80 49.66 ? 121 GLU B CD  1 
ATOM   2139 O  OE1 . GLU B 1 121 ? 12.680  57.188 3.276   1.00 52.25 ? 121 GLU B OE1 1 
ATOM   2140 O  OE2 . GLU B 1 121 ? 12.944  57.461 5.449   0.80 54.31 ? 121 GLU B OE2 1 
ATOM   2141 N  N   . ALA B 1 122 ? 7.703   54.011 2.324   1.00 27.27 ? 122 ALA B N   1 
ATOM   2142 C  CA  . ALA B 1 122 ? 6.686   53.739 1.301   1.00 26.18 ? 122 ALA B CA  1 
ATOM   2143 C  C   . ALA B 1 122 ? 5.289   53.872 1.892   1.00 25.69 ? 122 ALA B C   1 
ATOM   2144 O  O   . ALA B 1 122 ? 4.425   54.476 1.297   1.00 25.53 ? 122 ALA B O   1 
ATOM   2145 C  CB  . ALA B 1 122 ? 6.866   52.354 0.654   1.00 24.01 ? 122 ALA B CB  1 
ATOM   2146 N  N   . CYS B 1 123 ? 5.080   53.280 3.057   1.00 26.14 ? 123 CYS B N   1 
ATOM   2147 C  CA  . CYS B 1 123 ? 3.793   53.340 3.708   1.00 29.08 ? 123 CYS B CA  1 
ATOM   2148 C  C   . CYS B 1 123 ? 3.395   54.775 4.053   1.00 32.56 ? 123 CYS B C   1 
ATOM   2149 O  O   . CYS B 1 123 ? 2.236   55.144 3.881   1.00 33.70 ? 123 CYS B O   1 
ATOM   2150 C  CB  . CYS B 1 123 ? 3.789   52.474 4.951   1.00 28.46 ? 123 CYS B CB  1 
ATOM   2151 S  SG  . CYS B 1 123 ? 3.649   50.747 4.480   1.00 26.50 ? 123 CYS B SG  1 
ATOM   2152 N  N   . GLN B 1 124 ? 4.360   55.570 4.511   1.00 34.55 ? 124 GLN B N   1 
ATOM   2153 C  CA  . GLN B 1 124 ? 4.137   56.998 4.807   1.00 39.19 ? 124 GLN B CA  1 
ATOM   2154 C  C   . GLN B 1 124 ? 3.625   57.787 3.583   1.00 39.82 ? 124 GLN B C   1 
ATOM   2155 O  O   . GLN B 1 124 ? 2.624   58.497 3.680   1.00 40.72 ? 124 GLN B O   1 
ATOM   2156 C  CB  . GLN B 1 124 ? 5.410   57.654 5.353   1.00 40.14 ? 124 GLN B CB  1 
ATOM   2157 C  CG  . GLN B 1 124 ? 5.686   57.392 6.826   1.00 43.07 ? 124 GLN B CG  1 
ATOM   2158 C  CD  . GLN B 1 124 ? 6.916   58.134 7.332   0.30 43.70 ? 124 GLN B CD  1 
ATOM   2159 O  OE1 . GLN B 1 124 ? 7.834   58.447 6.567   0.30 42.92 ? 124 GLN B OE1 1 
ATOM   2160 N  NE2 . GLN B 1 124 ? 6.938   58.418 8.627   0.30 45.46 ? 124 GLN B NE2 1 
ATOM   2161 N  N   . LEU B 1 125 ? 4.292   57.640 2.434   1.00 38.34 ? 125 LEU B N   1 
ATOM   2162 C  CA  . LEU B 1 125 ? 3.832   58.305 1.214   1.00 38.34 ? 125 LEU B CA  1 
ATOM   2163 C  C   . LEU B 1 125 ? 2.508   57.772 0.706   1.00 39.04 ? 125 LEU B C   1 
ATOM   2164 O  O   . LEU B 1 125 ? 1.624   58.551 0.364   1.00 39.71 ? 125 LEU B O   1 
ATOM   2165 C  CB  . LEU B 1 125 ? 4.871   58.235 0.099   1.00 37.98 ? 125 LEU B CB  1 
ATOM   2166 C  CG  . LEU B 1 125 ? 6.072   59.163 0.157   1.00 39.19 ? 125 LEU B CG  1 
ATOM   2167 C  CD1 . LEU B 1 125 ? 6.753   59.130 -1.198  1.00 38.00 ? 125 LEU B CD1 1 
ATOM   2168 C  CD2 . LEU B 1 125 ? 5.659   60.597 0.495   1.00 42.59 ? 125 LEU B CD2 1 
ATOM   2169 N  N   . ALA B 1 126 ? 2.371   56.441 0.642   1.00 36.87 ? 126 ALA B N   1 
ATOM   2170 C  CA  . ALA B 1 126 ? 1.131   55.827 0.185   1.00 35.58 ? 126 ALA B CA  1 
ATOM   2171 C  C   . ALA B 1 126 ? -0.055  56.334 1.010   1.00 38.02 ? 126 ALA B C   1 
ATOM   2172 O  O   . ALA B 1 126 ? -1.147  56.521 0.474   1.00 38.55 ? 126 ALA B O   1 
ATOM   2173 C  CB  . ALA B 1 126 ? 1.218   54.311 0.247   1.00 33.34 ? 126 ALA B CB  1 
ATOM   2174 N  N   . GLN B 1 127 ? 0.177   56.539 2.307   1.00 38.25 ? 127 GLN B N   1 
ATOM   2175 C  CA  . GLN B 1 127 ? -0.771  57.184 3.209   1.00 41.75 ? 127 GLN B CA  1 
ATOM   2176 C  C   . GLN B 1 127 ? -2.060  56.386 3.476   1.00 41.11 ? 127 GLN B C   1 
ATOM   2177 O  O   . GLN B 1 127 ? -2.375  56.113 4.640   1.00 42.93 ? 127 GLN B O   1 
ATOM   2178 C  CB  . GLN B 1 127 ? -1.067  58.605 2.706   1.00 45.77 ? 127 GLN B CB  1 
ATOM   2179 C  CG  . GLN B 1 127 ? -2.185  59.352 3.406   1.00 52.48 ? 127 GLN B CG  1 
ATOM   2180 C  CD  . GLN B 1 127 ? -2.393  60.720 2.789   1.00 56.02 ? 127 GLN B CD  1 
ATOM   2181 O  OE1 . GLN B 1 127 ? -3.228  60.891 1.897   1.00 58.57 ? 127 GLN B OE1 1 
ATOM   2182 N  NE2 . GLN B 1 127 ? -1.597  61.694 3.229   1.00 58.77 ? 127 GLN B NE2 1 
ATOM   2183 N  N   . PHE B 1 128 ? -2.816  56.076 2.427   1.00 38.43 ? 128 PHE B N   1 
ATOM   2184 C  CA  A PHE B 1 128 ? -4.040  55.280 2.628   0.50 37.94 ? 128 PHE B CA  1 
ATOM   2185 C  CA  B PHE B 1 128 ? -4.021  55.258 2.634   0.50 37.90 ? 128 PHE B CA  1 
ATOM   2186 C  C   . PHE B 1 128 ? -3.970  53.826 3.140   1.00 35.85 ? 128 PHE B C   1 
ATOM   2187 O  O   . PHE B 1 128 ? -3.080  52.976 2.844   1.00 33.45 ? 128 PHE B O   1 
ATOM   2188 C  CB  A PHE B 1 128 ? -4.897  55.325 1.352   0.50 37.93 ? 128 PHE B CB  1 
ATOM   2189 C  CB  B PHE B 1 128 ? -4.749  55.312 1.273   0.50 37.74 ? 128 PHE B CB  1 
ATOM   2190 C  CG  A PHE B 1 128 ? -5.164  56.726 0.863   0.50 41.00 ? 128 PHE B CG  1 
ATOM   2191 C  CG  B PHE B 1 128 ? -5.886  54.346 1.150   0.50 39.62 ? 128 PHE B CG  1 
ATOM   2192 C  CD1 A PHE B 1 128 ? -6.195  57.487 1.405   0.50 42.27 ? 128 PHE B CD1 1 
ATOM   2193 C  CD1 B PHE B 1 128 ? -7.030  54.484 1.939   0.50 41.40 ? 128 PHE B CD1 1 
ATOM   2194 C  CD2 A PHE B 1 128 ? -4.372  57.292 -0.127  0.50 40.84 ? 128 PHE B CD2 1 
ATOM   2195 C  CD2 B PHE B 1 128 ? -5.819  53.303 0.236   0.50 39.24 ? 128 PHE B CD2 1 
ATOM   2196 C  CE1 A PHE B 1 128 ? -6.437  58.775 0.961   0.30 43.70 ? 128 PHE B CE1 1 
ATOM   2197 C  CE1 B PHE B 1 128 ? -8.082  53.589 1.836   0.70 41.28 ? 128 PHE B CE1 1 
ATOM   2198 C  CE2 A PHE B 1 128 ? -4.607  58.581 -0.573  0.50 42.35 ? 128 PHE B CE2 1 
ATOM   2199 C  CE2 B PHE B 1 128 ? -6.872  52.411 0.121   0.50 40.91 ? 128 PHE B CE2 1 
ATOM   2200 C  CZ  A PHE B 1 128 ? -5.642  59.323 -0.031  0.30 43.52 ? 128 PHE B CZ  1 
ATOM   2201 C  CZ  B PHE B 1 128 ? -8.007  52.556 0.922   0.70 41.37 ? 128 PHE B CZ  1 
ATOM   2202 N  N   . LYS B 1 129 ? -4.891  53.622 4.078   1.00 35.59 ? 129 LYS B N   1 
ATOM   2203 C  CA  . LYS B 1 129 ? -4.932  52.386 4.853   1.00 36.66 ? 129 LYS B CA  1 
ATOM   2204 C  C   . LYS B 1 129 ? -4.729  51.103 4.026   1.00 32.08 ? 129 LYS B C   1 
ATOM   2205 O  O   . LYS B 1 129 ? -3.866  50.295 4.347   1.00 29.94 ? 129 LYS B O   1 
ATOM   2206 C  CB  . LYS B 1 129 ? -6.241  52.289 5.647   1.00 40.00 ? 129 LYS B CB  1 
ATOM   2207 C  CG  . LYS B 1 129 ? -6.165  52.845 7.068   1.00 46.62 ? 129 LYS B CG  1 
ATOM   2208 C  CD  . LYS B 1 129 ? -7.431  52.552 7.876   1.00 49.75 ? 129 LYS B CD  1 
ATOM   2209 C  CE  . LYS B 1 129 ? -7.652  51.050 8.059   1.00 49.49 ? 129 LYS B CE  1 
ATOM   2210 N  NZ  . LYS B 1 129 ? -8.682  50.759 9.098   1.00 54.38 ? 129 LYS B NZ  1 
ATOM   2211 N  N   . GLU B 1 130 ? -5.539  50.925 2.985   1.00 31.52 ? 130 GLU B N   1 
ATOM   2212 C  CA  . GLU B 1 130 ? -5.482  49.698 2.199   1.00 31.23 ? 130 GLU B CA  1 
ATOM   2213 C  C   . GLU B 1 130 ? -4.154  49.548 1.445   1.00 27.34 ? 130 GLU B C   1 
ATOM   2214 O  O   . GLU B 1 130 ? -3.653  48.443 1.336   1.00 24.45 ? 130 GLU B O   1 
ATOM   2215 C  CB  . GLU B 1 130 ? -6.673  49.545 1.268   1.00 33.79 ? 130 GLU B CB  1 
ATOM   2216 C  CG  . GLU B 1 130 ? -8.004  49.502 2.016   1.00 42.42 ? 130 GLU B CG  1 
ATOM   2217 C  CD  . GLU B 1 130 ? -8.997  48.504 1.444   1.00 46.71 ? 130 GLU B CD  1 
ATOM   2218 O  OE1 . GLU B 1 130 ? -10.128 48.457 1.969   1.00 52.96 ? 130 GLU B OE1 1 
ATOM   2219 O  OE2 . GLU B 1 130 ? -8.662  47.747 0.495   1.00 47.60 ? 130 GLU B OE2 1 
ATOM   2220 N  N   . MET B 1 131 ? -3.586  50.655 0.963   1.00 25.71 ? 131 MET B N   1 
ATOM   2221 C  CA  . MET B 1 131 ? -2.318  50.587 0.235   1.00 24.76 ? 131 MET B CA  1 
ATOM   2222 C  C   . MET B 1 131 ? -1.182  50.246 1.192   1.00 23.40 ? 131 MET B C   1 
ATOM   2223 O  O   . MET B 1 131 ? -0.329  49.422 0.868   1.00 21.38 ? 131 MET B O   1 
ATOM   2224 C  CB  . MET B 1 131 ? -2.009  51.897 -0.489  1.00 26.02 ? 131 MET B CB  1 
ATOM   2225 C  CG  . MET B 1 131 ? -0.836  51.843 -1.472  1.00 25.36 ? 131 MET B CG  1 
ATOM   2226 S  SD  . MET B 1 131 ? -1.245  50.773 -2.877  1.00 29.05 ? 131 MET B SD  1 
ATOM   2227 C  CE  . MET B 1 131 ? -0.045  49.475 -2.579  1.00 24.27 ? 131 MET B CE  1 
ATOM   2228 N  N   . LYS B 1 132 ? -1.192  50.849 2.377   1.00 23.56 ? 132 LYS B N   1 
ATOM   2229 C  CA  . LYS B 1 132 ? -0.197  50.521 3.399   1.00 24.14 ? 132 LYS B CA  1 
ATOM   2230 C  C   . LYS B 1 132 ? -0.254  49.043 3.778   1.00 22.33 ? 132 LYS B C   1 
ATOM   2231 O  O   . LYS B 1 132 ? 0.770   48.404 3.900   1.00 21.28 ? 132 LYS B O   1 
ATOM   2232 C  CB  . LYS B 1 132 ? -0.391  51.361 4.666   1.00 27.34 ? 132 LYS B CB  1 
ATOM   2233 C  CG  . LYS B 1 132 ? -0.184  52.866 4.464   1.00 31.54 ? 132 LYS B CG  1 
ATOM   2234 C  CD  . LYS B 1 132 ? 0.065   53.552 5.814   1.00 36.90 ? 132 LYS B CD  1 
ATOM   2235 C  CE  . LYS B 1 132 ? -1.204  54.117 6.437   1.00 41.34 ? 132 LYS B CE  1 
ATOM   2236 N  NZ  . LYS B 1 132 ? -0.989  54.661 7.814   1.00 46.50 ? 132 LYS B NZ  1 
ATOM   2237 N  N   . ALA B 1 133 ? -1.450  48.526 4.004   1.00 21.96 ? 133 ALA B N   1 
ATOM   2238 C  CA  . ALA B 1 133 ? -1.633  47.129 4.358   1.00 21.68 ? 133 ALA B CA  1 
ATOM   2239 C  C   . ALA B 1 133 ? -1.097  46.213 3.240   1.00 19.98 ? 133 ALA B C   1 
ATOM   2240 O  O   . ALA B 1 133 ? -0.373  45.257 3.543   1.00 19.59 ? 133 ALA B O   1 
ATOM   2241 C  CB  . ALA B 1 133 ? -3.086  46.829 4.682   1.00 22.35 ? 133 ALA B CB  1 
ATOM   2242 N  N   . ALA B 1 134 ? -1.388  46.517 1.972   1.00 18.61 ? 134 ALA B N   1 
ATOM   2243 C  CA  . ALA B 1 134 ? -0.869  45.690 0.877   1.00 17.24 ? 134 ALA B CA  1 
ATOM   2244 C  C   . ALA B 1 134 ? 0.667   45.695 0.794   1.00 16.51 ? 134 ALA B C   1 
ATOM   2245 O  O   . ALA B 1 134 ? 1.274   44.638 0.541   1.00 15.68 ? 134 ALA B O   1 
ATOM   2246 C  CB  . ALA B 1 134 ? -1.457  46.122 -0.455  1.00 17.72 ? 134 ALA B CB  1 
ATOM   2247 N  N   . LEU B 1 135 ? 1.287   46.872 0.964   1.00 15.96 ? 135 LEU B N   1 
ATOM   2248 C  CA  . LEU B 1 135 ? 2.755   46.971 0.968   1.00 15.98 ? 135 LEU B CA  1 
ATOM   2249 C  C   . LEU B 1 135 ? 3.348   46.184 2.140   1.00 16.26 ? 135 LEU B C   1 
ATOM   2250 O  O   . LEU B 1 135 ? 4.331   45.434 1.957   1.00 15.26 ? 135 LEU B O   1 
ATOM   2251 C  CB  . LEU B 1 135 ? 3.221   48.441 1.023   1.00 16.31 ? 135 LEU B CB  1 
ATOM   2252 C  CG  . LEU B 1 135 ? 2.964   49.261 -0.263  1.00 16.97 ? 135 LEU B CG  1 
ATOM   2253 C  CD1 . LEU B 1 135 ? 3.103   50.750 0.070   1.00 17.34 ? 135 LEU B CD1 1 
ATOM   2254 C  CD2 . LEU B 1 135 ? 3.838   48.851 -1.480  1.00 16.11 ? 135 LEU B CD2 1 
ATOM   2255 N  N   . GLN B 1 136 ? 2.717   46.298 3.322   1.00 16.51 ? 136 GLN B N   1 
ATOM   2256 C  CA  . GLN B 1 136 ? 3.218   45.557 4.491   1.00 17.75 ? 136 GLN B CA  1 
ATOM   2257 C  C   . GLN B 1 136 ? 3.068   44.049 4.257   1.00 17.07 ? 136 GLN B C   1 
ATOM   2258 O  O   . GLN B 1 136 ? 3.967   43.280 4.564   1.00 17.30 ? 136 GLN B O   1 
ATOM   2259 C  CB  . GLN B 1 136 ? 2.503   45.988 5.783   1.00 19.68 ? 136 GLN B CB  1 
ATOM   2260 C  CG  . GLN B 1 136 ? 2.904   47.400 6.247   1.00 22.43 ? 136 GLN B CG  1 
ATOM   2261 C  CD  . GLN B 1 136 ? 1.915   47.977 7.252   0.70 24.88 ? 136 GLN B CD  1 
ATOM   2262 O  OE1 . GLN B 1 136 ? 1.080   47.263 7.775   0.70 26.08 ? 136 GLN B OE1 1 
ATOM   2263 N  NE2 . GLN B 1 136 ? 2.002   49.275 7.507   0.70 27.00 ? 136 GLN B NE2 1 
ATOM   2264 N  N   . GLU B 1 137 ? 1.934   43.637 3.700   1.00 16.60 ? 137 GLU B N   1 
ATOM   2265 C  CA  . GLU B 1 137 ? 1.684   42.209 3.490   1.00 17.10 ? 137 GLU B CA  1 
ATOM   2266 C  C   . GLU B 1 137 ? 2.635   41.683 2.407   1.00 16.83 ? 137 GLU B C   1 
ATOM   2267 O  O   . GLU B 1 137 ? 3.093   40.542 2.479   1.00 17.11 ? 137 GLU B O   1 
ATOM   2268 C  CB  . GLU B 1 137 ? 0.222   41.980 3.114   1.00 18.01 ? 137 GLU B CB  1 
ATOM   2269 C  CG  . GLU B 1 137 ? -0.706  42.328 4.273   1.00 20.65 ? 137 GLU B CG  1 
ATOM   2270 C  CD  . GLU B 1 137 ? -2.136  42.623 3.868   1.00 22.07 ? 137 GLU B CD  1 
ATOM   2271 O  OE1 . GLU B 1 137 ? -2.519  42.357 2.707   1.00 21.44 ? 137 GLU B OE1 1 
ATOM   2272 O  OE2 . GLU B 1 137 ? -2.894  43.107 4.743   1.00 23.40 ? 137 GLU B OE2 1 
ATOM   2273 N  N   . GLY B 1 138 ? 2.906   42.506 1.396   1.00 15.92 ? 138 GLY B N   1 
ATOM   2274 C  CA  . GLY B 1 138 ? 3.822   42.116 0.320   1.00 16.43 ? 138 GLY B CA  1 
ATOM   2275 C  C   . GLY B 1 138 ? 5.225   41.917 0.856   1.00 17.31 ? 138 GLY B C   1 
ATOM   2276 O  O   . GLY B 1 138 ? 5.906   40.910 0.561   1.00 17.35 ? 138 GLY B O   1 
ATOM   2277 N  N   . HIS B 1 139 ? 5.662   42.867 1.669   1.00 18.02 ? 139 HIS B N   1 
ATOM   2278 C  CA  . HIS B 1 139 ? 6.967   42.763 2.339   1.00 19.57 ? 139 HIS B CA  1 
ATOM   2279 C  C   . HIS B 1 139 ? 7.082   41.532 3.215   1.00 20.29 ? 139 HIS B C   1 
ATOM   2280 O  O   . HIS B 1 139 ? 8.116   40.814 3.215   1.00 20.95 ? 139 HIS B O   1 
ATOM   2281 C  CB  . HIS B 1 139 ? 7.192   44.015 3.188   1.00 21.10 ? 139 HIS B CB  1 
ATOM   2282 C  CG  . HIS B 1 139 ? 8.593   44.126 3.758   1.00 22.47 ? 139 HIS B CG  1 
ATOM   2283 N  ND1 . HIS B 1 139 ? 8.926   43.627 4.963   1.00 24.66 ? 139 HIS B ND1 1 
ATOM   2284 C  CD2 . HIS B 1 139 ? 9.751   44.712 3.248   1.00 23.68 ? 139 HIS B CD2 1 
ATOM   2285 C  CE1 . HIS B 1 139 ? 10.234  43.884 5.224   1.00 24.65 ? 139 HIS B CE1 1 
ATOM   2286 N  NE2 . HIS B 1 139 ? 10.744  44.530 4.172   1.00 24.98 ? 139 HIS B NE2 1 
ATOM   2287 N  N   . GLN B 1 140 ? 6.048   41.281 4.005   1.00 20.25 ? 140 GLN B N   1 
ATOM   2288 C  CA  . GLN B 1 140 ? 6.045   40.104 4.871   1.00 22.54 ? 140 GLN B CA  1 
ATOM   2289 C  C   . GLN B 1 140 ? 6.096   38.799 4.037   1.00 22.09 ? 140 GLN B C   1 
ATOM   2290 O  O   . GLN B 1 140 ? 6.767   37.835 4.420   1.00 22.16 ? 140 GLN B O   1 
ATOM   2291 C  CB  . GLN B 1 140 ? 4.799   40.136 5.752   1.00 25.44 ? 140 GLN B CB  1 
ATOM   2292 C  CG  . GLN B 1 140 ? 4.596   38.900 6.585   1.00 30.83 ? 140 GLN B CG  1 
ATOM   2293 C  CD  . GLN B 1 140 ? 3.279   38.930 7.361   1.00 36.64 ? 140 GLN B CD  1 
ATOM   2294 O  OE1 . GLN B 1 140 ? 2.962   39.903 8.056   1.00 41.30 ? 140 GLN B OE1 1 
ATOM   2295 N  NE2 . GLN B 1 140 ? 2.529   37.855 7.268   1.00 38.12 ? 140 GLN B NE2 1 
ATOM   2296 N  N   . PHE B 1 141 ? 5.396   38.800 2.898   1.00 19.39 ? 141 PHE B N   1 
ATOM   2297 C  CA  . PHE B 1 141 ? 5.421   37.660 1.995   1.00 20.53 ? 141 PHE B CA  1 
ATOM   2298 C  C   . PHE B 1 141 ? 6.857   37.401 1.523   1.00 20.73 ? 141 PHE B C   1 
ATOM   2299 O  O   . PHE B 1 141 ? 7.376   36.272 1.630   1.00 21.64 ? 141 PHE B O   1 
ATOM   2300 C  CB  . PHE B 1 141 ? 4.447   37.879 0.808   1.00 19.63 ? 141 PHE B CB  1 
ATOM   2301 C  CG  . PHE B 1 141 ? 4.490   36.770 -0.230  1.00 20.99 ? 141 PHE B CG  1 
ATOM   2302 C  CD1 . PHE B 1 141 ? 4.069   35.508 0.076   1.00 21.99 ? 141 PHE B CD1 1 
ATOM   2303 C  CD2 . PHE B 1 141 ? 4.994   37.004 -1.499  1.00 21.15 ? 141 PHE B CD2 1 
ATOM   2304 C  CE1 . PHE B 1 141 ? 4.159   34.459 -0.855  1.00 24.12 ? 141 PHE B CE1 1 
ATOM   2305 C  CE2 . PHE B 1 141 ? 5.045   35.991 -2.450  1.00 22.35 ? 141 PHE B CE2 1 
ATOM   2306 C  CZ  . PHE B 1 141 ? 4.628   34.715 -2.122  1.00 24.10 ? 141 PHE B CZ  1 
ATOM   2307 N  N   . LEU B 1 142 ? 7.510   38.471 1.054   1.00 20.32 ? 142 LEU B N   1 
ATOM   2308 C  CA  . LEU B 1 142 ? 8.868   38.389 0.519   1.00 21.83 ? 142 LEU B CA  1 
ATOM   2309 C  C   . LEU B 1 142 ? 9.855   37.902 1.590   1.00 24.32 ? 142 LEU B C   1 
ATOM   2310 O  O   . LEU B 1 142 ? 10.684  37.037 1.321   1.00 25.39 ? 142 LEU B O   1 
ATOM   2311 C  CB  . LEU B 1 142 ? 9.310   39.758 -0.021  1.00 20.41 ? 142 LEU B CB  1 
ATOM   2312 C  CG  . LEU B 1 142 ? 8.509   40.139 -1.258  1.00 19.73 ? 142 LEU B CG  1 
ATOM   2313 C  CD1 . LEU B 1 142 ? 8.832   41.569 -1.645  1.00 19.27 ? 142 LEU B CD1 1 
ATOM   2314 C  CD2 . LEU B 1 142 ? 8.771   39.152 -2.415  1.00 21.53 ? 142 LEU B CD2 1 
ATOM   2315 N  N   . CYS B 1 143 ? 9.738   38.434 2.811   1.00 24.63 ? 143 CYS B N   1 
ATOM   2316 C  CA  . CYS B 1 143 ? 10.549  37.941 3.929   1.00 27.98 ? 143 CYS B CA  1 
ATOM   2317 C  C   . CYS B 1 143 ? 10.325  36.457 4.200   1.00 29.62 ? 143 CYS B C   1 
ATOM   2318 O  O   . CYS B 1 143 ? 11.282  35.730 4.421   1.00 31.19 ? 143 CYS B O   1 
ATOM   2319 C  CB  . CYS B 1 143 ? 10.299  38.744 5.199   1.00 28.72 ? 143 CYS B CB  1 
ATOM   2320 S  SG  . CYS B 1 143 ? 10.844  40.429 4.953   1.00 32.04 ? 143 CYS B SG  1 
ATOM   2321 N  N   . SER B 1 144 ? 9.076   36.000 4.159   1.00 29.97 ? 144 SER B N   1 
ATOM   2322 C  CA  . SER B 1 144 ? 8.815   34.576 4.407   1.00 32.40 ? 144 SER B CA  1 
ATOM   2323 C  C   . SER B 1 144 ? 9.428   33.642 3.348   1.00 34.51 ? 144 SER B C   1 
ATOM   2324 O  O   . SER B 1 144 ? 9.954   32.586 3.717   1.00 35.31 ? 144 SER B O   1 
ATOM   2325 C  CB  . SER B 1 144 ? 7.340   34.289 4.593   1.00 32.50 ? 144 SER B CB  1 
ATOM   2326 O  OG  . SER B 1 144 ? 6.672   34.165 3.335   1.00 32.83 ? 144 SER B OG  1 
ATOM   2327 N  N   . ILE B 1 145 ? 9.363   34.035 2.064   1.00 33.60 ? 145 ILE B N   1 
ATOM   2328 C  CA  A ILE B 1 145 ? 10.026  33.314 0.968   0.50 36.74 ? 145 ILE B CA  1 
ATOM   2329 C  CA  B ILE B 1 145 ? 10.005  33.266 1.000   0.50 36.78 ? 145 ILE B CA  1 
ATOM   2330 C  C   . ILE B 1 145 ? 11.528  33.164 1.237   1.00 39.43 ? 145 ILE B C   1 
ATOM   2331 O  O   . ILE B 1 145 ? 12.116  32.083 1.069   1.00 42.53 ? 145 ILE B O   1 
ATOM   2332 C  CB  A ILE B 1 145 ? 9.863   34.062 -0.366  0.50 35.69 ? 145 ILE B CB  1 
ATOM   2333 C  CB  B ILE B 1 145 ? 9.709   33.840 -0.403  0.50 35.73 ? 145 ILE B CB  1 
ATOM   2334 C  CG1 A ILE B 1 145 ? 8.505   33.789 -0.989  0.50 34.88 ? 145 ILE B CG1 1 
ATOM   2335 C  CG1 B ILE B 1 145 ? 8.201   33.920 -0.665  0.50 34.46 ? 145 ILE B CG1 1 
ATOM   2336 C  CG2 A ILE B 1 145 ? 10.942  33.661 -1.372  0.50 38.11 ? 145 ILE B CG2 1 
ATOM   2337 C  CG2 B ILE B 1 145 ? 10.403  33.020 -1.486  0.50 38.89 ? 145 ILE B CG2 1 
ATOM   2338 C  CD1 A ILE B 1 145 ? 8.311   34.614 -2.241  0.50 33.46 ? 145 ILE B CD1 1 
ATOM   2339 C  CD1 B ILE B 1 145 ? 7.419   32.695 -0.268  0.50 34.42 ? 145 ILE B CD1 1 
ATOM   2340 N  N   . GLU B 1 146 ? 12.153  34.268 1.643   1.00 39.17 ? 146 GLU B N   1 
ATOM   2341 C  CA  . GLU B 1 146 ? 13.576  34.274 1.968   1.00 43.32 ? 146 GLU B CA  1 
ATOM   2342 C  C   . GLU B 1 146 ? 13.879  33.320 3.116   1.00 46.79 ? 146 GLU B C   1 
ATOM   2343 O  O   . GLU B 1 146 ? 14.808  32.530 3.019   1.00 49.28 ? 146 GLU B O   1 
ATOM   2344 C  CB  . GLU B 1 146 ? 14.061  35.680 2.312   1.00 43.97 ? 146 GLU B CB  1 
ATOM   2345 C  CG  . GLU B 1 146 ? 13.954  36.671 1.157   1.00 45.85 ? 146 GLU B CG  1 
ATOM   2346 C  CD  . GLU B 1 146 ? 14.222  38.113 1.574   0.60 45.80 ? 146 GLU B CD  1 
ATOM   2347 O  OE1 . GLU B 1 146 ? 14.319  38.401 2.793   0.60 46.78 ? 146 GLU B OE1 1 
ATOM   2348 O  OE2 . GLU B 1 146 ? 14.338  38.974 0.677   0.60 46.92 ? 146 GLU B OE2 1 
ATOM   2349 N  N   . ALA B 1 147 ? 13.094  33.367 4.191   1.00 46.30 ? 147 ALA B N   1 
ATOM   2350 C  CA  . ALA B 1 147 ? 13.357  32.486 5.342   1.00 49.54 ? 147 ALA B CA  1 
ATOM   2351 C  C   . ALA B 1 147 ? 13.213  30.996 4.969   1.00 53.97 ? 147 ALA B C   1 
ATOM   2352 O  O   . ALA B 1 147 ? 13.879  30.126 5.556   1.00 54.27 ? 147 ALA B O   1 
ATOM   2353 C  CB  . ALA B 1 147 ? 12.467  32.850 6.521   1.00 47.84 ? 147 ALA B CB  1 
ATOM   2354 N  N   . LEU B 1 148 ? 12.356  30.718 3.984   1.00 53.32 ? 148 LEU B N   1 
ATOM   2355 C  CA  . LEU B 1 148 ? 12.168  29.364 3.469   1.00 57.65 ? 148 LEU B CA  1 
ATOM   2356 C  C   . LEU B 1 148 ? 13.301  28.939 2.540   1.00 59.61 ? 148 LEU B C   1 
ATOM   2357 O  O   . LEU B 1 148 ? 13.843  29.716 1.748   1.00 57.94 ? 148 LEU B O   1 
ATOM   2358 C  CB  . LEU B 1 148 ? 10.834  29.228 2.731   1.00 55.17 ? 148 LEU B CB  1 
ATOM   2359 C  CG  . LEU B 1 148 ? 9.581   28.876 3.528   1.00 56.89 ? 148 LEU B CG  1 
ATOM   2360 C  CD1 . LEU B 1 148 ? 8.382   28.923 2.598   1.00 52.45 ? 148 LEU B CD1 1 
ATOM   2361 C  CD2 . LEU B 1 148 ? 9.682   27.507 4.206   1.00 57.77 ? 148 LEU B CD2 1 
HETATM 2362 C  C1  . GOL C 2 .   ? -8.957  23.055 -3.990  1.00 49.86 ? 201 GOL A C1  1 
HETATM 2363 O  O1  . GOL C 2 .   ? -8.886  23.570 -5.330  1.00 60.79 ? 201 GOL A O1  1 
HETATM 2364 C  C2  . GOL C 2 .   ? -7.896  22.006 -3.626  1.00 50.83 ? 201 GOL A C2  1 
HETATM 2365 O  O2  . GOL C 2 .   ? -7.027  22.463 -2.577  1.00 44.00 ? 201 GOL A O2  1 
HETATM 2366 C  C3  . GOL C 2 .   ? -7.060  21.503 -4.804  1.00 53.22 ? 201 GOL A C3  1 
HETATM 2367 O  O3  . GOL C 2 .   ? -6.788  20.113 -4.565  1.00 51.59 ? 201 GOL A O3  1 
HETATM 2368 P  P   . PO4 D 3 .   ? 16.735  56.020 -9.368  1.00 32.34 ? 201 PO4 B P   1 
HETATM 2369 O  O1  . PO4 D 3 .   ? 18.137  55.514 -9.550  1.00 32.21 ? 201 PO4 B O1  1 
HETATM 2370 O  O2  . PO4 D 3 .   ? 16.470  57.293 -10.148 1.00 27.35 ? 201 PO4 B O2  1 
HETATM 2371 O  O3  . PO4 D 3 .   ? 15.743  54.958 -9.865  1.00 33.14 ? 201 PO4 B O3  1 
HETATM 2372 O  O4  . PO4 D 3 .   ? 16.543  56.284 -7.911  1.00 27.02 ? 201 PO4 B O4  1 
HETATM 2373 MG MG  . MG  E 4 .   ? -3.484  35.478 -9.766  1.00 23.88 ? 202 MG  B MG  1 
HETATM 2374 O  O   . HOH F 5 .   ? -7.697  38.201 -5.067  1.00 26.81 ? 301 HOH A O   1 
HETATM 2375 O  O   . HOH F 5 .   ? -15.645 39.590 19.825  1.00 46.00 ? 302 HOH A O   1 
HETATM 2376 O  O   . HOH F 5 .   ? 5.085   28.837 8.665   1.00 46.50 ? 303 HOH A O   1 
HETATM 2377 O  O   . HOH F 5 .   ? -4.476  19.462 8.652   1.00 30.66 ? 304 HOH A O   1 
HETATM 2378 O  O   . HOH F 5 .   ? -21.381 30.847 24.824  1.00 49.48 ? 305 HOH A O   1 
HETATM 2379 O  O   . HOH F 5 .   ? -2.161  35.411 -2.363  1.00 28.10 ? 306 HOH A O   1 
HETATM 2380 O  O   . HOH F 5 .   ? -6.352  29.405 19.648  1.00 20.25 ? 307 HOH A O   1 
HETATM 2381 O  O   . HOH F 5 .   ? -5.331  28.890 -5.686  1.00 25.68 ? 308 HOH A O   1 
HETATM 2382 O  O   . HOH F 5 .   ? -10.918 21.455 20.082  1.00 31.94 ? 309 HOH A O   1 
HETATM 2383 O  O   . HOH F 5 .   ? -0.383  33.662 8.472   1.00 24.36 ? 310 HOH A O   1 
HETATM 2384 O  O   . HOH F 5 .   ? -0.206  29.640 -6.107  1.00 26.28 ? 311 HOH A O   1 
HETATM 2385 O  O   . HOH F 5 .   ? -3.305  24.287 23.853  1.00 34.72 ? 312 HOH A O   1 
HETATM 2386 O  O   . HOH F 5 .   ? -0.658  43.569 13.459  1.00 51.11 ? 313 HOH A O   1 
HETATM 2387 O  O   . HOH F 5 .   ? -9.547  24.192 -1.491  1.00 26.39 ? 314 HOH A O   1 
HETATM 2388 O  O   . HOH F 5 .   ? -18.463 20.371 6.766   1.00 23.40 ? 315 HOH A O   1 
HETATM 2389 O  O   . HOH F 5 .   ? -11.187 29.569 7.489   1.00 21.58 ? 316 HOH A O   1 
HETATM 2390 O  O   . HOH F 5 .   ? -2.816  28.738 -6.929  1.00 31.06 ? 317 HOH A O   1 
HETATM 2391 O  O   . HOH F 5 .   ? -15.441 18.596 12.184  1.00 28.18 ? 318 HOH A O   1 
HETATM 2392 O  O   . HOH F 5 .   ? -18.822 30.616 18.107  1.00 23.44 ? 319 HOH A O   1 
HETATM 2393 O  O   . HOH F 5 .   ? -4.931  28.116 23.702  1.00 27.71 ? 320 HOH A O   1 
HETATM 2394 O  O   . HOH F 5 .   ? -0.547  44.054 17.230  1.00 32.52 ? 321 HOH A O   1 
HETATM 2395 O  O   . HOH F 5 .   ? -16.806 32.660 -6.431  1.00 56.43 ? 322 HOH A O   1 
HETATM 2396 O  O   . HOH F 5 .   ? -16.260 19.012 15.540  1.00 35.61 ? 323 HOH A O   1 
HETATM 2397 O  O   . HOH F 5 .   ? -15.937 34.340 14.483  1.00 28.14 ? 324 HOH A O   1 
HETATM 2398 O  O   . HOH F 5 .   ? -19.753 41.412 -2.193  1.00 45.03 ? 325 HOH A O   1 
HETATM 2399 O  O   . HOH F 5 .   ? -26.908 25.821 9.146   1.00 50.67 ? 326 HOH A O   1 
HETATM 2400 O  O   . HOH F 5 .   ? -16.079 27.820 21.815  1.00 29.09 ? 327 HOH A O   1 
HETATM 2401 O  O   . HOH F 5 .   ? -5.545  14.222 11.206  1.00 37.97 ? 328 HOH A O   1 
HETATM 2402 O  O   . HOH F 5 .   ? -12.641 24.489 -4.605  1.00 45.40 ? 329 HOH A O   1 
HETATM 2403 O  O   . HOH F 5 .   ? -16.125 30.684 24.026  1.00 41.35 ? 330 HOH A O   1 
HETATM 2404 O  O   . HOH F 5 .   ? -19.260 40.361 11.181  1.00 50.34 ? 331 HOH A O   1 
HETATM 2405 O  O   . HOH F 5 .   ? -23.741 27.548 19.551  1.00 34.42 ? 332 HOH A O   1 
HETATM 2406 O  O   . HOH F 5 .   ? -14.020 38.614 -4.777  1.00 40.83 ? 333 HOH A O   1 
HETATM 2407 O  O   . HOH F 5 .   ? -20.511 23.435 19.073  1.00 33.92 ? 334 HOH A O   1 
HETATM 2408 O  O   . HOH F 5 .   ? 2.167   27.990 15.659  1.00 51.28 ? 335 HOH A O   1 
HETATM 2409 O  O   . HOH F 5 .   ? -10.859 34.048 26.046  1.00 33.15 ? 336 HOH A O   1 
HETATM 2410 O  O   . HOH F 5 .   ? -5.959  20.040 15.852  1.00 36.30 ? 337 HOH A O   1 
HETATM 2411 O  O   . HOH F 5 .   ? -16.036 21.303 -0.380  1.00 35.79 ? 338 HOH A O   1 
HETATM 2412 O  O   . HOH F 5 .   ? -14.516 44.515 12.515  1.00 40.52 ? 339 HOH A O   1 
HETATM 2413 O  O   . HOH F 5 .   ? -19.163 37.154 14.594  1.00 68.05 ? 340 HOH A O   1 
HETATM 2414 O  O   . HOH F 5 .   ? 6.165   29.277 -5.305  1.00 37.61 ? 341 HOH A O   1 
HETATM 2415 O  O   . HOH F 5 .   ? 1.380   24.836 1.918   1.00 39.42 ? 342 HOH A O   1 
HETATM 2416 O  O   . HOH F 5 .   ? -11.297 24.133 23.534  1.00 45.15 ? 343 HOH A O   1 
HETATM 2417 O  O   . HOH F 5 .   ? -14.643 17.019 15.462  1.00 39.54 ? 344 HOH A O   1 
HETATM 2418 O  O   . HOH F 5 .   ? -6.185  13.739 5.269   1.00 51.58 ? 345 HOH A O   1 
HETATM 2419 O  O   . HOH F 5 .   ? -14.110 27.073 24.193  1.00 46.63 ? 346 HOH A O   1 
HETATM 2420 O  O   . HOH F 5 .   ? -10.175 39.387 25.963  1.00 47.12 ? 347 HOH A O   1 
HETATM 2421 O  O   . HOH F 5 .   ? -6.802  30.965 -5.799  1.00 37.85 ? 348 HOH A O   1 
HETATM 2422 O  O   . HOH F 5 .   ? 1.870   23.653 -4.938  1.00 38.04 ? 349 HOH A O   1 
HETATM 2423 O  O   . HOH F 5 .   ? -0.673  31.610 -8.133  1.00 48.63 ? 350 HOH A O   1 
HETATM 2424 O  O   . HOH F 5 .   ? -14.100 36.211 20.140  1.00 31.32 ? 351 HOH A O   1 
HETATM 2425 O  O   . HOH F 5 .   ? 5.949   30.148 5.410   1.00 47.48 ? 352 HOH A O   1 
HETATM 2426 O  O   . HOH F 5 .   ? -14.725 47.826 0.711   1.00 44.94 ? 353 HOH A O   1 
HETATM 2427 O  O   . HOH F 5 .   ? -12.434 11.194 15.792  1.00 43.72 ? 354 HOH A O   1 
HETATM 2428 O  O   . HOH F 5 .   ? -11.899 17.457 -0.058  1.00 43.60 ? 355 HOH A O   1 
HETATM 2429 O  O   . HOH F 5 .   ? -21.980 34.413 4.212   1.00 39.87 ? 356 HOH A O   1 
HETATM 2430 O  O   . HOH F 5 .   ? -7.735  13.238 13.033  1.00 49.11 ? 357 HOH A O   1 
HETATM 2431 O  O   . HOH F 5 .   ? -19.045 34.384 11.118  1.00 48.89 ? 358 HOH A O   1 
HETATM 2432 O  O   . HOH F 5 .   ? -11.882 37.448 -6.023  1.00 42.71 ? 359 HOH A O   1 
HETATM 2433 O  O   . HOH F 5 .   ? -9.757  11.591 11.878  1.00 41.73 ? 360 HOH A O   1 
HETATM 2434 O  O   . HOH F 5 .   ? -10.584 11.344 9.349   1.00 26.04 ? 361 HOH A O   1 
HETATM 2435 O  O   . HOH F 5 .   ? -8.219  36.059 -5.946  1.00 30.70 ? 362 HOH A O   1 
HETATM 2436 O  O   . HOH F 5 .   ? 2.020   43.472 21.156  1.00 43.81 ? 363 HOH A O   1 
HETATM 2437 O  O   . HOH F 5 .   ? -15.054 23.462 -3.140  1.00 35.11 ? 364 HOH A O   1 
HETATM 2438 O  O   . HOH F 5 .   ? -14.585 38.919 7.967   1.00 31.12 ? 365 HOH A O   1 
HETATM 2439 O  O   . HOH F 5 .   ? -5.079  46.326 20.824  1.00 43.38 ? 366 HOH A O   1 
HETATM 2440 O  O   . HOH F 5 .   ? -5.117  30.476 22.042  1.00 35.43 ? 367 HOH A O   1 
HETATM 2441 O  O   . HOH F 5 .   ? -25.736 23.154 13.617  1.00 38.24 ? 368 HOH A O   1 
HETATM 2442 O  O   . HOH F 5 .   ? -13.814 30.704 25.657  1.00 38.80 ? 369 HOH A O   1 
HETATM 2443 O  O   . HOH F 5 .   ? -6.392  18.418 17.999  1.00 44.63 ? 370 HOH A O   1 
HETATM 2444 O  O   . HOH F 5 .   ? -20.234 41.203 4.952   1.00 65.74 ? 371 HOH A O   1 
HETATM 2445 O  O   . HOH F 5 .   ? -12.691 19.090 12.618  1.00 30.37 ? 372 HOH A O   1 
HETATM 2446 O  O   . HOH F 5 .   ? -5.626  17.306 8.259   1.00 45.93 ? 373 HOH A O   1 
HETATM 2447 O  O   . HOH F 5 .   ? 13.818  22.725 -1.978  1.00 57.11 ? 374 HOH A O   1 
HETATM 2448 O  O   . HOH F 5 .   ? -14.159 19.320 -0.150  1.00 42.61 ? 375 HOH A O   1 
HETATM 2449 O  O   . HOH F 5 .   ? -5.470  14.932 -1.614  1.00 50.43 ? 376 HOH A O   1 
HETATM 2450 O  O   . HOH F 5 .   ? -18.233 33.990 21.802  1.00 46.77 ? 377 HOH A O   1 
HETATM 2451 O  O   . HOH F 5 .   ? -17.635 48.135 1.428   1.00 49.66 ? 378 HOH A O   1 
HETATM 2452 O  O   . HOH F 5 .   ? -2.872  19.485 1.370   1.00 44.91 ? 379 HOH A O   1 
HETATM 2453 O  O   . HOH F 5 .   ? -14.024 49.480 15.775  1.00 53.62 ? 380 HOH A O   1 
HETATM 2454 O  O   . HOH F 5 .   ? -3.112  48.764 22.850  1.00 62.46 ? 381 HOH A O   1 
HETATM 2455 O  O   . HOH F 5 .   ? -1.067  50.321 25.929  1.00 46.55 ? 382 HOH A O   1 
HETATM 2456 O  O   . HOH F 5 .   ? -1.257  22.382 13.605  1.00 47.76 ? 383 HOH A O   1 
HETATM 2457 O  O   . HOH F 5 .   ? -8.361  49.609 12.141  1.00 57.93 ? 384 HOH A O   1 
HETATM 2458 O  O   . HOH F 5 .   ? 0.943   35.500 -7.894  1.00 53.24 ? 385 HOH A O   1 
HETATM 2459 O  O   . HOH F 5 .   ? -14.037 14.988 -1.676  1.00 47.61 ? 386 HOH A O   1 
HETATM 2460 O  O   . HOH F 5 .   ? -4.861  46.379 17.820  1.00 42.51 ? 387 HOH A O   1 
HETATM 2461 O  O   . HOH F 5 .   ? -5.917  8.076  -2.002  1.00 57.04 ? 388 HOH A O   1 
HETATM 2462 O  O   . HOH F 5 .   ? -19.400 20.662 4.330   1.00 41.99 ? 389 HOH A O   1 
HETATM 2463 O  O   . HOH F 5 .   ? -10.035 18.346 19.437  1.00 44.33 ? 390 HOH A O   1 
HETATM 2464 O  O   . HOH F 5 .   ? -3.830  22.112 22.730  1.00 53.29 ? 391 HOH A O   1 
HETATM 2465 O  O   . HOH F 5 .   ? 6.026   20.561 -0.849  1.00 48.91 ? 392 HOH A O   1 
HETATM 2466 O  O   . HOH F 5 .   ? -7.912  46.116 2.787   1.00 49.75 ? 393 HOH A O   1 
HETATM 2467 O  O   . HOH F 5 .   ? -0.751  18.190 11.509  1.00 53.02 ? 394 HOH A O   1 
HETATM 2468 O  O   . HOH F 5 .   ? 5.685   27.758 5.913   1.00 34.52 ? 395 HOH A O   1 
HETATM 2469 O  O   . HOH F 5 .   ? -6.001  34.083 -6.216  1.00 33.25 ? 396 HOH A O   1 
HETATM 2470 O  O   . HOH F 5 .   ? -13.648 46.731 18.609  1.00 32.88 ? 397 HOH A O   1 
HETATM 2471 O  O   . HOH G 5 .   ? 16.132  54.640 -12.415 1.00 32.02 ? 301 HOH B O   1 
HETATM 2472 O  O   . HOH G 5 .   ? 16.071  51.673 -10.743 1.00 22.74 ? 302 HOH B O   1 
HETATM 2473 O  O   . HOH G 5 .   ? 18.209  53.013 -9.988  1.00 36.75 ? 303 HOH B O   1 
HETATM 2474 O  O   . HOH G 5 .   ? 18.093  54.986 -6.198  1.00 28.20 ? 304 HOH B O   1 
HETATM 2475 O  O   . HOH G 5 .   ? 14.514  56.974 -6.053  1.00 26.77 ? 305 HOH B O   1 
HETATM 2476 O  O   . HOH G 5 .   ? 16.191  43.218 -7.295  1.00 33.49 ? 306 HOH B O   1 
HETATM 2477 O  O   . HOH G 5 .   ? -7.297  55.478 4.579   1.00 34.47 ? 307 HOH B O   1 
HETATM 2478 O  O   . HOH G 5 .   ? 11.639  47.696 3.047   1.00 27.68 ? 308 HOH B O   1 
HETATM 2479 O  O   . HOH G 5 .   ? 0.749   36.513 1.369   1.00 40.12 ? 309 HOH B O   1 
HETATM 2480 O  O   . HOH G 5 .   ? 7.356   36.916 7.006   1.00 39.87 ? 310 HOH B O   1 
HETATM 2481 O  O   . HOH G 5 .   ? 2.914   60.951 -21.487 1.00 51.54 ? 311 HOH B O   1 
HETATM 2482 O  O   . HOH G 5 .   ? 1.371   38.658 3.638   1.00 27.18 ? 312 HOH B O   1 
HETATM 2483 O  O   . HOH G 5 .   ? 7.819   33.609 -7.989  1.00 32.89 ? 313 HOH B O   1 
HETATM 2484 O  O   . HOH G 5 .   ? -2.017  43.867 6.881   1.00 32.31 ? 314 HOH B O   1 
HETATM 2485 O  O   . HOH G 5 .   ? 16.999  50.257 -17.917 1.00 48.18 ? 315 HOH B O   1 
HETATM 2486 O  O   . HOH G 5 .   ? 2.459   38.328 -7.178  1.00 24.34 ? 316 HOH B O   1 
HETATM 2487 O  O   . HOH G 5 .   ? 10.934  34.728 -5.188  1.00 51.37 ? 317 HOH B O   1 
HETATM 2488 O  O   . HOH G 5 .   ? 5.680   45.469 -18.109 1.00 32.31 ? 318 HOH B O   1 
HETATM 2489 O  O   . HOH G 5 .   ? 7.459   42.755 6.929   1.00 45.34 ? 319 HOH B O   1 
HETATM 2490 O  O   . HOH G 5 .   ? -4.911  43.493 2.460   1.00 37.29 ? 320 HOH B O   1 
HETATM 2491 O  O   . HOH G 5 .   ? 21.679  47.099 -11.304 1.00 35.71 ? 321 HOH B O   1 
HETATM 2492 O  O   . HOH G 5 .   ? 1.907   27.814 -6.581  1.00 31.60 ? 322 HOH B O   1 
HETATM 2493 O  O   . HOH G 5 .   ? 18.630  39.270 -11.893 1.00 65.54 ? 323 HOH B O   1 
HETATM 2494 O  O   . HOH G 5 .   ? 10.756  34.887 -7.818  1.00 51.29 ? 324 HOH B O   1 
HETATM 2495 O  O   . HOH G 5 .   ? 5.739   49.371 -5.716  1.00 21.59 ? 325 HOH B O   1 
