data_4ICU
# 
_entry.id   4ICU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ICU         
RCSB  RCSB076591   
WWPDB D_1000076591 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4ICV 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ICU 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Janowski, R.' 1 
'Boutin, M.'   2 
'Zabala, J.C.' 3 
'Coll, M.'     4 
# 
_citation.id                        primary 
_citation.title                     
'The structure of the complex between alpha-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.' 
_citation.journal_abbrev            J.Cell.Sci. 
_citation.journal_volume            128 
_citation.page_first                1824 
_citation.page_last                 1834 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           0021-9533 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25908846 
_citation.pdbx_database_id_DOI      10.1242/jcs.167387 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Serna, M.'         1 
primary 'Carranza, G.'      2 
primary 'Martin-Benito, J.' 3 
primary 'Janowski, R.'      4 
primary 'Canals, A.'        5 
primary 'Coll, M.'          6 
primary 'Zabala, J.C.'      7 
primary 'Valpuesta, J.M.'   8 
# 
_cell.entry_id           4ICU 
_cell.length_a           43.200 
_cell.length_b           60.110 
_cell.length_c           130.450 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ICU 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tubulin-specific chaperone E' 9819.529 4  ? ? 'Ubiquitin-like domain, UNP residues 443-527' ? 
2 water   nat water                          18.015   77 ? ? ?                                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Tubulin-folding cofactor E' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDC
LLVRW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDC
LLVRW
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASN n 
1 2  GLN n 
1 3  LEU n 
1 4  LEU n 
1 5  THR n 
1 6  LEU n 
1 7  LYS n 
1 8  ILE n 
1 9  LYS n 
1 10 TYR n 
1 11 PRO n 
1 12 HIS n 
1 13 GLN n 
1 14 LEU n 
1 15 ASP n 
1 16 GLN n 
1 17 LYS n 
1 18 VAL n 
1 19 LEU n 
1 20 GLU n 
1 21 LYS n 
1 22 GLN n 
1 23 LEU n 
1 24 PRO n 
1 25 GLY n 
1 26 SER n 
1 27 MET n 
1 28 THR n 
1 29 ILE n 
1 30 GLN n 
1 31 LYS n 
1 32 VAL n 
1 33 LYS n 
1 34 GLY n 
1 35 LEU n 
1 36 LEU n 
1 37 SER n 
1 38 ARG n 
1 39 LEU n 
1 40 LEU n 
1 41 LYS n 
1 42 VAL n 
1 43 PRO n 
1 44 VAL n 
1 45 SER n 
1 46 ASP n 
1 47 LEU n 
1 48 LEU n 
1 49 LEU n 
1 50 SER n 
1 51 TYR n 
1 52 GLU n 
1 53 SER n 
1 54 PRO n 
1 55 LYS n 
1 56 LYS n 
1 57 PRO n 
1 58 GLY n 
1 59 ARG n 
1 60 GLU n 
1 61 ILE n 
1 62 GLU n 
1 63 LEU n 
1 64 GLU n 
1 65 ASN n 
1 66 ASP n 
1 67 LEU n 
1 68 LYS n 
1 69 SER n 
1 70 LEU n 
1 71 GLN n 
1 72 PHE n 
1 73 TYR n 
1 74 SER n 
1 75 VAL n 
1 76 GLU n 
1 77 ASN n 
1 78 GLY n 
1 79 ASP n 
1 80 CYS n 
1 81 LEU n 
1 82 LEU n 
1 83 VAL n 
1 84 ARG n 
1 85 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TBCE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'B834(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pOPINS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TBCE_HUMAN 
_struct_ref.pdbx_db_accession          Q15813 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDLKSLQFYSVENGDC
LLVRW
;
_struct_ref.pdbx_align_begin           443 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ICU A 1 ? 85 ? Q15813 443 ? 527 ? 443 527 
2 1 4ICU B 1 ? 85 ? Q15813 443 ? 527 ? 443 527 
3 1 4ICU C 1 ? 85 ? Q15813 443 ? 527 ? 443 527 
4 1 4ICU D 1 ? 85 ? Q15813 443 ? 527 ? 443 527 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4ICU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   42.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'100 mM Tris pH 8.5, 200 mM sodium acetate and 26% PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-02-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
# 
_reflns.entry_id                     4ICU 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   13724 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.143 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.2 
_reflns.B_iso_Wilson_estimate        23.53 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.46 
_reflns_shell.percent_possible_all   87.5 
_reflns_shell.Rmerge_I_obs           0.766 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4ICU 
_refine.ls_number_reflns_obs                     13039 
_refine.ls_number_reflns_all                     13039 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    98.88 
_refine.ls_R_factor_obs                          0.20698 
_refine.ls_R_factor_all                          0.20698 
_refine.ls_R_factor_R_work                       0.20417 
_refine.ls_R_factor_R_free                       0.26349 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  684 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               39.579 
_refine.aniso_B[1][1]                            -0.17 
_refine.aniso_B[2][2]                            3.00 
_refine.aniso_B[3][3]                            -2.83 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4ICV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.649 
_refine.pdbx_overall_ESU_R_Free                  0.301 
_refine.overall_SU_ML                            0.212 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             20.031 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2728 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               2805 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.008  0.022  ? 2809 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.110  2.033  ? 3791 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.389  5.000  ? 340  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 34.436 25.268 ? 112  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 15.960 15.000 ? 593  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 15.149 15.000 ? 14   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.070  0.200  ? 440  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.004  0.021  ? 2000 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            0.357  1.500  ? 1699 ? 'X-RAY DIFFRACTION' 
r_mcangle_it           0.740  2.500  ? 2769 ? 'X-RAY DIFFRACTION' 
r_scbond_it            2.042  5.000  ? 1110 ? 'X-RAY DIFFRACTION' 
r_scangle_it           3.327  10.000 ? 1019 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 329 0.22 0.05 'tight positional'  1 1  'X-RAY DIFFRACTION' ? ? ? 
1 B 329 0.23 0.05 'tight positional'  1 2  'X-RAY DIFFRACTION' ? ? ? 
1 C 329 0.19 0.05 'tight positional'  1 3  'X-RAY DIFFRACTION' ? ? ? 
1 D 329 0.20 0.05 'tight positional'  1 4  'X-RAY DIFFRACTION' ? ? ? 
1 A 321 0.57 0.50 'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? 
1 B 321 0.56 0.50 'medium positional' 1 6  'X-RAY DIFFRACTION' ? ? ? 
1 C 321 0.42 0.50 'medium positional' 1 7  'X-RAY DIFFRACTION' ? ? ? 
1 D 321 0.52 0.50 'medium positional' 1 8  'X-RAY DIFFRACTION' ? ? ? 
1 A 329 0.70 1.50 'tight thermal'     1 9  'X-RAY DIFFRACTION' ? ? ? 
1 B 329 0.39 1.50 'tight thermal'     1 10 'X-RAY DIFFRACTION' ? ? ? 
1 C 329 0.37 1.50 'tight thermal'     1 11 'X-RAY DIFFRACTION' ? ? ? 
1 D 329 0.43 1.50 'tight thermal'     1 12 'X-RAY DIFFRACTION' ? ? ? 
1 A 321 0.86 2.50 'medium thermal'    1 13 'X-RAY DIFFRACTION' ? ? ? 
1 B 321 0.67 2.50 'medium thermal'    1 14 'X-RAY DIFFRACTION' ? ? ? 
1 C 321 0.56 2.50 'medium thermal'    1 15 'X-RAY DIFFRACTION' ? ? ? 
1 D 321 0.68 2.50 'medium thermal'    1 16 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.529 
_refine_ls_shell.number_reflns_R_work             1721 
_refine_ls_shell.R_factor_R_work                  0.233 
_refine_ls_shell.percent_reflns_obs               92.37 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 444 A 527 1 2 ? ? ? ? ? ? ? ? 1 ? 
2 B 444 B 527 1 2 ? ? ? ? ? ? ? ? 1 ? 
3 C 444 C 527 1 2 ? ? ? ? ? ? ? ? 1 ? 
4 D 444 D 527 1 2 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4ICU 
_struct.title                     'Ubiquitin-like domain of human tubulin folding cofactor E - crystal from A' 
_struct.pdbx_descriptor           'Tubulin-specific chaperone E' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ICU 
_struct_keywords.pdbx_keywords   CHAPERONE 
_struct_keywords.text            
'Ubiquitin-like domain, tubulin folding cofactor, alpha tubulin, tubulin folding cofactor B, CHAPERONE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 28 ? LYS A 41 ? THR A 470 LYS A 483 1 ? 14 
HELX_P HELX_P2 2 PRO A 43 ? LEU A 47 ? PRO A 485 LEU A 489 5 ? 5  
HELX_P HELX_P3 3 LEU A 70 ? SER A 74 ? LEU A 512 SER A 516 5 ? 5  
HELX_P HELX_P4 4 THR B 28 ? LYS B 41 ? THR B 470 LYS B 483 1 ? 14 
HELX_P HELX_P5 5 PRO B 43 ? LEU B 47 ? PRO B 485 LEU B 489 5 ? 5  
HELX_P HELX_P6 6 THR C 28 ? LYS C 41 ? THR C 470 LYS C 483 1 ? 14 
HELX_P HELX_P7 7 PRO C 43 ? LEU C 47 ? PRO C 485 LEU C 489 5 ? 5  
HELX_P HELX_P8 8 THR D 28 ? LYS D 41 ? THR D 470 LYS D 483 1 ? 14 
HELX_P HELX_P9 9 PRO D 43 ? LEU D 47 ? PRO D 485 LEU D 489 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 19 ? PRO A 24 ? LEU A 461 PRO A 466 
A 2 LEU A 3  ? LYS A 9  ? LEU A 445 LYS A 451 
A 3 CYS A 80 ? ARG A 84 ? CYS A 522 ARG A 526 
A 4 LEU A 48 ? GLU A 52 ? LEU A 490 GLU A 494 
A 5 ILE A 61 ? GLU A 62 ? ILE A 503 GLU A 504 
B 1 LYS B 17 ? PRO B 24 ? LYS B 459 PRO B 466 
B 2 LEU B 3  ? LYS B 9  ? LEU B 445 LYS B 451 
B 3 CYS B 80 ? ARG B 84 ? CYS B 522 ARG B 526 
B 4 LEU B 48 ? SER B 53 ? LEU B 490 SER B 495 
B 5 LYS B 56 ? GLU B 62 ? LYS B 498 GLU B 504 
C 1 LEU C 19 ? PRO C 24 ? LEU C 461 PRO C 466 
C 2 LEU C 3  ? LYS C 9  ? LEU C 445 LYS C 451 
C 3 CYS C 80 ? ARG C 84 ? CYS C 522 ARG C 526 
C 4 LEU C 48 ? GLU C 52 ? LEU C 490 GLU C 494 
C 5 ILE C 61 ? GLU C 62 ? ILE C 503 GLU C 504 
D 1 LEU D 19 ? PRO D 24 ? LEU D 461 PRO D 466 
D 2 LEU D 3  ? LYS D 9  ? LEU D 445 LYS D 451 
D 3 CYS D 80 ? ARG D 84 ? CYS D 522 ARG D 526 
D 4 LEU D 48 ? GLU D 52 ? LEU D 490 GLU D 494 
D 5 ILE D 61 ? GLU D 62 ? ILE D 503 GLU D 504 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 21 ? O LYS A 463 N LEU A 6  ? N LEU A 448 
A 2 3 N LYS A 7  ? N LYS A 449 O LEU A 81 ? O LEU A 523 
A 3 4 O ARG A 84 ? O ARG A 526 N LEU A 48 ? N LEU A 490 
A 4 5 N TYR A 51 ? N TYR A 493 O ILE A 61 ? O ILE A 503 
B 1 2 O LEU B 19 ? O LEU B 461 N ILE B 8  ? N ILE B 450 
B 2 3 N LYS B 7  ? N LYS B 449 O LEU B 81 ? O LEU B 523 
B 3 4 O ARG B 84 ? O ARG B 526 N LEU B 48 ? N LEU B 490 
B 4 5 N TYR B 51 ? N TYR B 493 O ILE B 61 ? O ILE B 503 
C 1 2 O LYS C 21 ? O LYS C 463 N LEU C 6  ? N LEU C 448 
C 2 3 N LYS C 7  ? N LYS C 449 O LEU C 81 ? O LEU C 523 
C 3 4 O ARG C 84 ? O ARG C 526 N LEU C 48 ? N LEU C 490 
C 4 5 N TYR C 51 ? N TYR C 493 O ILE C 61 ? O ILE C 503 
D 1 2 O LEU D 19 ? O LEU D 461 N ILE D 8  ? N ILE D 450 
D 2 3 N LYS D 7  ? N LYS D 449 O LEU D 81 ? O LEU D 523 
D 3 4 O ARG D 84 ? O ARG D 526 N LEU D 48 ? N LEU D 490 
D 4 5 N TYR D 51 ? N TYR D 493 O ILE D 61 ? O ILE D 503 
# 
_database_PDB_matrix.entry_id          4ICU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ICU 
_atom_sites.fract_transf_matrix[1][1]   0.023148 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007666 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 2  ? 6.300   27.658 -0.401  1.00 38.16 ? 444 GLN A N   1 
ATOM   2    C CA  . GLN A 1 2  ? 6.921   26.302 -0.231  1.00 36.94 ? 444 GLN A CA  1 
ATOM   3    C C   . GLN A 1 2  ? 5.933   25.246 0.291   1.00 34.73 ? 444 GLN A C   1 
ATOM   4    O O   . GLN A 1 2  ? 5.839   24.158 -0.280  1.00 33.39 ? 444 GLN A O   1 
ATOM   5    C CB  . GLN A 1 2  ? 8.161   26.373 0.664   1.00 38.44 ? 444 GLN A CB  1 
ATOM   6    C CG  . GLN A 1 2  ? 9.377   27.082 0.038   1.00 41.01 ? 444 GLN A CG  1 
ATOM   7    C CD  . GLN A 1 2  ? 10.232  26.194 -0.885  1.00 46.96 ? 444 GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 2  ? 11.168  26.689 -1.522  1.00 50.36 ? 444 GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 2  ? 9.920   24.892 -0.959  1.00 41.98 ? 444 GLN A NE2 1 
ATOM   10   N N   . LEU A 1 3  ? 5.215   25.555 1.369   1.00 34.13 ? 445 LEU A N   1 
ATOM   11   C CA  . LEU A 1 3  ? 4.119   24.687 1.830   1.00 32.44 ? 445 LEU A CA  1 
ATOM   12   C C   . LEU A 1 3  ? 2.817   24.987 1.069   1.00 31.33 ? 445 LEU A C   1 
ATOM   13   O O   . LEU A 1 3  ? 2.200   26.040 1.260   1.00 32.81 ? 445 LEU A O   1 
ATOM   14   C CB  . LEU A 1 3  ? 3.905   24.789 3.348   1.00 32.98 ? 445 LEU A CB  1 
ATOM   15   C CG  . LEU A 1 3  ? 2.967   23.725 3.940   1.00 32.06 ? 445 LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 3  ? 3.496   22.306 3.684   1.00 29.42 ? 445 LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 3  ? 2.755   23.942 5.426   1.00 29.73 ? 445 LEU A CD2 1 
ATOM   18   N N   . LEU A 1 4  ? 2.406   24.063 0.208   1.00 28.94 ? 446 LEU A N   1 
ATOM   19   C CA  . LEU A 1 4  ? 1.255   24.298 -0.666  1.00 28.14 ? 446 LEU A CA  1 
ATOM   20   C C   . LEU A 1 4  ? -0.052  23.706 -0.132  1.00 27.10 ? 446 LEU A C   1 
ATOM   21   O O   . LEU A 1 4  ? -0.123  22.513 0.161   1.00 26.32 ? 446 LEU A O   1 
ATOM   22   C CB  . LEU A 1 4  ? 1.529   23.776 -2.087  1.00 27.03 ? 446 LEU A CB  1 
ATOM   23   C CG  . LEU A 1 4  ? 2.821   24.159 -2.827  1.00 27.41 ? 446 LEU A CG  1 
ATOM   24   C CD1 . LEU A 1 4  ? 2.868   23.443 -4.170  1.00 24.46 ? 446 LEU A CD1 1 
ATOM   25   C CD2 . LEU A 1 4  ? 3.004   25.679 -3.008  1.00 24.51 ? 446 LEU A CD2 1 
ATOM   26   N N   . THR A 1 5  ? -1.076  24.548 -0.008  1.00 27.28 ? 447 THR A N   1 
ATOM   27   C CA  . THR A 1 5  ? -2.423  24.091 0.316   1.00 27.46 ? 447 THR A CA  1 
ATOM   28   C C   . THR A 1 5  ? -3.114  23.615 -0.962  1.00 26.94 ? 447 THR A C   1 
ATOM   29   O O   . THR A 1 5  ? -3.372  24.404 -1.865  1.00 27.78 ? 447 THR A O   1 
ATOM   30   C CB  . THR A 1 5  ? -3.252  25.195 1.000   1.00 28.87 ? 447 THR A CB  1 
ATOM   31   O OG1 . THR A 1 5  ? -2.635  25.550 2.238   1.00 30.09 ? 447 THR A OG1 1 
ATOM   32   C CG2 . THR A 1 5  ? -4.682  24.731 1.272   1.00 29.29 ? 447 THR A CG2 1 
ATOM   33   N N   . LEU A 1 6  ? -3.384  22.319 -1.051  1.00 26.15 ? 448 LEU A N   1 
ATOM   34   C CA  . LEU A 1 6  ? -4.036  21.785 -2.234  1.00 25.82 ? 448 LEU A CA  1 
ATOM   35   C C   . LEU A 1 6  ? -5.405  21.197 -1.908  1.00 26.38 ? 448 LEU A C   1 
ATOM   36   O O   . LEU A 1 6  ? -5.606  20.607 -0.841  1.00 26.46 ? 448 LEU A O   1 
ATOM   37   C CB  . LEU A 1 6  ? -3.152  20.762 -2.938  1.00 24.68 ? 448 LEU A CB  1 
ATOM   38   C CG  . LEU A 1 6  ? -1.705  21.170 -3.258  1.00 26.47 ? 448 LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 6  ? -0.979  20.018 -3.915  1.00 22.81 ? 448 LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 6  ? -1.588  22.477 -4.103  1.00 23.89 ? 448 LEU A CD2 1 
ATOM   41   N N   . LYS A 1 7  ? -6.340  21.379 -2.838  1.00 26.61 ? 449 LYS A N   1 
ATOM   42   C CA  . LYS A 1 7  ? -7.664  20.797 -2.742  1.00 27.15 ? 449 LYS A CA  1 
ATOM   43   C C   . LYS A 1 7  ? -7.659  19.500 -3.538  1.00 26.66 ? 449 LYS A C   1 
ATOM   44   O O   . LYS A 1 7  ? -7.064  19.424 -4.610  1.00 27.40 ? 449 LYS A O   1 
ATOM   45   C CB  . LYS A 1 7  ? -8.711  21.787 -3.249  1.00 28.49 ? 449 LYS A CB  1 
ATOM   46   C CG  . LYS A 1 7  ? -8.706  23.072 -2.422  1.00 30.03 ? 449 LYS A CG  1 
ATOM   47   C CD  . LYS A 1 7  ? -9.636  24.116 -2.947  1.00 34.60 ? 449 LYS A CD  1 
ATOM   48   C CE  . LYS A 1 7  ? -9.605  25.356 -2.068  0.50 35.09 ? 449 LYS A CE  1 
ATOM   49   N NZ  . LYS A 1 7  ? -10.905 26.073 -2.113  0.50 35.91 ? 449 LYS A NZ  1 
ATOM   50   N N   . ILE A 1 8  ? -8.273  18.461 -2.994  1.00 26.04 ? 450 ILE A N   1 
ATOM   51   C CA  . ILE A 1 8  ? -8.251  17.162 -3.642  1.00 25.01 ? 450 ILE A CA  1 
ATOM   52   C C   . ILE A 1 8  ? -9.615  16.865 -4.236  1.00 25.28 ? 450 ILE A C   1 
ATOM   53   O O   . ILE A 1 8  ? -10.637 17.153 -3.631  1.00 25.46 ? 450 ILE A O   1 
ATOM   54   C CB  . ILE A 1 8  ? -7.840  16.035 -2.655  1.00 24.76 ? 450 ILE A CB  1 
ATOM   55   C CG1 . ILE A 1 8  ? -6.475  16.335 -2.013  1.00 23.44 ? 450 ILE A CG1 1 
ATOM   56   C CG2 . ILE A 1 8  ? -7.910  14.655 -3.313  1.00 23.96 ? 450 ILE A CG2 1 
ATOM   57   C CD1 . ILE A 1 8  ? -5.278  16.180 -2.899  1.00 22.58 ? 450 ILE A CD1 1 
ATOM   58   N N   . LYS A 1 9  ? -9.603  16.274 -5.426  1.00 25.21 ? 451 LYS A N   1 
ATOM   59   C CA  . LYS A 1 9  ? -10.813 15.939 -6.156  1.00 26.12 ? 451 LYS A CA  1 
ATOM   60   C C   . LYS A 1 9  ? -10.644 14.536 -6.738  1.00 25.95 ? 451 LYS A C   1 
ATOM   61   O O   . LYS A 1 9  ? -9.555  14.179 -7.210  1.00 25.48 ? 451 LYS A O   1 
ATOM   62   C CB  . LYS A 1 9  ? -11.018 16.974 -7.259  1.00 26.11 ? 451 LYS A CB  1 
ATOM   63   C CG  . LYS A 1 9  ? -12.245 16.800 -8.114  1.00 30.33 ? 451 LYS A CG  1 
ATOM   64   C CD  . LYS A 1 9  ? -12.369 17.987 -9.068  1.00 34.27 ? 451 LYS A CD  1 
ATOM   65   C CE  . LYS A 1 9  ? -13.679 17.985 -9.813  1.00 38.95 ? 451 LYS A CE  1 
ATOM   66   N NZ  . LYS A 1 9  ? -13.890 19.308 -10.477 1.00 43.55 ? 451 LYS A NZ  1 
ATOM   67   N N   . TYR A 1 10 ? -11.707 13.737 -6.662  1.00 26.59 ? 452 TYR A N   1 
ATOM   68   C CA  . TYR A 1 10 ? -11.778 12.444 -7.345  1.00 26.64 ? 452 TYR A CA  1 
ATOM   69   C C   . TYR A 1 10 ? -12.850 12.557 -8.413  1.00 27.89 ? 452 TYR A C   1 
ATOM   70   O O   . TYR A 1 10 ? -14.021 12.275 -8.146  1.00 29.15 ? 452 TYR A O   1 
ATOM   71   C CB  . TYR A 1 10 ? -12.165 11.308 -6.399  1.00 26.76 ? 452 TYR A CB  1 
ATOM   72   C CG  . TYR A 1 10 ? -11.435 11.248 -5.089  1.00 25.68 ? 452 TYR A CG  1 
ATOM   73   C CD1 . TYR A 1 10 ? -12.124 10.958 -3.912  1.00 24.88 ? 452 TYR A CD1 1 
ATOM   74   C CD2 . TYR A 1 10 ? -10.071 11.476 -5.015  1.00 26.77 ? 452 TYR A CD2 1 
ATOM   75   C CE1 . TYR A 1 10 ? -11.471 10.889 -2.698  1.00 27.31 ? 452 TYR A CE1 1 
ATOM   76   C CE2 . TYR A 1 10 ? -9.400  11.417 -3.797  1.00 27.32 ? 452 TYR A CE2 1 
ATOM   77   C CZ  . TYR A 1 10 ? -10.109 11.128 -2.643  1.00 27.84 ? 452 TYR A CZ  1 
ATOM   78   O OH  . TYR A 1 10 ? -9.451  11.068 -1.437  1.00 25.52 ? 452 TYR A OH  1 
ATOM   79   N N   . PRO A 1 11 ? -12.463 12.972 -9.626  1.00 27.79 ? 453 PRO A N   1 
ATOM   80   C CA  . PRO A 1 11 ? -13.450 13.335 -10.660 1.00 29.05 ? 453 PRO A CA  1 
ATOM   81   C C   . PRO A 1 11 ? -14.403 12.213 -11.120 1.00 30.31 ? 453 PRO A C   1 
ATOM   82   O O   . PRO A 1 11 ? -15.510 12.496 -11.572 1.00 31.20 ? 453 PRO A O   1 
ATOM   83   C CB  . PRO A 1 11 ? -12.592 13.853 -11.827 1.00 28.64 ? 453 PRO A CB  1 
ATOM   84   C CG  . PRO A 1 11 ? -11.199 13.453 -11.525 1.00 27.71 ? 453 PRO A CG  1 
ATOM   85   C CD  . PRO A 1 11 ? -11.071 13.180 -10.064 1.00 26.98 ? 453 PRO A CD  1 
ATOM   86   N N   A HIS A 1 12 ? -13.971 10.959 -11.000 0.50 30.30 ? 454 HIS A N   1 
ATOM   87   N N   B HIS A 1 12 ? -13.965 10.965 -11.007 0.50 30.19 ? 454 HIS A N   1 
ATOM   88   C CA  A HIS A 1 12 ? -14.826 9.822  -11.363 0.50 31.80 ? 454 HIS A CA  1 
ATOM   89   C CA  B HIS A 1 12 ? -14.792 9.805  -11.346 0.50 31.56 ? 454 HIS A CA  1 
ATOM   90   C C   A HIS A 1 12 ? -15.805 9.453  -10.247 0.50 32.75 ? 454 HIS A C   1 
ATOM   91   C C   B HIS A 1 12 ? -15.872 9.554  -10.292 0.50 32.66 ? 454 HIS A C   1 
ATOM   92   O O   A HIS A 1 12 ? -16.663 8.589  -10.429 0.50 34.32 ? 454 HIS A O   1 
ATOM   93   O O   B HIS A 1 12 ? -16.861 8.872  -10.557 0.50 34.25 ? 454 HIS A O   1 
ATOM   94   C CB  A HIS A 1 12 ? -13.993 8.610  -11.786 0.50 31.51 ? 454 HIS A CB  1 
ATOM   95   C CB  B HIS A 1 12 ? -13.898 8.582  -11.458 0.50 30.90 ? 454 HIS A CB  1 
ATOM   96   C CG  A HIS A 1 12 ? -13.683 7.660  -10.673 0.50 30.13 ? 454 HIS A CG  1 
ATOM   97   C CG  B HIS A 1 12 ? -12.911 8.479  -10.341 0.50 28.17 ? 454 HIS A CG  1 
ATOM   98   N ND1 A HIS A 1 12 ? -12.583 7.803  -9.855  0.50 27.95 ? 454 HIS A ND1 1 
ATOM   99   N ND1 B HIS A 1 12 ? -12.105 9.534  -9.967  0.50 20.53 ? 454 HIS A ND1 1 
ATOM   100  C CD2 A HIS A 1 12 ? -14.320 6.541  -10.253 0.50 29.85 ? 454 HIS A CD2 1 
ATOM   101  C CD2 B HIS A 1 12 ? -12.616 7.460  -9.500  0.50 24.77 ? 454 HIS A CD2 1 
ATOM   102  C CE1 A HIS A 1 12 ? -12.560 6.819  -8.974  0.50 25.45 ? 454 HIS A CE1 1 
ATOM   103  C CE1 B HIS A 1 12 ? -11.349 9.167  -8.952  0.50 16.83 ? 454 HIS A CE1 1 
ATOM   104  N NE2 A HIS A 1 12 ? -13.602 6.040  -9.194  0.50 28.73 ? 454 HIS A NE2 1 
ATOM   105  N NE2 B HIS A 1 12 ? -11.639 7.914  -8.649  0.50 23.78 ? 454 HIS A NE2 1 
ATOM   106  N N   . GLN A 1 13 ? -15.679 10.118 -9.101  1.00 32.22 ? 455 GLN A N   1 
ATOM   107  C CA  . GLN A 1 13 ? -16.593 9.890  -7.969  1.00 33.79 ? 455 GLN A CA  1 
ATOM   108  C C   . GLN A 1 13 ? -17.530 11.056 -7.656  1.00 35.36 ? 455 GLN A C   1 
ATOM   109  O O   . GLN A 1 13 ? -18.701 10.845 -7.319  1.00 36.78 ? 455 GLN A O   1 
ATOM   110  C CB  . GLN A 1 13 ? -15.815 9.460  -6.718  1.00 32.65 ? 455 GLN A CB  1 
ATOM   111  C CG  . GLN A 1 13 ? -15.211 8.056  -6.846  1.00 31.67 ? 455 GLN A CG  1 
ATOM   112  C CD  . GLN A 1 13 ? -14.598 7.531  -5.559  1.00 29.37 ? 455 GLN A CD  1 
ATOM   113  O OE1 . GLN A 1 13 ? -14.451 6.317  -5.377  1.00 27.99 ? 455 GLN A OE1 1 
ATOM   114  N NE2 . GLN A 1 13 ? -14.242 8.439  -4.656  1.00 26.73 ? 455 GLN A NE2 1 
ATOM   115  N N   . LEU A 1 14 ? -17.019 12.280 -7.777  1.00 35.40 ? 456 LEU A N   1 
ATOM   116  C CA  . LEU A 1 14 ? -17.770 13.465 -7.393  1.00 36.73 ? 456 LEU A CA  1 
ATOM   117  C C   . LEU A 1 14 ? -17.190 14.722 -8.041  1.00 36.76 ? 456 LEU A C   1 
ATOM   118  O O   . LEU A 1 14 ? -15.990 14.808 -8.280  1.00 35.40 ? 456 LEU A O   1 
ATOM   119  C CB  . LEU A 1 14 ? -17.770 13.592 -5.864  1.00 36.21 ? 456 LEU A CB  1 
ATOM   120  C CG  . LEU A 1 14 ? -18.738 14.524 -5.131  1.00 37.94 ? 456 LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 14 ? -20.226 14.167 -5.348  1.00 39.45 ? 456 LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 14 ? -18.392 14.521 -3.657  1.00 36.32 ? 456 LEU A CD2 1 
ATOM   123  N N   . ASP A 1 15 ? -18.060 15.688 -8.322  1.00 38.86 ? 457 ASP A N   1 
ATOM   124  C CA  . ASP A 1 15 ? -17.674 16.970 -8.927  1.00 39.34 ? 457 ASP A CA  1 
ATOM   125  C C   . ASP A 1 15 ? -17.053 17.969 -7.962  1.00 38.24 ? 457 ASP A C   1 
ATOM   126  O O   . ASP A 1 15 ? -16.406 18.925 -8.380  1.00 38.46 ? 457 ASP A O   1 
ATOM   127  C CB  . ASP A 1 15 ? -18.891 17.628 -9.574  1.00 41.36 ? 457 ASP A CB  1 
ATOM   128  C CG  . ASP A 1 15 ? -18.968 17.365 -11.055 1.00 44.97 ? 457 ASP A CG  1 
ATOM   129  O OD1 . ASP A 1 15 ? -17.952 17.595 -11.749 1.00 47.45 ? 457 ASP A OD1 1 
ATOM   130  O OD2 . ASP A 1 15 ? -20.047 16.945 -11.529 1.00 52.82 ? 457 ASP A OD2 1 
ATOM   131  N N   . GLN A 1 16 ? -17.263 17.761 -6.673  1.00 37.78 ? 458 GLN A N   1 
ATOM   132  C CA  . GLN A 1 16 ? -16.809 18.716 -5.677  1.00 36.64 ? 458 GLN A CA  1 
ATOM   133  C C   . GLN A 1 16 ? -15.477 18.282 -5.078  1.00 34.59 ? 458 GLN A C   1 
ATOM   134  O O   . GLN A 1 16 ? -15.065 17.115 -5.210  1.00 33.40 ? 458 GLN A O   1 
ATOM   135  C CB  . GLN A 1 16 ? -17.877 18.904 -4.587  1.00 38.32 ? 458 GLN A CB  1 
ATOM   136  C CG  . GLN A 1 16 ? -19.169 19.581 -5.059  1.00 39.46 ? 458 GLN A CG  1 
ATOM   137  C CD  . GLN A 1 16 ? -20.132 18.617 -5.737  1.00 45.80 ? 458 GLN A CD  1 
ATOM   138  O OE1 . GLN A 1 16 ? -19.830 17.435 -5.902  1.00 45.88 ? 458 GLN A OE1 1 
ATOM   139  N NE2 . GLN A 1 16 ? -21.301 19.120 -6.132  1.00 47.33 ? 458 GLN A NE2 1 
ATOM   140  N N   . LYS A 1 17 ? -14.792 19.240 -4.452  1.00 33.69 ? 459 LYS A N   1 
ATOM   141  C CA  . LYS A 1 17 ? -13.561 18.965 -3.714  1.00 31.84 ? 459 LYS A CA  1 
ATOM   142  C C   . LYS A 1 17 ? -13.857 18.054 -2.513  1.00 31.63 ? 459 LYS A C   1 
ATOM   143  O O   . LYS A 1 17 ? -14.883 18.197 -1.834  1.00 32.45 ? 459 LYS A O   1 
ATOM   144  C CB  . LYS A 1 17 ? -12.890 20.270 -3.294  1.00 31.65 ? 459 LYS A CB  1 
ATOM   145  C CG  . LYS A 1 17 ? -12.310 21.051 -4.480  1.00 32.09 ? 459 LYS A CG  1 
ATOM   146  C CD  . LYS A 1 17 ? -12.523 22.545 -4.361  0.10 35.96 ? 459 LYS A CD  1 
ATOM   147  C CE  . LYS A 1 17 ? -12.120 23.245 -5.654  0.10 37.72 ? 459 LYS A CE  1 
ATOM   148  N NZ  . LYS A 1 17 ? -12.204 24.729 -5.554  0.10 38.95 ? 459 LYS A NZ  1 
ATOM   149  N N   . VAL A 1 18 ? -12.963 17.101 -2.289  1.00 30.37 ? 460 VAL A N   1 
ATOM   150  C CA  . VAL A 1 18 ? -13.157 16.052 -1.297  1.00 30.79 ? 460 VAL A CA  1 
ATOM   151  C C   . VAL A 1 18 ? -12.464 16.393 0.032   1.00 30.64 ? 460 VAL A C   1 
ATOM   152  O O   . VAL A 1 18 ? -12.988 16.108 1.112   1.00 31.35 ? 460 VAL A O   1 
ATOM   153  C CB  . VAL A 1 18 ? -12.725 14.658 -1.887  1.00 30.14 ? 460 VAL A CB  1 
ATOM   154  C CG1 . VAL A 1 18 ? -12.453 13.622 -0.808  1.00 29.37 ? 460 VAL A CG1 1 
ATOM   155  C CG2 . VAL A 1 18 ? -13.791 14.146 -2.850  1.00 31.56 ? 460 VAL A CG2 1 
ATOM   156  N N   . LEU A 1 19 ? -11.297 17.015 -0.055  1.00 29.84 ? 461 LEU A N   1 
ATOM   157  C CA  . LEU A 1 19 ? -10.519 17.357 1.130   1.00 30.38 ? 461 LEU A CA  1 
ATOM   158  C C   . LEU A 1 19 ? -9.469  18.408 0.784   1.00 29.87 ? 461 LEU A C   1 
ATOM   159  O O   . LEU A 1 19 ? -9.295  18.757 -0.383  1.00 29.14 ? 461 LEU A O   1 
ATOM   160  C CB  . LEU A 1 19 ? -9.866  16.103 1.740   1.00 29.58 ? 461 LEU A CB  1 
ATOM   161  C CG  . LEU A 1 19 ? -8.905  15.285 0.870   1.00 29.91 ? 461 LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 19 ? -7.471  15.567 1.272   1.00 34.11 ? 461 LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 19 ? -9.174  13.801 1.004   1.00 30.93 ? 461 LEU A CD2 1 
ATOM   164  N N   . GLU A 1 20 ? -8.799  18.918 1.811   1.00 30.36 ? 462 GLU A N   1 
ATOM   165  C CA  . GLU A 1 20 ? -7.638  19.783 1.637   1.00 30.89 ? 462 GLU A CA  1 
ATOM   166  C C   . GLU A 1 20 ? -6.445  19.239 2.403   1.00 30.90 ? 462 GLU A C   1 
ATOM   167  O O   . GLU A 1 20 ? -6.563  18.842 3.571   1.00 31.56 ? 462 GLU A O   1 
ATOM   168  C CB  . GLU A 1 20 ? -7.934  21.204 2.102   1.00 31.90 ? 462 GLU A CB  1 
ATOM   169  C CG  . GLU A 1 20 ? -8.819  21.959 1.155   1.00 34.76 ? 462 GLU A CG  1 
ATOM   170  C CD  . GLU A 1 20 ? -9.068  23.385 1.578   1.00 39.87 ? 462 GLU A CD  1 
ATOM   171  O OE1 . GLU A 1 20 ? -8.145  24.027 2.133   1.00 40.99 ? 462 GLU A OE1 1 
ATOM   172  O OE2 . GLU A 1 20 ? -10.197 23.862 1.337   1.00 42.96 ? 462 GLU A OE2 1 
ATOM   173  N N   . LYS A 1 21 ? -5.298  19.240 1.730   1.00 30.57 ? 463 LYS A N   1 
ATOM   174  C CA  . LYS A 1 21 ? -4.041  18.770 2.287   1.00 30.23 ? 463 LYS A CA  1 
ATOM   175  C C   . LYS A 1 21 ? -2.974  19.844 2.103   1.00 30.08 ? 463 LYS A C   1 
ATOM   176  O O   . LYS A 1 21 ? -2.956  20.540 1.091   1.00 29.95 ? 463 LYS A O   1 
ATOM   177  C CB  . LYS A 1 21 ? -3.619  17.479 1.578   1.00 29.55 ? 463 LYS A CB  1 
ATOM   178  C CG  . LYS A 1 21 ? -4.021  16.192 2.289   1.00 32.09 ? 463 LYS A CG  1 
ATOM   179  C CD  . LYS A 1 21 ? -2.985  15.822 3.350   1.00 41.00 ? 463 LYS A CD  1 
ATOM   180  C CE  . LYS A 1 21 ? -3.437  14.664 4.215   1.00 45.37 ? 463 LYS A CE  1 
ATOM   181  N NZ  . LYS A 1 21 ? -2.431  14.383 5.277   1.00 47.54 ? 463 LYS A NZ  1 
ATOM   182  N N   . GLN A 1 22 ? -2.092  19.986 3.088   1.00 30.32 ? 464 GLN A N   1 
ATOM   183  C CA  . GLN A 1 22 ? -0.916  20.838 2.939   1.00 30.35 ? 464 GLN A CA  1 
ATOM   184  C C   . GLN A 1 22 ? 0.325   20.012 2.603   1.00 29.62 ? 464 GLN A C   1 
ATOM   185  O O   . GLN A 1 22 ? 0.760   19.173 3.398   1.00 30.40 ? 464 GLN A O   1 
ATOM   186  C CB  . GLN A 1 22 ? -0.685  21.686 4.182   1.00 31.49 ? 464 GLN A CB  1 
ATOM   187  C CG  . GLN A 1 22 ? -1.604  22.879 4.260   1.00 33.15 ? 464 GLN A CG  1 
ATOM   188  C CD  . GLN A 1 22 ? -1.033  23.996 5.106   0.50 37.77 ? 464 GLN A CD  1 
ATOM   189  O OE1 . GLN A 1 22 ? -0.320  23.755 6.073   0.50 37.62 ? 464 GLN A OE1 1 
ATOM   190  N NE2 . GLN A 1 22 ? -1.343  25.234 4.738   0.50 39.35 ? 464 GLN A NE2 1 
ATOM   191  N N   . LEU A 1 23 ? 0.882   20.242 1.418   1.00 28.46 ? 465 LEU A N   1 
ATOM   192  C CA  . LEU A 1 23 ? 2.005   19.439 0.939   1.00 27.82 ? 465 LEU A CA  1 
ATOM   193  C C   . LEU A 1 23 ? 3.194   20.313 0.622   1.00 27.96 ? 465 LEU A C   1 
ATOM   194  O O   . LEU A 1 23 ? 3.032   21.379 0.020   1.00 28.59 ? 465 LEU A O   1 
ATOM   195  C CB  . LEU A 1 23 ? 1.608   18.636 -0.297  1.00 27.26 ? 465 LEU A CB  1 
ATOM   196  C CG  . LEU A 1 23 ? 0.388   17.706 -0.187  1.00 26.50 ? 465 LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 23 ? 0.049   17.133 -1.541  1.00 23.39 ? 465 LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 23 ? 0.620   16.579 0.819   1.00 25.40 ? 465 LEU A CD2 1 
ATOM   199  N N   . PRO A 1 24 ? 4.393   19.895 1.057   1.00 27.72 ? 466 PRO A N   1 
ATOM   200  C CA  . PRO A 1 24 ? 5.614   20.606 0.649   1.00 27.99 ? 466 PRO A CA  1 
ATOM   201  C C   . PRO A 1 24 ? 5.760   20.725 -0.868  1.00 27.20 ? 466 PRO A C   1 
ATOM   202  O O   . PRO A 1 24 ? 5.388   19.816 -1.597  1.00 26.32 ? 466 PRO A O   1 
ATOM   203  C CB  . PRO A 1 24 ? 6.726   19.740 1.236   1.00 28.51 ? 466 PRO A CB  1 
ATOM   204  C CG  . PRO A 1 24 ? 6.094   19.143 2.477   1.00 28.42 ? 466 PRO A CG  1 
ATOM   205  C CD  . PRO A 1 24 ? 4.640   18.950 2.163   1.00 27.35 ? 466 PRO A CD  1 
ATOM   206  N N   . GLY A 1 25 ? 6.288   21.856 -1.333  1.00 28.11 ? 467 GLY A N   1 
ATOM   207  C CA  . GLY A 1 25 ? 6.522   22.084 -2.762  1.00 27.41 ? 467 GLY A CA  1 
ATOM   208  C C   . GLY A 1 25 ? 7.561   21.155 -3.373  1.00 26.87 ? 467 GLY A C   1 
ATOM   209  O O   . GLY A 1 25 ? 7.519   20.874 -4.571  1.00 26.22 ? 467 GLY A O   1 
ATOM   210  N N   . SER A 1 26 ? 8.483   20.671 -2.542  1.00 27.18 ? 468 SER A N   1 
ATOM   211  C CA  . SER A 1 26 ? 9.535   19.735 -2.972  1.00 27.15 ? 468 SER A CA  1 
ATOM   212  C C   . SER A 1 26 ? 9.133   18.261 -2.819  1.00 26.75 ? 468 SER A C   1 
ATOM   213  O O   . SER A 1 26 ? 9.970   17.345 -2.992  1.00 26.79 ? 468 SER A O   1 
ATOM   214  C CB  . SER A 1 26 ? 10.823  20.000 -2.200  1.00 28.13 ? 468 SER A CB  1 
ATOM   215  O OG  . SER A 1 26 ? 10.580  19.938 -0.814  1.00 26.64 ? 468 SER A OG  1 
ATOM   216  N N   . MET A 1 27 ? 7.859   18.039 -2.495  1.00 25.72 ? 469 MET A N   1 
ATOM   217  C CA  . MET A 1 27 ? 7.313   16.698 -2.430  1.00 25.42 ? 469 MET A CA  1 
ATOM   218  C C   . MET A 1 27 ? 7.224   16.117 -3.823  1.00 25.54 ? 469 MET A C   1 
ATOM   219  O O   . MET A 1 27 ? 6.679   16.738 -4.727  1.00 25.57 ? 469 MET A O   1 
ATOM   220  C CB  . MET A 1 27 ? 5.936   16.693 -1.770  1.00 24.98 ? 469 MET A CB  1 
ATOM   221  C CG  . MET A 1 27 ? 5.438   15.305 -1.423  1.00 24.29 ? 469 MET A CG  1 
ATOM   222  S SD  . MET A 1 27 ? 4.005   15.421 -0.366  1.00 31.38 ? 469 MET A SD  1 
ATOM   223  C CE  . MET A 1 27 ? 3.983   13.792 0.386   1.00 24.48 ? 469 MET A CE  1 
ATOM   224  N N   . THR A 1 28 ? 7.784   14.929 -3.999  1.00 26.51 ? 470 THR A N   1 
ATOM   225  C CA  . THR A 1 28 ? 7.750   14.274 -5.292  1.00 27.04 ? 470 THR A CA  1 
ATOM   226  C C   . THR A 1 28 ? 6.373   13.661 -5.539  1.00 26.71 ? 470 THR A C   1 
ATOM   227  O O   . THR A 1 28 ? 5.621   13.418 -4.598  1.00 26.77 ? 470 THR A O   1 
ATOM   228  C CB  . THR A 1 28 ? 8.853   13.219 -5.424  1.00 28.06 ? 470 THR A CB  1 
ATOM   229  O OG1 . THR A 1 28 ? 8.641   12.181 -4.463  1.00 28.20 ? 470 THR A OG1 1 
ATOM   230  C CG2 . THR A 1 28 ? 10.228  13.853 -5.214  1.00 27.90 ? 470 THR A CG2 1 
ATOM   231  N N   . ILE A 1 29 ? 6.044   13.427 -6.807  1.00 27.19 ? 471 ILE A N   1 
ATOM   232  C CA  . ILE A 1 29 ? 4.737   12.863 -7.177  1.00 27.18 ? 471 ILE A CA  1 
ATOM   233  C C   . ILE A 1 29 ? 4.577   11.432 -6.641  1.00 27.29 ? 471 ILE A C   1 
ATOM   234  O O   . ILE A 1 29 ? 3.489   11.050 -6.187  1.00 27.13 ? 471 ILE A O   1 
ATOM   235  C CB  . ILE A 1 29 ? 4.490   12.942 -8.716  1.00 27.42 ? 471 ILE A CB  1 
ATOM   236  C CG1 . ILE A 1 29 ? 4.538   14.402 -9.208  1.00 28.48 ? 471 ILE A CG1 1 
ATOM   237  C CG2 . ILE A 1 29 ? 3.178   12.271 -9.115  1.00 27.55 ? 471 ILE A CG2 1 
ATOM   238  C CD1 . ILE A 1 29 ? 3.594   15.375 -8.501  1.00 25.47 ? 471 ILE A CD1 1 
ATOM   239  N N   . GLN A 1 30 ? 5.665   10.661 -6.683  1.00 28.19 ? 472 GLN A N   1 
ATOM   240  C CA  . GLN A 1 30 ? 5.734   9.348  -6.029  1.00 29.01 ? 472 GLN A CA  1 
ATOM   241  C C   . GLN A 1 30 ? 5.293   9.401  -4.549  1.00 28.42 ? 472 GLN A C   1 
ATOM   242  O O   . GLN A 1 30 ? 4.567   8.519  -4.077  1.00 28.54 ? 472 GLN A O   1 
ATOM   243  C CB  . GLN A 1 30 ? 7.156   8.782  -6.140  1.00 30.38 ? 472 GLN A CB  1 
ATOM   244  C CG  . GLN A 1 30 ? 7.376   7.470  -5.413  1.00 32.66 ? 472 GLN A CG  1 
ATOM   245  C CD  . GLN A 1 30 ? 8.771   6.920  -5.603  0.50 37.72 ? 472 GLN A CD  1 
ATOM   246  O OE1 . GLN A 1 30 ? 9.070   6.301  -6.623  0.50 37.98 ? 472 GLN A OE1 1 
ATOM   247  N NE2 . GLN A 1 30 ? 9.633   7.129  -4.610  0.50 40.07 ? 472 GLN A NE2 1 
ATOM   248  N N   . LYS A 1 31 ? 5.734   10.432 -3.828  1.00 27.58 ? 473 LYS A N   1 
ATOM   249  C CA  . LYS A 1 31 ? 5.429   10.548 -2.404  1.00 27.39 ? 473 LYS A CA  1 
ATOM   250  C C   . LYS A 1 31 ? 4.008   11.025 -2.163  1.00 26.33 ? 473 LYS A C   1 
ATOM   251  O O   . LYS A 1 31 ? 3.375   10.611 -1.192  1.00 26.71 ? 473 LYS A O   1 
ATOM   252  C CB  . LYS A 1 31 ? 6.428   11.452 -1.678  1.00 27.40 ? 473 LYS A CB  1 
ATOM   253  C CG  . LYS A 1 31 ? 7.822   10.867 -1.560  1.00 29.00 ? 473 LYS A CG  1 
ATOM   254  C CD  . LYS A 1 31 ? 7.861   9.639  -0.685  1.00 28.74 ? 473 LYS A CD  1 
ATOM   255  C CE  . LYS A 1 31 ? 9.158   8.902  -0.921  1.00 32.61 ? 473 LYS A CE  1 
ATOM   256  N NZ  . LYS A 1 31 ? 8.987   7.462  -0.659  1.00 34.00 ? 473 LYS A NZ  1 
ATOM   257  N N   . VAL A 1 32 ? 3.519   11.897 -3.040  1.00 25.57 ? 474 VAL A N   1 
ATOM   258  C CA  . VAL A 1 32 ? 2.106   12.295 -3.031  1.00 24.56 ? 474 VAL A CA  1 
ATOM   259  C C   . VAL A 1 32 ? 1.224   11.088 -3.342  1.00 24.43 ? 474 VAL A C   1 
ATOM   260  O O   . VAL A 1 32 ? 0.194   10.885 -2.708  1.00 24.32 ? 474 VAL A O   1 
ATOM   261  C CB  . VAL A 1 32 ? 1.799   13.449 -4.038  1.00 24.47 ? 474 VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 32 ? 0.325   13.875 -3.952  1.00 23.12 ? 474 VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 32 ? 2.706   14.645 -3.800  1.00 23.21 ? 474 VAL A CG2 1 
ATOM   264  N N   . LYS A 1 33 ? 1.625   10.285 -4.321  1.00 25.11 ? 475 LYS A N   1 
ATOM   265  C CA  . LYS A 1 33 ? 0.909   9.045  -4.600  1.00 26.03 ? 475 LYS A CA  1 
ATOM   266  C C   . LYS A 1 33 ? 0.907   8.116  -3.388  1.00 26.69 ? 475 LYS A C   1 
ATOM   267  O O   . LYS A 1 33 ? -0.130  7.526  -3.056  1.00 26.78 ? 475 LYS A O   1 
ATOM   268  C CB  . LYS A 1 33 ? 1.486   8.345  -5.821  1.00 27.19 ? 475 LYS A CB  1 
ATOM   269  C CG  . LYS A 1 33 ? 1.017   8.929  -7.136  1.00 27.40 ? 475 LYS A CG  1 
ATOM   270  C CD  . LYS A 1 33 ? 1.622   8.179  -8.317  1.00 30.04 ? 475 LYS A CD  1 
ATOM   271  C CE  . LYS A 1 33 ? 1.338   8.922  -9.625  1.00 29.51 ? 475 LYS A CE  1 
ATOM   272  N NZ  . LYS A 1 33 ? 1.705   8.091  -10.801 1.00 32.55 ? 475 LYS A NZ  1 
ATOM   273  N N   . GLY A 1 34 ? 2.057   8.017  -2.715  1.00 27.23 ? 476 GLY A N   1 
ATOM   274  C CA  . GLY A 1 34 ? 2.203   7.172  -1.528  1.00 28.35 ? 476 GLY A CA  1 
ATOM   275  C C   . GLY A 1 34 ? 1.228   7.543  -0.423  1.00 28.72 ? 476 GLY A C   1 
ATOM   276  O O   . GLY A 1 34 ? 0.635   6.668  0.212   1.00 29.28 ? 476 GLY A O   1 
ATOM   277  N N   . LEU A 1 35 ? 1.076   8.849  -0.194  1.00 28.28 ? 477 LEU A N   1 
ATOM   278  C CA  . LEU A 1 35 ? 0.178   9.378  0.818   1.00 28.50 ? 477 LEU A CA  1 
ATOM   279  C C   . LEU A 1 35 ? -1.270  9.038  0.455   1.00 28.65 ? 477 LEU A C   1 
ATOM   280  O O   . LEU A 1 35 ? -2.016  8.551  1.290   1.00 29.40 ? 477 LEU A O   1 
ATOM   281  C CB  . LEU A 1 35 ? 0.372   10.892 0.942   1.00 28.33 ? 477 LEU A CB  1 
ATOM   282  C CG  . LEU A 1 35 ? -0.387  11.706 2.005   1.00 29.13 ? 477 LEU A CG  1 
ATOM   283  C CD1 . LEU A 1 35 ? 0.348   13.010 2.297   1.00 29.15 ? 477 LEU A CD1 1 
ATOM   284  C CD2 . LEU A 1 35 ? -1.808  11.991 1.571   1.00 29.32 ? 477 LEU A CD2 1 
ATOM   285  N N   . LEU A 1 36 ? -1.643  9.278  -0.800  1.00 28.58 ? 478 LEU A N   1 
ATOM   286  C CA  . LEU A 1 36 ? -2.994  8.999  -1.300  1.00 29.13 ? 478 LEU A CA  1 
ATOM   287  C C   . LEU A 1 36 ? -3.312  7.512  -1.343  1.00 30.53 ? 478 LEU A C   1 
ATOM   288  O O   . LEU A 1 36 ? -4.468  7.110  -1.227  1.00 31.44 ? 478 LEU A O   1 
ATOM   289  C CB  . LEU A 1 36 ? -3.185  9.613  -2.687  1.00 28.26 ? 478 LEU A CB  1 
ATOM   290  C CG  . LEU A 1 36 ? -3.326  11.139 -2.675  1.00 26.96 ? 478 LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 36 ? -3.157  11.710 -4.067  1.00 23.68 ? 478 LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 36 ? -4.679  11.542 -2.078  1.00 25.03 ? 478 LEU A CD2 1 
ATOM   293  N N   . SER A 1 37 ? -2.273  6.705  -1.524  1.00 31.20 ? 479 SER A N   1 
ATOM   294  C CA  . SER A 1 37 ? -2.406  5.266  -1.549  1.00 32.32 ? 479 SER A CA  1 
ATOM   295  C C   . SER A 1 37 ? -2.873  4.750  -0.190  1.00 33.33 ? 479 SER A C   1 
ATOM   296  O O   . SER A 1 37 ? -3.829  3.965  -0.117  1.00 34.06 ? 479 SER A O   1 
ATOM   297  C CB  . SER A 1 37 ? -1.077  4.626  -1.939  1.00 32.61 ? 479 SER A CB  1 
ATOM   298  O OG  . SER A 1 37 ? -1.198  3.225  -1.959  1.00 34.21 ? 479 SER A OG  1 
ATOM   299  N N   . ARG A 1 38 ? -2.198  5.198  0.874   1.00 33.12 ? 480 ARG A N   1 
ATOM   300  C CA  A ARG A 1 38 ? -2.538  4.793  2.234   0.50 33.99 ? 480 ARG A CA  1 
ATOM   301  C CA  B ARG A 1 38 ? -2.537  4.799  2.240   0.50 34.04 ? 480 ARG A CA  1 
ATOM   302  C C   . ARG A 1 38 ? -3.932  5.289  2.620   1.00 33.99 ? 480 ARG A C   1 
ATOM   303  O O   . ARG A 1 38 ? -4.679  4.592  3.314   1.00 34.92 ? 480 ARG A O   1 
ATOM   304  C CB  A ARG A 1 38 ? -1.471  5.272  3.231   0.50 33.95 ? 480 ARG A CB  1 
ATOM   305  C CB  B ARG A 1 38 ? -1.502  5.321  3.246   0.50 33.99 ? 480 ARG A CB  1 
ATOM   306  C CG  A ARG A 1 38 ? -0.111  4.589  3.044   0.50 34.13 ? 480 ARG A CG  1 
ATOM   307  C CG  B ARG A 1 38 ? -0.125  4.660  3.166   0.50 34.53 ? 480 ARG A CG  1 
ATOM   308  C CD  A ARG A 1 38 ? 0.897   4.952  4.130   0.50 31.20 ? 480 ARG A CD  1 
ATOM   309  C CD  B ARG A 1 38 ? -0.197  3.150  3.367   0.50 34.79 ? 480 ARG A CD  1 
ATOM   310  N NE  A ARG A 1 38 ? 1.541   6.244  3.898   0.50 31.60 ? 480 ARG A NE  1 
ATOM   311  N NE  B ARG A 1 38 ? 1.080   2.599  3.814   0.50 33.37 ? 480 ARG A NE  1 
ATOM   312  C CZ  A ARG A 1 38 ? 2.490   6.454  2.987   0.50 31.17 ? 480 ARG A CZ  1 
ATOM   313  C CZ  B ARG A 1 38 ? 1.344   2.238  5.066   0.50 31.48 ? 480 ARG A CZ  1 
ATOM   314  N NH1 A ARG A 1 38 ? 2.892   5.459  2.207   0.50 30.61 ? 480 ARG A NH1 1 
ATOM   315  N NH1 B ARG A 1 38 ? 0.417   2.358  6.007   0.50 32.11 ? 480 ARG A NH1 1 
ATOM   316  N NH2 A ARG A 1 38 ? 3.030   7.662  2.848   0.50 28.11 ? 480 ARG A NH2 1 
ATOM   317  N NH2 B ARG A 1 38 ? 2.534   1.754  5.380   0.50 28.79 ? 480 ARG A NH2 1 
ATOM   318  N N   . LEU A 1 39 ? -4.280  6.488  2.154   1.00 33.11 ? 481 LEU A N   1 
ATOM   319  C CA  . LEU A 1 39 ? -5.589  7.082  2.439   1.00 32.93 ? 481 LEU A CA  1 
ATOM   320  C C   . LEU A 1 39 ? -6.743  6.335  1.760   1.00 33.02 ? 481 LEU A C   1 
ATOM   321  O O   . LEU A 1 39 ? -7.759  6.058  2.387   1.00 33.59 ? 481 LEU A O   1 
ATOM   322  C CB  . LEU A 1 39 ? -5.608  8.565  2.035   1.00 32.17 ? 481 LEU A CB  1 
ATOM   323  C CG  . LEU A 1 39 ? -6.884  9.350  2.376   1.00 31.94 ? 481 LEU A CG  1 
ATOM   324  C CD1 . LEU A 1 39 ? -6.962  9.600  3.878   1.00 30.70 ? 481 LEU A CD1 1 
ATOM   325  C CD2 . LEU A 1 39 ? -6.953  10.662 1.604   1.00 32.54 ? 481 LEU A CD2 1 
ATOM   326  N N   . LEU A 1 40 ? -6.568  6.016  0.481   1.00 32.44 ? 482 LEU A N   1 
ATOM   327  C CA  . LEU A 1 40 ? -7.629  5.434  -0.339  1.00 33.15 ? 482 LEU A CA  1 
ATOM   328  C C   . LEU A 1 40 ? -7.551  3.923  -0.449  1.00 34.49 ? 482 LEU A C   1 
ATOM   329  O O   . LEU A 1 40 ? -8.480  3.291  -0.947  1.00 35.48 ? 482 LEU A O   1 
ATOM   330  C CB  . LEU A 1 40 ? -7.603  6.038  -1.742  1.00 32.55 ? 482 LEU A CB  1 
ATOM   331  C CG  . LEU A 1 40 ? -8.064  7.488  -1.845  1.00 30.61 ? 482 LEU A CG  1 
ATOM   332  C CD1 . LEU A 1 40 ? -7.425  8.160  -3.058  1.00 29.20 ? 482 LEU A CD1 1 
ATOM   333  C CD2 . LEU A 1 40 ? -9.573  7.510  -1.913  1.00 31.89 ? 482 LEU A CD2 1 
ATOM   334  N N   . LYS A 1 41 ? -6.438  3.364  0.022   1.00 35.03 ? 483 LYS A N   1 
ATOM   335  C CA  . LYS A 1 41 ? -6.144  1.927  -0.047  1.00 36.35 ? 483 LYS A CA  1 
ATOM   336  C C   . LYS A 1 41 ? -6.183  1.382  -1.479  1.00 36.63 ? 483 LYS A C   1 
ATOM   337  O O   . LYS A 1 41 ? -6.792  0.353  -1.772  1.00 38.16 ? 483 LYS A O   1 
ATOM   338  C CB  . LYS A 1 41 ? -6.994  1.143  0.948   1.00 37.82 ? 483 LYS A CB  1 
ATOM   339  C CG  . LYS A 1 41 ? -6.581  1.403  2.402   1.00 38.80 ? 483 LYS A CG  1 
ATOM   340  C CD  . LYS A 1 41 ? -7.655  0.917  3.344   1.00 46.71 ? 483 LYS A CD  1 
ATOM   341  C CE  . LYS A 1 41 ? -7.198  0.918  4.793   1.00 48.86 ? 483 LYS A CE  1 
ATOM   342  N NZ  . LYS A 1 41 ? -8.054  -0.023 5.592   1.00 49.03 ? 483 LYS A NZ  1 
ATOM   343  N N   . VAL A 1 42 ? -5.499  2.120  -2.349  1.00 35.59 ? 484 VAL A N   1 
ATOM   344  C CA  . VAL A 1 42 ? -5.375  1.855  -3.782  1.00 35.80 ? 484 VAL A CA  1 
ATOM   345  C C   . VAL A 1 42 ? -3.879  1.952  -4.118  1.00 35.21 ? 484 VAL A C   1 
ATOM   346  O O   . VAL A 1 42 ? -3.205  2.853  -3.624  1.00 34.07 ? 484 VAL A O   1 
ATOM   347  C CB  . VAL A 1 42 ? -6.175  2.923  -4.595  1.00 34.87 ? 484 VAL A CB  1 
ATOM   348  C CG1 . VAL A 1 42 ? -5.839  2.882  -6.084  1.00 34.60 ? 484 VAL A CG1 1 
ATOM   349  C CG2 . VAL A 1 42 ? -7.679  2.752  -4.378  1.00 35.22 ? 484 VAL A CG2 1 
ATOM   350  N N   . PRO A 1 43 ? -3.350  1.021  -4.944  1.00 36.05 ? 485 PRO A N   1 
ATOM   351  C CA  . PRO A 1 43 ? -1.902  0.996  -5.198  1.00 36.19 ? 485 PRO A CA  1 
ATOM   352  C C   . PRO A 1 43 ? -1.321  2.287  -5.799  1.00 35.08 ? 485 PRO A C   1 
ATOM   353  O O   . PRO A 1 43 ? -1.989  2.954  -6.592  1.00 34.32 ? 485 PRO A O   1 
ATOM   354  C CB  . PRO A 1 43 ? -1.731  -0.161 -6.185  1.00 37.86 ? 485 PRO A CB  1 
ATOM   355  C CG  . PRO A 1 43 ? -2.959  -0.978 -6.064  1.00 38.79 ? 485 PRO A CG  1 
ATOM   356  C CD  . PRO A 1 43 ? -4.055  -0.040 -5.683  1.00 37.64 ? 485 PRO A CD  1 
ATOM   357  N N   . VAL A 1 44 ? -0.085  2.618  -5.416  1.00 35.06 ? 486 VAL A N   1 
ATOM   358  C CA  . VAL A 1 44 ? 0.664   3.749  -5.987  1.00 34.91 ? 486 VAL A CA  1 
ATOM   359  C C   . VAL A 1 44 ? 0.763   3.675  -7.515  1.00 35.65 ? 486 VAL A C   1 
ATOM   360  O O   . VAL A 1 44 ? 0.643   4.700  -8.204  1.00 35.13 ? 486 VAL A O   1 
ATOM   361  C CB  . VAL A 1 44 ? 2.098   3.866  -5.374  1.00 35.50 ? 486 VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 44 ? 3.051   4.653  -6.293  1.00 34.27 ? 486 VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 44 ? 2.042   4.492  -3.980  1.00 34.02 ? 486 VAL A CG2 1 
ATOM   364  N N   . SER A 1 45 ? 0.963   2.462  -8.029  1.00 36.99 ? 487 SER A N   1 
ATOM   365  C CA  . SER A 1 45 ? 1.104   2.226  -9.468  1.00 37.82 ? 487 SER A CA  1 
ATOM   366  C C   . SER A 1 45 ? -0.203  2.404  -10.247 1.00 37.43 ? 487 SER A C   1 
ATOM   367  O O   . SER A 1 45 ? -0.180  2.555  -11.463 1.00 38.20 ? 487 SER A O   1 
ATOM   368  C CB  . SER A 1 45 ? 1.700   0.840  -9.730  1.00 39.88 ? 487 SER A CB  1 
ATOM   369  O OG  . SER A 1 45 ? 0.914   -0.182 -9.142  1.00 41.29 ? 487 SER A OG  1 
ATOM   370  N N   . ASP A 1 46 ? -1.338  2.386  -9.557  1.00 36.52 ? 488 ASP A N   1 
ATOM   371  C CA  . ASP A 1 46 ? -2.625  2.572  -10.227 1.00 36.38 ? 488 ASP A CA  1 
ATOM   372  C C   . ASP A 1 46 ? -3.048  4.037  -10.245 1.00 34.53 ? 488 ASP A C   1 
ATOM   373  O O   . ASP A 1 46 ? -3.966  4.405  -10.969 1.00 34.68 ? 488 ASP A O   1 
ATOM   374  C CB  . ASP A 1 46 ? -3.722  1.728  -9.569  1.00 36.89 ? 488 ASP A CB  1 
ATOM   375  C CG  . ASP A 1 46 ? -3.595  0.234  -9.872  1.00 40.08 ? 488 ASP A CG  1 
ATOM   376  O OD1 . ASP A 1 46 ? -2.781  -0.171 -10.729 1.00 40.10 ? 488 ASP A OD1 1 
ATOM   377  O OD2 . ASP A 1 46 ? -4.331  -0.549 -9.237  1.00 44.61 ? 488 ASP A OD2 1 
ATOM   378  N N   . LEU A 1 47 ? -2.375  4.864  -9.446  1.00 33.04 ? 489 LEU A N   1 
ATOM   379  C CA  . LEU A 1 47 ? -2.790  6.246  -9.247  1.00 31.70 ? 489 LEU A CA  1 
ATOM   380  C C   . LEU A 1 47 ? -2.316  7.155  -10.371 1.00 31.50 ? 489 LEU A C   1 
ATOM   381  O O   . LEU A 1 47 ? -1.132  7.167  -10.725 1.00 31.73 ? 489 LEU A O   1 
ATOM   382  C CB  . LEU A 1 47 ? -2.321  6.782  -7.888  1.00 30.61 ? 489 LEU A CB  1 
ATOM   383  C CG  . LEU A 1 47 ? -3.082  6.388  -6.612  1.00 31.11 ? 489 LEU A CG  1 
ATOM   384  C CD1 . LEU A 1 47 ? -2.325  6.858  -5.382  1.00 28.98 ? 489 LEU A CD1 1 
ATOM   385  C CD2 . LEU A 1 47 ? -4.505  6.925  -6.571  1.00 28.37 ? 489 LEU A CD2 1 
ATOM   386  N N   . LEU A 1 48 ? -3.259  7.914  -10.920 1.00 31.10 ? 490 LEU A N   1 
ATOM   387  C CA  . LEU A 1 48 ? -2.986  8.879  -11.981 1.00 30.94 ? 490 LEU A CA  1 
ATOM   388  C C   . LEU A 1 48 ? -3.321  10.274 -11.500 1.00 29.49 ? 490 LEU A C   1 
ATOM   389  O O   . LEU A 1 48 ? -4.462  10.541 -11.097 1.00 28.79 ? 490 LEU A O   1 
ATOM   390  C CB  . LEU A 1 48 ? -3.809  8.553  -13.229 1.00 32.16 ? 490 LEU A CB  1 
ATOM   391  C CG  . LEU A 1 48 ? -3.346  7.327  -14.019 1.00 35.90 ? 490 LEU A CG  1 
ATOM   392  C CD1 . LEU A 1 48 ? -4.441  6.847  -14.967 1.00 38.26 ? 490 LEU A CD1 1 
ATOM   393  C CD2 . LEU A 1 48 ? -2.056  7.634  -14.777 1.00 37.49 ? 490 LEU A CD2 1 
ATOM   394  N N   . LEU A 1 49 ? -2.325  11.156 -11.554 1.00 28.87 ? 491 LEU A N   1 
ATOM   395  C CA  . LEU A 1 49 ? -2.448  12.521 -11.037 1.00 28.48 ? 491 LEU A CA  1 
ATOM   396  C C   . LEU A 1 49 ? -2.296  13.614 -12.093 1.00 28.67 ? 491 LEU A C   1 
ATOM   397  O O   . LEU A 1 49 ? -1.536  13.498 -13.056 1.00 29.67 ? 491 LEU A O   1 
ATOM   398  C CB  . LEU A 1 49 ? -1.451  12.778 -9.900  1.00 27.67 ? 491 LEU A CB  1 
ATOM   399  C CG  . LEU A 1 49 ? -1.557  11.936 -8.624  1.00 29.88 ? 491 LEU A CG  1 
ATOM   400  C CD1 . LEU A 1 49 ? -0.744  12.575 -7.490  1.00 29.69 ? 491 LEU A CD1 1 
ATOM   401  C CD2 . LEU A 1 49 ? -3.015  11.750 -8.198  1.00 29.94 ? 491 LEU A CD2 1 
ATOM   402  N N   . SER A 1 50 ? -3.037  14.684 -11.874 1.00 28.29 ? 492 SER A N   1 
ATOM   403  C CA  . SER A 1 50 ? -3.002  15.862 -12.702 1.00 28.74 ? 492 SER A CA  1 
ATOM   404  C C   . SER A 1 50 ? -3.480  16.975 -11.797 1.00 28.12 ? 492 SER A C   1 
ATOM   405  O O   . SER A 1 50 ? -3.866  16.712 -10.661 1.00 27.48 ? 492 SER A O   1 
ATOM   406  C CB  . SER A 1 50 ? -3.939  15.690 -13.903 1.00 29.65 ? 492 SER A CB  1 
ATOM   407  O OG  . SER A 1 50 ? -5.239  15.367 -13.463 1.00 29.94 ? 492 SER A OG  1 
ATOM   408  N N   . TYR A 1 51 ? -3.463  18.211 -12.276 1.00 29.21 ? 493 TYR A N   1 
ATOM   409  C CA  . TYR A 1 51 ? -3.959  19.318 -11.461 1.00 29.60 ? 493 TYR A CA  1 
ATOM   410  C C   . TYR A 1 51 ? -4.598  20.432 -12.289 1.00 31.80 ? 493 TYR A C   1 
ATOM   411  O O   . TYR A 1 51 ? -4.320  20.565 -13.474 1.00 32.87 ? 493 TYR A O   1 
ATOM   412  C CB  . TYR A 1 51 ? -2.859  19.842 -10.514 1.00 28.53 ? 493 TYR A CB  1 
ATOM   413  C CG  . TYR A 1 51 ? -1.839  20.782 -11.132 1.00 27.69 ? 493 TYR A CG  1 
ATOM   414  C CD1 . TYR A 1 51 ? -1.908  22.163 -10.902 1.00 28.59 ? 493 TYR A CD1 1 
ATOM   415  C CD2 . TYR A 1 51 ? -0.806  20.302 -11.934 1.00 23.42 ? 493 TYR A CD2 1 
ATOM   416  C CE1 . TYR A 1 51 ? -0.983  23.043 -11.468 1.00 25.95 ? 493 TYR A CE1 1 
ATOM   417  C CE2 . TYR A 1 51 ? 0.140   21.174 -12.506 1.00 24.85 ? 493 TYR A CE2 1 
ATOM   418  C CZ  . TYR A 1 51 ? 0.042   22.547 -12.268 1.00 25.99 ? 493 TYR A CZ  1 