HETATM 2496 O  O   . HOH G 5 .   ? 3.555   57.720 -15.407 1.00 32.55 ? 326 HOH B O   1 
HETATM 2497 O  O   . HOH G 5 .   ? 0.251   57.512 -8.449  1.00 38.01 ? 327 HOH B O   1 
HETATM 2498 O  O   . HOH G 5 .   ? 1.924   35.588 8.631   1.00 41.75 ? 328 HOH B O   1 
HETATM 2499 O  O   . HOH G 5 .   ? -3.942  51.839 -5.206  1.00 32.02 ? 329 HOH B O   1 
HETATM 2500 O  O   . HOH G 5 .   ? 1.116   58.904 5.747   1.00 54.80 ? 330 HOH B O   1 
HETATM 2501 O  O   . HOH G 5 .   ? 8.204   40.260 7.880   1.00 53.45 ? 331 HOH B O   1 
HETATM 2502 O  O   . HOH G 5 .   ? 8.826   31.235 5.854   1.00 37.17 ? 332 HOH B O   1 
HETATM 2503 O  O   . HOH G 5 .   ? 11.864  64.091 -7.896  1.00 39.65 ? 333 HOH B O   1 
HETATM 2504 O  O   . HOH G 5 .   ? 6.386   55.854 -19.241 1.00 37.85 ? 334 HOH B O   1 
HETATM 2505 O  O   . HOH G 5 .   ? 11.646  36.756 -15.066 1.00 40.02 ? 335 HOH B O   1 
HETATM 2506 O  O   . HOH G 5 .   ? -8.449  38.563 -15.735 1.00 41.89 ? 336 HOH B O   1 
HETATM 2507 O  O   . HOH G 5 .   ? 3.203   42.893 7.628   1.00 52.21 ? 337 HOH B O   1 
HETATM 2508 O  O   . HOH G 5 .   ? 13.184  50.759 -18.006 1.00 37.95 ? 338 HOH B O   1 
HETATM 2509 O  O   . HOH G 5 .   ? 9.075   32.956 7.626   1.00 54.87 ? 339 HOH B O   1 
HETATM 2510 O  O   . HOH G 5 .   ? -2.299  62.070 -12.643 1.00 46.04 ? 340 HOH B O   1 
HETATM 2511 O  O   . HOH G 5 .   ? 3.515   52.090 8.683   1.00 58.85 ? 341 HOH B O   1 
HETATM 2512 O  O   . HOH G 5 .   ? -15.009 49.294 -4.108  1.00 48.69 ? 342 HOH B O   1 
HETATM 2513 O  O   . HOH G 5 .   ? -2.361  44.188 -22.630 1.00 49.19 ? 343 HOH B O   1 
HETATM 2514 O  O   . HOH G 5 .   ? 5.668   66.950 -3.349  1.00 51.49 ? 344 HOH B O   1 
HETATM 2515 O  O   . HOH G 5 .   ? 1.600   61.374 1.278   1.00 57.44 ? 345 HOH B O   1 
HETATM 2516 O  O   . HOH G 5 .   ? 5.172   54.109 8.026   1.00 50.11 ? 346 HOH B O   1 
HETATM 2517 O  O   . HOH G 5 .   ? -13.231 41.273 -8.479  1.00 66.00 ? 347 HOH B O   1 
HETATM 2518 O  O   . HOH G 5 .   ? 20.515  52.097 -9.020  1.00 24.85 ? 348 HOH B O   1 
HETATM 2519 O  O   . HOH G 5 .   ? 11.330  50.417 6.405   1.00 30.43 ? 349 HOH B O   1 
HETATM 2520 O  O   . HOH G 5 .   ? 15.214  56.746 -13.793 1.00 40.01 ? 350 HOH B O   1 
HETATM 2521 O  O   . HOH G 5 .   ? 15.179  56.566 -3.352  1.00 40.46 ? 351 HOH B O   1 
HETATM 2522 O  O   . HOH G 5 .   ? 14.975  45.372 -14.678 1.00 35.62 ? 352 HOH B O   1 
HETATM 2523 O  O   . HOH G 5 .   ? 0.353   44.541 7.943   1.00 39.65 ? 353 HOH B O   1 
HETATM 2524 O  O   . HOH G 5 .   ? -5.195  54.274 -16.368 1.00 52.43 ? 354 HOH B O   1 
HETATM 2525 O  O   . HOH G 5 .   ? 19.618  51.303 -16.258 1.00 30.99 ? 355 HOH B O   1 
HETATM 2526 O  O   . HOH G 5 .   ? 6.714   32.223 -4.333  1.00 39.88 ? 356 HOH B O   1 
HETATM 2527 O  O   . HOH G 5 .   ? 7.828   36.634 -14.839 1.00 54.40 ? 357 HOH B O   1 
HETATM 2528 O  O   . HOH G 5 .   ? -13.027 50.201 -15.018 1.00 52.12 ? 358 HOH B O   1 
HETATM 2529 O  O   . HOH G 5 .   ? 6.934   53.915 -21.618 1.00 50.24 ? 359 HOH B O   1 
HETATM 2530 O  O   . HOH G 5 .   ? -0.315  59.129 -1.359  1.00 38.54 ? 360 HOH B O   1 
HETATM 2531 O  O   . HOH G 5 .   ? 11.991  37.536 -1.171  1.00 42.15 ? 361 HOH B O   1 
HETATM 2532 O  O   . HOH G 5 .   ? -5.857  43.463 -0.009  1.00 48.53 ? 362 HOH B O   1 
HETATM 2533 O  O   . HOH G 5 .   ? -1.561  71.365 -7.896  1.00 65.43 ? 363 HOH B O   1 
HETATM 2534 O  O   . HOH G 5 .   ? 13.129  30.973 -2.278  1.00 61.69 ? 364 HOH B O   1 
HETATM 2535 O  O   . HOH G 5 .   ? -16.000 49.159 -1.470  1.00 51.14 ? 365 HOH B O   1 
HETATM 2536 O  O   . HOH G 5 .   ? 22.612  50.790 -16.138 1.00 49.77 ? 366 HOH B O   1 
HETATM 2537 O  O   . HOH G 5 .   ? 11.812  53.249 4.900   1.00 31.45 ? 367 HOH B O   1 
HETATM 2538 O  O   . HOH G 5 .   ? -8.302  56.506 -1.537  1.00 53.20 ? 368 HOH B O   1 
HETATM 2539 O  O   . HOH G 5 .   ? -4.479  52.082 -18.348 1.00 46.48 ? 369 HOH B O   1 
HETATM 2540 O  O   . HOH G 5 .   ? -7.296  56.648 -6.757  1.00 62.71 ? 370 HOH B O   1 
HETATM 2541 O  O   . HOH G 5 .   ? -8.900  45.245 -24.475 1.00 54.96 ? 371 HOH B O   1 
HETATM 2542 O  O   . HOH G 5 .   ? -9.484  39.205 -6.253  1.00 38.00 ? 372 HOH B O   1 
HETATM 2543 O  O   . HOH G 5 .   ? 9.814   65.483 -6.787  1.00 49.86 ? 373 HOH B O   1 
HETATM 2544 O  O   . HOH G 5 .   ? 17.591  29.460 4.339   1.00 62.90 ? 374 HOH B O   1 
HETATM 2545 O  O   . HOH G 5 .   ? 13.599  44.977 3.810   1.00 48.37 ? 375 HOH B O   1 
HETATM 2546 O  O   . HOH G 5 .   ? -8.843  56.127 -9.852  1.00 60.63 ? 376 HOH B O   1 
HETATM 2547 O  O   . HOH G 5 .   ? -9.958  51.519 -9.230  1.00 47.37 ? 377 HOH B O   1 
HETATM 2548 O  O   . HOH G 5 .   ? 20.608  43.665 2.904   1.00 55.96 ? 378 HOH B O   1 
HETATM 2549 O  O   . HOH G 5 .   ? 13.516  54.439 2.363   1.00 43.93 ? 379 HOH B O   1 
HETATM 2550 O  O   . HOH G 5 .   ? 3.376   47.271 -22.917 1.00 50.61 ? 380 HOH B O   1 
HETATM 2551 O  O   . HOH G 5 .   ? 17.643  56.628 -4.021  1.00 50.91 ? 381 HOH B O   1 
HETATM 2552 O  O   . HOH G 5 .   ? 4.426   33.611 -11.080 1.00 41.21 ? 382 HOH B O   1 
HETATM 2553 O  O   . HOH G 5 .   ? -21.932 58.958 -2.228  1.00 38.08 ? 383 HOH B O   1 
HETATM 2554 O  O   . HOH G 5 .   ? 6.030   63.249 -16.332 1.00 44.33 ? 384 HOH B O   1 
HETATM 2555 O  O   . HOH G 5 .   ? 10.347  52.875 10.656  1.00 56.39 ? 385 HOH B O   1 
HETATM 2556 O  O   . HOH G 5 .   ? -3.079  50.219 7.226   1.00 43.11 ? 386 HOH B O   1 
HETATM 2557 O  O   . HOH G 5 .   ? 1.413   52.969 9.657   1.00 54.96 ? 387 HOH B O   1 
HETATM 2558 O  O   . HOH G 5 .   ? 25.423  48.751 5.418   1.00 45.21 ? 388 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 4   ? 0.5262 0.3181 0.3885 -0.0032 0.0558  -0.0028 4   ARG A N   
2    C CA  . ARG A 4   ? 0.5206 0.3236 0.3887 -0.0077 0.0481  -0.0075 4   ARG A CA  
3    C C   . ARG A 4   ? 0.4752 0.2910 0.3435 -0.0080 0.0352  -0.0101 4   ARG A C   
4    O O   . ARG A 4   ? 0.4680 0.2812 0.3303 -0.0092 0.0310  -0.0154 4   ARG A O   
5    C CB  . ARG A 4   ? 0.5645 0.3621 0.4377 -0.0158 0.0519  -0.0190 4   ARG A CB  
6    C CG  . ARG A 4   ? 0.6057 0.4140 0.4894 -0.0198 0.0470  -0.0235 4   ARG A CG  
7    C CD  . ARG A 4   ? 0.6641 0.4760 0.5585 -0.0277 0.0429  -0.0379 4   ARG A CD  
8    N NE  . ARG A 4   ? 0.6853 0.5015 0.5955 -0.0330 0.0467  -0.0437 4   ARG A NE  
9    C CZ  . ARG A 4   ? 0.7118 0.5159 0.6264 -0.0370 0.0618  -0.0458 4   ARG A CZ  
10   N NH1 . ARG A 4   ? 0.8084 0.5960 0.7124 -0.0354 0.0737  -0.0416 4   ARG A NH1 
11   N NH2 . ARG A 4   ? 0.7325 0.5392 0.6624 -0.0425 0.0671  -0.0519 4   ARG A NH2 
12   N N   . ALA A 5   ? 0.4336 0.2605 0.3059 -0.0066 0.0299  -0.0061 5   ALA A N   
13   C CA  . ALA A 5   ? 0.3876 0.2250 0.2604 -0.0061 0.0201  -0.0072 5   ALA A CA  
14   C C   . ALA A 5   ? 0.3707 0.2166 0.2522 -0.0101 0.0156  -0.0121 5   ALA A C   
15   O O   . ALA A 5   ? 0.3668 0.2110 0.2527 -0.0126 0.0212  -0.0122 5   ALA A O   
16   C CB  . ALA A 5   ? 0.3796 0.2229 0.2514 -0.0011 0.0191  0.0014  5   ALA A CB  
17   N N   . CYS A 6   ? 0.3368 0.1897 0.2201 -0.0101 0.0070  -0.0155 6   CYS A N   
18   C CA  . CYS A 6   ? 0.3261 0.1875 0.2206 -0.0128 0.0034  -0.0196 6   CYS A CA  
19   C C   . CYS A 6   ? 0.3032 0.1706 0.1948 -0.0096 -0.0017 -0.0158 6   CYS A C   
20   O O   . CYS A 6   ? 0.3052 0.1696 0.1873 -0.0060 -0.0048 -0.0136 6   CYS A O   
21   C CB  . CYS A 6   ? 0.3427 0.2068 0.2468 -0.0155 -0.0026 -0.0296 6   CYS A CB  
22   S SG  . CYS A 6   ? 0.3876 0.2432 0.2957 -0.0209 0.0050  -0.0364 6   CYS A SG  
23   N N   . GLY A 7   ? 0.2863 0.1596 0.1850 -0.0114 -0.0006 -0.0156 7   GLY A N   
24   C CA  . GLY A 7   ? 0.2694 0.1471 0.1666 -0.0094 -0.0037 -0.0132 7   GLY A CA  
25   C C   . GLY A 7   ? 0.2552 0.1380 0.1635 -0.0122 -0.0025 -0.0163 7   GLY A C   
26   O O   . GLY A 7   ? 0.2589 0.1425 0.1784 -0.0155 0.0002  -0.0210 7   GLY A O   
27   N N   . LEU A 8   ? 0.2395 0.1246 0.1462 -0.0110 -0.0030 -0.0142 8   LEU A N   
28   C CA  . LEU A 8   ? 0.2350 0.1230 0.1519 -0.0134 0.0000  -0.0169 8   LEU A CA  
29   C C   . LEU A 8   ? 0.2298 0.1170 0.1387 -0.0167 0.0053  -0.0141 8   LEU A C   
30   O O   . LEU A 8   ? 0.2235 0.1112 0.1246 -0.0152 0.0041  -0.0109 8   LEU A O   
31   C CB  . LEU A 8   ? 0.2320 0.1218 0.1550 -0.0086 -0.0051 -0.0179 8   LEU A CB  
32   C CG  . LEU A 8   ? 0.2421 0.1342 0.1728 -0.0047 -0.0142 -0.0218 8   LEU A CG  
33   C CD1 . LEU A 8   ? 0.2494 0.1412 0.1815 0.0022  -0.0210 -0.0208 8   LEU A CD1 
34   C CD2 . LEU A 8   ? 0.2356 0.1332 0.1861 -0.0093 -0.0119 -0.0284 8   LEU A CD2 
35   N N   . ILE A 9   ? 0.2374 0.1225 0.1482 -0.0218 0.0119  -0.0161 9   ILE A N   
36   C CA  . ILE A 9   ? 0.2483 0.1318 0.1513 -0.0259 0.0165  -0.0157 9   ILE A CA  
37   C C   . ILE A 9   ? 0.2528 0.1374 0.1657 -0.0252 0.0185  -0.0182 9   ILE A C   
38   O O   . ILE A 9   ? 0.2787 0.1628 0.2056 -0.0256 0.0224  -0.0218 9   ILE A O   
39   C CB  . ILE A 9   ? 0.2624 0.1383 0.1589 -0.0315 0.0242  -0.0172 9   ILE A CB  
40   C CG1 . ILE A 9   ? 0.2700 0.1425 0.1534 -0.0302 0.0220  -0.0128 9   ILE A CG1 
41   C CG2 . ILE A 9   ? 0.2753 0.1477 0.1616 -0.0369 0.0290  -0.0186 9   ILE A CG2 
42   C CD1 . ILE A 9   ? 0.2899 0.1500 0.1656 -0.0339 0.0312  -0.0136 9   ILE A CD1 
43   N N   . ILE A 10  ? 0.2501 0.1360 0.1582 -0.0237 0.0171  -0.0164 10  ILE A N   
44   C CA  . ILE A 10  ? 0.2549 0.1389 0.1696 -0.0214 0.0198  -0.0172 10  ILE A CA  
45   C C   . ILE A 10  ? 0.2588 0.1394 0.1701 -0.0285 0.0288  -0.0202 10  ILE A C   
46   O O   . ILE A 10  ? 0.2589 0.1406 0.1591 -0.0336 0.0289  -0.0206 10  ILE A O   
47   C CB  . ILE A 10  ? 0.2556 0.1382 0.1643 -0.0159 0.0160  -0.0138 10  ILE A CB  
48   C CG1 . ILE A 10  ? 0.2746 0.1570 0.1830 -0.0090 0.0076  -0.0118 10  ILE A CG1 
49   C CG2 . ILE A 10  ? 0.2638 0.1403 0.1743 -0.0137 0.0217  -0.0137 10  ILE A CG2 
50   C CD1 . ILE A 10  ? 0.2894 0.1724 0.2100 -0.0040 0.0036  -0.0135 10  ILE A CD1 
51   N N   . PHE A 11  ? 0.2583 0.1349 0.1799 -0.0290 0.0360  -0.0228 11  PHE A N   
52   C CA  . PHE A 11  ? 0.2755 0.1460 0.1929 -0.0363 0.0466  -0.0265 11  PHE A CA  
53   C C   . PHE A 11  ? 0.2811 0.1467 0.2093 -0.0324 0.0533  -0.0266 11  PHE A C   
54   O O   . PHE A 11  ? 0.2720 0.1392 0.2121 -0.0232 0.0486  -0.0236 11  PHE A O   
55   C CB  . PHE A 11  ? 0.2902 0.1552 0.2059 -0.0433 0.0543  -0.0305 11  PHE A CB  
56   C CG  . PHE A 11  ? 0.2950 0.1586 0.2318 -0.0403 0.0598  -0.0322 11  PHE A CG  
57   C CD1 . PHE A 11  ? 0.2812 0.1507 0.2296 -0.0359 0.0533  -0.0315 11  PHE A CD1 
58   C CD2 . PHE A 11  ? 0.3089 0.1654 0.2561 -0.0425 0.0723  -0.0356 11  PHE A CD2 
59   C CE1 . PHE A 11  ? 0.2918 0.1633 0.2653 -0.0335 0.0574  -0.0347 11  PHE A CE1 
60   C CE2 . PHE A 11  ? 0.3129 0.1702 0.2852 -0.0394 0.0777  -0.0378 11  PHE A CE2 
61   C CZ  . PHE A 11  ? 0.2991 0.1652 0.2861 -0.0349 0.0694  -0.0376 11  PHE A CZ  
62   N N   . ARG A 12  ? 0.2925 0.1514 0.2153 -0.0391 0.0637  -0.0301 12  ARG A N   
63   C CA  . ARG A 12  ? 0.3167 0.1675 0.2490 -0.0363 0.0737  -0.0304 12  ARG A CA  
64   C C   . ARG A 12  ? 0.3467 0.1891 0.2769 -0.0467 0.0877  -0.0369 12  ARG A C   
65   O O   . ARG A 12  ? 0.3381 0.1800 0.2529 -0.0563 0.0879  -0.0411 12  ARG A O   
66   C CB  . ARG A 12  ? 0.3276 0.1740 0.2531 -0.0346 0.0762  -0.0289 12  ARG A CB  
67   C CG  . ARG A 12  ? 0.3270 0.1730 0.2404 -0.0465 0.0813  -0.0350 12  ARG A CG  
68   C CD  . ARG A 12  ? 0.3242 0.1666 0.2352 -0.0447 0.0845  -0.0340 12  ARG A CD  
69   N NE  . ARG A 12  ? 0.3294 0.1738 0.2346 -0.0566 0.0892  -0.0417 12  ARG A NE  
70   C CZ  . ARG A 12  ? 0.3385 0.1795 0.2446 -0.0583 0.0956  -0.0437 12  ARG A CZ  
71   N NH1 . ARG A 12  ? 0.3330 0.1649 0.2403 -0.0479 0.0988  -0.0371 12  ARG A NH1 
72   N NH2 . ARG A 12  ? 0.3372 0.1832 0.2424 -0.0702 0.0987  -0.0526 12  ARG A NH2 
73   N N   . ARG A 13  ? 0.3861 0.2205 0.3306 -0.0439 0.0992  -0.0375 13  ARG A N   
74   C CA  . ARG A 13  ? 0.4342 0.2571 0.3782 -0.0532 0.1158  -0.0440 13  ARG A CA  
75   C C   . ARG A 13  ? 0.4709 0.2834 0.4077 -0.0583 0.1276  -0.0472 13  ARG A C   
76   O O   . ARG A 13  ? 0.4797 0.2901 0.4229 -0.0503 0.1284  -0.0429 13  ARG A O   
77   C CB  . ARG A 13  ? 0.4633 0.2836 0.4328 -0.0467 0.1234  -0.0431 13  ARG A CB  
78   C CG  . ARG A 13  ? 0.4892 0.3190 0.4697 -0.0440 0.1149  -0.0425 13  ARG A CG  
79   C CD  . ARG A 13  ? 0.5224 0.3493 0.5310 -0.0418 0.1265  -0.0450 13  ARG A CD  
80   N NE  . ARG A 13  ? 0.5492 0.3846 0.5683 -0.0414 0.1199  -0.0463 13  ARG A NE  
81   C CZ  . ARG A 13  ? 0.5670 0.3945 0.5758 -0.0513 0.1288  -0.0511 13  ARG A CZ  
82   N NH1 . ARG A 13  ? 0.5963 0.4070 0.5816 -0.0626 0.1431  -0.0554 13  ARG A NH1 
83   N NH2 . ARG A 13  ? 0.5496 0.3840 0.5702 -0.0502 0.1240  -0.0521 13  ARG A NH2 
84   N N   . CYS A 14  ? 0.5018 0.3058 0.4233 -0.0719 0.1374  -0.0552 14  CYS A N   
85   C CA  . CYS A 14  ? 0.5498 0.3442 0.4639 -0.0794 0.1493  -0.0608 14  CYS A CA  
86   C C   . CYS A 14  ? 0.5840 0.3612 0.5017 -0.0857 0.1701  -0.0664 14  CYS A C   
87   O O   . CYS A 14  ? 0.5847 0.3553 0.4891 -0.0957 0.1750  -0.0724 14  CYS A O   
88   C CB  . CYS A 14  ? 0.5386 0.3391 0.4314 -0.0909 0.1411  -0.0670 14  CYS A CB  
89   S SG  . CYS A 14  ? 0.5552 0.3759 0.4476 -0.0825 0.1175  -0.0597 14  CYS A SG  
90   N N   . LEU A 15  ? 0.6351 0.4031 0.5700 -0.0788 0.1830  -0.0638 15  LEU A N   
91   C CA  . LEU A 15  ? 0.7240 0.4768 0.6709 -0.0806 0.2032  -0.0669 15  LEU A CA  
92   C C   . LEU A 15  ? 0.7941 0.5280 0.7359 -0.0891 0.2250  -0.0736 15  LEU A C   
93   O O   . LEU A 15  ? 0.8619 0.5837 0.8220 -0.0831 0.2414  -0.0715 15  LEU A O   
94   C CB  . LEU A 15  ? 0.7149 0.4730 0.6929 -0.0634 0.2009  -0.0577 15  LEU A CB  
95   C CG  . LEU A 15  ? 0.7072 0.4843 0.6933 -0.0550 0.1797  -0.0522 15  LEU A CG  
96   C CD1 . LEU A 15  ? 0.7026 0.4878 0.7138 -0.0364 0.1704  -0.0426 15  LEU A CD1 
97   C CD2 . LEU A 15  ? 0.6808 0.4570 0.6702 -0.0618 0.1842  -0.0571 15  LEU A CD2 
98   N N   . ILE A 16  ? 0.8304 0.5622 0.7492 -0.1028 0.2249  -0.0820 16  ILE A N   
99   C CA  . ILE A 16  ? 0.8684 0.5815 0.7780 -0.1157 0.2462  -0.0922 16  ILE A CA  
100  C C   . ILE A 16  ? 0.9185 0.6260 0.8017 -0.1333 0.2474  -0.1037 16  ILE A C   
101  O O   . ILE A 16  ? 0.9106 0.6268 0.7737 -0.1433 0.2348  -0.1101 16  ILE A O   
102  C CB  . ILE A 16  ? 0.8589 0.5744 0.7642 -0.1185 0.2450  -0.0947 16  ILE A CB  
103  C CG1 . ILE A 16  ? 0.8256 0.5438 0.7494 -0.0997 0.2418  -0.0818 16  ILE A CG1 
104  C CG2 . ILE A 16  ? 0.9090 0.6048 0.8058 -0.1337 0.2683  -0.1073 16  ILE A CG2 
105  C CD1 . ILE A 16  ? 0.8532 0.5751 0.7722 -0.1007 0.2382  -0.0826 16  ILE A CD1 
106  N N   . PRO A 17  ? 0.9921 0.6845 0.8752 -0.1366 0.2623  -0.1062 17  PRO A N   
107  C CA  . PRO A 17  ? 1.0460 0.7292 0.8989 -0.1513 0.2631  -0.1152 17  PRO A CA  
108  C C   . PRO A 17  ? 1.0889 0.7605 0.9121 -0.1704 0.2693  -0.1296 17  PRO A C   
109  O O   . PRO A 17  ? 1.1234 0.7955 0.9160 -0.1808 0.2580  -0.1357 17  PRO A O   
110  C CB  . PRO A 17  ? 1.0550 0.7194 0.9193 -0.1502 0.2848  -0.1152 17  PRO A CB  
111  C CG  . PRO A 17  ? 1.0622 0.7233 0.9609 -0.1388 0.2992  -0.1097 17  PRO A CG  
112  C CD  . PRO A 17  ? 0.9996 0.6825 0.9115 -0.1257 0.2788  -0.1003 17  PRO A CD  
113  N N   . LYS A 18  ? 1.0926 0.7540 0.9241 -0.1748 0.2862  -0.1351 18  LYS A N   
114  C CA  . LYS A 18  ? 1.1621 0.8131 0.9681 -0.1946 0.2928  -0.1510 18  LYS A CA  
115  C C   . LYS A 18  ? 1.1498 0.8238 0.9434 -0.1996 0.2669  -0.1549 18  LYS A C   
116  O O   . LYS A 18  ? 1.2097 0.8803 0.9773 -0.2165 0.2638  -0.1687 18  LYS A O   
117  C CB  . LYS A 18  ? 1.1814 0.8145 1.0009 -0.1987 0.3195  -0.1567 18  LYS A CB  
118  C CG  . LYS A 18  ? 1.1924 0.7979 1.0184 -0.1991 0.3491  -0.1576 18  LYS A CG  
119  C CD  . LYS A 18  ? 1.2205 0.8073 1.0127 -0.2153 0.3565  -0.1687 18  LYS A CD  
120  C CE  . LYS A 18  ? 1.2292 0.7904 1.0334 -0.2130 0.3855  -0.1673 18  LYS A CE  
121  N NZ  . LYS A 18  ? 1.2674 0.8081 1.0357 -0.2271 0.3926  -0.1764 18  LYS A NZ  
122  N N   . VAL A 19  ? 1.0749 0.7721 0.8874 -0.1853 0.2481  -0.1435 19  VAL A N   
123  C CA  . VAL A 19  ? 1.0307 0.7506 0.8386 -0.1888 0.2256  -0.1469 19  VAL A CA  
124  C C   . VAL A 19  ? 0.9684 0.7105 0.7768 -0.1771 0.1990  -0.1358 19  VAL A C   
125  O O   . VAL A 19  ? 0.9717 0.7281 0.7651 -0.1830 0.1795  -0.1402 19  VAL A O   
126  C CB  . VAL A 19  ? 1.0373 0.7613 0.8661 -0.1885 0.2332  -0.1494 19  VAL A CB  
127  C CG1 . VAL A 19  ? 0.9808 0.7313 0.8166 -0.1856 0.2102  -0.1479 19  VAL A CG1 
128  C CG2 . VAL A 19  ? 1.0663 0.7740 0.8857 -0.2075 0.2525  -0.1668 19  VAL A CG2 
129  N N   . ASP A 20  ? 0.9010 0.6457 0.7268 -0.1608 0.1978  -0.1219 20  ASP A N   
130  C CA  . ASP A 20  ? 0.8214 0.5851 0.6489 -0.1497 0.1750  -0.1116 20  ASP A CA  
131  C C   . ASP A 20  ? 0.8246 0.5869 0.6239 -0.1563 0.1642  -0.1143 20  ASP A C   
132  O O   . ASP A 20  ? 0.8323 0.5777 0.6212 -0.1580 0.1752  -0.1142 20  ASP A O   
133  C CB  . ASP A 20  ? 0.7687 0.5333 0.6190 -0.1328 0.1771  -0.0985 20  ASP A CB  
134  C CG  . ASP A 20  ? 0.7532 0.5229 0.6258 -0.1223 0.1790  -0.0924 20  ASP A CG  
135  O OD1 . ASP A 20  ? 0.7793 0.5559 0.6515 -0.1265 0.1754  -0.0965 20  ASP A OD1 
136  O OD2 . ASP A 20  ? 0.7130 0.4790 0.6034 -0.1094 0.1840  -0.0835 20  ASP A OD2 
137  N N   . ASN A 21  ? 0.8020 0.5803 0.5887 -0.1596 0.1436  -0.1166 21  ASN A N   
138  C CA  . ASN A 21  ? 0.8277 0.6045 0.5844 -0.1634 0.1303  -0.1172 21  ASN A CA  
139  C C   . ASN A 21  ? 0.7888 0.5645 0.5477 -0.1509 0.1265  -0.1048 21  ASN A C   
140  O O   . ASN A 21  ? 0.7945 0.5548 0.5292 -0.1539 0.1295  -0.1048 21  ASN A O   
141  C CB  . ASN A 21  ? 0.8536 0.6521 0.6039 -0.1656 0.1063  -0.1200 21  ASN A CB  
142  C CG  . ASN A 21  ? 0.9227 0.7227 0.6663 -0.1812 0.1074  -0.1356 21  ASN A CG  
143  O OD1 . ASN A 21  ? 0.9514 0.7723 0.7113 -0.1823 0.0957  -0.1393 21  ASN A OD1 
144  N ND2 . ASN A 21  ? 0.9732 0.7504 0.6938 -0.1940 0.1225  -0.1458 21  ASN A ND2 
145  N N   . ASN A 22  ? 0.7034 0.4941 0.4902 -0.1376 0.1208  -0.0950 22  ASN A N   
146  C CA  . ASN A 22  ? 0.6817 0.4749 0.4745 -0.1262 0.1154  -0.0845 22  ASN A CA  
147  C C   . ASN A 22  ? 0.6290 0.4205 0.4517 -0.1168 0.1272  -0.0791 22  ASN A C   
148  O O   . ASN A 22  ? 0.6301 0.4304 0.4726 -0.1111 0.1265  -0.0768 22  ASN A O   
149  C CB  . ASN A 22  ? 0.6506 0.4648 0.4466 -0.1183 0.0934  -0.0777 22  ASN A CB  
150  C CG  . ASN A 22  ? 0.6873 0.5067 0.4581 -0.1257 0.0788  -0.0825 22  ASN A CG  
151  O OD1 . ASN A 22  ? 0.7022 0.5347 0.4787 -0.1301 0.0715  -0.0881 22  ASN A OD1 
152  N ND2 . ASN A 22  ? 0.6852 0.4939 0.4284 -0.1269 0.0746  -0.0807 22  ASN A ND2 
153  N N   . ALA A 23  ? 0.5965 0.3758 0.4226 -0.1149 0.1382  -0.0774 23  ALA A N   
154  C CA  . ALA A 23  ? 0.5632 0.3435 0.4211 -0.1050 0.1469  -0.0726 23  ALA A CA  
155  C C   . ALA A 23  ? 0.5037 0.3026 0.3792 -0.0917 0.1301  -0.0634 23  ALA A C   
156  O O   . ALA A 23  ? 0.5031 0.3074 0.4035 -0.0818 0.1308  -0.0588 23  ALA A O   
157  C CB  . ALA A 23  ? 0.5827 0.3462 0.4445 -0.1075 0.1643  -0.0750 23  ALA A CB  
158  N N   . ILE A 24  ? 0.4707 0.2776 0.3313 -0.0914 0.1154  -0.0607 24  ILE A N   
159  C CA  . ILE A 24  ? 0.4309 0.2531 0.3031 -0.0806 0.1001  -0.0529 24  ILE A CA  
160  C C   . ILE A 24  ? 0.4076 0.2416 0.2675 -0.0812 0.0853  -0.0517 24  ILE A C   
161  O O   . ILE A 24  ? 0.4169 0.2490 0.2550 -0.0885 0.0811  -0.0550 24  ILE A O   
162  C CB  . ILE A 24  ? 0.4330 0.2519 0.3011 -0.0792 0.0988  -0.0506 24  ILE A CB  
163  C CG1 . ILE A 24  ? 0.4478 0.2581 0.3367 -0.0780 0.1137  -0.0525 24  ILE A CG1 
164  C CG2 . ILE A 24  ? 0.3996 0.2331 0.2750 -0.0701 0.0830  -0.0439 24  ILE A CG2 
165  C CD1 . ILE A 24  ? 0.4499 0.2483 0.3297 -0.0818 0.1212  -0.0539 24  ILE A CD1 
166  N N   . GLU A 25  ? 0.3726 0.2180 0.2466 -0.0732 0.0776  -0.0473 25  GLU A N   
167  C CA  . GLU A 25  ? 0.3630 0.2204 0.2315 -0.0727 0.0649  -0.0459 25  GLU A CA  
168  C C   . GLU A 25  ? 0.3427 0.2089 0.2197 -0.0622 0.0544  -0.0382 25  GLU A C   
169  O O   . GLU A 25  ? 0.3268 0.1918 0.2175 -0.0548 0.0563  -0.0348 25  GLU A O   
170  C CB  . GLU A 25  ? 0.3779 0.2373 0.2531 -0.0750 0.0692  -0.0494 25  GLU A CB  
171  C CG  . GLU A 25  ? 0.4245 0.2770 0.2892 -0.0879 0.0780  -0.0591 25  GLU A CG  
172  C CD  . GLU A 25  ? 0.4492 0.3017 0.3229 -0.0913 0.0856  -0.0639 25  GLU A CD  
173  O OE1 . GLU A 25  ? 0.5153 0.3640 0.3814 -0.1030 0.0917  -0.0734 25  GLU A OE1 
174  O OE2 . GLU A 25  ? 0.4180 0.2717 0.3045 -0.0831 0.0870  -0.0590 25  GLU A OE2 
175  N N   . PHE A 26  ? 0.3282 0.2028 0.1972 -0.0614 0.0430  -0.0357 26  PHE A N   
176  C CA  . PHE A 26  ? 0.3047 0.1856 0.1793 -0.0526 0.0343  -0.0292 26  PHE A CA  
177  C C   . PHE A 26  ? 0.2966 0.1866 0.1778 -0.0491 0.0287  -0.0274 26  PHE A C   
178  O O   . PHE A 26  ? 0.2958 0.1919 0.1750 -0.0543 0.0267  -0.0311 26  PHE A O   
179  C CB  . PHE A 26  ? 0.3196 0.2007 0.1805 -0.0532 0.0278  -0.0268 26  PHE A CB  
180  C CG  . PHE A 26  ? 0.3435 0.2122 0.1966 -0.0562 0.0355  -0.0280 26  PHE A CG  
181  C CD1 . PHE A 26  ? 0.3334 0.1993 0.1984 -0.0515 0.0388  -0.0261 26  PHE A CD1 
182  C CD2 . PHE A 26  ? 0.3785 0.2373 0.2127 -0.0644 0.0404  -0.0321 26  PHE A CD2 
183  C CE1 . PHE A 26  ? 0.3589 0.2130 0.2210 -0.0548 0.0485  -0.0282 26  PHE A CE1 
184  C CE2 . PHE A 26  ? 0.4071 0.2507 0.2332 -0.0675 0.0509  -0.0336 26  PHE A CE2 
185  C CZ  . PHE A 26  ? 0.3922 0.2338 0.2343 -0.0627 0.0558  -0.0316 26  PHE A CZ  
186  N N   . LEU A 27  ? 0.1324 0.1718 0.1643 -0.0179 -0.0002 -0.0312 27  LEU A N   
187  C CA  . LEU A 27  ? 0.1348 0.1798 0.1646 -0.0134 -0.0013 -0.0266 27  LEU A CA  
188  C C   . LEU A 27  ? 0.1525 0.1967 0.1721 -0.0076 -0.0012 -0.0254 27  LEU A C   
189  O O   . LEU A 27  ? 0.1660 0.2008 0.1775 -0.0053 -0.0016 -0.0263 27  LEU A O   
190  C CB  . LEU A 27  ? 0.1286 0.1698 0.1594 -0.0131 -0.0028 -0.0250 27  LEU A CB  
191  C CG  . LEU A 27  ? 0.1258 0.1723 0.1522 -0.0108 -0.0029 -0.0213 27  LEU A CG  
192  C CD1 . LEU A 27  ? 0.1191 0.1763 0.1520 -0.0137 -0.0031 -0.0189 27  LEU A CD1 
193  C CD2 . LEU A 27  ? 0.1237 0.1637 0.1471 -0.0124 -0.0051 -0.0196 27  LEU A CD2 
194  N N   . LEU A 28  ? 0.1540 0.2078 0.1749 -0.0050 -0.0014 -0.0234 28  LEU A N   
195  C CA  . LEU A 28  ? 0.1666 0.2208 0.1821 0.0020  -0.0023 -0.0228 28  LEU A CA  
196  C C   . LEU A 28  ? 0.1725 0.2382 0.1921 0.0054  -0.0005 -0.0221 28  LEU A C   
197  O O   . LEU A 28  ? 0.1644 0.2405 0.1904 0.0017  0.0003  -0.0208 28  LEU A O   
198  C CB  . LEU A 28  ? 0.1699 0.2266 0.1848 0.0023  -0.0050 -0.0217 28  LEU A CB  
199  C CG  . LEU A 28  ? 0.1893 0.2347 0.1965 -0.0028 -0.0067 -0.0225 28  LEU A CG  
200  C CD1 . LEU A 28  ? 0.2061 0.2541 0.2111 -0.0050 -0.0104 -0.0204 28  LEU A CD1 
201  C CD2 . LEU A 28  ? 0.2035 0.2351 0.2009 0.0003  -0.0080 -0.0232 28  LEU A CD2 
202  N N   . LEU A 29  ? 0.1856 0.2495 0.2013 0.0118  0.0003  -0.0237 29  LEU A N   
203  C CA  . LEU A 29  ? 0.1949 0.2710 0.2140 0.0144  0.0035  -0.0250 29  LEU A CA  
204  C C   . LEU A 29  ? 0.2204 0.3030 0.2445 0.0225  0.0025  -0.0270 29  LEU A C   
205  O O   . LEU A 29  ? 0.2192 0.2910 0.2395 0.0276  -0.0006 -0.0276 29  LEU A O   
206  C CB  . LEU A 29  ? 0.1996 0.2694 0.2113 0.0150  0.0061  -0.0271 29  LEU A CB  
207  C CG  . LEU A 29  ? 0.1895 0.2483 0.1953 0.0084  0.0050  -0.0252 29  LEU A CG  
208  C CD1 . LEU A 29  ? 0.1936 0.2479 0.1908 0.0084  0.0073  -0.0272 29  LEU A CD1 
209  C CD2 . LEU A 29  ? 0.1753 0.2401 0.1868 0.0007  0.0040  -0.0218 29  LEU A CD2 
210  N N   . GLN A 30  ? 0.2318 0.3321 0.2649 0.0234  0.0048  -0.0280 30  GLN A N   
211  C CA  . GLN A 30  ? 0.2700 0.3798 0.3124 0.0318  0.0036  -0.0306 30  GLN A CA  
212  C C   . GLN A 30  ? 0.2927 0.4080 0.3375 0.0377  0.0085  -0.0371 30  GLN A C   
213  O O   . GLN A 30  ? 0.3027 0.4295 0.3478 0.0331  0.0146  -0.0394 30  GLN A O   
214  C CB  . GLN A 30  ? 0.2713 0.3997 0.3246 0.0291  0.0033  -0.0289 30  GLN A CB  
215  C CG  . GLN A 30  ? 0.3012 0.4407 0.3674 0.0377  0.0001  -0.0310 30  GLN A CG  
216  C CD  . GLN A 30  ? 0.3032 0.4623 0.3799 0.0338  0.0000  -0.0292 30  GLN A CD  
217  O OE1 . GLN A 30  ? 0.3233 0.4929 0.4000 0.0263  0.0049  -0.0291 30  GLN A OE1 
218  N NE2 . GLN A 30  ? 0.3157 0.4790 0.4008 0.0379  -0.0067 -0.0272 30  GLN A NE2 
219  N N   . ALA A 31  ? 0.3186 0.4256 0.3648 0.0471  0.0059  -0.0404 31  ALA A N   
220  C CA  . ALA A 31  ? 0.3781 0.4902 0.4286 0.0539  0.0110  -0.0486 31  ALA A CA  
221  C C   . ALA A 31  ? 0.4075 0.5456 0.4738 0.0556  0.0162  -0.0539 31  ALA A C   
222  O O   . ALA A 31  ? 0.3940 0.5443 0.4720 0.0567  0.0127  -0.0515 31  ALA A O   
223  C CB  . ALA A 31  ? 0.3798 0.4774 0.4317 0.0646  0.0057  -0.0512 31  ALA A CB  
224  N N   . SER A 32  ? 0.4662 0.6129 0.5319 0.0545  0.0247  -0.0615 32  SER A N   
225  C CA  . SER A 32  ? 0.5051 0.6780 0.5849 0.0547  0.0318  -0.0689 32  SER A CA  
226  C C   . SER A 32  ? 0.5498 0.7319 0.6502 0.0685  0.0305  -0.0770 32  SER A C   
227  O O   . SER A 32  ? 0.5894 0.7946 0.7075 0.0703  0.0325  -0.0808 32  SER A O   
228  C CB  . SER A 32  ? 0.4997 0.6777 0.5696 0.0471  0.0419  -0.0752 32  SER A CB  
229  O OG  . SER A 32  ? 0.4998 0.6757 0.5556 0.0334  0.0424  -0.0675 32  SER A OG  
230  N N   . ASP A 33  ? 0.5964 0.7603 0.6953 0.0779  0.0266  -0.0798 33  ASP A N   
231  C CA  . ASP A 33  ? 0.6755 0.8441 0.7948 0.0924  0.0242  -0.0884 33  ASP A CA  
232  C C   . ASP A 33  ? 0.6833 0.8388 0.8089 0.1003  0.0100  -0.0806 33  ASP A C   
233  O O   . ASP A 33  ? 0.6467 0.7967 0.7638 0.0935  0.0039  -0.0698 33  ASP A O   
234  C CB  . ASP A 33  ? 0.7058 0.8616 0.8194 0.0975  0.0291  -0.0979 33  ASP A CB  
235  C CG  . ASP A 33  ? 0.7100 0.8347 0.8020 0.0956  0.0230  -0.0905 33  ASP A CG  
236  O OD1 . ASP A 33  ? 0.7138 0.8281 0.7959 0.0902  0.0158  -0.0789 33  ASP A OD1 
237  O OD2 . ASP A 33  ? 0.7311 0.8426 0.8162 0.0990  0.0259  -0.0971 33  ASP A OD2 
238  N N   . GLY A 34  ? 0.7147 0.8645 0.8548 0.1138  0.0045  -0.0864 34  GLY A N   
239  C CA  . GLY A 34  ? 0.7328 0.8653 0.8758 0.1206  -0.0106 -0.0785 34  GLY A CA  
240  C C   . GLY A 34  ? 0.7410 0.8842 0.8898 0.1164  -0.0180 -0.0690 34  GLY A C   
241  O O   . GLY A 34  ? 0.7508 0.9204 0.9161 0.1159  -0.0138 -0.0724 34  GLY A O   
242  N N   . ILE A 35  ? 0.7718 0.8951 0.9061 0.1120  -0.0285 -0.0576 35  ILE A N   
243  C CA  . ILE A 35  ? 0.7456 0.8770 0.8809 0.1052  -0.0350 -0.0483 35  ILE A CA  
244  C C   . ILE A 35  ? 0.6874 0.8183 0.8033 0.0903  -0.0285 -0.0426 35  ILE A C   
245  O O   . ILE A 35  ? 0.6943 0.8236 0.8039 0.0827  -0.0340 -0.0344 35  ILE A O   
246  C CB  . ILE A 35  ? 0.7879 0.9014 0.9217 0.1082  -0.0517 -0.0395 35  ILE A CB  
247  C CG1 . ILE A 35  ? 0.8031 0.8856 0.9115 0.1033  -0.0556 -0.0341 35  ILE A CG1 
248  C CG2 . ILE A 35  ? 0.8350 0.9535 0.9945 0.1235  -0.0604 -0.0445 35  ILE A CG2 
249  C CD1 . ILE A 35  ? 0.8097 0.8759 0.9071 0.0977  -0.0697 -0.0228 35  ILE A CD1 
250  N N   . HIS A 36  ? 0.6315 0.7636 0.7385 0.0860  -0.0172 -0.0474 36  HIS A N   
251  C CA  . HIS A 36  ? 0.5552 0.6874 0.6473 0.0729  -0.0114 -0.0430 36  HIS A CA  
252  C C   . HIS A 36  ? 0.5052 0.6165 0.5804 0.0662  -0.0179 -0.0346 36  HIS A C   
253  O O   . HIS A 36  ? 0.5105 0.6255 0.5834 0.0585  -0.0204 -0.0289 36  HIS A O   
254  C CB  . HIS A 36  ? 0.5517 0.7084 0.6540 0.0670  -0.0079 -0.0421 36  HIS A CB  
255  C CG  . HIS A 36  ? 0.5983 0.7797 0.7209 0.0734  -0.0025 -0.0508 36  HIS A CG  
256  N ND1 . HIS A 36  ? 0.6051 0.7931 0.7282 0.0743  0.0074  -0.0596 36  HIS A ND1 
257  C CD2 . HIS A 36  ? 0.5937 0.7963 0.7372 0.0779  -0.0054 -0.0525 36  HIS A CD2 
258  C CE1 . HIS A 36  ? 0.6079 0.8209 0.7517 0.0791  0.0115  -0.0675 36  HIS A CE1 
259  N NE2 . HIS A 36  ? 0.6014 0.8237 0.7587 0.0818  0.0034  -0.0630 36  HIS A NE2 
260  N N   . HIS A 37  ? 0.4780 0.5676 0.5413 0.0685  -0.0202 -0.0347 37  HIS A N   
261  C CA  . HIS A 37  ? 0.4585 0.5283 0.5044 0.0608  -0.0245 -0.0285 37  HIS A CA  
262  C C   . HIS A 37  ? 0.3934 0.4650 0.4304 0.0501  -0.0175 -0.0273 37  HIS A C   
263  O O   . HIS A 37  ? 0.3680 0.4497 0.4075 0.0488  -0.0098 -0.0309 37  HIS A O   
264  C CB  . HIS A 37  ? 0.5044 0.5516 0.5396 0.0651  -0.0276 -0.0298 37  HIS A CB  
265  C CG  . HIS A 37  ? 0.5620 0.5967 0.5990 0.0714  -0.0395 -0.0265 37  HIS A CG  
266  N ND1 . HIS A 37  ? 0.5751 0.6105 0.6255 0.0838  -0.0433 -0.0310 37  HIS A ND1 
267  C CD2 . HIS A 37  ? 0.5657 0.5860 0.5918 0.0656  -0.0493 -0.0190 37  HIS A CD2 
268  C CE1 . HIS A 37  ? 0.5989 0.6197 0.6479 0.0865  -0.0563 -0.0255 37  HIS A CE1 
269  N NE2 . HIS A 37  ? 0.5948 0.6062 0.6272 0.0745  -0.0599 -0.0177 37  HIS A NE2 
270  N N   . TRP A 38  ? 0.3545 0.4158 0.3810 0.0417  -0.0206 -0.0225 38  TRP A N   
271  C CA  . TRP A 38  ? 0.3099 0.3705 0.3300 0.0321  -0.0153 -0.0219 38  TRP A CA  
272  C C   . TRP A 38  ? 0.3037 0.3452 0.3103 0.0285  -0.0157 -0.0218 38  TRP A C   
273  O O   . TRP A 38  ? 0.3182 0.3478 0.3165 0.0254  -0.0210 -0.0192 38  TRP A O   
274  C CB  . TRP A 38  ? 0.2824 0.3497 0.3042 0.0243  -0.0169 -0.0185 38  TRP A CB  
275  C CG  . TRP A 38  ? 0.2764 0.3639 0.3109 0.0248  -0.0158 -0.0182 38  TRP A CG  
276  C CD1 . TRP A 38  ? 0.2860 0.3839 0.3300 0.0295  -0.0208 -0.0168 38  TRP A CD1 
277  C CD2 . TRP A 38  ? 0.2644 0.3645 0.3040 0.0195  -0.0099 -0.0190 38  TRP A CD2 
278  N NE1 . TRP A 38  ? 0.2798 0.3969 0.3341 0.0270  -0.0176 -0.0171 38  TRP A NE1 
279  C CE2 . TRP A 38  ? 0.2681 0.3865 0.3191 0.0207  -0.0111 -0.0182 38  TRP A CE2 
280  C CE3 . TRP A 38  ? 0.2541 0.3515 0.2903 0.0136  -0.0052 -0.0197 38  TRP A CE3 
281  C CZ2 . TRP A 38  ? 0.2517 0.3844 0.3084 0.0153  -0.0069 -0.0182 38  TRP A CZ2 
282  C CZ3 . TRP A 38  ? 0.2416 0.3519 0.2839 0.0086  -0.0022 -0.0191 38  TRP A CZ3 
283  C CH2 . TRP A 38  ? 0.2392 0.3666 0.2906 0.0091  -0.0027 -0.0184 38  TRP A CH2 
284  N N   . THR A 39  ? 0.2725 0.3107 0.2756 0.0277  -0.0106 -0.0245 39  THR A N   
285  C CA  . THR A 39  ? 0.2693 0.2910 0.2609 0.0235  -0.0107 -0.0247 39  THR A CA  
286  C C   . THR A 39  ? 0.2460 0.2699 0.2381 0.0176  -0.0060 -0.0257 39  THR A C   
287  O O   . THR A 39  ? 0.2296 0.2650 0.2283 0.0175  -0.0028 -0.0261 39  THR A O   
288  C CB  . THR A 39  ? 0.2898 0.2983 0.2741 0.0300  -0.0119 -0.0270 39  THR A CB  
289  O OG1 . THR A 39  ? 0.3040 0.3179 0.2903 0.0325  -0.0066 -0.0304 39  THR A OG1 
290  C CG2 . THR A 39  ? 0.3122 0.3181 0.2994 0.0385  -0.0176 -0.0267 39  THR A CG2 
291  N N   . PRO A 40  ? 0.2401 0.2527 0.2253 0.0122  -0.0062 -0.0262 40  PRO A N   
292  C CA  . PRO A 40  ? 0.2268 0.2397 0.2139 0.0083  -0.0034 -0.0271 40  PRO A CA  
293  C C   . PRO A 40  ? 0.2291 0.2399 0.2119 0.0127  -0.0019 -0.0283 40  PRO A C   
294  O O   . PRO A 40  ? 0.2516 0.2590 0.2304 0.0191  -0.0023 -0.0297 40  PRO A O   
295  C CB  . PRO A 40  ? 0.2217 0.2233 0.2032 0.0025  -0.0042 -0.0284 40  PRO A CB  
296  C CG  . PRO A 40  ? 0.2361 0.2341 0.2130 0.0006  -0.0064 -0.0278 40  PRO A CG  
297  C CD  . PRO A 40  ? 0.2468 0.2466 0.2227 0.0084  -0.0091 -0.0258 40  PRO A CD  
298  N N   . PRO A 41  ? 0.2210 0.2337 0.2051 0.0087  -0.0005 -0.0279 41  PRO A N   
299  C CA  . PRO A 41  ? 0.2376 0.2480 0.2152 0.0103  0.0011  -0.0291 41  PRO A CA  
300  C C   . PRO A 41  ? 0.2509 0.2461 0.2174 0.0123  0.0003  -0.0313 41  PRO A C   
301  O O   . PRO A 41  ? 0.2481 0.2341 0.2117 0.0090  -0.0017 -0.0309 41  PRO A O   
302  C CB  . PRO A 41  ? 0.2219 0.2346 0.2023 0.0031  0.0002  -0.0266 41  PRO A CB  
303  C CG  . PRO A 41  ? 0.2181 0.2368 0.2096 -0.0003 -0.0012 -0.0248 41  PRO A CG  
304  C CD  . PRO A 41  ? 0.2064 0.2229 0.1986 0.0021  -0.0013 -0.0264 41  PRO A CD  
305  N N   . LYS A 42  ? 0.2716 0.2645 0.2323 0.0175  0.0023  -0.0343 42  LYS A N   
306  C CA  . LYS A 42  ? 0.2878 0.2653 0.2377 0.0201  0.0013  -0.0368 42  LYS A CA  
307  C C   . LYS A 42  ? 0.3066 0.2852 0.2519 0.0237  0.0053  -0.0415 42  LYS A C   
308  O O   . LYS A 42  ? 0.3082 0.3007 0.2601 0.0257  0.0088  -0.0434 42  LYS A O   
309  C CB  . LYS A 42  ? 0.3054 0.2750 0.2545 0.0253  -0.0020 -0.0368 42  LYS A CB  
310  C CG  . LYS A 42  ? 0.3348 0.3138 0.2925 0.0335  -0.0017 -0.0386 42  LYS A CG  
311  C CD  . LYS A 42  ? 0.3610 0.3288 0.3167 0.0389  -0.0074 -0.0379 42  LYS A CD  
312  C CE  . LYS A 42  ? 0.3825 0.3621 0.3509 0.0472  -0.0085 -0.0392 42  LYS A CE  
313  N NZ  . LYS A 42  ? 0.4238 0.4071 0.3966 0.0551  -0.0045 -0.0462 42  LYS A NZ  
314  N N   . GLY A 43  ? 0.3103 0.2747 0.2442 0.0238  0.0052  -0.0441 43  GLY A N   
315  C CA  . GLY A 43  ? 0.3259 0.2899 0.2540 0.0262  0.0098  -0.0501 43  GLY A CA  
316  C C   . GLY A 43  ? 0.3449 0.2898 0.2605 0.0276  0.0085  -0.0532 43  GLY A C   
317  O O   . GLY A 43  ? 0.3261 0.2589 0.2358 0.0242  0.0041  -0.0497 43  GLY A O   
318  N N   . HIS A 44  ? 0.3735 0.3162 0.2853 0.0321  0.0127  -0.0606 44  HIS A N   
319  C CA  . HIS A 44  ? 0.4018 0.3251 0.3024 0.0348  0.0115  -0.0647 44  HIS A CA  
320  C C   . HIS A 44  ? 0.3987 0.3125 0.2845 0.0252  0.0113  -0.0632 44  HIS A C   
321  O O   . HIS A 44  ? 0.3835 0.3066 0.2668 0.0174  0.0138  -0.0617 44  HIS A O   
322  C CB  . HIS A 44  ? 0.4506 0.3752 0.3553 0.0440  0.0163  -0.0749 44  HIS A CB  
323  C CG  . HIS A 44  ? 0.4674 0.4003 0.3893 0.0546  0.0143  -0.0760 44  HIS A CG  
324  N ND1 . HIS A 44  ? 0.4606 0.4134 0.3950 0.0542  0.0156  -0.0729 44  HIS A ND1 
325  C CD2 . HIS A 44  ? 0.4960 0.4184 0.4244 0.0655  0.0096  -0.0790 44  HIS A CD2 
326  C CE1 . HIS A 44  ? 0.4630 0.4192 0.4115 0.0642  0.0123  -0.0742 44  HIS A CE1 
327  N NE2 . HIS A 44  ? 0.4925 0.4298 0.4377 0.0714  0.0080  -0.0776 44  HIS A NE2 
328  N N   . VAL A 45  ? 0.4162 0.3110 0.2918 0.0247  0.0074  -0.0629 45  VAL A N   
329  C CA  . VAL A 45  ? 0.4444 0.3292 0.3057 0.0154  0.0066  -0.0618 45  VAL A CA  
330  C C   . VAL A 45  ? 0.4841 0.3673 0.3354 0.0136  0.0123  -0.0691 45  VAL A C   
331  O O   . VAL A 45  ? 0.4961 0.3819 0.3508 0.0210  0.0172  -0.0769 45  VAL A O   
332  C CB  . VAL A 45  ? 0.4492 0.3139 0.3010 0.0145  0.0013  -0.0602 45  VAL A CB  
333  C CG1 . VAL A 45  ? 0.4373 0.3042 0.2973 0.0146  -0.0032 -0.0541 45  VAL A CG1 
334  C CG2 . VAL A 45  ? 0.4847 0.3332 0.3305 0.0227  0.0014  -0.0670 45  VAL A CG2 
335  N N   . GLU A 46  ? 0.5161 0.3954 0.3556 0.0032  0.0115  -0.0668 46  GLU A N   
336  C CA  . GLU A 46  ? 0.5401 0.4164 0.3661 -0.0020 0.0162  -0.0728 46  GLU A CA  
337  C C   . GLU A 46  ? 0.5564 0.4130 0.3667 -0.0070 0.0129  -0.0730 46  GLU A C   
338  O O   . GLU A 46  ? 0.5251 0.3762 0.3354 -0.0108 0.0068  -0.0663 46  GLU A O   
339  C CB  . GLU A 46  ? 0.5516 0.4419 0.3761 -0.0125 0.0169  -0.0684 46  GLU A CB  
340  C CG  . GLU A 46  ? 0.5687 0.4779 0.4047 -0.0095 0.0217  -0.0699 46  GLU A CG  
341  C CD  . GLU A 46  ? 0.6404 0.5547 0.4690 -0.0106 0.0307  -0.0802 46  GLU A CD  
342  O OE1 . GLU A 46  ? 0.6577 0.5891 0.4921 -0.0127 0.0351  -0.0811 46  GLU A OE1 
343  O OE2 . GLU A 46  ? 0.6327 0.5341 0.4492 -0.0105 0.0339  -0.0879 46  GLU A OE2 
344  N N   . PRO A 47  ? 0.5913 0.4379 0.3883 -0.0077 0.0176  -0.0817 47  PRO A N   
345  C CA  . PRO A 47  ? 0.6075 0.4347 0.3880 -0.0135 0.0145  -0.0822 47  PRO A CA  
346  C C   . PRO A 47  ? 0.6027 0.4324 0.3775 -0.0264 0.0090  -0.0733 47  PRO A C   
347  O O   . PRO A 47  ? 0.5938 0.4360 0.3677 -0.0342 0.0097  -0.0705 47  PRO A O   
348  C CB  . PRO A 47  ? 0.6394 0.4609 0.4073 -0.0145 0.0220  -0.0937 47  PRO A CB  
349  C CG  . PRO A 47  ? 0.6366 0.4703 0.4187 -0.0037 0.0286  -0.1012 47  PRO A CG  
350  C CD  . PRO A 47  ? 0.6030 0.4560 0.4009 -0.0030 0.0263  -0.0926 47  PRO A CD  
351  N N   . GLY A 48  ? 0.6130 0.4316 0.3851 -0.0290 0.0028  -0.0687 48  GLY A N   
352  C CA  . GLY A 48  ? 0.6052 0.4266 0.3760 -0.0401 -0.0032 -0.0610 48  GLY A CA  
353  C C   . GLY A 48  ? 0.5901 0.4286 0.3792 -0.0410 -0.0071 -0.0532 48  GLY A C   
354  O O   . GLY A 48  ? 0.6248 0.4660 0.4168 -0.0490 -0.0129 -0.0475 48  GLY A O   
355  N N   . GLU A 49  ? 0.5354 0.3855 0.3381 -0.0330 -0.0042 -0.0533 49  GLU A N   
356  C CA  . GLU A 49  ? 0.4985 0.3637 0.3190 -0.0337 -0.0077 -0.0466 49  GLU A CA  
357  C C   . GLU A 49  ? 0.4652 0.3279 0.2950 -0.0310 -0.0106 -0.0446 49  GLU A C   
358  O O   . GLU A 49  ? 0.4619 0.3153 0.2883 -0.0250 -0.0091 -0.0477 49  GLU A O   
359  C CB  . GLU A 49  ? 0.4939 0.3730 0.3241 -0.0278 -0.0034 -0.0475 49  GLU A CB  
360  C CG  . GLU A 49  ? 0.4981 0.3923 0.3433 -0.0310 -0.0070 -0.0408 49  GLU A CG  
361  C CD  . GLU A 49  ? 0.5120 0.4194 0.3640 -0.0265 -0.0023 -0.0421 49  GLU A CD  
362  O OE1 . GLU A 49  ? 0.5320 0.4404 0.3887 -0.0171 0.0018  -0.0464 49  GLU A OE1 
363  O OE2 . GLU A 49  ? 0.5263 0.4422 0.3779 -0.0331 -0.0033 -0.0388 49  GLU A OE2 
364  N N   . ASP A 50  ? 0.4302 0.3008 0.2715 -0.0364 -0.0154 -0.0397 50  ASP A N   
365  C CA  . ASP A 50  ? 0.4216 0.2933 0.2731 -0.0358 -0.0170 -0.0388 50  ASP A CA  
366  C C   . ASP A 50  ? 0.3873 0.2681 0.2507 -0.0280 -0.0141 -0.0389 50  ASP A C   
367  O O   . ASP A 50  ? 0.3684 0.2604 0.2397 -0.0256 -0.0130 -0.0375 50  ASP A O   
368  C CB  . ASP A 50  ? 0.4154 0.2965 0.2802 -0.0432 -0.0221 -0.0351 50  ASP A CB  
369  C CG  . ASP A 50  ? 0.4110 0.2956 0.2872 -0.0448 -0.0228 -0.0359 50  ASP A CG  
370  O OD1 . ASP A 50  ? 0.3964 0.2901 0.2855 -0.0409 -0.0210 -0.0360 50  ASP A OD1 
371  O OD2 . ASP A 50  ? 0.4411 0.3199 0.3131 -0.0510 -0.0247 -0.0369 50  ASP A OD2 
372  N N   . ASP A 51  ? 0.3725 0.2478 0.2354 -0.0251 -0.0135 -0.0402 51  ASP A N   
373  C CA  . ASP A 51  ? 0.3594 0.2411 0.2309 -0.0185 -0.0117 -0.0401 51  ASP A CA  
374  C C   . ASP A 51  ? 0.3160 0.2154 0.2061 -0.0198 -0.0119 -0.0376 51  ASP A C   
375  O O   . ASP A 51  ? 0.3056 0.2137 0.2026 -0.0147 -0.0101 -0.0370 51  ASP A O   
376  C CB  . ASP A 51  ? 0.3931 0.2647 0.2590 -0.0186 -0.0128 -0.0407 51  ASP A CB  
377  C CG  . ASP A 51  ? 0.4569 0.3109 0.3076 -0.0132 -0.0133 -0.0429 51  ASP A CG  
378  O OD1 . ASP A 51  ? 0.4999 0.3503 0.3450 -0.0093 -0.0116 -0.0456 51  ASP A OD1 
379  O OD2 . ASP A 51  ? 0.5033 0.3466 0.3476 -0.0134 -0.0157 -0.0424 51  ASP A OD2 
380  N N   . LEU A 52  ? 0.2892 0.1936 0.1883 -0.0265 -0.0144 -0.0366 52  LEU A N   
381  C CA  . LEU A 52  ? 0.2687 0.1881 0.1870 -0.0274 -0.0153 -0.0349 52  LEU A CA  
382  C C   . LEU A 52  ? 0.2695 0.1950 0.1906 -0.0269 -0.0170 -0.0317 52  LEU A C   
383  O O   . LEU A 52  ? 0.2481 0.1838 0.1800 -0.0246 -0.0167 -0.0300 52  LEU A O   
384  C CB  . LEU A 52  ? 0.2585 0.1819 0.1887 -0.0342 -0.0178 -0.0361 52  LEU A CB  
385  C CG  . LEU A 52  ? 0.2406 0.1782 0.1937 -0.0350 -0.0196 -0.0356 52  LEU A CG  
386  C CD1 . LEU A 52  ? 0.2224 0.1667 0.1818 -0.0308 -0.0158 -0.0367 52  LEU A CD1 
387  C CD2 . LEU A 52  ? 0.2416 0.1834 0.2081 -0.0412 -0.0214 -0.0390 52  LEU A CD2 
388  N N   . GLU A 53  ? 0.2870 0.2057 0.1961 -0.0301 -0.0187 -0.0308 53  GLU A N   
389  C CA  . GLU A 53  ? 0.3051 0.2286 0.2123 -0.0317 -0.0200 -0.0276 53  GLU A CA  
390  C C   . GLU A 53  ? 0.2828 0.2098 0.1849 -0.0254 -0.0142 -0.0296 53  GLU A C   
391  O O   . GLU A 53  ? 0.2721 0.2085 0.1796 -0.0259 -0.0142 -0.0272 53  GLU A O   
392  C CB  . GLU A 53  ? 0.3529 0.2684 0.2464 -0.0387 -0.0233 -0.0263 53  GLU A CB  
393  C CG  . GLU A 53  ? 0.4084 0.3278 0.2957 -0.0432 -0.0247 -0.0229 53  GLU A CG  
394  C CD  . GLU A 53  ? 0.4316 0.3619 0.3351 -0.0457 -0.0301 -0.0171 53  GLU A CD  
395  O OE1 . GLU A 53  ? 0.4275 0.3615 0.3488 -0.0461 -0.0353 -0.0151 53  GLU A OE1 
396  O OE2 . GLU A 53  ? 0.4437 0.3788 0.3421 -0.0481 -0.0292 -0.0149 53  GLU A OE2 
397  N N   . THR A 54  ? 0.2850 0.2046 0.1782 -0.0196 -0.0100 -0.0340 54  THR A N   
398  C CA  . THR A 54  ? 0.2905 0.2151 0.1840 -0.0121 -0.0050 -0.0368 54  THR A CA  
399  C C   . THR A 54  ? 0.2679 0.2051 0.1774 -0.0093 -0.0052 -0.0344 54  THR A C   
400  O O   . THR A 54  ? 0.2730 0.2206 0.1868 -0.0074 -0.0027 -0.0343 54  THR A O   
401  C CB  . THR A 54  ? 0.3098 0.2228 0.1953 -0.0052 -0.0029 -0.0414 54  THR A CB  
402  O OG1 . THR A 54  ? 0.3342 0.2338 0.2044 -0.0080 -0.0028 -0.0442 54  THR A OG1 
403  C CG2 . THR A 54  ? 0.3049 0.2242 0.1943 0.0036  0.0013  -0.0451 54  THR A CG2 
404  N N   . ALA A 55  ? 0.2459 0.1827 0.1636 -0.0102 -0.0075 -0.0333 55  ALA A N   
405  C CA  . ALA A 55  ? 0.2270 0.1746 0.1588 -0.0084 -0.0072 -0.0320 55  ALA A CA  
406  C C   . ALA A 55  ? 0.2250 0.1834 0.1672 -0.0122 -0.0092 -0.0285 55  ALA A C   
407  O O   . ALA A 55  ? 0.2195 0.1879 0.1691 -0.0101 -0.0078 -0.0274 55  ALA A O   
408  C CB  . ALA A 55  ? 0.2104 0.1555 0.1479 -0.0112 -0.0087 -0.0327 55  ALA A CB  
409  N N   . LEU A 56  ? 0.2324 0.1882 0.1754 -0.0183 -0.0134 -0.0262 56  LEU A N   
410  C CA  . LEU A 56  ? 0.2341 0.1968 0.1859 -0.0231 -0.0179 -0.0217 56  LEU A CA  
411  C C   . LEU A 56  ? 0.2432 0.2093 0.1850 -0.0242 -0.0158 -0.0201 56  LEU A C   
412  O O   . LEU A 56  ? 0.2349 0.2099 0.1832 -0.0253 -0.0162 -0.0175 56  LEU A O   
413  C CB  . LEU A 56  ? 0.2405 0.1980 0.1946 -0.0295 -0.0245 -0.0193 56  LEU A CB  
414  C CG  . LEU A 56  ? 0.2423 0.2012 0.2128 -0.0298 -0.0266 -0.0215 56  LEU A CG  
415  C CD1 . LEU A 56  ? 0.2561 0.2094 0.2269 -0.0352 -0.0322 -0.0207 56  LEU A CD1 
416  C CD2 . LEU A 56  ? 0.2304 0.1985 0.2215 -0.0299 -0.0295 -0.0201 56  LEU A CD2 
417  N N   . ARG A 57  ? 0.2660 0.2256 0.1916 -0.0248 -0.0131 -0.0225 57  ARG A N   
418  C CA  . ARG A 57  ? 0.2899 0.2542 0.2052 -0.0268 -0.0094 -0.0232 57  ARG A CA  
419  C C   . ARG A 57  ? 0.2856 0.2602 0.2067 -0.0197 -0.0033 -0.0264 57  ARG A C   
420  O O   . ARG A 57  ? 0.2786 0.2633 0.2014 -0.0228 -0.0020 -0.0247 57  ARG A O   
421  C CB  . ARG A 57  ? 0.3197 0.2749 0.2170 -0.0286 -0.0064 -0.0272 57  ARG A CB  
422  C CG  . ARG A 57  ? 0.3559 0.3174 0.2424 -0.0310 -0.0001 -0.0307 57  ARG A CG  
423  C CD  . ARG A 57  ? 0.3969 0.3488 0.2658 -0.0328 0.0037  -0.0366 57  ARG A CD  
424  N NE  . ARG A 57  ? 0.4070 0.3498 0.2758 -0.0231 0.0065  -0.0425 57  ARG A NE  
425  C CZ  . ARG A 57  ? 0.4235 0.3697 0.2978 -0.0130 0.0121  -0.0486 57  ARG A CZ  
426  N NH1 . ARG A 57  ? 0.4229 0.3837 0.3044 -0.0108 0.0167  -0.0507 57  ARG A NH1 
427  N NH2 . ARG A 57  ? 0.4199 0.3543 0.2925 -0.0055 0.0123  -0.0526 57  ARG A NH2 
428  N N   . ALA A 58  ? 0.2823 0.2543 0.2064 -0.0112 -0.0004 -0.0305 58  ALA A N   
429  C CA  . ALA A 58  ? 0.2750 0.2569 0.2059 -0.0043 0.0039  -0.0332 58  ALA A CA  
430  C C   . ALA A 58  ? 0.2617 0.2547 0.2062 -0.0063 0.0016  -0.0287 58  ALA A C   
431  O O   . ALA A 58  ? 0.2652 0.2701 0.2143 -0.0053 0.0045  -0.0290 58  ALA A O   
432  C CB  . ALA A 58  ? 0.2728 0.2476 0.2041 0.0041  0.0047  -0.0368 58  ALA A CB  
433  N N   . THR A 59  ? 0.2514 0.2409 0.2031 -0.0094 -0.0032 -0.0252 59  THR A N   
434  C CA  . THR A 59  ? 0.2450 0.2433 0.2100 -0.0118 -0.0056 -0.0218 59  THR A CA  
435  C C   . THR A 59  ? 0.2614 0.2658 0.2256 -0.0188 -0.0076 -0.0175 59  THR A C   
436  O O   . THR A 59  ? 0.2554 0.2696 0.2260 -0.0195 -0.0068 -0.0159 59  THR A O   
437  C CB  . THR A 59  ? 0.2366 0.2305 0.2119 -0.0134 -0.0097 -0.0210 59  THR A CB  
438  O OG1 . THR A 59  ? 0.2312 0.2201 0.2042 -0.0088 -0.0072 -0.0248 59  THR A OG1 
439  C CG2 . THR A 59  ? 0.2195 0.2218 0.2099 -0.0152 -0.0116 -0.0190 59  THR A CG2 
440  N N   . GLN A 60  ? 0.2741 0.2722 0.2289 -0.0251 -0.0108 -0.0151 60  GLN A N   
441  C CA  . GLN A 60  ? 0.3006 0.3026 0.2496 -0.0339 -0.0132 -0.0105 60  GLN A CA  
442  C C   . GLN A 60  ? 0.3066 0.3191 0.2477 -0.0334 -0.0052 -0.0142 60  GLN A C   
443  O O   . GLN A 60  ? 0.3053 0.3272 0.2483 -0.0382 -0.0050 -0.0115 60  GLN A O   
444  C CB  . GLN A 60  ? 0.3223 0.3143 0.2604 -0.0417 -0.0188 -0.0071 60  GLN A CB  
445  C CG  . GLN A 60  ? 0.3710 0.3650 0.2966 -0.0532 -0.0212 -0.0023 60  GLN A CG  
446  C CD  . GLN A 60  ? 0.3988 0.3959 0.3069 -0.0545 -0.0121 -0.0085 60  GLN A CD  
447  O OE1 . GLN A 60  ? 0.4077 0.3970 0.3058 -0.0532 -0.0098 -0.0126 60  GLN A OE1 
448  N NE2 . GLN A 60  ? 0.4042 0.4132 0.3095 -0.0569 -0.0062 -0.0103 60  GLN A NE2 
449  N N   . GLU A 61  ? 0.3106 0.3219 0.2442 -0.0276 0.0013  -0.0211 61  GLU A N   
450  C CA  . GLU A 61  ? 0.3419 0.3643 0.2708 -0.0260 0.0097  -0.0270 61  GLU A CA  
451  C C   . GLU A 61  ? 0.3140 0.3494 0.2566 -0.0192 0.0129  -0.0289 61  GLU A C   
452  O O   . GLU A 61  ? 0.3247 0.3734 0.2680 -0.0223 0.0170  -0.0301 61  GLU A O   
453  C CB  . GLU A 61  ? 0.3753 0.3914 0.2953 -0.0203 0.0151  -0.0350 61  GLU A CB  
454  C CG  . GLU A 61  ? 0.4222 0.4268 0.3258 -0.0283 0.0134  -0.0345 61  GLU A CG  
455  C CD  . GLU A 61  ? 0.4723 0.4689 0.3675 -0.0222 0.0187  -0.0431 61  GLU A CD  
456  O OE1 . GLU A 61  ? 0.4924 0.4908 0.3955 -0.0111 0.0226  -0.0490 61  GLU A OE1 
457  O OE2 . GLU A 61  ? 0.5066 0.4940 0.3871 -0.0288 0.0183  -0.0439 61  GLU A OE2 
458  N N   . GLU A 62  ? 0.2894 0.3214 0.2419 -0.0109 0.0110  -0.0291 62  GLU A N   
459  C CA  . GLU A 62  ? 0.2820 0.3255 0.2464 -0.0045 0.0134  -0.0308 62  GLU A CA  
460  C C   . GLU A 62  ? 0.2574 0.3076 0.2308 -0.0095 0.0098  -0.0250 62  GLU A C   
461  O O   . GLU A 62  ? 0.2598 0.3233 0.2403 -0.0086 0.0122  -0.0256 62  GLU A O   
462  C CB  . GLU A 62  ? 0.2806 0.3164 0.2488 0.0051  0.0124  -0.0334 62  GLU A CB  
463  C CG  . GLU A 62  ? 0.3299 0.3573 0.2898 0.0107  0.0153  -0.0395 62  GLU A CG  
464  C CD  . GLU A 62  ? 0.3702 0.4096 0.3312 0.0140  0.0221  -0.0464 62  GLU A CD  
465  O OE1 . GLU A 62  ? 0.4356 0.4708 0.3869 0.0130  0.0259  -0.0515 62  GLU A OE1 
466  O OE2 . GLU A 62  ? 0.3694 0.4234 0.3413 0.0168  0.0240  -0.0474 62  GLU A OE2 
467  N N   . ALA A 63  ? 0.2465 0.2877 0.2212 -0.0146 0.0036  -0.0199 63  ALA A N   
468  C CA  . ALA A 63  ? 0.2264 0.2713 0.2121 -0.0181 -0.0003 -0.0154 63  ALA A CA  
469  C C   . ALA A 63  ? 0.2315 0.2742 0.2152 -0.0283 -0.0058 -0.0094 63  ALA A C   
470  O O   . ALA A 63  ? 0.2230 0.2680 0.2157 -0.0318 -0.0096 -0.0058 63  ALA A O   
471  C CB  . ALA A 63  ? 0.1979 0.2352 0.1922 -0.0145 -0.0033 -0.0160 63  ALA A CB  
472  N N   . GLY A 64  ? 0.2453 0.2822 0.2169 -0.0337 -0.0071 -0.0080 64  GLY A N   
473  C CA  . GLY A 64  ? 0.2598 0.2921 0.2274 -0.0446 -0.0144 -0.0009 64  GLY A CA  
474  C C   . GLY A 64  ? 0.2671 0.2883 0.2455 -0.0456 -0.0238 0.0031  64  GLY A C   
475  O O   . GLY A 64  ? 0.2827 0.2994 0.2630 -0.0536 -0.0323 0.0099  64  GLY A O   
476  N N   . ILE A 65  ? 0.2498 0.2663 0.2358 -0.0379 -0.0229 -0.0010 65  ILE A N   
477  C CA  . ILE A 65  ? 0.2436 0.2521 0.2431 -0.0380 -0.0302 0.0004  65  ILE A CA  
478  C C   . ILE A 65  ? 0.2770 0.2759 0.2695 -0.0402 -0.0341 0.0012  65  ILE A C   
479  O O   . ILE A 65  ? 0.2477 0.2438 0.2328 -0.0358 -0.0292 -0.0033 65  ILE A O   
480  C CB  . ILE A 65  ? 0.2288 0.2392 0.2409 -0.0306 -0.0264 -0.0054 65  ILE A CB  
481  C CG1 . ILE A 65  ? 0.2208 0.2409 0.2386 -0.0289 -0.0226 -0.0064 65  ILE A CG1 
482  C CG2 . ILE A 65  ? 0.2176 0.2225 0.2465 -0.0315 -0.0329 -0.0058 65  ILE A CG2 
483  C CD1 . ILE A 65  ? 0.1982 0.2209 0.2228 -0.0230 -0.0177 -0.0122 65  ILE A CD1 
484  N N   . GLU A 66  ? 0.3049 0.2981 0.3006 -0.0467 -0.0434 0.0070  66  GLU A N   
485  C CA  . GLU A 66  ? 0.3452 0.3293 0.3349 -0.0514 -0.0502 0.0101  66  GLU A CA  
486  C C   . GLU A 66  ? 0.3167 0.2969 0.3236 -0.0470 -0.0538 0.0068  66  GLU A C   
487  O O   . GLU A 66  ? 0.2722 0.2562 0.2970 -0.0423 -0.0527 0.0031  66  GLU A O   
488  C CB  . GLU A 66  ? 0.4206 0.4002 0.4059 -0.0621 -0.0609 0.0195  66  GLU A CB  
489  C CG  . GLU A 66  ? 0.5472 0.5324 0.5120 -0.0682 -0.0549 0.0209  66  GLU A CG  
490  C CD  . GLU A 66  ? 0.6687 0.6498 0.6254 -0.0811 -0.0648 0.0306  66  GLU A CD  
491  O OE1 . GLU A 66  ? 0.7585 0.7318 0.7286 -0.0840 -0.0777 0.0370  66  GLU A OE1 
492  O OE2 . GLU A 66  ? 0.7546 0.7402 0.6919 -0.0890 -0.0600 0.0315  66  GLU A OE2 
493  N N   . ALA A 67  ? 0.3130 0.2866 0.3135 -0.0491 -0.0568 0.0071  67  ALA A N   
494  C CA  . ALA A 67  ? 0.3079 0.2796 0.3232 -0.0456 -0.0584 0.0026  67  ALA A CA  
495  C C   . ALA A 67  ? 0.2998 0.2723 0.3419 -0.0459 -0.0679 0.0039  67  ALA A C   
496  O O   . ALA A 67  ? 0.2917 0.2682 0.3516 -0.0412 -0.0649 -0.0029 67  ALA A O   
497  C CB  . ALA A 67  ? 0.3227 0.2873 0.3255 -0.0492 -0.0608 0.0033  67  ALA A CB  
498  N N   . GLY A 68  ? 0.3027 0.2713 0.3478 -0.0518 -0.0789 0.0122  68  GLY A N   
499  C CA  . GLY A 68  ? 0.3153 0.2830 0.3877 -0.0515 -0.0895 0.0138  68  GLY A CA  
500  C C   . GLY A 68  ? 0.3094 0.2835 0.3970 -0.0462 -0.0839 0.0084  68  GLY A C   
501  O O   . GLY A 68  ? 0.3205 0.2949 0.4339 -0.0440 -0.0898 0.0059  68  GLY A O   
502  N N   . GLN A 69  ? 0.2928 0.2722 0.3655 -0.0442 -0.0728 0.0061  69  GLN A N   
503  C CA  . GLN A 69  ? 0.3062 0.2919 0.3902 -0.0405 -0.0674 0.0016  69  GLN A CA  
504  C C   . GLN A 69  ? 0.2924 0.2843 0.3825 -0.0345 -0.0566 -0.0089 69  GLN A C   
505  O O   . GLN A 69  ? 0.2977 0.2949 0.3949 -0.0322 -0.0515 -0.0131 69  GLN A O   
506  C CB  . GLN A 69  ? 0.3196 0.3088 0.3856 -0.0429 -0.0628 0.0057  69  GLN A CB  
507  C CG  . GLN A 69  ? 0.3719 0.3555 0.4305 -0.0513 -0.0729 0.0161  69  GLN A CG  
508  C CD  . GLN A 69  ? 0.3961 0.3850 0.4336 -0.0556 -0.0670 0.0194  69  GLN A CD  
509  O OE1 . GLN A 69  ? 0.3590 0.3528 0.3798 -0.0540 -0.0576 0.0164  69  GLN A OE1 
510  N NE2 . GLN A 69  ? 0.4378 0.4254 0.4770 -0.0617 -0.0731 0.0255  69  GLN A NE2 
511  N N   . LEU A 70  ? 0.2996 0.3064 0.3194 0.0006  -0.0203 0.0180  70  LEU A N   
512  C CA  . LEU A 70  ? 0.3111 0.3230 0.3360 0.0033  -0.0168 0.0155  70  LEU A CA  
513  C C   . LEU A 70  ? 0.3072 0.3278 0.3435 0.0055  -0.0187 0.0206  70  LEU A C   
514  O O   . LEU A 70  ? 0.2978 0.3219 0.3371 0.0031  -0.0239 0.0260  70  LEU A O   
515  C CB  . LEU A 70  ? 0.3226 0.3334 0.3405 -0.0013 -0.0167 0.0127  70  LEU A CB  
516  C CG  . LEU A 70  ? 0.3430 0.3478 0.3513 -0.0032 -0.0137 0.0075  70  LEU A CG  
517  C CD1 . LEU A 70  ? 0.3359 0.3382 0.3373 -0.0071 -0.0130 0.0059  70  LEU A CD1 
518  C CD2 . LEU A 70  ? 0.3643 0.3706 0.3757 0.0018  -0.0092 0.0038  70  LEU A CD2 
519  N N   . THR A 71  ? 0.2861 0.3104 0.3284 0.0095  -0.0146 0.0190  71  THR A N   
520  C CA  . THR A 71  ? 0.3105 0.3441 0.3634 0.0103  -0.0157 0.0232  71  THR A CA  
521  C C   . THR A 71  ? 0.2809 0.3148 0.3314 0.0095  -0.0122 0.0192  71  THR A C   
522  O O   . THR A 71  ? 0.2595 0.2899 0.3083 0.0134  -0.0074 0.0151  71  THR A O   
523  C CB  . THR A 71  ? 0.3140 0.3517 0.3788 0.0174  -0.0131 0.0266  71  THR A CB  
524  O OG1 . THR A 71  ? 0.3528 0.3885 0.4185 0.0188  -0.0161 0.0307  71  THR A OG1 
525  C CG2 . THR A 71  ? 0.3312 0.3808 0.4089 0.0180  -0.0136 0.0313  71  THR A CG2 
526  N N   . ILE A 72  ? 0.2712 0.3080 0.3200 0.0041  -0.0149 0.0205  72  ILE A N   
527  C CA  . ILE A 72  ? 0.2764 0.3128 0.3224 0.0029  -0.0118 0.0177  72  ILE A CA  
528  C C   . ILE A 72  ? 0.2694 0.3128 0.3269 0.0073  -0.0085 0.0193  72  ILE A C   
529  O O   . ILE A 72  ? 0.2642 0.3167 0.3333 0.0080  -0.0104 0.0246  72  ILE A O   
530  C CB  . ILE A 72  ? 0.3097 0.3462 0.3497 -0.0051 -0.0152 0.0192  72  ILE A CB  
531  C CG1 . ILE A 72  ? 0.3348 0.3628 0.3621 -0.0101 -0.0178 0.0179  72  ILE A CG1 
532  C CG2 . ILE A 72  ? 0.3077 0.3405 0.3419 -0.0060 -0.0111 0.0158  72  ILE A CG2 
533  C CD1 . ILE A 72  ? 0.3314 0.3499 0.3483 -0.0079 -0.0131 0.0119  72  ILE A CD1 
534  N N   . ILE A 73  ? 0.2519 0.2910 0.3060 0.0105  -0.0033 0.0150  73  ILE A N   
535  C CA  . ILE A 73  ? 0.2442 0.2876 0.3068 0.0144  0.0010  0.0156  73  ILE A CA  
536  C C   . ILE A 73  ? 0.2560 0.3014 0.3169 0.0100  0.0015  0.0156  73  ILE A C   
537  O O   . ILE A 73  ? 0.2500 0.2880 0.2999 0.0083  0.0030  0.0118  73  ILE A O   
538  C CB  . ILE A 73  ? 0.2348 0.2710 0.2931 0.0197  0.0062  0.0112  73  ILE A CB  
539  C CG1 . ILE A 73  ? 0.2266 0.2588 0.2831 0.0223  0.0055  0.0104  73  ILE A CG1 
540  C CG2 . ILE A 73  ? 0.2216 0.2605 0.2877 0.0235  0.0115  0.0119  73  ILE A CG2 
541  C CD1 . ILE A 73  ? 0.2208 0.2573 0.2877 0.0253  0.0050  0.0153  73  ILE A CD1 
542  N N   . GLU A 74  ? 0.2596 0.3153 0.3313 0.0078  0.0004  0.0202  74  GLU A N   
543  C CA  . GLU A 74  ? 0.2708 0.3281 0.3396 0.0017  0.0005  0.0203  74  GLU A CA  
544  C C   . GLU A 74  ? 0.2560 0.3090 0.3224 0.0046  0.0072  0.0168  74  GLU A C   
545  O O   . GLU A 74  ? 0.2478 0.3016 0.3207 0.0107  0.0116  0.0163  74  GLU A O   
546  C CB  . GLU A 74  ? 0.3140 0.3860 0.3963 -0.0023 -0.0029 0.0267  74  GLU A CB  
547  C CG  . GLU A 74  ? 0.3443 0.4232 0.4330 -0.0035 -0.0097 0.0319  74  GLU A CG  
548  C CD  . GLU A 74  ? 0.3607 0.4341 0.4363 -0.0120 -0.0156 0.0317  74  GLU A CD  
549  O OE1 . GLU A 74  ? 0.3520 0.4125 0.4137 -0.0117 -0.0145 0.0269  74  GLU A OE1 
550  O OE2 . GLU A 74  ? 0.3746 0.4569 0.4540 -0.0193 -0.0212 0.0367  74  GLU A OE2 
551  N N   . GLY A 75  ? 0.2507 0.2973 0.3062 0.0000  0.0082  0.0143  75  GLY A N   
552  C CA  . GLY A 75  ? 0.2359 0.2774 0.2875 0.0018  0.0142  0.0114  75  GLY A CA  
553  C C   . GLY A 75  ? 0.2400 0.2681 0.2771 0.0050  0.0166  0.0064  75  GLY A C   
554  O O   . GLY A 75  ? 0.2441 0.2661 0.2751 0.0058  0.0209  0.0041  75  GLY A O   
555  N N   . PHE A 76  ? 0.2144 0.2382 0.2460 0.0067  0.0138  0.0049  76  PHE A N   
556  C CA  . PHE A 76  ? 0.2218 0.2354 0.2414 0.0099  0.0155  0.0010  76  PHE A CA  
557  C C   . PHE A 76  ? 0.2274 0.2346 0.2364 0.0068  0.0132  0.0002  76  PHE A C   
558  O O   . PHE A 76  ? 0.2322 0.2417 0.2426 0.0046  0.0098  0.0014  76  PHE A O   
559  C CB  . PHE A 76  ? 0.2058 0.2198 0.2282 0.0155  0.0156  -0.0004 76  PHE A CB  
560  C CG  . PHE A 76  ? 0.2077 0.2142 0.2199 0.0187  0.0166  -0.0037 76  PHE A CG  
561  C CD1 . PHE A 76  ? 0.2155 0.2174 0.2233 0.0216  0.0199  -0.0054 76  PHE A CD1 
562  C CD2 . PHE A 76  ? 0.2016 0.2061 0.2089 0.0190  0.0143  -0.0047 76  PHE A CD2 
563  C CE1 . PHE A 76  ? 0.2210 0.2177 0.2204 0.0248  0.0199  -0.0076 76  PHE A CE1 
564  C CE2 . PHE A 76  ? 0.2150 0.2152 0.2152 0.0226  0.0151  -0.0069 76  PHE A CE2 
565  C CZ  . PHE A 76  ? 0.2257 0.2226 0.2224 0.0256  0.0174  -0.0081 76  PHE A CZ  
566  N N   . LYS A 77  ? 0.2344 0.2321 0.2316 0.0070  0.0158  -0.0018 77  LYS A N   
567  C CA  . LYS A 77  ? 0.2575 0.2467 0.2433 0.0061  0.0155  -0.0030 77  LYS A CA  
568  C C   . LYS A 77  ? 0.2533 0.2334 0.2293 0.0110  0.0190  -0.0053 77  LYS A C   
569  O O   . LYS A 77  ? 0.2594 0.2370 0.2335 0.0119  0.0215  -0.0057 77  LYS A O   
570  C CB  . LYS A 77  ? 0.2816 0.2668 0.2606 -0.0020 0.0148  -0.0016 77  LYS A CB  
571  C CG  . LYS A 77  ? 0.3265 0.2991 0.2907 -0.0025 0.0165  -0.0032 77  LYS A CG  
572  C CD  . LYS A 77  ? 0.3547 0.3235 0.3121 -0.0114 0.0145  -0.0018 77  LYS A CD  
573  C CE  . LYS A 77  ? 0.3905 0.3551 0.3412 -0.0188 0.0156  -0.0009 77  LYS A CE  
574  N NZ  . LYS A 77  ? 0.4243 0.3735 0.3565 -0.0249 0.0174  -0.0017 77  LYS A NZ  
575  N N   . ARG A 78  ? 0.2599 0.2357 0.2303 0.0147  0.0192  -0.0066 78  ARG A N   
576  C CA  . ARG A 78  ? 0.2853 0.2544 0.2481 0.0206  0.0218  -0.0079 78  ARG A CA  
577  C C   . ARG A 78  ? 0.3088 0.2697 0.2620 0.0221  0.0235  -0.0083 78  ARG A C   
578  O O   . ARG A 78  ? 0.2878 0.2522 0.2442 0.0223  0.0223  -0.0085 78  ARG A O   
579  C CB  . ARG A 78  ? 0.3093 0.2864 0.2801 0.0259  0.0203  -0.0085 78  ARG A CB  
580  C CG  . ARG A 78  ? 0.3523 0.3258 0.3174 0.0323  0.0213  -0.0091 78  ARG A CG  
581  C CD  . ARG A 78  ? 0.4235 0.3878 0.3794 0.0333  0.0240  -0.0090 78  ARG A CD  
582  N NE  . ARG A 78  ? 0.5042 0.4637 0.4530 0.0396  0.0247  -0.0086 78  ARG A NE  
583  C CZ  . ARG A 78  ? 0.5280 0.4865 0.4737 0.0444  0.0241  -0.0082 78  ARG A CZ  
584  N NH1 . ARG A 78  ? 0.5032 0.4620 0.4491 0.0431  0.0238  -0.0087 78  ARG A NH1 
585  N NH2 . ARG A 78  ? 0.5063 0.4625 0.4475 0.0507  0.0244  -0.0069 78  ARG A NH2 
586  N N   . GLU A 79  ? 0.3384 0.2869 0.2790 0.0228  0.0271  -0.0084 79  GLU A N   
587  C CA  . GLU A 79  ? 0.3662 0.3044 0.2963 0.0253  0.0304  -0.0087 79  GLU A CA  
588  C C   . GLU A 79  ? 0.3848 0.3219 0.3134 0.0349  0.0319  -0.0085 79  GLU A C   
589  O O   . GLU A 79  ? 0.3772 0.3111 0.3024 0.0376  0.0324  -0.0081 79  GLU A O   
590  C CB  . GLU A 79  ? 0.4308 0.3534 0.3454 0.0199  0.0340  -0.0087 79  GLU A CB  
591  C CG  . GLU A 79  ? 0.4953 0.4033 0.3962 0.0241  0.0392  -0.0089 79  GLU A CG  
592  C CD  . GLU A 79  ? 0.5660 0.4563 0.4490 0.0168  0.0432  -0.0093 79  GLU A CD  
593  O OE1 . GLU A 79  ? 0.6167 0.5091 0.5000 0.0068  0.0408  -0.0092 79  GLU A OE1 
594  O OE2 . GLU A 79  ? 0.6474 0.5213 0.5156 0.0208  0.0490  -0.0094 79  GLU A OE2 
595  N N   . LEU A 80  ? 0.3767 0.3172 0.3083 0.0399  0.0325  -0.0084 80  LEU A N   
596  C CA  . LEU A 80  ? 0.3815 0.3235 0.3135 0.0493  0.0335  -0.0073 80  LEU A CA  
597  C C   . LEU A 80  ? 0.4253 0.3531 0.3450 0.0536  0.0395  -0.0065 80  LEU A C   
598  O O   . LEU A 80  ? 0.4015 0.3242 0.3175 0.0508  0.0424  -0.0073 80  LEU A O   
599  C CB  . LEU A 80  ? 0.3704 0.3286 0.3163 0.0519  0.0302  -0.0073 80  LEU A CB  
600  C CG  . LEU A 80  ? 0.3612 0.3328 0.3183 0.0505  0.0250  -0.0077 80  LEU A CG  
601  C CD1 . LEU A 80  ? 0.3458 0.3200 0.3073 0.0427  0.0229  -0.0089 80  LEU A CD1 
602  C CD2 . LEU A 80  ? 0.3678 0.3530 0.3352 0.0538  0.0227  -0.0075 80  LEU A CD2 
603  N N   . ASN A 81  ? 0.4602 0.3799 0.3721 0.0604  0.0418  -0.0050 81  ASN A N   
604  C CA  . ASN A 81  ? 0.5314 0.4371 0.4319 0.0670  0.0483  -0.0036 81  ASN A CA  
605  C C   . ASN A 81  ? 0.5607 0.4746 0.4677 0.0783  0.0474  -0.0008 81  ASN A C   
606  O O   . ASN A 81  ? 0.5202 0.4366 0.4275 0.0811  0.0440  0.0005  81  ASN A O   
607  C CB  . ASN A 81  ? 0.5595 0.4433 0.4406 0.0648  0.0530  -0.0037 81  ASN A CB  
608  C CG  . ASN A 81  ? 0.5759 0.4534 0.4507 0.0522  0.0529  -0.0060 81  ASN A CG  
609  O OD1 . ASN A 81  ? 0.5827 0.4502 0.4489 0.0475  0.0566  -0.0070 81  ASN A OD1 
610  N ND2 . ASN A 81  ? 0.6058 0.4901 0.4856 0.0465  0.0485  -0.0067 81  ASN A ND2 
611  N N   . TYR A 82  ? 0.5405 0.4591 0.4529 0.0845  0.0502  0.0003  82  TYR A N   
612  C CA  . TYR A 82  ? 0.5728 0.5025 0.4940 0.0955  0.0491  0.0038  82  TYR A CA  
613  C C   . TYR A 82  ? 0.6182 0.5447 0.5393 0.1035  0.0562  0.0055  82  TYR A C   
614  O O   . TYR A 82  ? 0.5877 0.5052 0.5032 0.0994  0.0615  0.0033  82  TYR A O   
615  C CB  . TYR A 82  ? 0.5375 0.4908 0.4765 0.0937  0.0413  0.0037  82  TYR A CB  
616  C CG  . TYR A 82  ? 0.5234 0.4871 0.4722 0.0874  0.0406  0.0011  82  TYR A CG  
617  C CD1 . TYR A 82  ? 0.5035 0.4655 0.4514 0.0769  0.0383  -0.0020 82  TYR A CD1 
618  C CD2 . TYR A 82  ? 0.5186 0.4940 0.4778 0.0920  0.0423  0.0022  82  TYR A CD2 
619  C CE1 . TYR A 82  ? 0.4654 0.4354 0.4209 0.0713  0.0374  -0.0040 82  TYR A CE1 
620  C CE2 . TYR A 82  ? 0.5083 0.4917 0.4750 0.0857  0.0419  -0.0003 82  TYR A CE2 
621  C CZ  . TYR A 82  ? 0.4987 0.4786 0.4627 0.0755  0.0392  -0.0033 82  TYR A CZ  
622  O OH  . TYR A 82  ? 0.5012 0.4877 0.4713 0.0695  0.0386  -0.0054 82  TYR A OH  
623  N N   . VAL A 83  ? 0.6610 0.5950 0.5882 0.1150  0.0563  0.0098  83  VAL A N   
624  C CA  . VAL A 83  ? 0.7119 0.6456 0.6418 0.1247  0.0634  0.0123  83  VAL A CA  
625  C C   . VAL A 83  ? 0.7251 0.6860 0.6770 0.1271  0.0593  0.0136  83  VAL A C   
626  O O   . VAL A 83  ? 0.7598 0.7383 0.7230 0.1291  0.0516  0.0160  83  VAL A O   
627  C CB  . VAL A 83  ? 0.7457 0.6677 0.6668 0.1374  0.0676  0.0172  83  VAL A CB  
628  C CG1 . VAL A 83  ? 0.7296 0.6539 0.6566 0.1492  0.0754  0.0205  83  VAL A CG1 
629  C CG2 . VAL A 83  ? 0.7360 0.6288 0.6331 0.1338  0.0724  0.0155  83  VAL A CG2 
630  N N   . ALA A 84  ? 0.7482 0.7121 0.7051 0.1256  0.0644  0.0118  84  ALA A N   
631  C CA  . ALA A 84  ? 0.7338 0.7227 0.7108 0.1276  0.0619  0.0130  84  ALA A CA  
632  C C   . ALA A 84  ? 0.7775 0.7648 0.7574 0.1372  0.0720  0.0152  84  ALA A C   
633  O O   . ALA A 84  ? 0.7916 0.7618 0.7604 0.1342  0.0803  0.0123  84  ALA A O   
634  C CB  . ALA A 84  ? 0.6523 0.6493 0.6347 0.1151  0.0579  0.0083  84  ALA A CB  
635  N N   . ARG A 85  ? 0.7956 0.8008 0.7902 0.1484  0.0713  0.0206  85  ARG A N   
636  C CA  . ARG A 85  ? 0.8011 0.8091 0.8026 0.1596  0.0811  0.0238  85  ARG A CA  
637  C C   . ARG A 85  ? 0.8034 0.7814 0.7846 0.1667  0.0918  0.0246  85  ARG A C   
638  O O   . ARG A 85  ? 0.8084 0.7726 0.7826 0.1685  0.1029  0.0231  85  ARG A O   
639  C CB  . ARG A 85  ? 0.8162 0.8314 0.8252 0.1532  0.0856  0.0200  85  ARG A CB  
640  C CG  . ARG A 85  ? 0.8528 0.8955 0.8800 0.1452  0.0762  0.0187  85  ARG A CG  
641  C CD  . ARG A 85  ? 0.8913 0.9358 0.9213 0.1374  0.0812  0.0144  85  ARG A CD  
642  N NE  . ARG A 85  ? 0.9286 0.9795 0.9681 0.1468  0.0915  0.0169  85  ARG A NE  
643  C CZ  . ARG A 85  ? 0.9584 1.0121 1.0017 0.1422  0.0977  0.0140  85  ARG A CZ  
644  N NH1 . ARG A 85  ? 0.9474 0.9978 0.9855 0.1283  0.0941  0.0085  85  ARG A NH1 
645  N NH2 . ARG A 85  ? 0.9550 1.0148 1.0075 0.1519  0.1080  0.0167  85  ARG A NH2 
646  N N   . ASN A 86  ? 0.8252 0.7913 0.7950 0.1699  0.0885  0.0267  86  ASN A N   
647  C CA  . ASN A 86  ? 0.8311 0.7666 0.7788 0.1759  0.0976  0.0277  86  ASN A CA  
648  C C   . ASN A 86  ? 0.7865 0.6949 0.7128 0.1644  0.1042  0.0214  86  ASN A C   
649  O O   . ASN A 86  ? 0.8020 0.6832 0.7086 0.1682  0.1144  0.0214  86  ASN A O   
650  C CB  . ASN A 86  ? 0.9104 0.8454 0.8630 0.1934  0.1074  0.0337  86  ASN A CB  
651  C CG  . ASN A 86  ? 0.9515 0.9183 0.9288 0.2039  0.1000  0.0406  86  ASN A CG  
652  O OD1 . ASN A 86  ? 1.0269 0.9917 1.0039 0.2175  0.1013  0.0471  86  ASN A OD1 
653  N ND2 . ASN A 86  ? 0.9429 0.9387 0.9409 0.1975  0.0922  0.0395  86  ASN A ND2 
654  N N   . LYS A 87  ? 0.7268 0.6423 0.6561 0.1502  0.0983  0.0163  87  LYS A N   
655  C CA  . LYS A 87  ? 0.7013 0.5947 0.6119 0.1376  0.1022  0.0108  87  LYS A CA  
656  C C   . LYS A 87  ? 0.6503 0.5424 0.5555 0.1250  0.0926  0.0077  87  LYS A C   
657  O O   . LYS A 87  ? 0.6161 0.5297 0.5365 0.1218  0.0827  0.0078  87  LYS A O   
658  C CB  . LYS A 87  ? 0.7114 0.6105 0.6279 0.1319  0.1060  0.0077  87  LYS A CB  
659  C CG  . LYS A 87  ? 0.7493 0.6455 0.6684 0.1430  0.1180  0.0100  87  LYS A CG  
660  C CD  . LYS A 87  ? 0.7680 0.6621 0.6861 0.1350  0.1234  0.0059  87  LYS A CD  
661  C CE  . LYS A 87  ? 0.7552 0.6690 0.6859 0.1227  0.1128  0.0027  87  LYS A CE  
662  N NZ  . LYS A 87  ? 0.7603 0.7061 0.7159 0.1270  0.1035  0.0055  87  LYS A NZ  
663  N N   . PRO A 88  ? 0.6310 0.4976 0.5140 0.1175  0.0961  0.0052  88  PRO A N   
664  C CA  . PRO A 88  ? 0.6019 0.4677 0.4805 0.1058  0.0880  0.0026  88  PRO A CA  
665  C C   . PRO A 88  ? 0.5673 0.4440 0.4534 0.0932  0.0828  -0.0010 88  PRO A C   
666  O O   . PRO A 88  ? 0.5884 0.4576 0.4691 0.0887  0.0880  -0.0030 88  PRO A O   
667  C CB  . PRO A 88  ? 0.6350 0.4703 0.4874 0.1018  0.0946  0.0015  88  PRO A CB  
668  C CG  . PRO A 88  ? 0.6845 0.5019 0.5253 0.1075  0.1067  0.0018  88  PRO A CG  
669  C CD  . PRO A 88  ? 0.6683 0.5056 0.5291 0.1195  0.1082  0.0048  88  PRO A CD  
670  N N   . LYS A 89  ? 0.5120 0.4049 0.4095 0.0880  0.0731  -0.0016 89  LYS A N   
671  C CA  . LYS A 89  ? 0.4877 0.3912 0.3928 0.0768  0.0673  -0.0044 89  LYS A CA  
672  C C   . LYS A 89  ? 0.4577 0.3573 0.3574 0.0678  0.0619  -0.0057 89  LYS A C   
673  O O   . LYS A 89  ? 0.4415 0.3418 0.3409 0.0708  0.0592  -0.0044 89  LYS A O   