ATOM   419  O OH  . TYR A 1 51 ? 0.958   23.420 -12.818 1.00 21.05 ? 493 TYR A OH  1 
ATOM   420  N N   . GLU A 1 52 ? -5.482  21.210 -11.671 1.00 33.48 ? 494 GLU A N   1 
ATOM   421  C CA  . GLU A 1 52 ? -5.976  22.429 -12.310 1.00 36.17 ? 494 GLU A CA  1 
ATOM   422  C C   . GLU A 1 52 ? -5.789  23.672 -11.447 1.00 37.06 ? 494 GLU A C   1 
ATOM   423  O O   . GLU A 1 52 ? -5.888  23.619 -10.216 1.00 36.54 ? 494 GLU A O   1 
ATOM   424  C CB  . GLU A 1 52 ? -7.420  22.294 -12.813 1.00 37.18 ? 494 GLU A CB  1 
ATOM   425  C CG  . GLU A 1 52 ? -8.464  21.873 -11.790 1.00 39.09 ? 494 GLU A CG  1 
ATOM   426  C CD  . GLU A 1 52 ? -9.853  21.747 -12.414 1.00 46.32 ? 494 GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 52 ? -10.395 22.776 -12.886 1.00 48.49 ? 494 GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 52 ? -10.399 20.620 -12.446 1.00 47.32 ? 494 GLU A OE2 1 
ATOM   429  N N   . SER A 1 53 ? -5.495  24.781 -12.118 1.00 38.78 ? 495 SER A N   1 
ATOM   430  C CA  . SER A 1 53 ? -5.265  26.054 -11.470 1.00 40.42 ? 495 SER A CA  1 
ATOM   431  C C   . SER A 1 53 ? -6.475  26.944 -11.751 1.00 42.64 ? 495 SER A C   1 
ATOM   432  O O   . SER A 1 53 ? -7.008  26.917 -12.858 1.00 43.55 ? 495 SER A O   1 
ATOM   433  C CB  . SER A 1 53 ? -3.993  26.688 -12.026 1.00 41.01 ? 495 SER A CB  1 
ATOM   434  O OG  . SER A 1 53 ? -3.454  27.652 -11.128 1.00 42.93 ? 495 SER A OG  1 
ATOM   435  N N   . PRO A 1 54 ? -6.917  27.732 -10.750 1.00 43.97 ? 496 PRO A N   1 
ATOM   436  C CA  . PRO A 1 54 ? -8.128  28.552 -10.898 1.00 46.12 ? 496 PRO A CA  1 
ATOM   437  C C   . PRO A 1 54 ? -8.047  29.539 -12.067 1.00 48.31 ? 496 PRO A C   1 
ATOM   438  O O   . PRO A 1 54 ? -9.082  29.926 -12.619 1.00 50.05 ? 496 PRO A O   1 
ATOM   439  C CB  . PRO A 1 54 ? -8.221  29.300 -9.557  1.00 46.54 ? 496 PRO A CB  1 
ATOM   440  C CG  . PRO A 1 54 ? -6.859  29.240 -8.975  1.00 45.60 ? 496 PRO A CG  1 
ATOM   441  C CD  . PRO A 1 54 ? -6.285  27.930 -9.432  1.00 43.47 ? 496 PRO A CD  1 
ATOM   442  N N   . LYS A 1 55 ? -6.821  29.925 -12.425 1.00 48.75 ? 497 LYS A N   1 
ATOM   443  C CA  . LYS A 1 55 ? -6.524  30.763 -13.593 1.00 50.74 ? 497 LYS A CA  1 
ATOM   444  C C   . LYS A 1 55 ? -7.123  30.170 -14.873 1.00 51.37 ? 497 LYS A C   1 
ATOM   445  O O   . LYS A 1 55 ? -7.851  30.845 -15.610 1.00 53.46 ? 497 LYS A O   1 
ATOM   446  C CB  . LYS A 1 55 ? -5.002  30.894 -13.772 1.00 50.59 ? 497 LYS A CB  1 
ATOM   447  C CG  . LYS A 1 55 ? -4.184  30.871 -12.470 1.00 49.76 ? 497 LYS A CG  1 
ATOM   448  C CD  . LYS A 1 55 ? -2.706  31.059 -12.760 1.00 51.52 ? 497 LYS A CD  1 
ATOM   449  C CE  . LYS A 1 55 ? -1.902  31.181 -11.484 0.50 51.69 ? 497 LYS A CE  1 
ATOM   450  N NZ  . LYS A 1 55 ? -0.441  31.346 -11.761 0.50 51.87 ? 497 LYS A NZ  1 
ATOM   451  N N   . LYS A 1 56 ? -6.811  28.899 -15.121 1.00 49.66 ? 498 LYS A N   1 
ATOM   452  C CA  . LYS A 1 56 ? -7.237  28.192 -16.325 1.00 49.59 ? 498 LYS A CA  1 
ATOM   453  C C   . LYS A 1 56 ? -8.220  27.078 -15.963 1.00 48.43 ? 498 LYS A C   1 
ATOM   454  O O   . LYS A 1 56 ? -7.846  25.900 -15.961 1.00 47.33 ? 498 LYS A O   1 
ATOM   455  C CB  . LYS A 1 56 ? -6.013  27.608 -17.048 1.00 49.02 ? 498 LYS A CB  1 
ATOM   456  C CG  . LYS A 1 56 ? -4.907  28.621 -17.313 1.00 49.48 ? 498 LYS A CG  1 
ATOM   457  C CD  . LYS A 1 56 ? -3.832  28.070 -18.221 1.00 47.63 ? 498 LYS A CD  1 
ATOM   458  C CE  . LYS A 1 56 ? -2.880  29.169 -18.667 1.00 49.83 ? 498 LYS A CE  1 
ATOM   459  N NZ  . LYS A 1 56 ? -3.537  30.246 -19.474 1.00 50.34 ? 498 LYS A NZ  1 
ATOM   460  N N   . PRO A 1 57 ? -9.483  27.437 -15.655 1.00 48.96 ? 499 PRO A N   1 
ATOM   461  C CA  . PRO A 1 57 ? -10.400 26.419 -15.139 1.00 48.01 ? 499 PRO A CA  1 
ATOM   462  C C   . PRO A 1 57 ? -10.785 25.381 -16.192 1.00 48.02 ? 499 PRO A C   1 
ATOM   463  O O   . PRO A 1 57 ? -11.069 25.736 -17.339 1.00 49.77 ? 499 PRO A O   1 
ATOM   464  C CB  . PRO A 1 57 ? -11.622 27.238 -14.705 1.00 49.71 ? 499 PRO A CB  1 
ATOM   465  C CG  . PRO A 1 57 ? -11.580 28.457 -15.566 1.00 51.26 ? 499 PRO A CG  1 
ATOM   466  C CD  . PRO A 1 57 ? -10.135 28.755 -15.782 1.00 50.90 ? 499 PRO A CD  1 
ATOM   467  N N   . GLY A 1 58 ? -10.784 24.110 -15.797 1.00 46.11 ? 500 GLY A N   1 
ATOM   468  C CA  . GLY A 1 58 ? -11.147 23.014 -16.702 1.00 45.99 ? 500 GLY A CA  1 
ATOM   469  C C   . GLY A 1 58 ? -9.972  22.392 -17.443 1.00 45.06 ? 500 GLY A C   1 
ATOM   470  O O   . GLY A 1 58 ? -10.114 21.326 -18.057 1.00 44.80 ? 500 GLY A O   1 
ATOM   471  N N   . ARG A 1 59 ? -8.815  23.058 -17.391 1.00 43.99 ? 501 ARG A N   1 
ATOM   472  C CA  . ARG A 1 59 ? -7.603  22.554 -18.034 1.00 43.27 ? 501 ARG A CA  1 
ATOM   473  C C   . ARG A 1 59 ? -6.746  21.742 -17.060 1.00 41.33 ? 501 ARG A C   1 
ATOM   474  O O   . ARG A 1 59 ? -6.159  22.284 -16.120 1.00 40.50 ? 501 ARG A O   1 
ATOM   475  C CB  . ARG A 1 59 ? -6.774  23.694 -18.641 1.00 44.07 ? 501 ARG A CB  1 
ATOM   476  C CG  . ARG A 1 59 ? -7.517  24.653 -19.563 1.00 46.05 ? 501 ARG A CG  1 
ATOM   477  C CD  . ARG A 1 59 ? -7.971  24.020 -20.878 1.00 45.91 ? 501 ARG A CD  1 
ATOM   478  N NE  . ARG A 1 59 ? -9.358  23.570 -20.820 1.00 47.21 ? 501 ARG A NE  1 
ATOM   479  C CZ  . ARG A 1 59 ? -9.771  22.342 -21.118 1.00 48.13 ? 501 ARG A CZ  1 
ATOM   480  N NH1 . ARG A 1 59 ? -8.909  21.420 -21.525 1.00 45.88 ? 501 ARG A NH1 1 
ATOM   481  N NH2 . ARG A 1 59 ? -11.059 22.040 -21.031 1.00 51.79 ? 501 ARG A NH2 1 
ATOM   482  N N   . GLU A 1 60 ? -6.678  20.438 -17.292 1.00 40.69 ? 502 GLU A N   1 
ATOM   483  C CA  . GLU A 1 60 ? -5.859  19.571 -16.469 1.00 39.48 ? 502 GLU A CA  1 
ATOM   484  C C   . GLU A 1 60 ? -4.418  19.565 -16.966 1.00 39.33 ? 502 GLU A C   1 
ATOM   485  O O   . GLU A 1 60 ? -4.169  19.328 -18.145 1.00 40.63 ? 502 GLU A O   1 
ATOM   486  C CB  . GLU A 1 60 ? -6.406  18.148 -16.482 1.00 39.29 ? 502 GLU A CB  1 
ATOM   487  C CG  . GLU A 1 60 ? -7.741  17.985 -15.791 1.00 40.57 ? 502 GLU A CG  1 
ATOM   488  C CD  . GLU A 1 60 ? -8.158  16.524 -15.680 1.00 43.17 ? 502 GLU A CD  1 
ATOM   489  O OE1 . GLU A 1 60 ? -7.284  15.667 -15.389 1.00 39.87 ? 502 GLU A OE1 1 
ATOM   490  O OE2 . GLU A 1 60 ? -9.359  16.239 -15.886 1.00 41.35 ? 502 GLU A OE2 1 
ATOM   491  N N   . ILE A 1 61 ? -3.476  19.831 -16.068 1.00 37.87 ? 503 ILE A N   1 
ATOM   492  C CA  . ILE A 1 61 ? -2.062  19.647 -16.372 1.00 37.84 ? 503 ILE A CA  1 
ATOM   493  C C   . ILE A 1 61 ? -1.566  18.358 -15.723 1.00 36.67 ? 503 ILE A C   1 
ATOM   494  O O   . ILE A 1 61 ? -1.802  18.138 -14.531 1.00 35.10 ? 503 ILE A O   1 
ATOM   495  C CB  . ILE A 1 61 ? -1.196  20.824 -15.881 1.00 37.77 ? 503 ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 61 ? -1.538  22.121 -16.623 1.00 39.36 ? 503 ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 61 ? 0.268   20.492 -16.060 1.00 37.83 ? 503 ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 61 ? -2.346  23.115 -15.817 1.00 39.59 ? 503 ILE A CD1 1 
ATOM   499  N N   . GLU A 1 62 ? -0.862  17.531 -16.495 1.00 37.42 ? 504 GLU A N   1 
ATOM   500  C CA  . GLU A 1 62 ? -0.438  16.201 -16.027 1.00 37.32 ? 504 GLU A CA  1 
ATOM   501  C C   . GLU A 1 62 ? 0.783   16.231 -15.129 1.00 36.60 ? 504 GLU A C   1 
ATOM   502  O O   . GLU A 1 62 ? 1.610   17.135 -15.204 1.00 37.34 ? 504 GLU A O   1 
ATOM   503  C CB  . GLU A 1 62 ? -0.207  15.233 -17.200 1.00 38.57 ? 504 GLU A CB  1 
ATOM   504  C CG  . GLU A 1 62 ? -1.476  14.527 -17.687 1.00 39.28 ? 504 GLU A CG  1 
ATOM   505  C CD  . GLU A 1 62 ? -1.400  14.111 -19.144 0.50 45.28 ? 504 GLU A CD  1 
ATOM   506  O OE1 . GLU A 1 62 ? -0.401  13.468 -19.532 0.50 46.97 ? 504 GLU A OE1 1 
ATOM   507  O OE2 . GLU A 1 62 ? -2.347  14.419 -19.904 0.50 47.57 ? 504 GLU A OE2 1 
ATOM   508  N N   . LEU A 1 63 ? 0.863   15.227 -14.268 1.00 36.03 ? 505 LEU A N   1 
ATOM   509  C CA  . LEU A 1 63 ? 1.991   15.006 -13.386 1.00 35.75 ? 505 LEU A CA  1 
ATOM   510  C C   . LEU A 1 63 ? 2.456   13.574 -13.637 1.00 36.79 ? 505 LEU A C   1 
ATOM   511  O O   . LEU A 1 63 ? 2.186   12.669 -12.837 1.00 36.54 ? 505 LEU A O   1 
ATOM   512  C CB  . LEU A 1 63 ? 1.555   15.199 -11.923 1.00 34.06 ? 505 LEU A CB  1 
ATOM   513  C CG  . LEU A 1 63 ? 0.838   16.512 -11.578 1.00 34.21 ? 505 LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 63 ? 0.150   16.468 -10.225 1.00 32.39 ? 505 LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 63 ? 1.793   17.695 -11.642 1.00 32.26 ? 505 LEU A CD2 1 
ATOM   516  N N   . GLU A 1 64 ? 3.136   13.364 -14.762 1.00 38.58 ? 506 GLU A N   1 
ATOM   517  C CA  . GLU A 1 64 ? 3.483   12.003 -15.199 1.00 39.85 ? 506 GLU A CA  1 
ATOM   518  C C   . GLU A 1 64 ? 4.720   11.414 -14.519 1.00 39.79 ? 506 GLU A C   1 
ATOM   519  O O   . GLU A 1 64 ? 4.673   10.282 -14.036 1.00 40.36 ? 506 GLU A O   1 
ATOM   520  C CB  . GLU A 1 64 ? 3.629   11.910 -16.728 1.00 41.60 ? 506 GLU A CB  1 
ATOM   521  C CG  . GLU A 1 64 ? 3.466   10.466 -17.249 1.00 44.36 ? 506 GLU A CG  1 
ATOM   522  C CD  . GLU A 1 64 ? 3.927   10.279 -18.686 0.50 48.39 ? 506 GLU A CD  1 
ATOM   523  O OE1 . GLU A 1 64 ? 3.408   10.972 -19.590 0.50 49.72 ? 506 GLU A OE1 1 
ATOM   524  O OE2 . GLU A 1 64 ? 4.804   9.421  -18.914 0.50 50.30 ? 506 GLU A OE2 1 
ATOM   525  N N   . ASN A 1 65 ? 5.819   12.167 -14.505 1.00 39.38 ? 507 ASN A N   1 
ATOM   526  C CA  . ASN A 1 65 ? 7.066   11.712 -13.883 1.00 38.97 ? 507 ASN A CA  1 
ATOM   527  C C   . ASN A 1 65 ? 6.993   11.718 -12.345 1.00 37.24 ? 507 ASN A C   1 
ATOM   528  O O   . ASN A 1 65 ? 7.040   12.779 -11.714 1.00 36.16 ? 507 ASN A O   1 
ATOM   529  C CB  . ASN A 1 65 ? 8.251   12.558 -14.387 1.00 39.71 ? 507 ASN A CB  1 
ATOM   530  C CG  . ASN A 1 65 ? 9.613   11.918 -14.104 1.00 40.05 ? 507 ASN A CG  1 
ATOM   531  O OD1 . ASN A 1 65 ? 9.832   11.296 -13.067 1.00 36.68 ? 507 ASN A OD1 1 
ATOM   532  N ND2 . ASN A 1 65 ? 10.539  12.098 -15.029 1.00 41.15 ? 507 ASN A ND2 1 
ATOM   533  N N   . ASP A 1 66 ? 6.897   10.523 -11.755 1.00 36.72 ? 508 ASP A N   1 
ATOM   534  C CA  . ASP A 1 66 ? 6.835   10.347 -10.293 1.00 35.48 ? 508 ASP A CA  1 
ATOM   535  C C   . ASP A 1 66 ? 8.001   10.964 -9.515  1.00 34.54 ? 508 ASP A C   1 
ATOM   536  O O   . ASP A 1 66 ? 7.861   11.303 -8.341  1.00 33.78 ? 508 ASP A O   1 
ATOM   537  C CB  . ASP A 1 66 ? 6.780   8.859  -9.931  1.00 36.07 ? 508 ASP A CB  1 
ATOM   538  C CG  . ASP A 1 66 ? 5.540   8.177  -10.447 1.00 39.41 ? 508 ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 66 ? 4.433   8.747  -10.322 1.00 40.64 ? 508 ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 66 ? 5.677   7.056  -10.983 1.00 48.10 ? 508 ASP A OD2 1 
ATOM   541  N N   . LEU A 1 67 ? 9.153   11.080 -10.159 1.00 34.66 ? 509 LEU A N   1 
ATOM   542  C CA  . LEU A 1 67 ? 10.374  11.450 -9.453  1.00 34.33 ? 509 LEU A CA  1 
ATOM   543  C C   . LEU A 1 67 ? 10.620  12.955 -9.425  1.00 32.90 ? 509 LEU A C   1 
ATOM   544  O O   . LEU A 1 67 ? 11.575  13.428 -8.807  1.00 32.76 ? 509 LEU A O   1 
ATOM   545  C CB  . LEU A 1 67 ? 11.571  10.647 -9.997  1.00 36.07 ? 509 LEU A CB  1 
ATOM   546  C CG  . LEU A 1 67 ? 11.389  9.123  -9.809  1.00 37.49 ? 509 LEU A CG  1 
ATOM   547  C CD1 . LEU A 1 67 ? 12.443  8.296  -10.537 1.00 39.49 ? 509 LEU A CD1 1 
ATOM   548  C CD2 . LEU A 1 67 ? 11.327  8.719  -8.330  1.00 37.21 ? 509 LEU A CD2 1 
ATOM   549  N N   . LYS A 1 68 ? 9.724   13.701 -10.070 1.00 31.43 ? 510 LYS A N   1 
ATOM   550  C CA  . LYS A 1 68 ? 9.761   15.159 -10.052 1.00 30.50 ? 510 LYS A CA  1 
ATOM   551  C C   . LYS A 1 68 ? 8.870   15.695 -8.930  1.00 28.59 ? 510 LYS A C   1 
ATOM   552  O O   . LYS A 1 68 ? 8.001   14.984 -8.423  1.00 27.46 ? 510 LYS A O   1 
ATOM   553  C CB  . LYS A 1 68 ? 9.345   15.731 -11.411 1.00 31.04 ? 510 LYS A CB  1 
ATOM   554  C CG  . LYS A 1 68 ? 10.286  15.404 -12.565 1.00 32.50 ? 510 LYS A CG  1 
ATOM   555  C CD  . LYS A 1 68 ? 11.652  16.071 -12.403 1.00 38.01 ? 510 LYS A CD  1 
ATOM   556  C CE  . LYS A 1 68 ? 12.605  15.673 -13.544 1.00 41.35 ? 510 LYS A CE  1 
ATOM   557  N NZ  . LYS A 1 68 ? 14.028  15.980 -13.231 1.00 41.52 ? 510 LYS A NZ  1 
ATOM   558  N N   . SER A 1 69 ? 9.093   16.943 -8.540  1.00 28.15 ? 511 SER A N   1 
ATOM   559  C CA  . SER A 1 69 ? 8.344   17.537 -7.431  1.00 27.29 ? 511 SER A CA  1 
ATOM   560  C C   . SER A 1 69 ? 7.112   18.322 -7.889  1.00 26.50 ? 511 SER A C   1 
ATOM   561  O O   . SER A 1 69 ? 6.947   18.607 -9.077  1.00 26.46 ? 511 SER A O   1 
ATOM   562  C CB  . SER A 1 69 ? 9.251   18.438 -6.602  1.00 27.75 ? 511 SER A CB  1 
ATOM   563  O OG  . SER A 1 69 ? 9.702   19.518 -7.389  1.00 29.21 ? 511 SER A OG  1 
ATOM   564  N N   . LEU A 1 70 ? 6.246   18.657 -6.933  1.00 25.96 ? 512 LEU A N   1 
ATOM   565  C CA  . LEU A 1 70 ? 5.087   19.509 -7.196  1.00 25.57 ? 512 LEU A CA  1 
ATOM   566  C C   . LEU A 1 70 ? 5.492   20.844 -7.813  1.00 26.27 ? 512 LEU A C   1 
ATOM   567  O O   . LEU A 1 70 ? 4.934   21.249 -8.831  1.00 26.74 ? 512 LEU A O   1 
ATOM   568  C CB  . LEU A 1 70 ? 4.280   19.760 -5.909  1.00 24.89 ? 512 LEU A CB  1 
ATOM   569  C CG  . LEU A 1 70 ? 3.453   18.572 -5.429  1.00 23.87 ? 512 LEU A CG  1 
ATOM   570  C CD1 . LEU A 1 70 ? 2.960   18.797 -4.001  1.00 19.43 ? 512 LEU A CD1 1 
ATOM   571  C CD2 . LEU A 1 70 ? 2.292   18.305 -6.396  1.00 23.71 ? 512 LEU A CD2 1 
ATOM   572  N N   . GLN A 1 71 ? 6.460   21.521 -7.202  1.00 26.73 ? 513 GLN A N   1 
ATOM   573  C CA  . GLN A 1 71 ? 6.807   22.872 -7.640  1.00 28.19 ? 513 GLN A CA  1 
ATOM   574  C C   . GLN A 1 71 ? 7.615   22.859 -8.945  1.00 29.02 ? 513 GLN A C   1 
ATOM   575  O O   . GLN A 1 71 ? 7.598   23.836 -9.691  1.00 30.08 ? 513 GLN A O   1 
ATOM   576  C CB  . GLN A 1 71 ? 7.469   23.692 -6.526  1.00 28.18 ? 513 GLN A CB  1 
ATOM   577  C CG  . GLN A 1 71 ? 8.934   23.379 -6.275  1.00 30.87 ? 513 GLN A CG  1 
ATOM   578  C CD  . GLN A 1 71 ? 9.380   23.702 -4.848  0.70 31.42 ? 513 GLN A CD  1 
ATOM   579  O OE1 . GLN A 1 71 ? 8.651   24.343 -4.074  0.70 26.39 ? 513 GLN A OE1 1 
ATOM   580  N NE2 . GLN A 1 71 ? 10.584  23.246 -4.495  0.70 28.28 ? 513 GLN A NE2 1 
ATOM   581  N N   . PHE A 1 72 ? 8.279   21.739 -9.230  1.00 28.87 ? 514 PHE A N   1 
ATOM   582  C CA  . PHE A 1 72 ? 8.870   21.518 -10.553 1.00 29.77 ? 514 PHE A CA  1 
ATOM   583  C C   . PHE A 1 72 ? 7.787   21.632 -11.611 1.00 29.49 ? 514 PHE A C   1 
ATOM   584  O O   . PHE A 1 72 ? 8.040   22.141 -12.701 1.00 30.35 ? 514 PHE A O   1 
ATOM   585  C CB  . PHE A 1 72 ? 9.522   20.132 -10.665 1.00 29.55 ? 514 PHE A CB  1 
ATOM   586  C CG  . PHE A 1 72 ? 9.988   19.788 -12.063 1.00 31.23 ? 514 PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 72 ? 11.238  20.212 -12.522 1.00 34.11 ? 514 PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 72 ? 9.172   19.058 -12.926 1.00 31.16 ? 514 PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 72 ? 11.673  19.902 -13.820 1.00 35.48 ? 514 PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 72 ? 9.593   18.749 -14.233 1.00 32.23 ? 514 PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 72 ? 10.853  19.170 -14.676 1.00 34.27 ? 514 PHE A CZ  1 
ATOM   592  N N   . TYR A 1 73 ? 6.587   21.137 -11.284 1.00 28.22 ? 515 TYR A N   1 
ATOM   593  C CA  . TYR A 1 73 ? 5.465   21.164 -12.213 1.00 27.93 ? 515 TYR A CA  1 
ATOM   594  C C   . TYR A 1 73 ? 4.661   22.468 -12.157 1.00 27.65 ? 515 TYR A C   1 
ATOM   595  O O   . TYR A 1 73 ? 3.622   22.564 -12.789 1.00 27.37 ? 515 TYR A O   1 
ATOM   596  C CB  . TYR A 1 73 ? 4.542   19.962 -11.993 1.00 26.82 ? 515 TYR A CB  1 
ATOM   597  C CG  . TYR A 1 73 ? 5.017   18.657 -12.605 1.00 28.67 ? 515 TYR A CG  1 
ATOM   598  C CD1 . TYR A 1 73 ? 5.122   18.504 -13.987 1.00 32.19 ? 515 TYR A CD1 1 
ATOM   599  C CD2 . TYR A 1 73 ? 5.333   17.562 -11.799 1.00 29.37 ? 515 TYR A CD2 1 
ATOM   600  C CE1 . TYR A 1 73 ? 5.550   17.303 -14.547 1.00 32.56 ? 515 TYR A CE1 1 
ATOM   601  C CE2 . TYR A 1 73 ? 5.757   16.360 -12.350 1.00 29.07 ? 515 TYR A CE2 1 
ATOM   602  C CZ  . TYR A 1 73 ? 5.866   16.237 -13.720 1.00 31.89 ? 515 TYR A CZ  1 
ATOM   603  O OH  . TYR A 1 73 ? 6.288   15.043 -14.265 1.00 33.80 ? 515 TYR A OH  1 
ATOM   604  N N   . SER A 1 74 ? 5.160   23.464 -11.422 1.00 28.24 ? 516 SER A N   1 
ATOM   605  C CA  . SER A 1 74 ? 4.475   24.760 -11.238 1.00 29.38 ? 516 SER A CA  1 
ATOM   606  C C   . SER A 1 74 ? 3.121   24.631 -10.524 1.00 28.83 ? 516 SER A C   1 
ATOM   607  O O   . SER A 1 74 ? 2.213   25.452 -10.725 1.00 29.48 ? 516 SER A O   1 
ATOM   608  C CB  . SER A 1 74 ? 4.323   25.520 -12.562 1.00 29.79 ? 516 SER A CB  1 
ATOM   609  O OG  . SER A 1 74 ? 5.587   25.743 -13.154 1.00 33.35 ? 516 SER A OG  1 
ATOM   610  N N   . VAL A 1 75 ? 2.983   23.595 -9.699  1.00 27.74 ? 517 VAL A N   1 
ATOM   611  C CA  . VAL A 1 75 ? 1.828   23.520 -8.808  1.00 27.64 ? 517 VAL A CA  1 
ATOM   612  C C   . VAL A 1 75 ? 1.930   24.672 -7.805  1.00 28.35 ? 517 VAL A C   1 
ATOM   613  O O   . VAL A 1 75 ? 3.012   24.952 -7.284  1.00 28.97 ? 517 VAL A O   1 
ATOM   614  C CB  . VAL A 1 75 ? 1.717   22.146 -8.109  1.00 26.25 ? 517 VAL A CB  1 
ATOM   615  C CG1 . VAL A 1 75 ? 0.533   22.123 -7.161  1.00 25.80 ? 517 VAL A CG1 1 
ATOM   616  C CG2 . VAL A 1 75 ? 1.570   21.030 -9.151  1.00 25.19 ? 517 VAL A CG2 1 
ATOM   617  N N   . GLU A 1 76 ? 0.820   25.360 -7.569  1.00 28.84 ? 518 GLU A N   1 
ATOM   618  C CA  . GLU A 1 76 ? 0.805   26.483 -6.630  1.00 30.16 ? 518 GLU A CA  1 
ATOM   619  C C   . GLU A 1 76 ? -0.190  26.286 -5.498  1.00 29.75 ? 518 GLU A C   1 
ATOM   620  O O   . GLU A 1 76 ? -1.161  25.531 -5.625  1.00 28.20 ? 518 GLU A O   1 
ATOM   621  C CB  . GLU A 1 76 ? 0.470   27.803 -7.345  1.00 31.66 ? 518 GLU A CB  1 
ATOM   622  C CG  . GLU A 1 76 ? 1.546   28.338 -8.281  1.00 35.04 ? 518 GLU A CG  1 
ATOM   623  C CD  . GLU A 1 76 ? 1.056   29.524 -9.111  1.00 41.74 ? 518 GLU A CD  1 
ATOM   624  O OE1 . GLU A 1 76 ? -0.014  29.407 -9.747  1.00 42.08 ? 518 GLU A OE1 1 
ATOM   625  O OE2 . GLU A 1 76 ? 1.737   30.572 -9.124  1.00 44.58 ? 518 GLU A OE2 1 
ATOM   626  N N   . ASN A 1 77 ? 0.060   27.005 -4.404  1.00 30.81 ? 519 ASN A N   1 
ATOM   627  C CA  . ASN A 1 77 ? -0.886  27.159 -3.312  1.00 31.56 ? 519 ASN A CA  1 
ATOM   628  C C   . ASN A 1 77 ? -2.295  27.465 -3.828  1.00 32.08 ? 519 ASN A C   1 
ATOM   629  O O   . ASN A 1 77 ? -2.484  28.399 -4.610  1.00 32.12 ? 519 ASN A O   1 
ATOM   630  C CB  . ASN A 1 77 ? -0.402  28.275 -2.386  1.00 33.39 ? 519 ASN A CB  1 
ATOM   631  C CG  . ASN A 1 77 ? -1.238  28.406 -1.139  1.00 34.76 ? 519 ASN A CG  1 
ATOM   632  O OD1 . ASN A 1 77 ? -1.443  27.434 -0.416  1.00 35.35 ? 519 ASN A OD1 1 
ATOM   633  N ND2 . ASN A 1 77 ? -1.729  29.617 -0.877  1.00 37.30 ? 519 ASN A ND2 1 
ATOM   634  N N   . GLY A 1 78 ? -3.263  26.645 -3.411  1.00 31.62 ? 520 GLY A N   1 
ATOM   635  C CA  . GLY A 1 78 ? -4.664  26.834 -3.787  1.00 32.62 ? 520 GLY A CA  1 
ATOM   636  C C   . GLY A 1 78 ? -5.145  26.011 -4.970  1.00 32.36 ? 520 GLY A C   1 
ATOM   637  O O   . GLY A 1 78 ? -6.343  25.969 -5.249  1.00 33.22 ? 520 GLY A O   1 
ATOM   638  N N   . ASP A 1 79 ? -4.215  25.356 -5.666  1.00 31.79 ? 521 ASP A N   1 
ATOM   639  C CA  . ASP A 1 79 ? -4.532  24.547 -6.845  1.00 31.30 ? 521 ASP A CA  1 
ATOM   640  C C   . ASP A 1 79 ? -5.304  23.296 -6.468  1.00 30.89 ? 521 ASP A C   1 
ATOM   641  O O   . ASP A 1 79 ? -5.399  22.943 -5.297  1.00 30.28 ? 521 ASP A O   1 
ATOM   642  C CB  . ASP A 1 79 ? -3.273  24.169 -7.640  1.00 30.55 ? 521 ASP A CB  1 
ATOM   643  C CG  . ASP A 1 79 ? -2.751  25.309 -8.497  1.00 31.78 ? 521 ASP A CG  1 
ATOM   644  O OD1 . ASP A 1 79 ? -3.391  26.381 -8.559  1.00 34.63 ? 521 ASP A OD1 1 
ATOM   645  O OD2 . ASP A 1 79 ? -1.682  25.142 -9.114  1.00 32.96 ? 521 ASP A OD2 1 
ATOM   646  N N   . CYS A 1 80 ? -5.865  22.647 -7.483  1.00 31.49 ? 522 CYS A N   1 
ATOM   647  C CA  . CYS A 1 80 ? -6.685  21.467 -7.301  1.00 31.95 ? 522 CYS A CA  1 
ATOM   648  C C   . CYS A 1 80 ? -5.921  20.254 -7.828  1.00 30.66 ? 522 CYS A C   1 
ATOM   649  O O   . CYS A 1 80 ? -5.411  20.268 -8.943  1.00 31.10 ? 522 CYS A O   1 
ATOM   650  C CB  . CYS A 1 80 ? -8.020  21.638 -8.032  1.00 32.69 ? 522 CYS A CB  1 
ATOM   651  S SG  . CYS A 1 80 ? -9.137  20.205 -7.942  1.00 39.07 ? 522 CYS A SG  1 
ATOM   652  N N   . LEU A 1 81 ? -5.840  19.214 -7.015  1.00 29.15 ? 523 LEU A N   1 
ATOM   653  C CA  . LEU A 1 81 ? -5.209  17.984 -7.429  1.00 28.25 ? 523 LEU A CA  1 
ATOM   654  C C   . LEU A 1 81 ? -6.277  16.962 -7.788  1.00 28.15 ? 523 LEU A C   1 
ATOM   655  O O   . LEU A 1 81 ? -7.132  16.618 -6.961  1.00 28.70 ? 523 LEU A O   1 
ATOM   656  C CB  . LEU A 1 81 ? -4.308  17.457 -6.315  1.00 27.35 ? 523 LEU A CB  1 
ATOM   657  C CG  . LEU A 1 81 ? -3.343  16.330 -6.696  1.00 29.36 ? 523 LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 81 ? -2.271  16.842 -7.634  1.00 28.35 ? 523 LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 81 ? -2.711  15.694 -5.446  1.00 31.39 ? 523 LEU A CD2 1 
ATOM   660  N N   . LEU A 1 82 ? -6.236  16.479 -9.020  1.00 27.52 ? 524 LEU A N   1 
ATOM   661  C CA  . LEU A 1 82 ? -7.224  15.506 -9.456  1.00 27.89 ? 524 LEU A CA  1 
ATOM   662  C C   . LEU A 1 82 ? -6.636  14.111 -9.392  1.00 27.29 ? 524 LEU A C   1 
ATOM   663  O O   . LEU A 1 82 ? -5.577  13.843 -9.976  1.00 27.63 ? 524 LEU A O   1 
ATOM   664  C CB  . LEU A 1 82 ? -7.745  15.815 -10.865 1.00 28.78 ? 524 LEU A CB  1 
ATOM   665  C CG  . LEU A 1 82 ? -8.555  17.098 -11.008 1.00 30.45 ? 524 LEU A CG  1 
ATOM   666  C CD1 . LEU A 1 82 ? -7.655  18.223 -11.438 1.00 31.99 ? 524 LEU A CD1 1 
ATOM   667  C CD2 . LEU A 1 82 ? -9.654  16.886 -12.030 1.00 36.47 ? 524 LEU A CD2 1 
ATOM   668  N N   . VAL A 1 83 ? -7.332  13.225 -8.689  1.00 26.67 ? 525 VAL A N   1 
ATOM   669  C CA  . VAL A 1 83 ? -6.802  11.904 -8.385  1.00 26.23 ? 525 VAL A CA  1 
ATOM   670  C C   . VAL A 1 83 ? -7.663  10.845 -9.055  1.00 26.80 ? 525 VAL A C   1 
ATOM   671  O O   . VAL A 1 83 ? -8.826  10.693 -8.711  1.00 27.02 ? 525 VAL A O   1 
ATOM   672  C CB  . VAL A 1 83 ? -6.760  11.652 -6.849  1.00 25.84 ? 525 VAL A CB  1 
ATOM   673  C CG1 . VAL A 1 83 ? -6.119  10.314 -6.539  1.00 25.21 ? 525 VAL A CG1 1 
ATOM   674  C CG2 . VAL A 1 83 ? -6.033  12.777 -6.134  1.00 24.42 ? 525 VAL A CG2 1 
ATOM   675  N N   . ARG A 1 84 ? -7.091  10.127 -10.015 1.00 27.36 ? 526 ARG A N   1 
ATOM   676  C CA  . ARG A 1 84 ? -7.795  9.013  -10.667 1.00 29.04 ? 526 ARG A CA  1 
ATOM   677  C C   . ARG A 1 84 ? -7.137  7.672  -10.396 1.00 29.61 ? 526 ARG A C   1 
ATOM   678  O O   . ARG A 1 84 ? -5.935  7.602  -10.130 1.00 29.28 ? 526 ARG A O   1 
ATOM   679  C CB  . ARG A 1 84 ? -7.907  9.234  -12.176 1.00 29.89 ? 526 ARG A CB  1 
ATOM   680  C CG  . ARG A 1 84 ? -8.747  10.442 -12.558 1.00 30.51 ? 526 ARG A CG  1 
ATOM   681  C CD  . ARG A 1 84 ? -8.860  10.555 -14.050 1.00 32.90 ? 526 ARG A CD  1 
ATOM   682  N NE  . ARG A 1 84 ? -9.716  11.662 -14.469 1.00 33.80 ? 526 ARG A NE  1 
ATOM   683  C CZ  . ARG A 1 84 ? -9.313  12.924 -14.580 1.00 30.29 ? 526 ARG A CZ  1 
ATOM   684  N NH1 . ARG A 1 84 ? -8.063  13.266 -14.284 1.00 30.85 ? 526 ARG A NH1 1 
ATOM   685  N NH2 . ARG A 1 84 ? -10.164 13.847 -14.981 1.00 29.69 ? 526 ARG A NH2 1 
ATOM   686  N N   . TRP A 1 85 ? -7.938  6.610  -10.451 1.00 31.56 ? 527 TRP A N   1 
ATOM   687  C CA  . TRP A 1 85 ? -7.431  5.243  -10.346 1.00 32.94 ? 527 TRP A CA  1 
ATOM   688  C C   . TRP A 1 85 ? -8.358  4.242  -11.006 1.00 35.57 ? 527 TRP A C   1 
ATOM   689  O O   . TRP A 1 85 ? -7.999  3.065  -11.151 1.00 37.12 ? 527 TRP A O   1 
ATOM   690  C CB  . TRP A 1 85 ? -7.172  4.844  -8.884  1.00 32.33 ? 527 TRP A CB  1 
ATOM   691  C CG  . TRP A 1 85 ? -8.389  4.747  -7.985  1.00 31.69 ? 527 TRP A CG  1 
ATOM   692  C CD1 . TRP A 1 85 ? -9.100  3.614  -7.682  1.00 31.79 ? 527 TRP A CD1 1 
ATOM   693  C CD2 . TRP A 1 85 ? -9.003  5.813  -7.238  1.00 29.22 ? 527 TRP A CD2 1 
ATOM   694  N NE1 . TRP A 1 85 ? -10.118 3.911  -6.804  1.00 31.58 ? 527 TRP A NE1 1 
ATOM   695  C CE2 . TRP A 1 85 ? -10.085 5.252  -6.519  1.00 30.28 ? 527 TRP A CE2 1 
ATOM   696  C CE3 . TRP A 1 85 ? -8.752  7.188  -7.117  1.00 26.97 ? 527 TRP A CE3 1 
ATOM   697  C CZ2 . TRP A 1 85 ? -10.916 6.020  -5.690  1.00 27.79 ? 527 TRP A CZ2 1 
ATOM   698  C CZ3 . TRP A 1 85 ? -9.580  7.951  -6.287  1.00 24.83 ? 527 TRP A CZ3 1 
ATOM   699  C CH2 . TRP A 1 85 ? -10.647 7.361  -5.585  1.00 24.08 ? 527 TRP A CH2 1 
ATOM   700  O OXT . TRP A 1 85 ? -9.478  4.590  -11.397 1.00 36.97 ? 527 TRP A OXT 1 
ATOM   701  N N   . GLN B 1 2  ? -10.491 -4.440 -19.645 1.00 44.67 ? 444 GLN B N   1 
ATOM   702  C CA  . GLN B 1 2  ? -10.478 -5.239 -20.905 1.00 45.30 ? 444 GLN B CA  1 
ATOM   703  C C   . GLN B 1 2  ? -11.672 -4.849 -21.777 1.00 43.30 ? 444 GLN B C   1 
ATOM   704  O O   . GLN B 1 2  ? -11.874 -3.661 -22.049 1.00 41.86 ? 444 GLN B O   1 
ATOM   705  C CB  . GLN B 1 2  ? -10.463 -6.745 -20.596 1.00 47.79 ? 444 GLN B CB  1 
ATOM   706  C CG  . GLN B 1 2  ? -9.988  -7.638 -21.746 1.00 50.44 ? 444 GLN B CG  1 
ATOM   707  C CD  . GLN B 1 2  ? -8.583  -7.300 -22.236 1.00 55.33 ? 444 GLN B CD  1 
ATOM   708  O OE1 . GLN B 1 2  ? -7.684  -6.980 -21.454 1.00 59.31 ? 444 GLN B OE1 1 
ATOM   709  N NE2 . GLN B 1 2  ? -8.393  -7.376 -23.537 1.00 53.58 ? 444 GLN B NE2 1 
ATOM   710  N N   . LEU B 1 3  ? -12.459 -5.835 -22.204 1.00 43.19 ? 445 LEU B N   1 
ATOM   711  C CA  . LEU B 1 3  ? -13.594 -5.583 -23.086 1.00 41.37 ? 445 LEU B CA  1 
ATOM   712  C C   . LEU B 1 3  ? -14.831 -5.194 -22.276 1.00 39.98 ? 445 LEU B C   1 
ATOM   713  O O   . LEU B 1 3  ? -15.366 -5.998 -21.506 1.00 41.37 ? 445 LEU B O   1 
ATOM   714  C CB  . LEU B 1 3  ? -13.861 -6.800 -23.979 1.00 42.70 ? 445 LEU B CB  1 
ATOM   715  C CG  . LEU B 1 3  ? -14.603 -6.576 -25.304 1.00 42.11 ? 445 LEU B CG  1 
ATOM   716  C CD1 . LEU B 1 3  ? -13.953 -5.500 -26.172 1.00 37.80 ? 445 LEU B CD1 1 
ATOM   717  C CD2 . LEU B 1 3  ? -14.703 -7.884 -26.084 1.00 43.71 ? 445 LEU B CD2 1 
ATOM   718  N N   . LEU B 1 4  ? -15.266 -3.950 -22.445 1.00 37.57 ? 446 LEU B N   1 
ATOM   719  C CA  . LEU B 1 4  ? -16.375 -3.407 -21.664 1.00 36.00 ? 446 LEU B CA  1 
ATOM   720  C C   . LEU B 1 4  ? -17.657 -3.417 -22.476 1.00 35.83 ? 446 LEU B C   1 
ATOM   721  O O   . LEU B 1 4  ? -17.711 -2.842 -23.567 1.00 35.21 ? 446 LEU B O   1 
ATOM   722  C CB  . LEU B 1 4  ? -16.082 -1.975 -21.206 1.00 34.02 ? 446 LEU B CB  1 
ATOM   723  C CG  . LEU B 1 4  ? -14.721 -1.614 -20.607 1.00 33.59 ? 446 LEU B CG  1 
ATOM   724  C CD1 . LEU B 1 4  ? -14.571 -0.093 -20.497 1.00 27.17 ? 446 LEU B CD1 1 
ATOM   725  C CD2 . LEU B 1 4  ? -14.514 -2.285 -19.256 1.00 32.70 ? 446 LEU B CD2 1 
ATOM   726  N N   . THR B 1 5  ? -18.680 -4.074 -21.931 1.00 36.43 ? 447 THR B N   1 
ATOM   727  C CA  . THR B 1 5  ? -20.032 -4.018 -22.471 1.00 36.51 ? 447 THR B CA  1 
ATOM   728  C C   . THR B 1 5  ? -20.714 -2.717 -22.039 1.00 35.33 ? 447 THR B C   1 
ATOM   729  O O   . THR B 1 5  ? -21.104 -2.568 -20.883 1.00 35.96 ? 447 THR B O   1 
ATOM   730  C CB  . THR B 1 5  ? -20.856 -5.266 -22.045 1.00 38.14 ? 447 THR B CB  1 
ATOM   731  O OG1 . THR B 1 5  ? -20.291 -6.431 -22.655 1.00 39.96 ? 447 THR B OG1 1 
ATOM   732  C CG2 . THR B 1 5  ? -22.308 -5.155 -22.480 1.00 38.28 ? 447 THR B CG2 1 
ATOM   733  N N   . LEU B 1 6  ? -20.846 -1.779 -22.977 1.00 34.37 ? 448 LEU B N   1 
ATOM   734  C CA  . LEU B 1 6  ? -21.474 -0.481 -22.712 1.00 33.16 ? 448 LEU B CA  1 
ATOM   735  C C   . LEU B 1 6  ? -22.777 -0.297 -23.474 1.00 33.58 ? 448 LEU B C   1 
ATOM   736  O O   . LEU B 1 6  ? -22.854 -0.556 -24.677 1.00 34.43 ? 448 LEU B O   1 
ATOM   737  C CB  . LEU B 1 6  ? -20.526 0.674  -23.068 1.00 32.14 ? 448 LEU B CB  1 
ATOM   738  C CG  . LEU B 1 6  ? -19.166 0.784  -22.375 1.00 31.80 ? 448 LEU B CG  1 
ATOM   739  C CD1 . LEU B 1 6  ? -18.394 1.970  -22.920 1.00 31.08 ? 448 LEU B CD1 1 
ATOM   740  C CD2 . LEU B 1 6  ? -19.325 0.907  -20.868 1.00 30.00 ? 448 LEU B CD2 1 
ATOM   741  N N   . LYS B 1 7  ? -23.787 0.186  -22.763 1.00 33.42 ? 449 LYS B N   1 
ATOM   742  C CA  . LYS B 1 7  ? -25.099 0.439  -23.320 1.00 33.96 ? 449 LYS B CA  1 
ATOM   743  C C   . LYS B 1 7  ? -25.159 1.903  -23.744 1.00 33.12 ? 449 LYS B C   1 
ATOM   744  O O   . LYS B 1 7  ? -24.607 2.767  -23.066 1.00 33.11 ? 449 LYS B O   1 
ATOM   745  C CB  . LYS B 1 7  ? -26.172 0.132  -22.269 1.00 35.15 ? 449 LYS B CB  1 
ATOM   746  C CG  . LYS B 1 7  ? -25.867 -1.108 -21.427 1.00 36.97 ? 449 LYS B CG  1 
ATOM   747  C CD  . LYS B 1 7  ? -27.058 -1.522 -20.584 1.00 42.13 ? 449 LYS B CD  1 
ATOM   748  C CE  . LYS B 1 7  ? -26.749 -2.769 -19.785 1.00 43.17 ? 449 LYS B CE  1 
ATOM   749  N NZ  . LYS B 1 7  ? -27.978 -3.614 -19.625 1.00 46.12 ? 449 LYS B NZ  1 
ATOM   750  N N   . ILE B 1 8  ? -25.824 2.192  -24.857 1.00 32.97 ? 450 ILE B N   1 
ATOM   751  C CA  . ILE B 1 8  ? -25.750 3.528  -25.439 1.00 32.13 ? 450 ILE B CA  1 
ATOM   752  C C   . ILE B 1 8  ? -27.093 4.252  -25.416 1.00 33.13 ? 450 ILE B C   1 
ATOM   753  O O   . ILE B 1 8  ? -28.140 3.650  -25.650 1.00 34.76 ? 450 ILE B O   1 
ATOM   754  C CB  . ILE B 1 8  ? -25.081 3.492  -26.842 1.00 32.30 ? 450 ILE B CB  1 
ATOM   755  C CG1 . ILE B 1 8  ? -23.600 3.142  -26.676 1.00 29.54 ? 450 ILE B CG1 1 
ATOM   756  C CG2 . ILE B 1 8  ? -25.242 4.828  -27.577 1.00 31.84 ? 450 ILE B CG2 1 
ATOM   757  C CD1 . ILE B 1 8  ? -22.954 2.518  -27.849 1.00 32.32 ? 450 ILE B CD1 1 
ATOM   758  N N   . LYS B 1 9  ? -27.053 5.542  -25.090 1.00 32.60 ? 451 LYS B N   1 
ATOM   759  C CA  . LYS B 1 9  ? -28.259 6.325  -24.910 1.00 33.28 ? 451 LYS B CA  1 
ATOM   760  C C   . LYS B 1 9  ? -28.119 7.658  -25.622 1.00 33.22 ? 451 LYS B C   1 
ATOM   761  O O   . LYS B 1 9  ? -27.053 8.271  -25.584 1.00 32.25 ? 451 LYS B O   1 
ATOM   762  C CB  . LYS B 1 9  ? -28.518 6.544  -23.416 1.00 33.65 ? 451 LYS B CB  1 
ATOM   763  C CG  . LYS B 1 9  ? -29.920 7.067  -23.063 1.00 36.11 ? 451 LYS B CG  1 
ATOM   764  C CD  . LYS B 1 9  ? -29.945 7.552  -21.625 1.00 39.71 ? 451 LYS B CD  1 
ATOM   765  C CE  . LYS B 1 9  ? -31.284 7.293  -20.959 0.50 44.30 ? 451 LYS B CE  1 
ATOM   766  N NZ  . LYS B 1 9  ? -31.213 7.474  -19.482 0.50 45.94 ? 451 LYS B NZ  1 
ATOM   767  N N   . TYR B 1 10 ? -29.194 8.087  -26.285 1.00 34.76 ? 452 TYR B N   1 
ATOM   768  C CA  . TYR B 1 10 ? -29.280 9.433  -26.866 1.00 35.66 ? 452 TYR B CA  1 
ATOM   769  C C   . TYR B 1 10 ? -30.317 10.277 -26.102 1.00 36.94 ? 452 TYR B C   1 
ATOM   770  O O   . TYR B 1 10 ? -31.469 10.402 -26.535 1.00 38.64 ? 452 TYR B O   1 
ATOM   771  C CB  . TYR B 1 10 ? -29.644 9.385  -28.355 1.00 36.81 ? 452 TYR B CB  1 
ATOM   772  C CG  . TYR B 1 10 ? -28.882 8.389  -29.216 1.00 35.83 ? 452 TYR B CG  1 
ATOM   773  C CD1 . TYR B 1 10 ? -29.518 7.739  -30.275 1.00 36.44 ? 452 TYR B CD1 1 
ATOM   774  C CD2 . TYR B 1 10 ? -27.535 8.116  -28.993 1.00 34.49 ? 452 TYR B CD2 1 
ATOM   775  C CE1 . TYR B 1 10 ? -28.836 6.836  -31.079 1.00 37.50 ? 452 TYR B CE1 1 
ATOM   776  C CE2 . TYR B 1 10 ? -26.840 7.207  -29.792 1.00 36.01 ? 452 TYR B CE2 1 
ATOM   777  C CZ  . TYR B 1 10 ? -27.496 6.571  -30.830 1.00 36.89 ? 452 TYR B CZ  1 
ATOM   778  O OH  . TYR B 1 10 ? -26.816 5.674  -31.622 1.00 35.10 ? 452 TYR B OH  1 
ATOM   779  N N   . PRO B 1 11 ? -29.906 10.880 -24.970 1.00 36.54 ? 453 PRO B N   1 
ATOM   780  C CA  . PRO B 1 11 ? -30.848 11.508 -24.029 1.00 37.86 ? 453 PRO B CA  1 
ATOM   781  C C   . PRO B 1 11 ? -31.685 12.664 -24.595 1.00 40.31 ? 453 PRO B C   1 
ATOM   782  O O   . PRO B 1 11 ? -32.726 12.998 -24.022 1.00 41.62 ? 453 PRO B O   1 
ATOM   783  C CB  . PRO B 1 11 ? -29.935 12.008 -22.900 1.00 36.84 ? 453 PRO B CB  1 
ATOM   784  C CG  . PRO B 1 11 ? -28.595 12.128 -23.522 1.00 35.80 ? 453 PRO B CG  1 
ATOM   785  C CD  . PRO B 1 11 ? -28.510 11.029 -24.525 1.00 34.86 ? 453 PRO B CD  1 
ATOM   786  N N   . HIS B 1 12 ? -31.237 13.272 -25.692 1.00 41.04 ? 454 HIS B N   1 
ATOM   787  C CA  . HIS B 1 12 ? -31.995 14.360 -26.303 1.00 44.19 ? 454 HIS B CA  1 
ATOM   788  C C   . HIS B 1 12 ? -33.120 13.863 -27.233 1.00 45.89 ? 454 HIS B C   1 
ATOM   789  O O   . HIS B 1 12 ? -34.026 14.622 -27.575 1.00 48.02 ? 454 HIS B O   1 
ATOM   790  C CB  . HIS B 1 12 ? -31.067 15.371 -26.994 1.00 44.46 ? 454 HIS B CB  1 
ATOM   791  C CG  . HIS B 1 12 ? -30.297 14.813 -28.150 0.70 44.58 ? 454 HIS B CG  1 
ATOM   792  N ND1 . HIS B 1 12 ? -29.354 13.817 -28.010 0.70 46.36 ? 454 HIS B ND1 1 
ATOM   793  C CD2 . HIS B 1 12 ? -30.307 15.139 -29.465 0.70 46.76 ? 454 HIS B CD2 1 
ATOM   794  C CE1 . HIS B 1 12 ? -28.833 13.538 -29.191 0.70 46.15 ? 454 HIS B CE1 1 
ATOM   795  N NE2 . HIS B 1 12 ? -29.392 14.328 -30.091 0.70 47.27 ? 454 HIS B NE2 1 
ATOM   796  N N   . GLN B 1 13 ? -33.062 12.582 -27.609 1.00 45.13 ? 455 GLN B N   1 
ATOM   797  C CA  . GLN B 1 13 ? -34.069 11.959 -28.480 1.00 46.68 ? 455 GLN B CA  1 
ATOM   798  C C   . GLN B 1 13 ? -34.992 11.002 -27.714 1.00 47.44 ? 455 GLN B C   1 
ATOM   799  O O   . GLN B 1 13 ? -36.204 11.017 -27.908 1.00 49.59 ? 455 GLN B O   1 
ATOM   800  C CB  . GLN B 1 13 ? -33.397 11.196 -29.631 1.00 45.40 ? 455 GLN B CB  1 
ATOM   801  C CG  . GLN B 1 13 ? -32.437 12.021 -30.480 1.00 44.78 ? 455 GLN B CG  1 
ATOM   802  C CD  . GLN B 1 13 ? -31.992 11.299 -31.741 1.00 41.96 ? 455 GLN B CD  1 
ATOM   803  O OE1 . GLN B 1 13 ? -31.864 10.076 -31.759 1.00 41.93 ? 455 GLN B OE1 1 
ATOM   804  N NE2 . GLN B 1 13 ? -31.761 12.056 -32.806 1.00 39.95 ? 455 GLN B NE2 1 
ATOM   805  N N   . LEU B 1 14 ? -34.405 10.160 -26.862 1.00 46.29 ? 456 LEU B N   1 
ATOM   806  C CA  . LEU B 1 14 ? -35.151 9.143  -26.115 1.00 47.26 ? 456 LEU B CA  1 
ATOM   807  C C   . LEU B 1 14 ? -34.477 8.855  -24.771 1.00 45.96 ? 456 LEU B C   1 
ATOM   808  O O   . LEU B 1 14 ? -33.262 8.937  -24.654 1.00 44.10 ? 456 LEU B O   1 
ATOM   809  C CB  . LEU B 1 14 ? -35.275 7.858  -26.951 1.00 47.26 ? 456 LEU B CB  1 
ATOM   810  C CG  . LEU B 1 14 ? -36.299 6.766  -26.604 1.00 48.92 ? 456 LEU B CG  1 
ATOM   811  C CD1 . LEU B 1 14 ? -37.751 7.246  -26.725 1.00 49.97 ? 456 LEU B CD1 1 
ATOM   812  C CD2 . LEU B 1 14 ? -36.074 5.541  -27.499 1.00 48.04 ? 456 LEU B CD2 1 
ATOM   813  N N   . ASP B 1 15 ? -35.283 8.519  -23.768 1.00 47.60 ? 457 ASP B N   1 
ATOM   814  C CA  . ASP B 1 15 ? -34.810 8.245  -22.408 1.00 47.19 ? 457 ASP B CA  1 
ATOM   815  C C   . ASP B 1 15 ? -34.548 6.747  -22.170 1.00 46.44 ? 457 ASP B C   1 
ATOM   816  O O   . ASP B 1 15 ? -34.433 6.293  -21.023 1.00 46.92 ? 457 ASP B O   1 
ATOM   817  C CB  . ASP B 1 15 ? -35.828 8.778  -21.386 0.50 49.17 ? 457 ASP B CB  1 
ATOM   818  C CG  . ASP B 1 15 ? -35.293 8.780  -19.962 0.50 50.47 ? 457 ASP B CG  1 
ATOM   819  O OD1 . ASP B 1 15 ? -34.070 8.974  -19.772 0.50 50.37 ? 457 ASP B OD1 1 
ATOM   820  O OD2 . ASP B 1 15 ? -36.102 8.590  -19.029 0.50 56.63 ? 457 ASP B OD2 1 
ATOM   821  N N   . GLN B 1 16 ? -34.448 5.987  -23.255 1.00 45.55 ? 458 GLN B N   1 
ATOM   822  C CA  . GLN B 1 16 ? -34.199 4.557  -23.178 1.00 44.76 ? 458 GLN B CA  1 
ATOM   823  C C   . GLN B 1 16 ? -32.854 4.231  -23.813 1.00 42.49 ? 458 GLN B C   1 
ATOM   824  O O   . GLN B 1 16 ? -32.355 4.972  -24.675 1.00 41.35 ? 458 GLN B O   1 
ATOM   825  C CB  . GLN B 1 16 ? -35.295 3.769  -23.907 1.00 46.73 ? 458 GLN B CB  1 
ATOM   826  C CG  . GLN B 1 16 ? -36.730 4.159  -23.563 1.00 50.46 ? 458 GLN B CG  1 
ATOM   827  C CD  . GLN B 1 16 ? -37.291 3.409  -22.375 1.00 54.66 ? 458 GLN B CD  1 
ATOM   828  O OE1 . GLN B 1 16 ? -36.572 3.073  -21.437 1.00 55.91 ? 458 GLN B OE1 1 
ATOM   829  N NE2 . GLN B 1 16 ? -38.593 3.145  -22.408 1.00 58.22 ? 458 GLN B NE2 1 
ATOM   830  N N   . LYS B 1 17 ? -32.281 3.107  -23.400 1.00 41.36 ? 459 LYS B N   1 
ATOM   831  C CA  . LYS B 1 17 ? -31.083 2.603  -24.044 1.00 39.88 ? 459 LYS B CA  1 
ATOM   832  C C   . LYS B 1 17 ? -31.366 2.171  -25.494 1.00 40.41 ? 459 LYS B C   1 
ATOM   833  O O   . LYS B 1 17 ? -32.375 1.517  -25.790 1.00 41.65 ? 459 LYS B O   1 
ATOM   834  C CB  . LYS B 1 17 ? -30.421 1.517  -23.189 1.00 39.42 ? 459 LYS B CB  1 
ATOM   835  C CG  . LYS B 1 17 ? -29.695 2.109  -21.975 1.00 39.01 ? 459 LYS B CG  1 
ATOM   836  C CD  . LYS B 1 17 ? -29.743 1.200  -20.756 0.50 42.87 ? 459 LYS B CD  1 
ATOM   837  C CE  . LYS B 1 17 ? -29.132 1.885  -19.537 0.50 43.71 ? 459 LYS B CE  1 
ATOM   838  N NZ  . LYS B 1 17 ? -29.210 1.044  -18.307 0.50 44.53 ? 459 LYS B NZ  1 
ATOM   839  N N   . VAL B 1 18 ? -30.466 2.576  -26.386 1.00 39.34 ? 460 VAL B N   1 
ATOM   840  C CA  . VAL B 1 18 ? -30.665 2.479  -27.827 1.00 39.97 ? 460 VAL B CA  1 
ATOM   841  C C   . VAL B 1 18 ? -29.917 1.284  -28.437 1.00 39.96 ? 460 VAL B C   1 
ATOM   842  O O   . VAL B 1 18 ? -30.420 0.644  -29.359 1.00 40.92 ? 460 VAL B O   1 
ATOM   843  C CB  . VAL B 1 18 ? -30.289 3.822  -28.506 1.00 39.46 ? 460 VAL B CB  1 
ATOM   844  C CG1 . VAL B 1 18 ? -29.985 3.652  -29.978 1.00 40.56 ? 460 VAL B CG1 1 
ATOM   845  C CG2 . VAL B 1 18 ? -31.409 4.818  -28.323 1.00 40.64 ? 460 VAL B CG2 1 
ATOM   846  N N   . LEU B 1 19 ? -28.736 0.978  -27.903 1.00 38.89 ? 461 LEU B N   1 
ATOM   847  C CA  . LEU B 1 19 ? -27.926 -0.142 -28.381 1.00 39.48 ? 461 LEU B CA  1 
ATOM   848  C C   . LEU B 1 19 ? -26.820 -0.504 -27.382 1.00 38.69 ? 461 LEU B C   1 
ATOM   849  O O   . LEU B 1 19 ? -26.609 0.209  -26.407 1.00 37.51 ? 461 LEU B O   1 
ATOM   850  C CB  . LEU B 1 19 ? -27.347 0.177  -29.765 1.00 39.40 ? 461 LEU B CB  1 
ATOM   851  C CG  . LEU B 1 19 ? -26.205 1.188  -29.859 1.00 39.37 ? 461 LEU B CG  1 
ATOM   852  C CD1 . LEU B 1 19 ? -25.005 0.470  -30.424 1.00 42.01 ? 461 LEU B CD1 1 
ATOM   853  C CD2 . LEU B 1 19 ? -26.575 2.350  -30.748 1.00 40.29 ? 461 LEU B CD2 1 
ATOM   854  N N   . GLU B 1 20 ? -26.137 -1.622 -27.631 1.00 39.80 ? 462 GLU B N   1 
ATOM   855  C CA  . GLU B 1 20 ? -25.030 -2.101 -26.798 1.00 39.75 ? 462 GLU B CA  1 
ATOM   856  C C   . GLU B 1 20 ? -23.782 -2.323 -27.641 1.00 39.58 ? 462 GLU B C   1 
ATOM   857  O O   . GLU B 1 20 ? -23.864 -2.886 -28.733 1.00 40.57 ? 462 GLU B O   1 
ATOM   858  C CB  . GLU B 1 20 ? -25.398 -3.424 -26.113 1.00 41.32 ? 462 GLU B CB  1 
ATOM   859  C CG  . GLU B 1 20 ? -25.911 -3.275 -24.690 1.00 43.33 ? 462 GLU B CG  1 
ATOM   860  C CD  . GLU B 1 20 ? -26.217 -4.606 -24.026 1.00 48.48 ? 462 GLU B CD  1 
ATOM   861  O OE1 . GLU B 1 20 ? -25.409 -5.553 -24.161 1.00 50.49 ? 462 GLU B OE1 1 
ATOM   862  O OE2 . GLU B 1 20 ? -27.270 -4.702 -23.355 1.00 51.41 ? 462 GLU B OE2 1 
ATOM   863  N N   . LYS B 1 21 ? -22.629 -1.902 -27.124 1.00 38.36 ? 463 LYS B N   1 
ATOM   864  C CA  . LYS B 1 21 ? -21.361 -2.116 -27.809 1.00 38.61 ? 463 LYS B CA  1 
ATOM   865  C C   . LYS B 1 21 ? -20.310 -2.637 -26.862 1.00 38.28 ? 463 LYS B C   1 
ATOM   866  O O   . LYS B 1 21 ? -20.208 -2.170 -25.730 1.00 37.78 ? 463 LYS B O   1 
ATOM   867  C CB  . LYS B 1 21 ? -20.854 -0.821 -28.459 1.00 38.12 ? 463 LYS B CB  1 
ATOM   868  C CG  . LYS B 1 21 ? -21.517 -0.459 -29.788 1.00 41.18 ? 463 LYS B CG  1 
ATOM   869  C CD  . LYS B 1 21 ? -21.249 -1.483 -30.893 1.00 47.92 ? 463 LYS B CD  1 
ATOM   870  C CE  . LYS B 1 21 ? -21.713 -0.942 -32.238 1.00 53.61 ? 463 LYS B CE  1 
ATOM   871  N NZ  . LYS B 1 21 ? -21.356 -1.833 -33.379 1.00 57.51 ? 463 LYS B NZ  1 
ATOM   872  N N   . GLN B 1 22 ? -19.535 -3.614 -27.327 1.00 39.18 ? 464 GLN B N   1 
ATOM   873  C CA  . GLN B 1 22 ? -18.366 -4.071 -26.597 1.00 39.35 ? 464 GLN B CA  1 
ATOM   874  C C   . GLN B 1 22 ? -17.138 -3.279 -27.042 1.00 38.53 ? 464 GLN B C   1 
ATOM   875  O O   . GLN B 1 22 ? -16.689 -3.372 -28.194 1.00 39.66 ? 464 GLN B O   1 
ATOM   876  C CB  . GLN B 1 22 ? -18.164 -5.581 -26.744 1.00 41.39 ? 464 GLN B CB  1 
ATOM   877  C CG  . GLN B 1 22 ? -18.929 -6.397 -25.702 1.00 43.49 ? 464 GLN B CG  1 
ATOM   878  C CD  . GLN B 1 22 ? -18.582 -7.887 -25.720 1.00 48.97 ? 464 GLN B CD  1 
ATOM   879  O OE1 . GLN B 1 22 ? -18.866 -8.597 -26.690 1.00 50.27 ? 464 GLN B OE1 1 
ATOM   880  N NE2 . GLN B 1 22 ? -17.986 -8.370 -24.631 1.00 48.52 ? 464 GLN B NE2 1 
ATOM   881  N N   . LEU B 1 23 ? -16.623 -2.470 -26.124 1.00 36.68 ? 465 LEU B N   1 
ATOM   882  C CA  . LEU B 1 23 ? -15.493 -1.598 -26.405 1.00 35.50 ? 465 LEU B CA  1 
ATOM   883  C C   . LEU B 1 23 ? -14.314 -1.912 -25.493 1.00 35.59 ? 465 LEU B C   1 
ATOM   884  O O   . LEU B 1 23 ? -14.488 -2.034 -24.275 1.00 35.31 ? 465 LEU B O   1 
ATOM   885  C CB  . LEU B 1 23 ? -15.904 -0.131 -26.249 1.00 33.94 ? 465 LEU B CB  1 
ATOM   886  C CG  . LEU B 1 23 ? -17.136 0.287  -27.055 1.00 32.96 ? 465 LEU B CG  1 
ATOM   887  C CD1 . LEU B 1 23 ? -17.446 1.768  -26.842 1.00 30.61 ? 465 LEU B CD1 1 
ATOM   888  C CD2 . LEU B 1 23 ? -16.957 -0.036 -28.542 1.00 29.57 ? 465 LEU B CD2 1 
ATOM   889  N N   . PRO B 1 24 ? -13.108 -2.055 -26.079 1.00 35.98 ? 466 PRO B N   1 
ATOM   890  C CA  . PRO B 1 24 ? -11.908 -2.241 -25.256 1.00 36.14 ? 466 PRO B CA  1 
ATOM   891  C C   . PRO B 1 24 ? -11.699 -1.033 -24.342 1.00 34.69 ? 466 PRO B C   1 
ATOM   892  O O   . PRO B 1 24 ? -11.911 0.105  -24.772 1.00 34.25 ? 466 PRO B O   1 
ATOM   893  C CB  . PRO B 1 24 ? -10.785 -2.344 -26.294 1.00 37.11 ? 466 PRO B CB  1 
ATOM   894  C CG  . PRO B 1 24 ? -11.461 -2.787 -27.547 1.00 37.03 ? 466 PRO B CG  1 
ATOM   895  C CD  . PRO B 1 24 ? -12.791 -2.085 -27.518 1.00 36.40 ? 466 PRO B CD  1 
ATOM   896  N N   . GLY B 1 25 ? -11.317 -1.282 -23.089 1.00 34.43 ? 467 GLY B N   1 
ATOM   897  C CA  . GLY B 1 25 ? -11.123 -0.217 -22.100 1.00 33.01 ? 467 GLY B CA  1 
ATOM   898  C C   . GLY B 1 25 ? -10.093 0.840  -22.472 1.00 32.58 ? 467 GLY B C   1 
ATOM   899  O O   . GLY B 1 25 ? -10.206 1.993  -22.053 1.00 32.02 ? 467 GLY B O   1 
ATOM   900  N N   . SER B 1 26 ? -9.100  0.445  -23.268 1.00 33.11 ? 468 SER B N   1 
ATOM   901  C CA  . SER B 1 26 ? -8.038  1.342  -23.728 1.00 33.46 ? 468 SER B CA  1 
ATOM   902  C C   . SER B 1 26 ? -8.438  2.184  -24.949 1.00 33.08 ? 468 SER B C   1 
ATOM   903  O O   . SER B 1 26 ? -7.665  3.041  -25.404 1.00 33.23 ? 468 SER B O   1 
ATOM   904  C CB  . SER B 1 26 ? -6.756  0.549  -24.035 1.00 35.43 ? 468 SER B CB  1 
ATOM   905  O OG  . SER B 1 26 ? -7.004  -0.488 -24.967 1.00 34.20 ? 468 SER B OG  1 
ATOM   906  N N   . MET B 1 27 ? -9.633  1.924  -25.483 1.00 32.24 ? 469 MET B N   1 
ATOM   907  C CA  . MET B 1 27 ? -10.189 2.728  -26.563 1.00 31.80 ? 469 MET B CA  1 
ATOM   908  C C   . MET B 1 27 ? -10.275 4.186  -26.121 1.00 31.24 ? 469 MET B C   1 
ATOM   909  O O   . MET B 1 27 ? -10.839 4.480  -25.073 1.00 30.02 ? 469 MET B O   1 
ATOM   910  C CB  . MET B 1 27 ? -11.572 2.203  -26.975 1.00 31.14 ? 469 MET B CB  1 
ATOM   911  C CG  . MET B 1 27 ? -12.135 2.806  -28.262 1.00 30.70 ? 469 MET B CG  1 
ATOM   912  S SD  . MET B 1 27 ? -13.551 1.875  -28.878 1.00 34.05 ? 469 MET B SD  1 
ATOM   913  C CE  . MET B 1 27 ? -13.744 2.594  -30.508 1.00 31.74 ? 469 MET B CE  1 
ATOM   914  N N   . THR B 1 28 ? -9.687  5.078  -26.915 1.00 32.40 ? 470 THR B N   1 
ATOM   915  C CA  . THR B 1 28 ? -9.745  6.511  -26.648 1.00 32.91 ? 470 THR B CA  1 
ATOM   916  C C   . THR B 1 28 ? -11.084 7.079  -27.082 1.00 32.80 ? 470 THR B C   1 
ATOM   917  O O   . THR B 1 28 ? -11.769 6.516  -27.948 1.00 33.43 ? 470 THR B O   1 
ATOM   918  C CB  . THR B 1 28 ? -8.613  7.314  -27.351 1.00 34.52 ? 470 THR B CB  1 
ATOM   919  O OG1 . THR B 1 28 ? -8.752  7.202  -28.770 1.00 36.95 ? 470 THR B OG1 1 
ATOM   920  C CG2 . THR B 1 28 ? -7.209  6.845  -26.915 1.00 34.94 ? 470 THR B CG2 1 
ATOM   921  N N   . ILE B 1 29 ? -11.440 8.211  -26.488 1.00 33.29 ? 471 ILE B N   1 
ATOM   922  C CA  . ILE B 1 29 ? -12.733 8.860  -26.709 1.00 33.15 ? 471 ILE B CA  1 
ATOM   923  C C   . ILE B 1 29 ? -12.882 9.372  -28.127 1.00 33.87 ? 471 ILE B C   1 
ATOM   924  O O   . ILE B 1 29 ? -13.998 9.455  -28.637 1.00 33.76 ? 471 ILE B O   1 
ATOM   925  C CB  . ILE B 1 29 ? -13.020 9.954  -25.623 1.00 33.44 ? 471 ILE B CB  1 
ATOM   926  C CG1 . ILE B 1 29 ? -13.868 9.363  -24.490 1.00 32.77 ? 471 ILE B CG1 1 
ATOM   927  C CG2 . ILE B 1 29 ? -13.760 11.165 -26.192 1.00 34.80 ? 471 ILE B CG2 1 
ATOM   928  C CD1 . ILE B 1 29 ? -13.135 8.450  -23.546 1.00 32.07 ? 471 ILE B CD1 1 
ATOM   929  N N   . GLN B 1 30 ? -11.761 9.684  -28.774 1.00 35.45 ? 472 GLN B N   1 
ATOM   930  C CA  . GLN B 1 30 ? -11.804 10.116 -30.163 1.00 37.27 ? 472 GLN B CA  1 
ATOM   931  C C   . GLN B 1 30 ? -12.129 8.958  -31.096 1.00 37.09 ? 472 GLN B C   1 
ATOM   932  O O   . GLN B 1 30 ? -12.803 9.151  -32.105 1.00 38.15 ? 472 GLN B O   1 
ATOM   933  C CB  . GLN B 1 30 ? -10.522 10.850 -30.594 1.00 39.29 ? 472 GLN B CB  1 
ATOM   934  C CG  . GLN B 1 30 ? -9.269  10.001 -30.693 1.00 41.71 ? 472 GLN B CG  1 
ATOM   935  C CD  . GLN B 1 30 ? -8.230  10.581 -31.649 1.00 47.85 ? 472 GLN B CD  1 
ATOM   936  O OE1 . GLN B 1 30 ? -8.310  11.745 -32.055 1.00 49.51 ? 472 GLN B OE1 1 
ATOM   937  N NE2 . GLN B 1 30 ? -7.243  9.765  -32.007 1.00 49.25 ? 472 GLN B NE2 1 
ATOM   938  N N   . LYS B 1 31 ? -11.667 7.759  -30.743 1.00 36.41 ? 473 LYS B N   1 
ATOM   939  C CA  . LYS B 1 31 ? -11.999 6.558  -31.497 1.00 36.19 ? 473 LYS B CA  1 
ATOM   940  C C   . LYS B 1 31 ? -13.409 6.064  -31.190 1.00 35.14 ? 473 LYS B C   1 
ATOM   941  O O   . LYS B 1 31 ? -14.025 5.436  -32.038 1.00 35.82 ? 473 LYS B O   1 
ATOM   942  C CB  . LYS B 1 31 ? -10.968 5.452  -31.260 1.00 36.24 ? 473 LYS B CB  1 
ATOM   943  C CG  . LYS B 1 31 ? -9.555  5.799  -31.732 1.00 38.08 ? 473 LYS B CG  1 
ATOM   944  C CD  . LYS B 1 31 ? -9.454  5.917  -33.241 1.00 38.99 ? 473 LYS B CD  1 
ATOM   945  C CE  . LYS B 1 31 ? -8.273  6.778  -33.622 1.00 41.55 ? 473 LYS B CE  1 
ATOM   946  N NZ  . LYS B 1 31 ? -8.444  7.319  -34.984 1.00 44.20 ? 473 LYS B NZ  1 
ATOM   947  N N   . VAL B 1 32 ? -13.909 6.337  -29.981 1.00 34.16 ? 474 VAL B N   1 
ATOM   948  C CA  . VAL B 1 32 ? -15.309 6.041  -29.629 1.00 33.05 ? 474 VAL B CA  1 
ATOM   949  C C   . VAL B 1 32 ? -16.228 6.952  -30.454 1.00 33.61 ? 474 VAL B C   1 
ATOM   950  O O   . VAL B 1 32 ? -17.211 6.486  -31.032 1.00 33.68 ? 474 VAL B O   1 
ATOM   951  C CB  . VAL B 1 32 ? -15.612 6.230  -28.101 1.00 31.92 ? 474 VAL B CB  1 
ATOM   952  C CG1 . VAL B 1 32 ? -17.047 5.822  -27.774 1.00 30.65 ? 474 VAL B CG1 1 
ATOM   953  C CG2 . VAL B 1 32 ? -14.656 5.433  -27.242 1.00 31.96 ? 474 VAL B CG2 1 
ATOM   954  N N   . LYS B 1 33 ? -15.892 8.243  -30.503 1.00 34.08 ? 475 LYS B N   1 
ATOM   955  C CA  . LYS B 1 33 ? -16.597 9.223  -31.343 1.00 35.50 ? 475 LYS B CA  1 
ATOM   956  C C   . LYS B 1 33 ? -16.520 8.872  -32.828 1.00 37.38 ? 475 LYS B C   1 
ATOM   957  O O   . LYS B 1 33 ? -17.477 9.101  -33.576 1.00 38.16 ? 475 LYS B O   1 
ATOM   958  C CB  . LYS B 1 33 ? -16.030 10.628 -31.140 1.00 36.09 ? 475 LYS B CB  1 
ATOM   959  C CG  . LYS B 1 33 ? -16.467 11.303 -29.860 1.00 36.11 ? 475 LYS B CG  1 
ATOM   960  C CD  . LYS B 1 33 ? -15.862 12.689 -29.748 1.00 39.23 ? 475 LYS B CD  1 
ATOM   961  C CE  . LYS B 1 33 ? -16.273 13.380 -28.451 1.00 39.10 ? 475 LYS B CE  1 
ATOM   962  N NZ  . LYS B 1 33 ? -15.665 14.743 -28.351 1.00 41.55 ? 475 LYS B NZ  1 
ATOM   963  N N   . GLY B 1 34 ? -15.371 8.332  -33.248 1.00 38.24 ? 476 GLY B N   1 
ATOM   964  C CA  . GLY B 1 34 ? -15.164 7.900  -34.626 1.00 39.95 ? 476 GLY B CA  1 
ATOM   965  C C   . GLY B 1 34 ? -16.137 6.795  -34.987 1.00 40.25 ? 476 GLY B C   1 
ATOM   966  O O   . GLY B 1 34 ? -16.782 6.842  -36.039 1.00 41.83 ? 476 GLY B O   1 
ATOM   967  N N   . LEU B 1 35 ? -16.242 5.809  -34.098 1.00 39.21 ? 477 LEU B N   1 