674  C CB  . LYS A 89  ? 0.4847 0.4143 0.4115 0.0793  0.0609  -0.0038 89  LYS A CB  
675  C CG  . LYS A 89  ? 0.5062 0.4465 0.4435 0.0895  0.0648  -0.0016 89  LYS A CG  
676  C CD  . LYS A 89  ? 0.5279 0.4627 0.4624 0.0872  0.0716  -0.0033 89  LYS A CD  
677  C CE  . LYS A 89  ? 0.5666 0.5096 0.5103 0.0988  0.0778  -0.0006 89  LYS A CE  
679  N N   . THR A 90  ? 0.4289 0.3247 0.3244 0.0566  0.0604  -0.0079 90  THR A N   
680  C CA  . THR A 90  ? 0.4142 0.3121 0.3098 0.0477  0.0545  -0.0088 90  THR A CA  
681  C C   . THR A 90  ? 0.3802 0.2923 0.2878 0.0410  0.0490  -0.0099 90  THR A C   
682  O O   . THR A 90  ? 0.3963 0.3044 0.3003 0.0370  0.0513  -0.0108 90  THR A O   
683  C CB  . THR A 90  ? 0.4309 0.3083 0.3071 0.0393  0.0579  -0.0096 90  THR A CB  
684  O OG1 . THR A 90  ? 0.4740 0.3350 0.3364 0.0457  0.0640  -0.0086 90  THR A OG1 
685  C CG2 . THR A 90  ? 0.4083 0.2914 0.2877 0.0305  0.0517  -0.0099 90  THR A CG2 
686  N N   . VAL A 91  ? 0.3409 0.2679 0.2613 0.0399  0.0424  -0.0096 91  VAL A N   
687  C CA  . VAL A 91  ? 0.3132 0.2521 0.2441 0.0337  0.0373  -0.0103 91  VAL A CA  
688  C C   . VAL A 91  ? 0.2991 0.2413 0.2328 0.0281  0.0326  -0.0100 91  VAL A C   
689  O O   . VAL A 91  ? 0.2869 0.2310 0.2224 0.0314  0.0318  -0.0095 91  VAL A O   
690  C CB  . VAL A 91  ? 0.3113 0.2671 0.2573 0.0386  0.0343  -0.0103 91  VAL A CB  
691  C CG1 . VAL A 91  ? 0.2937 0.2576 0.2470 0.0318  0.0302  -0.0111 91  VAL A CG1 
692  C CG2 . VAL A 91  ? 0.3394 0.2956 0.2858 0.0459  0.0391  -0.0100 91  VAL A CG2 
693  N N   . ILE A 92  ? 0.2815 0.2243 0.2153 0.0195  0.0299  -0.0099 92  ILE A N   
694  C CA  . ILE A 92  ? 0.2692 0.2178 0.2086 0.0143  0.0256  -0.0090 92  ILE A CA  
695  C C   . ILE A 92  ? 0.2336 0.1964 0.1872 0.0134  0.0207  -0.0086 92  ILE A C   
696  O O   . ILE A 92  ? 0.2208 0.1843 0.1745 0.0103  0.0197  -0.0086 92  ILE A O   
697  C CB  . ILE A 92  ? 0.2939 0.2339 0.2236 0.0046  0.0253  -0.0082 92  ILE A CB  
698  C CG1 . ILE A 92  ? 0.3360 0.2576 0.2473 0.0037  0.0312  -0.0090 92  ILE A CG1 
699  C CG2 . ILE A 92  ? 0.2798 0.2280 0.2173 0.0001  0.0215  -0.0067 92  ILE A CG2 
700  C CD1 . ILE A 92  ? 0.3707 0.2879 0.2785 0.0085  0.0338  -0.0091 92  ILE A CD1 
701  N N   . TYR A 93  ? 0.2040 0.1761 0.1677 0.0157  0.0183  -0.0082 93  TYR A N   
702  C CA  . TYR A 93  ? 0.1875 0.1705 0.1627 0.0152  0.0146  -0.0077 93  TYR A CA  
703  C C   . TYR A 93  ? 0.1905 0.1785 0.1723 0.0113  0.0120  -0.0059 93  TYR A C   
704  O O   . TYR A 93  ? 0.1772 0.1641 0.1586 0.0116  0.0133  -0.0055 93  TYR A O   
705  C CB  . TYR A 93  ? 0.1882 0.1778 0.1697 0.0216  0.0146  -0.0089 93  TYR A CB  
706  C CG  . TYR A 93  ? 0.1965 0.1873 0.1771 0.0256  0.0160  -0.0100 93  TYR A CG  
707  C CD1 . TYR A 93  ? 0.1974 0.1921 0.1813 0.0236  0.0149  -0.0105 93  TYR A CD1 
708  C CD2 . TYR A 93  ? 0.2112 0.1996 0.1879 0.0315  0.0185  -0.0103 93  TYR A CD2 
709  C CE1 . TYR A 93  ? 0.2091 0.2065 0.1935 0.0269  0.0167  -0.0115 93  TYR A CE1 
710  C CE2 . TYR A 93  ? 0.2235 0.2157 0.2018 0.0357  0.0199  -0.0108 93  TYR A CE2 
711  C CZ  . TYR A 93  ? 0.2220 0.2192 0.2046 0.0331  0.0192  -0.0115 93  TYR A CZ  
712  O OH  . TYR A 93  ? 0.2282 0.2303 0.2134 0.0367  0.0211  -0.0119 93  TYR A OH  
713  N N   . TRP A 94  ? 0.1802 0.1739 0.1684 0.0080  0.0086  -0.0044 94  TRP A N   
714  C CA  . TRP A 94  ? 0.1828 0.1841 0.1811 0.0068  0.0063  -0.0021 94  TRP A CA  
715  C C   . TRP A 94  ? 0.1843 0.1912 0.1903 0.0111  0.0057  -0.0027 94  TRP A C   
716  O O   . TRP A 94  ? 0.1851 0.1909 0.1887 0.0138  0.0065  -0.0048 94  TRP A O   
717  C CB  . TRP A 94  ? 0.1899 0.1937 0.1899 0.0001  0.0023  0.0010  94  TRP A CB  
718  C CG  . TRP A 94  ? 0.2075 0.2071 0.2005 -0.0062 0.0022  0.0023  94  TRP A CG  
719  C CD1 . TRP A 94  ? 0.2160 0.2214 0.2146 -0.0099 0.0010  0.0050  94  TRP A CD1 
720  C CD2 . TRP A 94  ? 0.2231 0.2109 0.2010 -0.0104 0.0040  0.0009  94  TRP A CD2 
721  N NE1 . TRP A 94  ? 0.2250 0.2234 0.2128 -0.0169 0.0014  0.0053  94  TRP A NE1 
722  C CE2 . TRP A 94  ? 0.2416 0.2280 0.2156 -0.0176 0.0033  0.0028  94  TRP A CE2 
723  C CE3 . TRP A 94  ? 0.2376 0.2158 0.2048 -0.0093 0.0067  -0.0015 94  TRP A CE3 
724  C CZ2 . TRP A 94  ? 0.2573 0.2311 0.2151 -0.0239 0.0051  0.0020  94  TRP A CZ2 
725  C CZ3 . TRP A 94  ? 0.2555 0.2208 0.2073 -0.0144 0.0092  -0.0022 94  TRP A CZ3 
726  C CH2 . TRP A 94  ? 0.2680 0.2301 0.2141 -0.0218 0.0084  -0.0006 94  TRP A CH2 
727  N N   . LEU A 95  ? 0.1816 0.1944 0.1967 0.0114  0.0045  -0.0006 95  LEU A N   
728  C CA  . LEU A 95  ? 0.1921 0.2077 0.2126 0.0152  0.0050  -0.0013 95  LEU A CA  
729  C C   . LEU A 95  ? 0.2008 0.2199 0.2272 0.0134  0.0019  0.0015  95  LEU A C   
730  O O   . LEU A 95  ? 0.2042 0.2271 0.2353 0.0107  -0.0001 0.0051  95  LEU A O   
731  C CB  . LEU A 95  ? 0.2072 0.2244 0.2325 0.0181  0.0079  -0.0010 95  LEU A CB  
732  C CG  . LEU A 95  ? 0.2313 0.2483 0.2593 0.0220  0.0100  -0.0023 95  LEU A CG  
733  C CD1 . LEU A 95  ? 0.2150 0.2288 0.2358 0.0236  0.0105  -0.0058 95  LEU A CD1 
734  C CD2 . LEU A 95  ? 0.2359 0.2525 0.2665 0.0238  0.0138  -0.0021 95  LEU A CD2 
735  N N   . ALA A 96  ? 0.1960 0.2140 0.2217 0.0145  0.0014  0.0004  96  ALA A N   
736  C CA  . ALA A 96  ? 0.1866 0.2062 0.2165 0.0133  -0.0013 0.0035  96  ALA A CA  
737  C C   . ALA A 96  ? 0.1833 0.2009 0.2139 0.0161  0.0000  0.0022  96  ALA A C   
738  O O   . ALA A 96  ? 0.1795 0.1945 0.2048 0.0165  0.0015  -0.0013 96  ALA A O   
739  C CB  . ALA A 96  ? 0.1892 0.2064 0.2130 0.0082  -0.0046 0.0041  96  ALA A CB  
740  N N   . GLU A 97  ? 0.1912 0.2100 0.2281 0.0179  -0.0004 0.0056  97  GLU A N   
741  C CA  . GLU A 97  ? 0.2070 0.2214 0.2431 0.0204  0.0014  0.0050  97  GLU A CA  
742  C C   . GLU A 97  ? 0.2126 0.2239 0.2451 0.0176  -0.0017 0.0064  97  GLU A C   
743  O O   . GLU A 97  ? 0.2148 0.2287 0.2504 0.0160  -0.0056 0.0105  97  GLU A O   
744  C CB  . GLU A 97  ? 0.2228 0.2382 0.2672 0.0250  0.0039  0.0084  97  GLU A CB  
745  C CG  . GLU A 97  ? 0.2462 0.2536 0.2866 0.0276  0.0077  0.0068  97  GLU A CG  
746  C CD  . GLU A 97  ? 0.2771 0.2832 0.3246 0.0332  0.0120  0.0099  97  GLU A CD  
747  O OE1 . GLU A 97  ? 0.2840 0.2973 0.3412 0.0353  0.0123  0.0132  97  GLU A OE1 
748  O OE2 . GLU A 97  ? 0.3314 0.3288 0.3746 0.0354  0.0155  0.0094  97  GLU A OE2 
749  N N   . VAL A 98  ? 0.2157 0.2217 0.2413 0.0165  -0.0004 0.0031  98  VAL A N   
750  C CA  . VAL A 98  ? 0.2402 0.2414 0.2614 0.0140  -0.0028 0.0045  98  VAL A CA  
751  C C   . VAL A 98  ? 0.2619 0.2594 0.2868 0.0178  -0.0022 0.0086  98  VAL A C   
752  O O   . VAL A 98  ? 0.2679 0.2631 0.2951 0.0219  0.0019  0.0082  98  VAL A O   
753  C CB  . VAL A 98  ? 0.2324 0.2298 0.2449 0.0104  -0.0015 0.0000  98  VAL A CB  
754  C CG1 . VAL A 98  ? 0.2232 0.2250 0.2338 0.0079  -0.0019 -0.0027 98  VAL A CG1 
755  C CG2 . VAL A 98  ? 0.2334 0.2278 0.2435 0.0120  0.0024  -0.0032 98  VAL A CG2 
756  N N   . LYS A 99  ? 0.2975 0.2939 0.3226 0.0166  -0.0061 0.0129  99  LYS A N   
757  C CA  . LYS A 99  ? 0.3439 0.3363 0.3723 0.0210  -0.0060 0.0177  99  LYS A CA  
758  C C   . LYS A 99  ? 0.3479 0.3286 0.3678 0.0221  -0.0014 0.0150  99  LYS A C   
759  O O   . LYS A 99  ? 0.3552 0.3310 0.3773 0.0274  0.0024  0.0169  99  LYS A O   
760  C CB  . LYS A 99  ? 0.3890 0.3816 0.4167 0.0183  -0.0122 0.0229  99  LYS A CB  
761  C CG  . LYS A 99  ? 0.4534 0.4562 0.4936 0.0211  -0.0160 0.0298  99  LYS A CG  
762  C CD  . LYS A 99  ? 0.4433 0.4534 0.4836 0.0148  -0.0211 0.0303  99  LYS A CD  
763  C CE  . LYS A 99  ? 0.4721 0.4940 0.5255 0.0166  -0.0249 0.0372  99  LYS A CE  
764  N NZ  . LYS A 99  ? 0.3869 0.4134 0.4515 0.0236  -0.0211 0.0395  99  LYS A NZ  
765  N N   . ASP A 100 ? 0.3472 0.3230 0.3566 0.0165  -0.0015 0.0105  100 ASP A N   
766  C CA  . ASP A 100 ? 0.3528 0.3173 0.3521 0.0152  0.0020  0.0076  100 ASP A CA  
767  C C   . ASP A 100 ? 0.3239 0.2897 0.3181 0.0114  0.0050  0.0010  100 ASP A C   
768  O O   . ASP A 100 ? 0.2966 0.2689 0.2904 0.0074  0.0031  -0.0016 100 ASP A O   
769  C CB  . ASP A 100 ? 0.3815 0.3393 0.3724 0.0107  -0.0009 0.0087  100 ASP A CB  
770  C CG  . ASP A 100 ? 0.4374 0.3932 0.4321 0.0143  -0.0047 0.0161  100 ASP A CG  
771  O OD1 . ASP A 100 ? 0.4625 0.4207 0.4663 0.0211  -0.0037 0.0205  100 ASP A OD1 
772  O OD2 . ASP A 100 ? 0.4847 0.4366 0.4731 0.0102  -0.0086 0.0178  100 ASP A OD2 
773  N N   . TYR A 101 ? 0.3292 0.2884 0.3191 0.0127  0.0097  -0.0011 101 TYR A N   
774  C CA  . TYR A 101 ? 0.3175 0.2774 0.3014 0.0083  0.0120  -0.0069 101 TYR A CA  
775  C C   . TYR A 101 ? 0.3197 0.2810 0.2972 0.0012  0.0102  -0.0100 101 TYR A C   
776  O O   . TYR A 101 ? 0.3006 0.2705 0.2792 -0.0017 0.0096  -0.0133 101 TYR A O   
777  C CB  . TYR A 101 ? 0.3338 0.2812 0.3094 0.0089  0.0173  -0.0081 101 TYR A CB  
778  C CG  . TYR A 101 ? 0.3331 0.2798 0.3009 0.0036  0.0194  -0.0134 101 TYR A CG  
779  C CD1 . TYR A 101 ? 0.3419 0.2853 0.2998 -0.0038 0.0194  -0.0167 101 TYR A CD1 
780  C CD2 . TYR A 101 ? 0.3263 0.2756 0.2958 0.0054  0.0214  -0.0148 101 TYR A CD2 
781  C CE1 . TYR A 101 ? 0.3457 0.2900 0.2969 -0.0096 0.0206  -0.0210 101 TYR A CE1 
782  C CE2 . TYR A 101 ? 0.3419 0.2904 0.3032 0.0000  0.0226  -0.0190 101 TYR A CE2 
783  C CZ  . TYR A 101 ? 0.3443 0.2911 0.2970 -0.0077 0.0219  -0.0219 101 TYR A CZ  
784  O OH  . TYR A 101 ? 0.3544 0.3022 0.2995 -0.0141 0.0223  -0.0256 101 TYR A OH  
785  N N   . ASP A 102 ? 0.3406 0.2936 0.3119 -0.0009 0.0095  -0.0085 102 ASP A N   
786  C CA  . ASP A 102 ? 0.3584 0.3102 0.3222 -0.0080 0.0090  -0.0114 102 ASP A CA  
787  C C   . ASP A 102 ? 0.3612 0.3197 0.3286 -0.0096 0.0052  -0.0101 102 ASP A C   
788  O O   . ASP A 102 ? 0.3763 0.3317 0.3369 -0.0152 0.0051  -0.0117 102 ASP A O   
789  C CB  . ASP A 102 ? 0.4021 0.3382 0.3543 -0.0102 0.0110  -0.0106 102 ASP A CB  
790  C CG  . ASP A 102 ? 0.4517 0.3821 0.4041 -0.0075 0.0079  -0.0052 102 ASP A CG  
791  O OD1 . ASP A 102 ? 0.4363 0.3743 0.3987 -0.0029 0.0044  -0.0013 102 ASP A OD1 
792  O OD2 . ASP A 102 ? 0.4902 0.4084 0.4320 -0.0104 0.0085  -0.0046 102 ASP A OD2 
793  N N   . VAL A 103 ? 0.3287 0.2852 0.3260 -0.0207 0.0360  0.0045  103 VAL A N   
794  C CA  . VAL A 103 ? 0.3121 0.2843 0.3070 -0.0201 0.0292  0.0069  103 VAL A CA  
795  C C   . VAL A 103 ? 0.3139 0.2891 0.3062 -0.0279 0.0297  0.0011  103 VAL A C   
796  O O   . VAL A 103 ? 0.2932 0.2682 0.2887 -0.0334 0.0299  -0.0071 103 VAL A O   
797  C CB  . VAL A 103 ? 0.2912 0.2774 0.2899 -0.0177 0.0212  0.0039  103 VAL A CB  
798  C CG1 . VAL A 103 ? 0.2715 0.2586 0.2735 -0.0220 0.0197  -0.0058 103 VAL A CG1 
799  C CG2 . VAL A 103 ? 0.2785 0.2788 0.2736 -0.0185 0.0154  0.0048  103 VAL A CG2 
800  N N   . GLU A 104 ? 0.3153 0.2947 0.3021 -0.0281 0.0300  0.0059  104 GLU A N   
801  C CA  . GLU A 104 ? 0.3429 0.3253 0.3281 -0.0347 0.0321  0.0014  104 GLU A CA  
802  C C   . GLU A 104 ? 0.3284 0.3246 0.3164 -0.0364 0.0262  -0.0060 104 GLU A C   
803  O O   . GLU A 104 ? 0.3091 0.3142 0.2941 -0.0335 0.0213  -0.0050 104 GLU A O   
804  C CB  . GLU A 104 ? 0.3816 0.3633 0.3583 -0.0343 0.0357  0.0093  104 GLU A CB  
805  C CG  . GLU A 104 ? 0.4117 0.3972 0.3877 -0.0412 0.0392  0.0045  104 GLU A CG  
806  C CD  . GLU A 104 ? 0.4712 0.4548 0.4372 -0.0416 0.0445  0.0123  104 GLU A CD  
807  O OE1 . GLU A 104 ? 0.5055 0.4877 0.4634 -0.0360 0.0437  0.0222  104 GLU A OE1 
808  O OE2 . GLU A 104 ? 0.5053 0.4904 0.4718 -0.0475 0.0496  0.0089  104 GLU A OE2 
809  N N   . ILE A 105 ? 0.3039 0.3023 0.2980 -0.0413 0.0268  -0.0133 105 ILE A N   
810  C CA  . ILE A 105 ? 0.2848 0.2951 0.2830 -0.0417 0.0227  -0.0190 105 ILE A CA  
811  C C   . ILE A 105 ? 0.3120 0.3273 0.3085 -0.0450 0.0265  -0.0198 105 ILE A C   
812  O O   . ILE A 105 ? 0.3123 0.3251 0.3113 -0.0497 0.0315  -0.0202 105 ILE A O   
813  C CB  . ILE A 105 ? 0.2609 0.2740 0.2673 -0.0438 0.0207  -0.0250 105 ILE A CB  
814  C CG1 . ILE A 105 ? 0.2490 0.2559 0.2552 -0.0408 0.0184  -0.0245 105 ILE A CG1 
815  C CG2 . ILE A 105 ? 0.2287 0.2533 0.2405 -0.0430 0.0180  -0.0291 105 ILE A CG2 
816  C CD1 . ILE A 105 ? 0.2391 0.2486 0.2439 -0.0350 0.0144  -0.0220 105 ILE A CD1 
817  N N   . ARG A 106 ? 0.3076 0.3294 0.2997 -0.0433 0.0251  -0.0206 106 ARG A N   
818  C CA  . ARG A 106 ? 0.3205 0.3467 0.3105 -0.0463 0.0302  -0.0223 106 ARG A CA  
819  C C   . ARG A 106 ? 0.3086 0.3428 0.3045 -0.0455 0.0292  -0.0288 106 ARG A C   
820  O O   . ARG A 106 ? 0.2954 0.3311 0.2879 -0.0431 0.0256  -0.0306 106 ARG A O   
821  C CB  . ARG A 106 ? 0.3577 0.3827 0.3338 -0.0459 0.0319  -0.0173 106 ARG A CB  
822  C CG  . ARG A 106 ? 0.3857 0.4038 0.3551 -0.0431 0.0304  -0.0087 106 ARG A CG  
823  C CD  . ARG A 106 ? 0.4321 0.4447 0.3929 -0.0449 0.0371  -0.0016 106 ARG A CD  
824  N NE  . ARG A 106 ? 0.4656 0.4841 0.4164 -0.0471 0.0403  -0.0026 106 ARG A NE  
825  C CZ  . ARG A 106 ? 0.5103 0.5252 0.4554 -0.0502 0.0483  0.0011  106 ARG A CZ  
826  N NH1 . ARG A 106 ? 0.5540 0.5590 0.5035 -0.0519 0.0539  0.0059  106 ARG A NH1 
827  N NH2 . ARG A 106 ? 0.5152 0.5357 0.4499 -0.0522 0.0517  -0.0004 106 ARG A NH2 
828  N N   . LEU A 107 ? 0.2814 0.3209 0.2873 -0.0474 0.0328  -0.0320 107 LEU A N   
829  C CA  . LEU A 107 ? 0.2869 0.3332 0.3009 -0.0451 0.0330  -0.0368 107 LEU A CA  
830  C C   . LEU A 107 ? 0.3108 0.3588 0.3195 -0.0456 0.0394  -0.0395 107 LEU A C   
831  O O   . LEU A 107 ? 0.3389 0.3855 0.3401 -0.0486 0.0442  -0.0376 107 LEU A O   
832  C CB  . LEU A 107 ? 0.2654 0.3196 0.2945 -0.0458 0.0331  -0.0378 107 LEU A CB  
833  C CG  . LEU A 107 ? 0.2636 0.3157 0.2950 -0.0466 0.0273  -0.0364 107 LEU A CG  
834  C CD1 . LEU A 107 ? 0.2489 0.3115 0.2933 -0.0496 0.0267  -0.0376 107 LEU A CD1 
835  C CD2 . LEU A 107 ? 0.2371 0.2861 0.2663 -0.0420 0.0218  -0.0366 107 LEU A CD2 
836  N N   . SER A 108 ? 0.3151 0.3645 0.3267 -0.0429 0.0405  -0.0441 108 SER A N   
837  C CA  . SER A 108 ? 0.3462 0.3967 0.3553 -0.0434 0.0486  -0.0484 108 SER A CA  
838  C C   . SER A 108 ? 0.3541 0.4125 0.3811 -0.0411 0.0538  -0.0491 108 SER A C   
839  O O   . SER A 108 ? 0.3272 0.3916 0.3667 -0.0399 0.0495  -0.0463 108 SER A O   
840  C CB  . SER A 108 ? 0.3471 0.3929 0.3497 -0.0422 0.0485  -0.0540 108 SER A CB  
841  O OG  . SER A 108 ? 0.3198 0.3659 0.3354 -0.0378 0.0464  -0.0550 108 SER A OG  
842  N N   . HIS A 109 ? 0.3985 0.4583 0.4268 -0.0405 0.0632  -0.0529 109 HIS A N   
843  C CA  . HIS A 109 ? 0.4088 0.4776 0.4562 -0.0367 0.0695  -0.0533 109 HIS A CA  
844  C C   . HIS A 109 ? 0.3803 0.4525 0.4422 -0.0304 0.0651  -0.0519 109 HIS A C   
845  O O   . HIS A 109 ? 0.3726 0.4565 0.4529 -0.0268 0.0662  -0.0489 109 HIS A O   
846  C CB  . HIS A 109 ? 0.4705 0.5359 0.5140 -0.0360 0.0815  -0.0588 109 HIS A CB  
847  C CG  . HIS A 109 ? 0.5288 0.5831 0.5631 -0.0343 0.0829  -0.0650 109 HIS A CG  
848  N ND1 . HIS A 109 ? 0.5781 0.6241 0.5914 -0.0392 0.0803  -0.0686 109 HIS A ND1 
849  C CD2 . HIS A 109 ? 0.5641 0.6149 0.6090 -0.0285 0.0867  -0.0677 109 HIS A CD2 
850  C CE1 . HIS A 109 ? 0.6103 0.6480 0.6207 -0.0380 0.0823  -0.0749 109 HIS A CE1 
851  N NE2 . HIS A 109 ? 0.6178 0.6568 0.6475 -0.0313 0.0870  -0.0743 109 HIS A NE2 
852  N N   . GLU A 110 ? 0.3652 0.4285 0.4196 -0.0291 0.0599  -0.0534 110 GLU A N   
853  C CA  . GLU A 110 ? 0.3433 0.4078 0.4095 -0.0230 0.0566  -0.0512 110 GLU A CA  
854  C C   . GLU A 110 ? 0.3200 0.3944 0.3949 -0.0225 0.0477  -0.0452 110 GLU A C   
855  O O   . GLU A 110 ? 0.3006 0.3812 0.3880 -0.0169 0.0457  -0.0416 110 GLU A O   
856  C CB  . GLU A 110 ? 0.3515 0.4037 0.4073 -0.0230 0.0542  -0.0545 110 GLU A CB  
857  C CG  . GLU A 110 ? 0.4176 0.4600 0.4687 -0.0227 0.0637  -0.0616 110 GLU A CG  
858  C CD  . GLU A 110 ? 0.4217 0.4535 0.4679 -0.0228 0.0617  -0.0648 110 GLU A CD  
859  O OE1 . GLU A 110 ? 0.4150 0.4476 0.4699 -0.0186 0.0569  -0.0599 110 GLU A OE1 
860  O OE2 . GLU A 110 ? 0.4351 0.4585 0.4685 -0.0278 0.0649  -0.0722 110 GLU A OE2 
861  N N   . HIS A 111 ? 0.2965 0.3720 0.3643 -0.0284 0.0429  -0.0440 111 HIS A N   
862  C CA  . HIS A 111 ? 0.2849 0.3676 0.3581 -0.0297 0.0349  -0.0403 111 HIS A CA  
863  C C   . HIS A 111 ? 0.2846 0.3750 0.3612 -0.0358 0.0355  -0.0396 111 HIS A C   
864  O O   . HIS A 111 ? 0.3068 0.3923 0.3758 -0.0399 0.0403  -0.0409 111 HIS A O   
865  C CB  . HIS A 111 ? 0.2463 0.3190 0.3081 -0.0304 0.0281  -0.0400 111 HIS A CB  
866  C CG  . HIS A 111 ? 0.2436 0.3103 0.3049 -0.0251 0.0276  -0.0405 111 HIS A CG  
867  N ND1 . HIS A 111 ? 0.2581 0.3150 0.3105 -0.0254 0.0307  -0.0441 111 HIS A ND1 
868  C CD2 . HIS A 111 ? 0.2385 0.3080 0.3075 -0.0199 0.0248  -0.0375 111 HIS A CD2 
869  C CE1 . HIS A 111 ? 0.2455 0.2979 0.3008 -0.0213 0.0306  -0.0442 111 HIS A CE1 
870  N NE2 . HIS A 111 ? 0.2407 0.3001 0.3060 -0.0174 0.0274  -0.0395 111 HIS A NE2 
871  N N   . GLN A 112 ? 0.2745 0.3775 0.3622 -0.0370 0.0308  -0.0376 112 GLN A N   
872  C CA  . GLN A 112 ? 0.2745 0.3865 0.3682 -0.0442 0.0321  -0.0379 112 GLN A CA  
873  C C   . GLN A 112 ? 0.2644 0.3724 0.3513 -0.0510 0.0261  -0.0387 112 GLN A C   
874  O O   . GLN A 112 ? 0.2871 0.3968 0.3753 -0.0587 0.0283  -0.0399 112 GLN A O   
875  C CB  . GLN A 112 ? 0.2904 0.4240 0.4049 -0.0423 0.0329  -0.0360 112 GLN A CB  
876  C CG  . GLN A 112 ? 0.3153 0.4607 0.4376 -0.0387 0.0242  -0.0329 112 GLN A CG  
877  C CD  . GLN A 112 ? 0.3426 0.5133 0.4872 -0.0359 0.0241  -0.0292 112 GLN A CD  
878  O OE1 . GLN A 112 ? 0.3500 0.5371 0.5020 -0.0379 0.0161  -0.0272 112 GLN A OE1 
879  N NE2 . GLN A 112 ? 0.3343 0.5091 0.4895 -0.0312 0.0330  -0.0283 112 GLN A NE2 
880  N N   . ALA A 113 ? 0.2412 0.3431 0.3212 -0.0486 0.0198  -0.0383 113 ALA A N   
881  C CA  . ALA A 113 ? 0.2213 0.3168 0.2936 -0.0549 0.0161  -0.0399 113 ALA A CA  
882  C C   . ALA A 113 ? 0.2061 0.2893 0.2673 -0.0506 0.0122  -0.0393 113 ALA A C   
883  O O   . ALA A 113 ? 0.1922 0.2748 0.2538 -0.0436 0.0113  -0.0376 113 ALA A O   
884  C CB  . ALA A 113 ? 0.2233 0.3356 0.3057 -0.0602 0.0113  -0.0413 113 ALA A CB  
885  N N   . TYR A 114 ? 0.2061 0.2791 0.2585 -0.0550 0.0110  -0.0408 114 TYR A N   
886  C CA  . TYR A 114 ? 0.1953 0.2590 0.2394 -0.0512 0.0077  -0.0402 114 TYR A CA  
887  C C   . TYR A 114 ? 0.1996 0.2611 0.2395 -0.0569 0.0053  -0.0433 114 TYR A C   
888  O O   . TYR A 114 ? 0.1967 0.2588 0.2377 -0.0649 0.0074  -0.0465 114 TYR A O   
889  C CB  . TYR A 114 ? 0.1941 0.2431 0.2289 -0.0483 0.0107  -0.0383 114 TYR A CB  
890  C CG  . TYR A 114 ? 0.2126 0.2497 0.2409 -0.0530 0.0146  -0.0383 114 TYR A CG  
891  C CD1 . TYR A 114 ? 0.2222 0.2489 0.2444 -0.0538 0.0144  -0.0390 114 TYR A CD1 
892  C CD2 . TYR A 114 ? 0.2259 0.2611 0.2540 -0.0564 0.0199  -0.0371 114 TYR A CD2 
893  C CE1 . TYR A 114 ? 0.2500 0.2634 0.2672 -0.0572 0.0196  -0.0383 114 TYR A CE1 
894  C CE2 . TYR A 114 ? 0.2478 0.2700 0.2699 -0.0600 0.0248  -0.0356 114 TYR A CE2 
895  C CZ  . TYR A 114 ? 0.2637 0.2746 0.2810 -0.0600 0.0247  -0.0361 114 TYR A CZ  
896  O OH  . TYR A 114 ? 0.3067 0.3024 0.3189 -0.0626 0.0308  -0.0342 114 TYR A OH  
897  N N   . ARG A 115 ? 0.1846 0.2430 0.2192 -0.0534 0.0019  -0.0430 115 ARG A N   
898  C CA  . ARG A 115 ? 0.2073 0.2604 0.2345 -0.0584 0.0009  -0.0468 115 ARG A CA  
899  C C   . ARG A 115 ? 0.1931 0.2327 0.2120 -0.0529 0.0019  -0.0451 115 ARG A C   
900  O O   . ARG A 115 ? 0.1691 0.2098 0.1898 -0.0457 0.0005  -0.0413 115 ARG A O   
901  C CB  . ARG A 115 ? 0.2329 0.3025 0.2625 -0.0609 -0.0052 -0.0483 115 ARG A CB  
902  C CG  . ARG A 115 ? 0.2680 0.3574 0.3094 -0.0655 -0.0078 -0.0488 115 ARG A CG  
903  C CD  . ARG A 115 ? 0.3181 0.4085 0.3591 -0.0778 -0.0063 -0.0554 115 ARG A CD  
904  N NE  . ARG A 115 ? 0.3673 0.4800 0.4224 -0.0823 -0.0088 -0.0555 115 ARG A NE  
905  C CZ  . ARG A 115 ? 0.3739 0.4901 0.4393 -0.0825 -0.0043 -0.0538 115 ARG A CZ  
906  N NH1 . ARG A 115 ? 0.3439 0.4428 0.4054 -0.0789 0.0024  -0.0518 115 ARG A NH1 
907  N NH2 . ARG A 115 ? 0.3977 0.5363 0.4776 -0.0864 -0.0066 -0.0537 115 ARG A NH2 
908  N N   . TRP A 116 ? 0.2007 0.2276 0.2119 -0.0568 0.0052  -0.0484 116 TRP A N   
909  C CA  . TRP A 116 ? 0.2037 0.2190 0.2078 -0.0527 0.0071  -0.0478 116 TRP A CA  
910  C C   . TRP A 116 ? 0.2347 0.2531 0.2322 -0.0572 0.0050  -0.0527 116 TRP A C   
911  O O   . TRP A 116 ? 0.2446 0.2617 0.2385 -0.0662 0.0064  -0.0589 116 TRP A O   
912  C CB  . TRP A 116 ? 0.2048 0.2026 0.2048 -0.0539 0.0142  -0.0481 116 TRP A CB  
913  C CG  . TRP A 116 ? 0.1879 0.1816 0.1912 -0.0484 0.0163  -0.0419 116 TRP A CG  
914  C CD1 . TRP A 116 ? 0.1955 0.1858 0.2003 -0.0506 0.0197  -0.0399 116 TRP A CD1 
915  C CD2 . TRP A 116 ? 0.1740 0.1672 0.1784 -0.0403 0.0152  -0.0367 116 TRP A CD2 
916  N NE1 . TRP A 116 ? 0.1878 0.1759 0.1929 -0.0441 0.0202  -0.0335 116 TRP A NE1 
917  C CE2 . TRP A 116 ? 0.1775 0.1684 0.1832 -0.0382 0.0170  -0.0318 116 TRP A CE2 
918  C CE3 . TRP A 116 ? 0.1585 0.1537 0.1631 -0.0353 0.0131  -0.0355 116 TRP A CE3 
919  C CZ2 . TRP A 116 ? 0.1670 0.1599 0.1739 -0.0319 0.0154  -0.0265 116 TRP A CZ2 
920  C CZ3 . TRP A 116 ? 0.1507 0.1470 0.1584 -0.0293 0.0123  -0.0305 116 TRP A CZ3 
921  C CH2 . TRP A 116 ? 0.1567 0.1527 0.1655 -0.0279 0.0130  -0.0263 116 TRP A CH2 
922  N N   . LEU A 117 ? 0.2310 0.2538 0.2261 -0.0521 0.0020  -0.0503 117 LEU A N   
923  C CA  . LEU A 117 ? 0.2512 0.2808 0.2385 -0.0560 -0.0011 -0.0539 117 LEU A CA  
924  C C   . LEU A 117 ? 0.2408 0.2625 0.2204 -0.0512 0.0010  -0.0526 117 LEU A C   
925  O O   . LEU A 117 ? 0.2137 0.2327 0.1978 -0.0434 0.0021  -0.0471 117 LEU A O   
926  C CB  . LEU A 117 ? 0.2677 0.3185 0.2615 -0.0550 -0.0087 -0.0504 117 LEU A CB  
927  C CG  . LEU A 117 ? 0.2867 0.3495 0.2887 -0.0618 -0.0110 -0.0529 117 LEU A CG  
928  C CD1 . LEU A 117 ? 0.2872 0.3724 0.2991 -0.0589 -0.0177 -0.0480 117 LEU A CD1 
929  C CD2 . LEU A 117 ? 0.3225 0.3837 0.3166 -0.0737 -0.0103 -0.0618 117 LEU A CD2 
930  N N   . GLY A 118 ? 0.2636 0.2824 0.2314 -0.0567 0.0022  -0.0583 118 GLY A N   
931  C CA  . GLY A 118 ? 0.2769 0.2910 0.2356 -0.0528 0.0044  -0.0573 118 GLY A CA  
932  C C   . GLY A 118 ? 0.2718 0.3006 0.2330 -0.0472 -0.0017 -0.0501 118 GLY A C   
933  O O   . GLY A 118 ? 0.2491 0.2935 0.2171 -0.0475 -0.0082 -0.0473 118 GLY A O   
934  N N   . LEU A 119 ? 0.2705 0.2941 0.2269 -0.0417 0.0012  -0.0467 119 LEU A N   
935  C CA  . LEU A 119 ? 0.2659 0.2991 0.2259 -0.0348 -0.0021 -0.0384 119 LEU A CA  
936  C C   . LEU A 119 ? 0.2926 0.3440 0.2493 -0.0368 -0.0099 -0.0359 119 LEU A C   
937  O O   . LEU A 119 ? 0.2808 0.3426 0.2482 -0.0319 -0.0137 -0.0293 119 LEU A O   
938  C CB  . LEU A 119 ? 0.2628 0.2875 0.2157 -0.0306 0.0034  -0.0359 119 LEU A CB  
939  C CG  . LEU A 119 ? 0.2644 0.2970 0.2201 -0.0240 0.0013  -0.0267 119 LEU A CG  
940  C CD1 . LEU A 119 ? 0.2393 0.2718 0.2116 -0.0187 0.0012  -0.0218 119 LEU A CD1 
941  C CD2 . LEU A 119 ? 0.2619 0.2868 0.2087 -0.0214 0.0075  -0.0247 119 LEU A CD2 
942  N N   . GLU A 120 ? 0.3290 0.3850 0.2710 -0.0436 -0.0118 -0.0410 120 GLU A N   
943  C CA  . GLU A 120 ? 0.3677 0.4448 0.3064 -0.0455 -0.0205 -0.0378 120 GLU A CA  
944  C C   . GLU A 120 ? 0.3495 0.4412 0.3032 -0.0472 -0.0264 -0.0369 120 GLU A C   
945  O O   . GLU A 120 ? 0.3478 0.4550 0.3106 -0.0413 -0.0315 -0.0282 120 GLU A O   
946  C CB  . GLU A 120 ? 0.4265 0.5081 0.3455 -0.0551 -0.0225 -0.0454 120 GLU A CB  
947  C CG  . GLU A 120 ? 0.4732 0.5815 0.3893 -0.0574 -0.0333 -0.0410 120 GLU A CG  
948  C CD  . GLU A 120 ? 0.5229 0.6416 0.4427 -0.0457 -0.0364 -0.0264 120 GLU A CD  
949  O OE1 . GLU A 120 ? 0.5809 0.7230 0.5043 -0.0443 -0.0452 -0.0195 120 GLU A OE1 
950  O OE2 . GLU A 120 ? 0.5185 0.6225 0.4384 -0.0377 -0.0296 -0.0211 120 GLU A OE2 
951  N N   . GLU A 121 ? 0.3469 0.4333 0.3034 -0.0549 -0.0246 -0.0453 121 GLU A N   
952  C CA  . GLU A 121 ? 0.3445 0.4443 0.3157 -0.0571 -0.0288 -0.0449 121 GLU A CA  
953  C C   . GLU A 121 ? 0.3230 0.4207 0.3103 -0.0475 -0.0268 -0.0375 121 GLU A C   
954  O O   . GLU A 121 ? 0.3183 0.4321 0.3182 -0.0450 -0.0309 -0.0328 121 GLU A O   
955  C CB  . GLU A 121 ? 0.3759 0.4677 0.3459 -0.0679 -0.0256 -0.0553 121 GLU A CB  
956  C CG  . GLU A 121 ? 0.4399 0.5388 0.3958 -0.0798 -0.0289 -0.0640 121 GLU A CG  
957  C CD  . GLU A 121 ? 0.4777 0.5576 0.4267 -0.0900 -0.0214 -0.0756 121 GLU A CD  
958  O OE1 . GLU A 121 ? 0.5071 0.5660 0.4454 -0.0883 -0.0137 -0.0786 121 GLU A OE1 
959  O OE2 . GLU A 121 ? 0.4945 0.5804 0.4496 -0.0994 -0.0224 -0.0812 121 GLU A OE2 
960  N N   . ALA A 122 ? 0.2700 0.3491 0.2571 -0.0424 -0.0203 -0.0366 122 ALA A N   
961  C CA  . ALA A 122 ? 0.2555 0.3319 0.2553 -0.0343 -0.0181 -0.0308 122 ALA A CA  
962  C C   . ALA A 122 ? 0.2505 0.3380 0.2553 -0.0265 -0.0210 -0.0218 122 ALA A C   
963  O O   . ALA A 122 ? 0.2359 0.3301 0.2533 -0.0219 -0.0212 -0.0175 122 ALA A O   
964  C CB  . ALA A 122 ? 0.2363 0.2942 0.2344 -0.0310 -0.0117 -0.0313 122 ALA A CB  
965  N N   . CYS A 123 ? 0.2606 0.3484 0.2551 -0.0246 -0.0218 -0.0186 123 CYS A N   
966  C CA  . CYS A 123 ? 0.2779 0.3753 0.2756 -0.0166 -0.0238 -0.0084 123 CYS A CA  
967  C C   . CYS A 123 ? 0.3035 0.4239 0.3092 -0.0161 -0.0309 -0.0041 123 CYS A C   
968  O O   . CYS A 123 ? 0.3148 0.4417 0.3335 -0.0082 -0.0305 0.0038  123 CYS A O   
969  C CB  . CYS A 123 ? 0.2810 0.3753 0.2636 -0.0157 -0.0233 -0.0058 123 CYS A CB  
970  S SG  . CYS A 123 ? 0.2839 0.3547 0.2648 -0.0124 -0.0138 -0.0067 123 CYS A SG  
971  N N   . GLN A 124 ? 0.3322 0.4651 0.3312 -0.0248 -0.0367 -0.0095 124 GLN A N   
972  C CA  . GLN A 124 ? 0.3798 0.5392 0.3880 -0.0257 -0.0445 -0.0056 124 GLN A CA  
973  C C   . GLN A 124 ? 0.3516 0.5144 0.3794 -0.0234 -0.0424 -0.0053 124 GLN A C   
974  O O   . GLN A 124 ? 0.3611 0.5402 0.4029 -0.0164 -0.0447 0.0031  124 GLN A O   
975  C CB  . GLN A 124 ? 0.4149 0.5865 0.4119 -0.0384 -0.0508 -0.0142 124 GLN A CB  
976  C CG  . GLN A 124 ? 0.4978 0.6658 0.4730 -0.0410 -0.0521 -0.0153 124 GLN A CG  
977  C CD  . GLN A 124 ? 0.5647 0.7419 0.5261 -0.0553 -0.0570 -0.0261 124 GLN A CD  
978  O OE1 . GLN A 124 ? 0.6542 0.8178 0.6129 -0.0647 -0.0526 -0.0379 124 GLN A OE1 
980  N N   . LEU A 125 ? 0.3338 0.4808 0.3625 -0.0284 -0.0371 -0.0137 125 LEU A N   
981  C CA  . LEU A 125 ? 0.3267 0.4761 0.3715 -0.0273 -0.0342 -0.0142 125 LEU A CA  
982  C C   . LEU A 125 ? 0.3142 0.4546 0.3677 -0.0163 -0.0285 -0.0075 125 LEU A C   
983  O O   . LEU A 125 ? 0.3137 0.4637 0.3819 -0.0113 -0.0273 -0.0032 125 LEU A O   
984  C CB  . LEU A 125 ? 0.3261 0.4604 0.3670 -0.0355 -0.0297 -0.0238 125 LEU A CB  
985  C CG  . LEU A 125 ? 0.3492 0.4916 0.3978 -0.0438 -0.0298 -0.0293 125 LEU A CG  
986  C CD1 . LEU A 125 ? 0.2974 0.4216 0.3475 -0.0436 -0.0223 -0.0324 125 LEU A CD1 
987  C CD2 . LEU A 125 ? 0.3646 0.5330 0.4301 -0.0419 -0.0339 -0.0243 125 LEU A CD2 
988  N N   . ALA A 126 ? 0.3049 0.4265 0.3500 -0.0131 -0.0241 -0.0074 126 ALA A N   
989  C CA  . ALA A 126 ? 0.3023 0.4142 0.3548 -0.0041 -0.0183 -0.0021 126 ALA A CA  
990  C C   . ALA A 126 ? 0.3312 0.4569 0.3918 0.0046  -0.0201 0.0087  126 ALA A C   
991  O O   . ALA A 126 ? 0.3399 0.4656 0.4134 0.0117  -0.0155 0.0132  126 ALA A O   
992  C CB  . ALA A 126 ? 0.2839 0.3768 0.3265 -0.0035 -0.0142 -0.0035 126 ALA A CB  
993  N N   . GLN A 127 ? 0.3591 0.4966 0.4115 0.0042  -0.0264 0.0130  127 GLN A N   
994  C CA  . GLN A 127 ? 0.4050 0.5598 0.4636 0.0128  -0.0299 0.0255  127 GLN A CA  
995  C C   . GLN A 127 ? 0.4148 0.5565 0.4758 0.0237  -0.0230 0.0350  127 GLN A C   
996  O O   . GLN A 127 ? 0.4328 0.5780 0.4862 0.0281  -0.0249 0.0435  127 GLN A O   
997  C CB  . GLN A 127 ? 0.4149 0.5920 0.4910 0.0149  -0.0332 0.0288  127 GLN A CB  
998  C CG  . GLN A 127 ? 0.4924 0.6934 0.5755 0.0234  -0.0389 0.0426  127 GLN A CG  
999  C CD  . GLN A 127 ? 0.5071 0.7031 0.6053 0.0377  -0.0312 0.0542  127 GLN A CD  
1000 O OE1 . GLN A 127 ? 0.5309 0.7317 0.6286 0.0470  -0.0318 0.0669  127 GLN A OE1 
1001 N NE2 . GLN A 127 ? 0.5476 0.7326 0.6584 0.0395  -0.0229 0.0498  127 GLN A NE2 
1002 N N   . PHE A 128 ? 0.4139 0.5398 0.4846 0.0272  -0.0143 0.0331  128 PHE A N   
1003 C CA  . PHE A 128 ? 0.4052 0.5175 0.4810 0.0367  -0.0061 0.0411  128 PHE A CA  
1004 C C   . PHE A 128 ? 0.3833 0.4802 0.4448 0.0352  -0.0037 0.0414  128 PHE A C   
1005 O O   . PHE A 128 ? 0.3406 0.4267 0.3931 0.0273  -0.0033 0.0317  128 PHE A O   
1006 C CB  . PHE A 128 ? 0.4250 0.5226 0.5115 0.0375  0.0027  0.0352  128 PHE A CB  
1007 C CG  . PHE A 128 ? 0.4581 0.5359 0.5476 0.0434  0.0128  0.0389  128 PHE A CG  
1008 C CD1 . PHE A 128 ? 0.5141 0.5933 0.6093 0.0542  0.0162  0.0526  128 PHE A CD1 
1009 C CD2 . PHE A 128 ? 0.4748 0.5329 0.5618 0.0380  0.0193  0.0292  128 PHE A CD2 
1010 C CE1 . PHE A 128 ? 0.5566 0.6149 0.6548 0.0589  0.0271  0.0559  128 PHE A CE1 
1011 C CE2 . PHE A 128 ? 0.4948 0.5345 0.5851 0.0416  0.0291  0.0313  128 PHE A CE2 
1012 C CZ  . PHE A 128 ? 0.5304 0.5688 0.6265 0.0519  0.0337  0.0444  128 PHE A CZ  
1013 N N   . LYS A 129 ? 0.3851 0.4809 0.4458 0.0435  -0.0012 0.0534  129 LYS A N   
1014 C CA  . LYS A 129 ? 0.3900 0.4754 0.4361 0.0422  0.0004  0.0556  129 LYS A CA  
1015 C C   . LYS A 129 ? 0.3473 0.4098 0.3913 0.0374  0.0083  0.0472  129 LYS A C   
1016 O O   . LYS A 129 ? 0.3453 0.4031 0.3770 0.0319  0.0074  0.0430  129 LYS A O   
1017 C CB  . LYS A 129 ? 0.4397 0.5285 0.4851 0.0525  0.0024  0.0718  129 LYS A CB  
1018 C CG  . LYS A 129 ? 0.5002 0.5715 0.5584 0.0610  0.0142  0.0786  129 LYS A CG  
1019 C CD  . LYS A 129 ? 0.5534 0.6269 0.6101 0.0720  0.0169  0.0964  129 LYS A CD  
1020 C CE  . LYS A 129 ? 0.5908 0.6506 0.6647 0.0822  0.0286  0.1045  129 LYS A CE  
1021 N NZ  . LYS A 129 ? 0.6236 0.6917 0.6991 0.0954  0.0295  0.1249  129 LYS A NZ  
1022 N N   . GLU A 130 ? 0.3289 0.3785 0.3848 0.0390  0.0160  0.0445  130 GLU A N   
1023 C CA  . GLU A 130 ? 0.3309 0.3625 0.3858 0.0332  0.0222  0.0359  130 GLU A CA  
1024 C C   . GLU A 130 ? 0.2872 0.3198 0.3373 0.0238  0.0177  0.0233  130 GLU A C   
1025 O O   . GLU A 130 ? 0.2689 0.2922 0.3148 0.0186  0.0199  0.0178  130 GLU A O   
1026 C CB  . GLU A 130 ? 0.3712 0.3888 0.4384 0.0363  0.0319  0.0356  130 GLU A CB  
1027 C CG  . GLU A 130 ? 0.4669 0.4832 0.5407 0.0473  0.0373  0.0496  130 GLU A CG  
1028 C CD  . GLU A 130 ? 0.5242 0.5200 0.6078 0.0495  0.0500  0.0492  130 GLU A CD  
1029 O OE1 . GLU A 130 ? 0.5975 0.5802 0.6791 0.0413  0.0540  0.0397  130 GLU A OE1 
1030 O OE2 . GLU A 130 ? 0.5474 0.5405 0.6410 0.0591  0.0563  0.0585  130 GLU A OE2 
1031 N N   . MET A 131 ? 0.2736 0.3180 0.3257 0.0219  0.0119  0.0197  131 MET A N   
1032 C CA  A MET A 131 ? 0.2566 0.3020 0.3043 0.0138  0.0081  0.0094  131 MET A CA  
1033 C CA  B MET A 131 ? 0.2500 0.2956 0.2978 0.0139  0.0080  0.0094  131 MET A CA  
1034 C C   . MET A 131 ? 0.2473 0.2974 0.2822 0.0101  0.0030  0.0086  131 MET A C   
1035 O O   . MET A 131 ? 0.2244 0.2679 0.2537 0.0049  0.0034  0.0023  131 MET A O   
1036 C CB  A MET A 131 ? 0.2581 0.3138 0.3126 0.0129  0.0051  0.0064  131 MET A CB  
1037 C CB  B MET A 131 ? 0.2413 0.2980 0.2956 0.0131  0.0047  0.0069  131 MET A CB  
1038 C CG  A MET A 131 ? 0.2526 0.3090 0.3023 0.0049  0.0018  -0.0026 131 MET A CG  
1039 C CG  B MET A 131 ? 0.2246 0.2796 0.2762 0.0055  0.0030  -0.0027 131 MET A CG  
1040 S SD  A MET A 131 ? 0.2638 0.3046 0.3102 0.0004  0.0059  -0.0095 131 MET A SD  
1041 S SD  B MET A 131 ? 0.2190 0.2592 0.2744 0.0035  0.0097  -0.0088 131 MET A SD  
1042 C CE  A MET A 131 ? 0.2638 0.2964 0.3205 0.0039  0.0133  -0.0094 131 MET A CE  
1043 C CE  B MET A 131 ? 0.1997 0.2318 0.2458 -0.0012 0.0089  -0.0123 131 MET A CE  
1044 N N   . LYS A 132 ? 0.2532 0.3154 0.2835 0.0129  -0.0013 0.0152  132 LYS A N   
1045 C CA  . LYS A 132 ? 0.2578 0.3238 0.2733 0.0090  -0.0052 0.0142  132 LYS A CA  