ATOM   968  C CA  . LEU B 1 35 ? -17.212 4.724  -34.210 1.00 39.47 ? 477 LEU B CA  1 
ATOM   969  C C   . LEU B 1 35 ? -18.649 5.237  -34.340 1.00 39.60 ? 477 LEU B C   1 
ATOM   970  O O   . LEU B 1 35 ? -19.369 4.841  -35.254 1.00 41.00 ? 477 LEU B O   1 
ATOM   971  C CB  . LEU B 1 35 ? -17.088 3.769  -33.012 1.00 38.01 ? 477 LEU B CB  1 
ATOM   972  C CG  . LEU B 1 35 ? -17.808 2.412  -33.110 1.00 39.76 ? 477 LEU B CG  1 
ATOM   973  C CD1 . LEU B 1 35 ? -17.105 1.349  -32.261 1.00 38.97 ? 477 LEU B CD1 1 
ATOM   974  C CD2 . LEU B 1 35 ? -19.300 2.502  -32.750 1.00 38.37 ? 477 LEU B CD2 1 
ATOM   975  N N   . LEU B 1 36 ? -19.053 6.115  -33.428 1.00 38.96 ? 478 LEU B N   1 
ATOM   976  C CA  . LEU B 1 36 ? -20.430 6.624  -33.393 1.00 39.66 ? 478 LEU B CA  1 
ATOM   977  C C   . LEU B 1 36 ? -20.748 7.544  -34.565 1.00 41.70 ? 478 LEU B C   1 
ATOM   978  O O   . LEU B 1 36 ? -21.892 7.600  -35.014 1.00 43.00 ? 478 LEU B O   1 
ATOM   979  C CB  . LEU B 1 36 ? -20.714 7.339  -32.070 1.00 38.47 ? 478 LEU B CB  1 
ATOM   980  C CG  . LEU B 1 36 ? -20.609 6.492  -30.798 1.00 35.96 ? 478 LEU B CG  1 
ATOM   981  C CD1 . LEU B 1 36 ? -20.371 7.395  -29.595 1.00 32.66 ? 478 LEU B CD1 1 
ATOM   982  C CD2 . LEU B 1 36 ? -21.836 5.595  -30.604 1.00 33.02 ? 478 LEU B CD2 1 
ATOM   983  N N   . SER B 1 37 ? -19.729 8.248  -35.058 1.00 42.41 ? 479 SER B N   1 
ATOM   984  C CA  . SER B 1 37 ? -19.868 9.123  -36.217 1.00 44.44 ? 479 SER B CA  1 
ATOM   985  C C   . SER B 1 37 ? -20.309 8.346  -37.459 1.00 46.27 ? 479 SER B C   1 
ATOM   986  O O   . SER B 1 37 ? -21.231 8.763  -38.160 1.00 47.76 ? 479 SER B O   1 
ATOM   987  C CB  . SER B 1 37 ? -18.555 9.862  -36.483 1.00 45.23 ? 479 SER B CB  1 
ATOM   988  O OG  . SER B 1 37 ? -18.658 10.721 -37.602 1.00 46.65 ? 479 SER B OG  1 
ATOM   989  N N   . ARG B 1 38 ? -19.655 7.212  -37.713 1.00 46.38 ? 480 ARG B N   1 
ATOM   990  C CA  . ARG B 1 38 ? -19.980 6.358  -38.858 1.00 48.22 ? 480 ARG B CA  1 
ATOM   991  C C   . ARG B 1 38 ? -21.365 5.730  -38.713 1.00 48.21 ? 480 ARG B C   1 
ATOM   992  O O   . ARG B 1 38 ? -22.064 5.504  -39.703 1.00 50.34 ? 480 ARG B O   1 
ATOM   993  C CB  . ARG B 1 38 ? -18.915 5.271  -39.041 1.00 48.24 ? 480 ARG B CB  1 
ATOM   994  C CG  . ARG B 1 38 ? -17.501 5.810  -39.271 1.00 49.76 ? 480 ARG B CG  1 
ATOM   995  C CD  . ARG B 1 38 ? -16.477 4.698  -39.482 1.00 52.46 ? 480 ARG B CD  1 
ATOM   996  N NE  . ARG B 1 38 ? -16.204 3.932  -38.264 1.00 53.46 ? 480 ARG B NE  1 
ATOM   997  C CZ  . ARG B 1 38 ? -15.273 4.244  -37.357 1.00 54.59 ? 480 ARG B CZ  1 
ATOM   998  N NH1 . ARG B 1 38 ? -14.512 5.327  -37.501 1.00 53.69 ? 480 ARG B NH1 1 
ATOM   999  N NH2 . ARG B 1 38 ? -15.106 3.471  -36.290 1.00 50.76 ? 480 ARG B NH2 1 
ATOM   1000 N N   . LEU B 1 39 ? -21.756 5.467  -37.471 1.00 46.36 ? 481 LEU B N   1 
ATOM   1001 C CA  . LEU B 1 39 ? -23.047 4.869  -37.148 1.00 46.29 ? 481 LEU B CA  1 
ATOM   1002 C C   . LEU B 1 39 ? -24.189 5.883  -37.273 1.00 47.12 ? 481 LEU B C   1 
ATOM   1003 O O   . LEU B 1 39 ? -25.255 5.573  -37.813 1.00 48.76 ? 481 LEU B O   1 
ATOM   1004 C CB  . LEU B 1 39 ? -22.983 4.310  -35.720 1.00 44.46 ? 481 LEU B CB  1 
ATOM   1005 C CG  . LEU B 1 39 ? -24.150 3.542  -35.098 1.00 44.90 ? 481 LEU B CG  1 
ATOM   1006 C CD1 . LEU B 1 39 ? -24.405 2.201  -35.812 1.00 44.81 ? 481 LEU B CD1 1 
ATOM   1007 C CD2 . LEU B 1 39 ? -23.874 3.326  -33.616 1.00 42.15 ? 481 LEU B CD2 1 
ATOM   1008 N N   . LEU B 1 40 ? -23.947 7.098  -36.786 1.00 46.46 ? 482 LEU B N   1 
ATOM   1009 C CA  . LEU B 1 40 ? -24.976 8.123  -36.669 1.00 46.95 ? 482 LEU B CA  1 
ATOM   1010 C C   . LEU B 1 40 ? -25.021 9.097  -37.838 1.00 49.26 ? 482 LEU B C   1 
ATOM   1011 O O   . LEU B 1 40 ? -25.986 9.858  -37.971 1.00 50.48 ? 482 LEU B O   1 
ATOM   1012 C CB  . LEU B 1 40 ? -24.775 8.916  -35.378 1.00 45.21 ? 482 LEU B CB  1 
ATOM   1013 C CG  . LEU B 1 40 ? -25.121 8.237  -34.058 1.00 42.93 ? 482 LEU B CG  1 
ATOM   1014 C CD1 . LEU B 1 40 ? -24.745 9.163  -32.898 1.00 40.51 ? 482 LEU B CD1 1 
ATOM   1015 C CD2 . LEU B 1 40 ? -26.592 7.872  -34.005 1.00 42.40 ? 482 LEU B CD2 1 
ATOM   1016 N N   . LYS B 1 41 ? -23.980 9.067  -38.672 1.00 50.05 ? 483 LYS B N   1 
ATOM   1017 C CA  . LYS B 1 41 ? -23.776 10.047 -39.757 1.00 52.52 ? 483 LYS B CA  1 
ATOM   1018 C C   . LYS B 1 41 ? -23.732 11.486 -39.230 1.00 52.65 ? 483 LYS B C   1 
ATOM   1019 O O   . LYS B 1 41 ? -24.372 12.390 -39.775 1.00 54.98 ? 483 LYS B O   1 
ATOM   1020 C CB  . LYS B 1 41 ? -24.814 9.892  -40.884 1.00 54.77 ? 483 LYS B CB  1 
ATOM   1021 C CG  . LYS B 1 41 ? -24.976 8.467  -41.422 1.00 56.30 ? 483 LYS B CG  1 
ATOM   1022 C CD  . LYS B 1 41 ? -23.654 7.825  -41.832 1.00 58.32 ? 483 LYS B CD  1 
ATOM   1023 C CE  . LYS B 1 41 ? -23.866 6.361  -42.195 1.00 61.56 ? 483 LYS B CE  1 
ATOM   1024 N NZ  . LYS B 1 41 ? -22.598 5.641  -42.501 1.00 60.95 ? 483 LYS B NZ  1 
ATOM   1025 N N   . VAL B 1 42 ? -22.966 11.677 -38.162 1.00 50.44 ? 484 VAL B N   1 
ATOM   1026 C CA  . VAL B 1 42 ? -22.779 12.983 -37.540 1.00 50.69 ? 484 VAL B CA  1 
ATOM   1027 C C   . VAL B 1 42 ? -21.275 13.180 -37.323 1.00 50.10 ? 484 VAL B C   1 
ATOM   1028 O O   . VAL B 1 42 ? -20.621 12.293 -36.774 1.00 48.37 ? 484 VAL B O   1 
ATOM   1029 C CB  . VAL B 1 42 ? -23.552 13.066 -36.202 1.00 48.93 ? 484 VAL B CB  1 
ATOM   1030 C CG1 . VAL B 1 42 ? -23.083 14.243 -35.353 1.00 49.12 ? 484 VAL B CG1 1 
ATOM   1031 C CG2 . VAL B 1 42 ? -25.049 13.150 -36.460 1.00 50.26 ? 484 VAL B CG2 1 
ATOM   1032 N N   . PRO B 1 43 ? -20.718 14.330 -37.765 1.00 51.95 ? 485 PRO B N   1 
ATOM   1033 C CA  . PRO B 1 43 ? -19.270 14.583 -37.644 1.00 51.95 ? 485 PRO B CA  1 
ATOM   1034 C C   . PRO B 1 43 ? -18.714 14.399 -36.221 1.00 49.57 ? 485 PRO B C   1 
ATOM   1035 O O   . PRO B 1 43 ? -19.422 14.643 -35.243 1.00 48.40 ? 485 PRO B O   1 
ATOM   1036 C CB  . PRO B 1 43 ? -19.131 16.044 -38.100 1.00 54.69 ? 485 PRO B CB  1 
ATOM   1037 C CG  . PRO B 1 43 ? -20.299 16.267 -39.003 1.00 56.10 ? 485 PRO B CG  1 
ATOM   1038 C CD  . PRO B 1 43 ? -21.416 15.449 -38.432 1.00 54.53 ? 485 PRO B CD  1 
ATOM   1039 N N   . VAL B 1 44 ? -17.455 13.964 -36.129 1.00 49.22 ? 486 VAL B N   1 
ATOM   1040 C CA  . VAL B 1 44 ? -16.788 13.684 -34.851 1.00 47.47 ? 486 VAL B CA  1 
ATOM   1041 C C   . VAL B 1 44 ? -16.782 14.914 -33.939 1.00 48.10 ? 486 VAL B C   1 
ATOM   1042 O O   . VAL B 1 44 ? -16.916 14.801 -32.711 1.00 46.64 ? 486 VAL B O   1 
ATOM   1043 C CB  . VAL B 1 44 ? -15.335 13.152 -35.076 1.00 47.65 ? 486 VAL B CB  1 
ATOM   1044 C CG1 . VAL B 1 44 ? -14.455 13.338 -33.830 1.00 47.19 ? 486 VAL B CG1 1 
ATOM   1045 C CG2 . VAL B 1 44 ? -15.359 11.688 -35.482 1.00 46.84 ? 486 VAL B CG2 1 
ATOM   1046 N N   . SER B 1 45 ? -16.651 16.085 -34.556 1.00 50.32 ? 487 SER B N   1 
ATOM   1047 C CA  . SER B 1 45 ? -16.592 17.343 -33.830 1.00 51.30 ? 487 SER B CA  1 
ATOM   1048 C C   . SER B 1 45 ? -17.937 17.770 -33.225 1.00 51.17 ? 487 SER B C   1 
ATOM   1049 O O   . SER B 1 45 ? -17.962 18.590 -32.301 1.00 52.03 ? 487 SER B O   1 
ATOM   1050 C CB  . SER B 1 45 ? -16.025 18.445 -34.731 1.00 54.59 ? 487 SER B CB  1 
ATOM   1051 O OG  . SER B 1 45 ? -16.796 18.603 -35.910 1.00 55.69 ? 487 SER B OG  1 
ATOM   1052 N N   . ASP B 1 46 ? -19.044 17.217 -33.725 1.00 50.43 ? 488 ASP B N   1 
ATOM   1053 C CA  . ASP B 1 46 ? -20.379 17.579 -33.218 1.00 50.43 ? 488 ASP B CA  1 
ATOM   1054 C C   . ASP B 1 46 ? -20.828 16.748 -32.011 1.00 47.75 ? 488 ASP B C   1 
ATOM   1055 O O   . ASP B 1 46 ? -21.828 17.079 -31.365 1.00 47.97 ? 488 ASP B O   1 
ATOM   1056 C CB  . ASP B 1 46 ? -21.441 17.512 -34.328 1.00 51.86 ? 488 ASP B CB  1 
ATOM   1057 C CG  . ASP B 1 46 ? -21.331 18.659 -35.332 1.00 56.20 ? 488 ASP B CG  1 
ATOM   1058 O OD1 . ASP B 1 46 ? -20.332 19.411 -35.304 1.00 57.17 ? 488 ASP B OD1 1 
ATOM   1059 O OD2 . ASP B 1 46 ? -22.255 18.809 -36.164 1.00 61.23 ? 488 ASP B OD2 1 
ATOM   1060 N N   . LEU B 1 47 ? -20.081 15.685 -31.705 1.00 45.35 ? 489 LEU B N   1 
ATOM   1061 C CA  . LEU B 1 47 ? -20.461 14.737 -30.658 1.00 42.73 ? 489 LEU B CA  1 
ATOM   1062 C C   . LEU B 1 47 ? -19.945 15.135 -29.278 1.00 41.91 ? 489 LEU B C   1 
ATOM   1063 O O   . LEU B 1 47 ? -18.784 15.525 -29.124 1.00 42.18 ? 489 LEU B O   1 
ATOM   1064 C CB  . LEU B 1 47 ? -19.982 13.313 -30.992 1.00 41.36 ? 489 LEU B CB  1 
ATOM   1065 C CG  . LEU B 1 47 ? -20.426 12.578 -32.262 1.00 40.79 ? 489 LEU B CG  1 
ATOM   1066 C CD1 . LEU B 1 47 ? -19.641 11.282 -32.395 1.00 36.94 ? 489 LEU B CD1 1 
ATOM   1067 C CD2 . LEU B 1 47 ? -21.914 12.288 -32.261 1.00 37.69 ? 489 LEU B CD2 1 
ATOM   1068 N N   . LEU B 1 48 ? -20.827 15.030 -28.287 1.00 41.01 ? 490 LEU B N   1 
ATOM   1069 C CA  . LEU B 1 48 ? -20.490 15.250 -26.890 1.00 40.20 ? 490 LEU B CA  1 
ATOM   1070 C C   . LEU B 1 48 ? -20.759 13.947 -26.138 1.00 38.26 ? 490 LEU B C   1 
ATOM   1071 O O   . LEU B 1 48 ? -21.889 13.455 -26.115 1.00 37.74 ? 490 LEU B O   1 
ATOM   1072 C CB  . LEU B 1 48 ? -21.329 16.396 -26.304 1.00 41.93 ? 490 LEU B CB  1 
ATOM   1073 C CG  . LEU B 1 48 ? -21.418 17.720 -27.087 0.50 45.26 ? 490 LEU B CG  1 
ATOM   1074 C CD1 . LEU B 1 48 ? -22.618 18.542 -26.640 0.50 48.03 ? 490 LEU B CD1 1 
ATOM   1075 C CD2 . LEU B 1 48 ? -20.136 18.534 -26.977 0.50 47.71 ? 490 LEU B CD2 1 
ATOM   1076 N N   . LEU B 1 49 ? -19.713 13.389 -25.535 1.00 37.23 ? 491 LEU B N   1 
ATOM   1077 C CA  . LEU B 1 49 ? -19.817 12.111 -24.837 1.00 35.88 ? 491 LEU B CA  1 
ATOM   1078 C C   . LEU B 1 49 ? -19.739 12.269 -23.321 1.00 35.68 ? 491 LEU B C   1 
ATOM   1079 O O   . LEU B 1 49 ? -18.978 13.099 -22.802 1.00 36.24 ? 491 LEU B O   1 
ATOM   1080 C CB  . LEU B 1 49 ? -18.738 11.128 -25.316 1.00 34.95 ? 491 LEU B CB  1 
ATOM   1081 C CG  . LEU B 1 49 ? -18.719 10.652 -26.773 1.00 36.79 ? 491 LEU B CG  1 
ATOM   1082 C CD1 . LEU B 1 49 ? -17.859 9.395  -26.893 1.00 35.78 ? 491 LEU B CD1 1 
ATOM   1083 C CD2 . LEU B 1 49 ? -20.118 10.372 -27.318 1.00 37.81 ? 491 LEU B CD2 1 
ATOM   1084 N N   . SER B 1 50 ? -20.539 11.461 -22.628 1.00 34.76 ? 492 SER B N   1 
ATOM   1085 C CA  . SER B 1 50 ? -20.530 11.385 -21.175 1.00 35.16 ? 492 SER B CA  1 
ATOM   1086 C C   . SER B 1 50 ? -20.972 9.977  -20.759 1.00 34.72 ? 492 SER B C   1 
ATOM   1087 O O   . SER B 1 50 ? -21.400 9.191  -21.603 1.00 34.24 ? 492 SER B O   1 
ATOM   1088 C CB  . SER B 1 50 ? -21.444 12.448 -20.567 1.00 35.74 ? 492 SER B CB  1 
ATOM   1089 O OG  . SER B 1 50 ? -22.800 12.076 -20.705 1.00 36.02 ? 492 SER B OG  1 
ATOM   1090 N N   . TYR B 1 51 ? -20.861 9.653  -19.473 1.00 35.13 ? 493 TYR B N   1 
ATOM   1091 C CA  . TYR B 1 51 ? -21.295 8.332  -19.008 1.00 35.41 ? 493 TYR B CA  1 
ATOM   1092 C C   . TYR B 1 51 ? -21.897 8.317  -17.606 1.00 37.03 ? 493 TYR B C   1 
ATOM   1093 O O   . TYR B 1 51 ? -21.648 9.221  -16.797 1.00 37.88 ? 493 TYR B O   1 
ATOM   1094 C CB  . TYR B 1 51 ? -20.171 7.289  -19.149 1.00 34.71 ? 493 TYR B CB  1 
ATOM   1095 C CG  . TYR B 1 51 ? -19.196 7.173  -17.988 1.00 33.82 ? 493 TYR B CG  1 
ATOM   1096 C CD1 . TYR B 1 51 ? -19.338 6.159  -17.026 1.00 30.91 ? 493 TYR B CD1 1 
ATOM   1097 C CD2 . TYR B 1 51 ? -18.113 8.050  -17.866 1.00 30.32 ? 493 TYR B CD2 1 
ATOM   1098 C CE1 . TYR B 1 51 ? -18.440 6.041  -15.964 1.00 27.38 ? 493 TYR B CE1 1 
ATOM   1099 C CE2 . TYR B 1 51 ? -17.203 7.936  -16.805 1.00 28.45 ? 493 TYR B CE2 1 
ATOM   1100 C CZ  . TYR B 1 51 ? -17.374 6.932  -15.864 1.00 28.86 ? 493 TYR B CZ  1 
ATOM   1101 O OH  . TYR B 1 51 ? -16.469 6.812  -14.833 1.00 29.46 ? 493 TYR B OH  1 
ATOM   1102 N N   . GLU B 1 52 ? -22.720 7.303  -17.344 1.00 38.03 ? 494 GLU B N   1 
ATOM   1103 C CA  . GLU B 1 52 ? -23.218 7.046  -15.995 1.00 39.85 ? 494 GLU B CA  1 
ATOM   1104 C C   . GLU B 1 52 ? -23.082 5.584  -15.573 1.00 40.38 ? 494 GLU B C   1 
ATOM   1105 O O   . GLU B 1 52 ? -23.230 4.665  -16.384 1.00 39.93 ? 494 GLU B O   1 
ATOM   1106 C CB  . GLU B 1 52 ? -24.656 7.535  -15.828 1.00 40.99 ? 494 GLU B CB  1 
ATOM   1107 C CG  . GLU B 1 52 ? -25.615 7.063  -16.901 1.00 42.64 ? 494 GLU B CG  1 
ATOM   1108 C CD  . GLU B 1 52 ? -26.947 7.792  -16.863 1.00 48.16 ? 494 GLU B CD  1 
ATOM   1109 O OE1 . GLU B 1 52 ? -26.947 9.037  -16.749 0.50 49.50 ? 494 GLU B OE1 1 
ATOM   1110 O OE2 . GLU B 1 52 ? -27.996 7.118  -16.961 0.50 51.25 ? 494 GLU B OE2 1 
ATOM   1111 N N   . SER B 1 53 ? -22.794 5.393  -14.290 1.00 41.73 ? 495 SER B N   1 
ATOM   1112 C CA  . SER B 1 53 ? -22.636 4.082  -13.694 1.00 42.75 ? 495 SER B CA  1 
ATOM   1113 C C   . SER B 1 53 ? -23.791 3.823  -12.728 1.00 45.24 ? 495 SER B C   1 
ATOM   1114 O O   . SER B 1 53 ? -24.226 4.745  -12.024 1.00 45.57 ? 495 SER B O   1 
ATOM   1115 C CB  . SER B 1 53 ? -21.302 4.020  -12.956 1.00 42.87 ? 495 SER B CB  1 
ATOM   1116 O OG  . SER B 1 53 ? -21.208 2.872  -12.139 1.00 43.64 ? 495 SER B OG  1 
ATOM   1117 N N   . PRO B 1 54 ? -24.303 2.572  -12.703 1.00 46.90 ? 496 PRO B N   1 
ATOM   1118 C CA  . PRO B 1 54 ? -25.299 2.148  -11.709 1.00 49.51 ? 496 PRO B CA  1 
ATOM   1119 C C   . PRO B 1 54 ? -24.796 2.305  -10.273 1.00 51.30 ? 496 PRO B C   1 
ATOM   1120 O O   . PRO B 1 54 ? -25.599 2.441  -9.343  1.00 53.45 ? 496 PRO B O   1 
ATOM   1121 C CB  . PRO B 1 54 ? -25.511 0.667  -12.038 1.00 50.26 ? 496 PRO B CB  1 
ATOM   1122 C CG  . PRO B 1 54 ? -25.192 0.559  -13.485 1.00 48.48 ? 496 PRO B CG  1 
ATOM   1123 C CD  . PRO B 1 54 ? -24.075 1.530  -13.724 1.00 46.28 ? 496 PRO B CD  1 
ATOM   1124 N N   . LYS B 1 55 ? -23.476 2.289  -10.105 1.00 51.09 ? 497 LYS B N   1 
ATOM   1125 C CA  . LYS B 1 55 ? -22.843 2.510  -8.805  1.00 52.72 ? 497 LYS B CA  1 
ATOM   1126 C C   . LYS B 1 55 ? -23.094 3.920  -8.286  1.00 53.15 ? 497 LYS B C   1 
ATOM   1127 O O   . LYS B 1 55 ? -23.382 4.088  -7.104  1.00 55.53 ? 497 LYS B O   1 
ATOM   1128 C CB  . LYS B 1 55 ? -21.340 2.245  -8.873  1.00 52.21 ? 497 LYS B CB  1 
ATOM   1129 C CG  . LYS B 1 55 ? -20.963 0.822  -9.255  1.00 53.23 ? 497 LYS B CG  1 
ATOM   1130 C CD  . LYS B 1 55 ? -19.472 0.621  -9.060  1.00 56.29 ? 497 LYS B CD  1 
ATOM   1131 C CE  . LYS B 1 55 ? -19.082 -0.839 -9.178  1.00 58.47 ? 497 LYS B CE  1 
ATOM   1132 N NZ  . LYS B 1 55 ? -17.650 -1.023 -8.809  0.84 58.60 ? 497 LYS B NZ  1 
ATOM   1133 N N   . LYS B 1 56 ? -22.982 4.923  -9.161  1.00 51.42 ? 498 LYS B N   1 
ATOM   1134 C CA  . LYS B 1 56 ? -23.352 6.304  -8.808  1.00 51.91 ? 498 LYS B CA  1 
ATOM   1135 C C   . LYS B 1 56 ? -24.451 6.874  -9.690  1.00 51.16 ? 498 LYS B C   1 
ATOM   1136 O O   . LYS B 1 56 ? -24.166 7.592  -10.657 1.00 50.21 ? 498 LYS B O   1 
ATOM   1137 C CB  . LYS B 1 56 ? -22.144 7.254  -8.763  1.00 51.62 ? 498 LYS B CB  1 
ATOM   1138 C CG  . LYS B 1 56 ? -20.921 6.810  -9.515  0.50 49.62 ? 498 LYS B CG  1 
ATOM   1139 C CD  . LYS B 1 56 ? -19.733 7.622  -9.057  0.50 49.43 ? 498 LYS B CD  1 
ATOM   1140 C CE  . LYS B 1 56 ? -18.452 6.893  -9.362  0.50 47.75 ? 498 LYS B CE  1 
ATOM   1141 N NZ  . LYS B 1 56 ? -18.520 6.330  -10.725 0.50 44.18 ? 498 LYS B NZ  1 
ATOM   1142 N N   . PRO B 1 57 ? -25.715 6.585  -9.335  1.00 52.05 ? 499 PRO B N   1 
ATOM   1143 C CA  . PRO B 1 57 ? -26.844 6.896  -10.206 1.00 51.37 ? 499 PRO B CA  1 
ATOM   1144 C C   . PRO B 1 57 ? -27.122 8.395  -10.289 1.00 51.32 ? 499 PRO B C   1 
ATOM   1145 O O   . PRO B 1 57 ? -26.970 9.114  -9.294  1.00 52.56 ? 499 PRO B O   1 
ATOM   1146 C CB  . PRO B 1 57 ? -28.022 6.156  -9.548  1.00 53.28 ? 499 PRO B CB  1 
ATOM   1147 C CG  . PRO B 1 57 ? -27.472 5.483  -8.307  1.00 54.70 ? 499 PRO B CG  1 
ATOM   1148 C CD  . PRO B 1 57 ? -26.158 6.110  -8.013  1.00 54.37 ? 499 PRO B CD  1 
ATOM   1149 N N   . GLY B 1 58 ? -27.501 8.852  -11.481 1.00 49.89 ? 500 GLY B N   1 
ATOM   1150 C CA  . GLY B 1 58 ? -27.901 10.240 -11.704 1.00 50.54 ? 500 GLY B CA  1 
ATOM   1151 C C   . GLY B 1 58 ? -26.774 11.249 -11.815 1.00 49.79 ? 500 GLY B C   1 
ATOM   1152 O O   . GLY B 1 58 ? -26.998 12.456 -11.710 1.00 51.10 ? 500 GLY B O   1 
ATOM   1153 N N   . ARG B 1 59 ? -25.557 10.761 -12.011 1.00 47.97 ? 501 ARG B N   1 
ATOM   1154 C CA  . ARG B 1 59 ? -24.453 11.641 -12.309 1.00 47.45 ? 501 ARG B CA  1 
ATOM   1155 C C   . ARG B 1 59 ? -23.933 11.343 -13.704 1.00 45.18 ? 501 ARG B C   1 
ATOM   1156 O O   . ARG B 1 59 ? -23.585 10.204 -14.017 1.00 44.25 ? 501 ARG B O   1 
ATOM   1157 C CB  . ARG B 1 59 ? -23.337 11.517 -11.264 1.00 47.93 ? 501 ARG B CB  1 
ATOM   1158 C CG  . ARG B 1 59 ? -22.438 12.737 -11.220 1.00 49.96 ? 501 ARG B CG  1 
ATOM   1159 C CD  . ARG B 1 59 ? -21.546 12.757 -9.994  1.00 55.37 ? 501 ARG B CD  1 
ATOM   1160 N NE  . ARG B 1 59 ? -20.295 12.036 -10.209 1.00 58.23 ? 501 ARG B NE  1 
ATOM   1161 C CZ  . ARG B 1 59 ? -19.217 12.540 -10.811 1.00 58.30 ? 501 ARG B CZ  1 
ATOM   1162 N NH1 . ARG B 1 59 ? -19.211 13.784 -11.283 1.00 61.37 ? 501 ARG B NH1 1 
ATOM   1163 N NH2 . ARG B 1 59 ? -18.136 11.791 -10.941 1.00 55.61 ? 501 ARG B NH2 1 
ATOM   1164 N N   . GLU B 1 60 ? -23.911 12.368 -14.547 1.00 44.86 ? 502 GLU B N   1 
ATOM   1165 C CA  . GLU B 1 60 ? -23.250 12.273 -15.837 1.00 43.50 ? 502 GLU B CA  1 
ATOM   1166 C C   . GLU B 1 60 ? -21.812 12.724 -15.691 1.00 43.04 ? 502 GLU B C   1 
ATOM   1167 O O   . GLU B 1 60 ? -21.546 13.876 -15.355 1.00 44.19 ? 502 GLU B O   1 
ATOM   1168 C CB  . GLU B 1 60 ? -23.960 13.122 -16.892 1.00 43.92 ? 502 GLU B CB  1 
ATOM   1169 C CG  . GLU B 1 60 ? -25.216 12.490 -17.454 1.00 45.33 ? 502 GLU B CG  1 
ATOM   1170 C CD  . GLU B 1 60 ? -25.685 13.147 -18.747 1.00 49.02 ? 502 GLU B CD  1 
ATOM   1171 O OE1 . GLU B 1 60 ? -24.832 13.443 -19.622 1.00 48.11 ? 502 GLU B OE1 1 
ATOM   1172 O OE2 . GLU B 1 60 ? -26.913 13.352 -18.890 1.00 49.06 ? 502 GLU B OE2 1 
ATOM   1173 N N   . ILE B 1 61 ? -20.887 11.801 -15.923 1.00 42.02 ? 503 ILE B N   1 
ATOM   1174 C CA  . ILE B 1 61 ? -19.467 12.132 -15.964 1.00 41.97 ? 503 ILE B CA  1 
ATOM   1175 C C   . ILE B 1 61 ? -19.091 12.515 -17.399 1.00 41.40 ? 503 ILE B C   1 
ATOM   1176 O O   . ILE B 1 61 ? -19.223 11.706 -18.324 1.00 40.20 ? 503 ILE B O   1 
ATOM   1177 C CB  . ILE B 1 61 ? -18.567 10.963 -15.457 1.00 41.23 ? 503 ILE B CB  1 
ATOM   1178 C CG1 . ILE B 1 61 ? -18.783 10.691 -13.966 1.00 42.59 ? 503 ILE B CG1 1 
ATOM   1179 C CG2 . ILE B 1 61 ? -17.084 11.259 -15.704 1.00 41.73 ? 503 ILE B CG2 1 
ATOM   1180 C CD1 . ILE B 1 61 ? -19.742 9.550  -13.660 1.00 43.45 ? 503 ILE B CD1 1 
ATOM   1181 N N   . GLU B 1 62 ? -18.633 13.750 -17.571 1.00 42.60 ? 504 GLU B N   1 
ATOM   1182 C CA  . GLU B 1 62 ? -18.155 14.234 -18.866 1.00 43.03 ? 504 GLU B CA  1 
ATOM   1183 C C   . GLU B 1 62 ? -16.914 13.467 -19.324 1.00 42.23 ? 504 GLU B C   1 
ATOM   1184 O O   . GLU B 1 62 ? -16.072 13.091 -18.511 1.00 42.85 ? 504 GLU B O   1 
ATOM   1185 C CB  . GLU B 1 62 ? -17.857 15.737 -18.809 1.00 44.52 ? 504 GLU B CB  1 
ATOM   1186 C CG  . GLU B 1 62 ? -19.087 16.614 -18.585 0.50 46.81 ? 504 GLU B CG  1 
ATOM   1187 C CD  . GLU B 1 62 ? -18.731 18.030 -18.150 0.50 52.96 ? 504 GLU B CD  1 
ATOM   1188 O OE1 . GLU B 1 62 ? -17.724 18.581 -18.650 0.50 53.90 ? 504 GLU B OE1 1 
ATOM   1189 O OE2 . GLU B 1 62 ? -19.462 18.597 -17.306 0.50 55.49 ? 504 GLU B OE2 1 
ATOM   1190 N N   . LEU B 1 63 ? -16.829 13.226 -20.627 1.00 41.73 ? 505 LEU B N   1 
ATOM   1191 C CA  . LEU B 1 63 ? -15.659 12.616 -21.254 1.00 41.24 ? 505 LEU B CA  1 
ATOM   1192 C C   . LEU B 1 63 ? -15.107 13.623 -22.263 1.00 42.50 ? 505 LEU B C   1 
ATOM   1193 O O   . LEU B 1 63 ? -15.318 13.482 -23.473 1.00 42.46 ? 505 LEU B O   1 
ATOM   1194 C CB  . LEU B 1 63 ? -16.038 11.287 -21.938 1.00 39.76 ? 505 LEU B CB  1 
ATOM   1195 C CG  . LEU B 1 63 ? -16.652 10.158 -21.092 1.00 38.67 ? 505 LEU B CG  1 
ATOM   1196 C CD1 . LEU B 1 63 ? -17.193 9.012  -21.969 1.00 38.45 ? 505 LEU B CD1 1 
ATOM   1197 C CD2 . LEU B 1 63 ? -15.649 9.614  -20.089 1.00 37.10 ? 505 LEU B CD2 1 
ATOM   1198 N N   . GLU B 1 64 ? -14.420 14.646 -21.745 1.00 44.09 ? 506 GLU B N   1 
ATOM   1199 C CA  . GLU B 1 64 ? -14.037 15.832 -22.521 1.00 45.97 ? 506 GLU B CA  1 
ATOM   1200 C C   . GLU B 1 64 ? -12.740 15.689 -23.334 1.00 46.39 ? 506 GLU B C   1 
ATOM   1201 O O   . GLU B 1 64 ? -12.645 16.230 -24.439 1.00 47.69 ? 506 GLU B O   1 
ATOM   1202 C CB  . GLU B 1 64 ? -13.959 17.079 -21.620 1.00 47.93 ? 506 GLU B CB  1 
ATOM   1203 C CG  . GLU B 1 64 ? -14.179 18.398 -22.382 0.50 50.98 ? 506 GLU B CG  1 
ATOM   1204 C CD  . GLU B 1 64 ? -13.835 19.645 -21.575 0.50 55.42 ? 506 GLU B CD  1 
ATOM   1205 O OE1 . GLU B 1 64 ? -14.627 20.613 -21.605 0.50 56.87 ? 506 GLU B OE1 1 
ATOM   1206 O OE2 . GLU B 1 64 ? -12.774 19.669 -20.918 0.50 56.23 ? 506 GLU B OE2 1 
ATOM   1207 N N   . ASN B 1 65 ? -11.748 14.985 -22.786 1.00 45.46 ? 507 ASN B N   1 
ATOM   1208 C CA  . ASN B 1 65 ? -10.454 14.819 -23.454 1.00 45.71 ? 507 ASN B CA  1 
ATOM   1209 C C   . ASN B 1 65 ? -10.488 13.663 -24.450 1.00 44.14 ? 507 ASN B C   1 
ATOM   1210 O O   . ASN B 1 65 ? -10.566 12.500 -24.048 1.00 42.79 ? 507 ASN B O   1 
ATOM   1211 C CB  . ASN B 1 65 ? -9.334  14.609 -22.422 1.00 46.12 ? 507 ASN B CB  1 
ATOM   1212 C CG  . ASN B 1 65 ? -7.936  14.828 -22.993 1.00 47.73 ? 507 ASN B CG  1 
ATOM   1213 O OD1 . ASN B 1 65 ? -7.696  14.685 -24.193 1.00 48.66 ? 507 ASN B OD1 1 
ATOM   1214 N ND2 . ASN B 1 65 ? -6.997  15.167 -22.116 1.00 50.37 ? 507 ASN B ND2 1 
ATOM   1215 N N   . ASP B 1 66 ? -10.412 13.999 -25.740 1.00 44.45 ? 508 ASP B N   1 
ATOM   1216 C CA  . ASP B 1 66 ? -10.440 13.023 -26.839 1.00 43.73 ? 508 ASP B CA  1 
ATOM   1217 C C   . ASP B 1 66 ? -9.325  11.967 -26.778 1.00 42.80 ? 508 ASP B C   1 
ATOM   1218 O O   . ASP B 1 66 ? -9.496  10.851 -27.285 1.00 41.96 ? 508 ASP B O   1 
ATOM   1219 C CB  . ASP B 1 66 ? -10.367 13.738 -28.204 1.00 45.57 ? 508 ASP B CB  1 
ATOM   1220 C CG  . ASP B 1 66 ? -11.633 14.520 -28.545 1.00 48.15 ? 508 ASP B CG  1 
ATOM   1221 O OD1 . ASP B 1 66 ? -12.587 14.533 -27.740 1.00 50.06 ? 508 ASP B OD1 1 
ATOM   1222 O OD2 . ASP B 1 66 ? -11.670 15.132 -29.639 1.00 54.50 ? 508 ASP B OD2 1 
ATOM   1223 N N   . LEU B 1 67 ? -8.194  12.319 -26.166 1.00 42.86 ? 509 LEU B N   1 
ATOM   1224 C CA  . LEU B 1 67 ? -6.991  11.472 -26.200 1.00 42.39 ? 509 LEU B CA  1 
ATOM   1225 C C   . LEU B 1 67 ? -6.891  10.445 -25.066 1.00 40.66 ? 509 LEU B C   1 
ATOM   1226 O O   . LEU B 1 67 ? -5.953  9.645  -25.027 1.00 41.12 ? 509 LEU B O   1 
ATOM   1227 C CB  . LEU B 1 67 ? -5.729  12.343 -26.256 1.00 44.60 ? 509 LEU B CB  1 
ATOM   1228 C CG  . LEU B 1 67 ? -5.521  13.145 -27.547 1.00 46.89 ? 509 LEU B CG  1 
ATOM   1229 C CD1 . LEU B 1 67 ? -4.259  14.003 -27.471 1.00 50.04 ? 509 LEU B CD1 1 
ATOM   1230 C CD2 . LEU B 1 67 ? -5.486  12.237 -28.788 1.00 48.21 ? 509 LEU B CD2 1 
ATOM   1231 N N   . LYS B 1 68 ? -7.869  10.469 -24.162 1.00 38.74 ? 510 LYS B N   1 
ATOM   1232 C CA  . LYS B 1 68 ? -7.905  9.578  -23.004 1.00 37.13 ? 510 LYS B CA  1 
ATOM   1233 C C   . LYS B 1 68 ? -8.816  8.360  -23.223 1.00 35.28 ? 510 LYS B C   1 
ATOM   1234 O O   . LYS B 1 68 ? -9.819  8.437  -23.934 1.00 33.91 ? 510 LYS B O   1 
ATOM   1235 C CB  . LYS B 1 68 ? -8.342  10.355 -21.760 1.00 37.13 ? 510 LYS B CB  1 
ATOM   1236 C CG  . LYS B 1 68 ? -7.405  11.500 -21.330 1.00 39.17 ? 510 LYS B CG  1 
ATOM   1237 C CD  . LYS B 1 68 ? -6.002  11.009 -20.961 1.00 43.09 ? 510 LYS B CD  1 
ATOM   1238 C CE  . LYS B 1 68 ? -5.213  12.084 -20.219 1.00 46.91 ? 510 LYS B CE  1 
ATOM   1239 N NZ  . LYS B 1 68 ? -3.742  11.853 -20.317 1.00 48.57 ? 510 LYS B NZ  1 
ATOM   1240 N N   . SER B 1 69 ? -8.452  7.238  -22.607 1.00 34.90 ? 511 SER B N   1 
ATOM   1241 C CA  . SER B 1 69 ? -9.199  5.991  -22.756 1.00 33.65 ? 511 SER B CA  1 
ATOM   1242 C C   . SER B 1 69 ? -10.464 5.946  -21.900 1.00 32.39 ? 511 SER B C   1 
ATOM   1243 O O   . SER B 1 69 ? -10.666 6.795  -21.029 1.00 32.62 ? 511 SER B O   1 
ATOM   1244 C CB  . SER B 1 69 ? -8.309  4.803  -22.405 1.00 34.18 ? 511 SER B CB  1 
ATOM   1245 O OG  . SER B 1 69 ? -7.991  4.800  -21.023 1.00 35.51 ? 511 SER B OG  1 
ATOM   1246 N N   . LEU B 1 70 ? -11.309 4.949  -22.160 1.00 31.34 ? 512 LEU B N   1 
ATOM   1247 C CA  . LEU B 1 70 ? -12.445 4.631  -21.297 1.00 30.34 ? 512 LEU B CA  1 
ATOM   1248 C C   . LEU B 1 70 ? -11.992 4.237  -19.886 1.00 31.06 ? 512 LEU B C   1 
ATOM   1249 O O   . LEU B 1 70 ? -12.587 4.696  -18.911 1.00 31.04 ? 512 LEU B O   1 
ATOM   1250 C CB  . LEU B 1 70 ? -13.320 3.535  -21.935 1.00 30.13 ? 512 LEU B CB  1 
ATOM   1251 C CG  . LEU B 1 70 ? -13.984 3.877  -23.284 1.00 27.88 ? 512 LEU B CG  1 
ATOM   1252 C CD1 . LEU B 1 70 ? -14.480 2.639  -24.014 1.00 25.58 ? 512 LEU B CD1 1 
ATOM   1253 C CD2 . LEU B 1 70 ? -15.121 4.903  -23.129 1.00 27.81 ? 512 LEU B CD2 1 
ATOM   1254 N N   . GLN B 1 71 ? -10.939 3.409  -19.795 1.00 31.84 ? 513 GLN B N   1 
ATOM   1255 C CA  A GLN B 1 71 ? -10.351 3.004  -18.519 0.60 32.79 ? 513 GLN B CA  1 
ATOM   1256 C CA  B GLN B 1 71 ? -10.346 2.992  -18.517 0.40 32.88 ? 513 GLN B CA  1 
ATOM   1257 C C   . GLN B 1 71 ? -9.908  4.193  -17.688 1.00 33.38 ? 513 GLN B C   1 
ATOM   1258 O O   . GLN B 1 71 ? -10.074 4.205  -16.461 1.00 33.92 ? 513 GLN B O   1 
ATOM   1259 C CB  A GLN B 1 71 ? -9.117  2.145  -18.757 0.60 33.94 ? 513 GLN B CB  1 
ATOM   1260 C CB  B GLN B 1 71 ? -9.107  2.109  -18.732 0.40 34.07 ? 513 GLN B CB  1 
ATOM   1261 C CG  A GLN B 1 71 ? -9.391  0.679  -18.912 0.60 35.16 ? 513 GLN B CG  1 
ATOM   1262 C CG  B GLN B 1 71 ? -9.354  0.692  -19.223 0.40 35.26 ? 513 GLN B CG  1 
ATOM   1263 C CD  A GLN B 1 71 ? -8.274  -0.030 -19.632 0.60 34.22 ? 513 GLN B CD  1 
ATOM   1264 C CD  B GLN B 1 71 ? -10.469 -0.020 -18.488 0.40 34.83 ? 513 GLN B CD  1 
ATOM   1265 O OE1 A GLN B 1 71 ? -7.230  0.560  -19.927 0.60 33.04 ? 513 GLN B OE1 1 
ATOM   1266 O OE1 B GLN B 1 71 ? -10.608 -1.238 -18.592 0.40 34.53 ? 513 GLN B OE1 1 
ATOM   1267 N NE2 A GLN B 1 71 ? -8.487  -1.302 -19.928 0.60 35.77 ? 513 GLN B NE2 1 
ATOM   1268 N NE2 B GLN B 1 71 ? -11.272 0.734  -17.745 0.40 34.41 ? 513 GLN B NE2 1 
ATOM   1269 N N   . PHE B 1 72 ? -9.309  5.174  -18.363 1.00 32.99 ? 514 PHE B N   1 
ATOM   1270 C CA  . PHE B 1 72 ? -8.778  6.351  -17.707 1.00 33.86 ? 514 PHE B CA  1 
ATOM   1271 C C   . PHE B 1 72 ? -9.884  7.047  -16.941 1.00 33.14 ? 514 PHE B C   1 
ATOM   1272 O O   . PHE B 1 72 ? -9.703  7.425  -15.785 1.00 33.87 ? 514 PHE B O   1 
ATOM   1273 C CB  . PHE B 1 72 ? -8.151  7.297  -18.737 1.00 34.20 ? 514 PHE B CB  1 
ATOM   1274 C CG  . PHE B 1 72 ? -7.709  8.607  -18.166 1.00 36.00 ? 514 PHE B CG  1 
ATOM   1275 C CD1 . PHE B 1 72 ? -6.476  8.721  -17.527 1.00 39.29 ? 514 PHE B CD1 1 
ATOM   1276 C CD2 . PHE B 1 72 ? -8.526  9.737  -18.266 1.00 34.37 ? 514 PHE B CD2 1 
ATOM   1277 C CE1 . PHE B 1 72 ? -6.055  9.952  -16.988 1.00 39.85 ? 514 PHE B CE1 1 
ATOM   1278 C CE2 . PHE B 1 72 ? -8.121  10.963 -17.730 1.00 35.10 ? 514 PHE B CE2 1 
ATOM   1279 C CZ  . PHE B 1 72 ? -6.877  11.072 -17.092 1.00 38.11 ? 514 PHE B CZ  1 
ATOM   1280 N N   . TYR B 1 73 ? -11.034 7.197  -17.591 1.00 31.90 ? 515 TYR B N   1 
ATOM   1281 C CA  . TYR B 1 73 ? -12.172 7.864  -16.980 1.00 31.99 ? 515 TYR B CA  1 
ATOM   1282 C C   . TYR B 1 73 ? -12.990 6.947  -16.065 1.00 32.09 ? 515 TYR B C   1 
ATOM   1283 O O   . TYR B 1 73 ? -14.073 7.327  -15.612 1.00 32.10 ? 515 TYR B O   1 
ATOM   1284 C CB  . TYR B 1 73 ? -13.056 8.479  -18.056 1.00 31.22 ? 515 TYR B CB  1 
ATOM   1285 C CG  . TYR B 1 73 ? -12.526 9.770  -18.655 1.00 32.78 ? 515 TYR B CG  1 
ATOM   1286 C CD1 . TYR B 1 73 ? -12.531 10.951 -17.922 1.00 35.45 ? 515 TYR B CD1 1 
ATOM   1287 C CD2 . TYR B 1 73 ? -12.063 9.815  -19.972 1.00 34.05 ? 515 TYR B CD2 1 
ATOM   1288 C CE1 . TYR B 1 73 ? -12.067 12.137 -18.469 1.00 37.90 ? 515 TYR B CE1 1 
ATOM   1289 C CE2 . TYR B 1 73 ? -11.609 10.995 -20.533 1.00 33.99 ? 515 TYR B CE2 1 
ATOM   1290 C CZ  . TYR B 1 73 ? -11.609 12.153 -19.775 1.00 38.97 ? 515 TYR B CZ  1 
ATOM   1291 O OH  . TYR B 1 73 ? -11.149 13.339 -20.314 1.00 41.45 ? 515 TYR B OH  1 
ATOM   1292 N N   . SER B 1 74 ? -12.455 5.755  -15.789 1.00 32.34 ? 516 SER B N   1 
ATOM   1293 C CA  . SER B 1 74 ? -13.075 4.762  -14.905 1.00 33.21 ? 516 SER B CA  1 
ATOM   1294 C C   . SER B 1 74 ? -14.400 4.220  -15.438 1.00 32.54 ? 516 SER B C   1 
ATOM   1295 O O   . SER B 1 74 ? -15.299 3.865  -14.659 1.00 33.06 ? 516 SER B O   1 
ATOM   1296 C CB  . SER B 1 74 ? -13.253 5.303  -13.474 1.00 34.28 ? 516 SER B CB  1 
ATOM   1297 O OG  . SER B 1 74 ? -12.000 5.546  -12.864 1.00 37.22 ? 516 SER B OG  1 
ATOM   1298 N N   . VAL B 1 75 ? -14.525 4.146  -16.759 1.00 31.66 ? 517 VAL B N   1 
ATOM   1299 C CA  . VAL B 1 75 ? -15.687 3.497  -17.342 1.00 31.81 ? 517 VAL B CA  1 
ATOM   1300 C C   . VAL B 1 75 ? -15.555 1.992  -17.093 1.00 33.13 ? 517 VAL B C   1 
ATOM   1301 O O   . VAL B 1 75 ? -14.497 1.414  -17.321 1.00 33.98 ? 517 VAL B O   1 
ATOM   1302 C CB  . VAL B 1 75 ? -15.859 3.837  -18.837 1.00 31.02 ? 517 VAL B CB  1 
ATOM   1303 C CG1 . VAL B 1 75 ? -17.071 3.132  -19.415 1.00 29.96 ? 517 VAL B CG1 1 
ATOM   1304 C CG2 . VAL B 1 75 ? -16.008 5.346  -19.017 1.00 29.90 ? 517 VAL B CG2 1 
ATOM   1305 N N   . GLU B 1 76 ? -16.621 1.388  -16.579 1.00 33.91 ? 518 GLU B N   1 
ATOM   1306 C CA  . GLU B 1 76 ? -16.636 -0.027 -16.223 1.00 35.89 ? 518 GLU B CA  1 
ATOM   1307 C C   . GLU B 1 76 ? -17.652 -0.810 -17.050 1.00 35.93 ? 518 GLU B C   1 
ATOM   1308 O O   . GLU B 1 76 ? -18.552 -0.226 -17.665 1.00 35.18 ? 518 GLU B O   1 
ATOM   1309 C CB  . GLU B 1 76 ? -16.975 -0.201 -14.737 1.00 37.18 ? 518 GLU B CB  1 
ATOM   1310 C CG  . GLU B 1 76 ? -15.837 0.125  -13.772 1.00 40.47 ? 518 GLU B CG  1 
ATOM   1311 C CD  . GLU B 1 76 ? -16.247 0.039  -12.298 1.00 46.50 ? 518 GLU B CD  1 
ATOM   1312 O OE1 . GLU B 1 76 ? -17.428 -0.252 -11.989 1.00 48.16 ? 518 GLU B OE1 1 
ATOM   1313 O OE2 . GLU B 1 76 ? -15.376 0.264  -11.438 1.00 49.31 ? 518 GLU B OE2 1 
ATOM   1314 N N   . ASN B 1 77 ? -17.508 -2.134 -17.043 1.00 37.02 ? 519 ASN B N   1 
ATOM   1315 C CA  . ASN B 1 77 ? -18.466 -3.036 -17.671 1.00 37.89 ? 519 ASN B CA  1 
ATOM   1316 C C   . ASN B 1 77 ? -19.891 -2.754 -17.187 1.00 38.08 ? 519 ASN B C   1 
ATOM   1317 O O   . ASN B 1 77 ? -20.121 -2.580 -15.995 1.00 38.47 ? 519 ASN B O   1 
ATOM   1318 C CB  . ASN B 1 77 ? -18.072 -4.485 -17.378 1.00 39.85 ? 519 ASN B CB  1 
ATOM   1319 C CG  . ASN B 1 77 ? -18.784 -5.488 -18.274 1.00 42.07 ? 519 ASN B CG  1 
ATOM   1320 O OD1 . ASN B 1 77 ? -19.070 -5.217 -19.439 1.00 41.89 ? 519 ASN B OD1 1 
ATOM   1321 N ND2 . ASN B 1 77 ? -19.053 -6.668 -17.731 1.00 45.32 ? 519 ASN B ND2 1 
ATOM   1322 N N   . GLY B 1 78 ? -20.830 -2.660 -18.125 1.00 37.94 ? 520 GLY B N   1 
ATOM   1323 C CA  . GLY B 1 78 ? -22.239 -2.451 -17.794 1.00 38.76 ? 520 GLY B CA  1 
ATOM   1324 C C   . GLY B 1 78 ? -22.690 -1.002 -17.692 1.00 38.06 ? 520 GLY B C   1 
ATOM   1325 O O   . GLY B 1 78 ? -23.873 -0.740 -17.469 1.00 38.61 ? 520 GLY B O   1 
ATOM   1326 N N   . ASP B 1 79 ? -21.758 -0.061 -17.852 1.00 37.00 ? 521 ASP B N   1 
ATOM   1327 C CA  . ASP B 1 79 ? -22.078 1.365  -17.742 1.00 36.78 ? 521 ASP B CA  1 
ATOM   1328 C C   . ASP B 1 79 ? -22.851 1.887  -18.954 1.00 36.53 ? 521 ASP B C   1 
ATOM   1329 O O   . ASP B 1 79 ? -22.955 1.211  -19.983 1.00 36.23 ? 521 ASP B O   1 
ATOM   1330 C CB  . ASP B 1 79 ? -20.811 2.205  -17.524 1.00 36.12 ? 521 ASP B CB  1 
ATOM   1331 C CG  . ASP B 1 79 ? -20.255 2.086  -16.109 1.00 37.07 ? 521 ASP B CG  1 
ATOM   1332 O OD1 . ASP B 1 79 ? -20.937 1.523  -15.211 1.00 37.01 ? 521 ASP B OD1 1 
ATOM   1333 O OD2 . ASP B 1 79 ? -19.120 2.564  -15.902 1.00 35.65 ? 521 ASP B OD2 1 
ATOM   1334 N N   . CYS B 1 80 ? -23.396 3.093  -18.813 1.00 36.84 ? 522 CYS B N   1 
ATOM   1335 C CA  . CYS B 1 80 ? -24.198 3.712  -19.865 1.00 37.45 ? 522 CYS B CA  1 
ATOM   1336 C C   . CYS B 1 80 ? -23.428 4.851  -20.514 1.00 36.13 ? 522 CYS B C   1 
ATOM   1337 O O   . CYS B 1 80 ? -22.965 5.765  -19.833 1.00 36.46 ? 522 CYS B O   1 
ATOM   1338 C CB  . CYS B 1 80 ? -25.537 4.219  -19.305 1.00 38.69 ? 522 CYS B CB  1 
ATOM   1339 S SG  . CYS B 1 80 ? -26.715 4.883  -20.544 1.00 44.46 ? 522 CYS B SG  1 
ATOM   1340 N N   . LEU B 1 81 ? -23.290 4.778  -21.832 1.00 35.04 ? 523 LEU B N   1 
ATOM   1341 C CA  . LEU B 1 81 ? -22.688 5.839  -22.612 1.00 34.11 ? 523 LEU B CA  1 
ATOM   1342 C C   . LEU B 1 81 ? -23.777 6.763  -23.155 1.00 34.30 ? 523 LEU B C   1 
ATOM   1343 O O   . LEU B 1 81 ? -24.686 6.327  -23.868 1.00 34.66 ? 523 LEU B O   1 
ATOM   1344 C CB  . LEU B 1 81 ? -21.877 5.239  -23.768 1.00 34.02 ? 523 LEU B CB  1 
ATOM   1345 C CG  . LEU B 1 81 ? -20.748 6.083  -24.358 1.00 34.28 ? 523 LEU B CG  1 
ATOM   1346 C CD1 . LEU B 1 81 ? -19.594 6.217  -23.364 1.00 34.53 ? 523 LEU B CD1 1 
ATOM   1347 C CD2 . LEU B 1 81 ? -20.268 5.483  -25.668 1.00 34.56 ? 523 LEU B CD2 1 
ATOM   1348 N N   . LEU B 1 82 ? -23.684 8.040  -22.807 1.00 34.17 ? 524 LEU B N   1 
ATOM   1349 C CA  . LEU B 1 82 ? -24.642 9.027  -23.281 1.00 34.56 ? 524 LEU B CA  1 
ATOM   1350 C C   . LEU B 1 82 ? -24.023 9.826  -24.403 1.00 34.21 ? 524 LEU B C   1 
ATOM   1351 O O   . LEU B 1 82 ? -22.928 10.374 -24.261 1.00 33.76 ? 524 LEU B O   1 
ATOM   1352 C CB  . LEU B 1 82 ? -25.105 9.951  -22.153 1.00 35.45 ? 524 LEU B CB  1 
ATOM   1353 C CG  . LEU B 1 82 ? -25.853 9.315  -20.980 1.00 36.49 ? 524 LEU B CG  1 
ATOM   1354 C CD1 . LEU B 1 82 ? -24.902 9.172  -19.809 1.00 39.07 ? 524 LEU B CD1 1 
ATOM   1355 C CD2 . LEU B 1 82 ? -27.016 10.196 -20.588 1.00 39.98 ? 524 LEU B CD2 1 
ATOM   1356 N N   . VAL B 1 83 ? -24.729 9.870  -25.528 1.00 34.52 ? 525 VAL B N   1 
ATOM   1357 C CA  . VAL B 1 83 ? -24.224 10.514 -26.737 1.00 34.60 ? 525 VAL B CA  1 
ATOM   1358 C C   . VAL B 1 83 ? -25.124 11.678 -27.084 1.00 36.23 ? 525 VAL B C   1 
ATOM   1359 O O   . VAL B 1 83 ? -26.346 11.520 -27.187 1.00 36.76 ? 525 VAL B O   1 
ATOM   1360 C CB  . VAL B 1 83 ? -24.187 9.535  -27.927 1.00 34.53 ? 525 VAL B CB  1 
ATOM   1361 C CG1 . VAL B 1 83 ? -23.494 10.173 -29.115 1.00 34.26 ? 525 VAL B CG1 1 
ATOM   1362 C CG2 . VAL B 1 83 ? -23.504 8.225  -27.523 1.00 33.24 ? 525 VAL B CG2 1 
ATOM   1363 N N   . ARG B 1 84 ? -24.506 12.841 -27.266 1.00 37.08 ? 526 ARG B N   1 
ATOM   1364 C CA  . ARG B 1 84 ? -25.214 14.069 -27.567 1.00 39.25 ? 526 ARG B CA  1 
ATOM   1365 C C   . ARG B 1 84 ? -24.602 14.761 -28.782 1.00 40.91 ? 526 ARG B C   1 
ATOM   1366 O O   . ARG B 1 84 ? -23.415 14.575 -29.087 1.00 40.35 ? 526 ARG B O   1 
ATOM   1367 C CB  . ARG B 1 84 ? -25.171 15.004 -26.361 1.00 39.68 ? 526 ARG B CB  1 
ATOM   1368 C CG  . ARG B 1 84 ? -26.227 14.713 -25.291 1.00 40.78 ? 526 ARG B CG  1 
ATOM   1369 C CD  . ARG B 1 84 ? -26.347 15.897 -24.328 1.00 43.32 ? 526 ARG B CD  1 
ATOM   1370 N NE  . ARG B 1 84 ? -27.268 15.662 -23.216 1.00 42.06 ? 526 ARG B NE  1 
ATOM   1371 C CZ  . ARG B 1 84 ? -26.947 14.993 -22.111 1.00 40.24 ? 526 ARG B CZ  1 
ATOM   1372 N NH1 . ARG B 1 84 ? -25.737 14.465 -21.982 1.00 35.54 ? 526 ARG B NH1 1 
ATOM   1373 N NH2 . ARG B 1 84 ? -27.844 14.832 -21.142 1.00 39.69 ? 526 ARG B NH2 1 
ATOM   1374 N N   . TRP B 1 85 ? -25.424 15.543 -29.481 1.00 42.99 ? 527 TRP B N   1 
ATOM   1375 C CA  . TRP B 1 85 ? -24.958 16.358 -30.598 1.00 44.95 ? 527 TRP B CA  1 
ATOM   1376 C C   . TRP B 1 85 ? -25.849 17.574 -30.855 1.00 47.97 ? 527 TRP B C   1 
ATOM   1377 O O   . TRP B 1 85 ? -25.459 18.465 -31.610 1.00 50.26 ? 527 TRP B O   1 
ATOM   1378 C CB  . TRP B 1 85 ? -24.776 15.523 -31.876 1.00 44.85 ? 527 TRP B CB  1 
ATOM   1379 C CG  . TRP B 1 85 ? -26.003 14.821 -32.369 1.00 43.97 ? 527 TRP B CG  1 
ATOM   1380 C CD1 . TRP B 1 85 ? -26.884 15.276 -33.314 1.00 45.49 ? 527 TRP B CD1 1 
ATOM   1381 C CD2 . TRP B 1 85 ? -26.475 13.527 -31.971 1.00 41.24 ? 527 TRP B CD2 1 
ATOM   1382 N NE1 . TRP B 1 85 ? -27.882 14.352 -33.517 1.00 44.17 ? 527 TRP B NE1 1 
ATOM   1383 C CE2 . TRP B 1 85 ? -27.655 13.267 -32.709 1.00 42.26 ? 527 TRP B CE2 1 
ATOM   1384 C CE3 . TRP B 1 85 ? -26.022 12.561 -31.056 1.00 38.23 ? 527 TRP B CE3 1 
ATOM   1385 C CZ2 . TRP B 1 85 ? -28.388 12.082 -32.562 1.00 39.77 ? 527 TRP B CZ2 1 
ATOM   1386 C CZ3 . TRP B 1 85 ? -26.756 11.380 -30.908 1.00 35.16 ? 527 TRP B CZ3 1 
ATOM   1387 C CH2 . TRP B 1 85 ? -27.924 11.154 -31.661 1.00 37.64 ? 527 TRP B CH2 1 
ATOM   1388 O OXT . TRP B 1 85 ? -26.956 17.704 -30.318 1.00 48.54 ? 527 TRP B OXT 1 
ATOM   1389 N N   . GLN C 1 2  ? -10.875 39.800 -25.682 1.00 49.38 ? 444 GLN C N   1 
ATOM   1390 C CA  . GLN C 1 2  ? -11.207 39.990 -27.124 1.00 48.94 ? 444 GLN C CA  1 
ATOM   1391 C C   . GLN C 1 2  ? -10.097 39.397 -28.010 1.00 46.22 ? 444 GLN C C   1 
ATOM   1392 O O   . GLN C 1 2  ? -10.017 38.170 -28.154 1.00 44.61 ? 444 GLN C O   1 
ATOM   1393 C CB  . GLN C 1 2  ? -11.454 41.478 -27.431 1.00 51.39 ? 444 GLN C CB  1 
ATOM   1394 C CG  . GLN C 1 2  ? -12.304 41.736 -28.682 1.00 53.75 ? 444 GLN C CG  1 
ATOM   1395 C CD  . GLN C 1 2  ? -13.762 41.380 -28.472 1.00 58.56 ? 444 GLN C CD  1 
ATOM   1396 O OE1 . GLN C 1 2  ? -14.512 42.129 -27.842 1.00 62.82 ? 444 GLN C OE1 1 
ATOM   1397 N NE2 . GLN C 1 2  ? -14.171 40.229 -28.995 1.00 56.48 ? 444 GLN C NE2 1 
ATOM   1398 N N   . LEU C 1 3  ? -9.251  40.262 -28.581 1.00 45.44 ? 445 LEU C N   1 
ATOM   1399 C CA  . LEU C 1 3  ? -8.127  39.847 -29.426 1.00 43.11 ? 445 LEU C CA  1 
ATOM   1400 C C   . LEU C 1 3  ? -6.921  39.387 -28.607 1.00 41.78 ? 445 LEU C C   1 
ATOM   1401 O O   . LEU C 1 3  ? -6.486  40.081 -27.683 1.00 43.03 ? 445 LEU C O   1 
ATOM   1402 C CB  . LEU C 1 3  ? -7.710  40.989 -30.360 1.00 44.10 ? 445 LEU C CB  1 
ATOM   1403 C CG  . LEU C 1 3  ? -6.958  40.613 -31.650 1.00 43.09 ? 445 LEU C CG  1 
ATOM   1404 C CD1 . LEU C 1 3  ? -7.832  39.798 -32.605 1.00 36.76 ? 445 LEU C CD1 1 
ATOM   1405 C CD2 . LEU C 1 3  ? -6.430  41.862 -32.362 1.00 44.32 ? 445 LEU C CD2 1 
ATOM   1406 N N   . LEU C 1 4  ? -6.375  38.223 -28.958 1.00 39.34 ? 446 LEU C N   1 
ATOM   1407 C CA  . LEU C 1 4  ? -5.243  37.644 -28.226 1.00 37.91 ? 446 LEU C CA  1 
ATOM   1408 C C   . LEU C 1 4  ? -3.948  37.619 -29.047 1.00 37.16 ? 446 LEU C C   1 
ATOM   1409 O O   . LEU C 1 4  ? -3.922  37.112 -30.172 1.00 35.83 ? 446 LEU C O   1 
ATOM   1410 C CB  . LEU C 1 4  ? -5.575  36.228 -27.725 1.00 36.62 ? 446 LEU C CB  1 
ATOM   1411 C CG  . LEU C 1 4  ? -6.921  35.953 -27.026 1.00 36.64 ? 446 LEU C CG  1 
ATOM   1412 C CD1 . LEU C 1 4  ? -7.093  34.452 -26.771 1.00 31.16 ? 446 LEU C CD1 1 
ATOM   1413 C CD2 . LEU C 1 4  ? -7.090  36.759 -25.731 1.00 33.70 ? 446 LEU C CD2 1 
ATOM   1414 N N   . THR C 1 5  ? -2.885  38.180 -28.467 1.00 37.68 ? 447 THR C N   1 
ATOM   1415 C CA  . THR C 1 5  ? -1.545  38.119 -29.035 1.00 37.48 ? 447 THR C CA  1 
ATOM   1416 C C   . THR C 1 5  ? -0.849  36.843 -28.564 1.00 36.39 ? 447 THR C C   1 
ATOM   1417 O O   . THR C 1 5  ? -0.584  36.671 -27.368 1.00 36.85 ? 447 THR C O   1 
ATOM   1418 C CB  . THR C 1 5  ? -0.700  39.345 -28.629 1.00 39.27 ? 447 THR C CB  1 
ATOM   1419 O OG1 . THR C 1 5  ? -1.309  40.540 -29.136 1.00 40.98 ? 447 THR C OG1 1 
ATOM   1420 C CG2 . THR C 1 5  ? 0.714   39.236 -29.192 1.00 39.67 ? 447 THR C CG2 1 
ATOM   1421 N N   . LEU C 1 6  ? -0.540  35.967 -29.515 1.00 35.04 ? 448 LEU C N   1 
ATOM   1422 C CA  . LEU C 1 6  ? 0.023   34.655 -29.221 1.00 34.37 ? 448 LEU C CA  1 
ATOM   1423 C C   . LEU C 1 6  ? 1.365   34.467 -29.895 1.00 34.73 ? 448 LEU C C   1 
ATOM   1424 O O   . LEU C 1 6  ? 1.561   34.885 -31.035 1.00 35.52 ? 448 LEU C O   1 
ATOM   1425 C CB  . LEU C 1 6  ? -0.926  33.542 -29.682 1.00 33.01 ? 448 LEU C CB  1 
ATOM   1426 C CG  . LEU C 1 6  ? -2.349  33.556 -29.124 1.00 33.20 ? 448 LEU C CG  1 
ATOM   1427 C CD1 . LEU C 1 6  ? -3.139  32.371 -29.655 1.00 31.92 ? 448 LEU C CD1 1 
ATOM   1428 C CD2 . LEU C 1 6  ? -2.322  33.545 -27.595 1.00 33.21 ? 448 LEU C CD2 1 
ATOM   1429 N N   . LYS C 1 7  ? 2.286   33.831 -29.183 1.00 34.70 ? 449 LYS C N   1 
ATOM   1430 C CA  . LYS C 1 7  ? 3.582   33.495 -29.736 1.00 35.14 ? 449 LYS C CA  1 
ATOM   1431 C C   . LYS C 1 7  ? 3.495   32.079 -30.296 1.00 34.43 ? 449 LYS C C   1 
ATOM   1432 O O   . LYS C 1 7  ? 2.701   31.266 -29.813 1.00 34.67 ? 449 LYS C O   1 
ATOM   1433 C CB  . LYS C 1 7  ? 4.661   33.642 -28.660 1.00 36.41 ? 449 LYS C CB  1 
ATOM   1434 C CG  . LYS C 1 7  ? 4.452   34.897 -27.787 1.00 38.47 ? 449 LYS C CG  1 
ATOM   1435 C CD  . LYS C 1 7  ? 5.745   35.571 -27.363 1.00 42.46 ? 449 LYS C CD  1 
ATOM   1436 C CE  . LYS C 1 7  ? 5.455   36.873 -26.625 0.50 43.75 ? 449 LYS C CE  1 
ATOM   1437 N NZ  . LYS C 1 7  ? 6.689   37.656 -26.342 0.50 45.87 ? 449 LYS C NZ  1 
ATOM   1438 N N   . ILE C 1 8  ? 4.263   31.789 -31.340 1.00 34.34 ? 450 ILE C N   1 
ATOM   1439 C CA  . ILE C 1 8  ? 4.202   30.470 -31.977 1.00 33.23 ? 450 ILE C CA  1 
ATOM   1440 C C   . ILE C 1 8  ? 5.555   29.784 -31.938 1.00 33.75 ? 450 ILE C C   1 
ATOM   1441 O O   . ILE C 1 8  ? 6.583   30.398 -32.236 1.00 34.76 ? 450 ILE C O   1 
ATOM   1442 C CB  . ILE C 1 8  ? 3.633   30.526 -33.427 1.00 33.08 ? 450 ILE C CB  1 
ATOM   1443 C CG1 . ILE C 1 8  ? 2.103   30.570 -33.409 1.00 31.81 ? 450 ILE C CG1 1 
ATOM   1444 C CG2 . ILE C 1 8  ? 4.026   29.294 -34.230 1.00 32.74 ? 450 ILE C CG2 1 
ATOM   1445 C CD1 . ILE C 1 8  ? 1.511   31.965 -33.392 1.00 32.27 ? 450 ILE C CD1 1 
ATOM   1446 N N   . LYS C 1 9  ? 5.537   28.512 -31.548 1.00 33.04 ? 451 LYS C N   1 
ATOM   1447 C CA  . LYS C 1 9  ? 6.743   27.718 -31.418 1.00 33.89 ? 451 LYS C CA  1 
ATOM   1448 C C   . LYS C 1 9  ? 6.569   26.402 -32.185 1.00 33.70 ? 451 LYS C C   1 
ATOM   1449 O O   . LYS C 1 9  ? 5.488   25.804 -32.156 1.00 32.91 ? 451 LYS C O   1 
ATOM   1450 C CB  . LYS C 1 9  ? 7.015   27.460 -29.937 1.00 33.95 ? 451 LYS C CB  1 
ATOM   1451 C CG  . LYS C 1 9  ? 8.424   26.985 -29.612 1.00 36.93 ? 451 LYS C CG  1 
ATOM   1452 C CD  . LYS C 1 9  ? 8.480   26.408 -28.210 1.00 40.86 ? 451 LYS C CD  1 
ATOM   1453 C CE  . LYS C 1 9  ? 9.867   26.515 -27.600 1.00 46.80 ? 451 LYS C CE  1 
ATOM   1454 N NZ  . LYS C 1 9  ? 9.827   26.392 -26.105 1.00 48.91 ? 451 LYS C NZ  1 
ATOM   1455 N N   . TYR C 1 10 ? 7.618   25.973 -32.888 1.00 34.59 ? 452 TYR C N   1 
ATOM   1456 C CA  . TYR C 1 10 ? 7.644   24.651 -33.537 1.00 35.23 ? 452 TYR C CA  1 
ATOM   1457 C C   . TYR C 1 10 ? 8.642   23.760 -32.798 1.00 36.68 ? 452 TYR C C   1 
ATOM   1458 O O   . TYR C 1 10 ? 9.766   23.575 -33.271 1.00 38.31 ? 452 TYR C O   1 
ATOM   1459 C CB  . TYR C 1 10 ? 8.040   24.741 -35.025 1.00 35.82 ? 452 TYR C CB  1 
ATOM   1460 C CG  . TYR C 1 10 ? 7.303   25.763 -35.873 1.00 34.70 ? 452 TYR C CG  1 
ATOM   1461 C CD1 . TYR C 1 10 ? 7.961   26.436 -36.900 1.00 35.68 ? 452 TYR C CD1 1 
ATOM   1462 C CD2 . TYR C 1 10 ? 5.955   26.050 -35.659 1.00 34.01 ? 452 TYR C CD2 1 
ATOM   1463 C CE1 . TYR C 1 10 ? 7.296   27.370 -37.700 1.00 35.56 ? 452 TYR C CE1 1 
ATOM   1464 C CE2 . TYR C 1 10 ? 5.283   26.982 -36.440 1.00 34.19 ? 452 TYR C CE2 1 
ATOM   1465 C CZ  . TYR C 1 10 ? 5.957   27.640 -37.460 1.00 35.80 ? 452 TYR C CZ  1 
ATOM   1466 O OH  . TYR C 1 10 ? 5.288   28.562 -38.231 1.00 31.09 ? 452 TYR C OH  1 
ATOM   1467 N N   . PRO C 1 11 ? 8.230   23.188 -31.645 1.00 36.85 ? 453 PRO C N   1 
ATOM   1468 C CA  . PRO C 1 11 ? 9.142   22.542 -30.684 1.00 38.44 ? 453 PRO C CA  1 
ATOM   1469 C C   . PRO C 1 11 ? 10.045  21.462 -31.292 1.00 40.68 ? 453 PRO C C   1 
ATOM   1470 O O   . PRO C 1 11 ? 11.178  21.259 -30.832 1.00 42.15 ? 453 PRO C O   1 
ATOM   1471 C CB  . PRO C 1 11 ? 8.188   21.905 -29.660 1.00 37.59 ? 453 PRO C CB  1 
ATOM   1472 C CG  . PRO C 1 11 ? 6.893   22.618 -29.834 1.00 36.42 ? 453 PRO C CG  1 
ATOM   1473 C CD  . PRO C 1 11 ? 6.815   22.979 -31.274 1.00 35.74 ? 453 PRO C CD  1 
ATOM   1474 N N   . HIS C 1 12 ? 9.532   20.779 -32.313 1.00 41.02 ? 454 HIS C N   1 
ATOM   1475 C CA  . HIS C 1 12 ? 10.239  19.693 -32.975 1.00 43.42 ? 454 HIS C CA  1 
ATOM   1476 C C   . HIS C 1 12 ? 11.381  20.194 -33.876 1.00 44.51 ? 454 HIS C C   1 
ATOM   1477 O O   . HIS C 1 12 ? 12.241  19.417 -34.286 1.00 46.15 ? 454 HIS C O   1 
ATOM   1478 C CB  . HIS C 1 12 ? 9.236   18.824 -33.753 1.00 43.37 ? 454 HIS C CB  1 
ATOM   1479 C CG  . HIS C 1 12 ? 8.373   19.597 -34.710 1.00 44.98 ? 454 HIS C CG  1 
ATOM   1480 N ND1 . HIS C 1 12 ? 7.663   20.721 -34.338 1.00 42.89 ? 454 HIS C ND1 1 
ATOM   1481 C CD2 . HIS C 1 12 ? 8.105   19.400 -36.025 1.00 47.65 ? 454 HIS C CD2 1 
ATOM   1482 C CE1 . HIS C 1 12 ? 7.002   21.185 -35.383 1.00 43.88 ? 454 HIS C CE1 1 
ATOM   1483 N NE2 . HIS C 1 12 ? 7.251   20.401 -36.418 1.00 46.10 ? 454 HIS C NE2 1 
ATOM   1484 N N   . GLN C 1 13 ? 11.395  21.500 -34.151 1.00 43.88 ? 455 GLN C N   1 
ATOM   1485 C CA  . GLN C 1 13 ? 12.374  22.108 -35.057 1.00 45.01 ? 455 GLN C CA  1 
ATOM   1486 C C   . GLN C 1 13 ? 13.359  23.032 -34.329 1.00 46.26 ? 455 GLN C C   1 
ATOM   1487 O O   . GLN C 1 13 ? 14.574  22.925 -34.507 1.00 48.18 ? 455 GLN C O   1 
ATOM   1488 C CB  . GLN C 1 13 ? 11.655  22.881 -36.172 1.00 43.89 ? 455 GLN C CB  1 
ATOM   1489 C CG  . GLN C 1 13 ? 10.681  22.044 -37.006 1.00 42.25 ? 455 GLN C CG  1 
ATOM   1490 C CD  . GLN C 1 13 ? 10.226  22.745 -38.277 1.00 39.91 ? 455 GLN C CD  1 
ATOM   1491 O OE1 . GLN C 1 13 ? 10.002  23.953 -38.291 1.00 38.90 ? 455 GLN C OE1 1 
ATOM   1492 N NE2 . GLN C 1 13 ? 10.081  21.979 -39.353 1.00 39.03 ? 455 GLN C NE2 1 
ATOM   1493 N N   . LEU C 1 14 ? 12.823  23.941 -33.518 1.00 45.42 ? 456 LEU C N   1 
ATOM   1494 C CA  . LEU C 1 14 ? 13.618  24.953 -32.835 1.00 46.49 ? 456 LEU C CA  1 
ATOM   1495 C C   . LEU C 1 14 ? 13.102  25.144 -31.407 1.00 46.22 ? 456 LEU C C   1 
ATOM   1496 O O   . LEU C 1 14 ? 11.931  24.887 -31.115 1.00 44.38 ? 456 LEU C O   1 
ATOM   1497 C CB  . LEU C 1 14 ? 13.571  26.273 -33.619 1.00 46.17 ? 456 LEU C CB  1 
ATOM   1498 C CG  . LEU C 1 14 ? 14.600  27.384 -33.354 1.00 47.49 ? 456 LEU C CG  1 
ATOM   1499 C CD1 . LEU C 1 14 ? 16.026  26.933 -33.642 1.00 48.79 ? 456 LEU C CD1 1 
ATOM   1500 C CD2 . LEU C 1 14 ? 14.263  28.618 -34.169 1.00 45.30 ? 456 LEU C CD2 1 
ATOM   1501 N N   . ASP C 1 15 ? 13.989  25.595 -30.523 1.00 48.36 ? 457 ASP C N   1 
ATOM   1502 C CA  . ASP C 1 15 ? 13.670  25.778 -29.105 1.00 48.63 ? 457 ASP C CA  1 
ATOM   1503 C C   . ASP C 1 15 ? 13.282  27.233 -28.780 1.00 47.84 ? 457 ASP C C   1 
ATOM   1504 O O   . ASP C 1 15 ? 13.201  27.623 -27.613 1.00 48.56 ? 457 ASP C O   1 
ATOM   1505 C CB  . ASP C 1 15 ? 14.866  25.333 -28.255 1.00 50.89 ? 457 ASP C CB  1 
ATOM   1506 C CG  . ASP C 1 15 ? 14.470  24.906 -26.855 1.00 53.39 ? 457 ASP C CG  1 
ATOM   1507 O OD1 . ASP C 1 15 ? 13.321  25.165 -26.436 1.00 54.07 ? 457 ASP C OD1 1 
ATOM   1508 O OD2 . ASP C 1 15 ? 15.322  24.306 -26.159 1.00 61.62 ? 457 ASP C OD2 1 
ATOM   1509 N N   . GLN C 1 16 ? 13.045  28.031 -29.817 1.00 46.92 ? 458 GLN C N   1 
ATOM   1510 C CA  . GLN C 1 16 ? 12.716  29.444 -29.642 1.00 46.13 ? 458 GLN C CA  1 
ATOM   1511 C C   . GLN C 1 16 ? 11.448  29.840 -30.395 1.00 43.81 ? 458 GLN C C   1 
ATOM   1512 O O   . GLN C 1 16 ? 11.029  29.158 -31.332 1.00 42.91 ? 458 GLN C O   1 
ATOM   1513 C CB  . GLN C 1 16 ? 13.890  30.339 -30.050 1.00 47.85 ? 458 GLN C CB  1 
ATOM   1514 C CG  . GLN C 1 16 ? 15.031  30.403 -29.021 1.00 50.84 ? 458 GLN C CG  1 
ATOM   1515 C CD  . GLN C 1 16 ? 16.271  29.634 -29.442 1.00 56.49 ? 458 GLN C CD  1 
ATOM   1516 O OE1 . GLN C 1 16 ? 16.333  29.077 -30.537 1.00 59.46 ? 458 GLN C OE1 1 
ATOM   1517 N NE2 . GLN C 1 16 ? 17.270  29.603 -28.569 1.00 58.71 ? 458 GLN C NE2 1 
ATOM   1518 N N   . LYS C 1 17 ? 10.837  30.938 -29.961 1.00 43.00 ? 459 LYS C N   1 
ATOM   1519 C CA  . LYS C 1 17 ? 9.616   31.448 -30.574 1.00 41.15 ? 459 LYS C CA  1 
ATOM   1520 C C   . LYS C 1 17 ? 9.837   31.934 -32.007 1.00 40.78 ? 459 LYS C C   1 
ATOM   1521 O O   . LYS C 1 17 ? 10.847  32.561 -32.319 1.00 41.85 ? 459 LYS C O   1 
ATOM   1522 C CB  . LYS C 1 17 ? 8.973   32.518 -29.688 1.00 41.18 ? 459 LYS C CB  1 
ATOM   1523 C CG  . LYS C 1 17 ? 8.186   31.918 -28.516 1.00 41.10 ? 459 LYS C CG  1 
ATOM   1524 C CD  . LYS C 1 17 ? 8.253   32.814 -27.289 0.50 44.42 ? 459 LYS C CD  1 
ATOM   1525 C CE  . LYS C 1 17 ? 7.677   32.117 -26.061 0.50 45.91 ? 459 LYS C CE  1 
ATOM   1526 N NZ  . LYS C 1 17 ? 7.904   32.903 -24.809 0.50 47.15 ? 459 LYS C NZ  1 
ATOM   1527 N N   . VAL C 1 18 ? 8.864   31.622 -32.859 1.00 39.53 ? 460 VAL C N   1 
ATOM   1528 C CA  . VAL C 1 18 ? 8.981   31.739 -34.314 1.00 39.67 ? 460 VAL C CA  1 
ATOM   1529 C C   . VAL C 1 18 ? 8.263   32.984 -34.857 1.00 39.54 ? 460 VAL C C   1 
ATOM   1530 O O   . VAL C 1 18 ? 8.775   33.668 -35.754 1.00 40.41 ? 460 VAL C O   1 
ATOM   1531 C CB  . VAL C 1 18 ? 8.477   30.425 -34.994 1.00 38.69 ? 460 VAL C CB  1 
ATOM   1532 C CG1 . VAL C 1 18 ? 8.297   30.585 -36.485 1.00 38.87 ? 460 VAL C CG1 1 
ATOM   1533 C CG2 . VAL C 1 18 ? 9.447   29.285 -34.713 1.00 40.25 ? 460 VAL C CG2 1 
ATOM   1534 N N   . LEU C 1 19 ? 7.094   33.285 -34.298 1.00 38.79 ? 461 LEU C N   1 
ATOM   1535 C CA  . LEU C 1 19 ? 6.276   34.407 -34.768 1.00 39.34 ? 461 LEU C CA  1 
ATOM   1536 C C   . LEU C 1 19 ? 5.196   34.785 -33.759 1.00 38.85 ? 461 LEU C C   1 
ATOM   1537 O O   . LEU C 1 19 ? 4.863   33.998 -32.869 1.00 38.17 ? 461 LEU C O   1 
ATOM   1538 C CB  . LEU C 1 19 ? 5.656   34.084 -36.138 1.00 38.54 ? 461 LEU C CB  1 
ATOM   1539 C CG  . LEU C 1 19 ? 4.630   32.954 -36.190 1.00 38.26 ? 461 LEU C CG  1 
ATOM   1540 C CD1 . LEU C 1 19 ? 3.257   33.549 -36.411 1.00 40.18 ? 461 LEU C CD1 1 
ATOM   1541 C CD2 . LEU C 1 19 ? 4.960   31.959 -37.292 1.00 39.83 ? 461 LEU C CD2 1 
ATOM   1542 N N   . GLU C 1 20 ? 4.668   35.997 -33.908 1.00 39.78 ? 462 GLU C N   1 
ATOM   1543 C CA  . GLU C 1 20 ? 3.525   36.475 -33.129 1.00 40.09 ? 462 GLU C CA  1 
ATOM   1544 C C   . GLU C 1 20 ? 2.303   36.666 -34.028 1.00 39.67 ? 462 GLU C C   1 
ATOM   1545 O O   . GLU C 1 20 ? 2.419   37.160 -35.147 1.00 40.21 ? 462 GLU C O   1 
ATOM   1546 C CB  . GLU C 1 20 ? 3.854   37.789 -32.415 1.00 41.23 ? 462 GLU C CB  1 
ATOM   1547 C CG  . GLU C 1 20 ? 4.654   37.596 -31.150 1.00 43.80 ? 462 GLU C CG  1 
ATOM   1548 C CD  . GLU C 1 20 ? 4.890   38.881 -30.379 1.00 49.97 ? 462 GLU C CD  1 
ATOM   1549 O OE1 . GLU C 1 20 ? 4.024   39.785 -30.431 1.00 51.98 ? 462 GLU C OE1 1 
ATOM   1550 O OE2 . GLU C 1 20 ? 5.946   38.981 -29.709 1.00 52.11 ? 462 GLU C OE2 1 
ATOM   1551 N N   . LYS C 1 21 ? 1.140   36.264 -33.529 1.00 38.84 ? 463 LYS C N   1 
ATOM   1552 C CA  . LYS C 1 21 ? -0.105  36.400 -34.269 1.00 38.90 ? 463 LYS C CA  1 
ATOM   1553 C C   . LYS C 1 21 ? -1.181  36.927 -33.343 1.00 38.86 ? 463 LYS C C   1 
ATOM   1554 O O   . LYS C 1 21 ? -1.340  36.431 -32.220 1.00 38.15 ? 463 LYS C O   1 
ATOM   1555 C CB  . LYS C 1 21 ? -0.544  35.046 -34.852 1.00 38.13 ? 463 LYS C CB  1 
ATOM   1556 C CG  . LYS C 1 21 ? -0.207  34.828 -36.324 1.00 40.09 ? 463 LYS C CG  1 
ATOM   1557 C CD  . LYS C 1 21 ? -1.155  35.627 -37.221 1.00 48.27 ? 463 LYS C CD  1 
ATOM   1558 C CE  . LYS C 1 21 ? -0.697  35.643 -38.665 1.00 52.98 ? 463 LYS C CE  1 
ATOM   1559 N NZ  . LYS C 1 21 ? -1.489  36.619 -39.481 1.00 56.00 ? 463 LYS C NZ  1 
ATOM   1560 N N   . GLN C 1 22 ? -1.904  37.941 -33.807 1.00 39.28 ? 464 GLN C N   1 
ATOM   1561 C CA  . GLN C 1 22 ? -3.118  38.369 -33.135 1.00 39.68 ? 464 GLN C CA  1 
ATOM   1562 C C   . GLN C 1 22 ? -4.290  37.570 -33.692 1.00 38.99 ? 464 GLN C C   1 
ATOM   1563 O O   . GLN C 1 22 ? -4.649  37.707 -34.865 1.00 39.79 ? 464 GLN C O   1 
ATOM   1564 C CB  . GLN C 1 22 ? -3.343  39.867 -33.292 1.00 41.40 ? 464 GLN C CB  1 
ATOM   1565 C CG  . GLN C 1 22 ? -2.425  40.719 -32.424 1.00 43.80 ? 464 GLN C CG  1 
ATOM   1566 C CD  . GLN C 1 22 ? -2.740  42.199 -32.521 0.50 47.56 ? 464 GLN C CD  1 
ATOM   1567 O OE1 . GLN C 1 22 ? -2.723  42.780 -33.606 0.50 48.40 ? 464 GLN C OE1 1 
ATOM   1568 N NE2 . GLN C 1 22 ? -3.025  42.818 -31.381 0.50 48.99 ? 464 GLN C NE2 1 
ATOM   1569 N N   . LEU C 1 23 ? -4.846  36.709 -32.844 1.00 37.75 ? 465 LEU C N   1 
ATOM   1570 C CA  . LEU C 1 23 ? -5.960  35.831 -33.194 1.00 36.70 ? 465 LEU C CA  1 
ATOM   1571 C C   . LEU C 1 23 ? -7.154  36.144 -32.293 1.00 36.75 ? 465 LEU C C   1 
ATOM   1572 O O   . LEU C 1 23 ? -6.969  36.339 -31.093 1.00 36.78 ? 465 LEU C O   1 
ATOM   1573 C CB  . LEU C 1 23 ? -5.553  34.357 -33.016 1.00 35.51 ? 465 LEU C CB  1 
ATOM   1574 C CG  . LEU C 1 23 ? -4.378  33.781 -33.822 1.00 34.53 ? 465 LEU C CG  1 
ATOM   1575 C CD1 . LEU C 1 23 ? -4.029  32.364 -33.361 1.00 31.75 ? 465 LEU C CD1 1 
ATOM   1576 C CD2 . LEU C 1 23 ? -4.657  33.788 -35.327 1.00 31.88 ? 465 LEU C CD2 1 
ATOM   1577 N N   . PRO C 1 24 ? -8.378  36.213 -32.865 1.00 36.85 ? 466 PRO C N   1 
ATOM   1578 C CA  . PRO C 1 24 ? -9.556  36.443 -32.032 1.00 37.35 ? 466 PRO C CA  1 
ATOM   1579 C C   . PRO C 1 24 ? -9.759  35.321 -31.014 1.00 36.35 ? 466 PRO C C   1 
ATOM   1580 O O   . PRO C 1 24 ? -9.531  34.146 -31.327 1.00 35.10 ? 466 PRO C O   1 
ATOM   1581 C CB  . PRO C 1 24 ? -10.706 36.467 -33.043 1.00 38.12 ? 466 PRO C CB  1 
ATOM   1582 C CG  . PRO C 1 24 ? -10.063 36.822 -34.333 1.00 38.27 ? 466 PRO C CG  1 
ATOM   1583 C CD  . PRO C 1 24 ? -8.735  36.138 -34.292 1.00 37.00 ? 466 PRO C CD  1 
ATOM   1584 N N   . GLY C 1 25 ? -10.174 35.700 -29.805 1.00 36.80 ? 467 GLY C N   1 
ATOM   1585 C CA  . GLY C 1 25 ? -10.398 34.763 -28.708 1.00 36.13 ? 467 GLY C CA  1 
ATOM   1586 C C   . GLY C 1 25 ? -11.402 33.681 -29.047 1.00 35.79 ? 467 GLY C C   1 
ATOM   1587 O O   . GLY C 1 25 ? -11.240 32.527 -28.625 1.00 35.28 ? 467 GLY C O   1 
ATOM   1588 N N   . SER C 1 26 ? -12.418 34.055 -29.828 1.00 36.06 ? 468 SER C N   1 
ATOM   1589 C CA  . SER C 1 26 ? -13.481 33.139 -30.262 1.00 36.24 ? 468 SER C CA  1 
ATOM   1590 C C   . SER C 1 26 ? -13.073 32.181 -31.395 1.00 35.43 ? 468 SER C C   1 
ATOM   1591 O O   . SER C 1 26 ? -13.832 31.273 -31.737 1.00 36.19 ? 468 SER C O   1 
ATOM   1592 C CB  . SER C 1 26 ? -14.746 33.927 -30.653 1.00 38.12 ? 468 SER C CB  1 
ATOM   1593 O OG  . SER C 1 26 ? -14.492 34.839 -31.714 1.00 36.59 ? 468 SER C OG  1 
ATOM   1594 N N   . MET C 1 27 ? -11.888 32.390 -31.970 1.00 34.45 ? 469 MET C N   1 
ATOM   1595 C CA  . MET C 1 27 ? -11.345 31.523 -33.022 1.00 33.99 ? 469 MET C CA  1 
ATOM   1596 C C   . MET C 1 27 ? -11.260 30.078 -32.563 1.00 33.82 ? 469 MET C C   1 
ATOM   1597 O O   . MET C 1 27 ? -10.651 29.785 -31.530 1.00 33.29 ? 469 MET C O   1 
ATOM   1598 C CB  . MET C 1 27 ? -9.959  32.005 -33.463 1.00 33.08 ? 469 MET C CB  1 
ATOM   1599 C CG  . MET C 1 27 ? -9.416  31.349 -34.722 1.00 33.04 ? 469 MET C CG  1 
ATOM   1600 S SD  . MET C 1 27 ? -8.015  32.266 -35.418 1.00 37.25 ? 469 MET C SD  1 
ATOM   1601 C CE  . MET C 1 27 ? -7.806  31.442 -36.991 1.00 32.07 ? 469 MET C CE  1 
ATOM   1602 N N   . THR C 1 28 ? -11.870 29.180 -33.335 1.00 34.73 ? 470 THR C N   1 
ATOM   1603 C CA  . THR C 1 28 ? -11.835 27.752 -33.022 1.00 34.93 ? 470 THR C CA  1 
ATOM   1604 C C   . THR C 1 28 ? -10.491 27.137 -33.403 1.00 34.29 ? 470 THR C C   1 
ATOM   1605 O O   . THR C 1 28 ? -9.762  27.688 -34.229 1.00 33.88 ? 470 THR C O   1 
ATOM   1606 C CB  . THR C 1 28 ? -12.983 26.980 -33.707 1.00 36.17 ? 470 THR C CB  1 
ATOM   1607 O OG1 . THR C 1 28 ? -12.850 27.084 -35.129 1.00 37.16 ? 470 THR C OG1 1 
ATOM   1608 C CG2 . THR C 1 28 ? -14.346 27.530 -33.268 1.00 36.68 ? 470 THR C CG2 1 
ATOM   1609 N N   . ILE C 1 29 ? -10.177 25.992 -32.799 1.00 34.65 ? 471 ILE C N   1 
ATOM   1610 C CA  . ILE C 1 29 ? -8.900  25.305 -33.015 1.00 34.51 ? 471 ILE C CA  1 
ATOM   1611 C C   . ILE C 1 29 ? -8.728  24.837 -34.465 1.00 35.11 ? 471 ILE C C   1 
ATOM   1612 O O   . ILE C 1 29 ? -7.619  24.900 -35.018 1.00 34.56 ? 471 ILE C O   1 
ATOM   1613 C CB  . ILE C 1 29 ? -8.718  24.108 -32.027 1.00 34.83 ? 471 ILE C CB  1 
ATOM   1614 C CG1 . ILE C 1 29 ? -8.792  24.577 -30.557 1.00 34.64 ? 471 ILE C CG1 1 
ATOM   1615 C CG2 . ILE C 1 29 ? -7.430  23.323 -32.317 1.00 34.82 ? 471 ILE C CG2 1 
ATOM   1616 C CD1 . ILE C 1 29 ? -7.828  25.708 -30.151 1.00 32.26 ? 471 ILE C CD1 1 
ATOM   1617 N N   . GLN C 1 30 ? -9.819  24.384 -35.081 1.00 36.27 ? 472 GLN C N   1 
ATOM   1618 C CA  . GLN C 1 30 ? -9.750  23.953 -36.472 1.00 37.39 ? 472 GLN C CA  1 
ATOM   1619 C C   . GLN C 1 30 ? -9.450  25.098 -37.440 1.00 36.91 ? 472 GLN C C   1 
ATOM   1620 O O   . GLN C 1 30 ? -8.790  24.881 -38.456 1.00 37.27 ? 472 GLN C O   1 
ATOM   1621 C CB  . GLN C 1 30 ? -10.991 23.158 -36.898 1.00 39.43 ? 472 GLN C CB  1 
ATOM   1622 C CG  . GLN C 1 30 ? -12.250 23.962 -37.166 1.00 42.43 ? 472 GLN C CG  1 
ATOM   1623 C CD  . GLN C 1 30 ? -13.191 23.250 -38.130 1.00 48.36 ? 472 GLN C CD  1 
ATOM   1624 O OE1 . GLN C 1 30 ? -12.832 22.230 -38.719 1.00 50.11 ? 472 GLN C OE1 1 
ATOM   1625 N NE2 . GLN C 1 30 ? -14.396 23.790 -38.301 1.00 49.93 ? 472 GLN C NE2 1 
ATOM   1626 N N   . LYS C 1 31 ? -9.907  26.309 -37.111 1.00 36.39 ? 473 LYS C N   1 
ATOM   1627 C CA  . LYS C 1 31 ? -9.607  27.497 -37.924 1.00 36.26 ? 473 LYS C CA  1 
ATOM   1628 C C   . LYS C 1 31 ? -8.180  27.971 -37.690 1.00 35.03 ? 473 LYS C C   1 
ATOM   1629 O O   . LYS C 1 31 ? -7.542  28.520 -38.597 1.00 35.30 ? 473 LYS C O   1 
ATOM   1630 C CB  . LYS C 1 31 ? -10.597 28.640 -37.662 1.00 36.56 ? 473 LYS C CB  1 
ATOM   1631 C CG  . LYS C 1 31 ? -12.031 28.365 -38.109 1.00 37.76 ? 473 LYS C CG  1 
ATOM   1632 C CD  . LYS C 1 31 ? -12.134 27.991 -39.573 1.00 39.15 ? 473 LYS C CD  1 
ATOM   1633 C CE  . LYS C 1 31 ? -13.534 27.482 -39.897 1.00 42.85 ? 473 LYS C CE  1 
ATOM   1634 N NZ  . LYS C 1 31 ? -13.587 26.750 -41.185 1.00 43.95 ? 473 LYS C NZ  1 
ATOM   1635 N N   . VAL C 1 32 ? -7.695  27.761 -36.468 1.00 33.96 ? 474 VAL C N   1 
ATOM   1636 C CA  . VAL C 1 32 ? -6.292  28.009 -36.126 1.00 33.04 ? 474 VAL C CA  1 
ATOM   1637 C C   . VAL C 1 32 ? -5.412  27.044 -36.923 1.00 33.26 ? 474 VAL C C   1 
ATOM   1638 O O   . VAL C 1 32 ? -4.433  27.455 -37.554 1.00 33.26 ? 474 VAL C O   1 
ATOM   1639 C CB  . VAL C 1 32 ? -6.022  27.873 -34.597 1.00 32.21 ? 474 VAL C CB  1 
ATOM   1640 C CG1 . VAL C 1 32 ? -4.569  28.135 -34.285 1.00 31.40 ? 474 VAL C CG1 1 
ATOM   1641 C CG2 . VAL C 1 32 ? -6.893  28.836 -33.798 1.00 32.14 ? 474 VAL C CG2 1 
ATOM   1642 N N   . LYS C 1 33 ? -5.780  25.766 -36.909 1.00 33.78 ? 475 LYS C N   1 
ATOM   1643 C CA  . LYS C 1 33 ? -5.094  24.766 -37.722 1.00 35.02 ? 475 LYS C CA  1 
ATOM   1644 C C   . LYS C 1 33 ? -5.157  25.126 -39.205 1.00 36.47 ? 475 LYS C C   1 
ATOM   1645 O O   . LYS C 1 33 ? -4.185  24.927 -39.925 1.00 36.87 ? 475 LYS C O   1 
ATOM   1646 C CB  . LYS C 1 33 ? -5.675  23.374 -37.480 1.00 35.77 ? 475 LYS C CB  1 
ATOM   1647 C CG  . LYS C 1 33 ? -5.310  22.785 -36.129 1.00 35.94 ? 475 LYS C CG  1 
ATOM   1648 C CD  . LYS C 1 33 ? -5.839  21.369 -35.994 1.00 38.15 ? 475 LYS C CD  1 
ATOM   1649 C CE  . LYS C 1 33 ? -5.432  20.740 -34.677 1.00 36.80 ? 475 LYS C CE  1 
ATOM   1650 N NZ  . LYS C 1 33 ? -6.143  19.435 -34.475 1.00 39.85 ? 475 LYS C NZ  1 
ATOM   1651 N N   . GLY C 1 34 ? -6.295  25.676 -39.645 1.00 37.49 ? 476 GLY C N   1 
ATOM   1652 C CA  . GLY C 1 34 ? -6.458  26.157 -41.017 1.00 38.59 ? 476 GLY C CA  1 
ATOM   1653 C C   . GLY C 1 34 ? -5.398  27.176 -41.399 1.00 38.46 ? 476 GLY C C   1 
ATOM   1654 O O   . GLY C 1 34 ? -4.683  26.990 -42.390 1.00 39.43 ? 476 GLY C O   1 
ATOM   1655 N N   . LEU C 1 35 ? -5.294  28.243 -40.608 1.00 37.58 ? 477 LEU C N   1 
ATOM   1656 C CA  . LEU C 1 35 ? -4.282  29.287 -40.810 1.00 37.85 ? 477 LEU C CA  1 
ATOM   1657 C C   . LEU C 1 35 ? -2.856  28.717 -40.834 1.00 37.88 ? 477 LEU C C   1 
ATOM   1658 O O   . LEU C 1 35 ? -2.064  29.044 -41.722 1.00 38.43 ? 477 LEU C O   1 
ATOM   1659 C CB  . LEU C 1 35 ? -4.414  30.370 -39.728 1.00 37.14 ? 477 LEU C CB  1 
ATOM   1660 C CG  . LEU C 1 35 ? -3.573  31.655 -39.788 1.00 38.13 ? 477 LEU C CG  1 
ATOM   1661 C CD1 . LEU C 1 35 ? -4.227  32.756 -38.951 1.00 39.08 ? 477 LEU C CD1 1 
ATOM   1662 C CD2 . LEU C 1 35 ? -2.140  31.439 -39.331 1.00 38.01 ? 477 LEU C CD2 1 
ATOM   1663 N N   . LEU C 1 36 ? -2.536  27.867 -39.858 1.00 37.66 ? 478 LEU C N   1 
ATOM   1664 C CA  . LEU C 1 36 ? -1.203  27.264 -39.767 1.00 38.09 ? 478 LEU C CA  1 
ATOM   1665 C C   . LEU C 1 36 ? -0.918  26.305 -40.916 1.00 39.60 ? 478 LEU C C   1 
ATOM   1666 O O   . LEU C 1 36 ? 0.219   26.209 -41.385 1.00 40.27 ? 478 LEU C O   1 
ATOM   1667 C CB  . LEU C 1 36 ? -1.016  26.542 -38.430 1.00 37.38 ? 478 LEU C CB  1 
ATOM   1668 C CG  . LEU C 1 36 ? -1.062  27.372 -37.141 1.00 35.63 ? 478 LEU C CG  1 
ATOM   1669 C CD1 . LEU C 1 36 ? -1.153  26.444 -35.926 1.00 32.03 ? 478 LEU C CD1 1 
ATOM   1670 C CD2 . LEU C 1 36 ? 0.138   28.324 -37.044 1.00 31.43 ? 478 LEU C CD2 1 
ATOM   1671 N N   . SER C 1 37 ? -1.957  25.601 -41.359 1.00 40.40 ? 479 SER C N   1 
ATOM   1672 C CA  . SER C 1 37 ? -1.858  24.679 -42.486 1.00 42.18 ? 479 SER C CA  1 
ATOM   1673 C C   . SER C 1 37 ? -1.554  25.404 -43.799 1.00 43.37 ? 479 SER C C   1 
ATOM   1674 O O   . SER C 1 37 ? -0.718  24.945 -44.576 1.00 44.75 ? 479 SER C O   1 
ATOM   1675 C CB  . SER C 1 37 ? -3.133  23.847 -42.608 1.00 42.81 ? 479 SER C CB  1 
ATOM   1676 O OG  . SER C 1 37 ? -3.201  23.193 -43.862 1.00 45.98 ? 479 SER C OG  1 
ATOM   1677 N N   . ARG C 1 38 ? -2.226  26.532 -44.034 1.00 43.20 ? 480 ARG C N   1 
ATOM   1678 C CA  . ARG C 1 38 ? -1.967  27.364 -45.220 1.00 44.61 ? 480 ARG C CA  1 
ATOM   1679 C C   . ARG C 1 38 ? -0.583  28.019 -45.178 1.00 44.55 ? 480 ARG C C   1 
ATOM   1680 O O   . ARG C 1 38 ? 0.037   28.256 -46.221 1.00 45.90 ? 480 ARG C O   1 
ATOM   1681 C CB  . ARG C 1 38 ? -3.057  28.433 -45.400 1.00 44.40 ? 480 ARG C CB  1 
ATOM   1682 C CG  . ARG C 1 38 ? -4.411  27.879 -45.855 1.00 46.00 ? 480 ARG C CG  1 
ATOM   1683 C CD  . ARG C 1 38 ? -5.448  28.982 -46.115 1.00 46.74 ? 480 ARG C CD  1 
ATOM   1684 N NE  . ARG C 1 38 ? -5.725  29.811 -44.938 1.00 47.64 ? 480 ARG C NE  1 
ATOM   1685 C CZ  . ARG C 1 38 ? -6.602  29.508 -43.980 1.00 48.96 ? 480 ARG C CZ  1 
ATOM   1686 N NH1 . ARG C 1 38 ? -7.303  28.381 -44.030 1.00 49.36 ? 480 ARG C NH1 1 
ATOM   1687 N NH2 . ARG C 1 38 ? -6.778  30.336 -42.958 1.00 47.02 ? 480 ARG C NH2 1 
ATOM   1688 N N   . LEU C 1 39 ? -0.109  28.308 -43.969 1.00 43.16 ? 481 LEU C N   1 
ATOM   1689 C CA  . LEU C 1 39 ? 1.201   28.922 -43.771 1.00 43.10 ? 481 LEU C CA  1 
ATOM   1690 C C   . LEU C 1 39 ? 2.364   27.920 -43.878 1.00 43.82 ? 481 LEU C C   1 
ATOM   1691 O O   . LEU C 1 39 ? 3.415   28.229 -44.464 1.00 44.60 ? 481 LEU C O   1 
ATOM   1692 C CB  . LEU C 1 39 ? 1.242   29.629 -42.412 1.00 41.59 ? 481 LEU C CB  1 
ATOM   1693 C CG  . LEU C 1 39 ? 2.574   30.183 -41.910 1.00 41.36 ? 481 LEU C CG  1 
ATOM   1694 C CD1 . LEU C 1 39 ? 3.059   31.348 -42.790 1.00 40.99 ? 481 LEU C CD1 1 
ATOM   1695 C CD2 . LEU C 1 39 ? 2.432   30.602 -40.459 1.00 39.33 ? 481 LEU C CD2 1 
ATOM   1696 N N   . LEU C 1 40 ? 2.178   26.736 -43.298 1.00 43.13 ? 482 LEU C N   1 
ATOM   1697 C CA  . LEU C 1 40 ? 3.249   25.739 -43.244 1.00 43.89 ? 482 LEU C CA  1 
ATOM   1698 C C   . LEU C 1 40 ? 3.221   24.771 -44.428 1.00 45.65 ? 482 LEU C C   1 
ATOM   1699 O O   . LEU C 1 40 ? 4.192   24.051 -44.664 1.00 46.90 ? 482 LEU C O   1 
ATOM   1700 C CB  . LEU C 1 40 ? 3.199   24.961 -41.922 1.00 43.01 ? 482 LEU C CB  1 
ATOM   1701 C CG  . LEU C 1 40 ? 3.469   25.722 -40.618 1.00 40.87 ? 482 LEU C CG  1 
ATOM   1702 C CD1 . LEU C 1 40 ? 2.856   24.986 -39.441 1.00 38.29 ? 482 LEU C CD1 1 
ATOM   1703 C CD2 . LEU C 1 40 ? 4.960   25.921 -40.410 1.00 41.70 ? 482 LEU C CD2 1 
ATOM   1704 N N   . LYS C 1 41 ? 2.114   24.777 -45.170 1.00 46.04 ? 483 LYS C N   1 
ATOM   1705 C CA  . LYS C 1 41 ? 1.859   23.797 -46.227 1.00 48.13 ? 483 LYS C CA  1 
ATOM   1706 C C   . LYS C 1 41 ? 1.979   22.365 -45.703 1.00 48.45 ? 483 LYS C C   1 
ATOM   1707 O O   . LYS C 1 41 ? 2.742   21.546 -46.216 1.00 50.23 ? 483 LYS C O   1 
ATOM   1708 C CB  . LYS C 1 41 ? 2.712   24.074 -47.475 1.00 49.90 ? 483 LYS C CB  1 
ATOM   1709 C CG  . LYS C 1 41 ? 1.981   24.960 -48.461 0.50 51.49 ? 483 LYS C CG  1 
ATOM   1710 C CD  . LYS C 1 41 ? 2.832   26.103 -48.959 0.50 55.10 ? 483 LYS C CD  1 
ATOM   1711 C CE  . LYS C 1 41 ? 1.945   27.165 -49.577 0.50 57.35 ? 483 LYS C CE  1 
ATOM   1712 N NZ  . LYS C 1 41 ? 2.725   28.218 -50.265 1.00 59.16 ? 483 LYS C NZ  1 
ATOM   1713 N N   . VAL C 1 42 ? 1.201   22.103 -44.656 1.00 46.96 ? 484 VAL C N   1 
ATOM   1714 C CA  . VAL C 1 42 ? 1.095   20.800 -44.005 1.00 47.13 ? 484 VAL C CA  1 
ATOM   1715 C C   . VAL C 1 42 ? -0.403  20.536 -43.799 1.00 46.90 ? 484 VAL C C   1 
ATOM   1716 O O   . VAL C 1 42 ? -1.136  21.443 -43.396 1.00 45.20 ? 484 VAL C O   1 
ATOM   1717 C CB  . VAL C 1 42 ? 1.855   20.791 -42.639 1.00 45.79 ? 484 VAL C CB  1 
ATOM   1718 C CG1 . VAL C 1 42 ? 1.551   19.533 -41.825 1.00 46.19 ? 484 VAL C CG1 1 
ATOM   1719 C CG2 . VAL C 1 42 ? 3.353   20.935 -42.850 1.00 45.61 ? 484 VAL C CG2 1 
ATOM   1720 N N   . PRO C 1 43 ? -0.871  19.303 -44.093 1.00 48.78 ? 485 PRO C N   1 
ATOM   1721 C CA  . PRO C 1 43 ? -2.306  18.999 -43.964 1.00 49.14 ? 485 PRO C CA  1 
ATOM   1722 C C   . PRO C 1 43 ? -2.875  19.269 -42.566 1.00 47.55 ? 485 PRO C C   1 
ATOM   1723 O O   . PRO C 1 43 ? -2.192  19.039 -41.560 1.00 46.62 ? 485 PRO C O   1 
ATOM   1724 C CB  . PRO C 1 43 ? -2.373  17.507 -44.291 1.00 51.51 ? 485 PRO C CB  1 
ATOM   1725 C CG  . PRO C 1 43 ? -1.194  17.272 -45.196 1.00 52.60 ? 485 PRO C CG  1 
ATOM   1726 C CD  . PRO C 1 43 ? -0.118  18.173 -44.677 1.00 50.74 ? 485 PRO C CD  1 
ATOM   1727 N N   . VAL C 1 44 ? -4.115  19.759 -42.519 1.00 47.38 ? 486 VAL C N   1 
ATOM   1728 C CA  . VAL C 1 44 ? -4.813  20.050 -41.257 1.00 46.14 ? 486 VAL C CA  1 
ATOM   1729 C C   . VAL C 1 44 ? -4.803  18.859 -40.292 1.00 46.48 ? 486 VAL C C   1 
ATOM   1730 O O   . VAL C 1 44 ? -4.643  19.040 -39.084 1.00 45.44 ? 486 VAL C O   1 
ATOM   1731 C CB  . VAL C 1 44 ? -6.270  20.546 -41.509 1.00 46.58 ? 486 VAL C CB  1 
ATOM   1732 C CG1 . VAL C 1 44 ? -7.131  20.445 -40.247 1.00 46.00 ? 486 VAL C CG1 1 
ATOM   1733 C CG2 . VAL C 1 44 ? -6.261  21.981 -42.029 1.00 45.88 ? 486 VAL C CG2 1 
ATOM   1734 N N   . SER C 1 45 ? -4.944  17.650 -40.835 1.00 48.21 ? 487 SER C N   1 
ATOM   1735 C CA  . SER C 1 45 ? -5.040  16.427 -40.033 1.00 48.90 ? 487 SER C CA  1 
ATOM   1736 C C   . SER C 1 45 ? -3.717  15.986 -39.392 1.00 48.47 ? 487 SER C C   1 
ATOM   1737 O O   . SER C 1 45 ? -3.706  15.110 -38.527 1.00 49.04 ? 487 SER C O   1 
ATOM   1738 C CB  . SER C 1 45 ? -5.643  15.284 -40.863 1.00 51.64 ? 487 SER C CB  1 
ATOM   1739 O OG  . SER C 1 45 ? -4.948  15.102 -42.088 1.00 52.68 ? 487 SER C OG  1 
ATOM   1740 N N   . ASP C 1 46 ? -2.612  16.600 -39.814 1.00 47.77 ? 488 ASP C N   1 
ATOM   1741 C CA  . ASP C 1 46 ? -1.274  16.271 -39.293 1.00 47.39 ? 488 ASP C CA  1 
ATOM   1742 C C   . ASP C 1 46 ? -0.840  17.151 -38.116 1.00 44.98 ? 488 ASP C C   1 
ATOM   1743 O O   . ASP C 1 46 ? 0.084   16.793 -37.381 1.00 44.88 ? 488 ASP C O   1 
ATOM   1744 C CB  . ASP C 1 46 ? -0.220  16.363 -40.407 1.00 48.37 ? 488 ASP C CB  1 
ATOM   1745 C CG  . ASP C 1 46 ? -0.245  15.169 -41.349 1.00 51.94 ? 488 ASP C CG  1 
ATOM   1746 O OD1 . ASP C 1 46 ? -0.766  14.100 -40.964 1.00 53.88 ? 488 ASP C OD1 1 
ATOM   1747 O OD2 . ASP C 1 46 ? 0.273   15.297 -42.480 1.00 55.69 ? 488 ASP C OD2 1 
ATOM   1748 N N   . LEU C 1 47 ? -1.507  18.293 -37.952 1.00 43.15 ? 489 LEU C N   1 
ATOM   1749 C CA  . LEU C 1 47 ? -1.125  19.302 -36.974 1.00 41.24 ? 489 LEU C CA  1 
ATOM   1750 C C   . LEU C 1 47 ? -1.564  18.956 -35.557 1.00 40.90 ? 489 LEU C C   1 
ATOM   1751 O O   . LEU C 1 47 ? -2.722  18.607 -35.325 1.00 41.31 ? 489 LEU C O   1 
ATOM   1752 C CB  . LEU C 1 47 ? -1.703  20.666 -37.365 1.00 40.31 ? 489 LEU C CB  1 
ATOM   1753 C CG  . LEU C 1 47 ? -1.125  21.374 -38.590 1.00 39.82 ? 489 LEU C CG  1 
ATOM   1754 C CD1 . LEU C 1 47 ? -2.042  22.515 -38.997 1.00 37.65 ? 489 LEU C CD1 1 
ATOM   1755 C CD2 . LEU C 1 47 ? 0.280   21.881 -38.320 1.00 34.70 ? 489 LEU C CD2 1 
ATOM   1756 N N   . LEU C 1 48 ? -0.626  19.058 -34.616 1.00 40.32 ? 490 LEU C N   1 
ATOM   1757 C CA  . LEU C 1 48 ? -0.911  18.843 -33.192 1.00 39.85 ? 490 LEU C CA  1 
ATOM   1758 C C   . LEU C 1 48 ? -0.730  20.142 -32.405 1.00 37.82 ? 490 LEU C C   1 
ATOM   1759 O O   . LEU C 1 48 ? 0.382   20.647 -32.281 1.00 37.28 ? 490 LEU C O   1 
ATOM   1760 C CB  . LEU C 1 48 ? -0.015  17.739 -32.608 1.00 40.90 ? 490 LEU C CB  1 
ATOM   1761 C CG  . LEU C 1 48 ? -0.288  16.283 -33.015 1.00 44.55 ? 490 LEU C CG  1 
ATOM   1762 C CD1 . LEU C 1 48 ? 0.854   15.364 -32.571 1.00 46.21 ? 490 LEU C CD1 1 
ATOM   1763 C CD2 . LEU C 1 48 ? -1.618  15.782 -32.456 1.00 46.53 ? 490 LEU C CD2 1 
ATOM   1764 N N   . LEU C 1 49 ? -1.832  20.676 -31.884 1.00 37.01 ? 491 LEU C N   1 
ATOM   1765 C CA  . LEU C 1 49 ? -1.791  21.900 -31.099 1.00 35.99 ? 491 LEU C CA  1 
ATOM   1766 C C   . LEU C 1 49 ? -1.864  21.682 -29.603 1.00 36.20 ? 491 LEU C C   1 
ATOM   1767 O O   . LEU C 1 49 ? -2.733  20.962 -29.091 1.00 36.76 ? 491 LEU C O   1 
ATOM   1768 C CB  . LEU C 1 49 ? -2.911  22.854 -31.498 1.00 35.67 ? 491 LEU C CB  1 
ATOM   1769 C CG  . LEU C 1 49 ? -2.727  23.836 -32.653 1.00 36.68 ? 491 LEU C CG  1 
ATOM   1770 C CD1 . LEU C 1 49 ? -3.919  24.783 -32.639 1.00 38.08 ? 491 LEU C CD1 1 
ATOM   1771 C CD2 . LEU C 1 49 ? -1.430  24.618 -32.537 1.00 36.34 ? 491 LEU C CD2 1 
ATOM   1772 N N   . SER C 1 50 ? -0.932  22.322 -28.912 1.00 35.76 ? 492 SER C N   1 
ATOM   1773 C CA  . SER C 1 50 ? -1.031  22.533 -27.487 1.00 35.99 ? 492 SER C CA  1 
ATOM   1774 C C   . SER C 1 50 ? -0.601  23.974 -27.231 1.00 35.82 ? 492 SER C C   1 
ATOM   1775 O O   . SER C 1 50 ? -0.185  24.682 -28.159 1.00 35.00 ? 492 SER C O   1 
ATOM   1776 C CB  . SER C 1 50 ? -0.159  21.540 -26.719 1.00 36.59 ? 492 SER C CB  1 
ATOM   1777 O OG  . SER C 1 50 ? 1.195   21.639 -27.110 1.00 36.41 ? 492 SER C OG  1 
ATOM   1778 N N   . TYR C 1 51 ? -0.715  24.416 -25.984 1.00 36.50 ? 493 TYR C N   1 
ATOM   1779 C CA  . TYR C 1 51 ? -0.243  25.746 -25.634 1.00 36.99 ? 493 TYR C CA  1 
ATOM   1780 C C   . TYR C 1 51 ? 0.423   25.800 -24.255 1.00 38.67 ? 493 TYR C C   1 
ATOM   1781 O O   . TYR C 1 51 ? 0.254   24.891 -23.438 1.00 39.53 ? 493 TYR C O   1 
ATOM   1782 C CB  . TYR C 1 51 ? -1.370  26.776 -25.779 1.00 36.04 ? 493 TYR C CB  1 
ATOM   1783 C CG  . TYR C 1 51 ? -2.309  26.923 -24.601 1.00 35.78 ? 493 TYR C CG  1 
ATOM   1784 C CD1 . TYR C 1 51 ? -2.228  28.039 -23.758 1.00 33.66 ? 493 TYR C CD1 1 
ATOM   1785 C CD2 . TYR C 1 51 ? -3.302  25.976 -24.349 1.00 31.09 ? 493 TYR C CD2 1 
ATOM   1786 C CE1 . TYR C 1 51 ? -3.098  28.199 -22.691 1.00 30.14 ? 493 TYR C CE1 1 
ATOM   1787 C CE2 . TYR C 1 51 ? -4.179  26.131 -23.284 1.00 30.22 ? 493 TYR C CE2 1 
ATOM   1788 C CZ  . TYR C 1 51 ? -4.071  27.241 -22.457 1.00 31.45 ? 493 TYR C CZ  1 
ATOM   1789 O OH  . TYR C 1 51 ? -4.938  27.396 -21.394 1.00 31.49 ? 493 TYR C OH  1 
ATOM   1790 N N   . GLU C 1 52 ? 1.208   26.845 -24.018 1.00 39.79 ? 494 GLU C N   1 
ATOM   1791 C CA  . GLU C 1 52 ? 1.788   27.063 -22.696 1.00 42.24 ? 494 GLU C CA  1 
ATOM   1792 C C   . GLU C 1 52 ? 1.716   28.519 -22.254 1.00 43.22 ? 494 GLU C C   1 
ATOM   1793 O O   . GLU C 1 52 ? 1.509   29.425 -23.070 1.00 42.65 ? 494 GLU C O   1 
ATOM   1794 C CB  . GLU C 1 52 ? 3.220   26.495 -22.597 1.00 43.13 ? 494 GLU C CB  1 
ATOM   1795 C CG  . GLU C 1 52 ? 4.303   27.264 -23.327 1.00 44.24 ? 494 GLU C CG  1 
ATOM   1796 C CD  . GLU C 1 52 ? 5.632   26.520 -23.380 1.00 50.06 ? 494 GLU C CD  1 
ATOM   1797 O OE1 . GLU C 1 52 ? 5.776   25.474 -22.708 0.50 51.89 ? 494 GLU C OE1 1 
ATOM   1798 O OE2 . GLU C 1 52 ? 6.540   26.987 -24.100 0.50 51.81 ? 494 GLU C OE2 1 
ATOM   1799 N N   . SER C 1 53 ? 1.881   28.729 -20.953 1.00 45.39 ? 495 SER C N   1 
ATOM   1800 C CA  . SER C 1 53 ? 1.791   30.055 -20.355 1.00 47.12 ? 495 SER C CA  1 
ATOM   1801 C C   . SER C 1 53 ? 3.011   30.331 -19.479 1.00 49.30 ? 495 SER C C   1 
ATOM   1802 O O   . SER C 1 53 ? 3.496   29.425 -18.798 1.00 50.12 ? 495 SER C O   1 
ATOM   1803 C CB  . SER C 1 53 ? 0.510   30.158 -19.524 1.00 47.41 ? 495 SER C CB  1 
ATOM   1804 O OG  . SER C 1 53 ? 0.488   31.337 -18.734 1.00 50.85 ? 495 SER C OG  1 
ATOM   1805 N N   . PRO C 1 54 ? 3.513   31.585 -19.498 1.00 50.74 ? 496 PRO C N   1 
ATOM   1806 C CA  . PRO C 1 54 ? 4.544   32.061 -18.552 1.00 53.17 ? 496 PRO C CA  1 
ATOM   1807 C C   . PRO C 1 54 ? 4.083   32.046 -17.087 1.00 55.13 ? 496 PRO C C   1 
ATOM   1808 O O   . PRO C 1 54 ? 4.914   32.130 -16.179 1.00 57.23 ? 496 PRO C O   1 
ATOM   1809 C CB  . PRO C 1 54 ? 4.815   33.505 -19.005 1.00 53.93 ? 496 PRO C CB  1 
ATOM   1810 C CG  . PRO C 1 54 ? 3.673   33.868 -19.932 1.00 52.49 ? 496 PRO C CG  1 
ATOM   1811 C CD  . PRO C 1 54 ? 3.231   32.577 -20.552 1.00 50.03 ? 496 PRO C CD  1 
ATOM   1812 N N   . LYS C 1 55 ? 2.773   31.942 -16.867 1.00 54.91 ? 497 LYS C N   1 
ATOM   1813 C CA  . LYS C 1 55 ? 2.208   31.782 -15.519 1.00 56.71 ? 497 LYS C CA  1 
ATOM   1814 C C   . LYS C 1 55 ? 2.330   30.338 -14.997 1.00 56.68 ? 497 LYS C C   1 
ATOM   1815 O O   . LYS C 1 55 ? 2.092   30.079 -13.813 1.00 58.19 ? 497 LYS C O   1 
ATOM   1816 C CB  . LYS C 1 55 ? 0.736   32.200 -15.507 1.00 56.34 ? 497 LYS C CB  1 
ATOM   1817 C CG  . LYS C 1 55 ? 0.488   33.693 -15.450 0.50 58.06 ? 497 LYS C CG  1 
ATOM   1818 C CD  . LYS C 1 55 ? -0.999  33.959 -15.303 0.50 59.61 ? 497 LYS C CD  1 
ATOM   1819 C CE  . LYS C 1 55 ? -1.286  35.419 -15.028 0.50 62.09 ? 497 LYS C CE  1 
ATOM   1820 N NZ  . LYS C 1 55 ? -2.739  35.624 -14.780 0.50 63.20 ? 497 LYS C NZ  1 
ATOM   1821 N N   . LYS C 1 56 ? 2.685   29.410 -15.891 1.00 55.09 ? 498 LYS C N   1 
ATOM   1822 C CA  . LYS C 1 56 ? 2.808   27.979 -15.573 1.00 54.71 ? 498 LYS C CA  1 
ATOM   1823 C C   . LYS C 1 56 ? 3.933   27.382 -16.437 1.00 53.95 ? 498 LYS C C   1 
ATOM   1824 O O   . LYS C 1 56 ? 3.684   26.497 -17.260 1.00 52.68 ? 498 LYS C O   1 
ATOM   1825 C CB  . LYS C 1 56 ? 1.476   27.278 -15.876 1.00 53.42 ? 498 LYS C CB  1 
ATOM   1826 C CG  . LYS C 1 56 ? 0.896   26.414 -14.762 1.00 54.02 ? 498 LYS C CG  1 
ATOM   1827 C CD  . LYS C 1 56 ? 0.138   27.242 -13.724 1.00 54.78 ? 498 LYS C CD  1 
ATOM   1828 C CE  . LYS C 1 56 ? -0.535  26.349 -12.689 1.00 55.86 ? 498 LYS C CE  1 
ATOM   1829 N NZ  . LYS C 1 56 ? -0.635  26.975 -11.335 1.00 55.50 ? 498 LYS C NZ  1 
ATOM   1830 N N   . PRO C 1 57 ? 5.178   27.874 -16.265 1.00 55.09 ? 499 PRO C N   1 
ATOM   1831 C CA  . PRO C 1 57 ? 6.248   27.577 -17.240 1.00 54.52 ? 499 PRO C CA  1 
ATOM   1832 C C   . PRO C 1 57 ? 6.659   26.100 -17.352 1.00 54.40 ? 499 PRO C C   1 
ATOM   1833 O O   . PRO C 1 57 ? 6.911   25.443 -16.339 1.00 56.07 ? 499 PRO C O   1 
ATOM   1834 C CB  . PRO C 1 57 ? 7.428   28.427 -16.744 1.00 56.49 ? 499 PRO C CB  1 
ATOM   1835 C CG  . PRO C 1 57 ? 7.145   28.685 -15.308 1.00 58.27 ? 499 PRO C CG  1 
ATOM   1836 C CD  . PRO C 1 57 ? 5.657   28.741 -15.168 1.00 57.12 ? 499 PRO C CD  1 
ATOM   1837 N N   . GLY C 1 58 ? 6.728   25.602 -18.586 1.00 52.48 ? 500 GLY C N   1 
ATOM   1838 C CA  . GLY C 1 58 ? 7.136   24.220 -18.858 1.00 52.36 ? 500 GLY C CA  1 
ATOM   1839 C C   . GLY C 1 58 ? 5.982   23.249 -19.091 1.00 50.88 ? 500 GLY C C   1 
ATOM   1840 O O   . GLY C 1 58 ? 6.201   22.104 -19.511 1.00 50.83 ? 500 GLY C O   1 
ATOM   1841 N N   . ARG C 1 59 ? 4.758   23.724 -18.850 1.00 49.20 ? 501 ARG C N   1 
ATOM   1842 C CA  A ARG C 1 59 ? 3.576   22.867 -18.877 0.50 48.23 ? 501 ARG C CA  1 
ATOM   1843 C CA  B ARG C 1 59 ? 3.572   22.877 -18.877 0.50 48.34 ? 501 ARG C CA  1 
ATOM   1844 C C   . ARG C 1 59 ? 2.695   23.123 -20.105 1.00 46.39 ? 501 ARG C C   1 
ATOM   1845 O O   . ARG C 1 59 ? 2.280   24.253 -20.367 1.00 45.60 ? 501 ARG C O   1 
ATOM   1846 C CB  A ARG C 1 59 ? 2.769   23.031 -17.582 0.50 48.95 ? 501 ARG C CB  1 
ATOM   1847 C CB  B ARG C 1 59 ? 2.764   23.074 -17.592 0.50 49.07 ? 501 ARG C CB  1 
ATOM   1848 C CG  A ARG C 1 59 ? 3.605   22.991 -16.302 0.50 48.85 ? 501 ARG C CG  1 
ATOM   1849 C CG  B ARG C 1 59 ? 2.876   21.939 -16.589 0.50 49.44 ? 501 ARG C CG  1 
ATOM   1850 C CD  A ARG C 1 59 ? 3.863   21.572 -15.800 0.50 42.28 ? 501 ARG C CD  1 
ATOM   1851 C CD  B ARG C 1 59 ? 4.289   21.658 -16.113 0.50 45.38 ? 501 ARG C CD  1 
ATOM   1852 N NE  A ARG C 1 59 ? 4.973   20.896 -16.466 0.50 37.02 ? 501 ARG C NE  1 
ATOM   1853 N NE  B ARG C 1 59 ? 5.050   20.813 -17.030 0.50 41.45 ? 501 ARG C NE  1 
ATOM   1854 C CZ  A ARG C 1 59 ? 6.257   21.198 -16.283 0.50 34.22 ? 501 ARG C CZ  1 
ATOM   1855 C CZ  B ARG C 1 59 ? 4.730   19.563 -17.354 0.50 39.23 ? 501 ARG C CZ  1 
ATOM   1856 N NH1 A ARG C 1 59 ? 6.606   22.194 -15.475 0.50 32.36 ? 501 ARG C NH1 1 
ATOM   1857 N NH1 B ARG C 1 59 ? 3.630   18.995 -16.865 0.50 37.78 ? 501 ARG C NH1 1 
ATOM   1858 N NH2 A ARG C 1 59 ? 7.194   20.513 -16.923 0.50 28.60 ? 501 ARG C NH2 1 
ATOM   1859 N NH2 B ARG C 1 59 ? 5.509   18.884 -18.185 0.50 37.06 ? 501 ARG C NH2 1 
ATOM   1860 N N   . GLU C 1 60 ? 2.415   22.056 -20.852 1.00 45.98 ? 502 GLU C N   1 
ATOM   1861 C CA  . GLU C 1 60 ? 1.619   22.145 -22.077 1.00 44.80 ? 502 GLU C CA  1 
ATOM   1862 C C   . GLU C 1 60 ? 0.178   21.705 -21.857 1.00 44.59 ? 502 GLU C C   1 
ATOM   1863 O O   . GLU C 1 60 ? -0.070  20.580 -21.423 1.00 45.62 ? 502 GLU C O   1 
ATOM   1864 C CB  . GLU C 1 60 ? 2.234   21.289 -23.189 1.00 44.91 ? 502 GLU C CB  1 
ATOM   1865 C CG  . GLU C 1 60 ? 3.605   21.730 -23.675 1.00 46.16 ? 502 GLU C CG  1 
ATOM   1866 C CD  . GLU C 1 60 ? 4.071   20.933 -24.884 1.00 49.33 ? 502 GLU C CD  1 
ATOM   1867 O OE1 . GLU C 1 60 ? 3.213   20.531 -25.709 1.00 47.89 ? 502 GLU C OE1 1 
ATOM   1868 O OE2 . GLU C 1 60 ? 5.297   20.714 -25.012 1.00 49.64 ? 502 GLU C OE2 1 
ATOM   1869 N N   . ILE C 1 61 ? -0.766  22.595 -22.167 1.00 43.64 ? 503 ILE C N   1 
ATOM   1870 C CA  . ILE C 1 61 ? -2.192  22.275 -22.127 1.00 43.48 ? 503 ILE C CA  1 
ATOM   1871 C C   . ILE C 1 61 ? -2.638  21.899 -23.545 1.00 42.76 ? 503 ILE C C   1 
ATOM   1872 O O   . ILE C 1 61 ? -2.477  22.682 -24.478 1.00 41.68 ? 503 ILE C O   1 
ATOM   1873 C CB  . ILE C 1 61 ? -3.038  23.468 -21.588 1.00 43.40 ? 503 ILE C CB  1 
ATOM   1874 C CG1 . ILE C 1 61 ? -2.641  23.846 -20.154 1.00 45.21 ? 503 ILE C CG1 1 
ATOM   1875 C CG2 . ILE C 1 61 ? -4.520  23.151 -21.629 1.00 43.57 ? 503 ILE C CG2 1 
ATOM   1876 C CD1 . ILE C 1 61 ? -1.706  25.041 -20.050 1.00 44.59 ? 503 ILE C CD1 1 
ATOM   1877 N N   . GLU C 1 62 ? -3.179  20.697 -23.705 1.00 43.65 ? 504 GLU C N   1 
ATOM   1878 C CA  . GLU C 1 62 ? -3.543  20.191 -25.028 1.00 43.72 ? 504 GLU C CA  1 
ATOM   1879 C C   . GLU C 1 62 ? -4.771  20.906 -25.575 1.00 43.15 ? 504 GLU C C   1 
ATOM   1880 O O   . GLU C 1 62 ? -5.642  21.319 -24.813 1.00 43.81 ? 504 GLU C O   1 
ATOM   1881 C CB  . GLU C 1 62 ? -3.760  18.670 -24.998 1.00 45.18 ? 504 GLU C CB  1 
ATOM   1882 C CG  . GLU C 1 62 ? -2.452  17.852 -24.914 1.00 47.02 ? 504 GLU C CG  1 
ATOM   1883 C CD  . GLU C 1 62 ? -2.679  16.357 -24.730 0.50 51.35 ? 504 GLU C CD  1 
ATOM   1884 O OE1 . GLU C 1 62 ? -3.575  15.968 -23.950 0.50 52.51 ? 504 GLU C OE1 1 
ATOM   1885 O OE2 . GLU C 1 62 ? -1.946  15.567 -25.360 0.50 53.26 ? 504 GLU C OE2 1 
ATOM   1886 N N   . LEU C 1 63 ? -4.818  21.068 -26.893 1.00 42.48 ? 505 LEU C N   1 
ATOM   1887 C CA  . LEU C 1 63 ? -5.984  21.643 -27.565 1.00 42.41 ? 505 LEU C CA  1 
ATOM   1888 C C   . LEU C 1 63 ? -6.537  20.650 -28.587 1.00 43.35 ? 505 LEU C C   1 
ATOM   1889 O O   . LEU C 1 63 ? -6.248  20.755 -29.786 1.00 43.32 ? 505 LEU C O   1 
ATOM   1890 C CB  . LEU C 1 63 ? -5.627  22.976 -28.249 1.00 41.04 ? 505 LEU C CB  1 
ATOM   1891 C CG  . LEU C 1 63 ? -4.882  24.042 -27.441 1.00 39.25 ? 505 LEU C CG  1 
ATOM   1892 C CD1 . LEU C 1 63 ? -4.336  25.117 -28.354 1.00 38.56 ? 505 LEU C CD1 1 
ATOM   1893 C CD2 . LEU C 1 63 ? -5.778  24.656 -26.396 1.00 38.67 ? 505 LEU C CD2 1 
ATOM   1894 N N   . GLU C 1 64 ? -7.331  19.694 -28.108 1.00 44.63 ? 506 GLU C N   1 
ATOM   1895 C CA  . GLU C 1 64 ? -7.862  18.627 -28.966 1.00 46.32 ? 506 GLU C CA  1 
ATOM   1896 C C   . GLU C 1 64 ? -9.114  18.977 -29.784 1.00 46.69 ? 506 GLU C C   1 
ATOM   1897 O O   . GLU C 1 64 ? -9.064  18.955 -31.018 1.00 47.28 ? 506 GLU C O   1 
ATOM   1898 C CB  . GLU C 1 64 ? -8.078  17.341 -28.169 1.00 47.99 ? 506 GLU C CB  1 
ATOM   1899 C CG  . GLU C 1 64 ? -6.881  16.418 -28.207 0.50 49.31 ? 506 GLU C CG  1 
ATOM   1900 C CD  . GLU C 1 64 ? -6.528  15.970 -29.618 0.50 51.93 ? 506 GLU C CD  1 
ATOM   1901 O OE1 . GLU C 1 64 ? -7.373  15.336 -30.284 0.50 53.29 ? 506 GLU C OE1 1 
ATOM   1902 O OE2 . GLU C 1 64 ? -5.398  16.250 -30.063 0.50 52.77 ? 506 GLU C OE2 1 
ATOM   1903 N N   . ASN C 1 65 ? -10.220 19.295 -29.104 1.00 46.68 ? 507 ASN C N   1 
ATOM   1904 C CA  . ASN C 1 65 ? -11.514 19.538 -29.765 1.00 46.82 ? 507 ASN C CA  1 
ATOM   1905 C C   . ASN C 1 65 ? -11.475 20.689 -30.765 1.00 45.68 ? 507 ASN C C   1 
ATOM   1906 O O   . ASN C 1 65 ? -11.327 21.857 -30.386 1.00 44.43 ? 507 ASN C O   1 
ATOM   1907 C CB  . ASN C 1 65 ? -12.624 19.773 -28.736 1.00 47.49 ? 507 ASN C CB  1 
ATOM   1908 C CG  . ASN C 1 65 ? -14.007 19.437 -29.273 1.00 49.38 ? 507 ASN C CG  1 
ATOM   1909 O OD1 . ASN C 1 65 ? -14.347 19.750 -30.415 1.00 49.09 ? 507 ASN C OD1 1 
ATOM   1910 N ND2 . ASN C 1 65 ? -14.817 18.797 -28.439 1.00 50.53 ? 507 ASN C ND2 1 
ATOM   1911 N N   . ASP C 1 66 ? -11.629 20.337 -32.040 1.00 46.05 ? 508 ASP C N   1 
ATOM   1912 C CA  . ASP C 1 66 ? -11.549 21.285 -33.151 1.00 45.13 ? 508 ASP C CA  1 
ATOM   1913 C C   . ASP C 1 66 ? -12.577 22.408 -33.106 1.00 44.62 ? 508 ASP C C   1 
ATOM   1914 O O   . ASP C 1 66 ? -12.333 23.487 -33.647 1.00 44.23 ? 508 ASP C O   1 
ATOM   1915 C CB  . ASP C 1 66 ? -11.677 20.548 -34.489 1.00 46.61 ? 508 ASP C CB  1 
ATOM   1916 C CG  . ASP C 1 66 ? -10.383 19.880 -34.923 0.70 47.89 ? 508 ASP C CG  1 
ATOM   1917 O OD1 . ASP C 1 66 ? -9.326  20.116 -34.287 0.70 48.20 ? 508 ASP C OD1 1 
ATOM   1918 O OD2 . ASP C 1 66 ? -10.433 19.111 -35.909 0.70 52.58 ? 508 ASP C OD2 1 
ATOM   1919 N N   . LEU C 1 67 ? -13.723 22.158 -32.476 1.00 44.98 ? 509 LEU C N   1 
ATOM   1920 C CA  . LEU C 1 67 ? -14.819 23.132 -32.472 1.00 44.71 ? 509 LEU C CA  1 
ATOM   1921 C C   . LEU C 1 67 ? -14.797 24.123 -31.301 1.00 43.08 ? 509 LEU C C   1 
ATOM   1922 O O   . LEU C 1 67 ? -15.608 25.052 -31.248 1.00 43.60 ? 509 LEU C O   1 
ATOM   1923 C CB  . LEU C 1 67 ? -16.179 22.427 -32.556 1.00 46.95 ? 509 LEU C CB  1 
ATOM   1924 C CG  . LEU C 1 67 ? -16.612 21.820 -33.902 0.50 48.90 ? 509 LEU C CG  1 
ATOM   1925 C CD1 . LEU C 1 67 ? -18.113 21.536 -33.899 0.50 50.64 ? 509 LEU C CD1 1 
ATOM   1926 C CD2 . LEU C 1 67 ? -16.249 22.694 -35.103 0.50 47.72 ? 509 LEU C CD2 1 
ATOM   1927 N N   . LYS C 1 68 ? -13.869 23.933 -30.370 1.00 41.17 ? 510 LYS C N   1 
ATOM   1928 C CA  . LYS C 1 68 ? -13.785 24.805 -29.208 1.00 39.78 ? 510 LYS C CA  1 
ATOM   1929 C C   . LYS C 1 68 ? -12.871 25.988 -29.480 1.00 37.99 ? 510 LYS C C   1 
ATOM   1930 O O   . LYS C 1 68 ? -11.877 25.869 -30.197 1.00 36.72 ? 510 LYS C O   1 
ATOM   1931 C CB  . LYS C 1 68 ? -13.325 24.028 -27.971 1.00 39.70 ? 510 LYS C CB  1 
ATOM   1932 C CG  . LYS C 1 68 ? -14.310 22.939 -27.481 1.00 42.06 ? 510 LYS C CG  1 
ATOM   1933 C CD  . LYS C 1 68 ? -15.675 23.512 -27.102 1.00 44.77 ? 510 LYS C CD  1 
ATOM   1934 C CE  . LYS C 1 68 ? -16.477 22.533 -26.253 1.00 49.16 ? 510 LYS C CE  1 
ATOM   1935 N NZ  . LYS C 1 68 ? -17.840 23.062 -25.931 1.00 51.07 ? 510 LYS C NZ  1 
ATOM   1936 N N   . SER C 1 69 ? -13.229 27.134 -28.909 1.00 37.96 ? 511 SER C N   1 
ATOM   1937 C CA  . SER C 1 69 ? -12.478 28.367 -29.090 1.00 36.68 ? 511 SER C CA  1 
ATOM   1938 C C   . SER C 1 69 ? -11.215 28.384 -28.245 1.00 35.69 ? 511 SER C C   1 
ATOM   1939 O O   . SER C 1 69 ? -11.097 27.623 -27.278 1.00 35.94 ? 511 SER C O   1 
ATOM   1940 C CB  . SER C 1 69 ? -13.347 29.566 -28.725 1.00 37.51 ? 511 SER C CB  1 
ATOM   1941 O OG  . SER C 1 69 ? -13.785 29.472 -27.376 1.00 39.27 ? 511 SER C OG  1 
ATOM   1942 N N   . LEU C 1 70 ? -10.286 29.274 -28.609 1.00 34.81 ? 512 LEU C N   1 
ATOM   1943 C CA  . LEU C 1 70 ? -9.081  29.532 -27.822 1.00 33.73 ? 512 LEU C CA  1 
ATOM   1944 C C   . LEU C 1 70 ? -9.428  29.994 -26.414 1.00 34.47 ? 512 LEU C C   1 
ATOM   1945 O O   . LEU C 1 70 ? -8.781  29.589 -25.452 1.00 34.83 ? 512 LEU C O   1 
ATOM   1946 C CB  . LEU C 1 70 ? -8.201  30.584 -28.506 1.00 33.05 ? 512 LEU C CB  1 
ATOM   1947 C CG  . LEU C 1 70 ? -7.412  30.191 -29.755 1.00 31.03 ? 512 LEU C CG  1 
ATOM   1948 C CD1 . LEU C 1 70 ? -6.843  31.434 -30.436 1.00 28.14 ? 512 LEU C CD1 1 
ATOM   1949 C CD2 . LEU C 1 70 ? -6.301  29.208 -29.415 1.00 30.42 ? 512 LEU C CD2 1 
ATOM   1950 N N   . GLN C 1 71 ? -10.448 30.839 -26.301 1.00 35.51 ? 513 GLN C N   1 
ATOM   1951 C CA  . GLN C 1 71 ? -10.884 31.361 -25.007 1.00 37.17 ? 513 GLN C CA  1 
ATOM   1952 C C   . GLN C 1 71 ? -11.580 30.306 -24.150 1.00 37.68 ? 513 GLN C C   1 
ATOM   1953 O O   . GLN C 1 71 ? -11.544 30.383 -22.922 1.00 38.59 ? 513 GLN C O   1 
ATOM   1954 C CB  . GLN C 1 71 ? -11.786 32.583 -25.184 1.00 38.58 ? 513 GLN C CB  1 
ATOM   1955 C CG  . GLN C 1 71 ? -13.041 32.339 -26.034 1.00 41.75 ? 513 GLN C CG  1 
ATOM   1956 C CD  . GLN C 1 71 ? -13.748 33.624 -26.449 1.00 46.61 ? 513 GLN C CD  1 
ATOM   1957 O OE1 . GLN C 1 71 ? -14.879 33.591 -26.947 1.00 49.09 ? 513 GLN C OE1 1 
ATOM   1958 N NE2 . GLN C 1 71 ? -13.086 34.760 -26.244 1.00 47.93 ? 513 GLN C NE2 1 
ATOM   1959 N N   . PHE C 1 72 ? -12.216 29.328 -24.799 1.00 37.55 ? 514 PHE C N   1 
ATOM   1960 C CA  . PHE C 1 72 ? -12.780 28.175 -24.094 1.00 38.01 ? 514 PHE C CA  1 
ATOM   1961 C C   . PHE C 1 72 ? -11.676 27.443 -23.343 1.00 37.07 ? 514 PHE C C   1 
ATOM   1962 O O   . PHE C 1 72 ? -11.874 26.994 -22.212 1.00 38.02 ? 514 PHE C O   1 
ATOM   1963 C CB  . PHE C 1 72 ? -13.493 27.209 -25.055 1.00 38.19 ? 514 PHE C CB  1 
ATOM   1964 C CG  . PHE C 1 72 ? -13.960 25.946 -24.394 1.00 39.43 ? 514 PHE C CG  1 
ATOM   1965 C CD1 . PHE C 1 72 ? -15.188 25.906 -23.733 1.00 42.54 ? 514 PHE C CD1 1 
ATOM   1966 C CD2 . PHE C 1 72 ? -13.155 24.802 -24.394 1.00 38.47 ? 514 PHE C CD2 1 
ATOM   1967 C CE1 . PHE C 1 72 ? -15.611 24.733 -23.085 1.00 44.09 ? 514 PHE C CE1 1 
ATOM   1968 C CE2 . PHE C 1 72 ? -13.572 23.629 -23.756 1.00 38.09 ? 514 PHE C CE2 1 
ATOM   1969 C CZ  . PHE C 1 72 ? -14.798 23.595 -23.099 1.00 39.75 ? 514 PHE C CZ  1 
ATOM   1970 N N   . TYR C 1 73 ? -10.513 27.337 -23.985 1.00 35.55 ? 515 TYR C N   1 
ATOM   1971 C CA  . TYR C 1 73 ? -9.348  26.688 -23.403 1.00 34.98 ? 515 TYR C CA  1 
ATOM   1972 C C   . TYR C 1 73 ? -8.518  27.595 -22.494 1.00 35.23 ? 515 TYR C C   1 
ATOM   1973 O O   . TYR C 1 73 ? -7.372  27.273 -22.187 1.00 35.12 ? 515 TYR C O   1 
ATOM   1974 C CB  . TYR C 1 73 ? -8.467  26.125 -24.506 1.00 33.82 ? 515 TYR C CB  1 
ATOM   1975 C CG  . TYR C 1 73 ? -8.996  24.863 -25.139 1.00 35.10 ? 515 TYR C CG  1 
ATOM   1976 C CD1 . TYR C 1 73 ? -8.968  23.651 -24.451 1.00 37.51 ? 515 TYR C CD1 1 
ATOM   1977 C CD2 . TYR C 1 73 ? -9.494  24.874 -26.441 1.00 35.24 ? 515 TYR C CD2 1 
ATOM   1978 C CE1 . TYR C 1 73 ? -9.449  22.487 -25.032 1.00 39.17 ? 515 TYR C CE1 1 
ATOM   1979 C CE2 . TYR C 1 73 ? -9.970  23.721 -27.030 1.00 36.23 ? 515 TYR C CE2 1 
ATOM   1980 C CZ  . TYR C 1 73 ? -9.950  22.534 -26.326 1.00 38.65 ? 515 TYR C CZ  1 
ATOM   1981 O OH  . TYR C 1 73 ? -10.425 21.391 -26.921 1.00 41.23 ? 515 TYR C OH  1 
ATOM   1982 N N   . SER C 1 74 ? -9.103  28.716 -22.069 1.00 36.06 ? 516 SER C N   1 
ATOM   1983 C CA  . SER C 1 74 ? -8.456  29.685 -21.173 1.00 37.02 ? 516 SER C CA  1 
ATOM   1984 C C   . SER C 1 74 ? -7.140  30.270 -21.711 1.00 36.36 ? 516 SER C C   1 
ATOM   1985 O O   . SER C 1 74 ? -6.318  30.763 -20.943 1.00 37.29 ? 516 SER C O   1 
ATOM   1986 C CB  . SER C 1 74 ? -8.242  29.087 -19.775 1.00 37.98 ? 516 SER C CB  1 
ATOM   1987 O OG  . SER C 1 74 ? -9.467  28.708 -19.168 1.00 40.51 ? 516 SER C OG  1 
ATOM   1988 N N   . VAL C 1 75 ? -6.951  30.234 -23.026 1.00 35.79 ? 517 VAL C N   1 
ATOM   1989 C CA  . VAL C 1 75 ? -5.769  30.845 -23.644 1.00 35.62 ? 517 VAL C CA  1 
ATOM   1990 C C   . VAL C 1 75 ? -5.808  32.359 -23.445 1.00 37.02 ? 517 VAL C C   1 
ATOM   1991 O O   . VAL C 1 75 ? -6.817  33.005 -23.720 1.00 37.94 ? 517 VAL C O   1 
ATOM   1992 C CB  . VAL C 1 75 ? -5.648  30.494 -25.150 1.00 34.42 ? 517 VAL C CB  1 
ATOM   1993 C CG1 . VAL C 1 75 ? -4.516  31.286 -25.814 1.00 34.27 ? 517 VAL C CG1 1 
ATOM   1994 C CG2 . VAL C 1 75 ? -5.418  28.998 -25.336 1.00 32.98 ? 517 VAL C CG2 1 
ATOM   1995 N N   . GLU C 1 76 ? -4.712  32.913 -22.945 1.00 37.97 ? 518 GLU C N   1 
ATOM   1996 C CA  . GLU C 1 76 ? -4.647  34.337 -22.639 1.00 39.72 ? 518 GLU C CA  1 
ATOM   1997 C C   . GLU C 1 76 ? -3.658  35.051 -23.540 1.00 39.58 ? 518 GLU C C   1 
ATOM   1998 O O   . GLU C 1 76 ? -2.839  34.421 -24.215 1.00 38.31 ? 518 GLU C O   1 
ATOM   1999 C CB  . GLU C 1 76 ? -4.279  34.567 -21.169 1.00 40.96 ? 518 GLU C CB  1 
ATOM   2000 C CG  . GLU C 1 76 ? -5.395  34.229 -20.190 1.00 44.31 ? 518 GLU C CG  1 
ATOM   2001 C CD  . GLU C 1 76 ? -4.921  34.152 -18.743 1.00 50.13 ? 518 GLU C CD  1 
ATOM   2002 O OE1 . GLU C 1 76 ? -4.088  33.278 -18.424 1.00 49.63 ? 518 GLU C OE1 1 
ATOM   2003 O OE2 . GLU C 1 76 ? -5.396  34.966 -17.919 1.00 54.99 ? 518 GLU C OE2 1 
ATOM   2004 N N   . ASN C 1 77 ? -3.767  36.378 -23.549 1.00 41.02 ? 519 ASN C N   1 
ATOM   2005 C CA  . ASN C 1 77 ? -2.821  37.260 -24.214 1.00 41.57 ? 519 ASN C CA  1 
ATOM   2006 C C   . ASN C 1 77 ? -1.406  36.988 -23.690 1.00 41.78 ? 519 ASN C C   1 
ATOM   2007 O O   . ASN C 1 77 ? -1.193  36.961 -22.478 1.00 42.86 ? 519 ASN C O   1 
ATOM   2008 C CB  . ASN C 1 77 ? -3.229  38.711 -23.927 1.00 43.64 ? 519 ASN C CB  1 
ATOM   2009 C CG  . ASN C 1 77 ? -2.829  39.669 -25.022 1.00 44.94 ? 519 ASN C CG  1 
ATOM   2010 O OD1 . ASN C 1 77 ? -3.145  39.465 -26.197 1.00 46.18 ? 519 ASN C OD1 1 
ATOM   2011 N ND2 . ASN C 1 77 ? -2.144  40.742 -24.642 1.00 48.19 ? 519 ASN C ND2 1 
ATOM   2012 N N   . GLY C 1 78 ? -0.455  36.756 -24.597 1.00 41.22 ? 520 GLY C N   1 
ATOM   2013 C CA  . GLY C 1 78 ? 0.947   36.510 -24.223 1.00 41.56 ? 520 GLY C CA  1 
ATOM   2014 C C   . GLY C 1 78 ? 1.322   35.044 -24.087 1.00 40.85 ? 520 GLY C C   1 
ATOM   2015 O O   . GLY C 1 78 ? 2.482   34.714 -23.823 1.00 41.43 ? 520 GLY C O   1 
ATOM   2016 N N   . ASP C 1 79 ? 0.337   34.162 -24.263 1.00 39.76 ? 521 ASP C N   1 
ATOM   2017 C CA  . ASP C 1 79 ? 0.553   32.720 -24.201 1.00 39.18 ? 521 ASP C CA  1 
ATOM   2018 C C   . ASP C 1 79 ? 1.305   32.209 -25.430 1.00 38.54 ? 521 ASP C C   1 
ATOM   2019 O O   . ASP C 1 79 ? 1.395   32.897 -26.439 1.00 38.13 ? 521 ASP C O   1 
ATOM   2020 C CB  . ASP C 1 79 ? -0.782  31.980 -24.046 1.00 38.58 ? 521 ASP C CB  1 
ATOM   2021 C CG  . ASP C 1 79 ? -1.276  31.946 -22.610 1.00 39.96 ? 521 ASP C CG  1 
ATOM   2022 O OD1 . ASP C 1 79 ? -0.557  32.432 -21.704 1.00 43.22 ? 521 ASP C OD1 1 
ATOM   2023 O OD2 . ASP C 1 79 ? -2.390  31.424 -22.384 1.00 38.90 ? 521 ASP C OD2 1 
ATOM   2024 N N   . CYS C 1 80 ? 1.852   31.000 -25.326 1.00 38.88 ? 522 CYS C N   1 
ATOM   2025 C CA  . CYS C 1 80 ? 2.647   30.410 -26.400 1.00 39.17 ? 522 CYS C CA  1 
ATOM   2026 C C   . CYS C 1 80 ? 1.877   29.269 -27.043 1.00 37.74 ? 522 CYS C C   1 
ATOM   2027 O O   . CYS C 1 80 ? 1.397   28.367 -26.356 1.00 38.25 ? 522 CYS C O   1 
ATOM   2028 C CB  . CYS C 1 80 ? 3.990   29.904 -25.858 1.00 40.07 ? 522 CYS C CB  1 
ATOM   2029 S SG  . CYS C 1 80 ? 5.240   29.430 -27.122 1.00 45.81 ? 522 CYS C SG  1 
ATOM   2030 N N   . LEU C 1 81 ? 1.749   29.318 -28.360 1.00 36.56 ? 523 LEU C N   1 
ATOM   2031 C CA  . LEU C 1 81 ? 1.114   28.243 -29.099 1.00 35.33 ? 523 LEU C CA  1 
ATOM   2032 C C   . LEU C 1 81 ? 2.173   27.289 -29.642 1.00 35.10 ? 523 LEU C C   1 
ATOM   2033 O O   . LEU C 1 81 ? 3.122   27.712 -30.304 1.00 35.38 ? 523 LEU C O   1 
ATOM   2034 C CB  . LEU C 1 81 ? 0.282   28.821 -30.242 1.00 35.21 ? 523 LEU C CB  1 
ATOM   2035 C CG  . LEU C 1 81 ? -0.819  27.940 -30.822 1.00 35.19 ? 523 LEU C CG  1 
ATOM   2036 C CD1 . LEU C 1 81 ? -1.892  27.657 -29.773 1.00 36.86 ? 523 LEU C CD1 1 
ATOM   2037 C CD2 . LEU C 1 81 ? -1.424  28.614 -32.035 1.00 36.73 ? 523 LEU C CD2 1 
ATOM   2038 N N   . LEU C 1 82 ? 1.999   26.000 -29.372 1.00 34.40 ? 524 LEU C N   1 
ATOM   2039 C CA  . LEU C 1 82 ? 2.978   24.995 -29.766 1.00 34.57 ? 524 LEU C CA  1 
ATOM   2040 C C   . LEU C 1 82 ? 2.443   24.108 -30.871 1.00 34.06 ? 524 LEU C C   1 
ATOM   2041 O O   . LEU C 1 82 ? 1.506   23.335 -30.661 1.00 33.81 ? 524 LEU C O   1 
ATOM   2042 C CB  . LEU C 1 82 ? 3.404   24.144 -28.557 1.00 35.56 ? 524 LEU C CB  1 
ATOM   2043 C CG  . LEU C 1 82 ? 4.512   24.717 -27.672 1.00 36.73 ? 524 LEU C CG  1 
ATOM   2044 C CD1 . LEU C 1 82 ? 4.015   25.862 -26.803 1.00 38.42 ? 524 LEU C CD1 1 
ATOM   2045 C CD2 . LEU C 1 82 ? 5.079   23.616 -26.816 1.00 40.68 ? 524 LEU C CD2 1 
ATOM   2046 N N   . VAL C 1 83 ? 3.062   24.217 -32.043 1.00 33.96 ? 525 VAL C N   1 
ATOM   2047 C CA  . VAL C 1 83 ? 2.596   23.536 -33.243 1.00 33.98 ? 525 VAL C CA  1 
ATOM   2048 C C   . VAL C 1 83 ? 3.536   22.398 -33.600 1.00 35.54 ? 525 VAL C C   1 
ATOM   2049 O O   . VAL C 1 83 ? 4.732   22.615 -33.787 1.00 36.37 ? 525 VAL C O   1 
ATOM   2050 C CB  . VAL C 1 83 ? 2.520   24.500 -34.445 1.00 33.97 ? 525 VAL C CB  1 
ATOM   2051 C CG1 . VAL C 1 83 ? 1.831   23.831 -35.614 1.00 33.77 ? 525 VAL C CG1 1 
ATOM   2052 C CG2 . VAL C 1 83 ? 1.809   25.803 -34.066 1.00 31.75 ? 525 VAL C CG2 1 
ATOM   2053 N N   . ARG C 1 84 ? 2.982   21.189 -33.691 1.00 36.38 ? 526 ARG C N   1 
ATOM   2054 C CA  . ARG C 1 84 ? 3.725   20.000 -34.109 1.00 38.11 ? 526 ARG C CA  1 
ATOM   2055 C C   . ARG C 1 84 ? 3.043   19.336 -35.307 1.00 39.29 ? 526 ARG C C   1 
ATOM   2056 O O   . ARG C 1 84 ? 1.839   19.528 -35.539 1.00 38.69 ? 526 ARG C O   1 
ATOM   2057 C CB  . ARG C 1 84 ? 3.837   18.988 -32.961 1.00 38.75 ? 526 ARG C CB  1 
ATOM   2058 C CG  . ARG C 1 84 ? 4.841   19.344 -31.863 1.00 39.28 ? 526 ARG C CG  1 
ATOM   2059 C CD  . ARG C 1 84 ? 4.942   18.215 -30.839 1.00 40.91 ? 526 ARG C CD  1 
ATOM   2060 N NE  . ARG C 1 84 ? 5.821   18.541 -29.712 1.00 41.85 ? 526 ARG C NE  1 
ATOM   2061 C CZ  . ARG C 1 84 ? 5.431   19.171 -28.603 1.00 40.14 ? 526 ARG C CZ  1 
ATOM   2062 N NH1 . ARG C 1 84 ? 4.165   19.556 -28.457 1.00 37.26 ? 526 ARG C NH1 1 
ATOM   2063 N NH2 . ARG C 1 84 ? 6.308   19.415 -27.632 1.00 38.92 ? 526 ARG C NH2 1 
ATOM   2064 N N   . TRP C 1 85 ? 3.833   18.566 -36.059 1.00 40.97 ? 527 TRP C N   1 
ATOM   2065 C CA  . TRP C 1 85 ? 3.365   17.768 -37.191 1.00 42.62 ? 527 TRP C CA  1 
ATOM   2066 C C   . TRP C 1 85 ? 4.407   16.696 -37.523 1.00 45.25 ? 527 TRP C C   1 
ATOM   2067 O O   . TRP C 1 85 ? 4.119   15.679 -38.153 1.00 47.10 ? 527 TRP C O   1 
ATOM   2068 C CB  . TRP C 1 85 ? 3.068   18.643 -38.424 1.00 42.34 ? 527 TRP C CB  1 
ATOM   2069 C CG  . TRP C 1 85 ? 4.266   19.355 -38.997 1.00 41.61 ? 527 TRP C CG  1 
ATOM   2070 C CD1 . TRP C 1 85 ? 5.087   18.910 -39.998 1.00 42.10 ? 527 TRP C CD1 1 