1046 C C   . LYS A 132 ? 0.2399 0.2918 0.2486 0.0091  0.0007  0.0147  132 LYS A C   
1047 O O   . LYS A 132 ? 0.2377 0.2844 0.2379 0.0040  0.0012  0.0085  132 LYS A O   
1048 C CB  . LYS A 132 ? 0.2912 0.3737 0.3022 0.0127  -0.0108 0.0231  132 LYS A CB  
1049 C CG  . LYS A 132 ? 0.3208 0.4227 0.3360 0.0101  -0.0186 0.0217  132 LYS A CG  
1050 C CD  . LYS A 132 ? 0.3777 0.4990 0.3864 0.0131  -0.0254 0.0309  132 LYS A CD  
1051 C CE  . LYS A 132 ? 0.4206 0.5644 0.4324 0.0077  -0.0344 0.0279  132 LYS A CE  
1052 N NZ  . LYS A 132 ? 0.4768 0.6446 0.4830 0.0097  -0.0429 0.0369  132 LYS A NZ  
1053 N N   . ALA A 133 ? 0.2382 0.2837 0.2516 0.0152  0.0062  0.0226  133 ALA A N   
1054 C CA  . ALA A 133 ? 0.2376 0.2701 0.2472 0.0149  0.0130  0.0233  133 ALA A CA  
1055 C C   . ALA A 133 ? 0.2071 0.2309 0.2214 0.0093  0.0155  0.0136  133 ALA A C   
1056 O O   . ALA A 133 ? 0.2090 0.2285 0.2170 0.0063  0.0175  0.0106  133 ALA A O   
1057 C CB  . ALA A 133 ? 0.2461 0.2709 0.2627 0.0215  0.0200  0.0328  133 ALA A CB  
1058 N N   . ALA A 134 ? 0.1937 0.2159 0.2185 0.0081  0.0155  0.0092  134 ALA A N   
1059 C CA  . ALA A 134 ? 0.1733 0.1895 0.2028 0.0032  0.0172  0.0014  134 ALA A CA  
1060 C C   . ALA A 134 ? 0.1635 0.1828 0.1861 -0.0010 0.0134  -0.0042 134 ALA A C   
1061 O O   . ALA A 134 ? 0.1633 0.1783 0.1862 -0.0034 0.0156  -0.0074 134 ALA A O   
1062 C CB  . ALA A 134 ? 0.1741 0.1895 0.2133 0.0026  0.0176  -0.0021 134 ALA A CB  
1063 N N   . LEU A 135 ? 0.1555 0.1823 0.1731 -0.0020 0.0082  -0.0054 135 LEU A N   
1064 C CA  . LEU A 135 ? 0.1518 0.1791 0.1621 -0.0063 0.0060  -0.0109 135 LEU A CA  
1065 C C   . LEU A 135 ? 0.1648 0.1888 0.1643 -0.0068 0.0084  -0.0103 135 LEU A C   
1066 O O   . LEU A 135 ? 0.1652 0.1835 0.1622 -0.0090 0.0110  -0.0145 135 LEU A O   
1067 C CB  . LEU A 135 ? 0.1544 0.1911 0.1625 -0.0086 0.0005  -0.0127 135 LEU A CB  
1068 C CG  . LEU A 135 ? 0.1446 0.1847 0.1622 -0.0092 -0.0010 -0.0146 135 LEU A CG  
1069 C CD1 . LEU A 135 ? 0.1472 0.1993 0.1635 -0.0114 -0.0060 -0.0151 135 LEU A CD1 
1070 C CD2 . LEU A 135 ? 0.1317 0.1652 0.1509 -0.0125 0.0004  -0.0199 135 LEU A CD2 
1071 N N   . GLN A 136 ? 0.1800 0.2075 0.1729 -0.0041 0.0083  -0.0047 136 GLN A N   
1072 C CA  . GLN A 136 ? 0.2085 0.2326 0.1888 -0.0046 0.0116  -0.0040 136 GLN A CA  
1073 C C   . GLN A 136 ? 0.2025 0.2170 0.1879 -0.0035 0.0190  -0.0037 136 GLN A C   
1074 O O   . GLN A 136 ? 0.2140 0.2234 0.1938 -0.0052 0.0231  -0.0072 136 GLN A O   
1075 C CB  . GLN A 136 ? 0.2336 0.2647 0.2055 -0.0013 0.0099  0.0038  136 GLN A CB  
1076 C CG  . GLN A 136 ? 0.2555 0.2998 0.2195 -0.0041 0.0020  0.0026  136 GLN A CG  
1077 C CD  . GLN A 136 ? 0.2830 0.3383 0.2438 0.0009  -0.0013 0.0130  136 GLN A CD  
1078 O OE1 . GLN A 136 ? 0.3067 0.3572 0.2715 0.0070  0.0032  0.0213  136 GLN A OE1 
1079 N NE2 . GLN A 136 ? 0.2972 0.3677 0.2509 -0.0015 -0.0089 0.0130  136 GLN A NE2 
1080 N N   . GLU A 137 ? 0.1993 0.2116 0.1962 -0.0009 0.0213  0.0000  137 GLU A N   
1081 C CA  . GLU A 137 ? 0.1938 0.1997 0.1987 -0.0009 0.0278  0.0004  137 GLU A CA  
1082 C C   . GLU A 137 ? 0.1769 0.1822 0.1889 -0.0037 0.0276  -0.0057 137 GLU A C   
1083 O O   . GLU A 137 ? 0.1854 0.1883 0.2006 -0.0040 0.0326  -0.0062 137 GLU A O   
1084 C CB  . GLU A 137 ? 0.1998 0.2031 0.2156 0.0009  0.0303  0.0046  137 GLU A CB  
1085 C CG  . GLU A 137 ? 0.2229 0.2250 0.2327 0.0054  0.0329  0.0136  137 GLU A CG  
1086 C CD  . GLU A 137 ? 0.2368 0.2345 0.2575 0.0081  0.0359  0.0180  137 GLU A CD  
1087 O OE1 . GLU A 137 ? 0.2251 0.2201 0.2567 0.0052  0.0364  0.0125  137 GLU A OE1 
1088 O OE2 . GLU A 137 ? 0.2532 0.2498 0.2711 0.0133  0.0380  0.0268  137 GLU A OE2 
1089 N N   . GLY A 138 ? 0.1594 0.1680 0.1747 -0.0053 0.0223  -0.0095 138 GLY A N   
1090 C CA  . GLY A 138 ? 0.1507 0.1596 0.1711 -0.0072 0.0214  -0.0138 138 GLY A CA  
1091 C C   . GLY A 138 ? 0.1586 0.1642 0.1711 -0.0074 0.0237  -0.0160 138 GLY A C   
1092 O O   . GLY A 138 ? 0.1607 0.1648 0.1785 -0.0067 0.0272  -0.0165 138 GLY A O   
1093 N N   . HIS A 139 ? 0.1687 0.1737 0.1690 -0.0085 0.0222  -0.0174 139 HIS A N   
1094 C CA  . HIS A 139 ? 0.1851 0.1846 0.1752 -0.0100 0.0256  -0.0213 139 HIS A CA  
1095 C C   . HIS A 139 ? 0.2046 0.1995 0.1920 -0.0079 0.0332  -0.0196 139 HIS A C   
1096 O O   . HIS A 139 ? 0.2049 0.1943 0.1935 -0.0070 0.0391  -0.0217 139 HIS A O   
1097 C CB  . HIS A 139 ? 0.2035 0.2057 0.1802 -0.0133 0.0217  -0.0236 139 HIS A CB  
1098 C CG  . HIS A 139 ? 0.2325 0.2277 0.1975 -0.0171 0.0251  -0.0302 139 HIS A CG  
1099 N ND1 . HIS A 139 ? 0.2582 0.2485 0.2106 -0.0178 0.0306  -0.0319 139 HIS A ND1 
1100 C CD2 . HIS A 139 ? 0.2379 0.2280 0.2020 -0.0207 0.0253  -0.0359 139 HIS A CD2 
1101 C CE1 . HIS A 139 ? 0.2803 0.2623 0.2237 -0.0221 0.0343  -0.0394 139 HIS A CE1 
1102 N NE2 . HIS A 139 ? 0.2667 0.2481 0.2179 -0.0239 0.0312  -0.0416 139 HIS A NE2 
1103 N N   . GLN A 140 ? 0.2114 0.2082 0.1963 -0.0067 0.0340  -0.0156 140 GLN A N   
1104 C CA  . GLN A 140 ? 0.2176 0.2107 0.2002 -0.0046 0.0423  -0.0125 140 GLN A CA  
1105 C C   . GLN A 140 ? 0.2092 0.2026 0.2089 -0.0030 0.0465  -0.0116 140 GLN A C   
1106 O O   . GLN A 140 ? 0.2141 0.2042 0.2144 -0.0015 0.0542  -0.0116 140 GLN A O   
1107 C CB  . GLN A 140 ? 0.2391 0.2347 0.2184 -0.0030 0.0422  -0.0058 140 GLN A CB  
1108 C CG  . GLN A 140 ? 0.2613 0.2529 0.2363 -0.0014 0.0510  -0.0017 140 GLN A CG  
1109 C CD  . GLN A 140 ? 0.2839 0.2769 0.2532 0.0006  0.0508  0.0062  140 GLN A CD  
1110 O OE1 . GLN A 140 ? 0.2834 0.2810 0.2531 0.0016  0.0440  0.0090  140 GLN A OE1 
1111 N NE2 . GLN A 140 ? 0.2991 0.2882 0.2633 0.0020  0.0591  0.0109  140 GLN A NE2 
1112 N N   . PHE A 141 ? 0.1901 0.1883 0.2033 -0.0033 0.0425  -0.0104 141 PHE A N   
1113 C CA  . PHE A 141 ? 0.1887 0.1911 0.2186 -0.0029 0.0447  -0.0097 141 PHE A CA  
1114 C C   . PHE A 141 ? 0.1942 0.1965 0.2273 -0.0013 0.0456  -0.0121 141 PHE A C   
1115 O O   . PHE A 141 ? 0.2044 0.2089 0.2469 0.0009  0.0511  -0.0105 141 PHE A O   
1116 C CB  . PHE A 141 ? 0.1781 0.1859 0.2184 -0.0052 0.0388  -0.0097 141 PHE A CB  
1117 C CG  . PHE A 141 ? 0.1895 0.2052 0.2455 -0.0062 0.0380  -0.0101 141 PHE A CG  
1118 C CD1 . PHE A 141 ? 0.1855 0.2058 0.2538 -0.0076 0.0424  -0.0082 141 PHE A CD1 
1119 C CD2 . PHE A 141 ? 0.1784 0.1984 0.2371 -0.0061 0.0327  -0.0119 141 PHE A CD2 
1120 C CE1 . PHE A 141 ? 0.1937 0.2253 0.2774 -0.0092 0.0404  -0.0085 141 PHE A CE1 
1121 C CE2 . PHE A 141 ? 0.1800 0.2102 0.2523 -0.0068 0.0308  -0.0111 141 PHE A CE2 
1122 C CZ  . PHE A 141 ? 0.1830 0.2202 0.2681 -0.0085 0.0340  -0.0097 141 PHE A CZ  
1123 N N   . LEU A 142 ? 0.1899 0.1897 0.2162 -0.0022 0.0408  -0.0151 142 LEU A N   
1124 C CA  . LEU A 142 ? 0.2070 0.2039 0.2353 -0.0002 0.0429  -0.0164 142 LEU A CA  
1125 C C   . LEU A 142 ? 0.2316 0.2197 0.2530 0.0019  0.0524  -0.0179 142 LEU A C   
1126 O O   . LEU A 142 ? 0.2421 0.2293 0.2725 0.0059  0.0582  -0.0163 142 LEU A O   
1127 C CB  . LEU A 142 ? 0.2011 0.1948 0.2215 -0.0027 0.0374  -0.0197 142 LEU A CB  
1128 C CG  . LEU A 142 ? 0.1858 0.1874 0.2137 -0.0041 0.0297  -0.0186 142 LEU A CG  
1129 C CD1 . LEU A 142 ? 0.1876 0.1866 0.2074 -0.0071 0.0252  -0.0217 142 LEU A CD1 
1130 C CD2 . LEU A 142 ? 0.1805 0.1884 0.2217 -0.0016 0.0291  -0.0153 142 LEU A CD2 
1131 N N   . CYS A 143 ? 0.2481 0.2304 0.2536 -0.0003 0.0545  -0.0206 143 CYS A N   
1132 C CA  . CYS A 143 ? 0.2814 0.2547 0.2777 0.0007  0.0647  -0.0231 143 CYS A CA  
1133 C C   . CYS A 143 ? 0.2845 0.2611 0.2923 0.0047  0.0726  -0.0187 143 CYS A C   
1134 O O   . CYS A 143 ? 0.3030 0.2742 0.3136 0.0081  0.0821  -0.0194 143 CYS A O   
1135 C CB  . CYS A 143 ? 0.3155 0.2847 0.2904 -0.0034 0.0641  -0.0268 143 CYS A CB  
1136 S SG  . CYS A 143 ? 0.3861 0.3529 0.3499 -0.0090 0.0565  -0.0331 143 CYS A SG  
1137 N N   . SER A 144 ? 0.2724 0.2573 0.2882 0.0042  0.0699  -0.0142 144 SER A N   
1138 C CA  . SER A 144 ? 0.2839 0.2727 0.3114 0.0065  0.0779  -0.0103 144 SER A CA  
1139 C C   . SER A 144 ? 0.2950 0.2921 0.3443 0.0101  0.0790  -0.0079 144 SER A C   
1140 O O   . SER A 144 ? 0.3028 0.3012 0.3612 0.0137  0.0884  -0.0059 144 SER A O   
1141 C CB  . SER A 144 ? 0.2790 0.2730 0.3102 0.0041  0.0760  -0.0062 144 SER A CB  
1142 O OG  . SER A 144 ? 0.2793 0.2826 0.3263 0.0024  0.0683  -0.0050 144 SER A OG  
1143 N N   . ILE A 145 ? 0.2937 0.2975 0.3513 0.0094  0.0698  -0.0075 145 ILE A N   
1144 C CA  A ILE A 145 ? 0.3093 0.3235 0.3861 0.0130  0.0688  -0.0040 145 ILE A CA  
1145 C CA  B ILE A 145 ? 0.2998 0.3141 0.3771 0.0132  0.0697  -0.0038 145 ILE A CA  
1146 C C   . ILE A 145 ? 0.3250 0.3309 0.4009 0.0190  0.0767  -0.0040 145 ILE A C   
1147 O O   . ILE A 145 ? 0.3484 0.3603 0.4397 0.0244  0.0833  0.0001  145 ILE A O   
1148 C CB  A ILE A 145 ? 0.3011 0.3222 0.3811 0.0106  0.0571  -0.0039 145 ILE A CB  
1149 C CB  B ILE A 145 ? 0.2791 0.3054 0.3663 0.0105  0.0583  -0.0025 145 ILE A CB  
1150 C CG1 A ILE A 145 ? 0.2899 0.3185 0.3735 0.0049  0.0508  -0.0045 145 ILE A CG1 
1151 C CG1 B ILE A 145 ? 0.2678 0.2875 0.3433 0.0097  0.0517  -0.0051 145 ILE A CG1 
1152 C CG2 A ILE A 145 ? 0.3215 0.3532 0.4175 0.0152  0.0554  0.0006  145 ILE A CG2 
1153 C CG2 B ILE A 145 ? 0.2742 0.3057 0.3635 0.0047  0.0545  -0.0032 145 ILE A CG2 
1154 C CD1 A ILE A 145 ? 0.3121 0.3489 0.4091 0.0035  0.0557  -0.0021 145 ILE A CD1 
1155 C CD1 B ILE A 145 ? 0.2446 0.2755 0.3271 0.0067  0.0416  -0.0043 145 ILE A CD1 
1156 N N   . GLU A 146 ? 0.3426 0.3347 0.4012 0.0177  0.0764  -0.0087 146 GLU A N   
1157 C CA  . GLU A 146 ? 0.4042 0.3838 0.4593 0.0222  0.0855  -0.0102 146 GLU A CA  
1158 C C   . GLU A 146 ? 0.4305 0.4043 0.4852 0.0255  0.0991  -0.0109 146 GLU A C   
1159 O O   . GLU A 146 ? 0.4624 0.4335 0.5277 0.0323  0.1083  -0.0083 146 GLU A O   
1160 C CB  . GLU A 146 ? 0.4313 0.3960 0.4658 0.0177  0.0841  -0.0173 146 GLU A CB  
1161 C CG  . GLU A 146 ? 0.4776 0.4456 0.5125 0.0151  0.0733  -0.0168 146 GLU A CG  
1162 C CD  . GLU A 146 ? 0.4715 0.4294 0.4867 0.0082  0.0702  -0.0241 146 GLU A CD  
1163 O OE1 . GLU A 146 ? 0.4860 0.4502 0.4999 0.0044  0.0603  -0.0242 146 GLU A OE1 
1164 O OE2 . GLU A 146 ? 0.4912 0.4361 0.4926 0.0061  0.0779  -0.0303 146 GLU A OE2 
1165 N N   . ALA A 147 ? 0.4237 0.3956 0.4665 0.0214  0.1011  -0.0136 147 ALA A N   
1166 C CA  . ALA A 147 ? 0.4740 0.4410 0.5152 0.0240  0.1149  -0.0140 147 ALA A CA  
1167 C C   . ALA A 147 ? 0.4956 0.4772 0.5633 0.0295  0.1196  -0.0067 147 ALA A C   
1168 O O   . ALA A 147 ? 0.5333 0.5115 0.6083 0.0354  0.1323  -0.0056 147 ALA A O   
1169 C CB  . ALA A 147 ? 0.4603 0.4235 0.4820 0.0186  0.1157  -0.0169 147 ALA A CB  
1170 N N   . LEU A 148 ? 0.4944 0.4926 0.5768 0.0272  0.1100  -0.0021 148 LEU A N   
1171 C CA  . LEU A 148 ? 0.5262 0.5421 0.6353 0.0305  0.1126  0.0042  148 LEU A CA  
1172 C C   . LEU A 148 ? 0.5721 0.5950 0.6995 0.0385  0.1139  0.0090  148 LEU A C   
1173 O O   . LEU A 148 ? 0.5721 0.6035 0.7182 0.0446  0.1231  0.0138  148 LEU A O   
1174 C CB  . LEU A 148 ? 0.5034 0.5347 0.6229 0.0244  0.1017  0.0064  148 LEU A CB  
1175 C CG  . LEU A 148 ? 0.5178 0.5449 0.6273 0.0185  0.1040  0.0050  148 LEU A CG  
1176 C CD1 . LEU A 148 ? 0.5076 0.5477 0.6294 0.0123  0.0946  0.0064  148 LEU A CD1 
1177 C CD2 . LEU A 148 ? 0.5160 0.5419 0.6295 0.0207  0.1185  0.0069  148 LEU A CD2 
1178 N N   . GLU A 149 ? 0.5930 0.6123 0.7152 0.0389  0.1056  0.0086  149 GLU A N   
1179 C CA  . GLU A 149 ? 0.6264 0.6503 0.7636 0.0473  0.1067  0.0146  149 GLU A CA  
1180 C C   . GLU A 149 ? 0.6656 0.6707 0.7974 0.0544  0.1225  0.0130  149 GLU A C   
1181 O O   . GLU A 149 ? 0.6771 0.6879 0.8279 0.0638  0.1301  0.0198  149 GLU A O   
1182 C CB  . GLU A 149 ? 0.6311 0.6548 0.7624 0.0455  0.0946  0.0150  149 GLU A CB  
1183 C CG  . GLU A 149 ? 0.6477 0.6895 0.7847 0.0389  0.0799  0.0161  149 GLU A CG  
1184 C CD  . GLU A 149 ? 0.6914 0.7289 0.8169 0.0359  0.0695  0.0146  149 GLU A CD  
1185 O OE1 . GLU A 149 ? 0.7406 0.7598 0.8515 0.0371  0.0733  0.0115  149 GLU A OE1 
1186 O OE2 . GLU A 149 ? 0.7078 0.7602 0.8386 0.0316  0.0582  0.0159  149 GLU A OE2 
1187 N N   . HIS A 150 ? 0.7042 0.6876 0.8103 0.0497  0.1277  0.0039  150 HIS A N   
1188 C CA  . HIS A 150 ? 0.7408 0.7029 0.8368 0.0538  0.1440  -0.0007 150 HIS A CA  
1189 C C   . HIS A 150 ? 0.7687 0.7351 0.8777 0.0596  0.1581  0.0020  150 HIS A C   
1190 O O   . HIS A 150 ? 0.7999 0.7594 0.9192 0.0686  0.1712  0.0045  150 HIS A O   
1191 C CB  . HIS A 150 ? 0.7432 0.6859 0.8077 0.0449  0.1448  -0.0120 150 HIS A CB  
1192 C CG  . HIS A 150 ? 0.7883 0.7076 0.8387 0.0467  0.1618  -0.0194 150 HIS A CG  
1193 N ND1 . HIS A 150 ? 0.8067 0.7187 0.8444 0.0448  0.1731  -0.0248 150 HIS A ND1 
1194 C CD2 . HIS A 150 ? 0.8072 0.7073 0.8536 0.0499  0.1705  -0.0228 150 HIS A CD2 
1195 C CE1 . HIS A 150 ? 0.8284 0.7178 0.8537 0.0461  0.1880  -0.0323 150 HIS A CE1 
1196 N NE2 . HIS A 150 ? 0.8275 0.7089 0.8588 0.0492  0.1867  -0.0312 150 HIS A NE2 
1197 N N   . LEU B 3   ? 0.5777 0.6019 0.9319 0.0612  -0.1586 -0.1565 3   LEU B N   
1198 C CA  . LEU B 3   ? 0.5784 0.5842 0.8825 0.0578  -0.1554 -0.1423 3   LEU B CA  
1199 C C   . LEU B 3   ? 0.5762 0.5968 0.8367 0.0534  -0.1286 -0.1351 3   LEU B C   
1200 O O   . LEU B 3   ? 0.5548 0.6103 0.8234 0.0546  -0.1060 -0.1456 3   LEU B O   
1201 C CB  . LEU B 3   ? 0.4412 0.4571 0.7713 0.0626  -0.1543 -0.1570 3   LEU B CB  
1202 C CG  . LEU B 3   ? 0.4592 0.4452 0.7719 0.0604  -0.1691 -0.1423 3   LEU B CG  
1203 C CD1 . LEU B 3   ? 0.4490 0.4448 0.7252 0.0588  -0.1469 -0.1413 3   LEU B CD1 
1204 C CD2 . LEU B 3   ? 0.4861 0.4357 0.7643 0.0535  -0.1904 -0.1142 3   LEU B CD2 
1205 N N   . ARG B 4   ? 0.5393 0.5357 0.7559 0.0480  -0.1325 -0.1174 4   ARG B N   
1206 C CA  . ARG B 4   ? 0.5279 0.5329 0.7104 0.0438  -0.1118 -0.1097 4   ARG B CA  
1207 C C   . ARG B 4   ? 0.4847 0.4687 0.6218 0.0406  -0.1111 -0.0986 4   ARG B C   
1208 O O   . ARG B 4   ? 0.5019 0.4598 0.6174 0.0381  -0.1280 -0.0890 4   ARG B O   
1209 C CB  . ARG B 4   ? 0.5345 0.5334 0.7157 0.0409  -0.1162 -0.1043 4   ARG B CB  
1210 C CG  . ARG B 4   ? 0.5648 0.5742 0.7275 0.0367  -0.0972 -0.0968 4   ARG B CG  
1211 C CD  . ARG B 4   ? 0.5802 0.5878 0.7616 0.0347  -0.1033 -0.0951 4   ARG B CD  
1212 N NE  . ARG B 4   ? 0.5675 0.5887 0.7496 0.0304  -0.0868 -0.0865 4   ARG B NE  
1213 C CZ  . ARG B 4   ? 0.5687 0.6210 0.7834 0.0279  -0.0724 -0.0803 4   ARG B CZ  
1214 N NH1 . ARG B 4   ? 0.5740 0.6508 0.8208 0.0298  -0.0689 -0.0858 4   ARG B NH1 
1215 N NH2 . ARG B 4   ? 0.5757 0.6379 0.7948 0.0227  -0.0615 -0.0675 4   ARG B NH2 
1216 N N   . ALA B 5   ? 0.4185 0.4175 0.5423 0.0401  -0.0916 -0.0991 5   ALA B N   
1217 C CA  . ALA B 5   ? 0.3916 0.3746 0.4778 0.0367  -0.0875 -0.0893 5   ALA B CA  
1218 C C   . ALA B 5   ? 0.3629 0.3568 0.4278 0.0334  -0.0677 -0.0845 5   ALA B C   
1219 O O   . ALA B 5   ? 0.3531 0.3711 0.4346 0.0334  -0.0565 -0.0866 5   ALA B O   
1220 C CB  . ALA B 5   ? 0.3767 0.3609 0.4753 0.0397  -0.0894 -0.0944 5   ALA B CB  
1221 N N   . CYS B 6   ? 0.3508 0.3288 0.3830 0.0297  -0.0643 -0.0764 6   CYS B N   
1222 C CA  . CYS B 6   ? 0.3372 0.3215 0.3553 0.0265  -0.0489 -0.0723 6   CYS B CA  
1223 C C   . CYS B 6   ? 0.3165 0.2921 0.3118 0.0247  -0.0423 -0.0682 6   CYS B C   
1224 O O   . CYS B 6   ? 0.3256 0.2842 0.3066 0.0234  -0.0509 -0.0641 6   CYS B O   
1225 C CB  . CYS B 6   ? 0.3707 0.3439 0.3796 0.0236  -0.0528 -0.0713 6   CYS B CB  
1226 S SG  . CYS B 6   ? 0.4240 0.4022 0.4645 0.0255  -0.0650 -0.0760 6   CYS B SG  
1227 N N   . GLY B 7   ? 0.2744 0.2631 0.2695 0.0237  -0.0282 -0.0666 7   GLY B N   
1228 C CA  . GLY B 7   ? 0.2579 0.2401 0.2381 0.0223  -0.0216 -0.0638 7   GLY B CA  
1229 C C   . GLY B 7   ? 0.2380 0.2304 0.2184 0.0201  -0.0090 -0.0604 7   GLY B C   
1230 O O   . GLY B 7   ? 0.2244 0.2279 0.2175 0.0188  -0.0063 -0.0576 7   GLY B O   
1231 N N   . LEU B 8   ? 0.2282 0.2164 0.2002 0.0191  -0.0030 -0.0589 8   LEU B N   
1232 C CA  . LEU B 8   ? 0.2209 0.2171 0.1971 0.0170  0.0065  -0.0552 8   LEU B CA  
1233 C C   . LEU B 8   ? 0.2153 0.2259 0.1975 0.0194  0.0090  -0.0569 8   LEU B C   
1234 O O   . LEU B 8   ? 0.2297 0.2323 0.2102 0.0212  0.0062  -0.0611 8   LEU B O   
1235 C CB  . LEU B 8   ? 0.2332 0.2125 0.1971 0.0134  0.0120  -0.0551 8   LEU B CB  
1236 C CG  . LEU B 8   ? 0.2549 0.2250 0.2121 0.0113  0.0097  -0.0597 8   LEU B CG  
1237 C CD1 . LEU B 8   ? 0.2687 0.2303 0.2111 0.0077  0.0179  -0.0646 8   LEU B CD1 
1238 C CD2 . LEU B 8   ? 0.2382 0.2177 0.2208 0.0114  0.0083  -0.0595 8   LEU B CD2 
1239 N N   . ILE B 9   ? 0.2035 0.2374 0.1955 0.0188  0.0126  -0.0527 9   ILE B N   
1240 C CA  . ILE B 9   ? 0.1982 0.2473 0.1926 0.0202  0.0145  -0.0548 9   ILE B CA  
1241 C C   . ILE B 9   ? 0.2033 0.2356 0.1977 0.0172  0.0187  -0.0498 9   ILE B C   
1242 O O   . ILE B 9   ? 0.1944 0.2303 0.1978 0.0137  0.0211  -0.0406 9   ILE B O   
1243 C CB  . ILE B 9   ? 0.1964 0.2825 0.1968 0.0189  0.0160  -0.0486 9   ILE B CB  
1244 C CG1 . ILE B 9   ? 0.1971 0.3057 0.2005 0.0222  0.0146  -0.0583 9   ILE B CG1 
1245 C CG2 . ILE B 9   ? 0.1938 0.2982 0.1933 0.0196  0.0158  -0.0502 9   ILE B CG2 
1246 C CD1 . ILE B 9   ? 0.2021 0.3489 0.2104 0.0178  0.0189  -0.0458 9   ILE B CD1 
1247 N N   . ILE B 10  ? 0.2095 0.2243 0.1999 0.0182  0.0189  -0.0553 10  ILE B N   
1248 C CA  . ILE B 10  ? 0.2150 0.2152 0.2074 0.0152  0.0250  -0.0527 10  ILE B CA  
1249 C C   . ILE B 10  ? 0.2056 0.2196 0.2113 0.0164  0.0240  -0.0532 10  ILE B C   
1250 O O   . ILE B 10  ? 0.2063 0.2335 0.2158 0.0206  0.0181  -0.0610 10  ILE B O   
1251 C CB  . ILE B 10  ? 0.2334 0.2149 0.2190 0.0142  0.0252  -0.0539 10  ILE B CB  
1252 C CG1 . ILE B 10  ? 0.2487 0.2186 0.2166 0.0120  0.0236  -0.0516 10  ILE B CG1 
1253 C CG2 . ILE B 10  ? 0.2442 0.2167 0.2354 0.0104  0.0341  -0.0514 10  ILE B CG2 
1254 C CD1 . ILE B 10  ? 0.2664 0.2321 0.2258 0.0081  0.0314  -0.0521 10  ILE B CD1 
1255 N N   . PHE B 11  ? 0.1954 0.2089 0.2123 0.0133  0.0278  -0.0471 11  PHE B N   
1256 C CA  . PHE B 11  ? 0.2071 0.2325 0.2378 0.0139  0.0243  -0.0461 11  PHE B CA  
1257 C C   . PHE B 11  ? 0.2149 0.2252 0.2630 0.0110  0.0304  -0.0451 11  PHE B C   
1258 O O   . PHE B 11  ? 0.2097 0.2069 0.2599 0.0080  0.0383  -0.0457 11  PHE B O   
1259 C CB  . PHE B 11  ? 0.2019 0.2548 0.2361 0.0127  0.0178  -0.0358 11  PHE B CB  
1260 C CG  . PHE B 11  ? 0.2045 0.2542 0.2565 0.0076  0.0183  -0.0219 11  PHE B CG  
1261 C CD1 . PHE B 11  ? 0.2034 0.2492 0.2558 0.0058  0.0201  -0.0177 11  PHE B CD1 
1262 C CD2 . PHE B 11  ? 0.2121 0.2629 0.2881 0.0050  0.0144  -0.0139 11  PHE B CD2 
1263 C CE1 . PHE B 11  ? 0.2146 0.2576 0.2950 0.0016  0.0178  -0.0071 11  PHE B CE1 
1264 C CE2 . PHE B 11  ? 0.2208 0.2683 0.3256 0.0006  0.0119  -0.0020 11  PHE B CE2 
1265 C CZ  . PHE B 11  ? 0.2197 0.2631 0.3285 -0.0009 0.0135  0.0005  11  PHE B CZ  
1266 N N   . ARG B 12  ? 0.2322 0.2473 0.2951 0.0121  0.0266  -0.0468 12  ARG B N   
1267 C CA  . ARG B 12  ? 0.2639 0.2690 0.3517 0.0094  0.0314  -0.0462 12  ARG B CA  
1268 C C   . ARG B 12  ? 0.2838 0.3054 0.3892 0.0098  0.0197  -0.0400 12  ARG B C   
1269 O O   . ARG B 12  ? 0.2784 0.3207 0.3715 0.0125  0.0096  -0.0398 12  ARG B O   
1270 C CB  . ARG B 12  ? 0.2782 0.2698 0.3724 0.0095  0.0378  -0.0532 12  ARG B CB  
1271 C CG  . ARG B 12  ? 0.2738 0.2728 0.3745 0.0140  0.0271  -0.0593 12  ARG B CG  
1272 C CD  . ARG B 12  ? 0.2987 0.2825 0.4150 0.0125  0.0331  -0.0616 12  ARG B CD  
1273 N NE  . ARG B 12  ? 0.3106 0.2997 0.4464 0.0173  0.0206  -0.0705 12  ARG B NE  
1274 C CZ  . ARG B 12  ? 0.3324 0.3102 0.4912 0.0165  0.0207  -0.0713 12  ARG B CZ  
1275 N NH1 . ARG B 12  ? 0.3424 0.3055 0.5015 0.0095  0.0346  -0.0599 12  ARG B NH1 
1276 N NH2 . ARG B 12  ? 0.3269 0.3114 0.5109 0.0221  0.0061  -0.0837 12  ARG B NH2 
1277 N N   . ARG B 13  ? 0.3230 0.3388 0.4586 0.0070  0.0204  -0.0363 13  ARG B N   
1278 C CA  . ARG B 13  ? 0.3876 0.4180 0.5445 0.0062  0.0062  -0.0264 13  ARG B CA  
1279 C C   . ARG B 13  ? 0.4433 0.4637 0.6321 0.0066  0.0065  -0.0335 13  ARG B C   
1280 O O   . ARG B 13  ? 0.4541 0.4580 0.6638 0.0048  0.0195  -0.0405 13  ARG B O   
1281 C CB  . ARG B 13  ? 0.4068 0.4411 0.5845 0.0017  0.0011  -0.0110 13  ARG B CB  
1282 C CG  . ARG B 13  ? 0.4655 0.5259 0.6459 -0.0011 -0.0169 0.0098  13  ARG B CG  
1283 C CD  . ARG B 13  ? 0.4989 0.5585 0.7185 -0.0068 -0.0247 0.0291  13  ARG B CD  
1284 N NE  . ARG B 13  ? 0.4633 0.5112 0.6859 -0.0077 -0.0151 0.0259  13  ARG B NE  
1285 C CZ  . ARG B 13  ? 0.4808 0.5426 0.6955 -0.0110 -0.0196 0.0423  13  ARG B CZ  
1286 N NH1 . ARG B 13  ? 0.4865 0.5783 0.6848 -0.0148 -0.0308 0.0648  13  ARG B NH1 
1287 N NH2 . ARG B 13  ? 0.4539 0.5029 0.6772 -0.0110 -0.0126 0.0357  13  ARG B NH2 
1288 N N   . CYS B 14  ? 0.5295 0.5635 0.7237 0.0087  -0.0076 -0.0330 14  CYS B N   
1289 C CA  . CYS B 14  ? 0.6327 0.6586 0.8626 0.0094  -0.0103 -0.0395 14  CYS B CA  
1290 C C   . CYS B 14  ? 0.6607 0.6915 0.9278 0.0063  -0.0236 -0.0270 14  CYS B C   
1291 O O   . CYS B 14  ? 0.6742 0.7264 0.9352 0.0057  -0.0426 -0.0147 14  CYS B O   
1292 C CB  . CYS B 14  ? 0.6812 0.7185 0.9031 0.0145  -0.0215 -0.0505 14  CYS B CB  
1293 S SG  . CYS B 14  ? 0.8298 0.8602 1.1012 0.0158  -0.0299 -0.0584 14  CYS B SG  
1294 N N   . LEU B 15  ? 0.7347 0.7490 1.0430 0.0040  -0.0145 -0.0305 15  LEU B N   
1295 C CA  . LEU B 15  ? 0.8456 0.8619 1.2032 0.0014  -0.0295 -0.0203 15  LEU B CA  
1296 C C   . LEU B 15  ? 0.8788 0.9022 1.2552 0.0035  -0.0465 -0.0213 15  LEU B C   
1297 O O   . LEU B 15  ? 0.9015 0.9388 1.2938 0.0016  -0.0697 -0.0052 15  LEU B O   
1298 C CB  . LEU B 15  ? 0.8489 0.8488 1.2546 -0.0005 -0.0146 -0.0308 15  LEU B CB  
1299 C CG  . LEU B 15  ? 0.8157 0.8143 1.2891 -0.0027 -0.0297 -0.0242 15  LEU B CG  
1300 C CD1 . LEU B 15  ? 0.8200 0.8319 1.2984 -0.0063 -0.0554 0.0038  15  LEU B CD1 
1301 C CD2 . LEU B 15  ? 0.8166 0.8038 1.3358 -0.0036 -0.0111 -0.0430 15  LEU B CD2 
1302 N N   . ILE B 16  ? 0.9030 0.9181 1.2799 0.0069  -0.0369 -0.0385 16  ILE B N   
1303 C CA  . ILE B 16  ? 0.9467 0.9678 1.3442 0.0099  -0.0536 -0.0441 16  ILE B CA  
1304 C C   . ILE B 16  ? 1.0263 1.0733 1.3802 0.0131  -0.0731 -0.0414 16  ILE B C   
1305 O O   . ILE B 16  ? 1.0549 1.1116 1.3634 0.0133  -0.0674 -0.0389 16  ILE B O   
1306 C CB  . ILE B 16  ? 0.9216 0.9274 1.3394 0.0119  -0.0378 -0.0618 16  ILE B CB  
1307 C CG1 . ILE B 16  ? 0.9416 0.9509 1.3198 0.0158  -0.0353 -0.0710 16  ILE B CG1 
1308 C CG2 . ILE B 16  ? 0.8800 0.8693 1.3197 0.0076  -0.0102 -0.0661 16  ILE B CG2 
1309 C CD1 . ILE B 16  ? 0.9436 0.9619 1.3373 0.0212  -0.0546 -0.0833 16  ILE B CD1 
1310 N N   . PRO B 17  ? 1.0671 1.1291 1.4358 0.0156  -0.0967 -0.0440 17  PRO B N   
1311 C CA  . PRO B 17  ? 1.0775 1.1729 1.4007 0.0185  -0.1137 -0.0459 17  PRO B CA  
1312 C C   . PRO B 17  ? 1.0472 1.1433 1.3439 0.0247  -0.1031 -0.0697 17  PRO B C   
1313 O O   . PRO B 17  ? 1.1076 1.1862 1.4336 0.0284  -0.0984 -0.0870 17  PRO B O   
1314 C CB  . PRO B 17  ? 1.1031 1.2140 1.4521 0.0202  -0.1414 -0.0485 17  PRO B CB  
1315 C CG  . PRO B 17  ? 1.0922 1.1795 1.4999 0.0162  -0.1424 -0.0370 17  PRO B CG  
1316 C CD  . PRO B 17  ? 1.0887 1.1444 1.5131 0.0158  -0.1110 -0.0462 17  PRO B CD  
1317 N N   . LYS B 18  ? 0.9836 1.1002 1.2322 0.0252  -0.0999 -0.0690 18  LYS B N   
1318 C CA  . LYS B 18  ? 0.9351 1.0540 1.1642 0.0314  -0.0922 -0.0920 18  LYS B CA  
1319 C C   . LYS B 18  ? 0.9171 1.0758 1.0988 0.0332  -0.0982 -0.0967 18  LYS B C   
1320 O O   . LYS B 18  ? 0.9359 1.1222 1.0942 0.0283  -0.1066 -0.0777 18  LYS B O   
1321 C CB  . LYS B 18  ? 0.8792 0.9651 1.1103 0.0294  -0.0677 -0.0894 18  LYS B CB  
1322 C CG  . LYS B 18  ? 0.8554 0.9119 1.1282 0.0304  -0.0593 -0.0990 18  LYS B CG  
1323 C CD  . LYS B 18  ? 0.8089 0.8394 1.0770 0.0257  -0.0348 -0.0900 18  LYS B CD  
1324 C CE  . LYS B 18  ? 0.7901 0.7975 1.0998 0.0233  -0.0236 -0.0921 18  LYS B CE  
1325 N NZ  . LYS B 18  ? 0.7492 0.7408 1.0619 0.0163  -0.0013 -0.0803 18  LYS B NZ  
1326 N N   . ASN B 22  ? 0.6232 0.8672 0.7041 0.0322  -0.0937 -0.0968 22  ASN B N   
1327 C CA  . ASN B 22  ? 0.6043 0.8390 0.6690 0.0257  -0.0784 -0.0721 22  ASN B CA  
1328 C C   . ASN B 22  ? 0.5675 0.7533 0.6613 0.0213  -0.0687 -0.0536 22  ASN B C   
1329 O O   . ASN B 22  ? 0.5492 0.7008 0.6690 0.0248  -0.0626 -0.0666 22  ASN B O   
1330 C CB  . ASN B 22  ? 0.6246 0.8632 0.6714 0.0302  -0.0654 -0.0905 22  ASN B CB  
1331 C CG  . ASN B 22  ? 0.6608 0.8927 0.7258 0.0403  -0.0687 -0.1278 22  ASN B CG  
1332 O OD1 . ASN B 22  ? 0.6786 0.9500 0.7353 0.0462  -0.0785 -0.1542 22  ASN B OD1 
1333 N ND2 . ASN B 22  ? 0.6321 0.8174 0.7251 0.0418  -0.0611 -0.1303 22  ASN B ND2 
1334 N N   . ALA B 23  ? 0.5595 0.7460 0.6526 0.0133  -0.0675 -0.0238 23  ALA B N   
1335 C CA  . ALA B 23  ? 0.5255 0.6722 0.6462 0.0098  -0.0568 -0.0118 23  ALA B CA  
1336 C C   . ALA B 23  ? 0.4760 0.6026 0.5827 0.0118  -0.0383 -0.0215 23  ALA B C   
1337 O O   . ALA B 23  ? 0.4601 0.5533 0.5843 0.0124  -0.0269 -0.0278 23  ALA B O   
1338 C CB  . ALA B 23  ? 0.5451 0.6999 0.6799 0.0011  -0.0646 0.0206  23  ALA B CB  
1339 N N   . ILE B 24  ? 0.4289 0.3713 0.5089 -0.0407 -0.1025 0.0558  24  ILE B N   
1340 C CA  . ILE B 24  ? 0.3738 0.3209 0.4358 -0.0329 -0.0808 0.0512  24  ILE B CA  
1341 C C   . ILE B 24  ? 0.3476 0.2962 0.3959 -0.0305 -0.0676 0.0443  24  ILE B C   
1342 O O   . ILE B 24  ? 0.3517 0.2988 0.3811 -0.0375 -0.0744 0.0414  24  ILE B O   
1343 C CB  . ILE B 24  ? 0.3769 0.3249 0.4077 -0.0359 -0.0831 0.0535  24  ILE B CB  
1344 C CG1 . ILE B 24  ? 0.3798 0.3265 0.4299 -0.0368 -0.0943 0.0606  24  ILE B CG1 
1345 C CG2 . ILE B 24  ? 0.3469 0.2991 0.3607 -0.0279 -0.0636 0.0480  24  ILE B CG2 
1346 C CD1 . ILE B 24  ? 0.4186 0.3634 0.4427 -0.0449 -0.1058 0.0667  24  ILE B CD1 
1347 N N   . GLU B 25  ? 0.3009 0.2518 0.3585 -0.0209 -0.0487 0.0417  25  GLU B N   
1348 C CA  . GLU B 25  ? 0.2932 0.2452 0.3391 -0.0176 -0.0355 0.0369  25  GLU B CA  
1349 C C   . GLU B 25  ? 0.2611 0.2153 0.2868 -0.0105 -0.0212 0.0357  25  GLU B C   
1350 O O   . GLU B 25  ? 0.2437 0.1981 0.2748 -0.0048 -0.0154 0.0375  25  GLU B O   
1351 C CB  . GLU B 25  ? 0.2908 0.2417 0.3685 -0.0135 -0.0271 0.0365  25  GLU B CB  
1352 C CG  . GLU B 25  ? 0.3364 0.2848 0.4371 -0.0206 -0.0433 0.0363  25  GLU B CG  
1353 C CD  . GLU B 25  ? 0.3561 0.3036 0.4939 -0.0165 -0.0343 0.0357  25  GLU B CD  
1354 O OE1 . GLU B 25  ? 0.4036 0.3496 0.5527 -0.0214 -0.0436 0.0323  25  GLU B OE1 
1355 O OE2 . GLU B 25  ? 0.3402 0.2880 0.4951 -0.0088 -0.0173 0.0380  25  GLU B OE2 
1356 N N   . PHE B 26  ? 0.2532 0.2084 0.2581 -0.0108 -0.0160 0.0317  26  PHE B N   
1357 C CA  . PHE B 26  ? 0.2400 0.1966 0.2263 -0.0046 -0.0055 0.0303  26  PHE B CA  
1358 C C   . PHE B 26  ? 0.2470 0.2023 0.2388 0.0016  0.0074  0.0298  26  PHE B C   
1359 O O   . PHE B 26  ? 0.2483 0.2031 0.2507 -0.0014 0.0073  0.0277  26  PHE B O   
1360 C CB  . PHE B 26  ? 0.2493 0.2078 0.2114 -0.0106 -0.0102 0.0261  26  PHE B CB  
1361 C CG  . PHE B 26  ? 0.2641 0.2228 0.2169 -0.0179 -0.0224 0.0283  26  PHE B CG  
1362 C CD1 . PHE B 26  ? 0.2603 0.2202 0.2086 -0.0148 -0.0227 0.0306  26  PHE B CD1 
1363 C CD2 . PHE B 26  ? 0.2912 0.2481 0.2392 -0.0284 -0.0346 0.0284  26  PHE B CD2 
1364 C CE1 . PHE B 26  ? 0.2768 0.2363 0.2190 -0.0216 -0.0339 0.0342  26  PHE B CE1 
1365 C CE2 . PHE B 26  ? 0.3014 0.2569 0.2386 -0.0356 -0.0464 0.0329  26  PHE B CE2 
1366 C CZ  . PHE B 26  ? 0.2968 0.2539 0.2334 -0.0321 -0.0456 0.0365  26  PHE B CZ  
1367 N N   . LEU B 27  ? 0.2354 0.1894 0.2196 0.0099  0.0176  0.0318  27  LEU B N   
1368 C CA  . LEU B 27  ? 0.2460 0.1972 0.2312 0.0160  0.0295  0.0338  27  LEU B CA  
1369 C C   . LEU B 27  ? 0.2513 0.2037 0.2200 0.0161  0.0288  0.0304  27  LEU B C   
1370 O O   . LEU B 27  ? 0.2395 0.1934 0.1914 0.0169  0.0251  0.0284  27  LEU B O   
1371 C CB  . LEU B 27  ? 0.2515 0.1989 0.2319 0.0244  0.0403  0.0381  27  LEU B CB  
1372 C CG  . LEU B 27  ? 0.2665 0.2086 0.2414 0.0311  0.0528  0.0431  27  LEU B CG  
1373 C CD1 . LEU B 27  ? 0.2856 0.2256 0.2865 0.0303  0.0608  0.0469  27  LEU B CD1 
1374 C CD2 . LEU B 27  ? 0.2832 0.2208 0.2420 0.0379  0.0610  0.0456  27  LEU B CD2 
1375 N N   . LEU B 28  ? 0.2550 0.2069 0.2330 0.0152  0.0320  0.0292  28  LEU B N   
1376 C CA  . LEU B 28  ? 0.2636 0.2163 0.2335 0.0159  0.0327  0.0256  28  LEU B CA  
1377 C C   . LEU B 28  ? 0.2849 0.2330 0.2642 0.0223  0.0417  0.0314  28  LEU B C   
1378 O O   . LEU B 28  ? 0.2737 0.2195 0.2708 0.0228  0.0472  0.0352  28  LEU B O   
1379 C CB  . LEU B 28  ? 0.2741 0.2306 0.2478 0.0071  0.0275  0.0165  28  LEU B CB  
1380 C CG  . LEU B 28  ? 0.2831 0.2429 0.2425 -0.0012 0.0187  0.0112  28  LEU B CG  
1381 C CD1 . LEU B 28  ? 0.2992 0.2609 0.2585 -0.0102 0.0165  0.0014  28  LEU B CD1 
1382 C CD2 . LEU B 28  ? 0.2804 0.2419 0.2232 0.0006  0.0176  0.0108  28  LEU B CD2 
1383 N N   . LEU B 29  ? 0.2979 0.2442 0.2672 0.0271  0.0425  0.0326  29  LEU B N   
1384 C CA  . LEU B 29  ? 0.3206 0.2609 0.2958 0.0333  0.0493  0.0405  29  LEU B CA  
1385 C C   . LEU B 29  ? 0.3373 0.2796 0.3258 0.0312  0.0470  0.0350  29  LEU B C   
1386 O O   . LEU B 29  ? 0.3302 0.2771 0.3138 0.0280  0.0415  0.0265  29  LEU B O   
1387 C CB  . LEU B 29  ? 0.3207 0.2554 0.2735 0.0408  0.0497  0.0474  29  LEU B CB  
1388 C CG  . LEU B 29  ? 0.3176 0.2507 0.2544 0.0430  0.0518  0.0494  29  LEU B CG  
1389 C CD1 . LEU B 29  ? 0.3389 0.2657 0.2500 0.0502  0.0505  0.0538  29  LEU B CD1 
1390 C CD2 . LEU B 29  ? 0.3179 0.2483 0.2670 0.0430  0.0623  0.0548  29  LEU B CD2 
1391 N N   . GLN B 30  ? 0.3605 0.2997 0.3695 0.0325  0.0522  0.0390  30  GLN B N   
1392 C CA  . GLN B 30  ? 0.3805 0.3216 0.4082 0.0308  0.0507  0.0326  30  GLN B CA  
1393 C C   . GLN B 30  ? 0.4041 0.3390 0.4306 0.0381  0.0499  0.0417  30  GLN B C   
1394 O O   . GLN B 30  ? 0.4005 0.3277 0.4268 0.0433  0.0547  0.0548  30  GLN B O   
1395 C CB  . GLN B 30  ? 0.3748 0.3162 0.4316 0.0275  0.0553  0.0304  30  GLN B CB  
1396 C CG  . GLN B 30  ? 0.3845 0.3281 0.4643 0.0255  0.0546  0.0218  30  GLN B CG  
1397 C CD  . GLN B 30  ? 0.4015 0.3457 0.5125 0.0220  0.0583  0.0174  30  GLN B CD  
1398 O OE1 . GLN B 30  ? 0.4026 0.3426 0.5247 0.0243  0.0630  0.0270  30  GLN B OE1 
1399 N NE2 . GLN B 30  ? 0.4219 0.3709 0.5485 0.0162  0.0570  0.0019  30  GLN B NE2 
1400 N N   . ALA B 31  ? 0.4270 0.3643 0.4533 0.0382  0.0437  0.0352  31  ALA B N   
1401 C CA  . ALA B 31  ? 0.4551 0.3858 0.4832 0.0450  0.0392  0.0436  31  ALA B CA  
1402 C C   . ALA B 31  ? 0.4878 0.4133 0.5434 0.0472  0.0428  0.0515  31  ALA B C   
1403 O O   . ALA B 31  ? 0.4676 0.3975 0.5502 0.0424  0.0470  0.0433  31  ALA B O   
1404 C CB  . ALA B 31  ? 0.4408 0.3763 0.4748 0.0437  0.0321  0.0329  31  ALA B CB  
1405 N N   . SER B 32  ? 0.5337 0.4489 0.5809 0.0541  0.0406  0.0676  32  SER B N   
1406 C CA  . SER B 32  ? 0.5966 0.5049 0.6698 0.0568  0.0423  0.0783  32  SER B CA  
1407 C C   . SER B 32  ? 0.6250 0.5357 0.7319 0.0563  0.0354  0.0710  32  SER B C   
1408 O O   . SER B 32  ? 0.6297 0.5397 0.7713 0.0554  0.0387  0.0717  32  SER B O   
1409 C CB  . SER B 32  ? 0.6147 0.5095 0.6632 0.0638  0.0404  0.0989  32  SER B CB  
1410 O OG  . SER B 32  ? 0.6463 0.5379 0.6715 0.0640  0.0508  0.1059  32  SER B OG  
1411 N N   . ASP B 33  ? 0.6776 0.5910 0.7781 0.0573  0.0261  0.0639  33  ASP B N   
1412 C CA  . ASP B 33  ? 0.7219 0.6369 0.8570 0.0576  0.0191  0.0572  33  ASP B CA  
1413 C C   . ASP B 33  ? 0.7373 0.6649 0.8921 0.0500  0.0241  0.0339  33  ASP B C   
1414 O O   . ASP B 33  ? 0.6940 0.6283 0.8318 0.0444  0.0309  0.0244  33  ASP B O   
1415 C CB  . ASP B 33  ? 0.7754 0.6838 0.8967 0.0637  0.0046  0.0647  33  ASP B CB  