ATOM   2071 C CD2 . TRP C 1 85 ? 4.772   20.639 -38.605 1.00 39.61 ? 527 TRP C CD2 1 
ATOM   2072 N NE1 . TRP C 1 85 ? 6.074   19.834 -40.248 1.00 42.32 ? 527 TRP C NE1 1 
ATOM   2073 C CE2 . TRP C 1 85 ? 5.904   20.905 -39.409 1.00 40.21 ? 527 TRP C CE2 1 
ATOM   2074 C CE3 . TRP C 1 85 ? 4.386   21.587 -37.646 1.00 36.83 ? 527 TRP C CE3 1 
ATOM   2075 C CZ2 . TRP C 1 85 ? 6.648   22.079 -39.286 1.00 37.17 ? 527 TRP C CZ2 1 
ATOM   2076 C CZ3 . TRP C 1 85 ? 5.136   22.760 -37.522 1.00 33.27 ? 527 TRP C CZ3 1 
ATOM   2077 C CH2 . TRP C 1 85 ? 6.252   22.989 -38.338 1.00 35.96 ? 527 TRP C CH2 1 
ATOM   2078 O OXT . TRP C 1 85 ? 5.577   16.813 -37.155 1.00 45.94 ? 527 TRP C OXT 1 
ATOM   2079 N N   . GLN D 1 2  ? -5.366  49.357 -11.503 1.00 51.98 ? 444 GLN D N   1 
ATOM   2080 C CA  . GLN D 1 2  ? -4.665  49.742 -10.243 1.00 50.68 ? 444 GLN D CA  1 
ATOM   2081 C C   . GLN D 1 2  ? -5.637  49.845 -9.061  1.00 48.07 ? 444 GLN D C   1 
ATOM   2082 O O   . GLN D 1 2  ? -5.474  49.145 -8.064  1.00 46.48 ? 444 GLN D O   1 
ATOM   2083 C CB  . GLN D 1 2  ? -3.912  51.061 -10.421 1.00 52.94 ? 444 GLN D CB  1 
ATOM   2084 C CG  . GLN D 1 2  ? -2.627  51.123 -9.619  1.00 54.35 ? 444 GLN D CG  1 
ATOM   2085 C CD  . GLN D 1 2  ? -2.325  52.515 -9.125  1.00 59.96 ? 444 GLN D CD  1 
ATOM   2086 O OE1 . GLN D 1 2  ? -3.108  53.097 -8.374  1.00 60.89 ? 444 GLN D OE1 1 
ATOM   2087 N NE2 . GLN D 1 2  ? -1.185  53.061 -9.542  1.00 59.88 ? 444 GLN D NE2 1 
ATOM   2088 N N   . LEU D 1 3  ? -6.632  50.725 -9.169  1.00 47.86 ? 445 LEU D N   1 
ATOM   2089 C CA  . LEU D 1 3  ? -7.684  50.827 -8.153  1.00 45.37 ? 445 LEU D CA  1 
ATOM   2090 C C   . LEU D 1 3  ? -9.019  50.310 -8.705  1.00 44.69 ? 445 LEU D C   1 
ATOM   2091 O O   . LEU D 1 3  ? -9.642  50.934 -9.566  1.00 46.41 ? 445 LEU D O   1 
ATOM   2092 C CB  . LEU D 1 3  ? -7.803  52.256 -7.616  1.00 46.27 ? 445 LEU D CB  1 
ATOM   2093 C CG  . LEU D 1 3  ? -8.673  52.458 -6.373  1.00 44.66 ? 445 LEU D CG  1 
ATOM   2094 C CD1 . LEU D 1 3  ? -8.139  51.702 -5.156  1.00 39.51 ? 445 LEU D CD1 1 
ATOM   2095 C CD2 . LEU D 1 3  ? -8.796  53.934 -6.067  1.00 45.52 ? 445 LEU D CD2 1 
ATOM   2096 N N   . LEU D 1 4  ? -9.444  49.157 -8.199  1.00 41.97 ? 446 LEU D N   1 
ATOM   2097 C CA  . LEU D 1 4  ? -10.557 48.417 -8.792  1.00 41.52 ? 446 LEU D CA  1 
ATOM   2098 C C   . LEU D 1 4  ? -11.885 48.652 -8.067  1.00 40.51 ? 446 LEU D C   1 
ATOM   2099 O O   . LEU D 1 4  ? -11.984 48.428 -6.861  1.00 39.11 ? 446 LEU D O   1 
ATOM   2100 C CB  . LEU D 1 4  ? -10.232 46.913 -8.836  1.00 40.06 ? 446 LEU D CB  1 
ATOM   2101 C CG  . LEU D 1 4  ? -8.927  46.472 -9.514  1.00 40.02 ? 446 LEU D CG  1 
ATOM   2102 C CD1 . LEU D 1 4  ? -8.563  45.035 -9.139  1.00 34.33 ? 446 LEU D CD1 1 
ATOM   2103 C CD2 . LEU D 1 4  ? -8.962  46.659 -11.041 1.00 40.25 ? 446 LEU D CD2 1 
ATOM   2104 N N   . THR D 1 5  ? -12.895 49.109 -8.804  1.00 41.61 ? 447 THR D N   1 
ATOM   2105 C CA  . THR D 1 5  ? -14.251 49.191 -8.265  1.00 41.45 ? 447 THR D CA  1 
ATOM   2106 C C   . THR D 1 5  ? -14.934 47.822 -8.371  1.00 40.47 ? 447 THR D C   1 
ATOM   2107 O O   . THR D 1 5  ? -15.323 47.389 -9.458  1.00 41.86 ? 447 THR D O   1 
ATOM   2108 C CB  . THR D 1 5  ? -15.094 50.275 -8.972  1.00 44.13 ? 447 THR D CB  1 
ATOM   2109 O OG1 . THR D 1 5  ? -14.464 51.548 -8.806  1.00 44.49 ? 447 THR D OG1 1 
ATOM   2110 C CG2 . THR D 1 5  ? -16.503 50.338 -8.389  1.00 43.87 ? 447 THR D CG2 1 
ATOM   2111 N N   . LEU D 1 6  ? -15.061 47.140 -7.237  1.00 38.37 ? 448 LEU D N   1 
ATOM   2112 C CA  . LEU D 1 6  ? -15.674 45.816 -7.218  1.00 37.70 ? 448 LEU D CA  1 
ATOM   2113 C C   . LEU D 1 6  ? -17.010 45.849 -6.501  1.00 37.81 ? 448 LEU D C   1 
ATOM   2114 O O   . LEU D 1 6  ? -17.143 46.461 -5.430  1.00 37.43 ? 448 LEU D O   1 
ATOM   2115 C CB  . LEU D 1 6  ? -14.744 44.766 -6.582  1.00 35.67 ? 448 LEU D CB  1 
ATOM   2116 C CG  . LEU D 1 6  ? -13.340 44.605 -7.185  1.00 36.36 ? 448 LEU D CG  1 
ATOM   2117 C CD1 . LEU D 1 6  ? -12.583 43.485 -6.499  1.00 34.89 ? 448 LEU D CD1 1 
ATOM   2118 C CD2 . LEU D 1 6  ? -13.378 44.382 -8.711  1.00 37.59 ? 448 LEU D CD2 1 
ATOM   2119 N N   . LYS D 1 7  ? -17.994 45.193 -7.112  1.00 38.40 ? 449 LYS D N   1 
ATOM   2120 C CA  . LYS D 1 7  ? -19.305 45.028 -6.513  1.00 38.65 ? 449 LYS D CA  1 
ATOM   2121 C C   . LYS D 1 7  ? -19.299 43.708 -5.754  1.00 36.94 ? 449 LYS D C   1 
ATOM   2122 O O   . LYS D 1 7  ? -18.698 42.736 -6.208  1.00 36.41 ? 449 LYS D O   1 
ATOM   2123 C CB  . LYS D 1 7  ? -20.390 45.072 -7.587  1.00 40.56 ? 449 LYS D CB  1 
ATOM   2124 C CG  . LYS D 1 7  ? -20.218 46.279 -8.496  1.00 44.27 ? 449 LYS D CG  1 
ATOM   2125 C CD  . LYS D 1 7  ? -21.358 46.493 -9.472  1.00 49.14 ? 449 LYS D CD  1 
ATOM   2126 C CE  . LYS D 1 7  ? -20.997 47.641 -10.419 1.00 51.32 ? 449 LYS D CE  1 
ATOM   2127 N NZ  . LYS D 1 7  ? -22.192 48.289 -11.006 1.00 53.52 ? 449 LYS D NZ  1 
ATOM   2128 N N   . ILE D 1 8  ? -19.941 43.690 -4.588  1.00 35.77 ? 450 ILE D N   1 
ATOM   2129 C CA  . ILE D 1 8  ? -19.863 42.547 -3.694  1.00 33.95 ? 450 ILE D CA  1 
ATOM   2130 C C   . ILE D 1 8  ? -21.232 41.915 -3.565  1.00 34.19 ? 450 ILE D C   1 
ATOM   2131 O O   . ILE D 1 8  ? -22.229 42.621 -3.410  1.00 35.14 ? 450 ILE D O   1 
ATOM   2132 C CB  . ILE D 1 8  ? -19.345 42.928 -2.257  1.00 33.10 ? 450 ILE D CB  1 
ATOM   2133 C CG1 . ILE D 1 8  ? -18.146 43.888 -2.289  1.00 31.87 ? 450 ILE D CG1 1 
ATOM   2134 C CG2 . ILE D 1 8  ? -19.038 41.675 -1.434  1.00 32.07 ? 450 ILE D CG2 1 
ATOM   2135 C CD1 . ILE D 1 8  ? -16.941 43.431 -3.055  1.00 31.05 ? 450 ILE D CD1 1 
ATOM   2136 N N   . LYS D 1 9  ? -21.255 40.584 -3.614  1.00 33.19 ? 451 LYS D N   1 
ATOM   2137 C CA  . LYS D 1 9  ? -22.457 39.789 -3.452  1.00 33.61 ? 451 LYS D CA  1 
ATOM   2138 C C   . LYS D 1 9  ? -22.249 38.707 -2.382  1.00 32.77 ? 451 LYS D C   1 
ATOM   2139 O O   . LYS D 1 9  ? -21.164 38.101 -2.294  1.00 31.68 ? 451 LYS D O   1 
ATOM   2140 C CB  . LYS D 1 9  ? -22.833 39.142 -4.792  1.00 35.13 ? 451 LYS D CB  1 
ATOM   2141 C CG  . LYS D 1 9  ? -24.112 38.269 -4.775  1.00 36.91 ? 451 LYS D CG  1 
ATOM   2142 C CD  . LYS D 1 9  ? -24.392 37.616 -6.125  1.00 41.54 ? 451 LYS D CD  1 
ATOM   2143 C CE  . LYS D 1 9  ? -24.798 38.633 -7.182  1.00 47.67 ? 451 LYS D CE  1 
ATOM   2144 N NZ  . LYS D 1 9  ? -25.305 37.978 -8.423  1.00 51.70 ? 451 LYS D NZ  1 
ATOM   2145 N N   . TYR D 1 10 ? -23.286 38.497 -1.565  1.00 33.12 ? 452 TYR D N   1 
ATOM   2146 C CA  . TYR D 1 10 ? -23.406 37.332 -0.689  1.00 32.93 ? 452 TYR D CA  1 
ATOM   2147 C C   . TYR D 1 10 ? -24.480 36.400 -1.272  1.00 34.16 ? 452 TYR D C   1 
ATOM   2148 O O   . TYR D 1 10 ? -25.650 36.495 -0.904  1.00 35.33 ? 452 TYR D O   1 
ATOM   2149 C CB  . TYR D 1 10 ? -23.778 37.735 0.745   1.00 32.71 ? 452 TYR D CB  1 
ATOM   2150 C CG  . TYR D 1 10 ? -22.988 38.896 1.337   1.00 32.30 ? 452 TYR D CG  1 
ATOM   2151 C CD1 . TYR D 1 10 ? -23.592 39.791 2.225   1.00 31.21 ? 452 TYR D CD1 1 
ATOM   2152 C CD2 . TYR D 1 10 ? -21.639 39.095 1.018   1.00 32.02 ? 452 TYR D CD2 1 
ATOM   2153 C CE1 . TYR D 1 10 ? -22.876 40.857 2.775   1.00 32.61 ? 452 TYR D CE1 1 
ATOM   2154 C CE2 . TYR D 1 10 ? -20.915 40.153 1.561   1.00 31.15 ? 452 TYR D CE2 1 
ATOM   2155 C CZ  . TYR D 1 10 ? -21.537 41.034 2.435   1.00 33.45 ? 452 TYR D CZ  1 
ATOM   2156 O OH  . TYR D 1 10 ? -20.811 42.079 2.971   1.00 32.06 ? 452 TYR D OH  1 
ATOM   2157 N N   . PRO D 1 11 ? -24.085 35.496 -2.190  1.00 34.33 ? 453 PRO D N   1 
ATOM   2158 C CA  . PRO D 1 11 ? -25.066 34.699 -2.951  1.00 35.88 ? 453 PRO D CA  1 
ATOM   2159 C C   . PRO D 1 11 ? -26.018 33.828 -2.110  1.00 37.14 ? 453 PRO D C   1 
ATOM   2160 O O   . PRO D 1 11 ? -27.160 33.609 -2.526  1.00 38.53 ? 453 PRO D O   1 
ATOM   2161 C CB  . PRO D 1 11 ? -24.193 33.840 -3.881  1.00 35.82 ? 453 PRO D CB  1 
ATOM   2162 C CG  . PRO D 1 11 ? -22.805 33.896 -3.290  1.00 34.42 ? 453 PRO D CG  1 
ATOM   2163 C CD  . PRO D 1 11 ? -22.698 35.221 -2.612  1.00 33.13 ? 453 PRO D CD  1 
ATOM   2164 N N   . HIS D 1 12 ? -25.574 33.354 -0.944  1.00 36.82 ? 454 HIS D N   1 
ATOM   2165 C CA  . HIS D 1 12 ? -26.440 32.520 -0.083  1.00 38.49 ? 454 HIS D CA  1 
ATOM   2166 C C   . HIS D 1 12 ? -27.499 33.297 0.711   1.00 39.51 ? 454 HIS D C   1 
ATOM   2167 O O   . HIS D 1 12 ? -28.412 32.706 1.311   1.00 40.79 ? 454 HIS D O   1 
ATOM   2168 C CB  . HIS D 1 12 ? -25.611 31.624 0.847   1.00 37.82 ? 454 HIS D CB  1 
ATOM   2169 C CG  . HIS D 1 12 ? -24.861 30.544 0.128   1.00 39.42 ? 454 HIS D CG  1 
ATOM   2170 N ND1 . HIS D 1 12 ? -23.698 29.992 0.618   1.00 42.90 ? 454 HIS D ND1 1 
ATOM   2171 C CD2 . HIS D 1 12 ? -25.096 29.934 -1.059  1.00 41.03 ? 454 HIS D CD2 1 
ATOM   2172 C CE1 . HIS D 1 12 ? -23.259 29.074 -0.225  1.00 45.64 ? 454 HIS D CE1 1 
ATOM   2173 N NE2 . HIS D 1 12 ? -24.092 29.017 -1.249  1.00 47.20 ? 454 HIS D NE2 1 
ATOM   2174 N N   . GLN D 1 13 ? -27.371 34.618 0.710   1.00 39.11 ? 455 GLN D N   1 
ATOM   2175 C CA  . GLN D 1 13 ? -28.308 35.475 1.423   1.00 40.64 ? 455 GLN D CA  1 
ATOM   2176 C C   . GLN D 1 13 ? -29.222 36.233 0.463   1.00 42.40 ? 455 GLN D C   1 
ATOM   2177 O O   . GLN D 1 13 ? -30.424 36.340 0.696   1.00 44.18 ? 455 GLN D O   1 
ATOM   2178 C CB  . GLN D 1 13 ? -27.559 36.462 2.323   1.00 39.37 ? 455 GLN D CB  1 
ATOM   2179 C CG  . GLN D 1 13 ? -26.706 35.810 3.411   1.00 37.14 ? 455 GLN D CG  1 
ATOM   2180 C CD  . GLN D 1 13 ? -26.337 36.787 4.510   1.00 36.57 ? 455 GLN D CD  1 
ATOM   2181 O OE1 . GLN D 1 13 ? -25.959 37.934 4.241   1.00 36.30 ? 455 GLN D OE1 1 
ATOM   2182 N NE2 . GLN D 1 13 ? -26.466 36.348 5.761   1.00 33.55 ? 455 GLN D NE2 1 
ATOM   2183 N N   . LEU D 1 14 ? -28.640 36.756 -0.613  1.00 42.60 ? 456 LEU D N   1 
ATOM   2184 C CA  . LEU D 1 14 ? -29.351 37.644 -1.524  1.00 44.75 ? 456 LEU D CA  1 
ATOM   2185 C C   . LEU D 1 14 ? -28.758 37.561 -2.929  1.00 45.16 ? 456 LEU D C   1 
ATOM   2186 O O   . LEU D 1 14 ? -27.536 37.536 -3.098  1.00 43.77 ? 456 LEU D O   1 
ATOM   2187 C CB  . LEU D 1 14 ? -29.291 39.086 -0.995  1.00 44.75 ? 456 LEU D CB  1 
ATOM   2188 C CG  . LEU D 1 14 ? -30.160 40.181 -1.623  1.00 46.28 ? 456 LEU D CG  1 
ATOM   2189 C CD1 . LEU D 1 14 ? -31.650 39.912 -1.445  1.00 47.57 ? 456 LEU D CD1 1 
ATOM   2190 C CD2 . LEU D 1 14 ? -29.788 41.530 -1.033  1.00 43.97 ? 456 LEU D CD2 1 
ATOM   2191 N N   . ASP D 1 15 ? -29.638 37.521 -3.926  1.00 47.68 ? 457 ASP D N   1 
ATOM   2192 C CA  . ASP D 1 15 ? -29.241 37.412 -5.331  1.00 48.91 ? 457 ASP D CA  1 
ATOM   2193 C C   . ASP D 1 15 ? -28.739 38.738 -5.922  1.00 49.10 ? 457 ASP D C   1 
ATOM   2194 O O   . ASP D 1 15 ? -28.126 38.755 -6.992  1.00 49.93 ? 457 ASP D O   1 
ATOM   2195 C CB  . ASP D 1 15 ? -30.413 36.877 -6.164  1.00 51.58 ? 457 ASP D CB  1 
ATOM   2196 C CG  . ASP D 1 15 ? -29.963 35.967 -7.303  0.50 54.09 ? 457 ASP D CG  1 
ATOM   2197 O OD1 . ASP D 1 15 ? -28.738 35.856 -7.548  0.50 53.71 ? 457 ASP D OD1 1 
ATOM   2198 O OD2 . ASP D 1 15 ? -30.842 35.357 -7.953  0.50 59.95 ? 457 ASP D OD2 1 
ATOM   2199 N N   . GLN D 1 16 ? -29.014 39.843 -5.231  1.00 48.79 ? 458 GLN D N   1 
ATOM   2200 C CA  . GLN D 1 16 ? -28.603 41.176 -5.681  1.00 48.68 ? 458 GLN D CA  1 
ATOM   2201 C C   . GLN D 1 16 ? -27.285 41.598 -5.014  1.00 45.94 ? 458 GLN D C   1 
ATOM   2202 O O   . GLN D 1 16 ? -26.910 41.065 -3.961  1.00 43.57 ? 458 GLN D O   1 
ATOM   2203 C CB  . GLN D 1 16 ? -29.710 42.209 -5.405  1.00 50.85 ? 458 GLN D CB  1 
ATOM   2204 C CG  . GLN D 1 16 ? -30.946 42.122 -6.325  1.00 53.82 ? 458 GLN D CG  1 
ATOM   2205 C CD  . GLN D 1 16 ? -32.020 41.142 -5.842  1.00 58.77 ? 458 GLN D CD  1 
ATOM   2206 O OE1 . GLN D 1 16 ? -31.851 40.446 -4.837  1.00 59.12 ? 458 GLN D OE1 1 
ATOM   2207 N NE2 . GLN D 1 16 ? -33.135 41.090 -6.565  1.00 61.10 ? 458 GLN D NE2 1 
ATOM   2208 N N   . LYS D 1 17 ? -26.579 42.540 -5.642  1.00 45.86 ? 459 LYS D N   1 
ATOM   2209 C CA  . LYS D 1 17 ? -25.342 43.083 -5.074  1.00 43.54 ? 459 LYS D CA  1 
ATOM   2210 C C   . LYS D 1 17 ? -25.622 43.902 -3.814  1.00 42.93 ? 459 LYS D C   1 
ATOM   2211 O O   . LYS D 1 17 ? -26.623 44.628 -3.725  1.00 44.66 ? 459 LYS D O   1 
ATOM   2212 C CB  . LYS D 1 17 ? -24.546 43.882 -6.117  1.00 44.17 ? 459 LYS D CB  1 
ATOM   2213 C CG  . LYS D 1 17 ? -23.679 42.994 -7.014  1.00 44.31 ? 459 LYS D CG  1 
ATOM   2214 C CD  . LYS D 1 17 ? -23.722 43.452 -8.459  0.50 49.09 ? 459 LYS D CD  1 
ATOM   2215 C CE  . LYS D 1 17 ? -23.224 42.366 -9.402  0.50 50.18 ? 459 LYS D CE  1 
ATOM   2216 N NZ  . LYS D 1 17 ? -23.409 42.749 -10.833 0.50 53.23 ? 459 LYS D NZ  1 
ATOM   2217 N N   . VAL D 1 18 ? -24.716 43.759 -2.856  1.00 40.67 ? 460 VAL D N   1 
ATOM   2218 C CA  . VAL D 1 18 ? -24.864 44.241 -1.489  1.00 40.37 ? 460 VAL D CA  1 
ATOM   2219 C C   . VAL D 1 18 ? -24.095 45.561 -1.268  1.00 40.61 ? 460 VAL D C   1 
ATOM   2220 O O   . VAL D 1 18 ? -24.544 46.430 -0.514  1.00 41.27 ? 460 VAL D O   1 
ATOM   2221 C CB  . VAL D 1 18 ? -24.375 43.130 -0.495  1.00 38.60 ? 460 VAL D CB  1 
ATOM   2222 C CG1 . VAL D 1 18 ? -24.238 43.638 0.930   1.00 38.63 ? 460 VAL D CG1 1 
ATOM   2223 C CG2 . VAL D 1 18 ? -25.306 41.936 -0.530  1.00 39.62 ? 460 VAL D CG2 1 
ATOM   2224 N N   . LEU D 1 19 ? -22.940 45.702 -1.921  1.00 40.11 ? 461 LEU D N   1 
ATOM   2225 C CA  . LEU D 1 19 ? -22.085 46.888 -1.763  1.00 41.00 ? 461 LEU D CA  1 
ATOM   2226 C C   . LEU D 1 19 ? -21.048 47.004 -2.875  1.00 41.15 ? 461 LEU D C   1 
ATOM   2227 O O   . LEU D 1 19 ? -20.827 46.058 -3.641  1.00 40.74 ? 461 LEU D O   1 
ATOM   2228 C CB  . LEU D 1 19 ? -21.397 46.909 -0.381  1.00 40.15 ? 461 LEU D CB  1 
ATOM   2229 C CG  . LEU D 1 19 ? -20.286 45.906 -0.041  1.00 39.20 ? 461 LEU D CG  1 
ATOM   2230 C CD1 . LEU D 1 19 ? -18.931 46.597 0.045   1.00 40.85 ? 461 LEU D CD1 1 
ATOM   2231 C CD2 . LEU D 1 19 ? -20.587 45.194 1.269   1.00 39.83 ? 461 LEU D CD2 1 
ATOM   2232 N N   . GLU D 1 20 ? -20.436 48.182 -2.970  1.00 42.24 ? 462 GLU D N   1 
ATOM   2233 C CA  . GLU D 1 20 ? -19.273 48.385 -3.820  1.00 42.50 ? 462 GLU D CA  1 
ATOM   2234 C C   . GLU D 1 20 ? -18.071 48.744 -2.958  1.00 41.58 ? 462 GLU D C   1 
ATOM   2235 O O   . GLU D 1 20 ? -18.226 49.272 -1.858  1.00 41.90 ? 462 GLU D O   1 
ATOM   2236 C CB  . GLU D 1 20 ? -19.537 49.473 -4.860  1.00 45.04 ? 462 GLU D CB  1 
ATOM   2237 C CG  . GLU D 1 20 ? -20.188 48.944 -6.123  1.00 47.74 ? 462 GLU D CG  1 
ATOM   2238 C CD  . GLU D 1 20 ? -20.450 50.011 -7.173  1.00 53.56 ? 462 GLU D CD  1 
ATOM   2239 O OE1 . GLU D 1 20 ? -19.672 50.984 -7.265  1.00 56.22 ? 462 GLU D OE1 1 
ATOM   2240 O OE2 . GLU D 1 20 ? -21.435 49.860 -7.926  1.00 56.91 ? 462 GLU D OE2 1 
ATOM   2241 N N   . LYS D 1 21 ? -16.875 48.441 -3.454  1.00 40.81 ? 463 LYS D N   1 
ATOM   2242 C CA  . LYS D 1 21 ? -15.647 48.822 -2.766  1.00 40.57 ? 463 LYS D CA  1 
ATOM   2243 C C   . LYS D 1 21 ? -14.516 49.082 -3.759  1.00 40.70 ? 463 LYS D C   1 
ATOM   2244 O O   . LYS D 1 21 ? -14.381 48.383 -4.768  1.00 40.55 ? 463 LYS D O   1 
ATOM   2245 C CB  . LYS D 1 21 ? -15.241 47.749 -1.742  1.00 39.08 ? 463 LYS D CB  1 
ATOM   2246 C CG  . LYS D 1 21 ? -14.418 48.269 -0.568  1.00 41.54 ? 463 LYS D CG  1 
ATOM   2247 C CD  . LYS D 1 21 ? -15.280 48.910 0.520   1.00 48.91 ? 463 LYS D CD  1 
ATOM   2248 C CE  . LYS D 1 21 ? -14.409 49.510 1.617   1.00 53.59 ? 463 LYS D CE  1 
ATOM   2249 N NZ  . LYS D 1 21 ? -15.194 50.339 2.583   1.00 57.98 ? 463 LYS D NZ  1 
ATOM   2250 N N   . GLN D 1 22 ? -13.720 50.108 -3.471  1.00 41.41 ? 464 GLN D N   1 
ATOM   2251 C CA  . GLN D 1 22 ? -12.525 50.414 -4.247  1.00 41.69 ? 464 GLN D CA  1 
ATOM   2252 C C   . GLN D 1 22 ? -11.318 49.780 -3.578  1.00 40.16 ? 464 GLN D C   1 
ATOM   2253 O O   . GLN D 1 22 ? -10.982 50.103 -2.432  1.00 40.17 ? 464 GLN D O   1 
ATOM   2254 C CB  . GLN D 1 22 ? -12.335 51.918 -4.370  1.00 43.95 ? 464 GLN D CB  1 
ATOM   2255 C CG  . GLN D 1 22 ? -13.197 52.560 -5.442  1.00 47.39 ? 464 GLN D CG  1 
ATOM   2256 C CD  . GLN D 1 22 ? -12.859 54.023 -5.644  1.00 52.70 ? 464 GLN D CD  1 
ATOM   2257 O OE1 . GLN D 1 22 ? -12.535 54.737 -4.691  1.00 53.60 ? 464 GLN D OE1 1 
ATOM   2258 N NE2 . GLN D 1 22 ? -12.934 54.480 -6.889  1.00 54.76 ? 464 GLN D NE2 1 
ATOM   2259 N N   . LEU D 1 23 ? -10.678 48.865 -4.295  1.00 39.01 ? 465 LEU D N   1 
ATOM   2260 C CA  . LEU D 1 23 ? -9.639  48.037 -3.719  1.00 37.45 ? 465 LEU D CA  1 
ATOM   2261 C C   . LEU D 1 23 ? -8.421  48.019 -4.628  1.00 37.93 ? 465 LEU D C   1 
ATOM   2262 O O   . LEU D 1 23 ? -8.558  47.780 -5.830  1.00 38.82 ? 465 LEU D O   1 
ATOM   2263 C CB  . LEU D 1 23 ? -10.155 46.611 -3.504  1.00 36.04 ? 465 LEU D CB  1 
ATOM   2264 C CG  . LEU D 1 23 ? -11.397 46.368 -2.641  1.00 35.45 ? 465 LEU D CG  1 
ATOM   2265 C CD1 . LEU D 1 23 ? -11.905 44.941 -2.808  1.00 32.72 ? 465 LEU D CD1 1 
ATOM   2266 C CD2 . LEU D 1 23 ? -11.131 46.666 -1.165  1.00 33.83 ? 465 LEU D CD2 1 
ATOM   2267 N N   . PRO D 1 24 ? -7.222  48.275 -4.059  1.00 37.58 ? 466 PRO D N   1 
ATOM   2268 C CA  . PRO D 1 24 ? -5.981  48.231 -4.845  1.00 38.14 ? 466 PRO D CA  1 
ATOM   2269 C C   . PRO D 1 24 ? -5.818  46.877 -5.532  1.00 37.03 ? 466 PRO D C   1 
ATOM   2270 O O   . PRO D 1 24 ? -6.138  45.858 -4.942  1.00 35.64 ? 466 PRO D O   1 
ATOM   2271 C CB  . PRO D 1 24 ? -4.882  48.433 -3.786  1.00 38.40 ? 466 PRO D CB  1 
ATOM   2272 C CG  . PRO D 1 24 ? -5.561  49.180 -2.669  1.00 38.02 ? 466 PRO D CG  1 
ATOM   2273 C CD  . PRO D 1 24 ? -6.974  48.646 -2.650  1.00 36.88 ? 466 PRO D CD  1 
ATOM   2274 N N   . GLY D 1 25 ? -5.333  46.878 -6.772  1.00 37.93 ? 467 GLY D N   1 
ATOM   2275 C CA  . GLY D 1 25 ? -5.128  45.642 -7.525  1.00 37.51 ? 467 GLY D CA  1 
ATOM   2276 C C   . GLY D 1 25 ? -4.083  44.734 -6.897  1.00 36.73 ? 467 GLY D C   1 
ATOM   2277 O O   . GLY D 1 25 ? -4.173  43.517 -7.001  1.00 36.09 ? 467 GLY D O   1 
ATOM   2278 N N   . SER D 1 26 ? -3.092  45.339 -6.245  1.00 36.98 ? 468 SER D N   1 
ATOM   2279 C CA  . SER D 1 26 ? -2.012  44.612 -5.578  1.00 36.75 ? 468 SER D CA  1 
ATOM   2280 C C   . SER D 1 26 ? -2.413  44.053 -4.205  1.00 35.37 ? 468 SER D C   1 
ATOM   2281 O O   . SER D 1 26 ? -1.583  43.443 -3.522  1.00 35.52 ? 468 SER D O   1 
ATOM   2282 C CB  . SER D 1 26 ? -0.768  45.506 -5.453  1.00 38.34 ? 468 SER D CB  1 
ATOM   2283 O OG  . SER D 1 26 ? -1.047  46.690 -4.716  1.00 36.52 ? 468 SER D OG  1 
ATOM   2284 N N   . MET D 1 27 ? -3.673  44.274 -3.809  1.00 34.11 ? 469 MET D N   1 
ATOM   2285 C CA  . MET D 1 27 ? -4.219  43.761 -2.551  1.00 33.19 ? 469 MET D CA  1 
ATOM   2286 C C   . MET D 1 27 ? -4.336  42.246 -2.615  1.00 32.89 ? 469 MET D C   1 
ATOM   2287 O O   . MET D 1 27 ? -4.903  41.712 -3.572  1.00 32.54 ? 469 MET D O   1 
ATOM   2288 C CB  . MET D 1 27 ? -5.596  44.384 -2.253  1.00 32.81 ? 469 MET D CB  1 
ATOM   2289 C CG  . MET D 1 27 ? -6.148  44.100 -0.850  1.00 32.15 ? 469 MET D CG  1 
ATOM   2290 S SD  . MET D 1 27 ? -7.719  44.942 -0.530  1.00 39.98 ? 469 MET D SD  1 
ATOM   2291 C CE  . MET D 1 27 ? -7.807  44.818 1.262   1.00 30.41 ? 469 MET D CE  1 
ATOM   2292 N N   . THR D 1 28 ? -3.801  41.571 -1.596  1.00 33.46 ? 470 THR D N   1 
ATOM   2293 C CA  . THR D 1 28 ? -3.766  40.103 -1.548  1.00 34.34 ? 470 THR D CA  1 
ATOM   2294 C C   . THR D 1 28 ? -5.112  39.541 -1.107  1.00 33.83 ? 470 THR D C   1 
ATOM   2295 O O   . THR D 1 28 ? -5.867  40.221 -0.400  1.00 33.39 ? 470 THR D O   1 
ATOM   2296 C CB  . THR D 1 28 ? -2.620  39.553 -0.627  1.00 35.67 ? 470 THR D CB  1 
ATOM   2297 O OG1 . THR D 1 28 ? -2.822  39.979 0.729   1.00 34.75 ? 470 THR D OG1 1 
ATOM   2298 C CG2 . THR D 1 28 ? -1.234  40.021 -1.118  1.00 36.19 ? 470 THR D CG2 1 
ATOM   2299 N N   . ILE D 1 29 ? -5.412  38.306 -1.518  1.00 34.44 ? 471 ILE D N   1 
ATOM   2300 C CA  . ILE D 1 29 ? -6.686  37.664 -1.158  1.00 34.07 ? 471 ILE D CA  1 
ATOM   2301 C C   . ILE D 1 29 ? -6.837  37.607 0.371   1.00 34.04 ? 471 ILE D C   1 
ATOM   2302 O O   . ILE D 1 29 ? -7.928  37.872 0.902   1.00 33.40 ? 471 ILE D O   1 
ATOM   2303 C CB  . ILE D 1 29 ? -6.882  36.262 -1.837  1.00 34.83 ? 471 ILE D CB  1 
ATOM   2304 C CG1 . ILE D 1 29 ? -6.640  36.320 -3.358  1.00 35.92 ? 471 ILE D CG1 1 
ATOM   2305 C CG2 . ILE D 1 29 ? -8.273  35.671 -1.536  1.00 34.98 ? 471 ILE D CG2 1 
ATOM   2306 C CD1 . ILE D 1 29 ? -7.424  37.409 -4.131  1.00 35.50 ? 471 ILE D CD1 1 
ATOM   2307 N N   . GLN D 1 30 ? -5.730  37.320 1.062   1.00 35.06 ? 472 GLN D N   1 
ATOM   2308 C CA  . GLN D 1 30 ? -5.675  37.326 2.531   1.00 35.94 ? 472 GLN D CA  1 
ATOM   2309 C C   . GLN D 1 30 ? -6.171  38.647 3.146   1.00 35.38 ? 472 GLN D C   1 
ATOM   2310 O O   . GLN D 1 30 ? -6.983  38.634 4.074   1.00 35.48 ? 472 GLN D O   1 
ATOM   2311 C CB  . GLN D 1 30 ? -4.246  37.020 3.013   1.00 37.90 ? 472 GLN D CB  1 
ATOM   2312 C CG  . GLN D 1 30 ? -4.062  36.944 4.536   1.00 39.38 ? 472 GLN D CG  1 
ATOM   2313 C CD  . GLN D 1 30 ? -2.600  37.022 4.947   0.50 46.17 ? 472 GLN D CD  1 
ATOM   2314 O OE1 . GLN D 1 30 ? -1.727  36.425 4.311   0.50 47.45 ? 472 GLN D OE1 1 
ATOM   2315 N NE2 . GLN D 1 30 ? -2.325  37.760 6.019   0.50 48.05 ? 472 GLN D NE2 1 
ATOM   2316 N N   . LYS D 1 31 ? -5.667  39.772 2.635   1.00 35.06 ? 473 LYS D N   1 
ATOM   2317 C CA  . LYS D 1 31 ? -6.059  41.104 3.111   1.00 34.77 ? 473 LYS D CA  1 
ATOM   2318 C C   . LYS D 1 31 ? -7.488  41.484 2.738   1.00 33.55 ? 473 LYS D C   1 
ATOM   2319 O O   . LYS D 1 31 ? -8.143  42.221 3.478   1.00 33.61 ? 473 LYS D O   1 
ATOM   2320 C CB  . LYS D 1 31 ? -5.089  42.190 2.613   1.00 34.92 ? 473 LYS D CB  1 
ATOM   2321 C CG  . LYS D 1 31 ? -3.678  42.088 3.172   1.00 35.59 ? 473 LYS D CG  1 
ATOM   2322 C CD  . LYS D 1 31 ? -3.633  41.974 4.685   1.00 37.76 ? 473 LYS D CD  1 
ATOM   2323 C CE  . LYS D 1 31 ? -2.184  41.815 5.145   1.00 42.23 ? 473 LYS D CE  1 
ATOM   2324 N NZ  . LYS D 1 31 ? -2.046  40.979 6.366   1.00 42.29 ? 473 LYS D NZ  1 
ATOM   2325 N N   . VAL D 1 32 ? -7.951  41.000 1.585   1.00 32.97 ? 474 VAL D N   1 
ATOM   2326 C CA  . VAL D 1 32 ? -9.349  41.191 1.167   1.00 32.51 ? 474 VAL D CA  1 
ATOM   2327 C C   . VAL D 1 32 ? -10.296 40.482 2.136   1.00 32.60 ? 474 VAL D C   1 
ATOM   2328 O O   . VAL D 1 32 ? -11.307 41.055 2.543   1.00 33.04 ? 474 VAL D O   1 
ATOM   2329 C CB  . VAL D 1 32 ? -9.616  40.709 -0.293  1.00 32.02 ? 474 VAL D CB  1 
ATOM   2330 C CG1 . VAL D 1 32 ? -11.110 40.716 -0.594  1.00 31.46 ? 474 VAL D CG1 1 
ATOM   2331 C CG2 . VAL D 1 32 ? -8.881  41.601 -1.292  1.00 31.59 ? 474 VAL D CG2 1 
ATOM   2332 N N   . LYS D 1 33 ? -9.950  39.247 2.502   1.00 32.90 ? 475 LYS D N   1 
ATOM   2333 C CA  . LYS D 1 33 ? -10.709 38.460 3.479   1.00 33.24 ? 475 LYS D CA  1 
ATOM   2334 C C   . LYS D 1 33 ? -10.640 39.095 4.852   1.00 34.28 ? 475 LYS D C   1 
ATOM   2335 O O   . LYS D 1 33 ? -11.596 39.024 5.623   1.00 34.62 ? 475 LYS D O   1 
ATOM   2336 C CB  . LYS D 1 33 ? -10.161 37.037 3.577   1.00 33.58 ? 475 LYS D CB  1 
ATOM   2337 C CG  . LYS D 1 33 ? -10.475 36.133 2.410   1.00 32.43 ? 475 LYS D CG  1 
ATOM   2338 C CD  . LYS D 1 33 ? -9.835  34.780 2.671   1.00 36.75 ? 475 LYS D CD  1 
ATOM   2339 C CE  . LYS D 1 33 ? -10.203 33.728 1.640   1.00 35.24 ? 475 LYS D CE  1 
ATOM   2340 N NZ  . LYS D 1 33 ? -9.421  32.497 1.948   1.00 37.86 ? 475 LYS D NZ  1 
ATOM   2341 N N   . GLY D 1 34 ? -9.492  39.700 5.151   1.00 35.39 ? 476 GLY D N   1 
ATOM   2342 C CA  . GLY D 1 34 ? -9.288  40.433 6.395   1.00 36.84 ? 476 GLY D CA  1 
ATOM   2343 C C   . GLY D 1 34 ? -10.273 41.574 6.479   1.00 36.92 ? 476 GLY D C   1 
ATOM   2344 O O   . GLY D 1 34 ? -10.961 41.727 7.492   1.00 37.95 ? 476 GLY D O   1 
ATOM   2345 N N   . LEU D 1 35 ? -10.362 42.354 5.401   1.00 36.46 ? 477 LEU D N   1 
ATOM   2346 C CA  . LEU D 1 35 ? -11.336 43.455 5.321   1.00 37.40 ? 477 LEU D CA  1 
ATOM   2347 C C   . LEU D 1 35 ? -12.784 42.948 5.490   1.00 37.24 ? 477 LEU D C   1 
ATOM   2348 O O   . LEU D 1 35 ? -13.522 43.465 6.329   1.00 37.93 ? 477 LEU D O   1 
ATOM   2349 C CB  . LEU D 1 35 ? -11.161 44.271 4.022   1.00 36.72 ? 477 LEU D CB  1 
ATOM   2350 C CG  . LEU D 1 35 ? -12.006 45.543 3.827   1.00 37.93 ? 477 LEU D CG  1 
ATOM   2351 C CD1 . LEU D 1 35 ? -11.196 46.682 3.184   1.00 38.57 ? 477 LEU D CD1 1 
ATOM   2352 C CD2 . LEU D 1 35 ? -13.265 45.268 3.020   1.00 37.41 ? 477 LEU D CD2 1 
ATOM   2353 N N   . LEU D 1 36 ? -13.165 41.926 4.716   1.00 36.63 ? 478 LEU D N   1 
ATOM   2354 C CA  . LEU D 1 36 ? -14.538 41.394 4.745   1.00 36.71 ? 478 LEU D CA  1 
ATOM   2355 C C   . LEU D 1 36 ? -14.911 40.797 6.101   1.00 38.35 ? 478 LEU D C   1 
ATOM   2356 O O   . LEU D 1 36 ? -16.059 40.917 6.544   1.00 39.41 ? 478 LEU D O   1 
ATOM   2357 C CB  . LEU D 1 36 ? -14.751 40.353 3.644   1.00 35.76 ? 478 LEU D CB  1 
ATOM   2358 C CG  . LEU D 1 36 ? -14.767 40.787 2.173   1.00 33.60 ? 478 LEU D CG  1 
ATOM   2359 C CD1 . LEU D 1 36 ? -14.496 39.586 1.269   1.00 31.06 ? 478 LEU D CD1 1 
ATOM   2360 C CD2 . LEU D 1 36 ? -16.084 41.441 1.805   1.00 30.23 ? 478 LEU D CD2 1 
ATOM   2361 N N   . SER D 1 37 ? -13.930 40.166 6.748   1.00 39.11 ? 479 SER D N   1 
ATOM   2362 C CA  . SER D 1 37 ? -14.090 39.548 8.064   1.00 40.52 ? 479 SER D CA  1 
ATOM   2363 C C   . SER D 1 37 ? -14.574 40.521 9.143   1.00 42.08 ? 479 SER D C   1 
ATOM   2364 O O   . SER D 1 37 ? -15.471 40.190 9.927   1.00 43.35 ? 479 SER D O   1 
ATOM   2365 C CB  . SER D 1 37 ? -12.765 38.923 8.506   1.00 41.20 ? 479 SER D CB  1 
ATOM   2366 O OG  . SER D 1 37 ? -12.888 38.320 9.784   1.00 43.27 ? 479 SER D OG  1 
ATOM   2367 N N   . ARG D 1 38 ? -13.966 41.705 9.182   1.00 42.39 ? 480 ARG D N   1 
ATOM   2368 C CA  . ARG D 1 38 ? -14.292 42.739 10.171  1.00 44.41 ? 480 ARG D CA  1 
ATOM   2369 C C   . ARG D 1 38 ? -15.704 43.289 9.953   1.00 44.23 ? 480 ARG D C   1 
ATOM   2370 O O   . ARG D 1 38 ? -16.382 43.703 10.899  1.00 45.98 ? 480 ARG D O   1 
ATOM   2371 C CB  . ARG D 1 38 ? -13.263 43.874 10.118  1.00 44.70 ? 480 ARG D CB  1 
ATOM   2372 C CG  . ARG D 1 38 ? -11.851 43.452 10.511  1.00 46.39 ? 480 ARG D CG  1 
ATOM   2373 C CD  . ARG D 1 38 ? -10.887 44.641 10.552  1.00 49.30 ? 480 ARG D CD  1 
ATOM   2374 N NE  . ARG D 1 38 ? -10.360 44.989 9.230   1.00 48.44 ? 480 ARG D NE  1 
ATOM   2375 C CZ  . ARG D 1 38 ? -9.276  44.438 8.684   1.00 48.61 ? 480 ARG D CZ  1 
ATOM   2376 N NH1 . ARG D 1 38 ? -8.597  43.498 9.336   1.00 51.54 ? 480 ARG D NH1 1 
ATOM   2377 N NH2 . ARG D 1 38 ? -8.867  44.821 7.482   1.00 43.85 ? 480 ARG D NH2 1 
ATOM   2378 N N   . LEU D 1 39 ? -16.130 43.271 8.695   1.00 42.23 ? 481 LEU D N   1 
ATOM   2379 C CA  . LEU D 1 39 ? -17.450 43.732 8.294   1.00 42.26 ? 481 LEU D CA  1 
ATOM   2380 C C   . LEU D 1 39 ? -18.564 42.756 8.677   1.00 42.47 ? 481 LEU D C   1 
ATOM   2381 O O   . LEU D 1 39 ? -19.617 43.167 9.167   1.00 43.87 ? 481 LEU D O   1 
ATOM   2382 C CB  . LEU D 1 39 ? -17.461 43.952 6.784   1.00 40.52 ? 481 LEU D CB  1 
ATOM   2383 C CG  . LEU D 1 39 ? -18.594 44.763 6.180   1.00 41.60 ? 481 LEU D CG  1 
ATOM   2384 C CD1 . LEU D 1 39 ? -18.601 46.176 6.753   1.00 41.23 ? 481 LEU D CD1 1 
ATOM   2385 C CD2 . LEU D 1 39 ? -18.409 44.790 4.675   1.00 41.65 ? 481 LEU D CD2 1 
ATOM   2386 N N   . LEU D 1 40 ? -18.319 41.465 8.457   1.00 41.31 ? 482 LEU D N   1 
ATOM   2387 C CA  . LEU D 1 40 ? -19.356 40.440 8.585   1.00 41.21 ? 482 LEU D CA  1 
ATOM   2388 C C   . LEU D 1 40 ? -19.360 39.751 9.947   1.00 42.94 ? 482 LEU D C   1 
ATOM   2389 O O   . LEU D 1 40 ? -20.290 39.012 10.281  1.00 43.52 ? 482 LEU D O   1 
ATOM   2390 C CB  . LEU D 1 40 ? -19.188 39.394 7.481   1.00 39.61 ? 482 LEU D CB  1 
ATOM   2391 C CG  . LEU D 1 40 ? -19.400 39.821 6.026   1.00 38.59 ? 482 LEU D CG  1 
ATOM   2392 C CD1 . LEU D 1 40 ? -18.896 38.742 5.070   1.00 37.21 ? 482 LEU D CD1 1 
ATOM   2393 C CD2 . LEU D 1 40 ? -20.864 40.130 5.761   1.00 37.47 ? 482 LEU D CD2 1 
ATOM   2394 N N   . LYS D 1 41 ? -18.316 40.008 10.731  1.00 44.11 ? 483 LYS D N   1 
ATOM   2395 C CA  . LYS D 1 41 ? -18.067 39.287 11.980  1.00 46.25 ? 483 LYS D CA  1 
ATOM   2396 C C   . LYS D 1 41 ? -18.057 37.769 11.708  1.00 45.59 ? 483 LYS D C   1 
ATOM   2397 O O   . LYS D 1 41 ? -18.794 36.998 12.323  1.00 46.73 ? 483 LYS D O   1 
ATOM   2398 C CB  . LYS D 1 41 ? -19.068 39.696 13.085  1.00 48.79 ? 483 LYS D CB  1 
ATOM   2399 C CG  . LYS D 1 41 ? -19.324 41.211 13.219  1.00 50.63 ? 483 LYS D CG  1 
ATOM   2400 C CD  . LYS D 1 41 ? -18.073 41.986 13.623  1.00 54.93 ? 483 LYS D CD  1 
ATOM   2401 C CE  . LYS D 1 41 ? -18.342 43.483 13.718  0.50 56.63 ? 483 LYS D CE  1 
ATOM   2402 N NZ  . LYS D 1 41 ? -19.124 43.838 14.935  0.50 59.90 ? 483 LYS D NZ  1 
ATOM   2403 N N   . VAL D 1 42 ? -17.221 37.378 10.745  1.00 43.89 ? 484 VAL D N   1 
ATOM   2404 C CA  . VAL D 1 42 ? -16.993 35.984 10.350  1.00 43.48 ? 484 VAL D CA  1 
ATOM   2405 C C   . VAL D 1 42 ? -15.477 35.810 10.188  1.00 43.12 ? 484 VAL D C   1 
ATOM   2406 O O   . VAL D 1 42 ? -14.851 36.599 9.476   1.00 41.78 ? 484 VAL D O   1 
ATOM   2407 C CB  . VAL D 1 42 ? -17.717 35.652 9.008   1.00 41.90 ? 484 VAL D CB  1 
ATOM   2408 C CG1 . VAL D 1 42 ? -17.243 34.320 8.426   1.00 41.77 ? 484 VAL D CG1 1 
ATOM   2409 C CG2 . VAL D 1 42 ? -19.237 35.652 9.184   1.00 41.88 ? 484 VAL D CG2 1 
ATOM   2410 N N   . PRO D 1 43 ? -14.878 34.799 10.855  1.00 44.70 ? 485 PRO D N   1 
ATOM   2411 C CA  . PRO D 1 43 ? -13.408 34.634 10.825  1.00 45.06 ? 485 PRO D CA  1 
ATOM   2412 C C   . PRO D 1 43 ? -12.824 34.472 9.413   1.00 43.34 ? 485 PRO D C   1 
ATOM   2413 O O   . PRO D 1 43 ? -13.475 33.893 8.537   1.00 42.01 ? 485 PRO D O   1 
ATOM   2414 C CB  . PRO D 1 43 ? -13.177 33.357 11.652  1.00 47.31 ? 485 PRO D CB  1 
ATOM   2415 C CG  . PRO D 1 43 ? -14.368 33.267 12.552  1.00 48.27 ? 485 PRO D CG  1 
ATOM   2416 C CD  . PRO D 1 43 ? -15.519 33.790 11.723  1.00 46.66 ? 485 PRO D CD  1 
ATOM   2417 N N   . VAL D 1 44 ? -11.610 34.989 9.206   1.00 43.66 ? 486 VAL D N   1 
ATOM   2418 C CA  . VAL D 1 44 ? -10.896 34.878 7.920   1.00 42.79 ? 486 VAL D CA  1 
ATOM   2419 C C   . VAL D 1 44 ? -10.887 33.429 7.375   1.00 43.41 ? 486 VAL D C   1 
ATOM   2420 O O   . VAL D 1 44 ? -11.254 33.194 6.212   1.00 42.10 ? 486 VAL D O   1 
ATOM   2421 C CB  . VAL D 1 44 ? -9.444  35.444 8.018   1.00 43.70 ? 486 VAL D CB  1 
ATOM   2422 C CG1 . VAL D 1 44 ? -8.633  35.151 6.743   1.00 43.27 ? 486 VAL D CG1 1 
ATOM   2423 C CG2 . VAL D 1 44 ? -9.459  36.954 8.315   1.00 43.34 ? 486 VAL D CG2 1 
ATOM   2424 N N   . SER D 1 45 ? -10.496 32.469 8.222   1.00 45.09 ? 487 SER D N   1 
ATOM   2425 C CA  . SER D 1 45 ? -10.398 31.061 7.819   1.00 45.91 ? 487 SER D CA  1 
ATOM   2426 C C   . SER D 1 45 ? -11.720 30.425 7.338   1.00 45.22 ? 487 SER D C   1 
ATOM   2427 O O   . SER D 1 45 ? -11.691 29.396 6.661   1.00 45.72 ? 487 SER D O   1 
ATOM   2428 C CB  . SER D 1 45 ? -9.731  30.211 8.920   1.00 48.85 ? 487 SER D CB  1 
ATOM   2429 O OG  . SER D 1 45 ? -10.516 30.133 10.099  1.00 49.22 ? 487 SER D OG  1 
ATOM   2430 N N   . ASP D 1 46 ? -12.855 31.049 7.675   1.00 44.28 ? 488 ASP D N   1 
ATOM   2431 C CA  . ASP D 1 46 ? -14.198 30.617 7.232   1.00 43.53 ? 488 ASP D CA  1 
ATOM   2432 C C   . ASP D 1 46 ? -14.643 31.155 5.851   1.00 41.23 ? 488 ASP D C   1 
ATOM   2433 O O   . ASP D 1 46 ? -15.560 30.600 5.229   1.00 41.00 ? 488 ASP D O   1 
ATOM   2434 C CB  . ASP D 1 46 ? -15.259 31.017 8.275   1.00 44.19 ? 488 ASP D CB  1 
ATOM   2435 C CG  . ASP D 1 46 ? -15.290 30.089 9.490   1.00 48.16 ? 488 ASP D CG  1 
ATOM   2436 O OD1 . ASP D 1 46 ? -14.760 28.958 9.419   1.00 49.50 ? 488 ASP D OD1 1 
ATOM   2437 O OD2 . ASP D 1 46 ? -15.862 30.500 10.525  1.00 52.37 ? 488 ASP D OD2 1 
ATOM   2438 N N   . LEU D 1 47 ? -14.013 32.234 5.387   1.00 39.64 ? 489 LEU D N   1 
ATOM   2439 C CA  . LEU D 1 47 ? -14.434 32.928 4.163   1.00 37.94 ? 489 LEU D CA  1 
ATOM   2440 C C   . LEU D 1 47 ? -14.005 32.232 2.877   1.00 38.13 ? 489 LEU D C   1 
ATOM   2441 O O   . LEU D 1 47 ? -12.879 31.716 2.770   1.00 39.24 ? 489 LEU D O   1 
ATOM   2442 C CB  . LEU D 1 47 ? -13.933 34.378 4.151   1.00 37.19 ? 489 LEU D CB  1 
ATOM   2443 C CG  . LEU D 1 47 ? -14.659 35.398 5.029   1.00 36.19 ? 489 LEU D CG  1 
ATOM   2444 C CD1 . LEU D 1 47 ? -13.910 36.713 5.003   1.00 35.51 ? 489 LEU D CD1 1 
ATOM   2445 C CD2 . LEU D 1 47 ? -16.115 35.591 4.597   1.00 32.64 ? 489 LEU D CD2 1 
ATOM   2446 N N   . LEU D 1 48 ? -14.913 32.226 1.904   1.00 37.27 ? 490 LEU D N   1 
ATOM   2447 C CA  . LEU D 1 48 ? -14.665 31.614 0.602   1.00 37.32 ? 490 LEU D CA  1 
ATOM   2448 C C   . LEU D 1 48 ? -14.919 32.655 -0.478  1.00 36.13 ? 490 LEU D C   1 
ATOM   2449 O O   . LEU D 1 48 ? -16.042 33.141 -0.642  1.00 36.04 ? 490 LEU D O   1 
ATOM   2450 C CB  . LEU D 1 48 ? -15.565 30.394 0.389   1.00 38.29 ? 490 LEU D CB  1 
ATOM   2451 C CG  . LEU D 1 48 ? -15.440 29.193 1.335   1.00 41.44 ? 490 LEU D CG  1 
ATOM   2452 C CD1 . LEU D 1 48 ? -16.760 28.429 1.409   1.00 43.90 ? 490 LEU D CD1 1 
ATOM   2453 C CD2 . LEU D 1 48 ? -14.296 28.258 0.934   1.00 43.80 ? 490 LEU D CD2 1 
ATOM   2454 N N   . LEU D 1 49 ? -13.869 33.005 -1.206  1.00 35.65 ? 491 LEU D N   1 
ATOM   2455 C CA  . LEU D 1 49 ? -13.963 34.057 -2.199  1.00 34.82 ? 491 LEU D CA  1 
ATOM   2456 C C   . LEU D 1 49 ? -13.955 33.561 -3.624  1.00 35.27 ? 491 LEU D C   1 
ATOM   2457 O O   . LEU D 1 49 ? -13.247 32.615 -3.965  1.00 36.19 ? 491 LEU D O   1 
ATOM   2458 C CB  . LEU D 1 49 ? -12.833 35.077 -2.013  1.00 34.40 ? 491 LEU D CB  1 
ATOM   2459 C CG  . LEU D 1 49 ? -13.081 36.167 -0.984  1.00 34.85 ? 491 LEU D CG  1 
ATOM   2460 C CD1 . LEU D 1 49 ? -12.067 37.284 -1.174  1.00 35.75 ? 491 LEU D CD1 1 
ATOM   2461 C CD2 . LEU D 1 49 ? -14.497 36.695 -1.132  1.00 35.72 ? 491 LEU D CD2 1 
ATOM   2462 N N   . SER D 1 50 ? -14.745 34.230 -4.454  1.00 35.36 ? 492 SER D N   1 
ATOM   2463 C CA  . SER D 1 50 ? -14.715 34.020 -5.890  1.00 37.38 ? 492 SER D CA  1 
ATOM   2464 C C   . SER D 1 50 ? -15.130 35.310 -6.594  1.00 37.81 ? 492 SER D C   1 
ATOM   2465 O O   . SER D 1 50 ? -15.589 36.254 -5.951  1.00 37.10 ? 492 SER D O   1 
ATOM   2466 C CB  . SER D 1 50 ? -15.619 32.849 -6.291  1.00 38.14 ? 492 SER D CB  1 
ATOM   2467 O OG  . SER D 1 50 ? -16.971 33.137 -5.990  1.00 38.63 ? 492 SER D OG  1 
ATOM   2468 N N   . TYR D 1 51 ? -14.937 35.358 -7.906  1.00 39.44 ? 493 TYR D N   1 
ATOM   2469 C CA  . TYR D 1 51 ? -15.412 36.482 -8.692  1.00 40.63 ? 493 TYR D CA  1 
ATOM   2470 C C   . TYR D 1 51 ? -16.009 36.031 -10.028 1.00 43.67 ? 493 TYR D C   1 
ATOM   2471 O O   . TYR D 1 51 ? -15.693 34.942 -10.531 1.00 44.77 ? 493 TYR D O   1 
ATOM   2472 C CB  . TYR D 1 51 ? -14.297 37.525 -8.883  1.00 40.57 ? 493 TYR D CB  1 
ATOM   2473 C CG  . TYR D 1 51 ? -13.287 37.222 -9.978  1.00 41.26 ? 493 TYR D CG  1 
ATOM   2474 C CD1 . TYR D 1 51 ? -13.313 37.923 -11.185 1.00 41.42 ? 493 TYR D CD1 1 
ATOM   2475 C CD2 . TYR D 1 51 ? -12.305 36.248 -9.804  1.00 38.14 ? 493 TYR D CD2 1 
ATOM   2476 C CE1 . TYR D 1 51 ? -12.398 37.656 -12.193 1.00 41.17 ? 493 TYR D CE1 1 
ATOM   2477 C CE2 . TYR D 1 51 ? -11.379 35.974 -10.806 1.00 38.96 ? 493 TYR D CE2 1 
ATOM   2478 C CZ  . TYR D 1 51 ? -11.432 36.681 -11.999 1.00 41.47 ? 493 TYR D CZ  1 
ATOM   2479 O OH  . TYR D 1 51 ? -10.515 36.423 -12.997 1.00 42.20 ? 493 TYR D OH  1 
ATOM   2480 N N   . GLU D 1 52 ? -16.908 36.853 -10.564 1.00 45.50 ? 494 GLU D N   1 
ATOM   2481 C CA  . GLU D 1 52 ? -17.387 36.708 -11.942 1.00 49.30 ? 494 GLU D CA  1 
ATOM   2482 C C   . GLU D 1 52 ? -17.187 38.017 -12.718 1.00 51.13 ? 494 GLU D C   1 
ATOM   2483 O O   . GLU D 1 52 ? -17.246 39.107 -12.145 1.00 49.74 ? 494 GLU D O   1 
ATOM   2484 C CB  . GLU D 1 52 ? -18.847 36.203 -12.009 1.00 50.17 ? 494 GLU D CB  1 
ATOM   2485 C CG  . GLU D 1 52 ? -19.894 37.042 -11.269 1.00 51.28 ? 494 GLU D CG  1 
ATOM   2486 C CD  . GLU D 1 52 ? -21.294 36.408 -11.266 1.00 58.46 ? 494 GLU D CD  1 
ATOM   2487 O OE1 . GLU D 1 52 ? -21.435 35.228 -10.866 1.00 59.13 ? 494 GLU D OE1 1 
ATOM   2488 O OE2 . GLU D 1 52 ? -22.265 37.102 -11.651 1.00 61.46 ? 494 GLU D OE2 1 
ATOM   2489 N N   . SER D 1 53 ? -16.916 37.892 -14.016 1.00 54.79 ? 495 SER D N   1 
ATOM   2490 C CA  . SER D 1 53 ? -16.748 39.042 -14.904 1.00 57.61 ? 495 SER D CA  1 
ATOM   2491 C C   . SER D 1 53 ? -17.930 39.099 -15.867 1.00 61.04 ? 495 SER D C   1 
ATOM   2492 O O   . SER D 1 53 ? -18.448 38.051 -16.255 1.00 62.46 ? 495 SER D O   1 
ATOM   2493 C CB  . SER D 1 53 ? -15.429 38.936 -15.681 1.00 58.97 ? 495 SER D CB  1 
ATOM   2494 O OG  . SER D 1 53 ? -15.118 40.147 -16.358 1.00 61.67 ? 495 SER D OG  1 
ATOM   2495 N N   . PRO D 1 54 ? -18.377 40.320 -16.240 1.00 63.06 ? 496 PRO D N   1 
ATOM   2496 C CA  . PRO D 1 54 ? -19.441 40.465 -17.249 1.00 66.89 ? 496 PRO D CA  1 
ATOM   2497 C C   . PRO D 1 54 ? -19.030 39.931 -18.626 1.00 70.55 ? 496 PRO D C   1 
ATOM   2498 O O   . PRO D 1 54 ? -19.894 39.642 -19.458 0.87 73.74 ? 496 PRO D O   1 
ATOM   2499 C CB  . PRO D 1 54 ? -19.665 41.980 -17.308 1.00 68.00 ? 496 PRO D CB  1 
ATOM   2500 C CG  . PRO D 1 54 ? -19.188 42.488 -15.976 1.00 64.27 ? 496 PRO D CG  1 
ATOM   2501 C CD  . PRO D 1 54 ? -18.020 41.618 -15.635 1.00 61.76 ? 496 PRO D CD  1 
ATOM   2502 N N   . LYS D 1 55 ? -17.720 39.793 -18.844 0.50 70.49 ? 497 LYS D N   1 
ATOM   2503 C CA  . LYS D 1 55 ? -17.167 39.234 -20.079 0.50 74.02 ? 497 LYS D CA  1 
ATOM   2504 C C   . LYS D 1 55 ? -17.485 37.746 -20.193 0.50 74.45 ? 497 LYS D C   1 
ATOM   2505 O O   . LYS D 1 55 ? -17.353 37.155 -21.264 0.50 77.95 ? 497 LYS D O   1 
ATOM   2506 C CB  . LYS D 1 55 ? -15.684 39.582 -20.207 0.50 73.76 ? 497 LYS D CB  1 
ATOM   2507 C CG  . LYS D 1 55 ? -15.376 41.064 -20.208 0.50 74.47 ? 497 LYS D CG  1 
ATOM   2508 C CD  . LYS D 1 55 ? -13.875 41.288 -20.232 0.50 75.68 ? 497 LYS D CD  1 
ATOM   2509 C CE  . LYS D 1 55 ? -13.533 42.760 -20.338 0.50 77.59 ? 497 LYS D CE  1 
ATOM   2510 N NZ  . LYS D 1 55 ? -12.064 42.966 -20.429 0.50 77.84 ? 497 LYS D NZ  1 
ATOM   2511 N N   . LYS D 1 56 ? -17.890 37.141 -19.083 0.50 71.24 ? 498 LYS D N   1 
ATOM   2512 C CA  . LYS D 1 56 ? -18.209 35.723 -19.067 0.50 71.44 ? 498 LYS D CA  1 
ATOM   2513 C C   . LYS D 1 56 ? -19.121 35.365 -17.893 0.50 68.64 ? 498 LYS D C   1 
ATOM   2514 O O   . LYS D 1 56 ? -18.693 34.661 -16.975 0.50 66.14 ? 498 LYS D O   1 
ATOM   2515 C CB  . LYS D 1 56 ? -16.860 35.024 -18.918 0.50 70.50 ? 498 LYS D CB  1 
ATOM   2516 C CG  . LYS D 1 56 ? -16.829 33.619 -19.459 0.50 72.46 ? 498 LYS D CG  1 
ATOM   2517 C CD  . LYS D 1 56 ? -15.405 33.187 -19.727 0.50 72.11 ? 498 LYS D CD  1 
ATOM   2518 C CE  . LYS D 1 56 ? -15.374 31.958 -20.612 0.50 75.20 ? 498 LYS D CE  1 
ATOM   2519 N NZ  . LYS D 1 56 ? -13.991 31.655 -21.074 0.50 75.85 ? 498 LYS D NZ  1 
ATOM   2520 N N   . PRO D 1 57 ? -20.388 35.836 -17.929 1.00 69.42 ? 499 PRO D N   1 
ATOM   2521 C CA  . PRO D 1 57 ? -21.319 35.730 -16.797 1.00 66.99 ? 499 PRO D CA  1 
ATOM   2522 C C   . PRO D 1 57 ? -21.630 34.288 -16.394 1.00 66.50 ? 499 PRO D C   1 
ATOM   2523 O O   . PRO D 1 57 ? -21.489 33.365 -17.210 1.00 68.94 ? 499 PRO D O   1 
ATOM   2524 C CB  . PRO D 1 57 ? -22.599 36.407 -17.318 1.00 69.51 ? 499 PRO D CB  1 
ATOM   2525 C CG  . PRO D 1 57 ? -22.196 37.145 -18.551 1.00 72.72 ? 499 PRO D CG  1 
ATOM   2526 C CD  . PRO D 1 57 ? -21.061 36.371 -19.127 1.00 73.43 ? 499 PRO D CD  1 
ATOM   2527 N N   . GLY D 1 58 ? -22.047 34.109 -15.141 1.00 63.63 ? 500 GLY D N   1 
ATOM   2528 C CA  . GLY D 1 58 ? -22.437 32.797 -14.617 1.00 62.96 ? 500 GLY D CA  1 
ATOM   2529 C C   . GLY D 1 58 ? -21.273 31.938 -14.148 1.00 61.19 ? 500 GLY D C   1 
ATOM   2530 O O   . GLY D 1 58 ? -21.447 31.068 -13.289 1.00 60.01 ? 500 GLY D O   1 
ATOM   2531 N N   . ARG D 1 59 ? -20.091 32.184 -14.713 1.00 61.09 ? 501 ARG D N   1 
ATOM   2532 C CA  . ARG D 1 59 ? -18.897 31.401 -14.407 1.00 59.98 ? 501 ARG D CA  1 
ATOM   2533 C C   . ARG D 1 59 ? -18.068 32.066 -13.307 1.00 56.52 ? 501 ARG D C   1 
ATOM   2534 O O   . ARG D 1 59 ? -17.760 33.258 -13.377 1.00 55.89 ? 501 ARG D O   1 
ATOM   2535 C CB  . ARG D 1 59 ? -18.050 31.178 -15.666 1.00 62.81 ? 501 ARG D CB  1 
ATOM   2536 C CG  . ARG D 1 59 ? -18.790 30.469 -16.808 0.50 66.88 ? 501 ARG D CG  1 
ATOM   2537 C CD  . ARG D 1 59 ? -17.834 29.986 -17.893 0.50 68.94 ? 501 ARG D CD  1 
ATOM   2538 N NE  . ARG D 1 59 ? -18.540 29.621 -19.117 0.50 73.22 ? 501 ARG D NE  1 
ATOM   2539 C CZ  . ARG D 1 59 ? -19.203 28.481 -19.288 0.50 74.84 ? 501 ARG D CZ  1 
ATOM   2540 N NH1 . ARG D 1 59 ? -19.257 27.588 -18.310 0.50 73.46 ? 501 ARG D NH1 1 
ATOM   2541 N NH2 . ARG D 1 59 ? -19.817 28.234 -20.436 0.50 77.77 ? 501 ARG D NH2 1 
ATOM   2542 N N   . GLU D 1 60 ? -17.711 31.279 -12.296 1.00 54.45 ? 502 GLU D N   1 
ATOM   2543 C CA  . GLU D 1 60 ? -16.982 31.780 -11.142 1.00 51.51 ? 502 GLU D CA  1 
ATOM   2544 C C   . GLU D 1 60 ? -15.581 31.205 -11.036 1.00 51.49 ? 502 GLU D C   1 
ATOM   2545 O O   . GLU D 1 60 ? -15.377 29.990 -11.169 1.00 52.88 ? 502 GLU D O   1 
ATOM   2546 C CB  . GLU D 1 60 ? -17.741 31.470 -9.857  1.00 49.63 ? 502 GLU D CB  1 
ATOM   2547 C CG  . GLU D 1 60 ? -18.907 32.395 -9.595  1.00 50.25 ? 502 GLU D CG  1 
ATOM   2548 C CD  . GLU D 1 60 ? -19.631 32.054 -8.310  1.00 51.85 ? 502 GLU D CD  1 
ATOM   2549 O OE1 . GLU D 1 60 ? -18.979 32.014 -7.237  1.00 49.64 ? 502 GLU D OE1 1 
ATOM   2550 O OE2 . GLU D 1 60 ? -20.856 31.823 -8.380  1.00 52.60 ? 502 GLU D OE2 1 
ATOM   2551 N N   . ILE D 1 61 ? -14.622 32.088 -10.776 1.00 49.94 ? 503 ILE D N   1 
ATOM   2552 C CA  . ILE D 1 61 ? -13.254 31.677 -10.525 1.00 49.88 ? 503 ILE D CA  1 
ATOM   2553 C C   . ILE D 1 61 ? -12.951 31.803 -9.030  1.00 47.55 ? 503 ILE D C   1 
ATOM   2554 O O   . ILE D 1 61 ? -13.067 32.888 -8.446  1.00 45.78 ? 503 ILE D O   1 
ATOM   2555 C CB  . ILE D 1 61 ? -12.229 32.475 -11.391 1.00 50.97 ? 503 ILE D CB  1 
ATOM   2556 C CG1 . ILE D 1 61 ? -12.312 32.058 -12.869 1.00 54.23 ? 503 ILE D CG1 1 
ATOM   2557 C CG2 . ILE D 1 61 ? -10.793 32.295 -10.871 1.00 50.21 ? 503 ILE D CG2 1 
ATOM   2558 C CD1 . ILE D 1 61 ? -13.247 32.918 -13.724 1.00 56.53 ? 503 ILE D CD1 1 
ATOM   2559 N N   . GLU D 1 62 ? -12.581 30.673 -8.427  1.00 47.80 ? 504 GLU D N   1 
ATOM   2560 C CA  . GLU D 1 62 ? -12.176 30.602 -7.024  1.00 46.48 ? 504 GLU D CA  1 
ATOM   2561 C C   . GLU D 1 62 ? -10.949 31.471 -6.766  1.00 45.72 ? 504 GLU D C   1 
ATOM   2562 O O   . GLU D 1 62 ? -9.990  31.452 -7.537  1.00 46.78 ? 504 GLU D O   1 
ATOM   2563 C CB  . GLU D 1 62 ? -11.845 29.159 -6.639  1.00 47.83 ? 504 GLU D CB  1 
ATOM   2564 C CG  . GLU D 1 62 ? -12.809 28.114 -7.170  0.50 50.18 ? 504 GLU D CG  1 
ATOM   2565 C CD  . GLU D 1 62 ? -14.044 27.987 -6.319  0.50 52.91 ? 504 GLU D CD  1 
ATOM   2566 O OE1 . GLU D 1 62 ? -13.913 27.563 -5.148  0.50 52.63 ? 504 GLU D OE1 1 
ATOM   2567 O OE2 . GLU D 1 62 ? -15.144 28.302 -6.824  0.50 54.39 ? 504 GLU D OE2 1 
ATOM   2568 N N   . LEU D 1 63 ? -10.983 32.234 -5.685  1.00 44.13 ? 505 LEU D N   1 
ATOM   2569 C CA  . LEU D 1 63 ? -9.806  32.985 -5.264  1.00 43.74 ? 505 LEU D CA  1 
ATOM   2570 C C   . LEU D 1 63 ? -9.190  32.253 -4.076  1.00 44.24 ? 505 LEU D C   1 
ATOM   2571 O O   . LEU D 1 63 ? -9.373  32.633 -2.917  1.00 43.33 ? 505 LEU D O   1 
ATOM   2572 C CB  . LEU D 1 63 ? -10.154 34.449 -4.960  1.00 42.06 ? 505 LEU D CB  1 
ATOM   2573 C CG  . LEU D 1 63 ? -10.783 35.240 -6.125  1.00 41.92 ? 505 LEU D CG  1 
ATOM   2574 C CD1 . LEU D 1 63 ? -11.349 36.580 -5.675  1.00 40.53 ? 505 LEU D CD1 1 
ATOM   2575 C CD2 . LEU D 1 63 ? -9.816  35.431 -7.281  1.00 41.75 ? 505 LEU D CD2 1 
ATOM   2576 N N   . GLU D 1 64 ? -8.471  31.179 -4.402  1.00 46.24 ? 506 GLU D N   1 
ATOM   2577 C CA  . GLU D 1 64 ? -7.957  30.222 -3.422  1.00 47.39 ? 506 GLU D CA  1 
ATOM   2578 C C   . GLU D 1 64 ? -6.629  30.613 -2.770  1.00 47.58 ? 506 GLU D C   1 
ATOM   2579 O O   . GLU D 1 64 ? -6.454  30.410 -1.566  1.00 48.07 ? 506 GLU D O   1 
ATOM   2580 C CB  . GLU D 1 64 ? -7.824  28.832 -4.060  1.00 49.92 ? 506 GLU D CB  1 
ATOM   2581 C CG  . GLU D 1 64 ? -9.135  28.185 -4.486  0.50 50.68 ? 506 GLU D CG  1 
ATOM   2582 C CD  . GLU D 1 64 ? -10.125 28.022 -3.345  0.50 53.16 ? 506 GLU D CD  1 
ATOM   2583 O OE1 . GLU D 1 64 ? -9.711  27.670 -2.217  0.50 54.37 ? 506 GLU D OE1 1 
ATOM   2584 O OE2 . GLU D 1 64 ? -11.331 28.245 -3.583  0.50 53.54 ? 506 GLU D OE2 1 
ATOM   2585 N N   . ASN D 1 65 ? -5.706  31.159 -3.566  1.00 47.43 ? 507 ASN D N   1 
ATOM   2586 C CA  . ASN D 1 65 ? -4.359  31.513 -3.103  1.00 47.42 ? 507 ASN D CA  1 
ATOM   2587 C C   . ASN D 1 65 ? -4.323  32.854 -2.370  1.00 45.67 ? 507 ASN D C   1 
ATOM   2588 O O   . ASN D 1 65 ? -4.203  33.916 -2.995  1.00 44.77 ? 507 ASN D O   1 
ATOM   2589 C CB  . ASN D 1 65 ? -3.377  31.515 -4.285  1.00 48.82 ? 507 ASN D CB  1 
ATOM   2590 C CG  . ASN D 1 65 ? -1.918  31.481 -3.848  1.00 50.49 ? 507 ASN D CG  1 
ATOM   2591 O OD1 . ASN D 1 65 ? -1.595  31.689 -2.678  1.00 50.96 ? 507 ASN D OD1 1 
ATOM   2592 N ND2 . ASN D 1 65 ? -1.026  31.223 -4.799  1.00 52.39 ? 507 ASN D ND2 1 
ATOM   2593 N N   . ASP D 1 66 ? -4.413  32.790 -1.042  1.00 45.17 ? 508 ASP D N   1 
ATOM   2594 C CA  . ASP D 1 66 ? -4.465  33.982 -0.185  1.00 43.84 ? 508 ASP D CA  1 
ATOM   2595 C C   . ASP D 1 66 ? -3.252  34.895 -0.328  1.00 43.82 ? 508 ASP D C   1 
ATOM   2596 O O   . ASP D 1 66 ? -3.291  36.053 0.083   1.00 43.18 ? 508 ASP D O   1 
ATOM   2597 C CB  . ASP D 1 66 ? -4.610  33.573 1.283   1.00 44.59 ? 508 ASP D CB  1 
ATOM   2598 C CG  . ASP D 1 66 ? -5.929  32.873 1.567   1.00 46.71 ? 508 ASP D CG  1 
ATOM   2599 O OD1 . ASP D 1 66 ? -6.980  33.404 1.152   1.00 48.69 ? 508 ASP D OD1 1 
ATOM   2600 O OD2 . ASP D 1 66 ? -5.916  31.798 2.210   1.00 51.62 ? 508 ASP D OD2 1 
ATOM   2601 N N   . LEU D 1 67 ? -2.179  34.369 -0.907  1.00 44.78 ? 509 LEU D N   1 
ATOM   2602 C CA  . LEU D 1 67 ? -0.915  35.090 -1.014  1.00 44.99 ? 509 LEU D CA  1 
ATOM   2603 C C   . LEU D 1 67 ? -0.815  35.962 -2.263  1.00 43.83 ? 509 LEU D C   1 
ATOM   2604 O O   . LEU D 1 67 ? 0.022   36.869 -2.326  1.00 44.18 ? 509 LEU D O   1 
ATOM   2605 C CB  . LEU D 1 67 ? 0.257   34.105 -0.968  1.00 47.36 ? 509 LEU D CB  1 
ATOM   2606 C CG  . LEU D 1 67 ? 0.480   33.369 0.358   1.00 49.65 ? 509 LEU D CG  1 
ATOM   2607 C CD1 . LEU D 1 67 ? 1.587   32.313 0.221   1.00 52.79 ? 509 LEU D CD1 1 
ATOM   2608 C CD2 . LEU D 1 67 ? 0.777   34.346 1.501   1.00 48.30 ? 509 LEU D CD2 1 
ATOM   2609 N N   . LYS D 1 68 ? -1.669  35.678 -3.245  1.00 42.28 ? 510 LYS D N   1 
ATOM   2610 C CA  . LYS D 1 68 ? -1.671  36.382 -4.523  1.00 41.60 ? 510 LYS D CA  1 
ATOM   2611 C C   . LYS D 1 68 ? -2.659  37.536 -4.473  1.00 39.30 ? 510 LYS D C   1 
ATOM   2612 O O   . LYS D 1 68 ? -3.574  37.535 -3.649  1.00 37.92 ? 510 LYS D O   1 
ATOM   2613 C CB  . LYS D 1 68 ? -2.028  35.425 -5.671  1.00 42.71 ? 510 LYS D CB  1 
ATOM   2614 C CG  . LYS D 1 68 ? -1.022  34.301 -5.903  1.00 45.24 ? 510 LYS D CG  1 
ATOM   2615 C CD  . LYS D 1 68 ? 0.241   34.796 -6.587  1.00 48.06 ? 510 LYS D CD  1 
ATOM   2616 C CE  . LYS D 1 68 ? 1.334   33.751 -6.522  1.00 53.01 ? 510 LYS D CE  1 
ATOM   2617 N NZ  . LYS D 1 68 ? 2.630   34.264 -7.045  1.00 54.84 ? 510 LYS D NZ  1 
ATOM   2618 N N   . SER D 1 69 ? -2.471  38.513 -5.356  1.00 38.83 ? 511 SER D N   1 
ATOM   2619 C CA  . SER D 1 69 ? -3.327  39.696 -5.405  1.00 37.26 ? 511 SER D CA  1 
ATOM   2620 C C   . SER D 1 69 ? -4.511  39.541 -6.374  1.00 36.80 ? 511 SER D C   1 
ATOM   2621 O O   . SER D 1 69 ? -4.559  38.592 -7.152  1.00 37.60 ? 511 SER D O   1 
ATOM   2622 C CB  . SER D 1 69 ? -2.486  40.929 -5.772  1.00 37.98 ? 511 SER D CB  1 
ATOM   2623 O OG  . SER D 1 69 ? -1.934  40.806 -7.068  1.00 38.82 ? 511 SER D OG  1 
ATOM   2624 N N   . LEU D 1 70 ? -5.462  40.476 -6.316  1.00 35.98 ? 512 LEU D N   1 
ATOM   2625 C CA  . LEU D 1 70 ? -6.579  40.535 -7.280  1.00 36.26 ? 512 LEU D CA  1 
ATOM   2626 C C   . LEU D 1 70 ? -6.074  40.731 -8.709  1.00 38.35 ? 512 LEU D C   1 
ATOM   2627 O O   . LEU D 1 70 ? -6.499  40.034 -9.640  1.00 39.45 ? 512 LEU D O   1 
ATOM   2628 C CB  . LEU D 1 70 ? -7.534  41.678 -6.928  1.00 35.52 ? 512 LEU D CB  1 
ATOM   2629 C CG  . LEU D 1 70 ? -8.140  41.698 -5.523  1.00 33.33 ? 512 LEU D CG  1 
ATOM   2630 C CD1 . LEU D 1 70 ? -8.700  43.089 -5.225  1.00 29.99 ? 512 LEU D CD1 1 
ATOM   2631 C CD2 . LEU D 1 70 ? -9.192  40.620 -5.358  1.00 32.46 ? 512 LEU D CD2 1 
ATOM   2632 N N   . GLN D 1 71 ? -5.162  41.691 -8.846  1.00 38.96 ? 513 GLN D N   1 
ATOM   2633 C CA  . GLN D 1 71 ? -4.398  41.981 -10.055 1.00 41.10 ? 513 GLN D CA  1 
ATOM   2634 C C   . GLN D 1 71 ? -3.863  40.715 -10.719 1.00 42.32 ? 513 GLN D C   1 
ATOM   2635 O O   . GLN D 1 71 ? -4.005  40.527 -11.929 1.00 43.84 ? 513 GLN D O   1 
ATOM   2636 C CB  . GLN D 1 71 ? -3.209  42.834 -9.638  1.00 41.68 ? 513 GLN D CB  1 
ATOM   2637 C CG  . GLN D 1 71 ? -2.824  43.933 -10.559 1.00 44.49 ? 513 GLN D CG  1 
ATOM   2638 C CD  . GLN D 1 71 ? -2.083  45.011 -9.819  1.00 46.05 ? 513 GLN D CD  1 
ATOM   2639 O OE1 . GLN D 1 71 ? -2.582  46.126 -9.679  1.00 45.41 ? 513 GLN D OE1 1 
ATOM   2640 N NE2 . GLN D 1 71 ? -0.894  44.681 -9.310  1.00 47.71 ? 513 GLN D NE2 1 
ATOM   2641 N N   . PHE D 1 72 ? -3.238  39.861 -9.906  1.00 41.69 ? 514 PHE D N   1 
ATOM   2642 C CA  . PHE D 1 72 ? -2.660  38.600 -10.363 1.00 43.18 ? 514 PHE D CA  1 
ATOM   2643 C C   . PHE D 1 72 ? -3.714  37.680 -10.977 1.00 43.58 ? 514 PHE D C   1 
ATOM   2644 O O   . PHE D 1 72 ? -3.471  37.032 -12.002 1.00 45.64 ? 514 PHE D O   1 
ATOM   2645 C CB  . PHE D 1 72 ? -1.968  37.894 -9.197  1.00 42.36 ? 514 PHE D CB  1 
ATOM   2646 C CG  . PHE D 1 72 ? -1.358  36.582 -9.567  1.00 45.39 ? 514 PHE D CG  1 
ATOM   2647 C CD1 . PHE D 1 72 ? -0.050  36.520 -10.045 1.00 49.25 ? 514 PHE D CD1 1 
ATOM   2648 C CD2 . PHE D 1 72 ? -2.094  35.402 -9.453  1.00 44.79 ? 514 PHE D CD2 1 
ATOM   2649 C CE1 . PHE D 1 72 ? 0.520   35.303 -10.401 1.00 50.78 ? 514 PHE D CE1 1 
ATOM   2650 C CE2 . PHE D 1 72 ? -1.537  34.188 -9.807  1.00 47.54 ? 514 PHE D CE2 1 
ATOM   2651 C CZ  . PHE D 1 72 ? -0.224  34.135 -10.279 1.00 49.84 ? 514 PHE D CZ  1 
ATOM   2652 N N   . TYR D 1 73 ? -4.873  37.623 -10.324 1.00 42.03 ? 515 TYR D N   1 
ATOM   2653 C CA  . TYR D 1 73 ? -6.013  36.830 -10.775 1.00 42.62 ? 515 TYR D CA  1 
ATOM   2654 C C   . TYR D 1 73 ? -6.800  37.530 -11.888 1.00 43.74 ? 515 TYR D C   1 
ATOM   2655 O O   . TYR D 1 73 ? -7.929  37.133 -12.197 1.00 44.17 ? 515 TYR D O   1 
ATOM   2656 C CB  . TYR D 1 73 ? -6.951  36.585 -9.600  1.00 40.61 ? 515 TYR D CB  1 
ATOM   2657 C CG  . TYR D 1 73 ? -6.625  35.391 -8.738  1.00 41.12 ? 515 TYR D CG  1 
ATOM   2658 C CD1 . TYR D 1 73 ? -6.999  34.107 -9.137  1.00 43.59 ? 515 TYR D CD1 1 
ATOM   2659 C CD2 . TYR D 1 73 ? -5.989  35.544 -7.503  1.00 39.96 ? 515 TYR D CD2 1 
ATOM   2660 C CE1 . TYR D 1 73 ? -6.731  33.004 -8.351  1.00 45.03 ? 515 TYR D CE1 1 
ATOM   2661 C CE2 . TYR D 1 73 ? -5.714  34.433 -6.697  1.00 40.92 ? 515 TYR D CE2 1 
ATOM   2662 C CZ  . TYR D 1 73 ? -6.091  33.167 -7.134  1.00 44.47 ? 515 TYR D CZ  1 
ATOM   2663 O OH  . TYR D 1 73 ? -5.847  32.045 -6.375  1.00 46.92 ? 515 TYR D OH  1 
ATOM   2664 N N   . SER D 1 74 ? -6.212  38.585 -12.456 1.00 44.71 ? 516 SER D N   1 
ATOM   2665 C CA  . SER D 1 74 ? -6.778  39.338 -13.582 1.00 46.54 ? 516 SER D CA  1 
ATOM   2666 C C   . SER D 1 74 ? -8.167  39.937 -13.315 1.00 45.40 ? 516 SER D C   1 
ATOM   2667 O O   . SER D 1 74 ? -8.926  40.214 -14.245 1.00 46.94 ? 516 SER D O   1 
ATOM   2668 C CB  . SER D 1 74 ? -6.760  38.495 -14.871 1.00 49.55 ? 516 SER D CB  1 
ATOM   2669 O OG  . SER D 1 74 ? -5.424  38.281 -15.324 1.00 51.71 ? 516 SER D OG  1 
ATOM   2670 N N   . VAL D 1 75 ? -8.486  40.141 -12.038 1.00 43.07 ? 517 VAL D N   1 
ATOM   2671 C CA  . VAL D 1 75 ? -9.726  40.804 -11.640 1.00 42.25 ? 517 VAL D CA  1 
ATOM   2672 C C   . VAL D 1 75 ? -9.718  42.217 -12.239 1.00 44.01 ? 517 VAL D C   1 
ATOM   2673 O O   . VAL D 1 75 ? -8.684  42.893 -12.229 1.00 44.39 ? 517 VAL D O   1 
ATOM   2674 C CB  . VAL D 1 75 ? -9.881  40.850 -10.101 1.00 39.48 ? 517 VAL D CB  1 
ATOM   2675 C CG1 . VAL D 1 75 ? -11.232 41.417 -9.710  1.00 39.22 ? 517 VAL D CG1 1 
ATOM   2676 C CG2 . VAL D 1 75 ? -9.718  39.463 -9.505  1.00 38.54 ? 517 VAL D CG2 1 
ATOM   2677 N N   . GLU D 1 76 ? -10.855 42.634 -12.792 1.00 45.55 ? 518 GLU D N   1 
ATOM   2678 C CA  . GLU D 1 76 ? -10.958 43.909 -13.508 1.00 48.16 ? 518 GLU D CA  1 
ATOM   2679 C C   . GLU D 1 76 ? -11.947 44.868 -12.853 1.00 47.37 ? 518 GLU D C   1 
ATOM   2680 O O   . GLU D 1 76 ? -12.773 44.461 -12.040 1.00 45.48 ? 518 GLU D O   1 
ATOM   2681 C CB  . GLU D 1 76 ? -11.362 43.680 -14.973 1.00 51.33 ? 518 GLU D CB  1 
ATOM   2682 C CG  . GLU D 1 76 ? -10.193 43.395 -15.916 1.00 55.53 ? 518 GLU D CG  1 
ATOM   2683 C CD  . GLU D 1 76 ? -10.640 43.028 -17.322 0.50 62.14 ? 518 GLU D CD  1 
ATOM   2684 O OE1 . GLU D 1 76 ? -11.629 42.273 -17.466 0.50 62.52 ? 518 GLU D OE1 1 
ATOM   2685 O OE2 . GLU D 1 76 ? -9.993  43.492 -18.284 0.50 66.39 ? 518 GLU D OE2 1 
ATOM   2686 N N   . ASN D 1 77 ? -11.851 46.140 -13.231 1.00 49.15 ? 519 ASN D N   1 
ATOM   2687 C CA  . ASN D 1 77 ? -12.796 47.163 -12.811 1.00 49.56 ? 519 ASN D CA  1 
ATOM   2688 C C   . ASN D 1 77 ? -14.228 46.809 -13.214 1.00 50.50 ? 519 ASN D C   1 
ATOM   2689 O O   . ASN D 1 77 ? -14.506 46.528 -14.382 1.00 52.64 ? 519 ASN D O   1 
ATOM   2690 C CB  . ASN D 1 77 ? -12.408 48.520 -13.408 1.00 51.93 ? 519 ASN D CB  1 
ATOM   2691 C CG  . ASN D 1 77 ? -13.053 49.677 -12.679 1.00 52.77 ? 519 ASN D CG  1 
ATOM   2692 O OD1 . ASN D 1 77 ? -12.966 49.778 -11.457 1.00 52.68 ? 519 ASN D OD1 1 
ATOM   2693 N ND2 . ASN D 1 77 ? -13.703 50.560 -13.425 1.00 57.45 ? 519 ASN D ND2 1 
ATOM   2694 N N   . GLY D 1 78 ? -15.123 46.807 -12.232 1.00 49.08 ? 520 GLY D N   1 
ATOM   2695 C CA  . GLY D 1 78 ? -16.527 46.498 -12.466 1.00 50.10 ? 520 GLY D CA  1 
ATOM   2696 C C   . GLY D 1 78 ? -16.889 45.043 -12.251 1.00 48.87 ? 520 GLY D C   1 
ATOM   2697 O O   . GLY D 1 78 ? -18.050 44.673 -12.394 1.00 50.12 ? 520 GLY D O   1 
ATOM   2698 N N   . ASP D 1 79 ? -15.908 44.208 -11.915 1.00 47.21 ? 521 ASP D N   1 
ATOM   2699 C CA  . ASP D 1 79 ? -16.176 42.790 -11.634 1.00 46.18 ? 521 ASP D CA  1 
ATOM   2700 C C   . ASP D 1 79 ? -16.978 42.594 -10.341 1.00 44.34 ? 521 ASP D C   1 
ATOM   2701 O O   . ASP D 1 79 ? -17.135 43.520 -9.542  1.00 43.46 ? 521 ASP D O   1 
ATOM   2702 C CB  . ASP D 1 79 ? -14.874 41.975 -11.585 1.00 45.12 ? 521 ASP D CB  1 
ATOM   2703 C CG  . ASP D 1 79 ? -14.386 41.544 -12.967 1.00 47.87 ? 521 ASP D CG  1 
ATOM   2704 O OD1 . ASP D 1 79 ? -15.112 41.740 -13.973 1.00 49.40 ? 521 ASP D OD1 1 
ATOM   2705 O OD2 . ASP D 1 79 ? -13.265 40.991 -13.039 1.00 46.41 ? 521 ASP D OD2 1 
ATOM   2706 N N   . CYS D 1 80 ? -17.488 41.381 -10.152 1.00 44.40 ? 522 CYS D N   1 
ATOM   2707 C CA  . CYS D 1 80 ? -18.303 41.047 -8.985  1.00 43.71 ? 522 CYS D CA  1 
ATOM   2708 C C   . CYS D 1 80 ? -17.563 40.068 -8.079  1.00 41.34 ? 522 CYS D C   1 
ATOM   2709 O O   . CYS D 1 80 ? -17.095 39.025 -8.530  1.00 41.98 ? 522 CYS D O   1 
ATOM   2710 C CB  . CYS D 1 80 ? -19.666 40.474 -9.414  1.00 45.07 ? 522 CYS D CB  1 
ATOM   2711 S SG  . CYS D 1 80 ? -20.853 40.150 -8.064  1.00 48.90 ? 522 CYS D SG  1 
ATOM   2712 N N   . LEU D 1 81 ? -17.461 40.419 -6.804  1.00 39.20 ? 523 LEU D N   1 
ATOM   2713 C CA  . LEU D 1 81 ? -16.888 39.551 -5.794  1.00 37.45 ? 523 LEU D CA  1 
ATOM   2714 C C   . LEU D 1 81 ? -17.988 38.778 -5.053  1.00 36.80 ? 523 LEU D C   1 
ATOM   2715 O O   . LEU D 1 81 ? -18.865 39.375 -4.427  1.00 36.59 ? 523 LEU D O   1 
ATOM   2716 C CB  . LEU D 1 81 ? -16.075 40.390 -4.810  1.00 36.39 ? 523 LEU D CB  1 
ATOM   2717 C CG  . LEU D 1 81 ? -15.018 39.743 -3.917  1.00 36.53 ? 523 LEU D CG  1 
ATOM   2718 C CD1 . LEU D 1 81 ? -13.830 39.235 -4.734  1.00 38.48 ? 523 LEU D CD1 1 
ATOM   2719 C CD2 . LEU D 1 81 ? -14.550 40.774 -2.904  1.00 38.75 ? 523 LEU D CD2 1 
ATOM   2720 N N   . LEU D 1 82 ? -17.933 37.451 -5.130  1.00 36.59 ? 524 LEU D N   1 
ATOM   2721 C CA  . LEU D 1 82 ? -18.887 36.599 -4.416  1.00 36.07 ? 524 LEU D CA  1 
ATOM   2722 C C   . LEU D 1 82 ? -18.283 36.072 -3.120  1.00 34.78 ? 524 LEU D C   1 
ATOM   2723 O O   . LEU D 1 82 ? -17.161 35.556 -3.105  1.00 34.49 ? 524 LEU D O   1 
ATOM   2724 C CB  . LEU D 1 82 ? -19.399 35.466 -5.303  1.00 37.21 ? 524 LEU D CB  1 
ATOM   2725 C CG  . LEU D 1 82 ? -20.047 35.912 -6.617  1.00 39.22 ? 524 LEU D CG  1 
ATOM   2726 C CD1 . LEU D 1 82 ? -19.075 35.693 -7.771  1.00 41.90 ? 524 LEU D CD1 1 
ATOM   2727 C CD2 . LEU D 1 82 ? -21.326 35.159 -6.873  1.00 43.34 ? 524 LEU D CD2 1 
ATOM   2728 N N   . VAL D 1 83 ? -19.036 36.244 -2.035  1.00 34.03 ? 525 VAL D N   1 
ATOM   2729 C CA  . VAL D 1 83 ? -18.538 36.020 -0.687  1.00 32.58 ? 525 VAL D CA  1 
ATOM   2730 C C   . VAL D 1 83 ? -19.415 34.999 0.000   1.00 33.05 ? 525 VAL D C   1 
ATOM   2731 O O   . VAL D 1 83 ? -20.638 35.172 0.101   1.00 33.37 ? 525 VAL D O   1 
ATOM   2732 C CB  . VAL D 1 83 ? -18.503 37.328 0.162   1.00 32.51 ? 525 VAL D CB  1 
ATOM   2733 C CG1 . VAL D 1 83 ? -17.845 37.073 1.524   1.00 31.95 ? 525 VAL D CG1 1 
ATOM   2734 C CG2 . VAL D 1 83 ? -17.769 38.441 -0.573  1.00 29.79 ? 525 VAL D CG2 1 
ATOM   2735 N N   . ARG D 1 84 ? -18.765 33.940 0.470   1.00 33.21 ? 526 ARG D N   1 
ATOM   2736 C CA  . ARG D 1 84 ? -19.426 32.799 1.088   1.00 34.32 ? 526 ARG D CA  1 
ATOM   2737 C C   . ARG D 1 84 ? -18.727 32.425 2.382   1.00 34.46 ? 526 ARG D C   1 
ATOM   2738 O O   . ARG D 1 84 ? -17.549 32.730 2.582   1.00 33.99 ? 526 ARG D O   1 
ATOM   2739 C CB  . ARG D 1 84 ? -19.399 31.602 0.143   1.00 34.99 ? 526 ARG D CB  1 
ATOM   2740 C CG  . ARG D 1 84 ? -20.210 31.786 -1.129  1.00 36.18 ? 526 ARG D CG  1 
ATOM   2741 C CD  . ARG D 1 84 ? -20.306 30.469 -1.896  1.00 37.38 ? 526 ARG D CD  1 
ATOM   2742 N NE  . ARG D 1 84 ? -21.239 30.555 -3.014  1.00 37.34 ? 526 ARG D NE  1 
ATOM   2743 C CZ  . ARG D 1 84 ? -20.917 30.990 -4.232  1.00 38.15 ? 526 ARG D CZ  1 
ATOM   2744 N NH1 . ARG D 1 84 ? -19.676 31.379 -4.503  1.00 34.81 ? 526 ARG D NH1 1 
ATOM   2745 N NH2 . ARG D 1 84 ? -21.844 31.031 -5.189  1.00 38.33 ? 526 ARG D NH2 1 
ATOM   2746 N N   . TRP D 1 85 ? -19.466 31.775 3.269   1.00 35.59 ? 527 TRP D N   1 
ATOM   2747 C CA  . TRP D 1 85 ? -18.896 31.270 4.515   1.00 36.58 ? 527 TRP D CA  1 
ATOM   2748 C C   . TRP D 1 85 ? -19.718 30.096 5.008   1.00 38.19 ? 527 TRP D C   1 
ATOM   2749 O O   . TRP D 1 85 ? -19.542 29.601 6.125   1.00 39.74 ? 527 TRP D O   1 
ATOM   2750 C CB  . TRP D 1 85 ? -18.796 32.372 5.578   1.00 36.39 ? 527 TRP D CB  1 
ATOM   2751 C CG  . TRP D 1 85 ? -20.090 33.068 5.912   1.00 35.76 ? 527 TRP D CG  1 
ATOM   2752 C CD1 . TRP D 1 85 ? -20.909 32.802 6.969   1.00 36.11 ? 527 TRP D CD1 1 
ATOM   2753 C CD2 . TRP D 1 85 ? -20.690 34.167 5.208   1.00 34.89 ? 527 TRP D CD2 1 
ATOM   2754 N NE1 . TRP D 1 85 ? -21.989 33.651 6.962   1.00 36.44 ? 527 TRP D NE1 1 
ATOM   2755 C CE2 . TRP D 1 85 ? -21.881 34.501 5.895   1.00 34.44 ? 527 TRP D CE2 1 
ATOM   2756 C CE3 . TRP D 1 85 ? -20.342 34.899 4.063   1.00 31.01 ? 527 TRP D CE3 1 
ATOM   2757 C CZ2 . TRP D 1 85 ? -22.725 35.531 5.478   1.00 31.20 ? 527 TRP D CZ2 1 
ATOM   2758 C CZ3 . TRP D 1 85 ? -21.190 35.917 3.641   1.00 29.03 ? 527 TRP D CZ3 1 
ATOM   2759 C CH2 . TRP D 1 85 ? -22.364 36.224 4.351   1.00 30.67 ? 527 TRP D CH2 1 
ATOM   2760 O OXT . TRP D 1 85 ? -20.572 29.626 4.260   1.00 38.33 ? 527 TRP D OXT 1 
HETATM 2761 O O   . HOH E 2 .  ? -17.123 20.189 -1.306  1.00 10.82 ? 601 HOH A O   1 
HETATM 2762 O O   . HOH E 2 .  ? 10.963  10.485 -4.300  1.00 24.71 ? 602 HOH A O   1 
HETATM 2763 O O   . HOH E 2 .  ? 0.273   10.454 -12.440 1.00 15.15 ? 603 HOH A O   1 
HETATM 2764 O O   . HOH E 2 .  ? -5.470  12.516 -12.948 1.00 16.48 ? 604 HOH A O   1 
HETATM 2765 O O   . HOH E 2 .  ? -6.050  24.628 -15.046 1.00 13.02 ? 605 HOH A O   1 
HETATM 2766 O O   . HOH E 2 .  ? 2.734   28.630 -4.791  1.00 31.85 ? 606 HOH A O   1 
HETATM 2767 O O   . HOH E 2 .  ? -14.201 14.816 -6.357  1.00 24.19 ? 607 HOH A O   1 
HETATM 2768 O O   . HOH E 2 .  ? 6.716   8.256  -13.292 1.00 42.72 ? 608 HOH A O   1 
HETATM 2769 O O   . HOH E 2 .  ? 12.124  17.978 -4.650  1.00 20.49 ? 609 HOH A O   1 
HETATM 2770 O O   . HOH E 2 .  ? 12.004  20.429 -6.070  1.00 23.69 ? 610 HOH A O   1 
HETATM 2771 O O   . HOH E 2 .  ? -4.023  28.369 -6.887  1.00 30.89 ? 611 HOH A O   1 
HETATM 2772 O O   . HOH E 2 .  ? -16.150 21.871 -4.586  1.00 16.25 ? 612 HOH A O   1 
HETATM 2773 O O   . HOH E 2 .  ? -5.607  14.440 -17.146 1.00 34.00 ? 613 HOH A O   1 
HETATM 2774 O O   . HOH E 2 .  ? -8.594  22.889 5.949   1.00 37.77 ? 614 HOH A O   1 
HETATM 2775 O O   A HOH E 2 .  ? 5.471   5.607  -2.681  0.50 4.63  ? 615 HOH A O   1 
HETATM 2776 O O   B HOH E 2 .  ? 7.274   5.513  -1.893  0.50 4.73  ? 615 HOH A O   1 
HETATM 2777 O O   . HOH E 2 .  ? 9.165   22.200 -0.029  1.00 7.22  ? 616 HOH A O   1 
HETATM 2778 O O   . HOH E 2 .  ? 7.962   25.691 3.618   1.00 19.53 ? 617 HOH A O   1 
HETATM 2779 O O   . HOH E 2 .  ? 8.038   22.995 2.156   1.00 23.95 ? 618 HOH A O   1 
HETATM 2780 O O   . HOH E 2 .  ? 6.822   26.307 -8.640  1.00 30.44 ? 619 HOH A O   1 
HETATM 2781 O O   . HOH E 2 .  ? 11.653  18.006 -8.840  1.00 28.63 ? 620 HOH A O   1 
HETATM 2782 O O   . HOH E 2 .  ? 9.756   4.525  -2.693  1.00 38.87 ? 621 HOH A O   1 
HETATM 2783 O O   . HOH E 2 .  ? 4.173   15.144 -16.998 1.00 47.99 ? 622 HOH A O   1 
HETATM 2784 O O   . HOH F 2 .  ? -5.412  7.233  -21.101 1.00 9.67  ? 601 HOH B O   1 
HETATM 2785 O O   . HOH F 2 .  ? -21.575 -1.027 -14.567 1.00 17.09 ? 602 HOH B O   1 
HETATM 2786 O O   . HOH F 2 .  ? -10.678 2.198  -14.898 1.00 40.21 ? 603 HOH B O   1 
HETATM 2787 O O   . HOH F 2 .  ? -6.950  -2.857 -21.001 1.00 18.30 ? 604 HOH B O   1 
HETATM 2788 O O   . HOH F 2 .  ? -35.575 14.240 -25.111 1.00 17.40 ? 605 HOH B O   1 
HETATM 2789 O O   . HOH F 2 .  ? -31.811 7.232  -26.174 1.00 24.88 ? 606 HOH B O   1 
HETATM 2790 O O   . HOH F 2 .  ? -2.825  10.166 -23.162 1.00 43.27 ? 607 HOH B O   1 
HETATM 2791 O O   . HOH F 2 .  ? -28.382 -4.141 -28.529 1.00 23.80 ? 608 HOH B O   1 
HETATM 2792 O O   . HOH F 2 .  ? -8.329  -2.456 -23.516 1.00 14.75 ? 609 HOH B O   1 
HETATM 2793 O O   . HOH F 2 .  ? -30.829 9.007  -33.977 1.00 19.94 ? 610 HOH B O   1 
HETATM 2794 O O   . HOH F 2 .  ? -5.381  4.123  -24.360 1.00 14.76 ? 611 HOH B O   1 
HETATM 2795 O O   . HOH F 2 .  ? -9.162  -4.948 -24.393 1.00 22.58 ? 612 HOH B O   1 
HETATM 2796 O O   . HOH F 2 .  ? -16.203 10.019 -39.125 1.00 23.19 ? 613 HOH B O   1 
HETATM 2797 O O   . HOH F 2 .  ? -13.451 10.765 -14.579 1.00 26.73 ? 614 HOH B O   1 
HETATM 2798 O O   . HOH F 2 .  ? -3.778  5.866  -25.403 1.00 16.75 ? 615 HOH B O   1 
HETATM 2799 O O   . HOH F 2 .  ? -30.947 15.168 -20.911 1.00 22.37 ? 616 HOH B O   1 
HETATM 2800 O O   . HOH F 2 .  ? -11.425 8.441  -13.836 1.00 36.31 ? 617 HOH B O   1 
HETATM 2801 O O   . HOH F 2 .  ? -27.935 7.160  -13.810 1.00 28.66 ? 618 HOH B O   1 
HETATM 2802 O O   . HOH F 2 .  ? -10.583 -2.272 -18.083 0.60 13.79 ? 619 HOH B O   1 
HETATM 2803 O O   . HOH F 2 .  ? -14.327 13.126 -15.940 1.00 27.57 ? 620 HOH B O   1 
HETATM 2804 O O   . HOH F 2 .  ? -17.648 3.669  -13.737 1.00 31.10 ? 621 HOH B O   1 
HETATM 2805 O O   . HOH F 2 .  ? -10.668 16.795 -26.198 1.00 28.32 ? 622 HOH B O   1 
HETATM 2806 O O   . HOH F 2 .  ? -5.876  3.288  -20.995 1.00 33.62 ? 623 HOH B O   1 
HETATM 2807 O O   . HOH G 2 .  ? -8.864  30.172 -40.716 1.00 11.47 ? 601 HOH C O   1 
HETATM 2808 O O   . HOH G 2 .  ? 1.744   20.488 -29.466 1.00 15.60 ? 602 HOH C O   1 
HETATM 2809 O O   . HOH G 2 .  ? 9.910   26.836 -32.689 1.00 31.96 ? 603 HOH C O   1 
HETATM 2810 O O   . HOH G 2 .  ? -1.903  31.583 -42.908 1.00 26.24 ? 604 HOH C O   1 
HETATM 2811 O O   . HOH G 2 .  ? 1.968   26.492 -19.181 1.00 16.30 ? 605 HOH C O   1 
HETATM 2812 O O   . HOH G 2 .  ? -13.541 36.857 -29.947 1.00 15.99 ? 606 HOH C O   1 
HETATM 2813 O O   . HOH G 2 .  ? -14.923 37.183 -27.548 1.00 25.30 ? 607 HOH C O   1 
HETATM 2814 O O   . HOH G 2 .  ? -10.409 26.257 -20.148 1.00 21.98 ? 608 HOH C O   1 
HETATM 2815 O O   . HOH G 2 .  ? 11.996  31.980 -27.715 1.00 21.14 ? 609 HOH C O   1 
HETATM 2816 O O   . HOH G 2 .  ? 11.177  29.966 -26.090 1.00 17.73 ? 610 HOH C O   1 
HETATM 2817 O O   . HOH G 2 .  ? -15.945 30.132 -30.803 1.00 21.49 ? 611 HOH C O   1 
HETATM 2818 O O   . HOH G 2 .  ? -5.595  20.011 -45.174 1.00 16.08 ? 612 HOH C O   1 
HETATM 2819 O O   . HOH G 2 .  ? -4.864  12.935 -37.531 1.00 16.29 ? 613 HOH C O   1 
HETATM 2820 O O   . HOH G 2 .  ? -1.339  34.009 -41.334 1.00 30.11 ? 614 HOH C O   1 
HETATM 2821 O O   . HOH G 2 .  ? 6.671   37.960 -35.037 1.00 29.45 ? 615 HOH C O   1 
HETATM 2822 O O   . HOH G 2 .  ? -4.969  15.260 -45.012 1.00 17.96 ? 616 HOH C O   1 
HETATM 2823 O O   . HOH H 2 .  ? -25.772 39.319 -2.228  1.00 24.50 ? 601 HOH D O   1 
HETATM 2824 O O   . HOH H 2 .  ? -33.164 37.536 -3.907  1.00 29.64 ? 602 HOH D O   1 
HETATM 2825 O O   . HOH H 2 .  ? -22.299 50.668 -2.499  1.00 8.18  ? 603 HOH D O   1 
HETATM 2826 O O   . HOH H 2 .  ? -5.277  45.883 -11.791 1.00 32.78 ? 604 HOH D O   1 
HETATM 2827 O O   . HOH H 2 .  ? -22.579 31.136 2.591   0.60 2.00  ? 605 HOH D O   1 
HETATM 2828 O O   . HOH H 2 .  ? -23.116 34.216 0.613   0.60 2.14  ? 606 HOH D O   1 
HETATM 2829 O O   . HOH H 2 .  ? -25.120 39.505 6.033   1.00 21.05 ? 607 HOH D O   1 
HETATM 2830 O O   . HOH H 2 .  ? 0.756   41.849 -7.179  1.00 16.12 ? 608 HOH D O   1 
HETATM 2831 O O   . HOH H 2 .  ? -11.885 28.681 3.134   1.00 24.48 ? 609 HOH D O   1 
HETATM 2832 O O   . HOH H 2 .  ? 0.579   38.811 -6.205  1.00 9.14  ? 610 HOH D O   1 
HETATM 2833 O O   . HOH H 2 .  ? -1.132  47.813 -9.075  1.00 12.72 ? 611 HOH D O   1 
HETATM 2834 O O   . HOH H 2 .  ? -2.376  48.246 -6.534  1.00 26.61 ? 612 HOH D O   1 
HETATM 2835 O O   . HOH H 2 .  ? -12.172 52.328 -0.002  1.00 38.41 ? 613 HOH D O   1 
HETATM 2836 O O   . HOH H 2 .  ? -23.517 33.390 2.994   1.00 15.02 ? 614 HOH D O   1 
HETATM 2837 O O   . HOH H 2 .  ? -27.789 43.851 -8.026  1.00 7.75  ? 615 HOH D O   1 
HETATM 2838 O O   . HOH H 2 .  ? -28.630 34.254 -4.734  1.00 39.90 ? 616 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLN A 2  ? 0.5033 0.4141 0.5326 -0.0810 -0.0319 -0.0176 444 GLN A N   
2    C CA  . GLN A 2  ? 0.4765 0.4198 0.5071 -0.0790 -0.0352 -0.0124 444 GLN A CA  
3    C C   . GLN A 2  ? 0.4516 0.4000 0.4678 -0.0665 -0.0336 -0.0173 444 GLN A C   
4    O O   . GLN A 2  ? 0.4288 0.3929 0.4471 -0.0573 -0.0310 -0.0091 444 GLN A O   
5    C CB  . GLN A 2  ? 0.4888 0.4475 0.5244 -0.0942 -0.0449 -0.0159 444 GLN A CB  
6    C CG  . GLN A 2  ? 0.5122 0.4777 0.5682 -0.1081 -0.0466 -0.0071 444 GLN A CG  
7    C CD  . GLN A 2  ? 0.5714 0.5684 0.6442 -0.1039 -0.0436 0.0088  444 GLN A CD  
8    O OE1 . GLN A 2  ? 0.6053 0.6119 0.6961 -0.1139 -0.0424 0.0179  444 GLN A OE1 
9    N NE2 . GLN A 2  ? 0.5050 0.5175 0.5727 -0.0895 -0.0416 0.0117  444 GLN A NE2 
10   N N   . LEU A 3  ? 0.4534 0.3886 0.4550 -0.0668 -0.0343 -0.0311 445 LEU A N   
11   C CA  . LEU A 3  ? 0.4351 0.3736 0.4239 -0.0558 -0.0307 -0.0350 445 LEU A CA  
12   C C   . LEU A 3  ? 0.4253 0.3492 0.4157 -0.0438 -0.0224 -0.0346 445 LEU A C   
13   O O   . LEU A 3  ? 0.4518 0.3545 0.4405 -0.0427 -0.0191 -0.0431 445 LEU A O   
14   C CB  . LEU A 3  ? 0.4489 0.3846 0.4196 -0.0612 -0.0336 -0.0492 445 LEU A CB  
15   C CG  . LEU A 3  ? 0.4385 0.3835 0.3961 -0.0526 -0.0299 -0.0504 445 LEU A CG  
16   C CD1 . LEU A 3  ? 0.3960 0.3634 0.3583 -0.0496 -0.0334 -0.0369 445 LEU A CD1 
17   C CD2 . LEU A 3  ? 0.4170 0.3594 0.3534 -0.0585 -0.0313 -0.0644 445 LEU A CD2 
18   N N   . LEU A 4  ? 0.3898 0.3254 0.3844 -0.0346 -0.0194 -0.0250 446 LEU A N   
19   C CA  . LEU A 4  ? 0.3813 0.3084 0.3796 -0.0239 -0.0139 -0.0222 446 LEU A CA  
20   C C   . LEU A 4  ? 0.3692 0.2998 0.3608 -0.0157 -0.0099 -0.0284 446 LEU A C   
21   O O   . LEU A 4  ? 0.3560 0.3013 0.3428 -0.0150 -0.0104 -0.0267 446 LEU A O   
22   C CB  . LEU A 4  ? 0.3613 0.2986 0.3671 -0.0200 -0.0134 -0.0088 446 LEU A CB  
23   C CG  . LEU A 4  ? 0.3623 0.3029 0.3765 -0.0273 -0.0149 0.0005  446 LEU A CG  
24   C CD1 . LEU A 4  ? 0.3201 0.2730 0.3365 -0.0212 -0.0122 0.0113  446 LEU A CD1 
25   C CD2 . LEU A 4  ? 0.3307 0.2504 0.3504 -0.0330 -0.0147 0.0012  446 LEU A CD2 
26   N N   . THR A 5  ? 0.3753 0.2925 0.3686 -0.0095 -0.0054 -0.0349 447 THR A N   
27   C CA  . THR A 5  ? 0.3757 0.2998 0.3679 -0.0009 -0.0002 -0.0393 447 THR A CA  
28   C C   . THR A 5  ? 0.3626 0.2960 0.3649 0.0072  -0.0003 -0.0288 447 THR A C   
29   O O   . THR A 5  ? 0.3732 0.2981 0.3843 0.0126  -0.0007 -0.0232 447 THR A O   
30   C CB  . THR A 5  ? 0.3985 0.3072 0.3911 0.0042  0.0058  -0.0516 447 THR A CB  
31   O OG1 . THR A 5  ? 0.4212 0.3219 0.4000 -0.0047 0.0055  -0.0638 447 THR A OG1 
32   C CG2 . THR A 5  ? 0.3986 0.3197 0.3946 0.0137  0.0125  -0.0550 447 THR A CG2 
33   N N   . LEU A 6  ? 0.3479 0.2978 0.3478 0.0072  -0.0007 -0.0256 448 LEU A N   
34   C CA  . LEU A 6  ? 0.3382 0.2978 0.3453 0.0129  -0.0020 -0.0178 448 LEU A CA  
35   C C   . LEU A 6  ? 0.3398 0.3116 0.3511 0.0171  0.0014  -0.0213 448 LEU A C   
36   O O   . LEU A 6  ? 0.3409 0.3180 0.3463 0.0135  0.0048  -0.0268 448 LEU A O   
37   C CB  . LEU A 6  ? 0.3226 0.2897 0.3256 0.0088  -0.0056 -0.0108 448 LEU A CB  
38   C CG  . LEU A 6  ? 0.3475 0.3091 0.3492 0.0037  -0.0079 -0.0063 448 LEU A CG  
39   C CD1 . LEU A 6  ? 0.2985 0.2704 0.2979 0.0024  -0.0092 -0.0010 448 LEU A CD1 
40   C CD2 . LEU A 6  ? 0.3166 0.2671 0.3239 0.0056  -0.0082 -0.0007 448 LEU A CD2 
41   N N   . LYS A 7  ? 0.3370 0.3151 0.3591 0.0242  0.0001  -0.0169 449 LYS A N   
42   C CA  . LYS A 7  ? 0.3353 0.3300 0.3662 0.0273  0.0021  -0.0186 449 LYS A CA  
43   C C   . LYS A 7  ? 0.3264 0.3320 0.3546 0.0224  -0.0027 -0.0137 449 LYS A C   
44   O O   . LYS A 7  ? 0.3381 0.3408 0.3621 0.0221  -0.0078 -0.0080 449 LYS A O   
45   C CB  . LYS A 7  ? 0.3460 0.3437 0.3928 0.0382  0.0022  -0.0166 449 LYS A CB  
46   C CG  . LYS A 7  ? 0.3699 0.3518 0.4193 0.0439  0.0083  -0.0236 449 LYS A CG  
47   C CD  . LYS A 7  ? 0.4221 0.4031 0.4893 0.0572  0.0084  -0.0204 449 LYS A CD  
48   C CE  . LYS A 7  ? 0.4347 0.3950 0.5037 0.0631  0.0157  -0.0300 449 LYS A CE  
49   N NZ  . LYS A 7  ? 0.4356 0.4023 0.5263 0.0786  0.0200  -0.0308 449 LYS A NZ  
50   N N   . ILE A 8  ? 0.3146 0.3312 0.3437 0.0178  -0.0004 -0.0165 450 ILE A N   
51   C CA  . ILE A 8  ? 0.3007 0.3229 0.3266 0.0119  -0.0046 -0.0140 450 ILE A CA  
52   C C   . ILE A 8  ? 0.2937 0.3336 0.3331 0.0127  -0.0073 -0.0134 450 ILE A C   
53   O O   . ILE A 8  ? 0.2877 0.3398 0.3398 0.0150  -0.0030 -0.0155 450 ILE A O   
54   C CB  . ILE A 8  ? 0.3016 0.3205 0.3187 0.0040  -0.0013 -0.0155 450 ILE A CB  
55   C CG1 . ILE A 8  ? 0.2931 0.2989 0.2984 0.0032  -0.0006 -0.0153 450 ILE A CG1 
56   C CG2 . ILE A 8  ? 0.2917 0.3116 0.3069 -0.0018 -0.0050 -0.0141 450 ILE A CG2 
57   C CD1 . ILE A 8  ? 0.2866 0.2848 0.2867 0.0036  -0.0050 -0.0117 450 ILE A CD1 
58   N N   . LYS A 9  ? 0.2927 0.3356 0.3294 0.0103  -0.0143 -0.0111 451 LYS A N   
59   C CA  . LYS A 9  ? 0.2941 0.3556 0.3426 0.0091  -0.0199 -0.0106 451 LYS A CA  
60   C C   . LYS A 9  ? 0.2958 0.3550 0.3352 -0.0007 -0.0242 -0.0135 451 LYS A C   
61   O O   . LYS A 9  ? 0.2999 0.3444 0.3239 -0.0015 -0.0250 -0.0140 451 LYS A O   
62   C CB  . LYS A 9  ? 0.2910 0.3579 0.3432 0.0178  -0.0266 -0.0049 451 LYS A CB  
63   C CG  . LYS A 9  ? 0.3325 0.4224 0.3974 0.0176  -0.0352 -0.0028 451 LYS A CG  
64   C CD  . LYS A 9  ? 0.3803 0.4739 0.4480 0.0283  -0.0417 0.0060  451 LYS A CD  
65   C CE  . LYS A 9  ? 0.4250 0.5460 0.5089 0.0301  -0.0518 0.0099  451 LYS A CE  
66   N NZ  . LYS A 9  ? 0.4800 0.6039 0.5707 0.0434  -0.0571 0.0212  451 LYS A NZ  
67   N N   . TYR A 10 ? 0.2956 0.3688 0.3458 -0.0084 -0.0259 -0.0159 452 TYR A N   
68   C CA  . TYR A 10 ? 0.2994 0.3697 0.3432 -0.0187 -0.0313 -0.0203 452 TYR A CA  
69   C C   . TYR A 10 ? 0.3047 0.3969 0.3582 -0.0204 -0.0416 -0.0205 452 TYR A C   
70   O O   . TYR A 10 ? 0.3078 0.4199 0.3798 -0.0264 -0.0431 -0.0210 452 TYR A O   
71   C CB  . TYR A 10 ? 0.3000 0.3677 0.3489 -0.0298 -0.0263 -0.0224 452 TYR A CB  
72   C CG  . TYR A 10 ? 0.2931 0.3467 0.3359 -0.0287 -0.0168 -0.0199 452 TYR A CG  
73   C CD1 . TYR A 10 ? 0.2771 0.3389 0.3294 -0.0345 -0.0097 -0.0178 452 TYR A CD1 
74   C CD2 . TYR A 10 ? 0.3182 0.3532 0.3458 -0.0226 -0.0150 -0.0188 452 TYR A CD2 
75   C CE1 . TYR A 10 ? 0.3148 0.3651 0.3578 -0.0342 -0.0020 -0.0148 452 TYR A CE1 
76   C CE2 . TYR A 10 ? 0.3305 0.3555 0.3522 -0.0222 -0.0085 -0.0159 452 TYR A CE2 
77   C CZ  . TYR A 10 ? 0.3327 0.3649 0.3604 -0.0279 -0.0024 -0.0140 452 TYR A CZ  
78   O OH  . TYR A 10 ? 0.3093 0.3330 0.3274 -0.0281 0.0031  -0.0105 452 TYR A OH  
79   N N   . PRO A 11 ? 0.3077 0.3990 0.3491 -0.0156 -0.0489 -0.0193 453 PRO A N   
80   C CA  . PRO A 11 ? 0.3131 0.4283 0.3624 -0.0149 -0.0605 -0.0168 453 PRO A CA  
81   C C   . PRO A 11 ? 0.3223 0.4519 0.3773 -0.0290 -0.0691 -0.0237 453 PRO A C   
82   O O   . PRO A 11 ? 0.3190 0.4763 0.3903 -0.0298 -0.0784 -0.0209 453 PRO A O   
83   C CB  . PRO A 11 ? 0.3179 0.4245 0.3456 -0.0086 -0.0651 -0.0136 453 PRO A CB  
84   C CG  . PRO A 11 ? 0.3210 0.4009 0.3308 -0.0087 -0.0560 -0.0172 453 PRO A CG  
85   C CD  . PRO A 11 ? 0.3114 0.3823 0.3316 -0.0104 -0.0463 -0.0187 453 PRO A CD  
86   N N   A HIS A 12 ? 0.3324 0.4433 0.3758 -0.0400 -0.0664 -0.0325 454 HIS A N   
87   N N   B HIS A 12 ? 0.3310 0.4418 0.3742 -0.0400 -0.0664 -0.0325 454 HIS A N   
88   C CA  A HIS A 12 ? 0.3468 0.4660 0.3955 -0.0561 -0.0740 -0.0405 454 HIS A CA  
89   C CA  B HIS A 12 ? 0.3443 0.4625 0.3925 -0.0561 -0.0737 -0.0406 454 HIS A CA  
90   C C   A HIS A 12 ? 0.3454 0.4785 0.4205 -0.0645 -0.0692 -0.0386 454 HIS A C   
91   C C   B HIS A 12 ? 0.3430 0.4788 0.4193 -0.0638 -0.0699 -0.0380 454 HIS A C   
92   O O   A HIS A 12 ? 0.3581 0.5020 0.4437 -0.0797 -0.0753 -0.0437 454 HIS A O   
93   O O   B HIS A 12 ? 0.3532 0.5057 0.4426 -0.0775 -0.0773 -0.0421 454 HIS A O   
94   C CB  A HIS A 12 ? 0.3607 0.4504 0.3861 -0.0642 -0.0730 -0.0516 454 HIS A CB  
95   C CB  B HIS A 12 ? 0.3534 0.4397 0.3809 -0.0637 -0.0700 -0.0505 454 HIS A CB  
96   C CG  A HIS A 12 ? 0.3493 0.4170 0.3783 -0.0709 -0.0630 -0.0533 454 HIS A CG  
97   C CG  B HIS A 12 ? 0.3279 0.3906 0.3519 -0.0580 -0.0567 -0.0470 454 HIS A CG  
98   N ND1 A HIS A 12 ? 0.3312 0.3780 0.3528 -0.0619 -0.0519 -0.0489 454 HIS A ND1 
99   N ND1 B HIS A 12 ? 0.2335 0.2928 0.2537 -0.0440 -0.0505 -0.0395 454 HIS A ND1 
100  C CD2 A HIS A 12 ? 0.3440 0.4073 0.3830 -0.0865 -0.0630 -0.0577 454 HIS A CD2 
101  C CD2 B HIS A 12 ? 0.2917 0.3338 0.3158 -0.0651 -0.0497 -0.0490 454 HIS A CD2 
102  C CE1 A HIS A 12 ? 0.3035 0.3344 0.3293 -0.0703 -0.0459 -0.0494 454 HIS A CE1 
103  C CE1 B HIS A 12 ? 0.1939 0.2342 0.2115 -0.0430 -0.0410 -0.0378 454 HIS A CE1 
104  N NE2 A HIS A 12 ? 0.3388 0.3777 0.3750 -0.0855 -0.0518 -0.0544 454 HIS A NE2 
105  N NE2 B HIS A 12 ? 0.2848 0.3144 0.3045 -0.0547 -0.0403 -0.0424 454 HIS A NE2 
106  N N   . GLN A 13 ? 0.3352 0.4686 0.4203 -0.0558 -0.0580 -0.0316 455 GLN A N   
107  C CA  . GLN A 13 ? 0.3419 0.4914 0.4507 -0.0624 -0.0507 -0.0287 455 GLN A CA  
108  C C   . GLN A 13 ? 0.3425 0.5243 0.4767 -0.0520 -0.0492 -0.0223 455 GLN A C   
109  O O   . GLN A 13 ? 0.3424 0.5524 0.5025 -0.0593 -0.0488 -0.0209 455 GLN A O   
110  C CB  . GLN A 13 ? 0.3388 0.4635 0.4380 -0.0635 -0.0373 -0.0272 455 GLN A CB  
111  C CG  . GLN A 13 ? 0.3414 0.4374 0.4247 -0.0757 -0.0380 -0.0325 455 GLN A CG  
112  C CD  . GLN A 13 ? 0.3212 0.3964 0.3981 -0.0776 -0.0264 -0.0280 455 GLN A CD  
113  O OE1 . GLN A 13 ? 0.3119 0.3675 0.3840 -0.0891 -0.0254 -0.0293 455 GLN A OE1 
114  N NE2 . GLN A 13 ? 0.2872 0.3654 0.3631 -0.0667 -0.0181 -0.0224 455 GLN A NE2 
115  N N   . LEU A 14 ? 0.3463 0.5240 0.4749 -0.0351 -0.0479 -0.0181 456 LEU A N   
116  C CA  . LEU A 14 ? 0.3476 0.5487 0.4993 -0.0220 -0.0445 -0.0126 456 LEU A CA  
117  C C   . LEU A 14 ? 0.3538 0.5462 0.4966 -0.0054 -0.0486 -0.0077 456 LEU A C   
118  O O   . LEU A 14 ? 0.3542 0.5189 0.4720 -0.0032 -0.0477 -0.0083 456 LEU A O   
119  C CB  . LEU A 14 ? 0.3402 0.5377 0.4978 -0.0203 -0.0280 -0.0131 456 LEU A CB  
120  C CG  . LEU A 14 ? 0.3443 0.5680 0.5291 -0.0094 -0.0194 -0.0107 456 LEU A CG  
121  C CD1 . LEU A 14 ? 0.3384 0.6037 0.5566 -0.0160 -0.0236 -0.0088 456 LEU A CD1 
122  C CD2 . LEU A 14 ? 0.3304 0.5420 0.5077 -0.0097 -0.0027 -0.0134 456 LEU A CD2 
123  N N   . ASP A 15 ? 0.3647 0.5816 0.5300 0.0062  -0.0527 -0.0016 457 ASP A N   
124  C CA  . ASP A 15 ? 0.3750 0.5840 0.5359 0.0226  -0.0567 0.0058  457 ASP A CA  
125  C C   . ASP A 15 ? 0.3692 0.5565 0.5274 0.0347  -0.0434 0.0056  457 ASP A C   
126  O O   . ASP A 15 ? 0.3809 0.5510 0.5295 0.0450  -0.0451 0.0110  457 ASP A O   
127  C CB  . ASP A 15 ? 0.3798 0.6230 0.5686 0.0320  -0.0670 0.0140  457 ASP A CB  
128  C CG  . ASP A 15 ? 0.4258 0.6792 0.6035 0.0274  -0.0852 0.0186  457 ASP A CG  
129  O OD1 . ASP A 15 ? 0.4745 0.7041 0.6242 0.0292  -0.0883 0.0212  457 ASP A OD1 
130  O OD2 . ASP A 15 ? 0.5076 0.7949 0.7046 0.0215  -0.0962 0.0198  457 ASP A OD2 
131  N N   . GLN A 16 ? 0.3604 0.5486 0.5264 0.0323  -0.0303 -0.0004 458 GLN A N   
132  C CA  . GLN A 16 ? 0.3528 0.5229 0.5163 0.0429  -0.0178 -0.0031 458 GLN A CA  
133  C C   . GLN A 16 ? 0.3467 0.4863 0.4814 0.0347  -0.0120 -0.0081 458 GLN A C   
134  O O   . GLN A 16 ? 0.3377 0.4723 0.4589 0.0215  -0.0147 -0.0098 458 GLN A O   
135  C CB  . GLN A 16 ? 0.3584 0.5508 0.5466 0.0473  -0.0058 -0.0071 458 GLN A CB  
136  C CG  . GLN A 16 ? 0.3507 0.5752 0.5732 0.0601  -0.0100 -0.0016 458 GLN A CG  
137  C CD  . GLN A 16 ? 0.4136 0.6728 0.6539 0.0490  -0.0206 0.0019  458 GLN A CD  
138  O OE1 . GLN A 16 ? 0.4209 0.6760 0.6462 0.0314  -0.0246 -0.0007 458 GLN A OE1 
139  N NE2 . GLN A 16 ? 0.4103 0.7038 0.6840 0.0593  -0.0256 0.0077  458 GLN A NE2 
140  N N   . LYS A 17 ? 0.3450 0.4635 0.4715 0.0428  -0.0047 -0.0104 459 LYS A N   
141  C CA  . LYS A 17 ? 0.3378 0.4316 0.4405 0.0360  0.0007  -0.0149 459 LYS A CA  
142  C C   . LYS A 17 ? 0.3332 0.4346 0.4341 0.0265  0.0099  -0.0202 459 LYS A C   
143  O O   . LYS A 17 ? 0.3317 0.4521 0.4491 0.0293  0.0179  -0.0230 459 LYS A O   
144  C CB  . LYS A 17 ? 0.3446 0.4167 0.4414 0.0453  0.0054  -0.0172 459 LYS A CB  
145  C CG  . LYS A 17 ? 0.3556 0.4145 0.4490 0.0513  -0.0034 -0.0094 459 LYS A CG  
146  C CD  . LYS A 17 ? 0.4047 0.4525 0.5089 0.0650  -0.0002 -0.0089 459 LYS A CD  
147  C CE  . LYS A 17 ? 0.4310 0.4687 0.5336 0.0702  -0.0096 0.0028  459 LYS A CE  
148  N NZ  . LYS A 17 ? 0.4491 0.4690 0.5617 0.0831  -0.0067 0.0048  459 LYS A NZ  
149  N N   . VAL A 18 ? 0.3281 0.4160 0.4099 0.0158  0.0090  -0.0203 460 VAL A N   
150  C CA  . VAL A 18 ? 0.3332 0.4259 0.4107 0.0051  0.0157  -0.0217 460 VAL A CA  
151  C C   . VAL A 18 ? 0.3412 0.4206 0.4023 0.0053  0.0246  -0.0256 460 VAL A C   
152  O O   . VAL A 18 ? 0.3469 0.4363 0.4080 0.0013  0.0342  -0.0275 460 VAL A O   
153  C CB  . VAL A 18 ? 0.3304 0.4160 0.3989 -0.0065 0.0086  -0.0184 460 VAL A CB  
154  C CG1 . VAL A 18 ? 0.3264 0.4055 0.3840 -0.0168 0.0147  -0.0172 460 VAL A CG1 
155  C CG2 . VAL A 18 ? 0.3361 0.4412 0.4219 -0.0107 0.0018  -0.0171 460 VAL A CG2 
156  N N   . LEU A 19 ? 0.3425 0.4016 0.3896 0.0089  0.0214  -0.0267 461 LEU A N   
157  C CA  . LEU A 19 ? 0.3592 0.4060 0.3890 0.0075  0.0268  -0.0311 461 LEU A CA  
158  C C   . LEU A 19 ? 0.3614 0.3894 0.3842 0.0127  0.0223  -0.0329 461 LEU A C   
159  O O   . LEU A 19 ? 0.3511 0.3752 0.3807 0.0170  0.0156  -0.0289 461 LEU A O   
160  C CB  . LEU A 19 ? 0.3559 0.3981 0.3700 -0.0033 0.0261  -0.0267 461 LEU A CB  
161  C CG  . LEU A 19 ? 0.3655 0.3964 0.3743 -0.0069 0.0169  -0.0206 461 LEU A CG  
162  C CD1 . LEU A 19 ? 0.4287 0.4449 0.4222 -0.0071 0.0138  -0.0203 461 LEU A CD1 
163  C CD2 . LEU A 19 ? 0.3779 0.4113 0.3858 -0.0159 0.0169  -0.0152 461 LEU A CD2 
164  N N   . GLU A 20 ? 0.3759 0.3932 0.3843 0.0111  0.0258  -0.0387 462 GLU A N   
165  C CA  . GLU A 20 ? 0.3913 0.3904 0.3921 0.0119  0.0210  -0.0404 462 GLU A CA  
166  C C   . GLU A 20 ? 0.3993 0.3928 0.3819 0.0030  0.0178  -0.0395 462 GLU A C   
167  O O   . GLU A 20 ? 0.4102 0.4085 0.3806 -0.0017 0.0223  -0.0425 462 GLU A O   
168  C CB  . GLU A 20 ? 0.4065 0.3959 0.4095 0.0188  0.0265  -0.0503 462 GLU A CB  
169  C CG  . GLU A 20 ? 0.4354 0.4264 0.4588 0.0300  0.0269  -0.0483 462 GLU A CG  
170  C CD  . GLU A 20 ? 0.5037 0.4800 0.5310 0.0386  0.0327  -0.0580 462 GLU A CD  
171  O OE1 . GLU A 20 ? 0.5288 0.4859 0.5426 0.0341  0.0323  -0.0649 462 GLU A OE1 
172  O OE2 . GLU A 20 ? 0.5343 0.5184 0.5797 0.0499  0.0374  -0.0590 462 GLU A OE2 
173  N N   . LYS A 21 ? 0.3982 0.3836 0.3795 0.0010  0.0102  -0.0343 463 LYS A N   
174  C CA  . LYS A 21 ? 0.3989 0.3818 0.3679 -0.0060 0.0054  -0.0317 463 LYS A CA  
175  C C   . LYS A 21 ? 0.4007 0.3726 0.3695 -0.0076 0.0009  -0.0339 463 LYS A C   
176  O O   . LYS A 21 ? 0.3978 0.3633 0.3768 -0.0036 0.0000  -0.0320 463 LYS A O   
177  C CB  . LYS A 21 ? 0.3878 0.3753 0.3597 -0.0072 0.0011  -0.0219 463 LYS A CB  
178  C CG  . LYS A 21 ? 0.4199 0.4139 0.3856 -0.0110 0.0031  -0.0180 463 LYS A CG  
179  C CD  . LYS A 21 ? 0.5372 0.5309 0.4895 -0.0161 -0.0007 -0.0148 463 LYS A CD  
180  C CE  . LYS A 21 ? 0.5940 0.5922 0.5376 -0.0203 0.0019  -0.0090 463 LYS A CE  
181  N NZ  . LYS A 21 ? 0.6259 0.6255 0.5550 -0.0246 -0.0034 -0.0041 463 LYS A NZ  
182  N N   . GLN A 22 ? 0.4083 0.3786 0.3652 -0.0145 -0.0023 -0.0372 464 GLN A N   
183  C CA  . GLN A 22 ? 0.4106 0.3733 0.3690 -0.0193 -0.0080 -0.0382 464 GLN A CA  
184  C C   . GLN A 22 ? 0.3972 0.3694 0.3589 -0.0228 -0.0151 -0.0279 464 GLN A C   
185  O O   . GLN A 22 ? 0.4067 0.3880 0.3602 -0.0262 -0.0186 -0.0248 464 GLN A O   
186  C CB  . GLN A 22 ? 0.4320 0.3876 0.3767 -0.0259 -0.0085 -0.0503 464 GLN A CB  
187  C CG  . GLN A 22 ? 0.4576 0.3982 0.4038 -0.0211 -0.0013 -0.0619 464 GLN A CG  
188  C CD  . GLN A 22 ? 0.5244 0.4506 0.4600 -0.0289 -0.0034 -0.0752 464 GLN A CD  
189  O OE1 . GLN A 22 ? 0.5256 0.4580 0.4459 -0.0382 -0.0087 -0.0788 464 GLN A OE1 
190  N NE2 . GLN A 22 ? 0.5486 0.4545 0.4920 -0.0253 0.0002  -0.0824 464 GLN A NE2 
191  N N   . LEU A 23 ? 0.3786 0.3497 0.3529 -0.0212 -0.0165 -0.0218 465 LEU A N   
192  C CA  . LEU A 23 ? 0.3647 0.3469 0.3455 -0.0219 -0.0207 -0.0124 465 LEU A CA  
193  C C   . LEU A 23 ? 0.3635 0.3462 0.3529 -0.0281 -0.0244 -0.0105 465 LEU A C   
194  O O   . LEU A 23 ? 0.3734 0.3452 0.3676 -0.0289 -0.0222 -0.0120 465 LEU A O   
195  C CB  . LEU A 23 ? 0.3546 0.3392 0.3418 -0.0143 -0.0172 -0.0062 465 LEU A CB  
196  C CG  . LEU A 23 ? 0.3467 0.3312 0.3290 -0.0100 -0.0138 -0.0074 465 LEU A CG  
197  C CD1 . LEU A 23 ? 0.3051 0.2905 0.2930 -0.0045 -0.0118 -0.0037 465 LEU A CD1 
198  C CD2 . LEU A 23 ? 0.3332 0.3231 0.3086 -0.0119 -0.0159 -0.0046 465 LEU A CD2 
199  N N   . PRO A 24 ? 0.3546 0.3508 0.3477 -0.0329 -0.0305 -0.0061 466 PRO A N   
200  C CA  . PRO A 24 ? 0.3517 0.3540 0.3577 -0.0399 -0.0339 -0.0025 466 PRO A CA  
201  C C   . PRO A 24 ? 0.3378 0.3404 0.3554 -0.0354 -0.0279 0.0048  466 PRO A C   
202  O O   . PRO A 24 ? 0.3256 0.3315 0.3431 -0.0263 -0.0236 0.0088  466 PRO A O   
203  C CB  . PRO A 24 ? 0.3496 0.3726 0.3609 -0.0418 -0.0409 0.0036  466 PRO A CB  
204  C CG  . PRO A 24 ? 0.3548 0.3761 0.3488 -0.0411 -0.0440 -0.0005 466 PRO A CG  
205  C CD  . PRO A 24 ? 0.3493 0.3558 0.3342 -0.0338 -0.0356 -0.0046 466 PRO A CD  
206  N N   . GLY A 25 ? 0.3480 0.3460 0.3739 -0.0426 -0.0276 0.0064  467 GLY A N   
207  C CA  . GLY A 25 ? 0.3357 0.3353 0.3704 -0.0400 -0.0216 0.0152  467 GLY A CA  
208  C C   . GLY A 25 ? 0.3174 0.3402 0.3634 -0.0369 -0.0196 0.0236  467 GLY A C   
209  O O   . GLY A 25 ? 0.3076 0.3338 0.3547 -0.0307 -0.0128 0.0293  467 GLY A O   
210  N N   . SER A 26 ? 0.3132 0.3526 0.3668 -0.0403 -0.0255 0.0241  468 SER A N   
211  C CA  . SER A 26 ? 0.3000 0.3635 0.3682 -0.0351 -0.0236 0.0317  468 SER A CA  
212  C C   . SER A 26 ? 0.2965 0.3615 0.3585 -0.0224 -0.0227 0.0311  468 SER A C   
213  O O   . SER A 26 ? 0.2869 0.3695 0.3613 -0.0157 -0.0216 0.0364  468 SER A O   
214  C CB  . SER A 26 ? 0.3000 0.3842 0.3846 -0.0450 -0.0316 0.0348  468 SER A CB  
215  O OG  . SER A 26 ? 0.2858 0.3661 0.3601 -0.0492 -0.0416 0.0286  468 SER A OG  
216  N N   . MET A 27 ? 0.2953 0.3419 0.3401 -0.0192 -0.0228 0.0250  469 MET A N   
217  C CA  . MET A 27 ? 0.2948 0.3381 0.3329 -0.0093 -0.0213 0.0245  469 MET A CA  
218  C C   . MET A 27 ? 0.2959 0.3390 0.3355 -0.0007 -0.0127 0.0257  469 MET A C   
219  O O   . MET A 27 ? 0.3005 0.3364 0.3347 -0.0015 -0.0083 0.0244  469 MET A O   
220  C CB  . MET A 27 ? 0.3004 0.3268 0.3219 -0.0100 -0.0225 0.0180  469 MET A CB  
221  C CG  . MET A 27 ? 0.2948 0.3177 0.3104 -0.0033 -0.0223 0.0187  469 MET A CG  
222  S SD  . MET A 27 ? 0.3944 0.4047 0.3934 -0.0072 -0.0234 0.0126  469 MET A SD  
223  C CE  . MET A 27 ? 0.3083 0.3185 0.3035 -0.0030 -0.0255 0.0187  469 MET A CE  
224  N N   . THR A 28 ? 0.3034 0.3542 0.3498 0.0079  -0.0106 0.0283  470 THR A N   
225  C CA  . THR A 28 ? 0.3108 0.3606 0.3561 0.0164  -0.0018 0.0268  470 THR A CA  
226  C C   . THR A 28 ? 0.3185 0.3491 0.3474 0.0192  -0.0008 0.0202  470 THR A C   
227  O O   . THR A 28 ? 0.3246 0.3456 0.3470 0.0167  -0.0059 0.0186  470 THR A O   
228  C CB  . THR A 28 ? 0.3145 0.3774 0.3744 0.0263  0.0015  0.0303  470 THR A CB  
229  O OG1 . THR A 28 ? 0.3192 0.3740 0.3781 0.0309  -0.0039 0.0311  470 THR A OG1 
230  C CG2 . THR A 28 ? 0.2972 0.3850 0.3777 0.0226  0.0001  0.0377  470 THR A CG2 
231  N N   . ILE A 29 ? 0.3281 0.3552 0.3499 0.0232  0.0057  0.0165  471 ILE A N   
232  C CA  . ILE A 29 ? 0.3377 0.3496 0.3453 0.0241  0.0055  0.0096  471 ILE A CA  
233  C C   . ILE A 29 ? 0.3425 0.3440 0.3502 0.0289  0.0047  0.0068  471 ILE A C   
234  O O   . ILE A 29 ? 0.3468 0.3366 0.3474 0.0255  0.0013  0.0039  471 ILE A O   
235  C CB  . ILE A 29 ? 0.3440 0.3566 0.3413 0.0264  0.0113  0.0059  471 ILE A CB  
236  C CG1 . ILE A 29 ? 0.3553 0.3751 0.3516 0.0211  0.0116  0.0118  471 ILE A CG1 
237  C CG2 . ILE A 29 ? 0.3543 0.3540 0.3384 0.0260  0.0093  -0.0020 471 ILE A CG2 
238  C CD1 . ILE A 29 ? 0.3200 0.3325 0.3152 0.0149  0.0049  0.0132  471 ILE A CD1 
239  N N   . GLN A 30 ? 0.3489 0.3553 0.3668 0.0368  0.0081  0.0089  472 GLN A N   
240  C CA  . GLN A 30 ? 0.3618 0.3570 0.3834 0.0426  0.0067  0.0095  472 GLN A CA  
241  C C   . GLN A 30 ? 0.3559 0.3475 0.3766 0.0364  -0.0016 0.0156  472 GLN A C   
242  O O   . GLN A 30 ? 0.3644 0.3404 0.3795 0.0357  -0.0032 0.0152  472 GLN A O   
243  C CB  . GLN A 30 ? 0.3700 0.3760 0.4082 0.0536  0.0108  0.0136  472 GLN A CB  
244  C CG  . GLN A 30 ? 0.4007 0.3945 0.4458 0.0616  0.0087  0.0174  472 GLN A CG  
245  C CD  . GLN A 30 ? 0.4539 0.4604 0.5190 0.0752  0.0133  0.0216  472 GLN A CD  
246  O OE1 . GLN A 30 ? 0.4584 0.4599 0.5248 0.0849  0.0231  0.0138  472 GLN A OE1 
247  N NE2 . GLN A 30 ? 0.4724 0.4967 0.5534 0.0764  0.0063  0.0335  472 GLN A NE2 
248  N N   . LYS A 31 ? 0.3390 0.3447 0.3642 0.0309  -0.0064 0.0209  473 LYS A N   
249  C CA  . LYS A 31 ? 0.3382 0.3430 0.3593 0.0249  -0.0137 0.0256  473 LYS A CA  
250  C C   . LYS A 31 ? 0.3327 0.3278 0.3401 0.0170  -0.0139 0.0202  473 LYS A C   
251  O O   . LYS A 31 ? 0.3419 0.3307 0.3423 0.0135  -0.0165 0.0223  473 LYS A O   
252  C CB  . LYS A 31 ? 0.3297 0.3527 0.3588 0.0207  -0.0195 0.0310  473 LYS A CB  
253  C CG  . LYS A 31 ? 0.3391 0.3770 0.3856 0.0285  -0.0215 0.0390  473 LYS A CG  
254  C CD  . LYS A 31 ? 0.3381 0.3692 0.3846 0.0343  -0.0259 0.0466  473 LYS A CD  
255  C CE  . LYS A 31 ? 0.3760 0.4197 0.4435 0.0467  -0.0255 0.0538  473 LYS A CE  
256  N NZ  . LYS A 31 ? 0.3992 0.4256 0.4669 0.0565  -0.0252 0.0590  473 LYS A NZ  
257  N N   . VAL A 32 ? 0.3238 0.3194 0.3283 0.0146  -0.0109 0.0145  474 VAL A N   
258  C CA  . VAL A 32 ? 0.3163 0.3049 0.3120 0.0097  -0.0105 0.0093  474 VAL A CA  
259  C C   . VAL A 32 ? 0.3197 0.2971 0.3113 0.0108  -0.0087 0.0064  474 VAL A C   
260  O O   . VAL A 32 ? 0.3212 0.2944 0.3085 0.0060  -0.0093 0.0055  474 VAL A O   
261  C CB  . VAL A 32 ? 0.3144 0.3059 0.3095 0.0088  -0.0086 0.0061  474 VAL A CB  
262  C CG1 . VAL A 32 ? 0.3003 0.2876 0.2904 0.0057  -0.0089 0.0019  474 VAL A CG1 
263  C CG2 . VAL A 32 ? 0.2940 0.2932 0.2945 0.0059  -0.0101 0.0092  474 VAL A CG2 
264  N N   . LYS A 33 ? 0.3294 0.3021 0.3225 0.0163  -0.0057 0.0040  475 LYS A N   
265  C CA  . LYS A 33 ? 0.3471 0.3055 0.3365 0.0161  -0.0045 -0.0001 475 LYS A CA  
266  C C   . LYS A 33 ? 0.3580 0.3074 0.3488 0.0149  -0.0064 0.0065  475 LYS A C   
267  O O   . LYS A 33 ? 0.3634 0.3035 0.3506 0.0089  -0.0067 0.0057  475 LYS A O   
268  C CB  . LYS A 33 ? 0.3637 0.3165 0.3528 0.0231  -0.0003 -0.0058 475 LYS A CB  
269  C CG  . LYS A 33 ? 0.3672 0.3252 0.3485 0.0218  0.0013  -0.0130 475 LYS A CG  
270  C CD  . LYS A 33 ? 0.4039 0.3565 0.3809 0.0286  0.0069  -0.0204 475 LYS A CD  
271  C CE  . LYS A 33 ? 0.3978 0.3597 0.3638 0.0273  0.0082  -0.0252 475 LYS A CE  
272  N NZ  . LYS A 33 ? 0.4417 0.3971 0.3980 0.0325  0.0141  -0.0354 475 LYS A NZ  
273  N N   . GLY A 34 ? 0.3613 0.3155 0.3581 0.0200  -0.0082 0.0144  476 GLY A N   
274  C CA  . GLY A 34 ? 0.3777 0.3248 0.3747 0.0199  -0.0112 0.0240  476 GLY A CA  
275  C C   . GLY A 34 ? 0.3845 0.3341 0.3725 0.0101  -0.0133 0.0269  476 GLY A C   
276  O O   . GLY A 34 ? 0.3967 0.3351 0.3806 0.0062  -0.0131 0.0321  476 GLY A O   
277  N N   . LEU A 35 ? 0.3755 0.3387 0.3603 0.0060  -0.0142 0.0236  477 LEU A N   
278  C CA  . LEU A 35 ? 0.3798 0.3474 0.3557 -0.0020 -0.0142 0.0237  477 LEU A CA  
279  C C   . LEU A 35 ? 0.3840 0.3456 0.3588 -0.0070 -0.0098 0.0186  477 LEU A C   
280  O O   . LEU A 35 ? 0.3960 0.3554 0.3658 -0.0130 -0.0081 0.0227  477 LEU A O   
281  C CB  . LEU A 35 ? 0.3742 0.3537 0.3486 -0.0038 -0.0153 0.0185  477 LEU A CB  
282  C CG  . LEU A 35 ? 0.3859 0.3706 0.3505 -0.0102 -0.0141 0.0154  477 LEU A CG  
283  C CD1 . LEU A 35 ? 0.3842 0.3760 0.3474 -0.0114 -0.0173 0.0116  477 LEU A CD1 
284  C CD2 . LEU A 35 ? 0.3880 0.3719 0.3541 -0.0121 -0.0085 0.0086  477 LEU A CD2 
285  N N   . LEU A 36 ? 0.3817 0.3428 0.3613 -0.0053 -0.0084 0.0108  478 LEU A N   
286  C CA  . LEU A 36 ? 0.3887 0.3482 0.3699 -0.0105 -0.0063 0.0055  478 LEU A CA  
287  C C   . LEU A 36 ? 0.4112 0.3556 0.3930 -0.0141 -0.0056 0.0077  478 LEU A C   
288  O O   . LEU A 36 ? 0.4222 0.3663 0.4059 -0.0221 -0.0041 0.0065  478 LEU A O   
289  C CB  . LEU A 36 ? 0.3752 0.3392 0.3593 -0.0075 -0.0070 -0.0021 478 LEU A CB  
290  C CG  . LEU A 36 ? 0.3544 0.3305 0.3396 -0.0058 -0.0071 -0.0038 478 LEU A CG  
291  C CD1 . LEU A 36 ? 0.3116 0.2905 0.2977 -0.0016 -0.0084 -0.0072 478 LEU A CD1 
292  C CD2 . LEU A 36 ? 0.3261 0.3105 0.3142 -0.0104 -0.0051 -0.0055 478 LEU A CD2 
293  N N   . SER A 37 ? 0.4238 0.3556 0.4061 -0.0081 -0.0065 0.0108  479 SER A N   
294  C CA  . SER A 37 ? 0.4444 0.3559 0.4278 -0.0100 -0.0058 0.0131  479 SER A CA  
295  C C   . SER A 37 ? 0.4593 0.3672 0.4398 -0.0173 -0.0052 0.0244  479 SER A C   
296  O O   . SER A 37 ? 0.4714 0.3694 0.4532 -0.0265 -0.0034 0.0250  479 SER A O   
297  C CB  . SER A 37 ? 0.4509 0.3506 0.4375 0.0013  -0.0060 0.0147  479 SER A CB  
298  O OG  . SER A 37 ? 0.4788 0.3539 0.4670 0.0005  -0.0049 0.0164  479 SER A OG  
299  N N   . ARG A 38 ? 0.4552 0.3723 0.4311 -0.0145 -0.0070 0.0336  480 ARG A N   
300  C CA  A ARG A 38 ? 0.4688 0.3852 0.4374 -0.0211 -0.0063 0.0459  480 ARG A CA  
301  C CA  B ARG A 38 ? 0.4694 0.3859 0.4379 -0.0211 -0.0064 0.0459  480 ARG A CA  
302  C C   . ARG A 38 ? 0.4656 0.3945 0.4315 -0.0319 -0.0015 0.0423  480 ARG A C   
303  O O   . ARG A 38 ? 0.4797 0.4042 0.4429 -0.0409 0.0019  0.0501  480 ARG A O   
304  C CB  A ARG A 38 ? 0.4672 0.3941 0.4288 -0.0161 -0.0108 0.0549  480 ARG A CB  
305  C CB  B ARG A 38 ? 0.4675 0.3952 0.4288 -0.0164 -0.0107 0.0546  480 ARG A CB  
306  C CG  A ARG A 38 ? 0.4703 0.3880 0.4387 -0.0050 -0.0157 0.0622  480 ARG A CG  
307  C CG  B ARG A 38 ? 0.4752 0.3945 0.4424 -0.0056 -0.0159 0.0628  480 ARG A CG  
308  C CD  A ARG A 38 ? 0.4305 0.3619 0.3933 -0.0018 -0.0224 0.0732  480 ARG A CD  
309  C CD  B ARG A 38 ? 0.4857 0.3810 0.4551 -0.0052 -0.0155 0.0739  480 ARG A CD  
310  N NE  A ARG A 38 ? 0.4283 0.3791 0.3932 0.0006  -0.0251 0.0649  480 ARG A NE  
311  N NE  B ARG A 38 ? 0.4675 0.3593 0.4411 0.0056  -0.0214 0.0872  480 ARG A NE  
312  C CZ  A ARG A 38 ? 0.4172 0.3719 0.3952 0.0094  -0.0264 0.0605  480 ARG A CZ  
313  C CZ  B ARG A 38 ? 0.4458 0.3393 0.4111 0.0043  -0.0261 0.1046  480 ARG A CZ  
314  N NH1 A ARG A 38 ? 0.4111 0.3517 0.4002 0.0181  -0.0244 0.0617  480 ARG A NH1 
315  N NH1 B ARG A 38 ? 0.4575 0.3553 0.4074 -0.0080 -0.0238 0.1102  480 ARG A NH1 
316  N NH2 A ARG A 38 ? 0.3721 0.3438 0.3521 0.0089  -0.0286 0.0545  480 ARG A NH2 
317  N NH2 B ARG A 38 ? 0.4096 0.3025 0.3818 0.0157  -0.0328 0.1173  480 ARG A NH2 
318  N N   . LEU A 39 ? 0.4484 0.3931 0.4166 -0.0306 -0.0006 0.0315  481 LEU A N   
319  C CA  . LEU A 39 ? 0.4407 0.4004 0.4103 -0.0378 0.0046  0.0270  481 LEU A CA  
320  C C   . LEU A 39 ? 0.4393 0.3958 0.4195 -0.0458 0.0067  0.0238  481 LEU A C   
321  O O   . LEU A 39 ? 0.4433 0.4072 0.4257 -0.0553 0.0118  0.0275  481 LEU A O   
322  C CB  . LEU A 39 ? 0.4254 0.3996 0.3972 -0.0322 0.0044  0.0170  481 LEU A CB  
323  C CG  . LEU A 39 ? 0.4155 0.4069 0.3913 -0.0359 0.0104  0.0118  481 LEU A CG  
324  C CD1 . LEU A 39 ? 0.4016 0.4002 0.3647 -0.0394 0.0156  0.0162  481 LEU A CD1 
325  C CD2 . LEU A 39 ? 0.4182 0.4177 0.4003 -0.0288 0.0091  0.0025  481 LEU A CD2 
326  N N   . LEU A 40 ? 0.4331 0.3801 0.4194 -0.0430 0.0027  0.0166  482 LEU A N   
327  C CA  . LEU A 40 ? 0.4394 0.3852 0.4351 -0.0514 0.0023  0.0105  482 LEU A CA  
328  C C   . LEU A 40 ? 0.4646 0.3852 0.4607 -0.0577 0.0016  0.0140  482 LEU A C   
329  O O   . LEU A 40 ? 0.4756 0.3932 0.4793 -0.0683 0.0010  0.0095  482 LEU A O   
330  C CB  . LEU A 40 ? 0.4288 0.3802 0.4278 -0.0458 -0.0022 -0.0009 482 LEU A CB  
331  C CG  . LEU A 40 ? 0.3951 0.3699 0.3981 -0.0414 -0.0019 -0.0045 482 LEU A CG  
332  C CD1 . LEU A 40 ? 0.3781 0.3532 0.3783 -0.0325 -0.0064 -0.0108 482 LEU A CD1 
333  C CD2 . LEU A 40 ? 0.4012 0.3935 0.4170 -0.0502 -0.0010 -0.0068 482 LEU A CD2 
334  N N   . LYS A 41 ? 0.4797 0.3824 0.4690 -0.0513 0.0011  0.0221  483 LYS A N   
335  C CA  . LYS A 41 ? 0.5061 0.3791 0.4960 -0.0537 0.0007  0.0266  483 LYS A CA  
336  C C   . LYS A 41 ? 0.5137 0.3711 0.5070 -0.0534 -0.0019 0.0122  483 LYS A C   
337  O O   . LYS A 41 ? 0.5381 0.3767 0.5352 -0.0637 -0.0020 0.0093  483 LYS A O   
338  C CB  . LYS A 41 ? 0.5263 0.3933 0.5174 -0.0676 0.0044  0.0385  483 LYS A CB  
339  C CG  . LYS A 41 ? 0.5391 0.4144 0.5206 -0.0655 0.0066  0.0546  483 LYS A CG  
340  C CD  . LYS A 41 ? 0.6381 0.5169 0.6196 -0.0810 0.0125  0.0656  483 LYS A CD  
341  C CE  . LYS A 41 ? 0.6689 0.5514 0.6362 -0.0800 0.0145  0.0833  483 LYS A CE  
342  N NZ  . LYS A 41 ? 0.6738 0.5487 0.6405 -0.0956 0.0204  0.0980  483 LYS A NZ  