1416 C CG  . ASP B 33  ? 0.8133 0.7266 0.9030 0.0629  0.0016  0.0566  33  ASP B CG  
1417 O OD1 . ASP B 33  ? 0.8219 0.7454 0.9099 0.0564  0.0096  0.0417  33  ASP B OD1 
1418 O OD2 . ASP B 33  ? 0.8385 0.7446 0.9044 0.0685  -0.0096 0.0653  33  ASP B OD2 
1419 N N   . GLY B 34  ? 0.7403 0.6703 0.9317 0.0495  0.0209  0.0249  34  GLY B N   
1420 C CA  . GLY B 34  ? 0.7104 0.6513 0.9202 0.0421  0.0269  0.0020  34  GLY B CA  
1421 C C   . GLY B 34  ? 0.6981 0.6456 0.9120 0.0341  0.0390  -0.0111 34  GLY B C   
1422 O O   . GLY B 34  ? 0.7198 0.6647 0.9525 0.0342  0.0426  -0.0072 34  GLY B O   
1423 N N   . ILE B 35  ? 0.6884 0.6435 0.8841 0.0268  0.0444  -0.0260 35  ILE B N   
1424 C CA  . ILE B 35  ? 0.6933 0.6541 0.8869 0.0177  0.0537  -0.0407 35  ILE B CA  
1425 C C   . ILE B 35  ? 0.6570 0.6157 0.8204 0.0173  0.0532  -0.0308 35  ILE B C   
1426 O O   . ILE B 35  ? 0.6699 0.6320 0.8285 0.0101  0.0576  -0.0408 35  ILE B O   
1427 C CB  . ILE B 35  ? 0.6974 0.6659 0.8819 0.0090  0.0597  -0.0601 35  ILE B CB  
1428 C CG1 . ILE B 35  ? 0.7046 0.6747 0.9119 0.0113  0.0586  -0.0656 35  ILE B CG1 
1429 C CG2 . ILE B 35  ? 0.7150 0.6881 0.9105 -0.0005 0.0694  -0.0795 35  ILE B CG2 
1430 C CD1 . ILE B 35  ? 0.6973 0.6667 0.8790 0.0147  0.0516  -0.0576 35  ILE B CD1 
1431 N N   . HIS B 36  ? 0.6089 0.5613 0.7532 0.0248  0.0477  -0.0120 36  HIS B N   
1432 C CA  . HIS B 36  ? 0.5697 0.5195 0.6887 0.0255  0.0483  -0.0017 36  HIS B CA  
1433 C C   . HIS B 36  ? 0.5192 0.4743 0.6106 0.0189  0.0483  -0.0100 36  HIS B C   
1434 O O   . HIS B 36  ? 0.5093 0.4662 0.5969 0.0137  0.0502  -0.0137 36  HIS B O   
1435 C CB  . HIS B 36  ? 0.5846 0.5325 0.7254 0.0244  0.0531  0.0004  36  HIS B CB  
1436 C CG  . HIS B 36  ? 0.6378 0.5800 0.8109 0.0298  0.0535  0.0089  36  HIS B CG  
1437 N ND1 . HIS B 36  ? 0.6580 0.5913 0.8248 0.0377  0.0515  0.0291  36  HIS B ND1 
1438 C CD2 . HIS B 36  ? 0.6572 0.6011 0.8706 0.0279  0.0558  -0.0003 36  HIS B CD2 
1439 C CE1 . HIS B 36  ? 0.6786 0.6075 0.8798 0.0406  0.0513  0.0344  36  HIS B CE1 
1440 N NE2 . HIS B 36  ? 0.6771 0.6130 0.9096 0.0348  0.0539  0.0158  36  HIS B NE2 
1441 N N   . HIS B 37  ? 0.4925 0.4499 0.5671 0.0189  0.0449  -0.0126 37  HIS B N   
1442 C CA  . HIS B 37  ? 0.4779 0.4393 0.5257 0.0131  0.0439  -0.0179 37  HIS B CA  
1443 C C   . HIS B 37  ? 0.4327 0.3912 0.4584 0.0155  0.0413  -0.0064 37  HIS B C   
1444 O O   . HIS B 37  ? 0.4248 0.3777 0.4474 0.0232  0.0404  0.0065  37  HIS B O   
1445 C CB  . HIS B 37  ? 0.4844 0.4481 0.5250 0.0139  0.0410  -0.0214 37  HIS B CB  
1446 C CG  . HIS B 37  ? 0.5327 0.5006 0.5966 0.0095  0.0458  -0.0360 37  HIS B CG  
1447 N ND1 . HIS B 37  ? 0.5391 0.5080 0.6121 0.0122  0.0435  -0.0385 37  HIS B ND1 
1448 C CD2 . HIS B 37  ? 0.5437 0.5150 0.6264 0.0024  0.0536  -0.0503 37  HIS B CD2 
1449 C CE1 . HIS B 37  ? 0.5610 0.5341 0.6594 0.0069  0.0508  -0.0535 37  HIS B CE1 
1450 N NE2 . HIS B 37  ? 0.5628 0.5373 0.6654 0.0008  0.0575  -0.0612 37  HIS B NE2 
1451 N N   . TRP B 38  ? 0.4007 0.3625 0.4111 0.0084  0.0403  -0.0113 38  TRP B N   
1452 C CA  . TRP B 38  ? 0.3689 0.3287 0.3631 0.0096  0.0374  -0.0026 38  TRP B CA  
1453 C C   . TRP B 38  ? 0.3478 0.3096 0.3208 0.0088  0.0330  -0.0023 38  TRP B C   
1454 O O   . TRP B 38  ? 0.3426 0.3083 0.3084 0.0014  0.0321  -0.0109 38  TRP B O   
1455 C CB  . TRP B 38  ? 0.3592 0.3205 0.3558 0.0018  0.0363  -0.0074 38  TRP B CB  
1456 C CG  . TRP B 38  ? 0.3658 0.3252 0.3866 0.0025  0.0398  -0.0073 38  TRP B CG  
1457 C CD1 . TRP B 38  ? 0.3718 0.3327 0.4122 -0.0012 0.0428  -0.0179 38  TRP B CD1 
1458 C CD2 . TRP B 38  ? 0.3524 0.3078 0.3849 0.0067  0.0417  0.0029  38  TRP B CD2 
1459 N NE1 . TRP B 38  ? 0.3760 0.3342 0.4392 0.0006  0.0449  -0.0144 38  TRP B NE1 
1460 C CE2 . TRP B 38  ? 0.3670 0.3219 0.4273 0.0053  0.0449  -0.0015 38  TRP B CE2 
1461 C CE3 . TRP B 38  ? 0.3345 0.2870 0.3602 0.0112  0.0424  0.0138  38  TRP B CE3 
1462 C CZ2 . TRP B 38  ? 0.3569 0.3082 0.4379 0.0082  0.0485  0.0062  38  TRP B CZ2 
1463 C CZ3 . TRP B 38  ? 0.3361 0.2850 0.3817 0.0138  0.0474  0.0209  38  TRP B CZ3 
1464 C CH2 . TRP B 38  ? 0.3571 0.3054 0.4301 0.0123  0.0502  0.0177  38  TRP B CH2 
1465 N N   . THR B 39  ? 0.3348 0.2933 0.2973 0.0159  0.0310  0.0072  39  THR B N   
1466 C CA  . THR B 39  ? 0.3338 0.2938 0.2792 0.0159  0.0261  0.0074  39  THR B CA  
1467 C C   . THR B 39  ? 0.3133 0.2698 0.2499 0.0207  0.0256  0.0161  39  THR B C   
1468 O O   . THR B 39  ? 0.3019 0.2540 0.2435 0.0256  0.0303  0.0228  39  THR B O   
1469 C CB  . THR B 39  ? 0.3521 0.3117 0.2955 0.0209  0.0234  0.0061  39  THR B CB  
1470 O OG1 . THR B 39  ? 0.3882 0.3416 0.3296 0.0303  0.0229  0.0148  39  THR B OG1 
1471 C CG2 . THR B 39  ? 0.3777 0.3405 0.3368 0.0173  0.0258  -0.0031 39  THR B CG2 
1472 N N   . PRO B 40  ? 0.3054 0.2637 0.2309 0.0193  0.0209  0.0158  40  PRO B N   
1473 C CA  . PRO B 40  ? 0.2936 0.2487 0.2130 0.0245  0.0214  0.0218  40  PRO B CA  
1474 C C   . PRO B 40  ? 0.3011 0.2512 0.2103 0.0337  0.0226  0.0253  40  PRO B C   
1475 O O   . PRO B 40  ? 0.2981 0.2480 0.2072 0.0355  0.0201  0.0232  40  PRO B O   
1476 C CB  . PRO B 40  ? 0.2817 0.2403 0.1952 0.0203  0.0147  0.0191  40  PRO B CB  
1477 C CG  . PRO B 40  ? 0.2884 0.2512 0.2033 0.0110  0.0119  0.0137  40  PRO B CG  
1478 C CD  . PRO B 40  ? 0.2949 0.2577 0.2146 0.0125  0.0162  0.0099  40  PRO B CD  
1479 N N   . PRO B 41  ? 0.3101 0.2555 0.2108 0.0393  0.0263  0.0301  41  PRO B N   
1480 C CA  . PRO B 41  ? 0.3268 0.2655 0.2116 0.0474  0.0264  0.0336  41  PRO B CA  
1481 C C   . PRO B 41  ? 0.3495 0.2895 0.2255 0.0494  0.0163  0.0282  41  PRO B C   
1482 O O   . PRO B 41  ? 0.3229 0.2674 0.1993 0.0467  0.0118  0.0230  41  PRO B O   
1483 C CB  . PRO B 41  ? 0.3402 0.2742 0.2149 0.0513  0.0335  0.0370  41  PRO B CB  
1484 C CG  . PRO B 41  ? 0.3328 0.2698 0.2266 0.0462  0.0398  0.0381  41  PRO B CG  
1485 C CD  . PRO B 41  ? 0.3049 0.2497 0.2107 0.0385  0.0312  0.0324  41  PRO B CD  
1486 N N   . LYS B 42  ? 0.3689 0.3044 0.2393 0.0543  0.0118  0.0301  42  LYS B N   
1487 C CA  . LYS B 42  ? 0.3799 0.3162 0.2467 0.0566  0.0009  0.0247  42  LYS B CA  
1488 C C   . LYS B 42  ? 0.4231 0.3510 0.2801 0.0637  -0.0053 0.0295  42  LYS B C   
1489 O O   . LYS B 42  ? 0.4369 0.3595 0.2941 0.0655  -0.0010 0.0374  42  LYS B O   
1490 C CB  . LYS B 42  ? 0.3665 0.3110 0.2533 0.0500  -0.0016 0.0176  42  LYS B CB  
1491 C CG  . LYS B 42  ? 0.3754 0.3205 0.2786 0.0480  0.0013  0.0182  42  LYS B CG  
1492 C CD  . LYS B 42  ? 0.3853 0.3378 0.3058 0.0415  0.0005  0.0090  42  LYS B CD  
1493 C CE  . LYS B 42  ? 0.4080 0.3624 0.3472 0.0376  0.0065  0.0067  42  LYS B CE  
1494 N NZ  . LYS B 42  ? 0.4414 0.3916 0.3927 0.0435  0.0011  0.0083  42  LYS B NZ  
1495 N N   . GLY B 43  ? 0.4297 0.3557 0.2797 0.0677  -0.0169 0.0253  43  GLY B N   
1496 C CA  . GLY B 43  ? 0.4802 0.3978 0.3238 0.0739  -0.0276 0.0296  43  GLY B CA  
1497 C C   . GLY B 43  ? 0.4943 0.4130 0.3424 0.0763  -0.0425 0.0217  43  GLY B C   
1498 O O   . GLY B 43  ? 0.4456 0.3706 0.2977 0.0739  -0.0435 0.0134  43  GLY B O   
1499 N N   . HIS B 44  ? 0.5262 0.4381 0.3764 0.0812  -0.0551 0.0248  44  HIS B N   
1500 C CA  . HIS B 44  ? 0.5560 0.4683 0.4171 0.0839  -0.0714 0.0173  44  HIS B CA  
1501 C C   . HIS B 44  ? 0.5549 0.4622 0.3887 0.0883  -0.0792 0.0134  44  HIS B C   
1502 O O   . HIS B 44  ? 0.5834 0.4830 0.3845 0.0910  -0.0747 0.0185  44  HIS B O   
1503 C CB  . HIS B 44  ? 0.5973 0.5027 0.4711 0.0881  -0.0851 0.0223  44  HIS B CB  
1504 C CG  . HIS B 44  ? 0.6904 0.5807 0.5306 0.0944  -0.0921 0.0347  44  HIS B CG  
1505 N ND1 . HIS B 44  ? 0.7232 0.6082 0.5595 0.0943  -0.0840 0.0467  44  HIS B ND1 
1506 C CD2 . HIS B 44  ? 0.7375 0.6158 0.5437 0.1007  -0.1066 0.0370  44  HIS B CD2 
1507 C CE1 . HIS B 44  ? 0.7570 0.6271 0.5579 0.0998  -0.0919 0.0578  44  HIS B CE1 
1508 N NE2 . HIS B 44  ? 0.7818 0.6475 0.5618 0.1036  -0.1060 0.0514  44  HIS B NE2 
1509 N N   . VAL B 45  ? 0.5783 0.4903 0.4278 0.0884  -0.0895 0.0033  45  VAL B N   
1510 C CA  . VAL B 45  ? 0.6140 0.5221 0.4439 0.0924  -0.0989 -0.0033 45  VAL B CA  
1511 C C   . VAL B 45  ? 0.6889 0.5832 0.4959 0.1001  -0.1173 0.0003  45  VAL B C   
1512 O O   . VAL B 45  ? 0.6828 0.5732 0.5034 0.1019  -0.1272 0.0056  45  VAL B O   
1513 C CB  . VAL B 45  ? 0.5983 0.5158 0.4582 0.0898  -0.1048 -0.0149 45  VAL B CB  
1514 C CG1 . VAL B 45  ? 0.5525 0.4817 0.4290 0.0815  -0.0878 -0.0167 45  VAL B CG1 
1515 C CG2 . VAL B 45  ? 0.6180 0.5369 0.5105 0.0905  -0.1168 -0.0171 45  VAL B CG2 
1516 N N   . GLU B 46  ? 0.7392 0.6254 0.5115 0.1042  -0.1223 -0.0028 46  GLU B N   
1517 C CA  . GLU B 46  ? 0.7980 0.6688 0.5390 0.1110  -0.1405 0.0006  46  GLU B CA  
1518 C C   . GLU B 46  ? 0.8428 0.7122 0.5810 0.1145  -0.1578 -0.0131 46  GLU B C   
1519 O O   . GLU B 46  ? 0.8070 0.6854 0.5562 0.1120  -0.1502 -0.0235 46  GLU B O   
1520 C CB  . GLU B 46  ? 0.8298 0.6890 0.5231 0.1125  -0.1292 0.0104  46  GLU B CB  
1521 C CG  . GLU B 46  ? 0.8433 0.6996 0.5398 0.1109  -0.1196 0.0264  46  GLU B CG  
1522 C CD  . GLU B 46  ? 0.8664 0.7123 0.5212 0.1112  -0.1036 0.0369  46  GLU B CD  
1523 O OE1 . GLU B 46  ? 0.8614 0.7083 0.5264 0.1086  -0.0904 0.0483  46  GLU B OE1 
1524 O OE2 . GLU B 46  ? 0.9024 0.7392 0.5165 0.1139  -0.1032 0.0332  46  GLU B OE2 
1525 N N   . PRO B 47  ? 0.9142 0.7719 0.6405 0.1202  -0.1826 -0.0130 47  PRO B N   
1526 C CA  . PRO B 47  ? 0.9388 0.7936 0.6680 0.1243  -0.2051 -0.0264 47  PRO B CA  
1527 C C   . PRO B 47  ? 0.9090 0.7687 0.6309 0.1238  -0.1993 -0.0414 47  PRO B C   
1528 O O   . PRO B 47  ? 0.8955 0.7657 0.6564 0.1224  -0.2039 -0.0525 47  PRO B O   
1529 C CB  . PRO B 47  ? 1.0097 0.8446 0.6940 0.1303  -0.2258 -0.0196 47  PRO B CB  
1530 C CG  . PRO B 47  ? 1.0138 0.8446 0.7005 0.1293  -0.2215 -0.0016 47  PRO B CG  
1531 C CD  . PRO B 47  ? 0.9428 0.7881 0.6545 0.1230  -0.1925 0.0018  47  PRO B CD  
1532 N N   . GLY B 48  ? 0.9123 0.7644 0.5881 0.1248  -0.1887 -0.0420 48  GLY B N   
1533 C CA  . GLY B 48  ? 0.9216 0.7761 0.5894 0.1253  -0.1858 -0.0579 48  GLY B CA  
1534 C C   . GLY B 48  ? 0.8914 0.7570 0.5696 0.1200  -0.1584 -0.0585 48  GLY B C   
1535 O O   . GLY B 48  ? 0.9056 0.7698 0.5657 0.1205  -0.1504 -0.0684 48  GLY B O   
1536 N N   . GLU B 49  ? 0.7930 0.6691 0.5017 0.1149  -0.1451 -0.0487 49  GLU B N   
1537 C CA  . GLU B 49  ? 0.7376 0.6233 0.4576 0.1093  -0.1214 -0.0464 49  GLU B CA  
1538 C C   . GLU B 49  ? 0.6590 0.5594 0.4254 0.1044  -0.1196 -0.0526 49  GLU B C   
1539 O O   . GLU B 49  ? 0.6179 0.5244 0.4160 0.1027  -0.1281 -0.0523 49  GLU B O   
1540 C CB  . GLU B 49  ? 0.7460 0.6324 0.4661 0.1061  -0.1078 -0.0308 49  GLU B CB  
1541 C CG  . GLU B 49  ? 0.7871 0.6649 0.4702 0.1067  -0.0915 -0.0231 49  GLU B CG  
1542 C CD  . GLU B 49  ? 0.7884 0.6671 0.4785 0.1038  -0.0809 -0.0079 49  GLU B CD  
1543 O OE1 . GLU B 49  ? 0.7502 0.6356 0.4716 0.1015  -0.0868 -0.0046 49  GLU B OE1 
1544 O OE2 . GLU B 49  ? 0.7983 0.6706 0.4644 0.1036  -0.0658 0.0000  49  GLU B OE2 
1545 N N   . ASP B 50  ? 0.6187 0.5243 0.3894 0.1018  -0.1075 -0.0579 50  ASP B N   
1546 C CA  . ASP B 50  ? 0.5803 0.4986 0.3892 0.0956  -0.1011 -0.0595 50  ASP B CA  
1547 C C   . ASP B 50  ? 0.5322 0.4561 0.3507 0.0895  -0.0866 -0.0460 50  ASP B C   
1548 O O   . ASP B 50  ? 0.5379 0.4563 0.3333 0.0904  -0.0773 -0.0381 50  ASP B O   
1549 C CB  . ASP B 50  ? 0.6009 0.5193 0.4043 0.0962  -0.0941 -0.0685 50  ASP B CB  
1550 C CG  . ASP B 50  ? 0.5474 0.4765 0.3828 0.0895  -0.0842 -0.0671 50  ASP B CG  
1551 O OD1 . ASP B 50  ? 0.5215 0.4537 0.3586 0.0850  -0.0710 -0.0570 50  ASP B OD1 
1552 O OD2 . ASP B 50  ? 0.5663 0.4997 0.4244 0.0890  -0.0903 -0.0761 50  ASP B OD2 
1553 N N   . ASP B 51  ? 0.4736 0.4074 0.3248 0.0833  -0.0851 -0.0438 51  ASP B N   
1554 C CA  . ASP B 51  ? 0.4523 0.3908 0.3119 0.0772  -0.0735 -0.0336 51  ASP B CA  
1555 C C   . ASP B 51  ? 0.4258 0.3652 0.2763 0.0740  -0.0583 -0.0280 51  ASP B C   
1556 O O   . ASP B 51  ? 0.4198 0.3574 0.2616 0.0727  -0.0498 -0.0200 51  ASP B O   
1557 C CB  . ASP B 51  ? 0.4393 0.3873 0.3317 0.0701  -0.0734 -0.0340 51  ASP B CB  
1558 C CG  . ASP B 51  ? 0.4839 0.4318 0.3919 0.0719  -0.0839 -0.0368 51  ASP B CG  
1559 O OD1 . ASP B 51  ? 0.4893 0.4294 0.3829 0.0787  -0.0936 -0.0371 51  ASP B OD1 
1560 O OD2 . ASP B 51  ? 0.4822 0.4372 0.4176 0.0661  -0.0823 -0.0383 51  ASP B OD2 
1561 N N   . LEU B 52  ? 0.4081 0.3498 0.2642 0.0728  -0.0555 -0.0327 52  LEU B N   
1562 C CA  . LEU B 52  ? 0.3939 0.3357 0.2458 0.0704  -0.0423 -0.0285 52  LEU B CA  
1563 C C   . LEU B 52  ? 0.4295 0.3618 0.2504 0.0764  -0.0356 -0.0274 52  LEU B C   
1564 O O   . LEU B 52  ? 0.4062 0.3372 0.2220 0.0747  -0.0238 -0.0198 52  LEU B O   
1565 C CB  . LEU B 52  ? 0.3719 0.3183 0.2429 0.0679  -0.0418 -0.0339 52  LEU B CB  
1566 C CG  . LEU B 52  ? 0.3711 0.3178 0.2455 0.0654  -0.0294 -0.0302 52  LEU B CG  
1567 C CD1 . LEU B 52  ? 0.3309 0.2803 0.2093 0.0595  -0.0225 -0.0189 52  LEU B CD1 
1568 C CD2 . LEU B 52  ? 0.3470 0.2985 0.2477 0.0622  -0.0313 -0.0345 52  LEU B CD2 
1569 N N   . GLU B 53  ? 0.4646 0.3893 0.2638 0.0831  -0.0431 -0.0346 53  GLU B N   
1570 C CA  . GLU B 53  ? 0.5012 0.4147 0.2645 0.0881  -0.0368 -0.0318 53  GLU B CA  
1571 C C   . GLU B 53  ? 0.4895 0.3993 0.2437 0.0880  -0.0360 -0.0193 53  GLU B C   
1572 O O   . GLU B 53  ? 0.4982 0.4019 0.2341 0.0888  -0.0244 -0.0117 53  GLU B O   
1573 C CB  . GLU B 53  ? 0.5749 0.4794 0.3114 0.0947  -0.0471 -0.0425 53  GLU B CB  
1574 C CG  . GLU B 53  ? 0.5914 0.4986 0.3369 0.0950  -0.0447 -0.0561 53  GLU B CG  
1575 C CD  . GLU B 53  ? 0.6776 0.5737 0.3878 0.1011  -0.0484 -0.0680 53  GLU B CD  
1576 O OE1 . GLU B 53  ? 0.7074 0.5979 0.3975 0.1018  -0.0324 -0.0708 53  GLU B OE1 
1577 O OE2 . GLU B 53  ? 0.6979 0.5905 0.4015 0.1049  -0.0670 -0.0756 53  GLU B OE2 
1578 N N   . THR B 54  ? 0.4809 0.3948 0.2521 0.0868  -0.0471 -0.0173 54  THR B N   
1579 C CA  . THR B 54  ? 0.4933 0.4057 0.2657 0.0857  -0.0451 -0.0065 54  THR B CA  
1580 C C   . THR B 54  ? 0.4528 0.3706 0.2381 0.0799  -0.0289 0.0005  54  THR B C   
1581 O O   . THR B 54  ? 0.4641 0.3768 0.2392 0.0805  -0.0207 0.0095  54  THR B O   
1582 C CB  . THR B 54  ? 0.4890 0.4064 0.2856 0.0843  -0.0575 -0.0078 54  THR B CB  
1583 O OG1 . THR B 54  ? 0.5385 0.4496 0.3253 0.0903  -0.0747 -0.0136 54  THR B OG1 
1584 C CG2 . THR B 54  ? 0.4806 0.3970 0.2838 0.0828  -0.0538 0.0020  54  THR B CG2 
1585 N N   . ALA B 55  ? 0.4011 0.3285 0.2097 0.0742  -0.0257 -0.0030 55  ALA B N   
1586 C CA  . ALA B 55  ? 0.3813 0.3138 0.2039 0.0681  -0.0141 0.0024  55  ALA B CA  
1587 C C   . ALA B 55  ? 0.4018 0.3284 0.2104 0.0703  -0.0008 0.0061  55  ALA B C   
1588 O O   . ALA B 55  ? 0.3950 0.3201 0.2049 0.0688  0.0081  0.0140  55  ALA B O   
1589 C CB  . ALA B 55  ? 0.3336 0.2750 0.1788 0.0618  -0.0157 -0.0015 55  ALA B CB  
1590 N N   . LEU B 56  ? 0.4175 0.3407 0.2146 0.0737  0.0009  -0.0002 56  LEU B N   
1591 C CA  . LEU B 56  ? 0.4545 0.3717 0.2390 0.0756  0.0161  0.0013  56  LEU B CA  
1592 C C   . LEU B 56  ? 0.4910 0.3973 0.2469 0.0798  0.0224  0.0096  56  LEU B C   
1593 O O   . LEU B 56  ? 0.4939 0.3977 0.2514 0.0785  0.0368  0.0167  56  LEU B O   
1594 C CB  . LEU B 56  ? 0.4695 0.3848 0.2471 0.0785  0.0172  -0.0098 56  LEU B CB  
1595 C CG  . LEU B 56  ? 0.4510 0.3755 0.2591 0.0746  0.0133  -0.0168 56  LEU B CG  
1596 C CD1 . LEU B 56  ? 0.4708 0.3920 0.2686 0.0790  0.0100  -0.0299 56  LEU B CD1 
1597 C CD2 . LEU B 56  ? 0.4340 0.3622 0.2656 0.0701  0.0260  -0.0131 56  LEU B CD2 
1598 N N   . ARG B 57  ? 0.5278 0.4272 0.2602 0.0844  0.0107  0.0095  57  ARG B N   
1599 C CA  . ARG B 57  ? 0.5883 0.4759 0.2922 0.0881  0.0128  0.0196  57  ARG B CA  
1600 C C   . ARG B 57  ? 0.5781 0.4679 0.2998 0.0853  0.0157  0.0313  57  ARG B C   
1601 O O   . ARG B 57  ? 0.5991 0.4816 0.3098 0.0858  0.0273  0.0416  57  ARG B O   
1602 C CB  . ARG B 57  ? 0.6497 0.5297 0.3296 0.0933  -0.0057 0.0170  57  ARG B CB  
1603 C CG  . ARG B 57  ? 0.7339 0.5988 0.3781 0.0973  -0.0064 0.0283  57  ARG B CG  
1604 C CD  . ARG B 57  ? 0.7988 0.6586 0.4356 0.1010  -0.0299 0.0293  57  ARG B CD  
1605 N NE  . ARG B 57  ? 0.8164 0.6804 0.4812 0.0991  -0.0346 0.0385  57  ARG B NE  
1606 C CZ  . ARG B 57  ? 0.8016 0.6757 0.5005 0.0973  -0.0460 0.0332  57  ARG B CZ  
1607 N NH1 . ARG B 57  ? 0.8054 0.6865 0.5163 0.0971  -0.0551 0.0204  57  ARG B NH1 
1608 N NH2 . ARG B 57  ? 0.8162 0.6933 0.5395 0.0954  -0.0473 0.0405  57  ARG B NH2 
1609 N N   . ALA B 58  ? 0.5303 0.4294 0.2794 0.0820  0.0058  0.0293  58  ALA B N   
1610 C CA  . ALA B 58  ? 0.5157 0.4181 0.2854 0.0787  0.0079  0.0370  58  ALA B CA  
1611 C C   . ALA B 58  ? 0.4971 0.4026 0.2812 0.0746  0.0243  0.0412  58  ALA B C   
1612 O O   . ALA B 58  ? 0.5113 0.4136 0.3003 0.0741  0.0312  0.0501  58  ALA B O   
1613 C CB  . ALA B 58  ? 0.4771 0.3897 0.2735 0.0748  -0.0024 0.0308  58  ALA B CB  
1614 N N   . THR B 59  ? 0.4703 0.3820 0.2650 0.0715  0.0291  0.0345  59  THR B N   
1615 C CA  . THR B 59  ? 0.4625 0.3773 0.2751 0.0676  0.0422  0.0371  59  THR B CA  
1616 C C   . THR B 59  ? 0.5237 0.4287 0.3203 0.0710  0.0577  0.0440  59  THR B C   
1617 O O   . THR B 59  ? 0.5335 0.4376 0.3435 0.0690  0.0682  0.0512  59  THR B O   
1618 C CB  . THR B 59  ? 0.4213 0.3433 0.2489 0.0643  0.0413  0.0287  59  THR B CB  
1619 O OG1 . THR B 59  ? 0.3781 0.3084 0.2208 0.0596  0.0291  0.0248  59  THR B OG1 
1620 C CG2 . THR B 59  ? 0.4187 0.3426 0.2668 0.0609  0.0533  0.0310  59  THR B CG2 
1621 N N   . GLN B 60  ? 0.5474 0.4445 0.3145 0.0757  0.0594  0.0415  60  GLN B N   
1622 C CA  . GLN B 60  ? 0.6083 0.4944 0.3526 0.0786  0.0752  0.0479  60  GLN B CA  
1623 C C   . GLN B 60  ? 0.6274 0.5048 0.3592 0.0804  0.0756  0.0618  60  GLN B C   
1624 O O   . GLN B 60  ? 0.6343 0.5074 0.3712 0.0794  0.0906  0.0710  60  GLN B O   
1625 C CB  . GLN B 60  ? 0.6591 0.5380 0.3693 0.0830  0.0734  0.0402  60  GLN B CB  
1626 C CG  . GLN B 60  ? 0.7327 0.6059 0.4319 0.0834  0.0943  0.0375  60  GLN B CG  
1627 C CD  . GLN B 60  ? 0.8190 0.6766 0.4754 0.0868  0.1033  0.0463  60  GLN B CD  
1628 O OE1 . GLN B 60  ? 0.8351 0.6872 0.4847 0.0873  0.1002  0.0597  60  GLN B OE1 
1629 N NE2 . GLN B 60  ? 0.9020 0.7513 0.5278 0.0889  0.1142  0.0389  60  GLN B NE2 
1630 N N   . GLU B 61  ? 0.4564 0.4557 0.3257 -0.0332 0.0181  0.0042  61  GLU B N   
1631 C CA  . GLU B 61  ? 0.4979 0.4978 0.3603 -0.0289 0.0141  0.0175  61  GLU B CA  
1632 C C   . GLU B 61  ? 0.4760 0.4596 0.3477 -0.0248 0.0142  0.0253  61  GLU B C   
1633 O O   . GLU B 61  ? 0.4772 0.4563 0.3455 -0.0230 0.0152  0.0359  61  GLU B O   
1634 C CB  . GLU B 61  ? 0.5093 0.5208 0.3694 -0.0259 0.0063  0.0190  61  GLU B CB  
1635 C CG  . GLU B 61  ? 0.5673 0.5979 0.4146 -0.0298 0.0041  0.0145  61  GLU B CG  
1636 C CD  . GLU B 61  ? 0.6070 0.6509 0.4547 -0.0271 -0.0044 0.0159  61  GLU B CD  
1637 O OE1 . GLU B 61  ? 0.6188 0.6793 0.4597 -0.0313 -0.0073 0.0080  61  GLU B OE1 
1638 O OE2 . GLU B 61  ? 0.6389 0.6771 0.4945 -0.0209 -0.0083 0.0241  61  GLU B OE2 
1639 N N   . GLU B 62  ? 0.4509 0.4260 0.3343 -0.0233 0.0134  0.0199  62  GLU B N   
1640 C CA  . GLU B 62  ? 0.4593 0.4207 0.3505 -0.0191 0.0122  0.0255  62  GLU B CA  
1641 C C   . GLU B 62  ? 0.4429 0.3927 0.3409 -0.0216 0.0168  0.0242  62  GLU B C   
1642 O O   . GLU B 62  ? 0.4268 0.3659 0.3288 -0.0198 0.0169  0.0299  62  GLU B O   
1643 C CB  . GLU B 62  ? 0.4479 0.4075 0.3466 -0.0154 0.0083  0.0216  62  GLU B CB  
1644 C CG  . GLU B 62  ? 0.4943 0.4643 0.3901 -0.0119 0.0031  0.0245  62  GLU B CG  
1645 C CD  . GLU B 62  ? 0.5531 0.5233 0.4441 -0.0077 0.0009  0.0369  62  GLU B CD  
1646 O OE1 . GLU B 62  ? 0.5960 0.5799 0.4790 -0.0077 -0.0019 0.0410  62  GLU B OE1 
1647 O OE2 . GLU B 62  ? 0.5628 0.5197 0.4584 -0.0045 0.0021  0.0426  62  GLU B OE2 
1648 N N   . ALA B 63  ? 0.4386 0.3912 0.3395 -0.0258 0.0207  0.0164  63  ALA B N   
1649 C CA  . ALA B 63  ? 0.4193 0.3637 0.3294 -0.0281 0.0243  0.0143  63  ALA B CA  
1650 C C   . ALA B 63  ? 0.4295 0.3787 0.3377 -0.0330 0.0309  0.0128  63  ALA B C   
1651 O O   . ALA B 63  ? 0.4334 0.3780 0.3503 -0.0352 0.0345  0.0119  63  ALA B O   
1652 C CB  . ALA B 63  ? 0.3966 0.3396 0.3160 -0.0274 0.0231  0.0067  63  ALA B CB  
1653 N N   . GLY B 64  ? 0.4213 0.3811 0.3187 -0.0347 0.0325  0.0116  64  GLY B N   
1654 C CA  . GLY B 64  ? 0.4391 0.4048 0.3315 -0.0391 0.0396  0.0099  64  GLY B CA  
1655 C C   . GLY B 64  ? 0.4521 0.4192 0.3540 -0.0421 0.0449  -0.0003 64  GLY B C   
1656 O O   . GLY B 64  ? 0.4632 0.4320 0.3664 -0.0454 0.0522  -0.0016 64  GLY B O   
1657 N N   . ILE B 65  ? 0.4306 0.3967 0.3403 -0.0407 0.0420  -0.0071 65  ILE B N   
1658 C CA  . ILE B 65  ? 0.4203 0.3868 0.3416 -0.0426 0.0472  -0.0161 65  ILE B CA  
1659 C C   . ILE B 65  ? 0.4469 0.4226 0.3625 -0.0451 0.0494  -0.0255 65  ILE B C   
1660 O O   . ILE B 65  ? 0.4162 0.3947 0.3295 -0.0439 0.0442  -0.0276 65  ILE B O   
1661 C CB  . ILE B 65  ? 0.3873 0.3471 0.3224 -0.0394 0.0437  -0.0169 65  ILE B CB  
1662 C CG1 . ILE B 65  ? 0.3782 0.3300 0.3176 -0.0373 0.0401  -0.0092 65  ILE B CG1 
1663 C CG2 . ILE B 65  ? 0.3887 0.3492 0.3375 -0.0408 0.0498  -0.0239 65  ILE B CG2 
1664 C CD1 . ILE B 65  ? 0.3576 0.3042 0.3053 -0.0337 0.0350  -0.0090 65  ILE B CD1 
1665 N N   . GLU B 66  ? 0.4769 0.4572 0.3915 -0.0490 0.0575  -0.0318 66  GLU B N   
1666 C CA  . GLU B 66  ? 0.5366 0.5258 0.4453 -0.0528 0.0611  -0.0432 66  GLU B CA  
1667 C C   . GLU B 66  ? 0.5319 0.5180 0.4567 -0.0529 0.0633  -0.0526 66  GLU B C   
1668 O O   . GLU B 66  ? 0.5212 0.4993 0.4617 -0.0502 0.0643  -0.0499 66  GLU B O   
1669 C CB  . GLU B 66  ? 0.5998 0.5932 0.5042 -0.0566 0.0711  -0.0472 66  GLU B CB  
1670 C CG  . GLU B 66  ? 0.6986 0.7043 0.5826 -0.0603 0.0724  -0.0517 66  GLU B CG  
1671 C CD  . GLU B 66  ? 0.7626 0.7716 0.6313 -0.0597 0.0714  -0.0393 66  GLU B CD  
1672 O OE1 . GLU B 66  ? 0.7968 0.8008 0.6651 -0.0559 0.0641  -0.0276 66  GLU B OE1 
1673 O OE2 . GLU B 66  ? 0.8096 0.8255 0.6669 -0.0629 0.0788  -0.0411 66  GLU B OE2 
1674 N N   . ALA B 67  ? 0.5636 0.5565 0.4854 -0.0562 0.0644  -0.0635 67  ALA B N   
1675 C CA  . ALA B 67  ? 0.5676 0.5572 0.5059 -0.0570 0.0679  -0.0732 67  ALA B CA  
1676 C C   . ALA B 67  ? 0.5701 0.5530 0.5253 -0.0568 0.0776  -0.0763 67  ALA B C   
1677 O O   . ALA B 67  ? 0.5449 0.5209 0.5181 -0.0540 0.0787  -0.0757 67  ALA B O   
1678 C CB  . ALA B 67  ? 0.6158 0.6149 0.5477 -0.0624 0.0691  -0.0866 67  ALA B CB  
1679 N N   . GLY B 68  ? 0.5440 0.5300 0.4938 -0.0592 0.0848  -0.0788 68  GLY B N   
1680 C CA  . GLY B 68  ? 0.5360 0.5174 0.5022 -0.0589 0.0948  -0.0817 68  GLY B CA  
1681 C C   . GLY B 68  ? 0.5149 0.4897 0.4934 -0.0543 0.0925  -0.0696 68  GLY B C   
1682 O O   . GLY B 68  ? 0.5000 0.4717 0.4963 -0.0529 0.0993  -0.0701 68  GLY B O   
1683 N N   . GLN B 69  ? 0.4879 0.4613 0.4581 -0.0518 0.0828  -0.0591 69  GLN B N   
1684 C CA  . GLN B 69  ? 0.4642 0.4321 0.4451 -0.0481 0.0792  -0.0489 69  GLN B CA  
1685 C C   . GLN B 69  ? 0.4178 0.3808 0.4094 -0.0440 0.0731  -0.0461 69  GLN B C   
1686 O O   . GLN B 69  ? 0.3989 0.3584 0.3980 -0.0408 0.0689  -0.0384 69  GLN B O   
1687 C CB  . GLN B 69  ? 0.5025 0.4705 0.4698 -0.0481 0.0736  -0.0396 69  GLN B CB  
1688 C CG  . GLN B 69  ? 0.5643 0.5369 0.5229 -0.0516 0.0806  -0.0394 69  GLN B CG  
1689 C CD  . GLN B 69  ? 0.5770 0.5495 0.5210 -0.0517 0.0756  -0.0294 69  GLN B CD  
1690 O OE1 . GLN B 69  ? 0.5723 0.5468 0.5019 -0.0511 0.0697  -0.0274 69  GLN B OE1 
1691 N NE2 . GLN B 69  ? 0.6317 0.6020 0.5812 -0.0523 0.0784  -0.0229 69  GLN B NE2 
1692 N N   . LEU B 70  ? 0.3878 0.3512 0.3803 -0.0444 0.0732  -0.0526 70  LEU B N   
1693 C CA  . LEU B 70  ? 0.3847 0.3446 0.3831 -0.0409 0.0674  -0.0493 70  LEU B CA  
1694 C C   . LEU B 70  ? 0.3644 0.3222 0.3792 -0.0408 0.0735  -0.0558 70  LEU B C   
1695 O O   . LEU B 70  ? 0.3599 0.3200 0.3763 -0.0447 0.0805  -0.0661 70  LEU B O   
1696 C CB  . LEU B 70  ? 0.4024 0.3656 0.3858 -0.0417 0.0607  -0.0500 70  LEU B CB  
1697 C CG  . LEU B 70  ? 0.4087 0.3724 0.3773 -0.0403 0.0532  -0.0419 70  LEU B CG  
1698 C CD1 . LEU B 70  ? 0.4071 0.3749 0.3650 -0.0402 0.0472  -0.0423 70  LEU B CD1 
1699 C CD2 . LEU B 70  ? 0.4190 0.3763 0.3946 -0.0359 0.0493  -0.0334 70  LEU B CD2 
1700 N N   . THR B 71  ? 0.3300 0.2838 0.3562 -0.0365 0.0709  -0.0500 71  THR B N   
1701 C CA  . THR B 71  ? 0.3358 0.2866 0.3784 -0.0360 0.0765  -0.0541 71  THR B CA  
1702 C C   . THR B 71  ? 0.3141 0.2640 0.3545 -0.0337 0.0704  -0.0498 71  THR B C   
1703 O O   . THR B 71  ? 0.2845 0.2329 0.3235 -0.0292 0.0646  -0.0400 71  THR B O   
1704 C CB  . THR B 71  ? 0.3344 0.2818 0.3974 -0.0319 0.0814  -0.0487 71  THR B CB  
1705 O OG1 . THR B 71  ? 0.3675 0.3164 0.4348 -0.0339 0.0882  -0.0530 71  THR B OG1 
1706 C CG2 . THR B 71  ? 0.3401 0.2831 0.4223 -0.0306 0.0879  -0.0510 71  THR B CG2 
1707 N N   . ILE B 72  ? 0.3152 0.2666 0.3560 -0.0369 0.0718  -0.0574 72  ILE B N   
1708 C CA  . ILE B 72  ? 0.3114 0.2625 0.3532 -0.0349 0.0674  -0.0534 72  ILE B CA  
1709 C C   . ILE B 72  ? 0.3100 0.2554 0.3713 -0.0307 0.0720  -0.0475 72  ILE B C   
1710 O O   . ILE B 72  ? 0.3080 0.2501 0.3857 -0.0322 0.0805  -0.0528 72  ILE B O   
1711 C CB  . ILE B 72  ? 0.3355 0.2912 0.3758 -0.0402 0.0679  -0.0637 72  ILE B CB  
1712 C CG1 . ILE B 72  ? 0.3454 0.3091 0.3659 -0.0440 0.0629  -0.0687 72  ILE B CG1 
1713 C CG2 . ILE B 72  ? 0.3266 0.2825 0.3706 -0.0377 0.0642  -0.0585 72  ILE B CG2 
1714 C CD1 . ILE B 72  ? 0.3498 0.3153 0.3548 -0.0401 0.0536  -0.0586 72  ILE B CD1 
1715 N N   . ILE B 73  ? 0.2869 0.2311 0.3466 -0.0253 0.0669  -0.0365 73  ILE B N   
1716 C CA  . ILE B 73  ? 0.2618 0.2019 0.3385 -0.0207 0.0710  -0.0286 73  ILE B CA  
1717 C C   . ILE B 73  ? 0.2788 0.2175 0.3656 -0.0220 0.0750  -0.0308 73  ILE B C   
1718 O O   . ILE B 73  ? 0.2672 0.2087 0.3447 -0.0216 0.0700  -0.0290 73  ILE B O   
1719 C CB  . ILE B 73  ? 0.2570 0.1981 0.3261 -0.0144 0.0640  -0.0160 73  ILE B CB  
1720 C CG1 . ILE B 73  ? 0.2407 0.1837 0.3009 -0.0140 0.0593  -0.0142 73  ILE B CG1 
1721 C CG2 . ILE B 73  ? 0.2723 0.2111 0.3577 -0.0091 0.0680  -0.0061 73  ILE B CG2 
1722 C CD1 . ILE B 73  ? 0.2444 0.1868 0.3183 -0.0148 0.0655  -0.0164 73  ILE B CD1 
1723 N N   . GLU B 74  ? 0.2725 0.2067 0.3798 -0.0235 0.0844  -0.0348 74  GLU B N   
1724 C CA  . GLU B 74  ? 0.2994 0.2314 0.4204 -0.0256 0.0895  -0.0374 74  GLU B CA  
1725 C C   . GLU B 74  ? 0.2782 0.2094 0.4024 -0.0194 0.0881  -0.0232 74  GLU B C   
1726 O O   . GLU B 74  ? 0.2742 0.2039 0.4010 -0.0131 0.0878  -0.0113 74  GLU B O   
1727 C CB  . GLU B 74  ? 0.3345 0.2598 0.4797 -0.0281 0.1013  -0.0441 74  GLU B CB  
1728 C CG  . GLU B 74  ? 0.3643 0.2855 0.5289 -0.0313 0.1087  -0.0481 74  GLU B CG  
1729 C CD  . GLU B 74  ? 0.4087 0.3213 0.5991 -0.0331 0.1213  -0.0545 74  GLU B CD  
1730 O OE1 . GLU B 74  ? 0.4273 0.3333 0.6382 -0.0286 0.1281  -0.0444 74  GLU B OE1 
1731 O OE2 . GLU B 74  ? 0.4374 0.3498 0.6280 -0.0386 0.1250  -0.0691 74  GLU B OE2 
1732 N N   . GLY B 75  ? 0.2816 0.2151 0.4049 -0.0212 0.0871  -0.0241 75  GLY B N   
1733 C CA  . GLY B 75  ? 0.2606 0.1933 0.3887 -0.0158 0.0882  -0.0113 75  GLY B CA  
1734 C C   . GLY B 75  ? 0.2771 0.2149 0.3847 -0.0116 0.0795  -0.0040 75  GLY B C   
1735 O O   . GLY B 75  ? 0.3013 0.2392 0.4099 -0.0065 0.0805  0.0071  75  GLY B O   
1736 N N   . PHE B 76  ? 0.2513 0.1932 0.3403 -0.0134 0.0716  -0.0097 76  PHE B N   
1737 C CA  . PHE B 76  ? 0.2326 0.1782 0.3031 -0.0097 0.0639  -0.0046 76  PHE B CA  
1738 C C   . PHE B 76  ? 0.2322 0.1831 0.2922 -0.0141 0.0588  -0.0135 76  PHE B C   
1739 O O   . PHE B 76  ? 0.2368 0.1893 0.2926 -0.0186 0.0571  -0.0221 76  PHE B O   
1740 C CB  . PHE B 76  ? 0.2139 0.1588 0.2714 -0.0059 0.0584  0.0005  76  PHE B CB  
1741 C CG  . PHE B 76  ? 0.2082 0.1555 0.2480 -0.0020 0.0514  0.0051  76  PHE B CG  
1742 C CD1 . PHE B 76  ? 0.2022 0.1513 0.2280 -0.0039 0.0454  -0.0003 76  PHE B CD1 
1743 C CD2 . PHE B 76  ? 0.2091 0.1568 0.2465 0.0037  0.0515  0.0151  76  PHE B CD2 
1744 C CE1 . PHE B 76  ? 0.1998 0.1497 0.2113 -0.0003 0.0401  0.0030  76  PHE B CE1 
1745 C CE2 . PHE B 76  ? 0.2096 0.1591 0.2304 0.0070  0.0460  0.0174  76  PHE B CE2 
1746 C CZ  . PHE B 76  ? 0.2016 0.1514 0.2104 0.0049  0.0405  0.0109  76  PHE B CZ  
1747 N N   . LYS B 77  ? 0.2151 0.1697 0.2707 -0.0121 0.0565  -0.0106 77  LYS B N   
1748 C CA  . LYS B 77  ? 0.2183 0.1790 0.2642 -0.0143 0.0508  -0.0160 77  LYS B CA  
1749 C C   . LYS B 77  ? 0.2117 0.1740 0.2512 -0.0087 0.0489  -0.0084 77  LYS B C   
1750 O O   . LYS B 77  ? 0.2020 0.1633 0.2508 -0.0062 0.0542  -0.0026 77  LYS B O   
1751 C CB  . LYS B 77  ? 0.2279 0.1942 0.2866 -0.0209 0.0534  -0.0253 77  LYS B CB  
1752 C CG  . LYS B 77  ? 0.2499 0.2254 0.3000 -0.0225 0.0467  -0.0292 77  LYS B CG  
1753 C CD  . LYS B 77  ? 0.2768 0.2602 0.3352 -0.0304 0.0467  -0.0410 77  LYS B CD  
1754 C CE  . LYS B 77  ? 0.2851 0.2735 0.3616 -0.0333 0.0506  -0.0434 77  LYS B CE  
1755 N NZ  . LYS B 77  ? 0.3057 0.3017 0.3913 -0.0423 0.0507  -0.0570 77  LYS B NZ  
1756 N N   . ARG B 78  ? 0.2101 0.1747 0.2349 -0.0067 0.0423  -0.0084 78  ARG B N   
1757 C CA  . ARG B 78  ? 0.2313 0.1974 0.2504 -0.0014 0.0412  -0.0028 78  ARG B CA  
1758 C C   . ARG B 78  ? 0.2372 0.2099 0.2521 -0.0021 0.0363  -0.0064 78  ARG B C   
1759 O O   . ARG B 78  ? 0.2326 0.2060 0.2389 -0.0039 0.0312  -0.0097 78  ARG B O   
1760 C CB  . ARG B 78  ? 0.2422 0.2028 0.2470 0.0040  0.0386  0.0028  78  ARG B CB  
1761 C CG  . ARG B 78  ? 0.2653 0.2223 0.2733 0.0068  0.0427  0.0093  78  ARG B CG  
1762 C CD  . ARG B 78  ? 0.2721 0.2314 0.2923 0.0084  0.0499  0.0143  78  ARG B CD  
1763 N NE  . ARG B 78  ? 0.2624 0.2193 0.2847 0.0119  0.0537  0.0228  78  ARG B NE  
1764 C CZ  . ARG B 78  ? 0.2643 0.2188 0.3004 0.0105  0.0585  0.0255  78  ARG B CZ  
1765 N NH1 . ARG B 78  ? 0.2499 0.2033 0.3001 0.0047  0.0611  0.0186  78  ARG B NH1 
1766 N NH2 . ARG B 78  ? 0.2474 0.2013 0.2830 0.0150  0.0606  0.0351  78  ARG B NH2 
1767 N N   . GLU B 79  ? 0.2544 0.2326 0.2763 -0.0004 0.0382  -0.0047 79  GLU B N   
1768 C CA  . GLU B 79  ? 0.2760 0.2619 0.2960 0.0002  0.0335  -0.0063 79  GLU B CA  
1769 C C   . GLU B 79  ? 0.2801 0.2633 0.2911 0.0075  0.0330  -0.0006 79  GLU B C   
1770 O O   . GLU B 79  ? 0.2865 0.2678 0.2997 0.0113  0.0382  0.0037  79  GLU B O   
1771 C CB  . GLU B 79  ? 0.3052 0.3017 0.3423 -0.0035 0.0355  -0.0096 79  GLU B CB  
1772 C CG  . GLU B 79  ? 0.3399 0.3461 0.3766 -0.0011 0.0305  -0.0090 79  GLU B CG  
1773 C CD  . GLU B 79  ? 0.4003 0.4204 0.4531 -0.0065 0.0295  -0.0142 79  GLU B CD  
1774 O OE1 . GLU B 79  ? 0.4433 0.4653 0.5041 -0.0137 0.0308  -0.0211 79  GLU B OE1 
1775 O OE2 . GLU B 79  ? 0.3899 0.4195 0.4486 -0.0037 0.0275  -0.0120 79  GLU B OE2 
1776 N N   . LEU B 80  ? 0.2817 0.2643 0.2825 0.0097  0.0274  -0.0007 80  LEU B N   
1777 C CA  . LEU B 80  ? 0.2886 0.2677 0.2818 0.0166  0.0273  0.0030  80  LEU B CA  
1778 C C   . LEU B 80  ? 0.2973 0.2863 0.2988 0.0184  0.0258  0.0035  80  LEU B C   
1779 O O   . LEU B 80  ? 0.2880 0.2844 0.2924 0.0150  0.0209  0.0013  80  LEU B O   
1780 C CB  . LEU B 80  ? 0.3026 0.2733 0.2818 0.0180  0.0228  0.0029  80  LEU B CB  
1781 C CG  . LEU B 80  ? 0.3273 0.2882 0.2968 0.0180  0.0233  0.0031  80  LEU B CG  
1782 C CD1 . LEU B 80  ? 0.3241 0.2852 0.2976 0.0125  0.0240  0.0013  80  LEU B CD1 
1783 C CD2 . LEU B 80  ? 0.3365 0.2900 0.2951 0.0194  0.0190  0.0028  80  LEU B CD2 
1784 N N   . ASN B 81  ? 0.3079 0.2984 0.3135 0.0236  0.0302  0.0065  81  ASN B N   