343  N N   . VAL A 42 ? 0.4987 0.3644 0.4893 -0.0422 -0.0038 0.0030  484 VAL A N   
344  C CA  . VAL A 42 ? 0.5050 0.3614 0.4938 -0.0396 -0.0056 -0.0120 484 VAL A CA  
345  C C   . VAL A 42 ? 0.5008 0.3510 0.4861 -0.0231 -0.0043 -0.0124 484 VAL A C   
346  O O   . VAL A 42 ? 0.4808 0.3478 0.4661 -0.0155 -0.0041 -0.0055 484 VAL A O   
347  C CB  . VAL A 42 ? 0.4845 0.3669 0.4736 -0.0429 -0.0086 -0.0214 484 VAL A CB  
348  C CG1 . VAL A 42 ? 0.4850 0.3627 0.4669 -0.0381 -0.0108 -0.0356 484 VAL A CG1 
349  C CG2 . VAL A 42 ? 0.4828 0.3752 0.4801 -0.0587 -0.0101 -0.0217 484 VAL A CG2 
350  N N   . PRO A 43 ? 0.5199 0.3465 0.5032 -0.0178 -0.0028 -0.0213 485 PRO A N   
351  C CA  . PRO A 43 ? 0.5229 0.3454 0.5067 -0.0011 0.0003  -0.0207 485 PRO A CA  
352  C C   . PRO A 43 ? 0.5008 0.3502 0.4819 0.0065  0.0007  -0.0241 485 PRO A C   
353  O O   . PRO A 43 ? 0.4886 0.3514 0.4639 0.0010  -0.0009 -0.0327 485 PRO A O   
354  C CB  . PRO A 43 ? 0.5548 0.3482 0.5355 0.0017  0.0032  -0.0345 485 PRO A CB  
355  C CG  . PRO A 43 ? 0.5727 0.3478 0.5531 -0.0146 0.0006  -0.0377 485 PRO A CG  
356  C CD  . PRO A 43 ? 0.5486 0.3518 0.5299 -0.0272 -0.0034 -0.0334 485 PRO A CD  
357  N N   . VAL A 44 ? 0.4960 0.3536 0.4826 0.0184  0.0024  -0.0160 486 VAL A N   
358  C CA  . VAL A 44 ? 0.4864 0.3671 0.4728 0.0253  0.0039  -0.0177 486 VAL A CA  
359  C C   . VAL A 44 ? 0.4992 0.3780 0.4775 0.0288  0.0081  -0.0326 486 VAL A C   
360  O O   . VAL A 44 ? 0.4884 0.3855 0.4608 0.0272  0.0079  -0.0357 486 VAL A O   
361  C CB  . VAL A 44 ? 0.4875 0.3768 0.4847 0.0372  0.0050  -0.0070 486 VAL A CB  
362  C CG1 . VAL A 44 ? 0.4649 0.3729 0.4643 0.0451  0.0093  -0.0111 486 VAL A CG1 
363  C CG2 . VAL A 44 ? 0.4635 0.3657 0.4635 0.0321  -0.0006 0.0065  486 VAL A CG2 
364  N N   . SER A 45 ? 0.5247 0.3796 0.5012 0.0333  0.0121  -0.0415 487 SER A N   
365  C CA  . SER A 45 ? 0.5406 0.3909 0.5057 0.0370  0.0171  -0.0579 487 SER A CA  
366  C C   . SER A 45 ? 0.5400 0.3915 0.4908 0.0233  0.0121  -0.0690 487 SER A C   
367  O O   . SER A 45 ? 0.5528 0.4087 0.4898 0.0243  0.0144  -0.0811 487 SER A O   
368  C CB  . SER A 45 ? 0.5756 0.3966 0.5429 0.0467  0.0235  -0.0662 487 SER A CB  
369  O OG  . SER A 45 ? 0.6021 0.3952 0.5713 0.0382  0.0196  -0.0660 487 SER A OG  
370  N N   . ASP A 46 ? 0.5277 0.3779 0.4818 0.0106  0.0053  -0.0643 488 ASP A N   
371  C CA  . ASP A 46 ? 0.5269 0.3834 0.4721 -0.0026 -0.0009 -0.0732 488 ASP A CA  
372  C C   . ASP A 46 ? 0.4930 0.3803 0.4388 -0.0048 -0.0051 -0.0658 488 ASP A C   
373  O O   . ASP A 46 ? 0.4934 0.3921 0.4323 -0.0124 -0.0107 -0.0716 488 ASP A O   
374  C CB  . ASP A 46 ? 0.5363 0.3775 0.4879 -0.0163 -0.0054 -0.0728 488 ASP A CB  
375  C CG  . ASP A 46 ? 0.5897 0.3952 0.5380 -0.0177 -0.0028 -0.0840 488 ASP A CG  
376  O OD1 . ASP A 46 ? 0.5972 0.3901 0.5364 -0.0077 0.0026  -0.0957 488 ASP A OD1 
377  O OD2 . ASP A 46 ? 0.6503 0.4391 0.6056 -0.0290 -0.0053 -0.0813 488 ASP A OD2 
378  N N   . LEU A 47 ? 0.4672 0.3669 0.4213 0.0019  -0.0030 -0.0530 489 LEU A N   
379  C CA  . LEU A 47 ? 0.4413 0.3647 0.3983 -0.0001 -0.0064 -0.0454 489 LEU A CA  
380  C C   . LEU A 47 ? 0.4372 0.3747 0.3850 0.0054  -0.0052 -0.0474 489 LEU A C   
381  O O   . LEU A 47 ? 0.4409 0.3780 0.3865 0.0141  0.0009  -0.0473 489 LEU A O   
382  C CB  . LEU A 47 ? 0.4222 0.3511 0.3898 0.0027  -0.0053 -0.0327 489 LEU A CB  
383  C CG  . LEU A 47 ? 0.4277 0.3521 0.4024 -0.0049 -0.0071 -0.0267 489 LEU A CG  
384  C CD1 . LEU A 47 ? 0.3973 0.3267 0.3771 -0.0007 -0.0058 -0.0156 489 LEU A CD1 
385  C CD2 . LEU A 47 ? 0.3875 0.3253 0.3651 -0.0140 -0.0109 -0.0277 489 LEU A CD2 
386  N N   . LEU A 48 ? 0.4287 0.3804 0.3725 0.0003  -0.0109 -0.0477 490 LEU A N   
387  C CA  . LEU A 48 ? 0.4253 0.3910 0.3591 0.0041  -0.0110 -0.0464 490 LEU A CA  
388  C C   . LEU A 48 ? 0.3991 0.3796 0.3419 0.0044  -0.0140 -0.0350 490 LEU A C   
389  O O   . LEU A 48 ? 0.3855 0.3724 0.3359 -0.0006 -0.0196 -0.0333 490 LEU A O   
390  C CB  . LEU A 48 ? 0.4448 0.4137 0.3636 -0.0013 -0.0166 -0.0563 490 LEU A CB  
391  C CG  . LEU A 48 ? 0.5023 0.4552 0.4064 -0.0007 -0.0124 -0.0709 490 LEU A CG  
392  C CD1 . LEU A 48 ? 0.5364 0.4907 0.4267 -0.0104 -0.0210 -0.0828 490 LEU A CD1 
393  C CD2 . LEU A 48 ? 0.5249 0.4815 0.4180 0.0091  -0.0032 -0.0708 490 LEU A CD2 
394  N N   . LEU A 49 ? 0.3893 0.3751 0.3327 0.0102  -0.0096 -0.0276 491 LEU A N   
395  C CA  . LEU A 49 ? 0.3785 0.3728 0.3307 0.0109  -0.0114 -0.0175 491 LEU A CA  
396  C C   . LEU A 49 ? 0.3804 0.3840 0.3249 0.0132  -0.0120 -0.0110 491 LEU A C   
397  O O   . LEU A 49 ? 0.3961 0.4020 0.3291 0.0154  -0.0077 -0.0116 491 LEU A O   
398  C CB  . LEU A 49 ? 0.3660 0.3568 0.3285 0.0129  -0.0071 -0.0123 491 LEU A CB  
399  C CG  . LEU A 49 ? 0.3943 0.3769 0.3642 0.0108  -0.0071 -0.0141 491 LEU A CG  
400  C CD1 . LEU A 49 ? 0.3886 0.3728 0.3667 0.0116  -0.0058 -0.0076 491 LEU A CD1 
401  C CD2 . LEU A 49 ? 0.3938 0.3770 0.3666 0.0053  -0.0114 -0.0166 491 LEU A CD2 
402  N N   . SER A 50 ? 0.3716 0.3804 0.3230 0.0130  -0.0166 -0.0043 492 SER A N   
403  C CA  . SER A 50 ? 0.3768 0.3917 0.3236 0.0154  -0.0181 0.0053  492 SER A CA  
404  C C   . SER A 50 ? 0.3646 0.3773 0.3264 0.0168  -0.0201 0.0115  492 SER A C   
405  O O   . SER A 50 ? 0.3542 0.3636 0.3262 0.0155  -0.0198 0.0068  492 SER A O   
406  C CB  . SER A 50 ? 0.3892 0.4136 0.3237 0.0147  -0.0252 0.0043  492 SER A CB  
407  O OG  . SER A 50 ? 0.3882 0.4171 0.3323 0.0124  -0.0321 -0.0001 492 SER A OG  
408  N N   . TYR A 51 ? 0.3781 0.3913 0.3403 0.0195  -0.0214 0.0219  493 TYR A N   
409  C CA  . TYR A 51 ? 0.3803 0.3877 0.3568 0.0221  -0.0226 0.0262  493 TYR A CA  
410  C C   . TYR A 51 ? 0.4071 0.4166 0.3844 0.0271  -0.0277 0.0377  493 TYR A C   
411  O O   . TYR A 51 ? 0.4234 0.4376 0.3878 0.0272  -0.0293 0.0455  493 TYR A O   
412  C CB  . TYR A 51 ? 0.3684 0.3647 0.3510 0.0196  -0.0168 0.0265  493 TYR A CB  
413  C CG  . TYR A 51 ? 0.3602 0.3517 0.3400 0.0182  -0.0139 0.0369  493 TYR A CG  
414  C CD1 . TYR A 51 ? 0.3729 0.3527 0.3608 0.0191  -0.0144 0.0442  493 TYR A CD1 
415  C CD2 . TYR A 51 ? 0.3072 0.3053 0.2773 0.0157  -0.0096 0.0394  493 TYR A CD2 
416  C CE1 . TYR A 51 ? 0.3418 0.3157 0.3283 0.0157  -0.0115 0.0553  493 TYR A CE1 
417  C CE2 . TYR A 51 ? 0.3262 0.3227 0.2951 0.0129  -0.0056 0.0505  493 TYR A CE2 
418  C CZ  . TYR A 51 ? 0.3420 0.3261 0.3194 0.0119  -0.0070 0.0592  493 TYR A CZ  
419  O OH  . TYR A 51 ? 0.2805 0.2614 0.2580 0.0072  -0.0029 0.0714  493 TYR A OH  
420  N N   . GLU A 52 ? 0.4245 0.4310 0.4165 0.0320  -0.0300 0.0392  494 GLU A N   
421  C CA  . GLU A 52 ? 0.4579 0.4620 0.4544 0.0389  -0.0344 0.0523  494 GLU A CA  
422  C C   . GLU A 52 ? 0.4712 0.4563 0.4808 0.0422  -0.0303 0.0546  494 GLU A C   
423  O O   . GLU A 52 ? 0.4635 0.4428 0.4820 0.0415  -0.0261 0.0439  494 GLU A O   
424  C CB  . GLU A 52 ? 0.4628 0.4842 0.4658 0.0447  -0.0433 0.0546  494 GLU A CB  
425  C CG  . GLU A 52 ? 0.4784 0.5082 0.4985 0.0466  -0.0432 0.0439  494 GLU A CG  
426  C CD  . GLU A 52 ? 0.5594 0.6116 0.5891 0.0514  -0.0530 0.0477  494 GLU A CD  
427  O OE1 . GLU A 52 ? 0.5831 0.6373 0.6220 0.0610  -0.0582 0.0598  494 GLU A OE1 
428  O OE2 . GLU A 52 ? 0.5669 0.6349 0.5961 0.0453  -0.0563 0.0392  494 GLU A OE2 
429  N N   . SER A 53 ? 0.4969 0.4710 0.5056 0.0449  -0.0313 0.0687  495 SER A N   
430  C CA  . SER A 53 ? 0.5216 0.4726 0.5416 0.0472  -0.0278 0.0715  495 SER A CA  
431  C C   . SER A 53 ? 0.5461 0.4945 0.5795 0.0600  -0.0330 0.0804  495 SER A C   
432  O O   . SER A 53 ? 0.5548 0.5163 0.5838 0.0647  -0.0403 0.0927  495 SER A O   
433  C CB  . SER A 53 ? 0.5361 0.4740 0.5479 0.0398  -0.0246 0.0828  495 SER A CB  
434  O OG  . SER A 53 ? 0.5653 0.4792 0.5868 0.0366  -0.0202 0.0797  495 SER A OG  
435  N N   . PRO A 54 ? 0.5630 0.4953 0.6124 0.0664  -0.0295 0.0739  496 PRO A N   
436  C CA  . PRO A 54 ? 0.5849 0.5156 0.6518 0.0816  -0.0333 0.0809  496 PRO A CA  
437  C C   . PRO A 54 ? 0.6168 0.5362 0.6824 0.0869  -0.0389 0.1034  496 PRO A C   
438  O O   . PRO A 54 ? 0.6321 0.5603 0.7091 0.0999  -0.0458 0.1146  496 PRO A O   
439  C CB  . PRO A 54 ? 0.5934 0.5015 0.6735 0.0855  -0.0251 0.0676  496 PRO A CB  
440  C CG  . PRO A 54 ? 0.5911 0.4831 0.6583 0.0709  -0.0196 0.0596  496 PRO A CG  
441  C CD  . PRO A 54 ? 0.5618 0.4767 0.6134 0.0604  -0.0217 0.0592  496 PRO A CD  
442  N N   . LYS A 55 ? 0.6324 0.5345 0.6852 0.0767  -0.0359 0.1112  497 LYS A N   
443  C CA  . LYS A 55 ? 0.6633 0.5548 0.7100 0.0779  -0.0398 0.1349  497 LYS A CA  
444  C C   . LYS A 55 ? 0.6654 0.5860 0.7004 0.0818  -0.0495 0.1480  497 LYS A C   
445  O O   . LYS A 55 ? 0.6900 0.6109 0.7302 0.0929  -0.0573 0.1661  497 LYS A O   
446  C CB  . LYS A 55 ? 0.6702 0.5489 0.7031 0.0621  -0.0336 0.1388  497 LYS A CB  
447  C CG  . LYS A 55 ? 0.6629 0.5267 0.7009 0.0521  -0.0255 0.1198  497 LYS A CG  
448  C CD  . LYS A 55 ? 0.6908 0.5471 0.7197 0.0365  -0.0205 0.1265  497 LYS A CD  
449  C CE  . LYS A 55 ? 0.6954 0.5375 0.7309 0.0262  -0.0151 0.1094  497 LYS A CE  
450  N NZ  . LYS A 55 ? 0.6999 0.5398 0.7310 0.0100  -0.0108 0.1164  497 LYS A NZ  
451  N N   . LYS A 56 ? 0.6412 0.5856 0.6601 0.0728  -0.0495 0.1386  498 LYS A N   
452  C CA  . LYS A 56 ? 0.6367 0.6085 0.6392 0.0731  -0.0582 0.1466  498 LYS A CA  
453  C C   . LYS A 56 ? 0.6114 0.6084 0.6202 0.0751  -0.0630 0.1303  498 LYS A C   
454  O O   . LYS A 56 ? 0.5976 0.6074 0.5932 0.0659  -0.0608 0.1172  498 LYS A O   
455  C CB  . LYS A 56 ? 0.6363 0.6133 0.6129 0.0602  -0.0531 0.1483  498 LYS A CB  
456  C CG  . LYS A 56 ? 0.6511 0.6056 0.6233 0.0547  -0.0463 0.1635  498 LYS A CG  
457  C CD  . LYS A 56 ? 0.6320 0.5985 0.5794 0.0439  -0.0408 0.1680  498 LYS A CD  
458  C CE  . LYS A 56 ? 0.6670 0.6152 0.6112 0.0379  -0.0347 0.1881  498 LYS A CE  
459  N NZ  . LYS A 56 ? 0.6768 0.6159 0.6198 0.0460  -0.0426 0.2134  498 LYS A NZ  
460  N N   . PRO A 57 ? 0.6083 0.6127 0.6391 0.0873  -0.0691 0.1314  499 PRO A N   
461  C CA  . PRO A 57 ? 0.5848 0.6131 0.6261 0.0873  -0.0717 0.1155  499 PRO A CA  
462  C C   . PRO A 57 ? 0.5808 0.6380 0.6055 0.0815  -0.0821 0.1161  499 PRO A C   
463  O O   . PRO A 57 ? 0.6027 0.6703 0.6180 0.0852  -0.0924 0.1326  499 PRO A O   
464  C CB  . PRO A 57 ? 0.5955 0.6268 0.6666 0.1032  -0.0751 0.1200  499 PRO A CB  
465  C CG  . PRO A 57 ? 0.6196 0.6376 0.6904 0.1125  -0.0808 0.1434  499 PRO A CG  
466  C CD  . PRO A 57 ? 0.6308 0.6231 0.6799 0.1020  -0.0733 0.1478  499 PRO A CD  
467  N N   . GLY A 58 ? 0.5544 0.6231 0.5744 0.0720  -0.0798 0.0981  500 GLY A N   
468  C CA  . GLY A 58 ? 0.5502 0.6430 0.5541 0.0645  -0.0891 0.0941  500 GLY A CA  
469  C C   . GLY A 58 ? 0.5512 0.6378 0.5231 0.0542  -0.0851 0.0913  500 GLY A C   
470  O O   . GLY A 58 ? 0.5485 0.6497 0.5039 0.0464  -0.0901 0.0825  500 GLY A O   
471  N N   . ARG A 59 ? 0.5475 0.6126 0.5113 0.0539  -0.0757 0.0982  501 ARG A N   
472  C CA  . ARG A 59 ? 0.5488 0.6097 0.4858 0.0455  -0.0691 0.0963  501 ARG A CA  
473  C C   . ARG A 59 ? 0.5269 0.5770 0.4664 0.0389  -0.0576 0.0790  501 ARG A C   
474  O O   . ARG A 59 ? 0.5176 0.5511 0.4701 0.0395  -0.0496 0.0786  501 ARG A O   
475  C CB  . ARG A 59 ? 0.5662 0.6144 0.4939 0.0471  -0.0651 0.1157  501 ARG A CB  
476  C CG  . ARG A 59 ? 0.5899 0.6445 0.5154 0.0549  -0.0763 0.1374  501 ARG A CG  
477  C CD  . ARG A 59 ? 0.5885 0.6679 0.4881 0.0523  -0.0871 0.1405  501 ARG A CD  
478  N NE  . ARG A 59 ? 0.5937 0.6939 0.5062 0.0560  -0.1006 0.1345  501 ARG A NE  
479  C CZ  . ARG A 59 ? 0.6029 0.7216 0.5041 0.0486  -0.1063 0.1185  501 ARG A CZ  
480  N NH1 . ARG A 59 ? 0.5838 0.7007 0.4587 0.0391  -0.0991 0.1060  501 ARG A NH1 
481  N NH2 . ARG A 59 ? 0.6369 0.7764 0.5544 0.0508  -0.1191 0.1148  501 ARG A NH2 
482  N N   . GLU A 60 ? 0.5201 0.5791 0.4467 0.0325  -0.0574 0.0648  502 GLU A N   
483  C CA  . GLU A 60 ? 0.5076 0.5569 0.4357 0.0275  -0.0476 0.0504  502 GLU A CA  
484  C C   . GLU A 60 ? 0.5130 0.5563 0.4252 0.0248  -0.0377 0.0531  502 GLU A C   
485  O O   . GLU A 60 ? 0.5340 0.5858 0.4239 0.0232  -0.0381 0.0557  502 GLU A O   
486  C CB  . GLU A 60 ? 0.5039 0.5614 0.4273 0.0223  -0.0510 0.0343  502 GLU A CB  
487  C CG  . GLU A 60 ? 0.5107 0.5766 0.4543 0.0228  -0.0583 0.0300  502 GLU A CG  
488  C CD  . GLU A 60 ? 0.5433 0.6133 0.4839 0.0148  -0.0603 0.0141  502 GLU A CD  
489  O OE1 . GLU A 60 ? 0.5081 0.5656 0.4410 0.0111  -0.0522 0.0044  502 GLU A OE1 
490  O OE2 . GLU A 60 ? 0.5125 0.5983 0.4604 0.0122  -0.0703 0.0118  502 GLU A OE2 
491  N N   . ILE A 61 ? 0.4947 0.5258 0.4182 0.0238  -0.0289 0.0524  503 ILE A N   
492  C CA  . ILE A 61 ? 0.4979 0.5275 0.4122 0.0207  -0.0186 0.0529  503 ILE A CA  
493  C C   . ILE A 61 ? 0.4827 0.5108 0.3996 0.0189  -0.0133 0.0370  503 ILE A C   
494  O O   . ILE A 61 ? 0.4600 0.4813 0.3924 0.0187  -0.0142 0.0306  503 ILE A O   
495  C CB  . ILE A 61 ? 0.4962 0.5157 0.4230 0.0194  -0.0130 0.0642  503 ILE A CB  
496  C CG1 . ILE A 61 ? 0.5184 0.5351 0.4419 0.0213  -0.0170 0.0826  503 ILE A CG1 
497  C CG2 . ILE A 61 ? 0.4970 0.5203 0.4200 0.0156  -0.0021 0.0635  503 ILE A CG2 
498  C CD1 . ILE A 61 ? 0.5194 0.5230 0.4618 0.0254  -0.0226 0.0870  503 ILE A CD1 
499  N N   . GLU A 62 ? 0.4957 0.5293 0.3969 0.0183  -0.0071 0.0311  504 GLU A N   
500  C CA  . GLU A 62 ? 0.4949 0.5250 0.3979 0.0185  -0.0023 0.0162  504 GLU A CA  
501  C C   . GLU A 62 ? 0.4817 0.5084 0.4005 0.0191  0.0058  0.0173  504 GLU A C   
502  O O   . GLU A 62 ? 0.4882 0.5184 0.4121 0.0179  0.0105  0.0280  504 GLU A O   
503  C CB  . GLU A 62 ? 0.5167 0.5519 0.3968 0.0192  0.0017  0.0067  504 GLU A CB  
504  C CG  . GLU A 62 ? 0.5297 0.5657 0.3972 0.0166  -0.0082 -0.0033 504 GLU A CG  
505  C CD  . GLU A 62 ? 0.6129 0.6566 0.4509 0.0159  -0.0067 -0.0089 504 GLU A CD  
506  O OE1 . GLU A 62 ? 0.6381 0.6803 0.4664 0.0185  0.0047  -0.0169 504 GLU A OE1 
507  O OE2 . GLU A 62 ? 0.6435 0.6962 0.4678 0.0132  -0.0170 -0.0057 504 GLU A OE2 
508  N N   . LEU A 63 ? 0.4738 0.4941 0.4010 0.0200  0.0064  0.0072  505 LEU A N   
509  C CA  . LEU A 63 ? 0.4656 0.4851 0.4077 0.0212  0.0121  0.0074  505 LEU A CA  
510  C C   . LEU A 63 ? 0.4810 0.4982 0.4184 0.0258  0.0177  -0.0037 505 LEU A C   
511  O O   . LEU A 63 ? 0.4791 0.4866 0.4227 0.0266  0.0153  -0.0105 505 LEU A O   
512  C CB  . LEU A 63 ? 0.4417 0.4536 0.3988 0.0189  0.0063  0.0077  505 LEU A CB  
513  C CG  . LEU A 63 ? 0.4428 0.4524 0.4046 0.0159  0.0008  0.0149  505 LEU A CG  
514  C CD1 . LEU A 63 ? 0.4188 0.4215 0.3903 0.0143  -0.0037 0.0112  505 LEU A CD1 
515  C CD2 . LEU A 63 ? 0.4152 0.4274 0.3832 0.0135  0.0042  0.0252  505 LEU A CD2 
516  N N   . GLU A 64 ? 0.5051 0.5301 0.4308 0.0291  0.0260  -0.0056 506 GLU A N   
517  C CA  . GLU A 64 ? 0.5252 0.5454 0.4435 0.0348  0.0326  -0.0188 506 GLU A CA  
518  C C   . GLU A 64 ? 0.5177 0.5395 0.4547 0.0417  0.0401  -0.0191 506 GLU A C   
519  O O   . GLU A 64 ? 0.5277 0.5366 0.4692 0.0459  0.0399  -0.0276 506 GLU A O   
520  C CB  . GLU A 64 ? 0.5528 0.5807 0.4471 0.0364  0.0395  -0.0237 506 GLU A CB  
521  C CG  . GLU A 64 ? 0.5964 0.6123 0.4766 0.0406  0.0430  -0.0424 506 GLU A CG  
522  C CD  . GLU A 64 ? 0.6526 0.6775 0.5083 0.0438  0.0534  -0.0497 506 GLU A CD  
523  O OE1 . GLU A 64 ? 0.6733 0.7076 0.5082 0.0386  0.0499  -0.0451 506 GLU A OE1 
524  O OE2 . GLU A 64 ? 0.6772 0.7000 0.5338 0.0523  0.0655  -0.0598 506 GLU A OE2 
525  N N   . ASN A 65 ? 0.5030 0.5411 0.4521 0.0425  0.0464  -0.0089 507 ASN A N   
526  C CA  . ASN A 65 ? 0.4879 0.5341 0.4588 0.0492  0.0525  -0.0071 507 ASN A CA  
527  C C   . ASN A 65 ? 0.4618 0.5020 0.4510 0.0468  0.0429  -0.0022 507 ASN A C   
528  O O   . ASN A 65 ? 0.4434 0.4893 0.4411 0.0394  0.0373  0.0072  507 ASN A O   
529  C CB  . ASN A 65 ? 0.4862 0.5562 0.4664 0.0486  0.0620  0.0030  507 ASN A CB  
530  C CG  . ASN A 65 ? 0.4780 0.5629 0.4809 0.0580  0.0709  0.0032  507 ASN A CG  
531  O OD1 . ASN A 65 ? 0.4314 0.5113 0.4509 0.0624  0.0658  0.0027  507 ASN A OD1 
532  N ND2 . ASN A 65 ? 0.4844 0.5899 0.4891 0.0613  0.0844  0.0054  507 ASN A ND2 
533  N N   . ASP A 66 ? 0.4582 0.4853 0.4518 0.0528  0.0412  -0.0087 508 ASP A N   
534  C CA  . ASP A 66 ? 0.4399 0.4613 0.4471 0.0511  0.0325  -0.0035 508 ASP A CA  
535  C C   . ASP A 66 ? 0.4144 0.4550 0.4431 0.0507  0.0313  0.0074  508 ASP A C   
536  O O   . ASP A 66 ? 0.4029 0.4425 0.4379 0.0452  0.0224  0.0129  508 ASP A O   
537  C CB  . ASP A 66 ? 0.4522 0.4568 0.4618 0.0592  0.0330  -0.0097 508 ASP A CB  
538  C CG  . ASP A 66 ? 0.5077 0.4911 0.4985 0.0563  0.0315  -0.0210 508 ASP A CG  
539  O OD1 . ASP A 66 ? 0.5277 0.5076 0.5089 0.0467  0.0246  -0.0208 508 ASP A OD1 
540  O OD2 . ASP A 66 ? 0.6235 0.5939 0.6103 0.0638  0.0373  -0.0308 508 ASP A OD2 
541  N N   . LEU A 67 ? 0.4058 0.4656 0.4455 0.0559  0.0404  0.0101  509 LEU A N   
542  C CA  . LEU A 67 ? 0.3860 0.4679 0.4506 0.0560  0.0390  0.0200  509 LEU A CA  
543  C C   . LEU A 67 ? 0.3619 0.4576 0.4306 0.0433  0.0366  0.0281  509 LEU A C   
544  O O   . LEU A 67 ? 0.3469 0.4616 0.4360 0.0395  0.0336  0.0360  509 LEU A O   
545  C CB  . LEU A 67 ? 0.3969 0.4954 0.4781 0.0696  0.0504  0.0193  509 LEU A CB  
546  C CG  . LEU A 67 ? 0.4215 0.5010 0.5020 0.0830  0.0515  0.0119  509 LEU A CG  
547  C CD1 . LEU A 67 ? 0.4381 0.5297 0.5328 0.0991  0.0654  0.0080  509 LEU A CD1 
548  C CD2 . LEU A 67 ? 0.4168 0.4893 0.5079 0.0829  0.0388  0.0190  509 LEU A CD2 
549  N N   . LYS A 68 ? 0.3531 0.4381 0.4029 0.0363  0.0368  0.0264  510 LYS A N   
550  C CA  . LYS A 68 ? 0.3392 0.4290 0.3906 0.0242  0.0340  0.0341  510 LYS A CA  
551  C C   . LYS A 68 ? 0.3221 0.3955 0.3688 0.0166  0.0220  0.0332  510 LYS A C   
552  O O   . LYS A 68 ? 0.3156 0.3743 0.3533 0.0201  0.0172  0.0270  510 LYS A O   
553  C CB  . LYS A 68 ? 0.3524 0.4404 0.3868 0.0221  0.0411  0.0354  510 LYS A CB  
554  C CG  . LYS A 68 ? 0.3637 0.4710 0.4000 0.0279  0.0551  0.0367  510 LYS A CG  
555  C CD  . LYS A 68 ? 0.4167 0.5495 0.4781 0.0224  0.0597  0.0473  510 LYS A CD  
556  C CE  . LYS A 68 ? 0.4500 0.6059 0.5151 0.0294  0.0763  0.0483  510 LYS A CE  
557  N NZ  . LYS A 68 ? 0.4315 0.6178 0.5284 0.0264  0.0810  0.0574  510 LYS A NZ  
558  N N   . SER A 69 ? 0.3135 0.3893 0.3668 0.0059  0.0179  0.0389  511 SER A N   
559  C CA  . SER A 69 ? 0.3090 0.3698 0.3579 -0.0008 0.0081  0.0363  511 SER A CA  
560  C C   . SER A 69 ? 0.3102 0.3529 0.3439 -0.0032 0.0074  0.0349  511 SER A C   
561  O O   . SER A 69 ? 0.3119 0.3549 0.3385 -0.0018 0.0130  0.0386  511 SER A O   
562  C CB  . SER A 69 ? 0.3066 0.3768 0.3708 -0.0116 0.0028  0.0406  511 SER A CB  
563  O OG  . SER A 69 ? 0.3221 0.3963 0.3915 -0.0192 0.0075  0.0475  511 SER A OG  
564  N N   . LEU A 70 ? 0.3097 0.3384 0.3383 -0.0060 0.0006  0.0302  512 LEU A N   
565  C CA  . LEU A 70 ? 0.3131 0.3260 0.3323 -0.0070 -0.0006 0.0293  512 LEU A CA  
566  C C   . LEU A 70 ? 0.3215 0.3316 0.3449 -0.0134 0.0014  0.0374  512 LEU A C   
567  O O   . LEU A 70 ? 0.3317 0.3368 0.3476 -0.0109 0.0039  0.0423  512 LEU A O   
568  C CB  . LEU A 70 ? 0.3094 0.3104 0.3258 -0.0091 -0.0064 0.0222  512 LEU A CB  
569  C CG  . LEU A 70 ? 0.2992 0.2991 0.3086 -0.0035 -0.0076 0.0161  512 LEU A CG  
570  C CD1 . LEU A 70 ? 0.2461 0.2393 0.2529 -0.0070 -0.0116 0.0101  512 LEU A CD1 
571  C CD2 . LEU A 70 ? 0.3013 0.2969 0.3028 0.0021  -0.0058 0.0151  512 LEU A CD2 
572  N N   . GLN A 71 ? 0.3223 0.3358 0.3576 -0.0226 -0.0004 0.0396  513 GLN A N   
573  C CA  . GLN A 71 ? 0.3414 0.3476 0.3821 -0.0312 0.0010  0.0474  513 GLN A CA  
574  C C   . GLN A 71 ? 0.3457 0.3672 0.3898 -0.0319 0.0091  0.0587  513 GLN A C   
575  O O   . GLN A 71 ? 0.3620 0.3757 0.4050 -0.0365 0.0120  0.0683  513 GLN A O   
576  C CB  . GLN A 71 ? 0.3391 0.3409 0.3907 -0.0434 -0.0046 0.0443  513 GLN A CB  
577  C CG  . GLN A 71 ? 0.3597 0.3857 0.4275 -0.0505 -0.0050 0.0476  513 GLN A CG  
578  C CD  . GLN A 71 ? 0.3648 0.3904 0.4386 -0.0606 -0.0143 0.0400  513 GLN A CD  
579  O OE1 . GLN A 71 ? 0.3113 0.3154 0.3759 -0.0636 -0.0189 0.0314  513 GLN A OE1 
580  N NE2 . GLN A 71 ? 0.3113 0.3626 0.4005 -0.0652 -0.0171 0.0427  513 GLN A NE2 
581  N N   . PHE A 72 ? 0.3357 0.3781 0.3830 -0.0265 0.0136  0.0579  514 PHE A N   
582  C CA  . PHE A 72 ? 0.3424 0.4006 0.3883 -0.0241 0.0237  0.0660  514 PHE A CA  
583  C C   . PHE A 72 ? 0.3496 0.3961 0.3749 -0.0184 0.0257  0.0684  514 PHE A C   
584  O O   . PHE A 72 ? 0.3607 0.4121 0.3805 -0.0208 0.0322  0.0790  514 PHE A O   
585  C CB  . PHE A 72 ? 0.3312 0.4096 0.3818 -0.0151 0.0289  0.0612  514 PHE A CB  
586  C CG  . PHE A 72 ? 0.3494 0.4432 0.3940 -0.0104 0.0412  0.0660  514 PHE A CG  
587  C CD1 . PHE A 72 ? 0.3733 0.4893 0.4335 -0.0164 0.0500  0.0757  514 PHE A CD1 
588  C CD2 . PHE A 72 ? 0.3578 0.4455 0.3808 -0.0011 0.0445  0.0604  514 PHE A CD2 
589  C CE1 . PHE A 72 ? 0.3878 0.5200 0.4403 -0.0119 0.0635  0.0798  514 PHE A CE1 
590  C CE2 . PHE A 72 ? 0.3699 0.4717 0.3828 0.0030  0.0565  0.0631  514 PHE A CE2 
591  C CZ  . PHE A 72 ? 0.3836 0.5080 0.4106 -0.0018 0.0669  0.0728  514 PHE A CZ  
592  N N   . TYR A 73 ? 0.3416 0.3751 0.3556 -0.0114 0.0197  0.0596  515 TYR A N   
593  C CA  . TYR A 73 ? 0.3464 0.3722 0.3425 -0.0060 0.0190  0.0611  515 TYR A CA  
594  C C   . TYR A 73 ? 0.3492 0.3568 0.3445 -0.0089 0.0136  0.0679  515 TYR A C   
595  O O   . TYR A 73 ? 0.3515 0.3537 0.3349 -0.0036 0.0106  0.0701  515 TYR A O   
596  C CB  . TYR A 73 ? 0.3362 0.3597 0.3233 0.0020  0.0153  0.0489  515 TYR A CB  
597  C CG  . TYR A 73 ? 0.3576 0.3936 0.3383 0.0077  0.0216  0.0429  515 TYR A CG  
598  C CD1 . TYR A 73 ? 0.4044 0.4488 0.3699 0.0101  0.0280  0.0460  515 TYR A CD1 
599  C CD2 . TYR A 73 ? 0.3632 0.4011 0.3515 0.0113  0.0214  0.0339  515 TYR A CD2 
600  C CE1 . TYR A 73 ? 0.4085 0.4618 0.3669 0.0162  0.0351  0.0377  515 TYR A CE1 
601  C CE2 . TYR A 73 ? 0.3586 0.4036 0.3423 0.0181  0.0278  0.0275  515 TYR A CE2 
602  C CZ  . TYR A 73 ? 0.3970 0.4491 0.3658 0.0206  0.0351  0.0281  515 TYR A CZ  
603  O OH  . TYR A 73 ? 0.4214 0.4783 0.3846 0.0281  0.0427  0.0190  515 TYR A OH  
604  N N   . SER A 74 ? 0.3553 0.3537 0.3640 -0.0171 0.0121  0.0711  516 SER A N   
605  C CA  . SER A 74 ? 0.3765 0.3527 0.3871 -0.0193 0.0078  0.0761  516 SER A CA  
606  C C   . SER A 74 ? 0.3746 0.3385 0.3824 -0.0115 0.0014  0.0659  516 SER A C   
607  O O   . SER A 74 ? 0.3882 0.3371 0.3949 -0.0074 -0.0015 0.0704  516 SER A O   
608  C CB  . SER A 74 ? 0.3856 0.3583 0.3880 -0.0191 0.0105  0.0926  516 SER A CB  
609  O OG  . SER A 74 ? 0.4253 0.4101 0.4316 -0.0278 0.0181  0.1030  516 SER A OG  
610  N N   . VAL A 75 ? 0.3583 0.3296 0.3661 -0.0089 -0.0002 0.0533  517 VAL A N   
611  C CA  . VAL A 75 ? 0.3603 0.3221 0.3679 -0.0040 -0.0045 0.0435  517 VAL A CA  
612  C C   . VAL A 75 ? 0.3725 0.3164 0.3883 -0.0093 -0.0061 0.0401  517 VAL A C   
613  O O   . VAL A 75 ? 0.3783 0.3223 0.4001 -0.0187 -0.0059 0.0392  517 VAL A O   
614  C CB  . VAL A 75 ? 0.3399 0.3126 0.3450 -0.0017 -0.0053 0.0328  517 VAL A CB  
615  C CG1 . VAL A 75 ? 0.3366 0.3020 0.3418 0.0019  -0.0080 0.0239  517 VAL A CG1 
616  C CG2 . VAL A 75 ? 0.3251 0.3107 0.3214 0.0032  -0.0035 0.0340  517 VAL A CG2 
617  N N   . GLU A 76 ? 0.3832 0.3122 0.4002 -0.0035 -0.0078 0.0377  518 GLU A N   
618  C CA  . GLU A 76 ? 0.4051 0.3128 0.4281 -0.0072 -0.0083 0.0317  518 GLU A CA  
619  C C   . GLU A 76 ? 0.4014 0.3056 0.4233 -0.0016 -0.0085 0.0175  518 GLU A C   
620  O O   . GLU A 76 ? 0.3787 0.2944 0.3984 0.0067  -0.0085 0.0156  518 GLU A O   
621  C CB  . GLU A 76 ? 0.4293 0.3164 0.4573 -0.0045 -0.0080 0.0424  518 GLU A CB  
622  C CG  . GLU A 76 ? 0.4721 0.3575 0.5018 -0.0133 -0.0065 0.0574  518 GLU A CG  
623  C CD  . GLU A 76 ? 0.5628 0.4276 0.5954 -0.0089 -0.0067 0.0717  518 GLU A CD  
624  O OE1 . GLU A 76 ? 0.5670 0.4354 0.5966 0.0033  -0.0087 0.0774  518 GLU A OE1 
625  O OE2 . GLU A 76 ? 0.6033 0.4484 0.6423 -0.0182 -0.0055 0.0781  518 GLU A OE2 
626  N N   . ASN A 77 ? 0.4198 0.3083 0.4427 -0.0072 -0.0083 0.0073  519 ASN A N   
627  C CA  . ASN A 77 ? 0.4324 0.3134 0.4533 -0.0018 -0.0063 -0.0067 519 ASN A CA  
628  C C   . ASN A 77 ? 0.4379 0.3156 0.4653 0.0125  -0.0042 -0.0038 519 ASN A C   
629  O O   . ASN A 77 ? 0.4409 0.3039 0.4755 0.0171  -0.0046 0.0055  519 ASN A O   
630  C CB  . ASN A 77 ? 0.4634 0.3211 0.4840 -0.0098 -0.0060 -0.0173 519 ASN A CB  
631  C CG  . ASN A 77 ? 0.4849 0.3360 0.4996 -0.0053 -0.0024 -0.0345 519 ASN A CG  
632  O OD1 . ASN A 77 ? 0.4894 0.3582 0.4956 -0.0055 -0.0018 -0.0408 519 ASN A OD1 
633  N ND2 . ASN A 77 ? 0.5246 0.3491 0.5434 -0.0008 0.0010  -0.0418 519 ASN A ND2 
634  N N   . GLY A 78 ? 0.4273 0.3205 0.4536 0.0192  -0.0024 -0.0100 520 GLY A N   
635  C CA  . GLY A 78 ? 0.4356 0.3324 0.4715 0.0326  -0.0008 -0.0080 520 GLY A CA  
636  C C   . GLY A 78 ? 0.4247 0.3422 0.4626 0.0369  -0.0050 0.0036  520 GLY A C   
637  O O   . GLY A 78 ? 0.4291 0.3567 0.4764 0.0468  -0.0054 0.0053  520 GLY A O   
638  N N   . ASP A 79 ? 0.4176 0.3429 0.4473 0.0294  -0.0081 0.0108  521 ASP A N   
639  C CA  . ASP A 79 ? 0.4064 0.3493 0.4334 0.0318  -0.0120 0.0197  521 ASP A CA  
640  C C   . ASP A 79 ? 0.3953 0.3567 0.4217 0.0324  -0.0120 0.0123  521 ASP A C   
641  O O   . ASP A 79 ? 0.3876 0.3494 0.4135 0.0297  -0.0083 0.0023  521 ASP A O   
642  C CB  . ASP A 79 ? 0.3991 0.3450 0.4166 0.0242  -0.0129 0.0271  521 ASP A CB  
643  C CG  . ASP A 79 ? 0.4187 0.3518 0.4371 0.0238  -0.0134 0.0400  521 ASP A CG  
644  O OD1 . ASP A 79 ? 0.4567 0.3761 0.4831 0.0303  -0.0143 0.0443  521 ASP A OD1 
645  O OD2 . ASP A 79 ? 0.4345 0.3712 0.4466 0.0171  -0.0122 0.0466  521 ASP A OD2 
646  N N   . CYS A 80 ? 0.3983 0.3746 0.4236 0.0347  -0.0164 0.0177  522 CYS A N   
647  C CA  . CYS A 80 ? 0.3981 0.3912 0.4246 0.0336  -0.0174 0.0118  522 CYS A CA  
648  C C   . CYS A 80 ? 0.3843 0.3824 0.3980 0.0266  -0.0187 0.0114  522 CYS A C   
649  O O   . CYS A 80 ? 0.3924 0.3914 0.3980 0.0263  -0.0212 0.0179  522 CYS A O   
650  C CB  . CYS A 80 ? 0.3992 0.4066 0.4363 0.0410  -0.0227 0.0166  522 CYS A CB  
651  S SG  . CYS A 80 ? 0.4706 0.5012 0.5126 0.0368  -0.0252 0.0100  522 CYS A SG  
652  N N   . LEU A 81 ? 0.3651 0.3658 0.3766 0.0216  -0.0161 0.0040  523 LEU A N   
653  C CA  . LEU A 81 ? 0.3563 0.3591 0.3581 0.0167  -0.0167 0.0024  523 LEU A CA  
654  C C   . LEU A 81 ? 0.3509 0.3646 0.3540 0.0147  -0.0200 -0.0012 523 LEU A C   
655  O O   . LEU A 81 ? 0.3535 0.3725 0.3647 0.0128  -0.0186 -0.0052 523 LEU A O   
656  C CB  . LEU A 81 ? 0.3481 0.3442 0.3469 0.0124  -0.0127 -0.0013 523 LEU A CB  
657  C CG  . LEU A 81 ? 0.3765 0.3713 0.3676 0.0099  -0.0121 -0.0017 523 LEU A CG  
658  C CD1 . LEU A 81 ? 0.3653 0.3593 0.3524 0.0115  -0.0113 0.0035  523 LEU A CD1 
659  C CD2 . LEU A 81 ? 0.4037 0.3945 0.3945 0.0068  -0.0100 -0.0036 523 LEU A CD2 
660  N N   . LEU A 82 ? 0.3444 0.3623 0.3391 0.0139  -0.0240 -0.0004 524 LEU A N   
661  C CA  . LEU A 82 ? 0.3456 0.3733 0.3409 0.0098  -0.0287 -0.0052 524 LEU A CA  
662  C C   . LEU A 82 ? 0.3438 0.3628 0.3302 0.0041  -0.0264 -0.0120 524 LEU A C   
663  O O   . LEU A 82 ? 0.3544 0.3661 0.3292 0.0054  -0.0241 -0.0125 524 LEU A O   
664  C CB  . LEU A 82 ? 0.3550 0.3938 0.3449 0.0117  -0.0365 -0.0016 524 LEU A CB  
665  C CG  . LEU A 82 ? 0.3688 0.4172 0.3708 0.0188  -0.0406 0.0069  524 LEU A CG  
666  C CD1 . LEU A 82 ? 0.3938 0.4324 0.3892 0.0243  -0.0386 0.0161  524 LEU A CD1 
667  C CD2 . LEU A 82 ? 0.4384 0.5057 0.4415 0.0180  -0.0510 0.0083  524 LEU A CD2 
668  N N   . VAL A 83 ? 0.3335 0.3533 0.3265 -0.0018 -0.0261 -0.0166 525 VAL A N   
669  C CA  . VAL A 83 ? 0.3342 0.3410 0.3214 -0.0066 -0.0232 -0.0215 525 VAL A CA  
670  C C   . VAL A 83 ? 0.3412 0.3499 0.3270 -0.0144 -0.0282 -0.0286 525 VAL A C   
671  O O   . VAL A 83 ? 0.3366 0.3561 0.3340 -0.0202 -0.0308 -0.0291 525 VAL A O   
672  C CB  . VAL A 83 ? 0.3286 0.3304 0.3228 -0.0089 -0.0181 -0.0193 525 VAL A CB  
673  C CG1 . VAL A 83 ? 0.3276 0.3136 0.3164 -0.0122 -0.0157 -0.0214 525 VAL A CG1 
674  C CG2 . VAL A 83 ? 0.3105 0.3117 0.3055 -0.0032 -0.0147 -0.0144 525 VAL A CG2 
675  N N   . ARG A 84 ? 0.3560 0.3552 0.3282 -0.0149 -0.0290 -0.0349 526 ARG A N   
676  C CA  . ARG A 84 ? 0.3797 0.3759 0.3476 -0.0240 -0.0340 -0.0446 526 ARG A CA  
677  C C   . ARG A 84 ? 0.3967 0.3690 0.3593 -0.0266 -0.0292 -0.0510 526 ARG A C   
678  O O   . ARG A 84 ? 0.3978 0.3583 0.3563 -0.0188 -0.0227 -0.0487 526 ARG A O   
679  C CB  . ARG A 84 ? 0.3926 0.3973 0.3458 -0.0234 -0.0403 -0.0495 526 ARG A CB  
680  C CG  . ARG A 84 ? 0.3904 0.4188 0.3501 -0.0211 -0.0475 -0.0417 526 ARG A CG  
681  C CD  . ARG A 84 ? 0.4237 0.4610 0.3655 -0.0215 -0.0550 -0.0451 526 ARG A CD  
682  N NE  . ARG A 84 ? 0.4250 0.4854 0.3739 -0.0184 -0.0636 -0.0355 526 ARG A NE  
683  C CZ  . ARG A 84 ? 0.3791 0.4438 0.3282 -0.0086 -0.0619 -0.0234 526 ARG A CZ  
684  N NH1 . ARG A 84 ? 0.3930 0.4430 0.3362 -0.0027 -0.0520 -0.0200 526 ARG A NH1 
685  N NH2 . ARG A 84 ? 0.3625 0.4462 0.3195 -0.0049 -0.0705 -0.0141 526 ARG A NH2 
686  N N   . TRP A 85 ? 0.4229 0.3882 0.3879 -0.0376 -0.0326 -0.0583 527 TRP A N   
687  C CA  . TRP A 85 ? 0.4513 0.3891 0.4112 -0.0406 -0.0288 -0.0654 527 TRP A CA  
688  C C   . TRP A 85 ? 0.4878 0.4186 0.4450 -0.0543 -0.0352 -0.0777 527 TRP A C   
689  O O   . TRP A 85 ? 0.5186 0.4224 0.4695 -0.0572 -0.0327 -0.0866 527 TRP A O   
690  C CB  . TRP A 85 ? 0.4437 0.3699 0.4148 -0.0406 -0.0230 -0.0558 527 TRP A CB  
691  C CG  . TRP A 85 ? 0.4273 0.3635 0.4132 -0.0521 -0.0247 -0.0502 527 TRP A CG  
692  C CD1 . TRP A 85 ? 0.4307 0.3544 0.4227 -0.0654 -0.0255 -0.0525 527 TRP A CD1 
693  C CD2 . TRP A 85 ? 0.3841 0.3446 0.3813 -0.0513 -0.0241 -0.0412 527 TRP A CD2 
694  N NE1 . TRP A 85 ? 0.4169 0.3592 0.4238 -0.0734 -0.0250 -0.0446 527 TRP A NE1 
695  C CE2 . TRP A 85 ? 0.3919 0.3570 0.4018 -0.0640 -0.0237 -0.0385 527 TRP A CE2 
696  C CE3 . TRP A 85 ? 0.3497 0.3272 0.3478 -0.0414 -0.0232 -0.0358 527 TRP A CE3 
697  C CZ2 . TRP A 85 ? 0.3479 0.3368 0.3713 -0.0655 -0.0213 -0.0313 527 TRP A CZ2 
698  C CZ3 . TRP A 85 ? 0.3119 0.3086 0.3227 -0.0426 -0.0216 -0.0297 527 TRP A CZ3 
699  C CH2 . TRP A 85 ? 0.2960 0.2996 0.3192 -0.0538 -0.0201 -0.0279 527 TRP A CH2 
700  O OXT . TRP A 85 ? 0.4968 0.4486 0.4592 -0.0627 -0.0434 -0.0792 527 TRP A OXT 
701  N N   . GLN B 2  ? 0.6004 0.5129 0.5839 0.0664  -0.0460 -0.0089 444 GLN B N   
702  C CA  . GLN B 2  ? 0.6128 0.5027 0.6058 0.0748  -0.0445 -0.0233 444 GLN B CA  
703  C C   . GLN B 2  ? 0.5939 0.4706 0.5807 0.0585  -0.0387 -0.0339 444 GLN B C   
704  O O   . GLN B 2  ? 0.5707 0.4689 0.5508 0.0474  -0.0341 -0.0393 444 GLN B O   
705  C CB  . GLN B 2  ? 0.6543 0.5070 0.6543 0.0886  -0.0507 -0.0135 444 GLN B CB  
706  C CG  . GLN B 2  ? 0.6895 0.5244 0.7027 0.1048  -0.0511 -0.0318 444 GLN B CG  
707  C CD  . GLN B 2  ? 0.7349 0.6091 0.7584 0.1216  -0.0501 -0.0451 444 GLN B CD  
708  O OE1 . GLN B 2  ? 0.7737 0.6786 0.8012 0.1297  -0.0539 -0.0355 444 GLN B OE1 
709  N NE2 . GLN B 2  ? 0.7098 0.5877 0.7381 0.1262  -0.0449 -0.0680 444 GLN B NE2 
710  N N   . LEU B 3  ? 0.6033 0.4445 0.5932 0.0570  -0.0399 -0.0367 445 LEU B N   
711  C CA  . LEU B 3  ? 0.5844 0.4169 0.5704 0.0429  -0.0367 -0.0484 445 LEU B CA  
712  C C   . LEU B 3  ? 0.5699 0.3993 0.5498 0.0252  -0.0353 -0.0351 445 LEU B C   
713  O O   . LEU B 3  ? 0.5943 0.4011 0.5766 0.0206  -0.0371 -0.0212 445 LEU B O   
714  C CB  . LEU B 3  ? 0.6094 0.4095 0.6037 0.0479  -0.0392 -0.0624 445 LEU B CB  
715  C CG  . LEU B 3  ? 0.6023 0.4043 0.5932 0.0396  -0.0375 -0.0830 445 LEU B CG  
716  C CD1 . LEU B 3  ? 0.5385 0.3767 0.5209 0.0436  -0.0327 -0.0941 445 LEU B CD1 
717  C CD2 . LEU B 3  ? 0.6305 0.4001 0.6303 0.0460  -0.0412 -0.1003 445 LEU B CD2 
718  N N   . LEU B 4  ? 0.5340 0.3868 0.5065 0.0156  -0.0314 -0.0388 446 LEU B N   
719  C CA  . LEU B 4  ? 0.5140 0.3719 0.4818 0.0016  -0.0291 -0.0291 446 LEU B CA  
720  C C   . LEU B 4  ? 0.5130 0.3643 0.4840 -0.0092 -0.0285 -0.0386 446 LEU B C   
721  O O   . LEU B 4  ? 0.5029 0.3636 0.4713 -0.0081 -0.0284 -0.0521 446 LEU B O   
722  C CB  . LEU B 4  ? 0.4822 0.3685 0.4418 -0.0004 -0.0261 -0.0280 446 LEU B CB  
723  C CG  . LEU B 4  ? 0.4716 0.3759 0.4290 0.0082  -0.0274 -0.0244 446 LEU B CG  
724  C CD1 . LEU B 4  ? 0.3845 0.3117 0.3360 0.0023  -0.0242 -0.0294 446 LEU B CD1 
725  C CD2 . LEU B 4  ? 0.4617 0.3640 0.4169 0.0113  -0.0306 -0.0076 446 LEU B CD2 
726  N N   . THR B 5  ? 0.5231 0.3612 0.4998 -0.0201 -0.0283 -0.0303 447 THR B N   
727  C CA  . THR B 5  ? 0.5212 0.3617 0.5043 -0.0328 -0.0281 -0.0380 447 THR B CA  
728  C C   . THR B 5  ? 0.4984 0.3672 0.4768 -0.0377 -0.0241 -0.0354 447 THR B C   
729  O O   . THR B 5  ? 0.5038 0.3814 0.4810 -0.0435 -0.0199 -0.0228 447 THR B O   
730  C CB  . THR B 5  ? 0.5457 0.3630 0.5406 -0.0454 -0.0284 -0.0301 447 THR B CB  
731  O OG1 . THR B 5  ? 0.5774 0.3627 0.5783 -0.0394 -0.0331 -0.0374 447 THR B OG1 
732  C CG2 . THR B 5  ? 0.5401 0.3689 0.5454 -0.0607 -0.0282 -0.0381 447 THR B CG2 
733  N N   . LEU B 6  ? 0.4828 0.3656 0.4575 -0.0342 -0.0252 -0.0473 448 LEU B N   
734  C CA  . LEU B 6  ? 0.4612 0.3660 0.4328 -0.0355 -0.0225 -0.0468 448 LEU B CA  
735  C C   . LEU B 6  ? 0.4601 0.3757 0.4399 -0.0406 -0.0253 -0.0553 448 LEU B C   
736  O O   . LEU B 6  ? 0.4719 0.3843 0.4519 -0.0389 -0.0305 -0.0660 448 LEU B O   
737  C CB  . LEU B 6  ? 0.4498 0.3613 0.4102 -0.0264 -0.0218 -0.0499 448 LEU B CB  
738  C CG  . LEU B 6  ? 0.4478 0.3586 0.4019 -0.0213 -0.0199 -0.0442 448 LEU B CG  
739  C CD1 . LEU B 6  ? 0.4386 0.3571 0.3853 -0.0169 -0.0187 -0.0488 448 LEU B CD1 
740  C CD2 . LEU B 6  ? 0.4229 0.3415 0.3755 -0.0249 -0.0170 -0.0343 448 LEU B CD2 
741  N N   . LYS B 7  ? 0.4501 0.3833 0.4365 -0.0457 -0.0220 -0.0516 449 LYS B N   
742  C CA  . LYS B 7  ? 0.4469 0.3986 0.4449 -0.0492 -0.0249 -0.0589 449 LYS B CA  
743  C C   . LYS B 7  ? 0.4347 0.3985 0.4252 -0.0375 -0.0263 -0.0625 449 LYS B C   
744  O O   . LYS B 7  ? 0.4378 0.4006 0.4198 -0.0318 -0.0218 -0.0582 449 LYS B O   
745  C CB  . LYS B 7  ? 0.4515 0.4202 0.4637 -0.0606 -0.0192 -0.0528 449 LYS B CB  
746  C CG  . LYS B 7  ? 0.4798 0.4312 0.4939 -0.0717 -0.0150 -0.0413 449 LYS B CG  
747  C CD  . LYS B 7  ? 0.5334 0.5044 0.5628 -0.0868 -0.0084 -0.0342 449 LYS B CD  
748  C CE  . LYS B 7  ? 0.5540 0.5029 0.5831 -0.0985 -0.0044 -0.0184 449 LYS B CE  
749  N NZ  . LYS B 7  ? 0.5811 0.5394 0.6316 -0.1194 -0.0008 -0.0149 449 LYS B NZ  
750  N N   . ILE B 8  ? 0.4283 0.4025 0.4219 -0.0338 -0.0332 -0.0702 450 ILE B N   
751  C CA  . ILE B 8  ? 0.4198 0.3977 0.4034 -0.0211 -0.0358 -0.0703 450 ILE B CA  
752  C C   . ILE B 8  ? 0.4199 0.4224 0.4165 -0.0159 -0.0385 -0.0728 450 ILE B C   
753  O O   . ILE B 8  ? 0.4284 0.4511 0.4411 -0.0218 -0.0426 -0.0783 450 ILE B O   
754  C CB  . ILE B 8  ? 0.4297 0.3986 0.3988 -0.0161 -0.0416 -0.0737 450 ILE B CB  
755  C CG1 . ILE B 8  ? 0.4051 0.3543 0.3628 -0.0170 -0.0366 -0.0709 450 ILE B CG1 
756  C CG2 . ILE B 8  ? 0.4260 0.3992 0.3848 -0.0041 -0.0453 -0.0702 450 ILE B CG2 
757  C CD1 . ILE B 8  ? 0.4454 0.3892 0.3934 -0.0155 -0.0400 -0.0776 450 ILE B CD1 
758  N N   . LYS B 9  ? 0.4152 0.4163 0.4070 -0.0048 -0.0362 -0.0697 451 LYS B N   
759  C CA  . LYS B 9  ? 0.4117 0.4353 0.4175 0.0044  -0.0379 -0.0727 451 LYS B CA  
760  C C   . LYS B 9  ? 0.4184 0.4304 0.4134 0.0207  -0.0428 -0.0692 451 LYS B C   
761  O O   . LYS B 9  ? 0.4202 0.4060 0.3992 0.0226  -0.0395 -0.0641 451 LYS B O   
762  C CB  . LYS B 9  ? 0.4103 0.4435 0.4246 0.0023  -0.0278 -0.0737 451 LYS B CB  
763  C CG  . LYS B 9  ? 0.4237 0.4899 0.4586 0.0105  -0.0273 -0.0799 451 LYS B CG  
764  C CD  . LYS B 9  ? 0.4663 0.5395 0.5029 0.0119  -0.0161 -0.0827 451 LYS B CD  
765  C CE  . LYS B 9  ? 0.5021 0.6186 0.5624 0.0097  -0.0107 -0.0884 451 LYS B CE  
766  N NZ  . LYS B 9  ? 0.5202 0.6476 0.5777 0.0072  0.0022  -0.0908 451 LYS B NZ  
767  N N   . TYR B 10 ? 0.4280 0.4600 0.4326 0.0320  -0.0513 -0.0709 452 TYR B N   
768  C CA  . TYR B 10 ? 0.4460 0.4664 0.4427 0.0505  -0.0567 -0.0648 452 TYR B CA  
769  C C   . TYR B 10 ? 0.4503 0.4870 0.4663 0.0647  -0.0553 -0.0700 452 TYR B C   
770  O O   . TYR B 10 ? 0.4568 0.5228 0.4887 0.0758  -0.0635 -0.0729 452 TYR B O   
771  C CB  . TYR B 10 ? 0.4597 0.4903 0.4487 0.0576  -0.0697 -0.0607 452 TYR B CB  
772  C CG  . TYR B 10 ? 0.4543 0.4800 0.4272 0.0450  -0.0718 -0.0609 452 TYR B CG  
773  C CD1 . TYR B 10 ? 0.4532 0.5042 0.4271 0.0446  -0.0832 -0.0662 452 TYR B CD1 
774  C CD2 . TYR B 10 ? 0.4512 0.4503 0.4090 0.0349  -0.0632 -0.0580 452 TYR B CD2 
775  C CE1 . TYR B 10 ? 0.4731 0.5199 0.4318 0.0348  -0.0850 -0.0704 452 TYR B CE1 
776  C CE2 . TYR B 10 ? 0.4756 0.4724 0.4204 0.0264  -0.0646 -0.0607 452 TYR B CE2 
777  C CZ  . TYR B 10 ? 0.4794 0.4984 0.4240 0.0266  -0.0751 -0.0677 452 TYR B CZ  
778  O OH  . TYR B 10 ? 0.4619 0.4787 0.3932 0.0195  -0.0762 -0.0741 452 TYR B OH  
779  N N   . PRO B 11 ? 0.4507 0.4715 0.4662 0.0656  -0.0454 -0.0732 453 PRO B N   
780  C CA  . PRO B 11 ? 0.4543 0.4950 0.4891 0.0776  -0.0412 -0.0830 453 PRO B CA  
781  C C   . PRO B 11 ? 0.4818 0.5241 0.5256 0.1032  -0.0499 -0.0824 453 PRO B C   
782  O O   . PRO B 11 ? 0.4815 0.5527 0.5472 0.1158  -0.0483 -0.0925 453 PRO B O   
783  C CB  . PRO B 11 ? 0.4534 0.4687 0.4778 0.0733  -0.0305 -0.0873 453 PRO B CB  
784  C CG  . PRO B 11 ? 0.4605 0.4375 0.4622 0.0657  -0.0323 -0.0771 453 PRO B CG  
785  C CD  . PRO B 11 ? 0.4467 0.4339 0.4439 0.0559  -0.0381 -0.0700 453 PRO B CD  
786  N N   . HIS B 12 ? 0.5063 0.5195 0.5335 0.1116  -0.0587 -0.0699 454 HIS B N   
787  C CA  . HIS B 12 ? 0.5452 0.5554 0.5785 0.1378  -0.0687 -0.0650 454 HIS B CA  
788  C C   . HIS B 12 ? 0.5476 0.6019 0.5942 0.1461  -0.0819 -0.0635 454 HIS B C   
789  O O   . HIS B 12 ? 0.5661 0.6330 0.6254 0.1705  -0.0912 -0.0620 454 HIS B O   
790  C CB  . HIS B 12 ? 0.5742 0.5317 0.5834 0.1439  -0.0718 -0.0491 454 HIS B CB  
791  C CG  . HIS B 12 ? 0.5865 0.5355 0.5718 0.1312  -0.0763 -0.0346 454 HIS B CG  
792  N ND1 . HIS B 12 ? 0.6128 0.5613 0.5873 0.1074  -0.0689 -0.0371 454 HIS B ND1 
793  C CD2 . HIS B 12 ? 0.6219 0.5639 0.5907 0.1404  -0.0871 -0.0177 454 HIS B CD2 
794  C CE1 . HIS B 12 ? 0.6186 0.5621 0.5728 0.1027  -0.0742 -0.0250 454 HIS B CE1 
795  N NE2 . HIS B 12 ? 0.6357 0.5762 0.5842 0.1215  -0.0849 -0.0126 454 HIS B NE2 
796  N N   . GLN B 13 ? 0.5306 0.6086 0.5756 0.1263  -0.0833 -0.0655 455 GLN B N   
797  C CA  . GLN B 13 ? 0.5307 0.6539 0.5889 0.1289  -0.0964 -0.0679 455 GLN B CA  
798  C C   . GLN B 13 ? 0.5139 0.6856 0.6030 0.1161  -0.0914 -0.0834 455 GLN B C   
799  O O   . GLN B 13 ? 0.5173 0.7348 0.6319 0.1266  -0.0996 -0.0898 455 GLN B O   
800  C CB  . GLN B 13 ? 0.5251 0.6405 0.5594 0.1154  -0.1032 -0.0613 455 GLN B CB  
801  C CG  . GLN B 13 ? 0.5422 0.6153 0.5439 0.1239  -0.1063 -0.0437 455 GLN B CG  
802  C CD  . GLN B 13 ? 0.5123 0.5909 0.4912 0.1146  -0.1140 -0.0394 455 GLN B CD  
803  O OE1 . GLN B 13 ? 0.5055 0.5999 0.4877 0.0957  -0.1122 -0.0511 455 GLN B OE1 
804  N NE2 . GLN B 13 ? 0.4994 0.5641 0.4543 0.1283  -0.1226 -0.0226 455 GLN B NE2 
805  N N   . LEU B 14 ? 0.5028 0.6660 0.5900 0.0929  -0.0783 -0.0879 456 LEU B N   
806  C CA  . LEU B 14 ? 0.4930 0.6965 0.6061 0.0756  -0.0716 -0.0984 456 LEU B CA  
807  C C   . LEU B 14 ? 0.4843 0.6699 0.5920 0.0611  -0.0543 -0.0992 456 LEU B C   
808  O O   . LEU B 14 ? 0.4832 0.6266 0.5660 0.0561  -0.0500 -0.0929 456 LEU B O   
809  C CB  . LEU B 14 ? 0.4870 0.7062 0.6023 0.0560  -0.0796 -0.1011 456 LEU B CB  
810  C CG  . LEU B 14 ? 0.4819 0.7480 0.6289 0.0367  -0.0777 -0.1114 456 LEU B CG  
811  C CD1 . LEU B 14 ? 0.4652 0.7885 0.6450 0.0516  -0.0851 -0.1192 456 LEU B CD1 
812  C CD2 . LEU B 14 ? 0.4737 0.7362 0.6155 0.0164  -0.0860 -0.1152 456 LEU B CD2 
813  N N   . ASP B 15 ? 0.4848 0.7075 0.6161 0.0543  -0.0446 -0.1067 457 ASP B N   
814  C CA  . ASP B 15 ? 0.4839 0.6992 0.6098 0.0416  -0.0283 -0.1068 457 ASP B CA  
815  C C   . ASP B 15 ? 0.4743 0.6903 0.5999 0.0125  -0.0233 -0.1019 457 ASP B C   
816  O O   . ASP B 15 ? 0.4784 0.7003 0.6038 -0.0005 -0.0101 -0.0996 457 ASP B O   
817  C CB  . ASP B 15 ? 0.4871 0.7449 0.6362 0.0516  -0.0186 -0.1169 457 ASP B CB  
818  C CG  . ASP B 15 ? 0.5100 0.7607 0.6471 0.0437  -0.0022 -0.1178 457 ASP B CG  
819  O OD1 . ASP B 15 ? 0.5326 0.7388 0.6426 0.0416  -0.0009 -0.1128 457 ASP B OD1 
820  O OD2 . ASP B 15 ? 0.5674 0.8617 0.7225 0.0395  0.0094  -0.1238 457 ASP B OD2 
821  N N   . GLN B 16 ? 0.4661 0.6746 0.5902 0.0032  -0.0340 -0.1002 458 GLN B N   
822  C CA  . GLN B 16 ? 0.4581 0.6595 0.5833 -0.0227 -0.0312 -0.0970 458 GLN B CA  
823  C C   . GLN B 16 ? 0.4547 0.6078 0.5520 -0.0249 -0.0359 -0.0916 458 GLN B C   
824  O O   . GLN B 16 ? 0.4517 0.5867 0.5328 -0.0096 -0.0441 -0.0912 458 GLN B O   
825  C CB  . GLN B 16 ? 0.4621 0.6994 0.6140 -0.0347 -0.0398 -0.1047 458 GLN B CB  
826  C CG  . GLN B 16 ? 0.4787 0.7746 0.6638 -0.0300 -0.0380 -0.1121 458 GLN B CG  
827  C CD  . GLN B 16 ? 0.5162 0.8395 0.7210 -0.0519 -0.0224 -0.1097 458 GLN B CD  
828  O OE1 . GLN B 16 ? 0.5460 0.8438 0.7345 -0.0618 -0.0101 -0.1000 458 GLN B OE1 
829  N NE2 . GLN B 16 ? 0.5307 0.9100 0.7713 -0.0601 -0.0228 -0.1175 458 GLN B NE2 
830  N N   . LYS B 17 ? 0.4484 0.5820 0.5410 -0.0436 -0.0304 -0.0866 459 LYS B N   
831  C CA  . LYS B 17 ? 0.4500 0.5440 0.5214 -0.0459 -0.0349 -0.0841 459 LYS B CA  
832  C C   . LYS B 17 ? 0.4545 0.5523 0.5287 -0.0469 -0.0484 -0.0936 459 LYS B C   
833  O O   . LYS B 17 ? 0.4542 0.5780 0.5504 -0.0584 -0.0531 -0.1014 459 LYS B O   
834  C CB  . LYS B 17 ? 0.4531 0.5246 0.5202 -0.0620 -0.0264 -0.0758 459 LYS B CB  
835  C CG  . LYS B 17 ? 0.4559 0.5179 0.5084 -0.0562 -0.0162 -0.0667 459 LYS B CG  
836  C CD  . LYS B 17 ? 0.5032 0.5664 0.5594 -0.0721 -0.0060 -0.0560 459 LYS B CD  
837  C CE  . LYS B 17 ? 0.5192 0.5822 0.5594 -0.0651 0.0028  -0.0495 459 LYS B CE  
838  N NZ  . LYS B 17 ? 0.5279 0.5965 0.5675 -0.0796 0.0129  -0.0361 459 LYS B NZ  
839  N N   . VAL B 18 ? 0.4560 0.5312 0.5075 -0.0354 -0.0543 -0.0935 460 VAL B N   
840  C CA  . VAL B 18 ? 0.4630 0.5459 0.5096 -0.0311 -0.0674 -0.1022 460 VAL B CA  
841  C C   . VAL B 18 ? 0.4739 0.5333 0.5113 -0.0421 -0.0699 -0.1092 460 VAL B C   
842  O O   . VAL B 18 ? 0.4797 0.5520 0.5231 -0.0480 -0.0799 -0.1222 460 VAL B O   
843  C CB  . VAL B 18 ? 0.4648 0.5432 0.4912 -0.0101 -0.0719 -0.0961 460 VAL B CB  
844  C CG1 . VAL B 18 ? 0.4850 0.5623 0.4938 -0.0059 -0.0828 -0.1012 460 VAL B CG1 
845  C CG2 . VAL B 18 ? 0.4649 0.5728 0.5065 0.0029  -0.0753 -0.0949 460 VAL B CG2 
846  N N   . LEU B 19 ? 0.4754 0.5024 0.4999 -0.0438 -0.0615 -0.1026 461 LEU B N   
847  C CA  . LEU B 19 ? 0.4936 0.4957 0.5108 -0.0505 -0.0628 -0.1097 461 LEU B CA  
848  C C   . LEU B 19 ? 0.4954 0.4682 0.5065 -0.0521 -0.0527 -0.0993 461 LEU B C   
849  O O   . LEU B 19 ? 0.4811 0.4546 0.4896 -0.0482 -0.0454 -0.0875 461 LEU B O   
850  C CB  . LEU B 19 ? 0.4999 0.5015 0.4957 -0.0390 -0.0700 -0.1171 461 LEU B CB  
851  C CG  . LEU B 19 ? 0.5112 0.5006 0.4840 -0.0254 -0.0647 -0.1063 461 LEU B CG  
852  C CD1 . LEU B 19 ? 0.5556 0.5260 0.5147 -0.0245 -0.0629 -0.1129 461 LEU B CD1 
853  C CD2 . LEU B 19 ? 0.5210 0.5286 0.4813 -0.0130 -0.0711 -0.1028 461 LEU B CD2 
854  N N   . GLU B 20 ? 0.5183 0.4666 0.5274 -0.0567 -0.0534 -0.1051 462 GLU B N   
855  C CA  . GLU B 20 ? 0.5283 0.4496 0.5322 -0.0557 -0.0462 -0.0955 462 GLU B CA  
856  C C   . GLU B 20 ? 0.5365 0.4422 0.5252 -0.0449 -0.0478 -0.1031 462 GLU B C   
857  O O   . GLU B 20 ? 0.5500 0.4542 0.5373 -0.0449 -0.0541 -0.1193 462 GLU B O   
858  C CB  . GLU B 20 ? 0.5488 0.4517 0.5695 -0.0707 -0.0446 -0.0928 462 GLU B CB  
859  C CG  . GLU B 20 ? 0.5688 0.4799 0.5978 -0.0792 -0.0366 -0.0756 462 GLU B CG  
860  C CD  . GLU B 20 ? 0.6364 0.5260 0.6795 -0.0956 -0.0339 -0.0683 462 GLU B CD  
861  O OE1 . GLU B 20 ? 0.6741 0.5296 0.7146 -0.0938 -0.0358 -0.0687 462 GLU B OE1 
862  O OE2 . GLU B 20 ? 0.6629 0.5700 0.7207 -0.1102 -0.0294 -0.0613 462 GLU B OE2 
863  N N   . LYS B 21 ? 0.5271 0.4252 0.5052 -0.0361 -0.0419 -0.0934 463 LYS B N   
864  C CA  . LYS B 21 ? 0.5371 0.4263 0.5039 -0.0256 -0.0414 -0.0999 463 LYS B CA  
865  C C   . LYS B 21 ? 0.5378 0.4099 0.5069 -0.0216 -0.0370 -0.0908 463 LYS B C   
866  O O   . LYS B 21 ? 0.5301 0.4054 0.4997 -0.0231 -0.0330 -0.0764 463 LYS B O   
867  C CB  . LYS B 21 ? 0.5304 0.4373 0.4808 -0.0171 -0.0395 -0.0982 463 LYS B CB  
868  C CG  . LYS B 21 ? 0.5667 0.4898 0.5083 -0.0157 -0.0456 -0.1083 463 LYS B CG  
869  C CD  . LYS B 21 ? 0.6545 0.5742 0.5921 -0.0134 -0.0497 -0.1272 463 LYS B CD  
870  C CE  . LYS B 21 ? 0.7242 0.6664 0.6463 -0.0099 -0.0556 -0.1353 463 LYS B CE  
871  N NZ  . LYS B 21 ? 0.7758 0.7198 0.6894 -0.0063 -0.0589 -0.1568 463 LYS B NZ  
872  N N   . GLN B 22 ? 0.5542 0.4100 0.5246 -0.0149 -0.0384 -0.1003 464 GLN B N   
873  C CA  . GLN B 22 ? 0.5597 0.4032 0.5321 -0.0061 -0.0357 -0.0923 464 GLN B CA  
874  C C   . GLN B 22 ? 0.5462 0.4093 0.5085 0.0053  -0.0318 -0.0945 464 GLN B C   
875  O O   . GLN B 22 ? 0.5601 0.4302 0.5167 0.0122  -0.0316 -0.1092 464 GLN B O   
876  C CB  . GLN B 22 ? 0.5924 0.4051 0.5752 -0.0026 -0.0392 -0.1006 464 GLN B CB  
877  C CG  . GLN B 22 ? 0.6232 0.4115 0.6178 -0.0142 -0.0404 -0.0870 464 GLN B CG  
878  C CD  . GLN B 22 ? 0.7021 0.4509 0.7075 -0.0095 -0.0440 -0.0915 464 GLN B CD  
879  O OE1 . GLN B 22 ? 0.7219 0.4551 0.7330 -0.0108 -0.0480 -0.1122 464 GLN B OE1 
880  N NE2 . GLN B 22 ? 0.7014 0.4328 0.7095 -0.0034 -0.0433 -0.0722 464 GLN B NE2 
881  N N   . LEU B 23 ? 0.5196 0.3945 0.4794 0.0057  -0.0283 -0.0807 465 LEU B N   
882  C CA  . LEU B 23 ? 0.4999 0.3956 0.4532 0.0119  -0.0240 -0.0809 465 LEU B CA  
883  C C   . LEU B 23 ? 0.4977 0.3966 0.4578 0.0200  -0.0234 -0.0737 465 LEU B C   
884  O O   . LEU B 23 ? 0.4951 0.3883 0.4581 0.0172  -0.0252 -0.0612 465 LEU B O   
885  C CB  . LEU B 23 ? 0.4781 0.3881 0.4234 0.0039  -0.0213 -0.0738 465 LEU B CB  
886  C CG  . LEU B 23 ? 0.4674 0.3779 0.4069 -0.0016 -0.0235 -0.0781 465 LEU B CG  
887  C CD1 . LEU B 23 ? 0.4368 0.3566 0.3698 -0.0058 -0.0212 -0.0701 465 LEU B CD1 
888  C CD2 . LEU B 23 ? 0.4254 0.3409 0.3572 0.0033  -0.0244 -0.0913 465 LEU B CD2 
889  N N   . PRO B 24 ? 0.4973 0.4098 0.4599 0.0307  -0.0210 -0.0816 466 PRO B N   
890  C CA  . PRO B 24 ? 0.4924 0.4167 0.4638 0.0399  -0.0216 -0.0755 466 PRO B CA  
891  C C   . PRO B 24 ? 0.4688 0.4121 0.4370 0.0307  -0.0201 -0.0647 466 PRO B C   
892  O O   . PRO B 24 ? 0.4622 0.4160 0.4230 0.0210  -0.0158 -0.0660 466 PRO B O   
893  C CB  . PRO B 24 ? 0.4965 0.4417 0.4718 0.0508  -0.0172 -0.0890 466 PRO B CB  
894  C CG  . PRO B 24 ? 0.5019 0.4347 0.4703 0.0511  -0.0163 -0.1035 466 PRO B CG  
895  C CD  . PRO B 24 ? 0.5008 0.4238 0.4584 0.0356  -0.0176 -0.0971 466 PRO B CD  
896  N N   . GLY B 25 ? 0.4632 0.4092 0.4358 0.0340  -0.0242 -0.0541 467 GLY B N   
897  C CA  . GLY B 25 ? 0.4401 0.4048 0.4092 0.0254  -0.0242 -0.0471 467 GLY B CA  
898  C C   . GLY B 25 ? 0.4237 0.4177 0.3965 0.0215  -0.0200 -0.0535 467 GLY B C   
899  O O   . GLY B 25 ? 0.4154 0.4177 0.3837 0.0096  -0.0183 -0.0524 467 GLY B O   
900  N N   . SER B 26 ? 0.4222 0.4317 0.4042 0.0308  -0.0177 -0.0610 468 SER B N   
901  C CA  . SER B 26 ? 0.4138 0.4554 0.4022 0.0255  -0.0119 -0.0664 468 SER B CA  
902  C C   . SER B 26 ? 0.4135 0.4517 0.3918 0.0147  -0.0036 -0.0702 468 SER B C   
903  O O   . SER B 26 ? 0.4064 0.4679 0.3882 0.0062  0.0031  -0.0719 468 SER B O   
904  C CB  . SER B 26 ? 0.4245 0.4923 0.4292 0.0414  -0.0118 -0.0730 468 SER B CB  
905  O OG  . SER B 26 ? 0.4148 0.4661 0.4186 0.0544  -0.0105 -0.0808 468 SER B OG  
906  N N   . MET B 27 ? 0.4158 0.4268 0.3822 0.0145  -0.0042 -0.0705 469 MET B N   