1785 C CA  . ASN B 81  ? 0.3434 0.3438 0.3588 0.0269  0.0296  0.0080  81  ASN B CA  
1786 C C   . ASN B 81  ? 0.3648 0.3587 0.3731 0.0349  0.0321  0.0108  81  ASN B C   
1787 O O   . ASN B 81  ? 0.3617 0.3506 0.3663 0.0382  0.0384  0.0119  81  ASN B O   
1788 C CB  . ASN B 81  ? 0.3395 0.3504 0.3725 0.0250  0.0347  0.0083  81  ASN B CB  
1789 C CG  . ASN B 81  ? 0.3683 0.3848 0.4105 0.0165  0.0333  0.0038  81  ASN B CG  
1790 O OD1 . ASN B 81  ? 0.3614 0.3880 0.4095 0.0124  0.0276  0.0004  81  ASN B OD1 
1791 N ND2 . ASN B 81  ? 0.3576 0.3676 0.4003 0.0139  0.0385  0.0037  81  ASN B ND2 
1792 N N   . TYR B 82  ? 0.3702 0.3641 0.3764 0.0381  0.0275  0.0119  82  TYR B N   
1793 C CA  . TYR B 82  ? 0.4167 0.4037 0.4187 0.0458  0.0304  0.0136  82  TYR B CA  
1794 C C   . TYR B 82  ? 0.4112 0.4049 0.4215 0.0498  0.0264  0.0169  82  TYR B C   
1795 O O   . TYR B 82  ? 0.3865 0.3894 0.4015 0.0462  0.0200  0.0181  82  TYR B O   
1796 C CB  . TYR B 82  ? 0.4261 0.3975 0.4112 0.0464  0.0300  0.0114  82  TYR B CB  
1797 C CG  . TYR B 82  ? 0.4382 0.4058 0.4174 0.0424  0.0231  0.0112  82  TYR B CG  
1798 C CD1 . TYR B 82  ? 0.4210 0.3887 0.3964 0.0356  0.0206  0.0093  82  TYR B CD1 
1799 C CD2 . TYR B 82  ? 0.4499 0.4139 0.4284 0.0459  0.0200  0.0137  82  TYR B CD2 
1800 C CE1 . TYR B 82  ? 0.4316 0.3967 0.4015 0.0321  0.0154  0.0093  82  TYR B CE1 
1801 C CE2 . TYR B 82  ? 0.4512 0.4123 0.4242 0.0424  0.0146  0.0148  82  TYR B CE2 
1802 C CZ  . TYR B 82  ? 0.4524 0.4144 0.4206 0.0354  0.0124  0.0124  82  TYR B CZ  
1803 O OH  . TYR B 82  ? 0.4998 0.4595 0.4624 0.0321  0.0081  0.0137  82  TYR B OH  
1804 N N   . VAL B 83  ? 0.4461 0.4360 0.4586 0.0575  0.0304  0.0186  83  VAL B N   
1805 C CA  . VAL B 83  ? 0.4990 0.4950 0.5219 0.0630  0.0277  0.0233  83  VAL B CA  
1806 C C   . VAL B 83  ? 0.5322 0.5118 0.5449 0.0673  0.0279  0.0234  83  VAL B C   
1807 O O   . VAL B 83  ? 0.5428 0.5117 0.5505 0.0715  0.0344  0.0201  83  VAL B O   
1808 C CB  . VAL B 83  ? 0.4904 0.4963 0.5293 0.0690  0.0338  0.0252  83  VAL B CB  
1809 C CG1 . VAL B 83  ? 0.5301 0.5442 0.5825 0.0753  0.0306  0.0313  83  VAL B CG1 
1810 C CG2 . VAL B 83  ? 0.4796 0.5000 0.5296 0.0636  0.0349  0.0244  83  VAL B CG2 
1811 N N   . ALA B 84  ? 0.5806 0.5586 0.5902 0.0658  0.0212  0.0268  84  ALA B N   
1812 C CA  . ALA B 84  ? 0.6389 0.5999 0.6393 0.0679  0.0212  0.0270  84  ALA B CA  
1813 C C   . ALA B 84  ? 0.7038 0.6667 0.7121 0.0729  0.0176  0.0352  84  ALA B C   
1814 O O   . ALA B 84  ? 0.6816 0.6525 0.6890 0.0694  0.0108  0.0401  84  ALA B O   
1815 C CB  . ALA B 84  ? 0.6336 0.5871 0.6200 0.0603  0.0179  0.0236  84  ALA B CB  
1816 N N   . ARG B 85  ? 0.7896 0.7442 0.8049 0.0811  0.0227  0.0368  85  ARG B N   
1817 C CA  . ARG B 85  ? 0.7934 0.7520 0.8220 0.0885  0.0210  0.0464  85  ARG B CA  
1818 C C   . ARG B 85  ? 0.7876 0.7672 0.8326 0.0921  0.0200  0.0506  85  ARG B C   
1819 O O   . ARG B 85  ? 0.8871 0.8762 0.9459 0.0983  0.0173  0.0597  85  ARG B O   
1820 C CB  . ARG B 85  ? 0.7898 0.7495 0.8141 0.0857  0.0135  0.0541  85  ARG B CB  
1821 C CG  . ARG B 85  ? 0.8708 0.8094 0.8840 0.0836  0.0152  0.0522  85  ARG B CG  
1822 C CD  . ARG B 85  ? 0.8955 0.8365 0.9069 0.0824  0.0092  0.0625  85  ARG B CD  
1823 N NE  . ARG B 85  ? 0.9160 0.8369 0.9204 0.0807  0.0117  0.0618  85  ARG B NE  
1824 C CZ  . ARG B 85  ? 0.9360 0.8553 0.9357 0.0780  0.0080  0.0696  85  ARG B CZ  
1825 N NH1 . ARG B 85  ? 0.9213 0.8585 0.9206 0.0772  0.0013  0.0786  85  ARG B NH1 
1826 N NH2 . ARG B 85  ? 0.9252 0.8258 0.9204 0.0756  0.0112  0.0680  85  ARG B NH2 
1827 N N   . ASN B 86  ? 0.7322 0.7195 0.7767 0.0880  0.0223  0.0443  86  ASN B N   
1828 C CA  . ASN B 86  ? 0.6942 0.7019 0.7553 0.0895  0.0223  0.0464  86  ASN B CA  
1829 C C   . ASN B 86  ? 0.6213 0.6498 0.6887 0.0847  0.0126  0.0509  86  ASN B C   
1830 O O   . ASN B 86  ? 0.6059 0.6537 0.6903 0.0865  0.0106  0.0543  86  ASN B O   
1831 C CB  . ASN B 86  ? 0.6946 0.7028 0.7712 0.0996  0.0296  0.0488  86  ASN B CB  
1832 C CG  . ASN B 86  ? 0.6922 0.6864 0.7611 0.1011  0.0402  0.0403  86  ASN B CG  
1833 O OD1 . ASN B 86  ? 0.6305 0.6332 0.7059 0.1013  0.0457  0.0377  86  ASN B OD1 
1834 N ND2 . ASN B 86  ? 0.7027 0.6761 0.7567 0.1012  0.0428  0.0357  86  ASN B ND2 
1835 N N   . LYS B 87  ? 0.5778 0.6020 0.6305 0.0777  0.0071  0.0496  87  LYS B N   
1836 C CA  . LYS B 87  ? 0.5321 0.5718 0.5833 0.0697  -0.0005 0.0489  87  LYS B CA  
1837 C C   . LYS B 87  ? 0.4829 0.5178 0.5270 0.0621  0.0035  0.0394  87  LYS B C   
1838 O O   . LYS B 87  ? 0.4435 0.4609 0.4743 0.0607  0.0076  0.0352  87  LYS B O   
1839 C CB  . LYS B 87  ? 0.5691 0.6047 0.6079 0.0678  -0.0068 0.0535  87  LYS B CB  
1840 C CG  . LYS B 87  ? 0.6001 0.6362 0.6470 0.0773  -0.0085 0.0648  87  LYS B CG  
1841 C CD  . LYS B 87  ? 0.6172 0.6458 0.6523 0.0768  -0.0127 0.0714  87  LYS B CD  
1842 C CE  . LYS B 87  ? 0.6364 0.6676 0.6831 0.0870  -0.0141 0.0845  87  LYS B CE  
1843 N NZ  . LYS B 87  ? 0.6642 0.6864 0.7012 0.0875  -0.0165 0.0930  87  LYS B NZ  
1844 N N   . PRO B 88  ? 0.4636 0.5145 0.5185 0.0576  0.0027  0.0362  88  PRO B N   
1845 C CA  . PRO B 88  ? 0.4346 0.4814 0.4843 0.0500  0.0063  0.0285  88  PRO B CA  
1846 C C   . PRO B 88  ? 0.4108 0.4523 0.4453 0.0428  0.0014  0.0255  88  PRO B C   
1847 O O   . PRO B 88  ? 0.4093 0.4603 0.4420 0.0407  -0.0060 0.0280  88  PRO B O   
1848 C CB  . PRO B 88  ? 0.4370 0.5038 0.5045 0.0459  0.0052  0.0265  88  PRO B CB  
1849 C CG  . PRO B 88  ? 0.4768 0.5590 0.5592 0.0522  0.0011  0.0332  88  PRO B CG  
1850 C CD  . PRO B 88  ? 0.4584 0.5328 0.5308 0.0579  -0.0028 0.0397  88  PRO B CD  
1851 N N   . LYS B 89  ? 0.4020 0.4292 0.4256 0.0394  0.0058  0.0208  89  LYS B N   
1852 C CA  . LYS B 89  ? 0.3976 0.4196 0.4085 0.0327  0.0025  0.0176  89  LYS B CA  
1853 C C   . LYS B 89  ? 0.3706 0.3908 0.3820 0.0261  0.0063  0.0112  89  LYS B C   
1854 O O   . LYS B 89  ? 0.3300 0.3449 0.3447 0.0280  0.0128  0.0104  89  LYS B O   
1855 C CB  . LYS B 89  ? 0.4390 0.4438 0.4359 0.0356  0.0031  0.0196  89  LYS B CB  
1856 C CG  . LYS B 89  ? 0.4954 0.5013 0.4923 0.0411  -0.0009 0.0269  89  LYS B CG  
1857 C CD  . LYS B 89  ? 0.5220 0.5130 0.5058 0.0407  -0.0015 0.0284  89  LYS B CD  
1858 C CE  . LYS B 89  ? 0.5564 0.5437 0.5430 0.0482  -0.0025 0.0365  89  LYS B CE  
1859 N NZ  . LYS B 89  ? 0.5868 0.5924 0.5818 0.0501  -0.0084 0.0431  89  LYS B NZ  
1860 N N   . THR B 90  ? 0.3336 0.3585 0.3420 0.0188  0.0027  0.0071  90  THR B N   
1861 C CA  . THR B 90  ? 0.3198 0.3419 0.3297 0.0123  0.0065  0.0010  90  THR B CA  
1862 C C   . THR B 90  ? 0.3009 0.3157 0.2977 0.0082  0.0044  -0.0012 90  THR B C   
1863 O O   . THR B 90  ? 0.3131 0.3339 0.3041 0.0064  -0.0010 -0.0008 90  THR B O   
1864 C CB  . THR B 90  ? 0.3394 0.3769 0.3637 0.0062  0.0055  -0.0040 90  THR B CB  
1865 O OG1 . THR B 90  ? 0.3563 0.4002 0.3949 0.0098  0.0089  -0.0015 90  THR B OG1 
1866 C CG2 . THR B 90  ? 0.3190 0.3522 0.3460 -0.0009 0.0099  -0.0108 90  THR B CG2 
1867 N N   . VAL B 91  ? 0.2739 0.2767 0.2662 0.0072  0.0089  -0.0027 91  VAL B N   
1868 C CA  . VAL B 91  ? 0.2666 0.2630 0.2495 0.0030  0.0081  -0.0053 91  VAL B CA  
1869 C C   . VAL B 91  ? 0.2528 0.2461 0.2419 -0.0012 0.0133  -0.0098 91  VAL B C   
1870 O O   . VAL B 91  ? 0.2315 0.2198 0.2253 0.0013  0.0181  -0.0079 91  VAL B O   
1871 C CB  . VAL B 91  ? 0.2714 0.2546 0.2426 0.0069  0.0080  -0.0014 91  VAL B CB  
1872 C CG1 . VAL B 91  ? 0.2721 0.2515 0.2356 0.0023  0.0070  -0.0036 91  VAL B CG1 
1873 C CG2 . VAL B 91  ? 0.2960 0.2794 0.2637 0.0124  0.0046  0.0039  91  VAL B CG2 
1874 N N   . ILE B 92  ? 0.2499 0.2463 0.2392 -0.0076 0.0130  -0.0155 92  ILE B N   
1875 C CA  . ILE B 92  ? 0.2438 0.2362 0.2409 -0.0115 0.0186  -0.0197 92  ILE B CA  
1876 C C   . ILE B 92  ? 0.2200 0.2036 0.2084 -0.0124 0.0194  -0.0199 92  ILE B C   
1877 O O   . ILE B 92  ? 0.2227 0.2084 0.2026 -0.0148 0.0162  -0.0217 92  ILE B O   
1878 C CB  . ILE B 92  ? 0.2696 0.2721 0.2762 -0.0187 0.0190  -0.0282 92  ILE B CB  
1879 C CG1 . ILE B 92  ? 0.2932 0.3078 0.3091 -0.0185 0.0166  -0.0285 92  ILE B CG1 
1880 C CG2 . ILE B 92  ? 0.2646 0.2612 0.2827 -0.0222 0.0263  -0.0324 92  ILE B CG2 
1881 C CD1 . ILE B 92  ? 0.3240 0.3363 0.3539 -0.0164 0.0225  -0.0259 92  ILE B CD1 
1882 N N   . TYR B 93  ? 0.2054 0.1803 0.1965 -0.0106 0.0236  -0.0174 93  TYR B N   
1883 C CA  . TYR B 93  ? 0.2044 0.1724 0.1903 -0.0117 0.0244  -0.0176 93  TYR B CA  
1884 C C   . TYR B 93  ? 0.1942 0.1601 0.1918 -0.0148 0.0304  -0.0208 93  TYR B C   
1885 O O   . TYR B 93  ? 0.1961 0.1615 0.2046 -0.0138 0.0346  -0.0194 93  TYR B O   
1886 C CB  . TYR B 93  ? 0.2071 0.1672 0.1856 -0.0064 0.0231  -0.0112 93  TYR B CB  
1887 C CG  . TYR B 93  ? 0.2106 0.1691 0.1776 -0.0037 0.0180  -0.0086 93  TYR B CG  
1888 C CD1 . TYR B 93  ? 0.2170 0.1745 0.1766 -0.0061 0.0155  -0.0094 93  TYR B CD1 
1889 C CD2 . TYR B 93  ? 0.2206 0.1779 0.1849 0.0014  0.0169  -0.0051 93  TYR B CD2 
1890 C CE1 . TYR B 93  ? 0.2264 0.1813 0.1776 -0.0035 0.0117  -0.0060 93  TYR B CE1 
1891 C CE2 . TYR B 93  ? 0.2414 0.1958 0.1974 0.0042  0.0132  -0.0028 93  TYR B CE2 
1892 C CZ  . TYR B 93  ? 0.2400 0.1927 0.1901 0.0017  0.0106  -0.0029 93  TYR B CZ  
1893 O OH  . TYR B 93  ? 0.2679 0.2164 0.2118 0.0047  0.0079  0.0003  93  TYR B OH  
1894 N N   . TRP B 94  ? 0.1965 0.1608 0.1927 -0.0182 0.0316  -0.0246 94  TRP B N   
1895 C CA  . TRP B 94  ? 0.1933 0.1534 0.2009 -0.0199 0.0379  -0.0264 94  TRP B CA  
1896 C C   . TRP B 94  ? 0.1929 0.1476 0.1952 -0.0173 0.0367  -0.0216 94  TRP B C   
1897 O O   . TRP B 94  ? 0.1978 0.1518 0.1877 -0.0159 0.0317  -0.0191 94  TRP B O   
1898 C CB  . TRP B 94  ? 0.1989 0.1627 0.2103 -0.0264 0.0410  -0.0364 94  TRP B CB  
1899 C CG  . TRP B 94  ? 0.2140 0.1839 0.2347 -0.0304 0.0427  -0.0432 94  TRP B CG  
1900 C CD1 . TRP B 94  ? 0.2176 0.1855 0.2560 -0.0329 0.0497  -0.0475 94  TRP B CD1 
1901 C CD2 . TRP B 94  ? 0.2221 0.2019 0.2368 -0.0326 0.0373  -0.0466 94  TRP B CD2 
1902 N NE1 . TRP B 94  ? 0.2343 0.2099 0.2784 -0.0373 0.0490  -0.0543 94  TRP B NE1 
1903 C CE2 . TRP B 94  ? 0.2368 0.2208 0.2670 -0.0372 0.0412  -0.0540 94  TRP B CE2 
1904 C CE3 . TRP B 94  ? 0.2306 0.2163 0.2308 -0.0311 0.0300  -0.0438 94  TRP B CE3 
1905 C CZ2 . TRP B 94  ? 0.2433 0.2389 0.2740 -0.0406 0.0369  -0.0590 94  TRP B CZ2 
1906 C CZ3 . TRP B 94  ? 0.2338 0.2312 0.2344 -0.0337 0.0259  -0.0477 94  TRP B CZ3 
1907 C CH2 . TRP B 94  ? 0.2409 0.2438 0.2562 -0.0384 0.0288  -0.0553 94  TRP B CH2 
1908 N N   . LEU B 95  ? 0.1930 0.1441 0.2059 -0.0166 0.0414  -0.0201 95  LEU B N   
1909 C CA  . LEU B 95  ? 0.1897 0.1378 0.2001 -0.0147 0.0399  -0.0158 95  LEU B CA  
1910 C C   . LEU B 95  ? 0.1940 0.1426 0.2075 -0.0191 0.0436  -0.0220 95  LEU B C   
1911 O O   . LEU B 95  ? 0.2004 0.1497 0.2237 -0.0223 0.0494  -0.0283 95  LEU B O   
1912 C CB  . LEU B 95  ? 0.1902 0.1362 0.2126 -0.0108 0.0431  -0.0093 95  LEU B CB  
1913 C CG  . LEU B 95  ? 0.2066 0.1525 0.2228 -0.0054 0.0388  -0.0011 95  LEU B CG  
1914 C CD1 . LEU B 95  ? 0.2039 0.1496 0.2331 -0.0017 0.0429  0.0060  95  LEU B CD1 
1915 C CD2 . LEU B 95  ? 0.1894 0.1348 0.1931 -0.0047 0.0321  0.0001  95  LEU B CD2 
1916 N N   . ALA B 96  ? 0.1948 0.1430 0.2008 -0.0197 0.0409  -0.0209 96  ALA B N   
1917 C CA  . ALA B 96  ? 0.2150 0.1642 0.2242 -0.0236 0.0456  -0.0263 96  ALA B CA  
1918 C C   . ALA B 96  ? 0.2193 0.1671 0.2295 -0.0223 0.0442  -0.0214 96  ALA B C   
1919 O O   . ALA B 96  ? 0.2117 0.1587 0.2119 -0.0211 0.0382  -0.0173 96  ALA B O   
1920 C CB  . ALA B 96  ? 0.2172 0.1702 0.2130 -0.0277 0.0442  -0.0315 96  ALA B CB  
1921 N N   . GLU B 97  ? 0.2324 0.1804 0.2565 -0.0225 0.0500  -0.0223 97  GLU B N   
1922 C CA  . GLU B 97  ? 0.2419 0.1907 0.2705 -0.0219 0.0493  -0.0183 97  GLU B CA  
1923 C C   . GLU B 97  ? 0.2614 0.2117 0.2851 -0.0264 0.0527  -0.0230 97  GLU B C   
1924 O O   . GLU B 97  ? 0.2465 0.1979 0.2715 -0.0296 0.0592  -0.0302 97  GLU B O   
1925 C CB  . GLU B 97  ? 0.2569 0.2063 0.3055 -0.0192 0.0544  -0.0158 97  GLU B CB  
1926 C CG  . GLU B 97  ? 0.2857 0.2383 0.3409 -0.0178 0.0516  -0.0101 97  GLU B CG  
1927 C CD  . GLU B 97  ? 0.3161 0.2711 0.3910 -0.0133 0.0541  -0.0043 97  GLU B CD  
1928 O OE1 . GLU B 97  ? 0.3544 0.3141 0.4370 -0.0120 0.0513  0.0004  97  GLU B OE1 
1929 O OE2 . GLU B 97  ? 0.3264 0.2791 0.4105 -0.0112 0.0589  -0.0041 97  GLU B OE2 
1930 N N   . VAL B 98  ? 0.2704 0.2210 0.2887 -0.0271 0.0488  -0.0192 98  VAL B N   
1931 C CA  . VAL B 98  ? 0.2944 0.2471 0.3106 -0.0312 0.0537  -0.0221 98  VAL B CA  
1932 C C   . VAL B 98  ? 0.3066 0.2617 0.3410 -0.0313 0.0611  -0.0234 98  VAL B C   
1933 O O   . VAL B 98  ? 0.3055 0.2617 0.3535 -0.0280 0.0594  -0.0187 98  VAL B O   
1934 C CB  . VAL B 98  ? 0.2959 0.2474 0.3029 -0.0326 0.0488  -0.0174 98  VAL B CB  
1935 C CG1 . VAL B 98  ? 0.3018 0.2505 0.2922 -0.0320 0.0429  -0.0163 98  VAL B CG1 
1936 C CG2 . VAL B 98  ? 0.2691 0.2206 0.2858 -0.0306 0.0437  -0.0120 98  VAL B CG2 
1937 N N   . LYS B 99  ? 0.3499 0.3070 0.3847 -0.0347 0.0696  -0.0298 99  LYS B N   
1938 C CA  . LYS B 99  ? 0.3929 0.3524 0.4452 -0.0348 0.0782  -0.0319 99  LYS B CA  
1939 C C   . LYS B 99  ? 0.3958 0.3584 0.4565 -0.0347 0.0765  -0.0254 99  LYS B C   
1940 O O   . LYS B 99  ? 0.3731 0.3383 0.4532 -0.0320 0.0783  -0.0223 99  LYS B O   
1941 C CB  . LYS B 99  ? 0.4554 0.4167 0.5020 -0.0392 0.0880  -0.0413 99  LYS B CB  
1942 C CG  . LYS B 99  ? 0.4931 0.4528 0.5499 -0.0391 0.0958  -0.0501 99  LYS B CG  
1943 C CD  . LYS B 99  ? 0.4990 0.4573 0.5426 -0.0407 0.0924  -0.0555 99  LYS B CD  
1944 C CE  . LYS B 99  ? 0.5184 0.4778 0.5632 -0.0448 0.1023  -0.0689 99  LYS B CE  
1945 N NZ  . LYS B 99  ? 0.5206 0.4814 0.5519 -0.0480 0.0992  -0.0762 99  LYS B NZ  
1946 N N   . ASP B 100 ? 0.3987 0.3612 0.4462 -0.0376 0.0732  -0.0230 100 ASP B N   
1947 C CA  . ASP B 100 ? 0.3911 0.3561 0.4467 -0.0386 0.0710  -0.0173 100 ASP B CA  
1948 C C   . ASP B 100 ? 0.3682 0.3303 0.4164 -0.0375 0.0597  -0.0120 100 ASP B C   
1949 O O   . ASP B 100 ? 0.3730 0.3307 0.4039 -0.0384 0.0559  -0.0118 100 ASP B O   
1950 C CB  . ASP B 100 ? 0.4508 0.4174 0.4998 -0.0432 0.0772  -0.0179 100 ASP B CB  
1951 C CG  . ASP B 100 ? 0.4965 0.4678 0.5575 -0.0445 0.0894  -0.0227 100 ASP B CG  
1952 O OD1 . ASP B 100 ? 0.4942 0.4661 0.5677 -0.0418 0.0937  -0.0267 100 ASP B OD1 
1953 O OD2 . ASP B 100 ? 0.5470 0.5208 0.6055 -0.0480 0.0955  -0.0222 100 ASP B OD2 
1954 N N   . TYR B 101 ? 0.3210 0.2863 0.3831 -0.0355 0.0546  -0.0079 101 TYR B N   
1955 C CA  . TYR B 101 ? 0.3270 0.2907 0.3842 -0.0349 0.0443  -0.0042 101 TYR B CA  
1956 C C   . TYR B 101 ? 0.3325 0.2914 0.3777 -0.0390 0.0428  -0.0036 101 TYR B C   
1957 O O   . TYR B 101 ? 0.3244 0.2778 0.3570 -0.0384 0.0362  -0.0029 101 TYR B O   
1958 C CB  . TYR B 101 ? 0.3304 0.3017 0.4065 -0.0339 0.0405  -0.0006 101 TYR B CB  
1959 C CG  . TYR B 101 ? 0.3388 0.3103 0.4105 -0.0329 0.0292  0.0016  101 TYR B CG  
1960 C CD1 . TYR B 101 ? 0.3386 0.3084 0.4075 -0.0372 0.0246  0.0014  101 TYR B CD1 
1961 C CD2 . TYR B 101 ? 0.3241 0.2973 0.3942 -0.0280 0.0238  0.0037  101 TYR B CD2 
1962 C CE1 . TYR B 101 ? 0.3538 0.3235 0.4180 -0.0367 0.0146  0.0014  101 TYR B CE1 
1963 C CE2 . TYR B 101 ? 0.3331 0.3073 0.3969 -0.0272 0.0139  0.0048  101 TYR B CE2 
1964 C CZ  . TYR B 101 ? 0.3425 0.3150 0.4034 -0.0317 0.0093  0.0028  101 TYR B CZ  
1965 O OH  . TYR B 101 ? 0.3904 0.3637 0.4445 -0.0314 0.0000  0.0020  101 TYR B OH  
1966 N N   . ASP B 102 ? 0.3375 0.2984 0.3876 -0.0430 0.0496  -0.0034 102 ASP B N   
1967 C CA  . ASP B 102 ? 0.3431 0.2999 0.3868 -0.0470 0.0488  -0.0008 102 ASP B CA  
1968 C C   . ASP B 102 ? 0.3497 0.3026 0.3756 -0.0483 0.0543  -0.0009 102 ASP B C   
1969 O O   . ASP B 102 ? 0.3657 0.3166 0.3878 -0.0517 0.0577  0.0024  102 ASP B O   
1970 C CB  . ASP B 102 ? 0.3647 0.3271 0.4269 -0.0508 0.0523  0.0010  102 ASP B CB  
1971 C CG  . ASP B 102 ? 0.3819 0.3501 0.4518 -0.0519 0.0640  -0.0003 102 ASP B CG  
1972 O OD1 . ASP B 102 ? 0.3862 0.3530 0.4443 -0.0506 0.0693  -0.0036 102 ASP B OD1 
1973 O OD2 . ASP B 102 ? 0.3707 0.3453 0.4588 -0.0543 0.0681  0.0010  102 ASP B OD2 
1974 N N   . VAL B 103 ? 0.3392 0.2921 0.3550 -0.0457 0.0552  -0.0044 103 VAL B N   
1975 C CA  . VAL B 103 ? 0.3497 0.3016 0.3476 -0.0466 0.0586  -0.0050 103 VAL B CA  
1976 C C   . VAL B 103 ? 0.3582 0.3041 0.3447 -0.0472 0.0541  0.0008  103 VAL B C   
1977 O O   . VAL B 103 ? 0.3518 0.2922 0.3389 -0.0453 0.0463  0.0025  103 VAL B O   
1978 C CB  . VAL B 103 ? 0.3496 0.3024 0.3400 -0.0438 0.0574  -0.0103 103 VAL B CB  
1979 C CG1 . VAL B 103 ? 0.3256 0.2737 0.3124 -0.0402 0.0481  -0.0085 103 VAL B CG1 
1980 C CG2 . VAL B 103 ? 0.3560 0.3117 0.3299 -0.0455 0.0612  -0.0126 103 VAL B CG2 
1981 N N   . GLU B 104 ? 0.3724 0.3192 0.3490 -0.0497 0.0594  0.0040  104 GLU B N   
1982 C CA  . GLU B 104 ? 0.4048 0.3457 0.3719 -0.0498 0.0566  0.0112  104 GLU B CA  
1983 C C   . GLU B 104 ? 0.3991 0.3373 0.3533 -0.0458 0.0497  0.0115  104 GLU B C   
1984 O O   . GLU B 104 ? 0.4064 0.3501 0.3515 -0.0446 0.0502  0.0078  104 GLU B O   
1985 C CB  . GLU B 104 ? 0.4470 0.3911 0.4057 -0.0528 0.0646  0.0164  104 GLU B CB  
1986 C CG  . GLU B 104 ? 0.4736 0.4108 0.4246 -0.0524 0.0625  0.0261  104 GLU B CG  
1987 C CD  . GLU B 104 ? 0.5345 0.4753 0.4771 -0.0549 0.0708  0.0336  104 GLU B CD  
1988 O OE1 . GLU B 104 ? 0.5771 0.5111 0.5202 -0.0554 0.0712  0.0429  104 GLU B OE1 
1989 O OE2 . GLU B 104 ? 0.5514 0.5014 0.4868 -0.0565 0.0774  0.0304  104 GLU B OE2 
1990 N N   . ILE B 105 ? 0.3939 0.3239 0.3486 -0.0440 0.0438  0.0153  105 ILE B N   
1991 C CA  . ILE B 105 ? 0.3932 0.3203 0.3370 -0.0400 0.0383  0.0173  105 ILE B CA  
1992 C C   . ILE B 105 ? 0.4281 0.3526 0.3627 -0.0399 0.0400  0.0264  105 ILE B C   
1993 O O   . ILE B 105 ? 0.4486 0.3656 0.3889 -0.0414 0.0413  0.0319  105 ILE B O   
1994 C CB  . ILE B 105 ? 0.3765 0.2963 0.3260 -0.0372 0.0314  0.0153  105 ILE B CB  
1995 C CG1 . ILE B 105 ? 0.3569 0.2804 0.3158 -0.0370 0.0298  0.0084  105 ILE B CG1 
1996 C CG2 . ILE B 105 ? 0.3793 0.2970 0.3190 -0.0325 0.0267  0.0169  105 ILE B CG2 
1997 C CD1 . ILE B 105 ? 0.3351 0.2661 0.2904 -0.0356 0.0313  0.0039  105 ILE B CD1 
1998 N N   . ARG B 106 ? 0.4517 0.3833 0.3728 -0.0384 0.0403  0.0284  106 ARG B N   
1999 C CA  . ARG B 106 ? 0.5049 0.4355 0.4167 -0.0370 0.0408  0.0390  106 ARG B CA  
2000 C C   . ARG B 106 ? 0.4892 0.4195 0.3945 -0.0316 0.0341  0.0414  106 ARG B C   
2001 O O   . ARG B 106 ? 0.5121 0.4517 0.4105 -0.0304 0.0313  0.0367  106 ARG B O   
2002 C CB  . ARG B 106 ? 0.5511 0.4922 0.4512 -0.0397 0.0471  0.0423  106 ARG B CB  
2003 C CG  . ARG B 106 ? 0.5995 0.5512 0.4965 -0.0422 0.0499  0.0316  106 ARG B CG  
2004 C CD  . ARG B 106 ? 0.6497 0.6125 0.5328 -0.0451 0.0564  0.0335  106 ARG B CD  
2005 N NE  . ARG B 106 ? 0.6859 0.6469 0.5751 -0.0489 0.0653  0.0362  106 ARG B NE  
2009 N N   . LEU B 107 ? 0.4749 0.3949 0.3842 -0.0287 0.0319  0.0483  107 LEU B N   
2010 C CA  . LEU B 107 ? 0.4838 0.4028 0.3898 -0.0229 0.0263  0.0512  107 LEU B CA  
2011 C C   . LEU B 107 ? 0.5106 0.4366 0.4057 -0.0204 0.0264  0.0624  107 LEU B C   
2012 O O   . LEU B 107 ? 0.5050 0.4333 0.3954 -0.0230 0.0313  0.0694  107 LEU B O   
2013 C CB  . LEU B 107 ? 0.4688 0.3727 0.3852 -0.0205 0.0246  0.0526  107 LEU B CB  
2014 C CG  . LEU B 107 ? 0.4490 0.3474 0.3747 -0.0224 0.0231  0.0418  107 LEU B CG  
2015 C CD1 . LEU B 107 ? 0.4444 0.3289 0.3781 -0.0201 0.0214  0.0420  107 LEU B CD1 
2016 C CD2 . LEU B 107 ? 0.4129 0.3200 0.3353 -0.0207 0.0195  0.0337  107 LEU B CD2 
2017 N N   . SER B 108 ? 0.5276 0.4585 0.4187 -0.0153 0.0210  0.0645  108 SER B N   
2018 C CA  . SER B 108 ? 0.5753 0.5137 0.4577 -0.0117 0.0195  0.0768  108 SER B CA  
2019 C C   . SER B 108 ? 0.5847 0.5114 0.4760 -0.0053 0.0173  0.0844  108 SER B C   
2020 O O   . SER B 108 ? 0.5426 0.4560 0.4448 -0.0050 0.0176  0.0784  108 SER B O   
2021 C CB  . SER B 108 ? 0.5690 0.5256 0.4409 -0.0112 0.0147  0.0728  108 SER B CB  
2022 O OG  . SER B 108 ? 0.5506 0.5066 0.4294 -0.0082 0.0097  0.0655  108 SER B OG  
2023 N N   . HIS B 109 ? 0.6132 0.5453 0.5001 -0.0001 0.0153  0.0973  109 HIS B N   
2024 C CA  . HIS B 109 ? 0.6477 0.5680 0.5448 0.0066  0.0146  0.1062  109 HIS B CA  
2025 C C   . HIS B 109 ? 0.6185 0.5344 0.5240 0.0103  0.0107  0.0972  109 HIS B C   
2026 O O   . HIS B 109 ? 0.6130 0.5146 0.5295 0.0146  0.0119  0.0994  109 HIS B O   
2027 C CB  . HIS B 109 ? 0.6964 0.6265 0.5878 0.0123  0.0127  0.1230  109 HIS B CB  
2028 C CG  . HIS B 109 ? 0.7281 0.6774 0.6128 0.0157  0.0050  0.1216  109 HIS B CG  
2029 N ND1 . HIS B 109 ? 0.7430 0.7115 0.6139 0.0114  0.0023  0.1169  109 HIS B ND1 
2030 C CD2 . HIS B 109 ? 0.7531 0.7056 0.6452 0.0227  0.0000  0.1236  109 HIS B CD2 
2031 C CE1 . HIS B 109 ? 0.7642 0.7476 0.6340 0.0150  -0.0049 0.1158  109 HIS B CE1 
2032 N NE2 . HIS B 109 ? 0.7853 0.7593 0.6686 0.0221  -0.0063 0.1205  109 HIS B NE2 
2033 N N   . GLU B 110 ? 0.6082 0.5360 0.5093 0.0087  0.0068  0.0866  110 GLU B N   
2034 C CA  . GLU B 110 ? 0.5956 0.5213 0.5038 0.0121  0.0038  0.0782  110 GLU B CA  
2035 C C   . GLU B 110 ? 0.5356 0.4452 0.4519 0.0102  0.0065  0.0684  110 GLU B C   
2036 O O   . GLU B 110 ? 0.5338 0.4383 0.4563 0.0142  0.0053  0.0640  110 GLU B O   
2037 C CB  . GLU B 110 ? 0.6129 0.5558 0.5153 0.0101  -0.0003 0.0703  110 GLU B CB  
2038 C CG  . GLU B 110 ? 0.7018 0.6628 0.5945 0.0105  -0.0036 0.0783  110 GLU B CG  
2039 C CD  . GLU B 110 ? 0.7311 0.7093 0.6181 0.0066  -0.0071 0.0686  110 GLU B CD  
2040 O OE1 . GLU B 110 ? 0.7286 0.7090 0.6227 0.0081  -0.0096 0.0613  110 GLU B OE1 
2041 O OE2 . GLU B 110 ? 0.7747 0.7641 0.6505 0.0018  -0.0067 0.0680  110 GLU B OE2 
2042 N N   . HIS B 111 ? 0.5004 0.4035 0.4168 0.0042  0.0101  0.0650  111 HIS B N   
2043 C CA  . HIS B 111 ? 0.4725 0.3627 0.3963 0.0020  0.0115  0.0557  111 HIS B CA  
2044 C C   . HIS B 111 ? 0.4807 0.3584 0.4100 -0.0013 0.0158  0.0593  111 HIS B C   
2045 O O   . HIS B 111 ? 0.4885 0.3695 0.4144 -0.0041 0.0187  0.0666  111 HIS B O   
2046 C CB  . HIS B 111 ? 0.4283 0.3254 0.3498 -0.0023 0.0105  0.0444  111 HIS B CB  
2047 C CG  . HIS B 111 ? 0.4144 0.3235 0.3324 0.0001  0.0071  0.0404  111 HIS B CG  
2048 N ND1 . HIS B 111 ? 0.4047 0.3280 0.3161 -0.0013 0.0060  0.0416  111 HIS B ND1 
2049 C CD2 . HIS B 111 ? 0.4059 0.3147 0.3271 0.0037  0.0051  0.0350  111 HIS B CD2 
2050 C CE1 . HIS B 111 ? 0.3882 0.3197 0.3004 0.0008  0.0031  0.0370  111 HIS B CE1 
2051 N NE2 . HIS B 111 ? 0.3916 0.3141 0.3099 0.0041  0.0029  0.0336  111 HIS B NE2 
2052 N N   . GLN B 112 ? 0.4604 0.3244 0.3982 -0.0017 0.0166  0.0533  112 GLN B N   
2053 C CA  . GLN B 112 ? 0.4866 0.3370 0.4330 -0.0051 0.0207  0.0561  112 GLN B CA  
2054 C C   . GLN B 112 ? 0.4674 0.3148 0.4188 -0.0121 0.0209  0.0457  112 GLN B C   
2055 O O   . GLN B 112 ? 0.4808 0.3193 0.4404 -0.0164 0.0242  0.0470  112 GLN B O   
2056 C CB  . GLN B 112 ? 0.5062 0.3415 0.4612 -0.0001 0.0220  0.0579  112 GLN B CB  
2057 C CG  . GLN B 112 ? 0.5132 0.3449 0.4694 0.0021  0.0192  0.0456  112 GLN B CG  
2058 C CD  . GLN B 112 ? 0.5476 0.3640 0.5126 0.0072  0.0216  0.0457  112 GLN B CD  
2059 O OE1 . GLN B 112 ? 0.5480 0.3538 0.5179 0.0052  0.0221  0.0351  112 GLN B OE1 
2060 N NE2 . GLN B 112 ? 0.5593 0.3750 0.5265 0.0138  0.0232  0.0576  112 GLN B NE2 
2061 N N   . ALA B 113 ? 0.4279 0.2831 0.3756 -0.0130 0.0174  0.0360  113 ALA B N   
2062 C CA  . ALA B 113 ? 0.4001 0.2549 0.3529 -0.0186 0.0163  0.0267  113 ALA B CA  
2063 C C   . ALA B 113 ? 0.3681 0.2358 0.3152 -0.0185 0.0134  0.0208  113 ALA B C   
2064 O O   . ALA B 113 ? 0.3604 0.2344 0.3007 -0.0140 0.0119  0.0217  113 ALA B O   
2065 C CB  . ALA B 113 ? 0.3990 0.2416 0.3583 -0.0186 0.0149  0.0191  113 ALA B CB  
2066 N N   . TYR B 114 ? 0.3521 0.2239 0.3036 -0.0233 0.0129  0.0156  114 TYR B N   
2067 C CA  . TYR B 114 ? 0.3365 0.2187 0.2855 -0.0228 0.0107  0.0103  114 TYR B CA  
2068 C C   . TYR B 114 ? 0.3424 0.2241 0.2985 -0.0260 0.0079  0.0035  114 TYR B C   
2069 O O   . TYR B 114 ? 0.3551 0.2313 0.3191 -0.0304 0.0084  0.0027  114 TYR B O   
2070 C CB  . TYR B 114 ? 0.3301 0.2225 0.2775 -0.0251 0.0139  0.0129  114 TYR B CB  
2071 C CG  . TYR B 114 ? 0.3400 0.2329 0.2953 -0.0309 0.0174  0.0141  114 TYR B CG  
2072 C CD1 . TYR B 114 ? 0.3364 0.2343 0.3001 -0.0339 0.0166  0.0091  114 TYR B CD1 
2073 C CD2 . TYR B 114 ? 0.3629 0.2523 0.3182 -0.0330 0.0217  0.0212  114 TYR B CD2 
2074 C CE1 . TYR B 114 ? 0.3440 0.2437 0.3172 -0.0392 0.0201  0.0103  114 TYR B CE1 
2075 C CE2 . TYR B 114 ? 0.3864 0.2768 0.3501 -0.0385 0.0259  0.0226  114 TYR B CE2 
2076 C CZ  . TYR B 114 ? 0.3742 0.2699 0.3474 -0.0416 0.0251  0.0167  114 TYR B CZ  
2077 O OH  . TYR B 114 ? 0.4050 0.3026 0.3889 -0.0470 0.0296  0.0182  114 TYR B OH  
2078 N N   . ARG B 115 ? 0.3068 0.1955 0.2610 -0.0241 0.0050  -0.0008 115 ARG B N   
2079 C CA  . ARG B 115 ? 0.2976 0.1898 0.2577 -0.0266 0.0015  -0.0060 115 ARG B CA  
2080 C C   . ARG B 115 ? 0.2839 0.1869 0.2443 -0.0250 0.0012  -0.0062 115 ARG B C   
2081 O O   . ARG B 115 ? 0.2615 0.1671 0.2158 -0.0211 0.0022  -0.0050 115 ARG B O   
2082 C CB  . ARG B 115 ? 0.3206 0.2076 0.2771 -0.0246 -0.0027 -0.0119 115 ARG B CB  
2083 C CG  . ARG B 115 ? 0.3522 0.2273 0.3121 -0.0272 -0.0027 -0.0146 115 ARG B CG  
2084 C CD  . ARG B 115 ? 0.3715 0.2480 0.3432 -0.0342 -0.0033 -0.0160 115 ARG B CD  
2085 N NE  . ARG B 115 ? 0.3864 0.2519 0.3643 -0.0381 -0.0036 -0.0202 115 ARG B NE  
2086 C CZ  . ARG B 115 ? 0.4180 0.2729 0.4010 -0.0398 0.0011  -0.0157 115 ARG B CZ  
2087 N NH1 . ARG B 115 ? 0.4141 0.2693 0.3942 -0.0376 0.0060  -0.0062 115 ARG B NH1 
2088 N NH2 . ARG B 115 ? 0.4359 0.2800 0.4272 -0.0439 0.0011  -0.0207 115 ARG B NH2 
2089 N N   . TRP B 116 ? 0.2751 0.1847 0.2445 -0.0280 0.0001  -0.0074 116 TRP B N   
2090 C CA  . TRP B 116 ? 0.2713 0.1904 0.2434 -0.0259 -0.0007 -0.0074 116 TRP B CA  
2091 C C   . TRP B 116 ? 0.2797 0.2005 0.2499 -0.0244 -0.0069 -0.0107 116 TRP B C   
2092 O O   . TRP B 116 ? 0.2959 0.2169 0.2712 -0.0280 -0.0106 -0.0137 116 TRP B O   
2093 C CB  . TRP B 116 ? 0.2681 0.1942 0.2528 -0.0294 0.0015  -0.0060 116 TRP B CB  
2094 C CG  . TRP B 116 ? 0.2624 0.1895 0.2485 -0.0307 0.0085  -0.0035 116 TRP B CG  
2095 C CD1 . TRP B 116 ? 0.2758 0.2003 0.2643 -0.0348 0.0129  -0.0017 116 TRP B CD1 
2096 C CD2 . TRP B 116 ? 0.2569 0.1884 0.2418 -0.0284 0.0127  -0.0031 116 TRP B CD2 
2097 N NE1 . TRP B 116 ? 0.2700 0.1980 0.2568 -0.0350 0.0191  -0.0006 116 TRP B NE1 
2098 C CE2 . TRP B 116 ? 0.2663 0.1983 0.2515 -0.0315 0.0192  -0.0022 116 TRP B CE2 
2099 C CE3 . TRP B 116 ? 0.2486 0.1834 0.2327 -0.0244 0.0124  -0.0034 116 TRP B CE3 
2100 C CZ2 . TRP B 116 ? 0.2539 0.1898 0.2379 -0.0310 0.0244  -0.0035 116 TRP B CZ2 
2101 C CZ3 . TRP B 116 ? 0.2428 0.1805 0.2283 -0.0241 0.0181  -0.0042 116 TRP B CZ3 
2102 C CH2 . TRP B 116 ? 0.2447 0.1831 0.2299 -0.0275 0.0236  -0.0051 116 TRP B CH2 
2103 N N   . LEU B 117 ? 0.2683 0.1917 0.2315 -0.0196 -0.0081 -0.0105 117 LEU B N   
2104 C CA  . LEU B 117 ? 0.2884 0.2145 0.2466 -0.0178 -0.0136 -0.0135 117 LEU B CA  
2105 C C   . LEU B 117 ? 0.2745 0.2102 0.2328 -0.0137 -0.0144 -0.0100 117 LEU B C   
2106 O O   . LEU B 117 ? 0.2522 0.1887 0.2111 -0.0109 -0.0098 -0.0063 117 LEU B O   
2107 C CB  . LEU B 117 ? 0.3033 0.2207 0.2497 -0.0151 -0.0139 -0.0171 117 LEU B CB  
2108 C CG  . LEU B 117 ? 0.3343 0.2404 0.2811 -0.0182 -0.0127 -0.0199 117 LEU B CG  
2109 C CD1 . LEU B 117 ? 0.3557 0.2538 0.2941 -0.0138 -0.0097 -0.0197 117 LEU B CD1 
2110 C CD2 . LEU B 117 ? 0.3555 0.2594 0.3044 -0.0223 -0.0175 -0.0267 117 LEU B CD2 
2111 N N   . GLY B 118 ? 0.3419 0.2814 0.2406 -0.0873 -0.0327 0.0014  118 GLY B N   
2112 C CA  . GLY B 118 ? 0.3517 0.2942 0.2490 -0.0865 -0.0313 0.0021  118 GLY B CA  
2113 C C   . GLY B 118 ? 0.3531 0.2852 0.2427 -0.0816 -0.0245 -0.0046 118 GLY B C   
2114 O O   . GLY B 118 ? 0.3605 0.2806 0.2443 -0.0798 -0.0212 -0.0104 118 GLY B O   
2115 N N   . LEU B 119 ? 0.3467 0.2844 0.2396 -0.0792 -0.0222 -0.0026 119 LEU B N   
2116 C CA  . LEU B 119 ? 0.3473 0.2793 0.2381 -0.0735 -0.0149 -0.0068 119 LEU B CA  
2117 C C   . LEU B 119 ? 0.3767 0.2922 0.2477 -0.0754 -0.0112 -0.0137 119 LEU B C   
2118 O O   . LEU B 119 ? 0.3577 0.2652 0.2305 -0.0698 -0.0049 -0.0186 119 LEU B O   
2119 C CB  . LEU B 119 ? 0.3329 0.2744 0.2298 -0.0727 -0.0142 -0.0010 119 LEU B CB  
2120 C CG  . LEU B 119 ? 0.3439 0.2814 0.2393 -0.0675 -0.0065 -0.0031 119 LEU B CG  
2121 C CD1 . LEU B 119 ? 0.3186 0.2553 0.2292 -0.0594 -0.0023 -0.0066 119 LEU B CD1 
2122 C CD2 . LEU B 119 ? 0.3422 0.2905 0.2441 -0.0680 -0.0065 0.0051  119 LEU B CD2 
2123 N N   . GLU B 120 ? 0.4301 0.3405 0.2830 -0.0834 -0.0150 -0.0142 120 GLU B N   
2124 C CA  . GLU B 120 ? 0.4927 0.3863 0.3248 -0.0852 -0.0103 -0.0231 120 GLU B CA  
2125 C C   . GLU B 120 ? 0.4893 0.3687 0.3220 -0.0842 -0.0096 -0.0297 120 GLU B C   
2126 O O   . GLU B 120 ? 0.4927 0.3605 0.3228 -0.0790 -0.0014 -0.0366 120 GLU B O   
2127 C CB  . GLU B 120 ? 0.5590 0.4497 0.3683 -0.0951 -0.0154 -0.0236 120 GLU B CB  
2128 C CG  . GLU B 120 ? 0.6042 0.5072 0.4104 -0.0953 -0.0134 -0.0171 120 GLU B CG  
2129 C CD  . GLU B 120 ? 0.6350 0.5367 0.4434 -0.0862 -0.0013 -0.0200 120 GLU B CD  
2130 O OE1 . GLU B 120 ? 0.6664 0.5553 0.4565 -0.0855 0.0061  -0.0293 120 GLU B OE1 
2131 O OE2 . GLU B 120 ? 0.6116 0.5253 0.4412 -0.0799 0.0008  -0.0131 120 GLU B OE2 
2132 N N   . GLU B 121 ? 0.4836 0.3655 0.3230 -0.0886 -0.0175 -0.0261 121 GLU B N   
2133 C CA  . GLU B 121 ? 0.5103 0.3815 0.3552 -0.0876 -0.0176 -0.0294 121 GLU B CA  
2134 C C   . GLU B 121 ? 0.4591 0.3353 0.3219 -0.0781 -0.0116 -0.0278 121 GLU B C   
2135 O O   . GLU B 121 ? 0.4626 0.3275 0.3283 -0.0744 -0.0069 -0.0320 121 GLU B O   
2136 C CB  . GLU B 121 ? 0.5643 0.4384 0.4125 -0.0955 -0.0278 -0.0240 121 GLU B CB  
2137 C CG  . GLU B 121 ? 0.6565 0.5254 0.4867 -0.1061 -0.0352 -0.0252 121 GLU B CG  
2138 C CD  . GLU B 121 ? 0.7286 0.5964 0.5617 -0.1152 -0.0460 -0.0204 121 GLU B CD  
2139 O OE1 . GLU B 121 ? 0.7526 0.6291 0.6033 -0.1135 -0.0480 -0.0134 121 GLU B OE1 
2140 O OE2 . GLU B 121 ? 0.7959 0.6547 0.6127 -0.1249 -0.0529 -0.0232 121 GLU B OE2 
2141 N N   . ALA B 122 ? 0.4227 0.3153 0.2980 -0.0742 -0.0117 -0.0222 122 ALA B N   
2142 C CA  . ALA B 122 ? 0.4023 0.2997 0.2926 -0.0664 -0.0073 -0.0213 122 ALA B CA  
2143 C C   . ALA B 122 ? 0.3998 0.2874 0.2887 -0.0608 0.0012  -0.0259 122 ALA B C   
2144 O O   . ALA B 122 ? 0.3966 0.2791 0.2943 -0.0566 0.0045  -0.0265 122 ALA B O   
2145 C CB  . ALA B 122 ? 0.3650 0.2796 0.2677 -0.0633 -0.0087 -0.0169 122 ALA B CB  
2146 N N   . CYS B 123 ? 0.4090 0.2958 0.2882 -0.0609 0.0049  -0.0276 123 CYS B N   
2147 C CA  . CYS B 123 ? 0.4491 0.3289 0.3268 -0.0553 0.0145  -0.0312 123 CYS B CA  
2148 C C   . CYS B 123 ? 0.5022 0.3634 0.3714 -0.0552 0.0193  -0.0387 123 CYS B C   
2149 O O   . CYS B 123 ? 0.5153 0.3709 0.3941 -0.0486 0.0270  -0.0402 123 CYS B O   
2150 C CB  . CYS B 123 ? 0.4433 0.3278 0.3101 -0.0566 0.0173  -0.0302 123 CYS B CB  
2151 S SG  . CYS B 123 ? 0.4054 0.3092 0.2921 -0.0530 0.0149  -0.0213 123 CYS B SG  
2152 N N   . GLN B 124 ? 0.5357 0.3874 0.3896 -0.0627 0.0144  -0.0432 124 GLN B N   
2153 C CA  . GLN B 124 ? 0.6035 0.4350 0.4506 -0.0636 0.0177  -0.0518 124 GLN B CA  
2154 C C   . GLN B 124 ? 0.6055 0.4335 0.4739 -0.0592 0.0177  -0.0488 124 GLN B C   
2155 O O   . GLN B 124 ? 0.6187 0.4348 0.4936 -0.0537 0.0260  -0.0531 124 GLN B O   
2156 C CB  . GLN B 124 ? 0.6241 0.4470 0.4537 -0.0740 0.0092  -0.0560 124 GLN B CB  
2157 C CG  . GLN B 124 ? 0.6712 0.4903 0.4747 -0.0792 0.0106  -0.0624 124 GLN B CG  
2158 C CD  . GLN B 124 ? 0.6881 0.4975 0.4746 -0.0908 0.0004  -0.0666 124 GLN B CD  
2159 O OE1 . GLN B 124 ? 0.6738 0.4863 0.4706 -0.0957 -0.0094 -0.0607 124 GLN B OE1 
2160 N NE2 . GLN B 124 ? 0.7228 0.5212 0.4831 -0.0957 0.0028  -0.0766 124 GLN B NE2 
2161 N N   . LEU B 125 ? 0.5789 0.4186 0.4592 -0.0617 0.0091  -0.0405 125 LEU B N   
2162 C CA  . LEU B 125 ? 0.5720 0.4123 0.4721 -0.0586 0.0080  -0.0350 125 LEU B CA  
2163 C C   . LEU B 125 ? 0.5733 0.4208 0.4890 -0.0502 0.0142  -0.0313 125 LEU B C   
2164 O O   . LEU B 125 ? 0.5798 0.4198 0.5091 -0.0459 0.0183  -0.0302 125 LEU B O   
2165 C CB  . LEU B 125 ? 0.5607 0.4147 0.4676 -0.0634 -0.0019 -0.0265 125 LEU B CB  
2166 C CG  . LEU B 125 ? 0.5800 0.4272 0.4816 -0.0718 -0.0096 -0.0261 125 LEU B CG  
2167 C CD1 . LEU B 125 ? 0.5552 0.4192 0.4692 -0.0740 -0.0166 -0.0152 125 LEU B CD1 
2168 C CD2 . LEU B 125 ? 0.6294 0.4549 0.5338 -0.0723 -0.0073 -0.0314 125 LEU B CD2 
2169 N N   . ALA B 126 ? 0.5408 0.4028 0.4572 -0.0480 0.0142  -0.0284 126 ALA B N   
2170 C CA  . ALA B 126 ? 0.5168 0.3862 0.4487 -0.0411 0.0186  -0.0244 126 ALA B CA  
2171 C C   . ALA B 126 ? 0.5511 0.4079 0.4857 -0.0352 0.0296  -0.0284 126 ALA B C   
2172 O O   . ALA B 126 ? 0.5513 0.4091 0.5041 -0.0298 0.0331  -0.0239 126 ALA B O   
2173 C CB  . ALA B 126 ? 0.4838 0.3675 0.4154 -0.0403 0.0170  -0.0224 126 ALA B CB  
2174 N N   . GLN B 127 ? 0.5636 0.4096 0.4800 -0.0366 0.0352  -0.0365 127 GLN B N   
2175 C CA  . GLN B 127 ? 0.6132 0.4452 0.5277 -0.0313 0.0474  -0.0430 127 GLN B CA  
2176 C C   . GLN B 127 ? 0.5986 0.4385 0.5247 -0.0235 0.0566  -0.0390 127 GLN B C   
2177 O O   . GLN B 127 ? 0.6267 0.4642 0.5401 -0.0215 0.0657  -0.0437 127 GLN B O   
2178 C CB  . GLN B 127 ? 0.6647 0.4824 0.5918 -0.0298 0.0487  -0.0445 127 GLN B CB  
2179 C CG  . GLN B 127 ? 0.7527 0.5558 0.6854 -0.0224 0.0627  -0.0508 127 GLN B CG  
2180 C CD  . GLN B 127 ? 0.7961 0.5857 0.7467 -0.0211 0.0624  -0.0504 127 GLN B CD  
2181 O OE1 . GLN B 127 ? 0.8177 0.6128 0.7947 -0.0164 0.0627  -0.0406 127 GLN B OE1 
2182 N NE2 . GLN B 127 ? 0.8410 0.6133 0.7787 -0.0264 0.0603  -0.0600 127 GLN B NE2 
2183 N N   . PHE B 128 ? 0.5534 0.4032 0.5033 -0.0195 0.0543  -0.0299 128 PHE B N   
2184 C CA  A PHE B 128 ? 0.5396 0.3979 0.5038 -0.0128 0.0616  -0.0243 128 PHE B CA  
2185 C CA  B PHE B 128 ? 0.5392 0.3977 0.5031 -0.0129 0.0614  -0.0243 128 PHE B CA  
2186 C C   . PHE B 128 ? 0.5104 0.3820 0.4695 -0.0135 0.0608  -0.0212 128 PHE B C   
2187 O O   . PHE B 128 ? 0.4788 0.3598 0.4323 -0.0186 0.0512  -0.0197 128 PHE B O   
2188 C CB  A PHE B 128 ? 0.5278 0.3935 0.5198 -0.0096 0.0575  -0.0145 128 PHE B CB  
2189 C CB  B PHE B 128 ? 0.5256 0.3918 0.5163 -0.0105 0.0560  -0.0146 128 PHE B CB  
2190 C CG  A PHE B 128 ? 0.5666 0.4210 0.5701 -0.0081 0.0589  -0.0141 128 PHE B CG  
2191 C CG  B PHE B 128 ? 0.5393 0.4173 0.5487 -0.0057 0.0585  -0.0064 128 PHE B CG  
2192 C CD1 A PHE B 128 ? 0.5821 0.4260 0.5978 -0.0009 0.0716  -0.0153 128 PHE B CD1 
2193 C CD1 B PHE B 128 ? 0.5596 0.4345 0.5790 0.0015  0.0717  -0.0050 128 PHE B CD1 
2194 C CD2 A PHE B 128 ? 0.5643 0.4191 0.5684 -0.0137 0.0482  -0.0119 128 PHE B CD2 
2195 C CD2 B PHE B 128 ? 0.5267 0.4191 0.5448 -0.0084 0.0479  -0.0004 128 PHE B CD2 
2196 C CE1 A PHE B 128 ? 0.5990 0.4317 0.6294 0.0006  0.0729  -0.0142 128 PHE B CE1 
2197 C CE1 B PHE B 128 ? 0.5473 0.4342 0.5868 0.0055  0.0734  0.0042  128 PHE B CE1 
2198 C CE2 A PHE B 128 ? 0.5820 0.4270 0.5998 -0.0127 0.0488  -0.0096 128 PHE B CE2 
2199 C CE2 B PHE B 128 ? 0.5383 0.4407 0.5753 -0.0048 0.0487  0.0071  128 PHE B CE2 
2200 C CZ  A PHE B 128 ? 0.5960 0.4292 0.6281 -0.0055 0.0608  -0.0108 128 PHE B CZ  
2201 C CZ  B PHE B 128 ? 0.5409 0.4411 0.5897 0.0019  0.0611  0.0105  128 PHE B CZ  
2202 N N   . LYS B 129 ? 0.5066 0.3782 0.4674 -0.0080 0.0726  -0.0208 129 LYS B N   
2203 C CA  . LYS B 129 ? 0.5179 0.4010 0.4740 -0.0084 0.0744  -0.0170 129 LYS B CA  
2204 C C   . LYS B 129 ? 0.4501 0.3481 0.4204 -0.0108 0.0629  -0.0090 129 LYS B C   
2205 O O   . LYS B 129 ? 0.4242 0.3286 0.3845 -0.0154 0.0573  -0.0088 129 LYS B O   
2206 C CB  . LYS B 129 ? 0.5563 0.4416 0.5218 -0.0008 0.0889  -0.0135 129 LYS B CB  
2207 C CG  . LYS B 129 ? 0.6514 0.5279 0.5918 0.0000  0.1017  -0.0224 129 LYS B CG  
2208 C CD  . LYS B 129 ? 0.6858 0.5687 0.6355 0.0077  0.1171  -0.0173 129 LYS B CD  
2209 C CE  . LYS B 129 ? 0.6725 0.5749 0.6329 0.0068  0.1135  -0.0047 129 LYS B CE  
2210 N NZ  . LYS B 129 ? 0.7307 0.6411 0.6943 0.0130  0.1293  0.0007  129 LYS B NZ  
2211 N N   . GLU B 130 ? 0.4333 0.3366 0.4277 -0.0077 0.0594  -0.0027 130 GLU B N   
2212 C CA  . GLU B 130 ? 0.4208 0.3366 0.4290 -0.0097 0.0490  0.0028  130 GLU B CA  
2213 C C   . GLU B 130 ? 0.3747 0.2919 0.3722 -0.0159 0.0377  -0.0016 130 GLU B C   
2214 O O   . GLU B 130 ? 0.3345 0.2600 0.3342 -0.0183 0.0316  -0.0004 130 GLU B O   
2215 C CB  . GLU B 130 ? 0.4426 0.3638 0.4772 -0.0063 0.0466  0.0103  130 GLU B CB  
2216 C CG  . GLU B 130 ? 0.5463 0.4693 0.5963 0.0001  0.0581  0.0172  130 GLU B CG  
2217 C CD  . GLU B 130 ? 0.5875 0.5220 0.6650 0.0015  0.0528  0.0273  130 GLU B CD  
2218 O OE1 . GLU B 130 ? 0.6600 0.5979 0.7541 0.0068  0.0618  0.0350  130 GLU B OE1 
2219 O OE2 . GLU B 130 ? 0.5950 0.5353 0.6782 -0.0027 0.0400  0.0274  130 GLU B OE2 
2220 N N   . MET B 131 ? 0.3597 0.2691 0.3479 -0.0182 0.0355  -0.0061 131 MET B N   
2221 C CA  . MET B 131 ? 0.3497 0.2621 0.3289 -0.0237 0.0259  -0.0091 131 MET B CA  
2222 C C   . MET B 131 ? 0.3387 0.2504 0.2998 -0.0278 0.0258  -0.0126 131 MET B C   
2223 O O   . MET B 131 ? 0.3105 0.2302 0.2714 -0.0308 0.0191  -0.0123 131 MET B O   
2224 C CB  . MET B 131 ? 0.3690 0.2746 0.3449 -0.0256 0.0236  -0.0106 131 MET B CB  
2225 C CG  . MET B 131 ? 0.3603 0.2723 0.3307 -0.0308 0.0140  -0.0114 131 MET B CG  
2226 S SD  . MET B 131 ? 0.3970 0.3240 0.3827 -0.0303 0.0062  -0.0080 131 MET B SD  
2227 C CE  . MET B 131 ? 0.3365 0.2708 0.3148 -0.0328 0.0029  -0.0120 131 MET B CE  
2228 N N   . LYS B 132 ? 0.3485 0.2512 0.2953 -0.0279 0.0332  -0.0158 132 LYS B N   
2229 C CA  . LYS B 132 ? 0.3617 0.2650 0.2905 -0.0327 0.0323  -0.0177 132 LYS B CA  
2230 C C   . LYS B 132 ? 0.3317 0.2477 0.2690 -0.0323 0.0310  -0.0116 132 LYS B C   
2231 O O   . LYS B 132 ? 0.3176 0.2399 0.2512 -0.0367 0.0248  -0.0101 132 LYS B O   
2232 C CB  . LYS B 132 ? 0.4122 0.3040 0.3223 -0.0330 0.0413  -0.0231 132 LYS B CB  
2233 C CG  . LYS B 132 ? 0.4734 0.3497 0.3750 -0.0342 0.0423  -0.0304 132 LYS B CG  
2234 C CD  . LYS B 132 ? 0.5535 0.4179 0.4303 -0.0372 0.0485  -0.0387 132 LYS B CD  
2235 C CE  . LYS B 132 ? 0.6125 0.4680 0.4901 -0.0300 0.0626  -0.0429 132 LYS B CE  
2236 N NZ  . LYS B 132 ? 0.6906 0.5354 0.5405 -0.0329 0.0698  -0.0528 132 LYS B NZ  
2237 N N   . ALA B 133 ? 0.3210 0.2410 0.2720 -0.0271 0.0368  -0.0069 133 ALA B N   
2238 C CA  . ALA B 133 ? 0.3094 0.2412 0.2729 -0.0265 0.0353  0.0003  133 ALA B CA  
2239 C C   . ALA B 133 ? 0.2804 0.2196 0.2593 -0.0279 0.0249  0.0013  133 ALA B C   
2240 O O   . ALA B 133 ? 0.2719 0.2184 0.2538 -0.0306 0.0206  0.0044  133 ALA B O   
2241 C CB  . ALA B 133 ? 0.3117 0.2468 0.2906 -0.0207 0.0432  0.0063  133 ALA B CB  
2242 N N   . ALA B 134 ? 0.2605 0.1982 0.2484 -0.0264 0.0210  -0.0015 134 ALA B N   
2243 C CA  . ALA B 134 ? 0.2372 0.1816 0.2362 -0.0276 0.0122  -0.0030 134 ALA B CA  
2244 C C   . ALA B 134 ? 0.2314 0.1773 0.2186 -0.0321 0.0077  -0.0064 134 ALA B C   
2245 O O   . ALA B 134 ? 0.2153 0.1682 0.2122 -0.0328 0.0030  -0.0060 134 ALA B O   
2246 C CB  . ALA B 134 ? 0.2410 0.1847 0.2475 -0.0263 0.0088  -0.0052 134 ALA B CB  
2247 N N   . LEU B 135 ? 0.2327 0.1719 0.2019 -0.0349 0.0088  -0.0093 135 LEU B N   
2248 C CA  . LEU B 135 ? 0.2355 0.1768 0.1947 -0.0398 0.0044  -0.0107 135 LEU B CA  
2249 C C   . LEU B 135 ? 0.2382 0.1841 0.1954 -0.0424 0.0042  -0.0061 135 LEU B C   
2250 O O   . LEU B 135 ? 0.2208 0.1743 0.1847 -0.0444 -0.0005 -0.0043 135 LEU B O   
2251 C CB  . LEU B 135 ? 0.2483 0.1806 0.1904 -0.0431 0.0049  -0.0137 135 LEU B CB  
2252 C CG  . LEU B 135 ? 0.2561 0.1867 0.2017 -0.0420 0.0032  -0.0157 135 LEU B CG  
2253 C CD1 . LEU B 135 ? 0.2691 0.1877 0.2017 -0.0446 0.0050  -0.0177 135 LEU B CD1 
2254 C CD2 . LEU B 135 ? 0.2401 0.1810 0.1909 -0.0434 -0.0028 -0.0161 135 LEU B CD2 
2255 N N   . GLN B 136 ? 0.2449 0.1876 0.1947 -0.0422 0.0097  -0.0034 136 GLN B N   
2256 C CA  . GLN B 136 ? 0.2594 0.2086 0.2064 -0.0457 0.0090  0.0029  136 GLN B CA  
2257 C C   . GLN B 136 ? 0.2389 0.1988 0.2109 -0.0431 0.0061  0.0091  136 GLN B C   
2258 O O   . GLN B 136 ? 0.2371 0.2047 0.2156 -0.0461 0.0015  0.0143  136 GLN B O   
2259 C CB  . GLN B 136 ? 0.2901 0.2354 0.2220 -0.0459 0.0167  0.0043  136 GLN B CB  
2260 C CG  . GLN B 136 ? 0.3377 0.2710 0.2432 -0.0500 0.0187  -0.0028 136 GLN B CG  
2261 C CD  . GLN B 136 ? 0.3757 0.3024 0.2671 -0.0478 0.0291  -0.0054 136 GLN B CD  
2262 O OE1 . GLN B 136 ? 0.3858 0.3198 0.2853 -0.0443 0.0346  0.0005  136 GLN B OE1 
2263 N NE2 . GLN B 136 ? 0.4137 0.3267 0.2856 -0.0496 0.0323  -0.0143 136 GLN B NE2 
2264 N N   . GLU B 137 ? 0.2274 0.1875 0.2156 -0.0378 0.0081  0.0088  137 GLU B N   
2265 C CA  . GLU B 137 ? 0.2225 0.1907 0.2364 -0.0357 0.0048  0.0139  137 GLU B CA  
2266 C C   . GLU B 137 ? 0.2147 0.1856 0.2389 -0.0359 -0.0016 0.0088  137 GLU B C   
2267 O O   . GLU B 137 ? 0.2101 0.1874 0.2524 -0.0360 -0.0052 0.0127  137 GLU B O   
2268 C CB  . GLU B 137 ? 0.2294 0.1965 0.2581 -0.0309 0.0074  0.0147  137 GLU B CB  
2269 C CG  . GLU B 137 ? 0.2650 0.2321 0.2873 -0.0296 0.0156  0.0212  137 GLU B CG  
2270 C CD  . GLU B 137 ? 0.2805 0.2448 0.3131 -0.0248 0.0199  0.0215  137 GLU B CD  
2271 O OE1 . GLU B 137 ? 0.2679 0.2314 0.3153 -0.0231 0.0147  0.0183  137 GLU B OE1 
2272 O OE2 . GLU B 137 ? 0.2998 0.2635 0.3257 -0.0228 0.0288  0.0254  137 GLU B OE2 
2273 N N   . GLY B 138 ? 0.2080 0.1745 0.2223 -0.0358 -0.0026 0.0006  138 GLY B N   
2274 C CA  . GLY B 138 ? 0.2110 0.1812 0.2319 -0.0357 -0.0070 -0.0049 138 GLY B CA  
2275 C C   . GLY B 138 ? 0.2211 0.1964 0.2401 -0.0393 -0.0089 -0.0010 138 GLY B C   
2276 O O   . GLY B 138 ? 0.2139 0.1953 0.2500 -0.0382 -0.0114 -0.0006 138 GLY B O   
2277 N N   . HIS B 139 ? 0.2376 0.2100 0.2371 -0.0436 -0.0079 0.0020  139 HIS B N   
2278 C CA  . HIS B 139 ? 0.2562 0.2341 0.2529 -0.0486 -0.0110 0.0080  139 HIS B CA  
2279 C C   . HIS B 139 ? 0.2571 0.2429 0.2708 -0.0491 -0.0127 0.0175  139 HIS B C   
2280 O O   . HIS B 139 ? 0.2579 0.2516 0.2862 -0.0503 -0.0162 0.0224  139 HIS B O   
2281 C CB  . HIS B 139 ? 0.2864 0.2580 0.2573 -0.0541 -0.0105 0.0089  139 HIS B CB  
2282 C CG  . HIS B 139 ? 0.3038 0.2806 0.2694 -0.0609 -0.0156 0.0148  139 HIS B CG  
2283 N ND1 . HIS B 139 ? 0.3298 0.3123 0.2947 -0.0654 -0.0180 0.0241  139 HIS B ND1 
2284 C CD2 . HIS B 139 ? 0.3199 0.2982 0.2816 -0.0643 -0.0193 0.0141  139 HIS B CD2 
2285 C CE1 . HIS B 139 ? 0.3296 0.3166 0.2904 -0.0719 -0.0238 0.0291  139 HIS B CE1 
2286 N NE2 . HIS B 139 ? 0.3349 0.3193 0.2950 -0.0710 -0.0244 0.0230  139 HIS B NE2 
2287 N N   . GLN B 140 ? 0.2568 0.2417 0.2708 -0.0483 -0.0098 0.0220  140 GLN B N   
2288 C CA  . GLN B 140 ? 0.2768 0.2707 0.3089 -0.0491 -0.0116 0.0336  140 GLN B CA  
2289 C C   . GLN B 140 ? 0.2589 0.2568 0.3236 -0.0444 -0.0142 0.0328  140 GLN B C   
2290 O O   . GLN B 140 ? 0.2503 0.2563 0.3352 -0.0455 -0.0177 0.0415  140 GLN B O   
2291 C CB  . GLN B 140 ? 0.3155 0.3088 0.3423 -0.0484 -0.0067 0.0385  140 GLN B CB  
2292 C CG  . GLN B 140 ? 0.3731 0.3771 0.4211 -0.0490 -0.0083 0.0523  140 GLN B CG  
2293 C CD  . GLN B 140 ? 0.4474 0.4528 0.4917 -0.0475 -0.0021 0.0578  140 GLN B CD  
2294 O OE1 . GLN B 140 ? 0.5166 0.5186 0.5339 -0.0494 0.0033  0.0562  140 GLN B OE1 
2295 N NE2 . GLN B 140 ? 0.4551 0.4654 0.5276 -0.0440 -0.0027 0.0645  140 GLN B NE2 
2296 N N   . PHE B 141 ? 0.2249 0.2168 0.2949 -0.0395 -0.0130 0.0222  141 PHE B N   
2297 C CA  . PHE B 141 ? 0.2299 0.2230 0.3270 -0.0353 -0.0155 0.0176  141 PHE B CA  
2298 C C   . PHE B 141 ? 0.2286 0.2262 0.3326 -0.0356 -0.0173 0.0152  141 PHE B C   
2299 O O   . PHE B 141 ? 0.2296 0.2323 0.3601 -0.0342 -0.0194 0.0196  141 PHE B O   
2300 C CB  . PHE B 141 ? 0.2214 0.2075 0.3168 -0.0316 -0.0149 0.0057  141 PHE B CB  
2301 C CG  . PHE B 141 ? 0.2308 0.2165 0.3499 -0.0279 -0.0178 -0.0025 141 PHE B CG  
2302 C CD1 . PHE B 141 ? 0.2336 0.2205 0.3813 -0.0264 -0.0205 0.0022  141 PHE B CD1 
2303 C CD2 . PHE B 141 ? 0.2356 0.2200 0.3479 -0.0263 -0.0177 -0.0153 141 PHE B CD2 
2304 C CE1 . PHE B 141 ? 0.2539 0.2382 0.4242 -0.0232 -0.0234 -0.0073 141 PHE B CE1 
2305 C CE2 . PHE B 141 ? 0.2449 0.2282 0.3760 -0.0230 -0.0197 -0.0254 141 PHE B CE2 
2306 C CZ  . PHE B 141 ? 0.2578 0.2398 0.4181 -0.0214 -0.0226 -0.0223 141 PHE B CZ  
2307 N N   . LEU B 142 ? 0.2310 0.2273 0.3136 -0.0373 -0.0161 0.0096  142 LEU B N   
2308 C CA  . LEU B 142 ? 0.2466 0.2483 0.3344 -0.0373 -0.0166 0.0077  142 LEU B CA  
2309 C C   . LEU B 142 ? 0.2712 0.2813 0.3712 -0.0410 -0.0195 0.0215  142 LEU B C   
2310 O O   . LEU B 142 ? 0.2749 0.2911 0.3987 -0.0387 -0.0200 0.0232  142 LEU B O   
2311 C CB  . LEU B 142 ? 0.2378 0.2376 0.2999 -0.0396 -0.0154 0.0025  142 LEU B CB  
2312 C CG  . LEU B 142 ? 0.2336 0.2283 0.2877 -0.0361 -0.0134 -0.0095 142 LEU B CG  
2313 C CD1 . LEU B 142 ? 0.2362 0.2293 0.2665 -0.0392 -0.0128 -0.0115 142 LEU B CD1 
2314 C CD2 . LEU B 142 ? 0.2493 0.2474 0.3214 -0.0310 -0.0124 -0.0190 142 LEU B CD2 
2315 N N   . CYS B 143 ? 0.2801 0.2909 0.3645 -0.0469 -0.0212 0.0314  143 CYS B N   
2316 C CA  . CYS B 143 ? 0.3160 0.3364 0.4107 -0.0519 -0.0254 0.0467  143 CYS B CA  
2317 C C   . CYS B 143 ? 0.3233 0.3495 0.4526 -0.0488 -0.0268 0.0546  143 CYS B C   
2318 O O   . CYS B 143 ? 0.3326 0.3674 0.4850 -0.0496 -0.0298 0.0638  143 CYS B O   
2319 C CB  . CYS B 143 ? 0.3344 0.3543 0.4024 -0.0592 -0.0269 0.0543  143 CYS B CB  
2320 S SG  . CYS B 143 ? 0.3903 0.4029 0.4239 -0.0639 -0.0270 0.0463  143 CYS B SG  
2321 N N   . SER B 144 ? 0.3270 0.3485 0.4629 -0.0453 -0.0250 0.0520  144 SER B N   
2322 C CA  . SER B 144 ? 0.3442 0.3704 0.5162 -0.0427 -0.0272 0.0602  144 SER B CA  
2323 C C   . SER B 144 ? 0.3611 0.3863 0.5637 -0.0368 -0.0271 0.0522  144 SER B C   
2324 O O   . SER B 144 ? 0.3582 0.3902 0.5932 -0.0363 -0.0299 0.0626  144 SER B O   
2325 C CB  . SER B 144 ? 0.3459 0.3679 0.5209 -0.0407 -0.0258 0.0604  144 SER B CB  
2326 O OG  . SER B 144 ? 0.3517 0.3640 0.5317 -0.0350 -0.0241 0.0445  144 SER B OG  
2327 N N   . ILE B 145 ? 0.3554 0.3730 0.5480 -0.0324 -0.0238 0.0344  145 ILE B N   
2328 C CA  A ILE B 145 ? 0.3882 0.4048 0.6029 -0.0266 -0.0219 0.0235  145 ILE B CA  
2329 C CA  B ILE B 145 ? 0.3883 0.4050 0.6042 -0.0266 -0.0220 0.0239  145 ILE B CA  
2330 C C   . ILE B 145 ? 0.4145 0.4410 0.6425 -0.0277 -0.0220 0.0323  145 ILE B C   
2331 O O   . ILE B 145 ? 0.4412 0.4709 0.7038 -0.0238 -0.0216 0.0340  145 ILE B O   
2332 C CB  A ILE B 145 ? 0.3845 0.3948 0.5765 -0.0237 -0.0180 0.0048  145 ILE B CB  
2333 C CB  B ILE B 145 ? 0.3838 0.3931 0.5807 -0.0230 -0.0183 0.0041  145 ILE B CB  
2334 C CG1 A ILE B 145 ? 0.3775 0.3785 0.5692 -0.0211 -0.0187 -0.0059 145 ILE B CG1 
2335 C CG1 B ILE B 145 ? 0.3734 0.3741 0.5616 -0.0224 -0.0195 -0.0024 145 ILE B CG1 
2336 C CG2 A ILE B 145 ? 0.4098 0.4229 0.6150 -0.0189 -0.0141 -0.0049 145 ILE B CG2 
2337 C CG2 B ILE B 145 ? 0.4167 0.4258 0.6351 -0.0168 -0.0151 -0.0082 145 ILE B CG2 
2338 C CD1 A ILE B 145 ? 0.3691 0.3662 0.5360 -0.0198 -0.0161 -0.0216 145 ILE B CD1 
2339 C CD1 B ILE B 145 ? 0.3635 0.3619 0.5822 -0.0209 -0.0229 0.0024  145 ILE B CD1 
2340 N N   . GLU B 146 ? 0.4183 0.4493 0.6204 -0.0332 -0.0226 0.0380  146 GLU B N   
2341 C CA  . GLU B 146 ? 0.4638 0.5054 0.6767 -0.0358 -0.0240 0.0487  146 GLU B CA  
2342 C C   . GLU B 146 ? 0.4950 0.5456 0.7369 -0.0388 -0.0292 0.0681  146 GLU B C   
2343 O O   . GLU B 146 ? 0.5134 0.5712 0.7877 -0.0362 -0.0291 0.0742  146 GLU B O   
2344 C CB  . GLU B 146 ? 0.4826 0.5262 0.6615 -0.0428 -0.0257 0.0522  146 GLU B CB  
2345 C CG  . GLU B 146 ? 0.5168 0.5542 0.6710 -0.0404 -0.0211 0.0363  146 GLU B CG  
2346 C CD  . GLU B 146 ? 0.5274 0.5639 0.6488 -0.0479 -0.0238 0.0397  146 GLU B CD  
2347 O OE1 . GLU B 146 ? 0.5422 0.5808 0.6543 -0.0553 -0.0290 0.0518  146 GLU B OE1 
2348 O OE2 . GLU B 146 ? 0.5481 0.5819 0.6527 -0.0469 -0.0209 0.0302  146 GLU B OE2 
2349 N N   . ALA B 147 ? 0.4919 0.5431 0.7241 -0.0440 -0.0332 0.0787  147 ALA B N   
2350 C CA  . ALA B 147 ? 0.5204 0.5828 0.7789 -0.0481 -0.0389 0.1000  147 ALA B CA  
2351 C C   . ALA B 147 ? 0.5609 0.6229 0.8666 -0.0411 -0.0383 0.1007  147 ALA B C   
2352 O O   . ALA B 147 ? 0.5499 0.6222 0.8898 -0.0424 -0.0423 0.1175  147 ALA B O   
2353 C CB  . ALA B 147 ? 0.5058 0.5702 0.7417 -0.0548 -0.0419 0.1103  147 ALA B CB  
2354 N N   . LEU B 148 ? 0.5559 0.6056 0.8642 -0.0341 -0.0340 0.0825  148 LEU B N   
2355 C CA  . LEU B 148 ? 0.5979 0.6435 0.9490 -0.0272 -0.0334 0.0784  148 LEU B CA  
2356 C C   . LEU B 148 ? 0.6151 0.6606 0.9890 -0.0208 -0.0289 0.0690  148 LEU B C   
2357 O O   . LEU B 148 ? 0.6018 0.6460 0.9535 -0.0190 -0.0240 0.0564  148 LEU B O   
2358 C CB  . LEU B 148 ? 0.5731 0.6052 0.9176 -0.0231 -0.0317 0.0617  148 LEU B CB  
2359 C CG  . LEU B 148 ? 0.5934 0.6253 0.9427 -0.0260 -0.0357 0.0723  148 LEU B CG  
2360 C CD1 . LEU B 148 ? 0.5447 0.5634 0.8849 -0.0223 -0.0341 0.0540  148 LEU B CD1 
2361 C CD2 . LEU B 148 ? 0.5863 0.6246 0.9839 -0.0259 -0.0405 0.0896  148 LEU B CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   LEU 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   CYS 6   6   6   CYS CYS A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  HIS 36  36  36  HIS HIS A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  TRP 38  38  38  TRP TRP A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  HIS 44  44  44  HIS HIS A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 HIS 109 109 109 HIS HIS A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 TRP 116 116 116 TRP TRP A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 CYS 123 123 123 CYS CYS A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 MET 131 131 131 MET MET A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 GLN 136 136 136 GLN GLN A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 CYS 143 143 143 CYS CYS A . n 
A 1 144 SER 144 144 144 SER SER A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 HIS 151 151 ?   ?   ?   A . n 
A 1 152 HIS 152 152 ?   ?   ?   A . n 
A 1 153 HIS 153 153 ?   ?   ?   A . n 
A 1 154 HIS 154 154 ?   ?   ?   A . n 
A 1 155 HIS 155 155 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   LEU 3   3   3   LEU LEU B . n 
B 1 4   ARG 4   4   4   ARG ARG B . n 
B 1 5   ALA 5   5   5   ALA ALA B . n 
B 1 6   CYS 6   6   6   CYS CYS B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  PHE 11  11  11  PHE PHE B . n 
B 1 12  ARG 12  12  12  ARG ARG B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  CYS 14  14  14  CYS CYS B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  VAL 19  19  ?   ?   ?   B . n 
B 1 20  ASP 20  20  ?   ?   ?   B . n 
B 1 21  ASN 21  21  ?   ?   ?   B . n 
B 1 22  ASN 22  22  22  ASN ASN B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  ILE 24  24  24  ILE ILE B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  HIS 36  36  36  HIS HIS B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  TRP 38  38  38  TRP TRP B . n 
B 1 39  THR 39  39  39  THR THR B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  HIS 44  44  44  HIS HIS B . n 
B 1 45  VAL 45  45  45  VAL VAL B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ALA 63  63  63  ALA ALA B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  ILE 72  72  72  ILE ILE B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  GLU 74  74  74  GLU GLU B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  LYS 77  77  77  LYS LYS B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  GLU 79  79  79  GLU GLU B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ASN 81  81  81  ASN ASN B . n 
B 1 82  TYR 82  82  82  TYR TYR B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  ASN 86  86  86  ASN ASN B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  THR 90  90  90  THR THR B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  TYR 93  93  93  TYR TYR B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  LYS 99  99  99  LYS LYS B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 TYR 101 101 101 TYR TYR B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 HIS 109 109 109 HIS HIS B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 HIS 111 111 111 HIS HIS B . n 
B 1 112 GLN 112 112 112 GLN GLN B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 TRP 116 116 116 TRP TRP B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 GLU 120 120 120 GLU GLU B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 CYS 123 123 123 CYS CYS B . n 
B 1 124 GLN 124 124 124 GLN GLN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 GLN 127 127 127 GLN GLN B . n 
B 1 128 PHE 128 128 128 PHE PHE B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 MET 131 131 131 MET MET B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 GLN 136 136 136 GLN GLN B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 HIS 139 139 139 HIS HIS B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 PHE 141 141 141 PHE PHE B . n 
B 1 142 LEU 142 142 142 LEU LEU B . n 
B 1 143 CYS 143 143 143 CYS CYS B . n 
B 1 144 SER 144 144 144 SER SER B . n 
B 1 145 ILE 145 145 145 ILE ILE B . n 
B 1 146 GLU 146 146 146 GLU GLU B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 GLU 149 149 ?   ?   ?   B . n 
B 1 150 HIS 150 150 ?   ?   ?   B . n 
B 1 151 HIS 151 151 ?   ?   ?   B . n 
B 1 152 HIS 152 152 ?   ?   ?   B . n 
B 1 153 HIS 153 153 ?   ?   ?   B . n 
B 1 154 HIS 154 154 ?   ?   ?   B . n 
B 1 155 HIS 155 155 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GOL 1  201 1   GOL GOL A . 
D 3 PO4 1  201 1   PO4 PO4 B . 
E 4 MG  1  202 1   MG  MG  B . 
F 5 HOH 1  301 9   HOH HOH A . 
F 5 HOH 2  302 10  HOH HOH A . 
F 5 HOH 3  303 12  HOH HOH A . 
F 5 HOH 4  304 13  HOH HOH A . 
F 5 HOH 5  305 14  HOH HOH A . 
F 5 HOH 6  306 16  HOH HOH A . 
F 5 HOH 7  307 19  HOH HOH A . 
F 5 HOH 8  308 20  HOH HOH A . 
F 5 HOH 9  309 22  HOH HOH A . 
F 5 HOH 10 310 23  HOH HOH A . 
F 5 HOH 11 311 24  HOH HOH A . 
F 5 HOH 12 312 25  HOH HOH A . 
F 5 HOH 13 313 26  HOH HOH A . 
F 5 HOH 14 314 27  HOH HOH A . 
F 5 HOH 15 315 29  HOH HOH A . 
F 5 HOH 16 316 31  HOH HOH A . 
F 5 HOH 17 317 33  HOH HOH A . 
F 5 HOH 18 318 35  HOH HOH A . 
F 5 HOH 19 319 36  HOH HOH A . 
F 5 HOH 20 320 38  HOH HOH A . 
F 5 HOH 21 321 40  HOH HOH A . 
F 5 HOH 22 322 41  HOH HOH A . 
F 5 HOH 23 323 43  HOH HOH A . 
F 5 HOH 24 324 44  HOH HOH A . 
F 5 HOH 25 325 46  HOH HOH A . 
F 5 HOH 26 326 47  HOH HOH A . 
F 5 HOH 27 327 49  HOH HOH A . 
F 5 HOH 28 328 50  HOH HOH A . 
F 5 HOH 29 329 51  HOH HOH A . 
F 5 HOH 30 330 52  HOH HOH A . 
F 5 HOH 31 331 55  HOH HOH A . 
F 5 HOH 32 332 60  HOH HOH A . 
F 5 HOH 33 333 63  HOH HOH A . 
F 5 HOH 34 334 68  HOH HOH A . 
F 5 HOH 35 335 69  HOH HOH A . 
F 5 HOH 36 336 75  HOH HOH A . 
F 5 HOH 37 337 77  HOH HOH A . 
F 5 HOH 38 338 80  HOH HOH A . 
F 5 HOH 39 339 81  HOH HOH A . 
F 5 HOH 40 340 83  HOH HOH A . 
F 5 HOH 41 341 85  HOH HOH A . 
F 5 HOH 42 342 90  HOH HOH A . 
F 5 HOH 43 343 91  HOH HOH A . 
F 5 HOH 44 344 93  HOH HOH A . 
F 5 HOH 45 345 95  HOH HOH A . 
F 5 HOH 46 346 96  HOH HOH A . 
F 5 HOH 47 347 102 HOH HOH A . 
F 5 HOH 48 348 104 HOH HOH A . 
F 5 HOH 49 349 105 HOH HOH A . 
F 5 HOH 50 350 106 HOH HOH A . 
F 5 HOH 51 351 107 HOH HOH A . 
F 5 HOH 52 352 109 HOH HOH A . 
F 5 HOH 53 353 111 HOH HOH A . 
F 5 HOH 54 354 113 HOH HOH A . 
F 5 HOH 55 355 115 HOH HOH A . 
F 5 HOH 56 356 121 HOH HOH A . 
F 5 HOH 57 357 122 HOH HOH A . 
F 5 HOH 58 358 124 HOH HOH A . 
F 5 HOH 59 359 125 HOH HOH A . 
F 5 HOH 60 360 127 HOH HOH A . 
F 5 HOH 61 361 130 HOH HOH A . 
F 5 HOH 62 362 134 HOH HOH A . 
F 5 HOH 63 363 136 HOH HOH A . 
F 5 HOH 64 364 137 HOH HOH A . 
F 5 HOH 65 365 138 HOH HOH A . 
F 5 HOH 66 366 139 HOH HOH A . 
F 5 HOH 67 367 144 HOH HOH A . 
F 5 HOH 68 368 145 HOH HOH A . 
F 5 HOH 69 369 147 HOH HOH A . 
F 5 HOH 70 370 148 HOH HOH A . 
F 5 HOH 71 371 149 HOH HOH A . 
F 5 HOH 72 372 150 HOH HOH A . 
F 5 HOH 73 373 152 HOH HOH A . 
F 5 HOH 74 374 158 HOH HOH A . 
F 5 HOH 75 375 160 HOH HOH A . 
F 5 HOH 76 376 161 HOH HOH A . 
F 5 HOH 77 377 165 HOH HOH A . 
F 5 HOH 78 378 167 HOH HOH A . 
F 5 HOH 79 379 178 HOH HOH A . 
F 5 HOH 80 380 181 HOH HOH A . 
F 5 HOH 81 381 182 HOH HOH A . 
F 5 HOH 82 382 183 HOH HOH A . 
F 5 HOH 83 383 184 HOH HOH A . 
F 5 HOH 84 384 189 HOH HOH A . 
F 5 HOH 85 385 193 HOH HOH A . 
F 5 HOH 86 386 197 HOH HOH A . 
F 5 HOH 87 387 198 HOH HOH A . 
F 5 HOH 88 388 204 HOH HOH A . 
F 5 HOH 89 389 208 HOH HOH A . 
F 5 HOH 90 390 209 HOH HOH A . 
F 5 HOH 91 391 210 HOH HOH A . 
F 5 HOH 92 392 211 HOH HOH A . 
F 5 HOH 93 393 217 HOH HOH A . 
F 5 HOH 94 394 218 HOH HOH A . 
F 5 HOH 95 395 224 HOH HOH A . 
F 5 HOH 96 396 226 HOH HOH A . 
F 5 HOH 97 397 227 HOH HOH A . 
G 5 HOH 1  301 1   HOH HOH B . 
G 5 HOH 2  302 2   HOH HOH B . 
G 5 HOH 3  303 3   HOH HOH B . 
G 5 HOH 4  304 4   HOH HOH B . 
G 5 HOH 5  305 5   HOH HOH B . 
G 5 HOH 6  306 11  HOH HOH B . 
G 5 HOH 7  307 17  HOH HOH B . 
G 5 HOH 8  308 18  HOH HOH B . 
G 5 HOH 9  309 21  HOH HOH B . 
G 5 HOH 10 310 28  HOH HOH B . 
G 5 HOH 11 311 32  HOH HOH B . 
G 5 HOH 12 312 34  HOH HOH B . 
G 5 HOH 13 313 39  HOH HOH B . 
G 5 HOH 14 314 42  HOH HOH B . 
G 5 HOH 15 315 45  HOH HOH B . 
G 5 HOH 16 316 48  HOH HOH B . 
G 5 HOH 17 317 53  HOH HOH B . 
G 5 HOH 18 318 56  HOH HOH B . 
G 5 HOH 19 319 58  HOH HOH B . 
G 5 HOH 20 320 59  HOH HOH B . 
G 5 HOH 21 321 61  HOH HOH B . 
G 5 HOH 22 322 66  HOH HOH B . 
G 5 HOH 23 323 70  HOH HOH B . 
G 5 HOH 24 324 71  HOH HOH B . 
G 5 HOH 25 325 72  HOH HOH B . 
G 5 HOH 26 326 73  HOH HOH B . 
G 5 HOH 27 327 76  HOH HOH B . 
G 5 HOH 28 328 78  HOH HOH B . 
G 5 HOH 29 329 79  HOH HOH B . 
G 5 HOH 30 330 82  HOH HOH B . 
G 5 HOH 31 331 86  HOH HOH B . 
G 5 HOH 32 332 88  HOH HOH B . 
G 5 HOH 33 333 89  HOH HOH B . 
G 5 HOH 34 334 92  HOH HOH B . 
G 5 HOH 35 335 98  HOH HOH B . 
G 5 HOH 36 336 99  HOH HOH B . 
G 5 HOH 37 337 101 HOH HOH B . 
G 5 HOH 38 338 108 HOH HOH B . 
G 5 HOH 39 339 110 HOH HOH B . 
G 5 HOH 40 340 112 HOH HOH B . 
G 5 HOH 41 341 114 HOH HOH B . 
G 5 HOH 42 342 117 HOH HOH B . 
G 5 HOH 43 343 118 HOH HOH B . 
G 5 HOH 44 344 119 HOH HOH B . 
G 5 HOH 45 345 123 HOH HOH B . 
G 5 HOH 46 346 126 HOH HOH B . 
G 5 HOH 47 347 128 HOH HOH B . 
G 5 HOH 48 348 133 HOH HOH B . 
G 5 HOH 49 349 135 HOH HOH B . 
G 5 HOH 50 350 140 HOH HOH B . 
G 5 HOH 51 351 141 HOH HOH B . 
G 5 HOH 52 352 143 HOH HOH B . 
G 5 HOH 53 353 146 HOH HOH B . 
G 5 HOH 54 354 151 HOH HOH B . 
G 5 HOH 55 355 153 HOH HOH B . 
G 5 HOH 56 356 154 HOH HOH B . 
G 5 HOH 57 357 156 HOH HOH B . 
G 5 HOH 58 358 159 HOH HOH B . 
G 5 HOH 59 359 162 HOH HOH B . 
G 5 HOH 60 360 163 HOH HOH B . 
G 5 HOH 61 361 169 HOH HOH B . 
G 5 HOH 62 362 170 HOH HOH B . 
G 5 HOH 63 363 171 HOH HOH B . 
G 5 HOH 64 364 177 HOH HOH B . 
G 5 HOH 65 365 179 HOH HOH B . 
G 5 HOH 66 366 180 HOH HOH B . 
G 5 HOH 67 367 185 HOH HOH B . 
G 5 HOH 68 368 188 HOH HOH B . 
G 5 HOH 69 369 190 HOH HOH B . 
G 5 HOH 70 370 191 HOH HOH B . 
G 5 HOH 71 371 192 HOH HOH B . 
G 5 HOH 72 372 194 HOH HOH B . 
G 5 HOH 73 373 195 HOH HOH B . 
G 5 HOH 74 374 196 HOH HOH B . 
G 5 HOH 75 375 199 HOH HOH B . 
G 5 HOH 76 376 200 HOH HOH B . 
G 5 HOH 77 377 202 HOH HOH B . 
G 5 HOH 78 378 203 HOH HOH B . 
G 5 HOH 79 379 205 HOH HOH B . 
G 5 HOH 80 380 206 HOH HOH B . 
G 5 HOH 81 381 207 HOH HOH B . 
G 5 HOH 82 382 212 HOH HOH B . 
G 5 HOH 83 383 213 HOH HOH B . 
G 5 HOH 84 384 214 HOH HOH B . 
G 5 HOH 85 385 215 HOH HOH B . 
G 5 HOH 86 386 216 HOH HOH B . 
G 5 HOH 87 387 220 HOH HOH B . 
G 5 HOH 88 388 222 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-11 
2 'Structure model' 1 1 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                 
2 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 
2 2 'Structure model' software                     
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -8.2254  23.2103 4.3940   0.2371 0.0903 0.1331 -0.0584 0.0701  -0.0387 1.1879 3.2030 1.3070 
-0.0318 -1.1866 0.5479  -0.2737 0.1392  -0.2076 -0.2914 0.1332  -0.2654 0.1231  -0.1138 0.1405  
'X-RAY DIFFRACTION' 2 ? refined -12.8194 34.1555 16.2291  0.1295 0.1291 0.0861 0.0104  0.0055  -0.0341 1.2134 1.3481 1.1051 1.1250 
0.4848  0.4029  0.0593  -0.1654 0.0470  0.1396  -0.0780 0.0979  -0.2078 -0.2306 0.0187  
'X-RAY DIFFRACTION' 3 ? refined -8.5076  36.0332 9.0659   0.1120 0.1058 0.0965 0.0215  0.0137  -0.0097 0.2342 1.0502 1.3155 0.4080 
-0.3782 -0.2838 0.0990  -0.0000 -0.0093 0.0638  -0.0774 -0.0074 -0.1702 -0.0353 -0.0216 
'X-RAY DIFFRACTION' 4 ? refined -11.5186 29.1268 4.1992   0.0599 0.0896 0.0728 -0.0205 -0.0005 -0.0280 1.7224 1.3440 1.5328 0.2340 
-0.9415 -0.2429 -0.0063 0.1548  0.0299  -0.1306 -0.0105 0.0221  0.0846  -0.1703 0.0168  
'X-RAY DIFFRACTION' 5 ? refined 8.9641   46.3375 -5.5534  0.1131 0.1506 0.1303 0.0162  0.0210  -0.0482 6.9133 3.0550 0.4538 0.5287 
1.5888  0.4464  -0.0540 -0.4908 -0.0467 -0.0687 0.0108  -0.2455 -0.0511 -0.1749 0.0432  
'X-RAY DIFFRACTION' 6 ? refined 0.1203   51.5406 -11.9176 0.1838 0.1191 0.0550 0.0542  0.0130  0.0309  2.3559 3.2146 0.0480 0.4169 
0.1729  0.2978  0.1564  0.2152  0.2201  -0.3919 -0.1600 0.0209  -0.0573 -0.0189 0.0036  
'X-RAY DIFFRACTION' 7 ? refined 3.0189   49.4332 -9.9100  0.1172 0.0645 0.0566 -0.0147 0.0140  -0.0069 2.0238 1.2062 0.8021 0.0011 
-0.5207 -0.1213 -0.0892 0.2084  -0.0408 -0.0926 0.0518  -0.0316 -0.0978 -0.0897 0.0374  
'X-RAY DIFFRACTION' 8 ? refined 4.1207   46.3280 2.9117   0.1564 0.1024 0.1028 -0.0467 0.0032  -0.0044 2.5171 1.6346 0.7174 0.3945 
0.1858  -0.9045 0.0646  -0.1989 -0.1506 0.2265  -0.0485 0.1114  -0.2083 0.0738  -0.0161 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 4   ? ? A 26  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 27  ? ? A 69  ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 70  ? ? A 102 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 103 ? ? A 150 ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 B 3   ? ? B 23  ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 B 24  ? ? B 60  ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 B 61  ? ? B 117 ? ? ? ? 
'X-RAY DIFFRACTION' 8 8 B 118 ? ? B 148 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.6.0117 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 33  ? ? -103.25 -161.98 
2 1 ASN A 86  ? ? 59.98   18.61   
3 1 GLN A 127 ? ? 67.04   -52.96  
4 1 GLN B 127 ? ? 67.23   -58.91  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A LEU 3   ? A LEU 3   
4  1 Y 1 A HIS 151 ? A HIS 151 
5  1 Y 1 A HIS 152 ? A HIS 152 
6  1 Y 1 A HIS 153 ? A HIS 153 
7  1 Y 1 A HIS 154 ? A HIS 154 
8  1 Y 1 A HIS 155 ? A HIS 155 
9  1 Y 1 B MET 1   ? B MET 1   
10 1 Y 1 B ALA 2   ? B ALA 2   
11 1 Y 1 B VAL 19  ? B VAL 19  
12 1 Y 1 B ASP 20  ? B ASP 20  
13 1 Y 1 B ASN 21  ? B ASN 21  
14 1 Y 1 B GLU 149 ? B GLU 149 
15 1 Y 1 B HIS 150 ? B HIS 150 
16 1 Y 1 B HIS 151 ? B HIS 151 
17 1 Y 1 B HIS 152 ? B HIS 152 
18 1 Y 1 B HIS 153 ? B HIS 153 
19 1 Y 1 B HIS 154 ? B HIS 154 
20 1 Y 1 B HIS 155 ? B HIS 155 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL        GOL 
3 'PHOSPHATE ION' PO4 
4 'MAGNESIUM ION' MG  
5 water           HOH 
#