907  C CA  . MET B 27 ? 0.4161 0.4224 0.3697 0.0059  0.0012  -0.0711 469 MET B CA  
908  C C   . MET B 27 ? 0.4100 0.4168 0.3602 -0.0088 0.0035  -0.0638 469 MET B C   
909  O O   . MET B 27 ? 0.3984 0.3935 0.3486 -0.0126 -0.0010 -0.0600 469 MET B O   
910  C CB  . MET B 27 ? 0.4197 0.4001 0.3635 0.0081  -0.0029 -0.0728 469 MET B CB  
911  C CG  . MET B 27 ? 0.4192 0.3988 0.3484 0.0039  0.0005  -0.0740 469 MET B CG  
912  S SD  . MET B 27 ? 0.4705 0.4303 0.3931 0.0085  -0.0063 -0.0817 469 MET B SD  
913  C CE  . MET B 27 ? 0.4436 0.4158 0.3464 0.0068  -0.0025 -0.0832 469 MET B CE  
914  N N   . THR B 28 ? 0.4212 0.4413 0.3685 -0.0172 0.0111  -0.0622 470 THR B N   
915  C CA  . THR B 28 ? 0.4307 0.4443 0.3753 -0.0322 0.0137  -0.0554 470 THR B CA  
916  C C   . THR B 28 ? 0.4437 0.4295 0.3732 -0.0336 0.0120  -0.0498 470 THR B C   
917  O O   . THR B 28 ? 0.4568 0.4368 0.3764 -0.0259 0.0107  -0.0507 470 THR B O   
918  C CB  . THR B 28 ? 0.4427 0.4782 0.3908 -0.0439 0.0234  -0.0526 470 THR B CB  
919  O OG1 . THR B 28 ? 0.4770 0.5156 0.4114 -0.0411 0.0296  -0.0499 470 THR B OG1 
920  C CG2 . THR B 28 ? 0.4292 0.5014 0.3971 -0.0426 0.0250  -0.0594 470 THR B CG2 
921  N N   . ILE B 29 ? 0.4554 0.4255 0.3842 -0.0425 0.0113  -0.0456 471 ILE B N   
922  C CA  . ILE B 29 ? 0.4656 0.4101 0.3838 -0.0412 0.0085  -0.0406 471 ILE B CA  
923  C C   . ILE B 29 ? 0.4810 0.4207 0.3851 -0.0423 0.0125  -0.0314 471 ILE B C   
924  O O   . ILE B 29 ? 0.4874 0.4139 0.3813 -0.0354 0.0083  -0.0277 471 ILE B O   
925  C CB  . ILE B 29 ? 0.4732 0.4013 0.3960 -0.0481 0.0068  -0.0415 471 ILE B CB  
926  C CG1 . ILE B 29 ? 0.4641 0.3905 0.3906 -0.0408 0.0007  -0.0480 471 ILE B CG1 
927  C CG2 . ILE B 29 ? 0.5021 0.4041 0.4161 -0.0498 0.0075  -0.0334 471 ILE B CG2 
928  C CD1 . ILE B 29 ? 0.4458 0.3921 0.3806 -0.0397 -0.0013 -0.0533 471 ILE B CD1 
929  N N   . GLN B 30 ? 0.4963 0.4511 0.3997 -0.0507 0.0207  -0.0270 472 GLN B N   
930  C CA  . GLN B 30 ? 0.5249 0.4799 0.4112 -0.0523 0.0259  -0.0158 472 GLN B CA  
931  C C   . GLN B 30 ? 0.5209 0.4918 0.3965 -0.0397 0.0242  -0.0219 472 GLN B C   
932  O O   . GLN B 30 ? 0.5418 0.5085 0.3991 -0.0355 0.0228  -0.0149 472 GLN B O   
933  C CB  . GLN B 30 ? 0.5449 0.5143 0.4335 -0.0680 0.0373  -0.0076 472 GLN B CB  
934  C CG  . GLN B 30 ? 0.5586 0.5673 0.4589 -0.0685 0.0438  -0.0172 472 GLN B CG  
935  C CD  . GLN B 30 ? 0.6300 0.6614 0.5266 -0.0821 0.0574  -0.0071 472 GLN B CD  
936  O OE1 . GLN B 30 ? 0.6603 0.6733 0.5475 -0.0954 0.0622  0.0094  472 GLN B OE1 
937  N NE2 . GLN B 30 ? 0.6316 0.7035 0.5364 -0.0786 0.0642  -0.0163 472 GLN B NE2 
938  N N   . LYS B 31 ? 0.5027 0.4910 0.3897 -0.0329 0.0231  -0.0356 473 LYS B N   
939  C CA  . LYS B 31 ? 0.4989 0.4970 0.3790 -0.0207 0.0203  -0.0462 473 LYS B CA  
940  C C   . LYS B 31 ? 0.4927 0.4708 0.3717 -0.0136 0.0094  -0.0505 473 LYS B C   
941  O O   . LYS B 31 ? 0.5037 0.4848 0.3725 -0.0068 0.0056  -0.0570 473 LYS B O   
942  C CB  . LYS B 31 ? 0.4878 0.5071 0.3822 -0.0142 0.0230  -0.0593 473 LYS B CB  
943  C CG  . LYS B 31 ? 0.4994 0.5497 0.3976 -0.0201 0.0348  -0.0578 473 LYS B CG  
944  C CD  . LYS B 31 ? 0.5119 0.5798 0.3896 -0.0196 0.0426  -0.0561 473 LYS B CD  
945  C CE  . LYS B 31 ? 0.5350 0.6293 0.4145 -0.0330 0.0562  -0.0463 473 LYS B CE  
946  N NZ  . LYS B 31 ? 0.5745 0.6776 0.4273 -0.0372 0.0636  -0.0354 473 LYS B NZ  
947  N N   . VAL B 32 ? 0.4821 0.4438 0.3721 -0.0160 0.0048  -0.0483 474 VAL B N   
948  C CA  . VAL B 32 ? 0.4724 0.4196 0.3637 -0.0117 -0.0037 -0.0505 474 VAL B CA  
949  C C   . VAL B 32 ? 0.4865 0.4268 0.3637 -0.0106 -0.0065 -0.0420 474 VAL B C   
950  O O   . VAL B 32 ? 0.4883 0.4308 0.3605 -0.0049 -0.0132 -0.0462 474 VAL B O   
951  C CB  . VAL B 32 ? 0.4572 0.3938 0.3618 -0.0145 -0.0060 -0.0497 474 VAL B CB  
952  C CG1 . VAL B 32 ? 0.4426 0.3714 0.3507 -0.0110 -0.0128 -0.0524 474 VAL B CG1 
953  C CG2 . VAL B 32 ? 0.4511 0.3959 0.3673 -0.0143 -0.0046 -0.0544 474 VAL B CG2 
954  N N   . LYS B 33 ? 0.4970 0.4289 0.3689 -0.0162 -0.0022 -0.0299 475 LYS B N   
955  C CA  . LYS B 33 ? 0.5232 0.4455 0.3801 -0.0136 -0.0047 -0.0173 475 LYS B CA  
956  C C   . LYS B 33 ? 0.5479 0.4874 0.3849 -0.0098 -0.0043 -0.0151 475 LYS B C   
957  O O   . LYS B 33 ? 0.5621 0.5015 0.3863 -0.0026 -0.0114 -0.0098 475 LYS B O   
958  C CB  . LYS B 33 ? 0.5370 0.4416 0.3925 -0.0223 0.0013  -0.0037 475 LYS B CB  
959  C CG  . LYS B 33 ? 0.5393 0.4233 0.4092 -0.0234 -0.0012 -0.0063 475 LYS B CG  
960  C CD  . LYS B 33 ? 0.5864 0.4484 0.4557 -0.0335 0.0043  0.0046  475 LYS B CD  
961  C CE  . LYS B 33 ? 0.5870 0.4284 0.4701 -0.0337 0.0017  -0.0027 475 LYS B CE  
962  N NZ  . LYS B 33 ? 0.6267 0.4413 0.5109 -0.0452 0.0066  0.0053  475 LYS B NZ  
963  N N   . GLY B 34 ? 0.5535 0.5115 0.3878 -0.0136 0.0038  -0.0199 476 GLY B N   
964  C CA  . GLY B 34 ? 0.5746 0.5547 0.3888 -0.0097 0.0060  -0.0217 476 GLY B CA  
965  C C   . GLY B 34 ? 0.5765 0.5637 0.3889 0.0001  -0.0044 -0.0379 476 GLY B C   
966  O O   . GLY B 34 ? 0.5997 0.5971 0.3927 0.0054  -0.0098 -0.0362 476 GLY B O   
967  N N   . LEU B 35 ? 0.5584 0.5403 0.3910 0.0015  -0.0077 -0.0529 477 LEU B N   
968  C CA  . LEU B 35 ? 0.5599 0.5426 0.3973 0.0069  -0.0176 -0.0688 477 LEU B CA  
969  C C   . LEU B 35 ? 0.5639 0.5423 0.3982 0.0092  -0.0281 -0.0629 477 LEU B C   
970  O O   . LEU B 35 ? 0.5807 0.5725 0.4046 0.0135  -0.0360 -0.0708 477 LEU B O   
971  C CB  . LEU B 35 ? 0.5375 0.5081 0.3984 0.0057  -0.0183 -0.0788 477 LEU B CB  
972  C CG  . LEU B 35 ? 0.5579 0.5256 0.4272 0.0081  -0.0262 -0.0967 477 LEU B CG  
973  C CD1 . LEU B 35 ? 0.5458 0.5025 0.4325 0.0091  -0.0236 -0.1046 477 LEU B CD1 
974  C CD2 . LEU B 35 ? 0.5394 0.5015 0.4168 0.0052  -0.0356 -0.0952 477 LEU B CD2 
975  N N   . LEU B 36 ? 0.5577 0.5206 0.4020 0.0073  -0.0285 -0.0511 478 LEU B N   
976  C CA  . LEU B 36 ? 0.5662 0.5274 0.4132 0.0121  -0.0381 -0.0465 478 LEU B CA  
977  C C   . LEU B 36 ? 0.5974 0.5652 0.4219 0.0186  -0.0421 -0.0329 478 LEU B C   
978  O O   . LEU B 36 ? 0.6109 0.5892 0.4335 0.0258  -0.0531 -0.0335 478 LEU B O   
979  C CB  . LEU B 36 ? 0.5513 0.4953 0.4150 0.0105  -0.0362 -0.0400 478 LEU B CB  
980  C CG  . LEU B 36 ? 0.5142 0.4542 0.3980 0.0048  -0.0336 -0.0500 478 LEU B CG  
981  C CD1 . LEU B 36 ? 0.4743 0.4001 0.3667 0.0023  -0.0284 -0.0433 478 LEU B CD1 
982  C CD2 . LEU B 36 ? 0.4693 0.4187 0.3667 0.0051  -0.0413 -0.0605 478 LEU B CD2 
983  N N   . SER B 37 ? 0.6133 0.5772 0.4210 0.0157  -0.0333 -0.0194 479 SER B N   
984  C CA  . SER B 37 ? 0.6461 0.6145 0.4280 0.0208  -0.0354 -0.0017 479 SER B CA  
985  C C   . SER B 37 ? 0.6656 0.6635 0.4288 0.0269  -0.0433 -0.0116 479 SER B C   
986  O O   . SER B 37 ? 0.6859 0.6929 0.4358 0.0360  -0.0542 -0.0034 479 SER B O   
987  C CB  . SER B 37 ? 0.6626 0.6240 0.4318 0.0120  -0.0217 0.0141  479 SER B CB  
988  O OG  . SER B 37 ? 0.6891 0.6526 0.4307 0.0155  -0.0226 0.0357  479 SER B OG  
989  N N   . ARG B 38 ? 0.6620 0.6755 0.4247 0.0233  -0.0388 -0.0308 480 ARG B N   
990  C CA  . ARG B 38 ? 0.6817 0.7234 0.4272 0.0282  -0.0458 -0.0468 480 ARG B CA  
991  C C   . ARG B 38 ? 0.6746 0.7226 0.4346 0.0319  -0.0615 -0.0622 480 ARG B C   
992  O O   . ARG B 38 ? 0.6988 0.7708 0.4430 0.0375  -0.0726 -0.0691 480 ARG B O   
993  C CB  . ARG B 38 ? 0.6781 0.7305 0.4242 0.0250  -0.0366 -0.0672 480 ARG B CB  
994  C CG  . ARG B 38 ? 0.6998 0.7569 0.4342 0.0205  -0.0201 -0.0544 480 ARG B CG  
995  C CD  . ARG B 38 ? 0.7274 0.8007 0.4652 0.0211  -0.0114 -0.0771 480 ARG B CD  
996  N NE  . ARG B 38 ? 0.7358 0.7900 0.5055 0.0195  -0.0106 -0.0900 480 ARG B NE  
997  C CZ  . ARG B 38 ? 0.7477 0.7922 0.5341 0.0143  -0.0010 -0.0816 480 ARG B CZ  
998  N NH1 . ARG B 38 ? 0.7374 0.7874 0.5151 0.0077  0.0094  -0.0616 480 ARG B NH1 
999  N NH2 . ARG B 38 ? 0.6956 0.7252 0.5077 0.0148  -0.0024 -0.0924 480 ARG B NH2 
1000 N N   . LEU B 39 ? 0.6471 0.6770 0.4372 0.0278  -0.0623 -0.0673 481 LEU B N   
1001 C CA  . LEU B 39 ? 0.6373 0.6741 0.4473 0.0277  -0.0746 -0.0808 481 LEU B CA  
1002 C C   . LEU B 39 ? 0.6454 0.6900 0.4550 0.0363  -0.0851 -0.0660 481 LEU B C   
1003 O O   . LEU B 39 ? 0.6574 0.7261 0.4690 0.0401  -0.0988 -0.0754 481 LEU B O   
1004 C CB  . LEU B 39 ? 0.6109 0.6273 0.4508 0.0196  -0.0692 -0.0870 481 LEU B CB  
1005 C CG  . LEU B 39 ? 0.6064 0.6270 0.4727 0.0143  -0.0773 -0.1001 481 LEU B CG  
1006 C CD1 . LEU B 39 ? 0.6007 0.6335 0.4684 0.0094  -0.0845 -0.1247 481 LEU B CD1 
1007 C CD2 . LEU B 39 ? 0.5714 0.5704 0.4597 0.0074  -0.0686 -0.0970 481 LEU B CD2 
1008 N N   . LEU B 40 ? 0.6440 0.6688 0.4523 0.0401  -0.0793 -0.0442 482 LEU B N   
1009 C CA  . LEU B 40 ? 0.6486 0.6732 0.4619 0.0511  -0.0880 -0.0301 482 LEU B CA  
1010 C C   . LEU B 40 ? 0.6861 0.7163 0.4694 0.0625  -0.0936 -0.0092 482 LEU B C   
1011 O O   . LEU B 40 ? 0.6993 0.7337 0.4849 0.0757  -0.1043 0.0021  482 LEU B O   
1012 C CB  . LEU B 40 ? 0.6306 0.6256 0.4616 0.0499  -0.0793 -0.0205 482 LEU B CB  
1013 C CG  . LEU B 40 ? 0.5923 0.5850 0.4537 0.0424  -0.0762 -0.0356 482 LEU B CG  
1014 C CD1 . LEU B 40 ? 0.5675 0.5329 0.4388 0.0421  -0.0671 -0.0263 482 LEU B CD1 
1015 C CD2 . LEU B 40 ? 0.5706 0.5891 0.4511 0.0472  -0.0882 -0.0457 482 LEU B CD2 
1016 N N   . LYS B 41 ? 0.7048 0.7367 0.4604 0.0583  -0.0860 -0.0031 483 LYS B N   
1017 C CA  . LYS B 41 ? 0.7466 0.7802 0.4687 0.0661  -0.0874 0.0224  483 LYS B CA  
1018 C C   . LYS B 41 ? 0.7593 0.7566 0.4846 0.0708  -0.0836 0.0493  483 LYS B C   
1019 O O   . LYS B 41 ? 0.7942 0.7886 0.5063 0.0846  -0.0931 0.0702  483 LYS B O   
1020 C CB  . LYS B 41 ? 0.7691 0.8384 0.4736 0.0788  -0.1054 0.0212  483 LYS B CB  
1021 C CG  . LYS B 41 ? 0.7773 0.8815 0.4803 0.0736  -0.1112 -0.0101 483 LYS B CG  
1022 C CD  . LYS B 41 ? 0.8078 0.9146 0.4933 0.0631  -0.0967 -0.0197 483 LYS B CD  
1023 C CE  . LYS B 41 ? 0.8387 0.9716 0.5289 0.0587  -0.1028 -0.0553 483 LYS B CE  
1024 N NZ  . LYS B 41 ? 0.8340 0.9692 0.5125 0.0516  -0.0886 -0.0693 483 LYS B NZ  
1025 N N   . VAL B 42 ? 0.7347 0.7037 0.4780 0.0599  -0.0705 0.0478  484 VAL B N   
1026 C CA  . VAL B 42 ? 0.7488 0.6789 0.4982 0.0610  -0.0653 0.0677  484 VAL B CA  
1027 C C   . VAL B 42 ? 0.7487 0.6617 0.4933 0.0435  -0.0479 0.0733  484 VAL B C   
1028 O O   . VAL B 42 ? 0.7193 0.6419 0.4768 0.0327  -0.0404 0.0543  484 VAL B O   
1029 C CB  . VAL B 42 ? 0.7196 0.6369 0.5028 0.0654  -0.0688 0.0546  484 VAL B CB  
1030 C CG1 . VAL B 42 ? 0.7330 0.6080 0.5253 0.0624  -0.0605 0.0663  484 VAL B CG1 
1031 C CG2 . VAL B 42 ? 0.7278 0.6637 0.5180 0.0839  -0.0855 0.0534  484 VAL B CG2 
1032 N N   . PRO B 43 ? 0.7860 0.6748 0.5132 0.0403  -0.0416 0.1003  485 PRO B N   
1033 C CA  . PRO B 43 ? 0.7904 0.6684 0.5149 0.0211  -0.0246 0.1068  485 PRO B CA  
1034 C C   . PRO B 43 ? 0.7547 0.6189 0.5101 0.0098  -0.0173 0.0885  485 PRO B C   
1035 O O   . PRO B 43 ? 0.7389 0.5852 0.5150 0.0163  -0.0234 0.0801  485 PRO B O   
1036 C CB  . PRO B 43 ? 0.8422 0.6855 0.5504 0.0203  -0.0220 0.1403  485 PRO B CB  
1037 C CG  . PRO B 43 ? 0.8640 0.7151 0.5524 0.0409  -0.0373 0.1543  485 PRO B CG  
1038 C CD  . PRO B 43 ? 0.8304 0.7011 0.5404 0.0543  -0.0505 0.1277  485 PRO B CD  
1039 N N   . VAL B 44 ? 0.7450 0.6224 0.5029 -0.0057 -0.0046 0.0821  486 VAL B N   
1040 C CA  . VAL B 44 ? 0.7156 0.5879 0.5001 -0.0163 0.0015  0.0650  486 VAL B CA  
1041 C C   . VAL B 44 ? 0.7321 0.5647 0.5306 -0.0217 0.0027  0.0726  486 VAL B C   
1042 O O   . VAL B 44 ? 0.7090 0.5337 0.5293 -0.0223 0.0009  0.0564  486 VAL B O   
1043 C CB  . VAL B 44 ? 0.7097 0.6071 0.4939 -0.0307 0.0149  0.0602  486 VAL B CB  
1044 C CG1 . VAL B 44 ? 0.6983 0.5869 0.5078 -0.0440 0.0215  0.0510  486 VAL B CG1 
1045 C CG2 . VAL B 44 ? 0.6885 0.6212 0.4699 -0.0231 0.0126  0.0409  486 VAL B CG2 
1046 N N   . SER B 45 ? 0.7737 0.5804 0.5580 -0.0254 0.0056  0.0972  487 SER B N   
1047 C CA  . SER B 45 ? 0.7968 0.5592 0.5931 -0.0314 0.0071  0.1046  487 SER B CA  
1048 C C   . SER B 45 ? 0.7998 0.5382 0.6062 -0.0120 -0.0054 0.0993  487 SER B C   
1049 O O   . SER B 45 ? 0.8165 0.5217 0.6388 -0.0145 -0.0050 0.0943  487 SER B O   
1050 C CB  . SER B 45 ? 0.8529 0.5904 0.6310 -0.0425 0.0146  0.1353  487 SER B CB  
1051 O OG  . SER B 45 ? 0.8753 0.6142 0.6267 -0.0271 0.0075  0.1566  487 SER B OG  
1052 N N   . ASP B 46 ? 0.7863 0.5446 0.5851 0.0072  -0.0163 0.0979  488 ASP B N   
1053 C CA  . ASP B 46 ? 0.7867 0.5315 0.5977 0.0274  -0.0280 0.0923  488 ASP B CA  
1054 C C   . ASP B 46 ? 0.7382 0.5028 0.5732 0.0298  -0.0300 0.0637  488 ASP B C   
1055 O O   . ASP B 46 ? 0.7388 0.4955 0.5883 0.0441  -0.0366 0.0555  488 ASP B O   
1056 C CB  . ASP B 46 ? 0.8055 0.5653 0.5996 0.0473  -0.0403 0.1058  488 ASP B CB  
1057 C CG  . ASP B 46 ? 0.8783 0.6080 0.6491 0.0512  -0.0411 0.1390  488 ASP B CG  
1058 O OD1 . ASP B 46 ? 0.9023 0.6009 0.6689 0.0345  -0.0302 0.1526  488 ASP B OD1 
1059 O OD2 . ASP B 46 ? 0.9438 0.6820 0.7007 0.0704  -0.0533 0.1527  488 ASP B OD2 
1060 N N   . LEU B 47 ? 0.6977 0.4886 0.5367 0.0167  -0.0238 0.0496  489 LEU B N   
1061 C CA  . LEU B 47 ? 0.6514 0.4629 0.5091 0.0178  -0.0253 0.0266  489 LEU B CA  
1062 C C   . LEU B 47 ? 0.6408 0.4366 0.5150 0.0088  -0.0193 0.0146  489 LEU B C   
1063 O O   . LEU B 47 ? 0.6484 0.4326 0.5215 -0.0063 -0.0116 0.0174  489 LEU B O   
1064 C CB  . LEU B 47 ? 0.6241 0.4690 0.4783 0.0111  -0.0233 0.0175  489 LEU B CB  
1065 C CG  . LEU B 47 ? 0.6139 0.4832 0.4526 0.0180  -0.0294 0.0206  489 LEU B CG  
1066 C CD1 . LEU B 47 ? 0.5574 0.4504 0.3956 0.0095  -0.0246 0.0081  489 LEU B CD1 
1067 C CD2 . LEU B 47 ? 0.5677 0.4499 0.4144 0.0322  -0.0412 0.0141  489 LEU B CD2 
1068 N N   . LEU B 48 ? 0.6230 0.4229 0.5125 0.0174  -0.0230 0.0004  490 LEU B N   
1069 C CA  . LEU B 48 ? 0.6103 0.4038 0.5133 0.0108  -0.0184 -0.0146 490 LEU B CA  
1070 C C   . LEU B 48 ? 0.5720 0.3981 0.4837 0.0097  -0.0185 -0.0286 490 LEU B C   
1071 O O   . LEU B 48 ? 0.5578 0.4008 0.4755 0.0201  -0.0234 -0.0326 490 LEU B O   
1072 C CB  . LEU B 48 ? 0.6374 0.4063 0.5494 0.0232  -0.0212 -0.0194 490 LEU B CB  
1073 C CG  . LEU B 48 ? 0.6951 0.4246 0.5999 0.0300  -0.0236 -0.0029 490 LEU B CG  
1074 C CD1 . LEU B 48 ? 0.7317 0.4451 0.6479 0.0508  -0.0291 -0.0095 490 LEU B CD1 
1075 C CD2 . LEU B 48 ? 0.7376 0.4361 0.6393 0.0114  -0.0164 0.0015  490 LEU B CD2 
1076 N N   . LEU B 49 ? 0.5552 0.3909 0.4685 -0.0033 -0.0134 -0.0346 491 LEU B N   
1077 C CA  . LEU B 49 ? 0.5274 0.3892 0.4469 -0.0051 -0.0134 -0.0436 491 LEU B CA  
1078 C C   . LEU B 49 ? 0.5209 0.3863 0.4483 -0.0082 -0.0107 -0.0558 491 LEU B C   
1079 O O   . LEU B 49 ? 0.5322 0.3847 0.4600 -0.0151 -0.0080 -0.0602 491 LEU B O   
1080 C CB  . LEU B 49 ? 0.5129 0.3877 0.4274 -0.0134 -0.0111 -0.0407 491 LEU B CB  
1081 C CG  . LEU B 49 ? 0.5377 0.4181 0.4421 -0.0108 -0.0128 -0.0328 491 LEU B CG  
1082 C CD1 . LEU B 49 ? 0.5190 0.4166 0.4238 -0.0153 -0.0107 -0.0368 491 LEU B CD1 
1083 C CD2 . LEU B 49 ? 0.5486 0.4350 0.4528 0.0000  -0.0198 -0.0325 491 LEU B CD2 
1084 N N   . SER B 50 ? 0.5009 0.3858 0.4342 -0.0043 -0.0114 -0.0615 492 SER B N   
1085 C CA  . SER B 50 ? 0.5008 0.3973 0.4379 -0.0070 -0.0084 -0.0717 492 SER B CA  
1086 C C   . SER B 50 ? 0.4864 0.4063 0.4264 -0.0084 -0.0082 -0.0698 492 SER B C   
1087 O O   . SER B 50 ? 0.4784 0.4022 0.4203 -0.0070 -0.0109 -0.0639 492 SER B O   
1088 C CB  . SER B 50 ? 0.5083 0.3989 0.4506 0.0019  -0.0076 -0.0817 492 SER B CB  
1089 O OG  . SER B 50 ? 0.5040 0.4102 0.4542 0.0116  -0.0088 -0.0815 492 SER B OG  
1090 N N   . TYR B 51 ? 0.4869 0.4215 0.4264 -0.0119 -0.0053 -0.0745 493 TYR B N   
1091 C CA  . TYR B 51 ? 0.4837 0.4365 0.4253 -0.0147 -0.0042 -0.0691 493 TYR B CA  
1092 C C   . TYR B 51 ? 0.4976 0.4708 0.4386 -0.0151 0.0006  -0.0740 493 TYR B C   
1093 O O   . TYR B 51 ? 0.5091 0.4847 0.4455 -0.0138 0.0026  -0.0843 493 TYR B O   
1094 C CB  . TYR B 51 ? 0.4768 0.4280 0.4141 -0.0202 -0.0062 -0.0612 493 TYR B CB  
1095 C CG  . TYR B 51 ? 0.4643 0.4256 0.3950 -0.0239 -0.0056 -0.0616 493 TYR B CG  
1096 C CD1 . TYR B 51 ? 0.4238 0.3993 0.3515 -0.0259 -0.0046 -0.0543 493 TYR B CD1 
1097 C CD2 . TYR B 51 ? 0.4220 0.3802 0.3497 -0.0264 -0.0067 -0.0680 493 TYR B CD2 
1098 C CE1 . TYR B 51 ? 0.3775 0.3660 0.2968 -0.0275 -0.0059 -0.0531 493 TYR B CE1 
1099 C CE2 . TYR B 51 ? 0.3950 0.3686 0.3175 -0.0297 -0.0082 -0.0699 493 TYR B CE2 
1100 C CZ  . TYR B 51 ? 0.3965 0.3863 0.3137 -0.0289 -0.0084 -0.0622 493 TYR B CZ  
1101 O OH  . TYR B 51 ? 0.4005 0.4087 0.3103 -0.0303 -0.0116 -0.0625 493 TYR B OH  
1102 N N   . GLU B 52 ? 0.5035 0.4922 0.4494 -0.0180 0.0030  -0.0674 494 GLU B N   
1103 C CA  . GLU B 52 ? 0.5194 0.5325 0.4622 -0.0208 0.0093  -0.0676 494 GLU B CA  
1104 C C   . GLU B 52 ? 0.5251 0.5444 0.4649 -0.0296 0.0104  -0.0521 494 GLU B C   
1105 O O   . GLU B 52 ? 0.5205 0.5286 0.4680 -0.0332 0.0075  -0.0439 494 GLU B O   
1106 C CB  . GLU B 52 ? 0.5237 0.5558 0.4778 -0.0157 0.0143  -0.0757 494 GLU B CB  
1107 C CG  . GLU B 52 ? 0.5389 0.5721 0.5090 -0.0155 0.0117  -0.0717 494 GLU B CG  
1108 C CD  . GLU B 52 ? 0.5968 0.6515 0.5815 -0.0064 0.0148  -0.0821 494 GLU B CD  
1109 O OE1 . GLU B 52 ? 0.6162 0.6649 0.5998 0.0054  0.0147  -0.0941 494 GLU B OE1 
1110 O OE2 . GLU B 52 ? 0.6234 0.7011 0.6229 -0.0111 0.0171  -0.0789 494 GLU B OE2 
1111 N N   . SER B 53 ? 0.5406 0.5766 0.4684 -0.0325 0.0142  -0.0483 495 SER B N   
1112 C CA  . SER B 53 ? 0.5541 0.5944 0.4760 -0.0397 0.0154  -0.0301 495 SER B CA  
1113 C C   . SER B 53 ? 0.5762 0.6450 0.4975 -0.0456 0.0253  -0.0252 495 SER B C   
1114 O O   . SER B 53 ? 0.5741 0.6662 0.4910 -0.0417 0.0310  -0.0381 495 SER B O   
1115 C CB  . SER B 53 ? 0.5606 0.6021 0.4661 -0.0377 0.0110  -0.0259 495 SER B CB  
1116 O OG  . SER B 53 ? 0.5713 0.6195 0.4675 -0.0423 0.0123  -0.0060 495 SER B OG  
1117 N N   . PRO B 54 ? 0.5959 0.6632 0.5228 -0.0557 0.0282  -0.0076 496 PRO B N   
1118 C CA  . PRO B 54 ? 0.6195 0.7164 0.5451 -0.0652 0.0394  0.0023  496 PRO B CA  
1119 C C   . PRO B 54 ? 0.6430 0.7627 0.5434 -0.0639 0.0435  0.0081  496 PRO B C   
1120 O O   . PRO B 54 ? 0.6605 0.8150 0.5555 -0.0682 0.0546  0.0089  496 PRO B O   
1121 C CB  . PRO B 54 ? 0.6326 0.7099 0.5669 -0.0779 0.0389  0.0233  496 PRO B CB  
1122 C CG  . PRO B 54 ? 0.6160 0.6617 0.5644 -0.0738 0.0289  0.0147  496 PRO B CG  
1123 C CD  . PRO B 54 ? 0.5946 0.6316 0.5322 -0.0599 0.0219  0.0018  496 PRO B CD  
1124 N N   . LYS B 55 ? 0.6501 0.7553 0.5357 -0.0578 0.0346  0.0111  497 LYS B N   
1125 C CA  . LYS B 55 ? 0.6713 0.8004 0.5314 -0.0550 0.0351  0.0141  497 LYS B CA  
1126 C C   . LYS B 55 ? 0.6697 0.8257 0.5240 -0.0487 0.0393  -0.0125 497 LYS B C   
1127 O O   . LYS B 55 ? 0.6943 0.8849 0.5308 -0.0498 0.0466  -0.0131 497 LYS B O   
1128 C CB  . LYS B 55 ? 0.6740 0.7852 0.5247 -0.0486 0.0226  0.0201  497 LYS B CB  
1129 C CG  . LYS B 55 ? 0.6949 0.7779 0.5498 -0.0509 0.0177  0.0455  497 LYS B CG  
1130 C CD  . LYS B 55 ? 0.7390 0.8163 0.5836 -0.0413 0.0058  0.0509  497 LYS B CD  
1131 C CE  . LYS B 55 ? 0.7749 0.8258 0.6208 -0.0401 0.0009  0.0779  497 LYS B CE  
1132 N NZ  . LYS B 55 ? 0.7786 0.8333 0.6145 -0.0279 -0.0110 0.0841  497 LYS B NZ  
1133 N N   . LYS B 56 ? 0.6489 0.7880 0.5170 -0.0418 0.0349  -0.0344 498 LYS B N   
1134 C CA  . LYS B 56 ? 0.6498 0.8054 0.5172 -0.0347 0.0388  -0.0616 498 LYS B CA  
1135 C C   . LYS B 56 ? 0.6346 0.7838 0.5253 -0.0301 0.0427  -0.0738 498 LYS B C   
1136 O O   . LYS B 56 ? 0.6280 0.7499 0.5297 -0.0241 0.0360  -0.0849 498 LYS B O   
1137 C CB  . LYS B 56 ? 0.6525 0.7965 0.5122 -0.0296 0.0296  -0.0791 498 LYS B CB  
1138 C CG  . LYS B 56 ? 0.6354 0.7519 0.4981 -0.0312 0.0186  -0.0686 498 LYS B CG  
1139 C CD  . LYS B 56 ? 0.6350 0.7555 0.4877 -0.0300 0.0112  -0.0843 498 LYS B CD  
1140 C CE  . LYS B 56 ? 0.6171 0.7283 0.4690 -0.0315 0.0014  -0.0698 498 LYS B CE  
1141 N NZ  . LYS B 56 ? 0.5762 0.6568 0.4457 -0.0312 0.0002  -0.0585 498 LYS B NZ  
1142 N N   . PRO B 57 ? 0.6339 0.8116 0.5321 -0.0329 0.0535  -0.0710 499 PRO B N   
1143 C CA  . PRO B 57 ? 0.6168 0.7948 0.5404 -0.0286 0.0560  -0.0788 499 PRO B CA  
1144 C C   . PRO B 57 ? 0.6139 0.7921 0.5439 -0.0130 0.0559  -0.1065 499 PRO B C   
1145 O O   . PRO B 57 ? 0.6284 0.8242 0.5447 -0.0076 0.0603  -0.1228 499 PRO B O   
1146 C CB  . PRO B 57 ? 0.6257 0.8439 0.5550 -0.0377 0.0691  -0.0683 499 PRO B CB  
1147 C CG  . PRO B 57 ? 0.6469 0.8821 0.5495 -0.0467 0.0740  -0.0527 499 PRO B CG  
1148 C CD  . PRO B 57 ? 0.6551 0.8732 0.5374 -0.0392 0.0647  -0.0625 499 PRO B CD  
1149 N N   . GLY B 58 ? 0.5964 0.7533 0.5459 -0.0053 0.0501  -0.1117 500 GLY B N   
1150 C CA  . GLY B 58 ? 0.6035 0.7543 0.5627 0.0115  0.0492  -0.1346 500 GLY B CA  
1151 C C   . GLY B 58 ? 0.6096 0.7246 0.5577 0.0166  0.0416  -0.1470 500 GLY B C   
1152 O O   . GLY B 58 ? 0.6274 0.7342 0.5799 0.0298  0.0418  -0.1678 500 GLY B O   
1153 N N   . ARG B 59 ? 0.5978 0.6915 0.5333 0.0061  0.0350  -0.1349 501 ARG B N   
1154 C CA  . ARG B 59 ? 0.6042 0.6648 0.5338 0.0072  0.0276  -0.1441 501 ARG B CA  
1155 C C   . ARG B 59 ? 0.5839 0.6128 0.5201 0.0039  0.0197  -0.1289 501 ARG B C   
1156 O O   . ARG B 59 ? 0.5723 0.6030 0.5062 -0.0046 0.0177  -0.1114 501 ARG B O   
1157 C CB  . ARG B 59 ? 0.6136 0.6842 0.5235 -0.0013 0.0265  -0.1475 501 ARG B CB  
1158 C CG  . ARG B 59 ? 0.6483 0.6946 0.5553 -0.0006 0.0212  -0.1666 501 ARG B CG  
1159 C CD  . ARG B 59 ? 0.7160 0.7834 0.6044 -0.0076 0.0199  -0.1766 501 ARG B CD  
1160 N NE  . ARG B 59 ? 0.7553 0.8190 0.6380 -0.0180 0.0124  -0.1607 501 ARG B NE  
1161 C CZ  . ARG B 59 ? 0.7627 0.8017 0.6507 -0.0239 0.0054  -0.1639 501 ARG B CZ  
1162 N NH1 . ARG B 59 ? 0.8083 0.8175 0.7059 -0.0223 0.0045  -0.1801 501 ARG B NH1 
1163 N NH2 . ARG B 59 ? 0.7279 0.7723 0.6127 -0.0312 -0.0005 -0.1499 501 ARG B NH2 
1164 N N   . GLU B 60 ? 0.5871 0.5865 0.5309 0.0115  0.0155  -0.1357 502 GLU B N   
1165 C CA  . GLU B 60 ? 0.5789 0.5494 0.5243 0.0080  0.0087  -0.1228 502 GLU B CA  
1166 C C   . GLU B 60 ? 0.5822 0.5347 0.5185 -0.0009 0.0057  -0.1263 502 GLU B C   
1167 O O   . GLU B 60 ? 0.6020 0.5388 0.5380 0.0008  0.0055  -0.1416 502 GLU B O   
1168 C CB  . GLU B 60 ? 0.5878 0.5368 0.5442 0.0202  0.0055  -0.1234 502 GLU B CB  
1169 C CG  . GLU B 60 ? 0.5951 0.5636 0.5635 0.0269  0.0052  -0.1160 502 GLU B CG  
1170 C CD  . GLU B 60 ? 0.6464 0.5940 0.6222 0.0386  -0.0014 -0.1110 502 GLU B CD  
1171 O OE1 . GLU B 60 ? 0.6472 0.5658 0.6151 0.0350  -0.0059 -0.1023 502 GLU B OE1 
1172 O OE2 . GLU B 60 ? 0.6369 0.6008 0.6264 0.0516  -0.0019 -0.1148 502 GLU B OE2 
1173 N N   . ILE B 61 ? 0.5698 0.5257 0.5009 -0.0105 0.0031  -0.1135 503 ILE B N   
1174 C CA  . ILE B 61 ? 0.5744 0.5192 0.5011 -0.0197 -0.0002 -0.1152 503 ILE B CA  
1175 C C   . ILE B 61 ? 0.5747 0.4918 0.5064 -0.0209 -0.0026 -0.1064 503 ILE B C   
1176 O O   . ILE B 61 ? 0.5591 0.4763 0.4919 -0.0196 -0.0037 -0.0928 503 ILE B O   
1177 C CB  . ILE B 61 ? 0.5599 0.5266 0.4800 -0.0268 -0.0021 -0.1062 503 ILE B CB  
1178 C CG1 . ILE B 61 ? 0.5709 0.5662 0.4812 -0.0267 -0.0001 -0.1127 503 ILE B CG1 
1179 C CG2 . ILE B 61 ? 0.5680 0.5290 0.4887 -0.0356 -0.0060 -0.1073 503 ILE B CG2 
1180 C CD1 . ILE B 61 ? 0.5763 0.5897 0.4847 -0.0239 0.0038  -0.1000 503 ILE B CD1 
1181 N N   . GLU B 62 ? 0.5973 0.4905 0.5308 -0.0240 -0.0030 -0.1145 504 GLU B N   
1182 C CA  . GLU B 62 ? 0.6108 0.4779 0.5463 -0.0276 -0.0040 -0.1038 504 GLU B CA  
1183 C C   . GLU B 62 ? 0.5972 0.4763 0.5311 -0.0383 -0.0044 -0.0940 504 GLU B C   
1184 O O   . GLU B 62 ? 0.5984 0.4976 0.5321 -0.0455 -0.0053 -0.0996 504 GLU B O   
1185 C CB  . GLU B 62 ? 0.6391 0.4746 0.5778 -0.0317 -0.0037 -0.1138 504 GLU B CB  
1186 C CG  . GLU B 62 ? 0.6730 0.4900 0.6154 -0.0169 -0.0036 -0.1234 504 GLU B CG  
1187 C CD  . GLU B 62 ? 0.7605 0.5451 0.7068 -0.0213 -0.0035 -0.1395 504 GLU B CD  
1188 O OE1 . GLU B 62 ? 0.7795 0.5416 0.7270 -0.0358 -0.0036 -0.1343 504 GLU B OE1 
1189 O OE2 . GLU B 62 ? 0.7923 0.5744 0.7416 -0.0109 -0.0029 -0.1584 504 GLU B OE2 
1190 N N   . LEU B 63 ? 0.5942 0.4648 0.5268 -0.0375 -0.0041 -0.0800 505 LEU B N   
1191 C CA  . LEU B 63 ? 0.5841 0.4662 0.5165 -0.0457 -0.0031 -0.0720 505 LEU B CA  
1192 C C   . LEU B 63 ? 0.6077 0.4678 0.5394 -0.0537 -0.0001 -0.0646 505 LEU B C   
1193 O O   . LEU B 63 ? 0.6112 0.4653 0.5369 -0.0500 0.0009  -0.0521 505 LEU B O   
1194 C CB  . LEU B 63 ? 0.5618 0.4574 0.4913 -0.0380 -0.0043 -0.0631 505 LEU B CB  
1195 C CG  . LEU B 63 ? 0.5420 0.4549 0.4724 -0.0320 -0.0064 -0.0656 505 LEU B CG  
1196 C CD1 . LEU B 63 ? 0.5383 0.4549 0.4679 -0.0260 -0.0079 -0.0583 505 LEU B CD1 
1197 C CD2 . LEU B 63 ? 0.5151 0.4475 0.4472 -0.0367 -0.0073 -0.0689 505 LEU B CD2 
1198 N N   . GLU B 64 ? 0.6297 0.4785 0.5668 -0.0657 0.0012  -0.0725 506 GLU B N   
1199 C CA  . GLU B 64 ? 0.6633 0.4825 0.6008 -0.0756 0.0047  -0.0650 506 GLU B CA  
1200 C C   . GLU B 64 ? 0.6633 0.4964 0.6031 -0.0904 0.0099  -0.0549 506 GLU B C   
1201 O O   . GLU B 64 ? 0.6876 0.5026 0.6217 -0.0949 0.0142  -0.0397 506 GLU B O   
1202 C CB  . GLU B 64 ? 0.6940 0.4887 0.6386 -0.0836 0.0039  -0.0800 506 GLU B CB  
1203 C CG  . GLU B 64 ? 0.7485 0.4963 0.6921 -0.0870 0.0060  -0.0704 506 GLU B CG  
1204 C CD  . GLU B 64 ? 0.8111 0.5300 0.7644 -0.0993 0.0057  -0.0870 506 GLU B CD  
1205 O OE1 . GLU B 64 ? 0.8434 0.5210 0.7966 -0.0905 0.0043  -0.0887 506 GLU B OE1 
1206 O OE2 . GLU B 64 ? 0.8123 0.5497 0.7745 -0.1170 0.0062  -0.0997 506 GLU B OE2 
1207 N N   . ASN B 65 ? 0.6372 0.5049 0.5851 -0.0973 0.0098  -0.0626 507 ASN B N   
1208 C CA  . ASN B 65 ? 0.6308 0.5208 0.5852 -0.1105 0.0156  -0.0561 507 ASN B CA  
1209 C C   . ASN B 65 ? 0.6067 0.5168 0.5535 -0.0991 0.0178  -0.0457 507 ASN B C   
1210 O O   . ASN B 65 ? 0.5819 0.5141 0.5297 -0.0876 0.0137  -0.0510 507 ASN B O   
1211 C CB  . ASN B 65 ? 0.6199 0.5429 0.5894 -0.1209 0.0131  -0.0703 507 ASN B CB  
1212 C CG  . ASN B 65 ? 0.6282 0.5748 0.6107 -0.1391 0.0198  -0.0665 507 ASN B CG  
1213 O OD1 . ASN B 65 ? 0.6401 0.5903 0.6184 -0.1404 0.0273  -0.0525 507 ASN B OD1 
1214 N ND2 . ASN B 65 ? 0.6490 0.6171 0.6477 -0.1538 0.0172  -0.0801 507 ASN B ND2 
1215 N N   . ASP B 66 ? 0.6164 0.5176 0.5547 -0.1026 0.0242  -0.0310 508 ASP B N   
1216 C CA  . ASP B 66 ? 0.6043 0.5244 0.5328 -0.0925 0.0269  -0.0234 508 ASP B CA  
1217 C C   . ASP B 66 ? 0.5747 0.5371 0.5142 -0.0921 0.0294  -0.0307 508 ASP B C   
1218 O O   . ASP B 66 ? 0.5610 0.5382 0.4952 -0.0785 0.0285  -0.0321 508 ASP B O   
1219 C CB  . ASP B 66 ? 0.6361 0.5443 0.5512 -0.0994 0.0345  -0.0055 508 ASP B CB  
1220 C CG  . ASP B 66 ? 0.6867 0.5551 0.5877 -0.0918 0.0301  0.0050  508 ASP B CG  
1221 O OD1 . ASP B 66 ? 0.7154 0.5676 0.6191 -0.0813 0.0221  -0.0036 508 ASP B OD1 
1222 O OD2 . ASP B 66 ? 0.7760 0.6318 0.6629 -0.0954 0.0349  0.0229  508 ASP B OD2 
1223 N N   . LEU B 67 ? 0.5634 0.5453 0.5197 -0.1063 0.0317  -0.0368 509 LEU B N   
1224 C CA  . LEU B 67 ? 0.5378 0.5647 0.5082 -0.1057 0.0346  -0.0427 509 LEU B CA  
1225 C C   . LEU B 67 ? 0.5066 0.5518 0.4865 -0.0925 0.0251  -0.0545 509 LEU B C   
1226 O O   . LEU B 67 ? 0.4960 0.5775 0.4888 -0.0871 0.0255  -0.0595 509 LEU B O   
1227 C CB  . LEU B 67 ? 0.5533 0.6012 0.5402 -0.1287 0.0424  -0.0422 509 LEU B CB  
1228 C CG  . LEU B 67 ? 0.5878 0.6278 0.5661 -0.1430 0.0548  -0.0263 509 LEU B CG  
1229 C CD1 . LEU B 67 ? 0.6136 0.6754 0.6124 -0.1699 0.0631  -0.0260 509 LEU B CD1 
1230 C CD2 . LEU B 67 ? 0.6014 0.6633 0.5671 -0.1296 0.0615  -0.0206 509 LEU B CD2 
1231 N N   . LYS B 68 ? 0.4924 0.5137 0.4657 -0.0864 0.0170  -0.0578 510 LYS B N   
1232 C CA  . LYS B 68 ? 0.4661 0.5008 0.4438 -0.0752 0.0082  -0.0650 510 LYS B CA  
1233 C C   . LYS B 68 ? 0.4496 0.4735 0.4174 -0.0566 0.0048  -0.0616 510 LYS B C   
1234 O O   . LYS B 68 ? 0.4443 0.4441 0.3999 -0.0531 0.0065  -0.0568 510 LYS B O   
1235 C CB  . LYS B 68 ? 0.4709 0.4925 0.4474 -0.0818 0.0026  -0.0720 510 LYS B CB  
1236 C CG  . LYS B 68 ? 0.4891 0.5210 0.4783 -0.1019 0.0037  -0.0800 510 LYS B CG  
1237 C CD  . LYS B 68 ? 0.5169 0.5962 0.5241 -0.1048 0.0012  -0.0857 510 LYS B CD  
1238 C CE  . LYS B 68 ? 0.5562 0.6490 0.5772 -0.1258 -0.0009 -0.0979 510 LYS B CE  
1239 N NZ  . LYS B 68 ? 0.5530 0.6957 0.5966 -0.1334 -0.0002 -0.1015 510 LYS B NZ  
1240 N N   . SER B 69 ? 0.4367 0.4786 0.4107 -0.0451 -0.0007 -0.0638 511 SER B N   
1241 C CA  . SER B 69 ? 0.4272 0.4566 0.3949 -0.0297 -0.0040 -0.0609 511 SER B CA  
1242 C C   . SER B 69 ? 0.4217 0.4292 0.3799 -0.0281 -0.0086 -0.0584 511 SER B C   
1243 O O   . SER B 69 ? 0.4258 0.4317 0.3820 -0.0358 -0.0100 -0.0609 511 SER B O   
1244 C CB  . SER B 69 ? 0.4226 0.4744 0.4014 -0.0168 -0.0082 -0.0620 511 SER B CB  
1245 O OG  . SER B 69 ? 0.4337 0.4990 0.4163 -0.0168 -0.0154 -0.0615 511 SER B OG  
1246 N N   . LEU B 70 ? 0.4149 0.4073 0.3684 -0.0187 -0.0104 -0.0552 512 LEU B N   
1247 C CA  . LEU B 70 ? 0.4087 0.3875 0.3564 -0.0172 -0.0139 -0.0516 512 LEU B CA  
1248 C C   . LEU B 70 ? 0.4126 0.4060 0.3617 -0.0148 -0.0188 -0.0485 512 LEU B C   
1249 O O   . LEU B 70 ? 0.4144 0.4079 0.3572 -0.0191 -0.0197 -0.0483 512 LEU B O   
1250 C CB  . LEU B 70 ? 0.4123 0.3743 0.3584 -0.0105 -0.0148 -0.0493 512 LEU B CB  
1251 C CG  . LEU B 70 ? 0.3890 0.3400 0.3304 -0.0120 -0.0120 -0.0526 512 LEU B CG  
1252 C CD1 . LEU B 70 ? 0.3630 0.3035 0.3054 -0.0056 -0.0142 -0.0550 512 LEU B CD1 
1253 C CD2 . LEU B 70 ? 0.3929 0.3347 0.3289 -0.0176 -0.0113 -0.0518 512 LEU B CD2 
1254 N N   . GLN B 71 ? 0.4150 0.4231 0.3718 -0.0064 -0.0222 -0.0464 513 GLN B N   
1255 C CA  A GLN B 71 ? 0.4207 0.4470 0.3781 -0.0016 -0.0288 -0.0414 513 GLN B CA  
1256 C CA  B GLN B 71 ? 0.4217 0.4482 0.3792 -0.0015 -0.0289 -0.0413 513 GLN B CA  
1257 C C   . GLN B 71 ? 0.4215 0.4693 0.3775 -0.0119 -0.0302 -0.0484 513 GLN B C   
1258 O O   . GLN B 71 ? 0.4277 0.4856 0.3755 -0.0122 -0.0347 -0.0457 513 GLN B O   
1259 C CB  A GLN B 71 ? 0.4255 0.4688 0.3954 0.0111  -0.0327 -0.0402 513 GLN B CB  
1260 C CB  B GLN B 71 ? 0.4270 0.4705 0.3969 0.0115  -0.0329 -0.0399 513 GLN B CB  
1261 C CG  A GLN B 71 ? 0.4473 0.4702 0.4183 0.0252  -0.0356 -0.0317 513 GLN B CG  
1262 C CG  B GLN B 71 ? 0.4485 0.4702 0.4211 0.0254  -0.0343 -0.0339 513 GLN B CG  
1263 C CD  A GLN B 71 ? 0.4265 0.4613 0.4125 0.0396  -0.0367 -0.0363 513 GLN B CD  
1264 C CD  B GLN B 71 ? 0.4547 0.4516 0.4169 0.0257  -0.0367 -0.0217 513 GLN B CD  
1265 O OE1 A GLN B 71 ? 0.3978 0.4634 0.3942 0.0384  -0.0351 -0.0444 513 GLN B OE1 
1266 O OE1 B GLN B 71 ? 0.4567 0.4333 0.4218 0.0357  -0.0394 -0.0145 513 GLN B OE1 
1267 N NE2 A GLN B 71 ? 0.4531 0.4641 0.4418 0.0529  -0.0390 -0.0323 513 GLN B NE2 
1268 N NE2 B GLN B 71 ? 0.4528 0.4509 0.4039 0.0142  -0.0349 -0.0198 513 GLN B NE2 
1269 N N   . PHE B 72 ? 0.4115 0.4668 0.3751 -0.0213 -0.0262 -0.0575 514 PHE B N   
1270 C CA  . PHE B 72 ? 0.4160 0.4886 0.3820 -0.0339 -0.0275 -0.0672 514 PHE B CA  
1271 C C   . PHE B 72 ? 0.4166 0.4732 0.3693 -0.0395 -0.0269 -0.0710 514 PHE B C   
1272 O O   . PHE B 72 ? 0.4217 0.4954 0.3699 -0.0431 -0.0316 -0.0773 514 PHE B O   
1273 C CB  . PHE B 72 ? 0.4165 0.4904 0.3927 -0.0459 -0.0209 -0.0735 514 PHE B CB  
1274 C CG  . PHE B 72 ? 0.4348 0.5177 0.4154 -0.0626 -0.0215 -0.0849 514 PHE B CG  
1275 C CD1 . PHE B 72 ? 0.4595 0.5804 0.4531 -0.0680 -0.0271 -0.0922 514 PHE B CD1 
1276 C CD2 . PHE B 72 ? 0.4265 0.4796 0.3998 -0.0726 -0.0174 -0.0896 514 PHE B CD2 
1277 C CE1 . PHE B 72 ? 0.4621 0.5907 0.4615 -0.0863 -0.0285 -0.1060 514 PHE B CE1 
1278 C CE2 . PHE B 72 ? 0.4333 0.4885 0.4118 -0.0886 -0.0182 -0.1026 514 PHE B CE2 
1279 C CZ  . PHE B 72 ? 0.4546 0.5473 0.4462 -0.0971 -0.0237 -0.1117 514 PHE B CZ  
1280 N N   . TYR B 73 ? 0.4125 0.4403 0.3592 -0.0391 -0.0215 -0.0684 515 TYR B N   
1281 C CA  . TYR B 73 ? 0.4213 0.4357 0.3583 -0.0418 -0.0198 -0.0731 515 TYR B CA  
1282 C C   . TYR B 73 ? 0.4243 0.4431 0.3516 -0.0343 -0.0216 -0.0656 515 TYR B C   
1283 O O   . TYR B 73 ? 0.4291 0.4412 0.3494 -0.0349 -0.0186 -0.0688 515 TYR B O   
1284 C CB  . TYR B 73 ? 0.4210 0.4075 0.3578 -0.0432 -0.0143 -0.0732 515 TYR B CB  
1285 C CG  . TYR B 73 ? 0.4424 0.4187 0.3844 -0.0536 -0.0114 -0.0798 515 TYR B CG  
1286 C CD1 . TYR B 73 ? 0.4779 0.4494 0.4198 -0.0616 -0.0117 -0.0922 515 TYR B CD1 
1287 C CD2 . TYR B 73 ? 0.4592 0.4289 0.4055 -0.0559 -0.0077 -0.0736 515 TYR B CD2 
1288 C CE1 . TYR B 73 ? 0.5123 0.4677 0.4601 -0.0731 -0.0089 -0.0968 515 TYR B CE1 
1289 C CE2 . TYR B 73 ? 0.4612 0.4192 0.4111 -0.0675 -0.0039 -0.0756 515 TYR B CE2 
1290 C CZ  . TYR B 73 ? 0.5269 0.4752 0.4787 -0.0767 -0.0046 -0.0864 515 TYR B CZ  
1291 O OH  . TYR B 73 ? 0.5625 0.4931 0.5193 -0.0903 -0.0007 -0.0872 515 TYR B OH  
1292 N N   . SER B 74 ? 0.4235 0.4542 0.3511 -0.0270 -0.0260 -0.0549 516 SER B N   
1293 C CA  . SER B 74 ? 0.4368 0.4705 0.3547 -0.0212 -0.0276 -0.0427 516 SER B CA  
1294 C C   . SER B 74 ? 0.4362 0.4467 0.3536 -0.0204 -0.0223 -0.0358 516 SER B C   
1295 O O   . SER B 74 ? 0.4447 0.4576 0.3540 -0.0213 -0.0200 -0.0290 516 SER B O   
1296 C CB  . SER B 74 ? 0.4476 0.5027 0.3523 -0.0247 -0.0290 -0.0476 516 SER B CB  
1297 O OG  . SER B 74 ? 0.4757 0.5577 0.3808 -0.0250 -0.0364 -0.0529 516 SER B OG  
1298 N N   . VAL B 75 ? 0.4281 0.4205 0.3543 -0.0197 -0.0203 -0.0378 517 VAL B N   
1299 C CA  . VAL B 75 ? 0.4354 0.4097 0.3635 -0.0193 -0.0175 -0.0328 517 VAL B CA  
1300 C C   . VAL B 75 ? 0.4540 0.4217 0.3831 -0.0143 -0.0205 -0.0193 517 VAL B C   
1301 O O   . VAL B 75 ? 0.4631 0.4315 0.3966 -0.0071 -0.0246 -0.0169 517 VAL B O   
1302 C CB  . VAL B 75 ? 0.4282 0.3882 0.3623 -0.0194 -0.0158 -0.0394 517 VAL B CB  
1303 C CG1 . VAL B 75 ? 0.4181 0.3646 0.3555 -0.0197 -0.0149 -0.0367 517 VAL B CG1 
1304 C CG2 . VAL B 75 ? 0.4145 0.3749 0.3469 -0.0237 -0.0132 -0.0488 517 VAL B CG2 
1305 N N   . GLU B 76 ? 0.4666 0.4289 0.3931 -0.0180 -0.0180 -0.0104 518 GLU B N   
1306 C CA  . GLU B 76 ? 0.4956 0.4454 0.4225 -0.0156 -0.0202 0.0055  518 GLU B CA  
1307 C C   . GLU B 76 ? 0.5006 0.4276 0.4371 -0.0207 -0.0182 0.0062  518 GLU B C   
1308 O O   . GLU B 76 ? 0.4890 0.4175 0.4300 -0.0264 -0.0150 -0.0037 518 GLU B O   
1309 C CB  . GLU B 76 ? 0.5112 0.4759 0.4256 -0.0191 -0.0185 0.0194  518 GLU B CB  
1310 C CG  . GLU B 76 ? 0.5488 0.5367 0.4524 -0.0127 -0.0238 0.0220  518 GLU B CG  
1311 C CD  . GLU B 76 ? 0.6242 0.6322 0.5103 -0.0162 -0.0217 0.0349  518 GLU B CD  
1312 O OE1 . GLU B 76 ? 0.6470 0.6524 0.5304 -0.0247 -0.0143 0.0428  518 GLU B OE1 
1313 O OE2 . GLU B 76 ? 0.6558 0.6869 0.5308 -0.0110 -0.0273 0.0370  518 GLU B OE2 
1314 N N   . ASN B 77 ? 0.5201 0.4258 0.4607 -0.0183 -0.0210 0.0176  519 ASN B N   
1315 C CA  . ASN B 77 ? 0.5355 0.4177 0.4866 -0.0258 -0.0199 0.0183  519 ASN B CA  
1316 C C   . ASN B 77 ? 0.5335 0.4279 0.4853 -0.0403 -0.0133 0.0216  519 ASN B C   
1317 O O   . ASN B 77 ? 0.5361 0.4471 0.4785 -0.0442 -0.0091 0.0337  519 ASN B O   
1318 C CB  . ASN B 77 ? 0.5687 0.4226 0.5228 -0.0218 -0.0237 0.0336  519 ASN B CB  
1319 C CG  . ASN B 77 ? 0.6026 0.4253 0.5706 -0.0288 -0.0244 0.0284  519 ASN B CG  
1320 O OD1 . ASN B 77 ? 0.5980 0.4204 0.5731 -0.0300 -0.0252 0.0092  519 ASN B OD1 
1321 N ND2 . ASN B 77 ? 0.6516 0.4473 0.6231 -0.0340 -0.0247 0.0459  519 ASN B ND2 
1322 N N   . GLY B 78 ? 0.5288 0.4208 0.4919 -0.0472 -0.0123 0.0096  520 GLY B N   
1323 C CA  . GLY B 78 ? 0.5315 0.4401 0.5010 -0.0602 -0.0063 0.0107  520 GLY B CA  
1324 C C   . GLY B 78 ? 0.5140 0.4518 0.4804 -0.0575 -0.0029 -0.0003 520 GLY B C   
1325 O O   . GLY B 78 ? 0.5120 0.4688 0.4862 -0.0653 0.0022  -0.0020 520 GLY B O   
1326 N N   . ASP B 79 ? 0.5026 0.4439 0.4595 -0.0467 -0.0055 -0.0081 521 ASP B N   
1327 C CA  . ASP B 79 ? 0.4941 0.4551 0.4481 -0.0431 -0.0029 -0.0188 521 ASP B CA  
1328 C C   . ASP B 79 ? 0.4876 0.4488 0.4516 -0.0416 -0.0051 -0.0307 521 ASP B C   
1329 O O   . ASP B 79 ? 0.4859 0.4341 0.4566 -0.0431 -0.0096 -0.0333 521 ASP B O   
1330 C CB  . ASP B 79 ? 0.4893 0.4512 0.4320 -0.0351 -0.0050 -0.0231 521 ASP B CB  
1331 C CG  . ASP B 79 ? 0.5009 0.4756 0.4318 -0.0353 -0.0034 -0.0143 521 ASP B CG  
1332 O OD1 . ASP B 79 ? 0.4977 0.4824 0.4259 -0.0413 0.0012  -0.0037 521 ASP B OD1 
1333 O OD2 . ASP B 79 ? 0.4842 0.4620 0.4081 -0.0304 -0.0067 -0.0177 521 ASP B OD2 
1334 N N   . CYS B 80 ? 0.4864 0.4627 0.4507 -0.0374 -0.0028 -0.0387 522 CYS B N   
1335 C CA  . CYS B 80 ? 0.4901 0.4697 0.4631 -0.0331 -0.0060 -0.0477 522 CYS B CA  
1336 C C   . CYS B 80 ? 0.4802 0.4481 0.4443 -0.0239 -0.0091 -0.0532 522 CYS B C   
1337 O O   . CYS B 80 ? 0.4865 0.4548 0.4438 -0.0206 -0.0063 -0.0560 522 CYS B O   
1338 C CB  . CYS B 80 ? 0.4936 0.4989 0.4774 -0.0329 -0.0013 -0.0518 522 CYS B CB  
1339 S SG  . CYS B 80 ? 0.5583 0.5746 0.5564 -0.0249 -0.0073 -0.0612 522 CYS B SG  
1340 N N   . LEU B 81 ? 0.4699 0.4277 0.4336 -0.0211 -0.0145 -0.0551 523 LEU B N   
1341 C CA  . LEU B 81 ? 0.4647 0.4117 0.4197 -0.0142 -0.0167 -0.0570 523 LEU B CA  
1342 C C   . LEU B 81 ? 0.4635 0.4164 0.4234 -0.0064 -0.0196 -0.0601 523 LEU B C   
1343 O O   . LEU B 81 ? 0.4621 0.4255 0.4294 -0.0055 -0.0244 -0.0617 523 LEU B O   
1344 C CB  . LEU B 81 ? 0.4690 0.4059 0.4176 -0.0146 -0.0201 -0.0561 523 LEU B CB  
1345 C CG  . LEU B 81 ? 0.4793 0.4063 0.4168 -0.0119 -0.0191 -0.0543 523 LEU B CG  
1346 C CD1 . LEU B 81 ? 0.4836 0.4091 0.4192 -0.0156 -0.0149 -0.0532 523 LEU B CD1 
1347 C CD2 . LEU B 81 ? 0.4856 0.4109 0.4167 -0.0108 -0.0216 -0.0553 523 LEU B CD2 
1348 N N   . LEU B 82 ? 0.4651 0.4113 0.4220 -0.0001 -0.0177 -0.0618 524 LEU B N   
1349 C CA  . LEU B 82 ? 0.4679 0.4155 0.4298 0.0112  -0.0212 -0.0636 524 LEU B CA  
1350 C C   . LEU B 82 ? 0.4746 0.4010 0.4244 0.0159  -0.0249 -0.0572 524 LEU B C   
1351 O O   . LEU B 82 ? 0.4778 0.3861 0.4187 0.0118  -0.0214 -0.0550 524 LEU B O   
1352 C CB  . LEU B 82 ? 0.4759 0.4271 0.4440 0.0173  -0.0166 -0.0711 524 LEU B CB  
1353 C CG  . LEU B 82 ? 0.4765 0.4548 0.4551 0.0133  -0.0109 -0.0765 524 LEU B CG  
1354 C CD1 . LEU B 82 ? 0.5132 0.4889 0.4823 0.0051  -0.0048 -0.0780 524 LEU B CD1 
1355 C CD2 . LEU B 82 ? 0.5114 0.5049 0.5027 0.0262  -0.0095 -0.0855 524 LEU B CD2 
1356 N N   . VAL B 83 ? 0.4767 0.4086 0.4262 0.0234  -0.0320 -0.0535 525 VAL B N   
1357 C CA  . VAL B 83 ? 0.4882 0.4037 0.4226 0.0276  -0.0356 -0.0438 525 VAL B CA  
1358 C C   . VAL B 83 ? 0.5101 0.4195 0.4470 0.0432  -0.0411 -0.0393 525 VAL B C   
1359 O O   . VAL B 83 ? 0.5055 0.4367 0.4546 0.0524  -0.0472 -0.0432 525 VAL B O   
1360 C CB  . VAL B 83 ? 0.4857 0.4141 0.4121 0.0248  -0.0408 -0.0422 525 VAL B CB  
1361 C CG1 . VAL B 83 ? 0.4934 0.4085 0.3997 0.0273  -0.0420 -0.0306 525 VAL B CG1 
1362 C CG2 . VAL B 83 ? 0.4668 0.4007 0.3954 0.0126  -0.0365 -0.0488 525 VAL B CG2 
1363 N N   . ARG B 84 ? 0.5340 0.4139 0.4610 0.0460  -0.0393 -0.0308 526 ARG B N   
1364 C CA  . ARG B 84 ? 0.5663 0.4301 0.4948 0.0627  -0.0445 -0.0243 526 ARG B CA  
1365 C C   . ARG B 84 ? 0.6021 0.4418 0.5103 0.0637  -0.0469 -0.0051 526 ARG B C   
1366 O O   . ARG B 84 ? 0.6023 0.4332 0.4976 0.0492  -0.0408 0.0005  526 ARG B O   
1367 C CB  . ARG B 84 ? 0.5752 0.4184 0.5140 0.0656  -0.0390 -0.0335 526 ARG B CB  
1368 C CG  . ARG B 84 ? 0.5736 0.4437 0.5323 0.0728  -0.0379 -0.0500 526 ARG B CG  
1369 C CD  . ARG B 84 ? 0.6103 0.4585 0.5770 0.0819  -0.0341 -0.0605 526 ARG B CD  
1370 N NE  . ARG B 84 ? 0.5786 0.4569 0.5627 0.0883  -0.0304 -0.0777 526 ARG B NE  
1371 C CZ  . ARG B 84 ? 0.5490 0.4457 0.5343 0.0753  -0.0224 -0.0887 526 ARG B CZ  
1372 N NH1 . ARG B 84 ? 0.4965 0.3849 0.4690 0.0569  -0.0190 -0.0849 526 ARG B NH1 
1373 N NH2 . ARG B 84 ? 0.5271 0.4545 0.5265 0.0812  -0.0178 -0.1025 526 ARG B NH2 
1374 N N   . TRP B 85 ? 0.6318 0.4642 0.5375 0.0816  -0.0556 0.0060  527 TRP B N   
1375 C CA  . TRP B 85 ? 0.6724 0.4786 0.5568 0.0844  -0.0579 0.0287  527 TRP B CA  
1376 C C   . TRP B 85 ? 0.7171 0.5009 0.6045 0.1073  -0.0664 0.0402  527 TRP B C   
1377 O O   . TRP B 85 ? 0.7626 0.5142 0.6329 0.1101  -0.0675 0.0622  527 TRP B O   
1378 C CB  . TRP B 85 ? 0.6690 0.5014 0.5337 0.0802  -0.0619 0.0375  527 TRP B CB  
1379 C CG  . TRP B 85 ? 0.6430 0.5143 0.5134 0.0929  -0.0741 0.0313  527 TRP B CG  
1380 C CD1 . TRP B 85 ? 0.6619 0.5423 0.5244 0.1115  -0.0870 0.0442  527 TRP B CD1 
1381 C CD2 . TRP B 85 ? 0.5912 0.4988 0.4769 0.0865  -0.0754 0.0111  527 TRP B CD2 
1382 N NE1 . TRP B 85 ? 0.6266 0.5512 0.5006 0.1165  -0.0967 0.0307  527 TRP B NE1 
1383 C CE2 . TRP B 85 ? 0.5924 0.5320 0.4813 0.1000  -0.0891 0.0104  527 TRP B CE2 
1384 C CE3 . TRP B 85 ? 0.5464 0.4622 0.4440 0.0706  -0.0668 -0.0052 527 TRP B CE3 
1385 C CZ2 . TRP B 85 ? 0.5425 0.5205 0.4480 0.0950  -0.0936 -0.0076 527 TRP B CZ2 
1386 C CZ3 . TRP B 85 ? 0.4915 0.4408 0.4035 0.0670  -0.0708 -0.0202 527 TRP B CZ3 
1387 C CH2 . TRP B 85 ? 0.5113 0.4908 0.4281 0.0776  -0.0837 -0.0220 527 TRP B CH2 
1388 O OXT . TRP B 85 ? 0.7134 0.5104 0.6206 0.1241  -0.0721 0.0290  527 TRP B OXT 
1389 N N   . GLN C 2  ? 0.7029 0.5489 0.6244 0.1127  0.0307  0.0562  444 GLN C N   
1390 C CA  . GLN C 2  ? 0.6859 0.5423 0.6313 0.1148  0.0252  0.0746  444 GLN C CA  
1391 C C   . GLN C 2  ? 0.6499 0.5100 0.5961 0.0924  0.0098  0.0770  444 GLN C C   
1392 O O   . GLN C 2  ? 0.6177 0.5077 0.5697 0.0814  0.0025  0.0806  444 GLN C O   
1393 C CB  . GLN C 2  ? 0.7293 0.5490 0.6745 0.1310  0.0335  0.0761  444 GLN C CB  
1394 C CG  . GLN C 2  ? 0.7437 0.5831 0.7154 0.1430  0.0321  0.0995  444 GLN C CG  
1395 C CD  . GLN C 2  ? 0.7838 0.6645 0.7769 0.1619  0.0403  0.1115  444 GLN C CD  
1396 O OE1 . GLN C 2  ? 0.8410 0.7108 0.8351 0.1849  0.0556  0.1099  444 GLN C OE1 
1397 N NE2 . GLN C 2  ? 0.7356 0.6640 0.7465 0.1519  0.0307  0.1234  444 GLN C NE2 
1398 N N   . LEU C 3  ? 0.6525 0.4811 0.5928 0.0861  0.0064  0.0752  445 LEU C N   
1399 C CA  . LEU C 3  ? 0.6219 0.4535 0.5628 0.0665  -0.0054 0.0777  445 LEU C CA  
1400 C C   . LEU C 3  ? 0.6123 0.4376 0.5377 0.0500  -0.0108 0.0618  445 LEU C C   
1401 O O   . LEU C 3  ? 0.6429 0.4400 0.5519 0.0486  -0.0076 0.0471  445 LEU C O   
1402 C CB  . LEU C 3  ? 0.6432 0.4466 0.5859 0.0657  -0.0056 0.0851  445 LEU C CB  
1403 C CG  . LEU C 3  ? 0.6237 0.4406 0.5727 0.0514  -0.0149 0.0961  445 LEU C CG  
1404 C CD1 . LEU C 3  ? 0.5261 0.3816 0.4888 0.0565  -0.0193 0.1116  445 LEU C CD1 
1405 C CD2 . LEU C 3  ? 0.6506 0.4347 0.5986 0.0490  -0.0130 0.1034  445 LEU C CD2 
1406 N N   . LEU C 4  ? 0.5712 0.4223 0.5012 0.0379  -0.0192 0.0646  446 LEU C N   
1407 C CA  . LEU C 4  ? 0.5562 0.4089 0.4755 0.0245  -0.0252 0.0533  446 LEU C CA  
1408 C C   . LEU C 4  ? 0.5453 0.3976 0.4690 0.0093  -0.0328 0.0553  446 LEU C C   
1409 O O   . LEU C 4  ? 0.5196 0.3881 0.4538 0.0071  -0.0355 0.0660  446 LEU C O   
1410 C CB  . LEU C 4  ? 0.5297 0.4113 0.4503 0.0248  -0.0269 0.0547  446 LEU C CB  
1411 C CG  . LEU C 4  ? 0.5256 0.4194 0.4471 0.0381  -0.0187 0.0572  446 LEU C CG  
1412 C CD1 . LEU C 4  ? 0.4459 0.3666 0.3715 0.0336  -0.0216 0.0621  446 LEU C CD1 
1413 C CD2 . LEU C 4  ? 0.5012 0.3751 0.4041 0.0461  -0.0106 0.0444  446 LEU C CD2 
1414 N N   . THR C 5  ? 0.5604 0.3959 0.4754 -0.0017 -0.0361 0.0445  447 THR C N   
1415 C CA  . THR C 5  ? 0.5538 0.3951 0.4754 -0.0172 -0.0427 0.0462  447 THR C CA  
1416 C C   . THR C 5  ? 0.5304 0.3993 0.4530 -0.0223 -0.0492 0.0437  447 THR C C   
1417 O O   . THR C 5  ? 0.5395 0.4094 0.4512 -0.0243 -0.0525 0.0337  447 THR C O   
1418 C CB  . THR C 5  ? 0.5880 0.4009 0.5033 -0.0296 -0.0446 0.0367  447 THR C CB  
1419 O OG1 . THR C 5  ? 0.6203 0.4017 0.5351 -0.0237 -0.0376 0.0410  447 THR C OG1 
1420 C CG2 . THR C 5  ? 0.5844 0.4113 0.5115 -0.0469 -0.0511 0.0405  447 THR C CG2 
1421 N N   . LEU C 6  ? 0.5023 0.3926 0.4363 -0.0235 -0.0506 0.0529  448 LEU C N   
1422 C CA  . LEU C 6  ? 0.4851 0.3989 0.4219 -0.0245 -0.0548 0.0529  448 LEU C CA  
1423 C C   . LEU C 6  ? 0.4812 0.4092 0.4294 -0.0337 -0.0577 0.0564  448 LEU C C   
1424 O O   . LEU C 6  ? 0.4893 0.4161 0.4441 -0.0367 -0.0546 0.0631  448 LEU C O   
1425 C CB  . LEU C 6  ? 0.4633 0.3886 0.4023 -0.0155 -0.0521 0.0593  448 LEU C CB  
1426 C CG  . LEU C 6  ? 0.4691 0.3897 0.4026 -0.0062 -0.0480 0.0593  448 LEU C CG  
1427 C CD1 . LEU C 6  ? 0.4462 0.3813 0.3853 -0.0025 -0.0474 0.0662  448 LEU C CD1 
1428 C CD2 . LEU C 6  ? 0.4742 0.3920 0.3958 -0.0047 -0.0484 0.0512  448 LEU C CD2 
1429 N N   . LYS C 7  ? 0.4744 0.4189 0.4252 -0.0370 -0.0633 0.0535  449 LYS C N   
1430 C CA  . LYS C 7  ? 0.4682 0.4335 0.4336 -0.0429 -0.0650 0.0582  449 LYS C CA  
1431 C C   . LYS C 7  ? 0.4532 0.4326 0.4223 -0.0326 -0.0616 0.0635  449 LYS C C   
1432 O O   . LYS C 7  ? 0.4601 0.4359 0.4214 -0.0245 -0.0615 0.0627  449 LYS C O   
1433 C CB  . LYS C 7  ? 0.4787 0.4573 0.4474 -0.0517 -0.0740 0.0533  449 LYS C CB  
1434 C CG  . LYS C 7  ? 0.5165 0.4728 0.4725 -0.0611 -0.0782 0.0428  449 LYS C CG  
1435 C CD  . LYS C 7  ? 0.5607 0.5277 0.5250 -0.0786 -0.0873 0.0388  449 LYS C CD  
1436 C CE  . LYS C 7  ? 0.5932 0.5285 0.5408 -0.0891 -0.0905 0.0256  449 LYS C CE  
1437 N NZ  . LYS C 7  ? 0.6148 0.5567 0.5713 -0.1110 -0.1004 0.0209  449 LYS C NZ  
1438 N N   . ILE C 8  ? 0.4439 0.4370 0.4239 -0.0331 -0.0577 0.0689  450 ILE C N   
1439 C CA  . ILE C 8  ? 0.4273 0.4276 0.4075 -0.0229 -0.0531 0.0714  450 ILE C CA  
1440 C C   . ILE C 8  ? 0.4213 0.4454 0.4158 -0.0199 -0.0526 0.0745  450 ILE C C   
1441 O O   . ILE C 8  ? 0.4239 0.4648 0.4320 -0.0270 -0.0520 0.0779  450 ILE C O   
1442 C CB  . ILE C 8  ? 0.4298 0.4230 0.4040 -0.0215 -0.0463 0.0740  450 ILE C CB  
1443 C CG1 . ILE C 8  ? 0.4235 0.3995 0.3855 -0.0190 -0.0476 0.0725  450 ILE C CG1 
1444 C CG2 . ILE C 8  ? 0.4229 0.4243 0.3967 -0.0134 -0.0406 0.0741  450 ILE C CG2 
1445 C CD1 . ILE C 8  ? 0.4344 0.3979 0.3941 -0.0236 -0.0483 0.0744  450 ILE C CD1 
1446 N N   . LYS C 9  ? 0.4119 0.4381 0.4053 -0.0091 -0.0525 0.0748  451 LYS C N   
1447 C CA  . LYS C 9  ? 0.4103 0.4589 0.4185 -0.0015 -0.0514 0.0793  451 LYS C CA  
1448 C C   . LYS C 9  ? 0.4126 0.4519 0.4160 0.0119  -0.0428 0.0789  451 LYS C C   
1449 O O   . LYS C 9  ? 0.4150 0.4313 0.4039 0.0145  -0.0425 0.0755  451 LYS C O   
1450 C CB  . LYS C 9  ? 0.4071 0.4650 0.4177 0.0000  -0.0611 0.0814  451 LYS C CB  
1451 C CG  . LYS C 9  ? 0.4273 0.5174 0.4584 0.0060  -0.0635 0.0888  451 LYS C CG  
1452 C CD  . LYS C 9  ? 0.4760 0.5725 0.5040 0.0114  -0.0730 0.0930  451 LYS C CD  
1453 C CE  . LYS C 9  ? 0.5310 0.6673 0.5801 0.0105  -0.0816 0.1004  451 LYS C CE  
1454 N NZ  . LYS C 9  ? 0.5582 0.7020 0.5980 0.0099  -0.0947 0.1031  451 LYS C NZ  
1455 N N   . TYR C 10 ? 0.4140 0.4706 0.4296 0.0198  -0.0351 0.0819  452 TYR C N   
1456 C CA  . TYR C 10 ? 0.4279 0.4729 0.4378 0.0347  -0.0256 0.0795  452 TYR C CA  
1457 C C   . TYR C 10 ? 0.4352 0.4968 0.4619 0.0491  -0.0256 0.0867  452 TYR C C   
1458 O O   . TYR C 10 ? 0.4424 0.5278 0.4855 0.0583  -0.0179 0.0908  452 TYR C O   
1459 C CB  . TYR C 10 ? 0.4347 0.4847 0.4418 0.0371  -0.0134 0.0767  452 TYR C CB  
1460 C CG  . TYR C 10 ? 0.4276 0.4696 0.4211 0.0239  -0.0134 0.0740  452 TYR C CG  
1461 C CD1 . TYR C 10 ? 0.4329 0.4926 0.4302 0.0206  -0.0051 0.0774  452 TYR C CD1 
1462 C CD2 . TYR C 10 ? 0.4316 0.4509 0.4097 0.0157  -0.0208 0.0703  452 TYR C CD2 
1463 C CE1 . TYR C 10 ? 0.4384 0.4904 0.4225 0.0098  -0.0050 0.0780  452 TYR C CE1 
1464 C CE2 . TYR C 10 ? 0.4391 0.4531 0.4067 0.0062  -0.0211 0.0704  452 TYR C CE2 
1465 C CZ  . TYR C 10 ? 0.4539 0.4827 0.4235 0.0035  -0.0136 0.0746  452 TYR C CZ  
1466 O OH  . TYR C 10 ? 0.4000 0.4230 0.3584 -0.0047 -0.0141 0.0776  452 TYR C OH  
1467 N N   . PRO C 11 ? 0.4420 0.4930 0.4651 0.0525  -0.0332 0.0899  453 PRO C N   
1468 C CA  . PRO C 11 ? 0.4500 0.5211 0.4894 0.0649  -0.0371 0.1005  453 PRO C CA  
1469 C C   . PRO C 11 ? 0.4725 0.5489 0.5241 0.0858  -0.0252 0.1043  453 PRO C C   
1470 O O   . PRO C 11 ? 0.4728 0.5817 0.5472 0.0966  -0.0266 0.1151  453 PRO C O   
1471 C CB  . PRO C 11 ? 0.4524 0.4988 0.4769 0.0658  -0.0433 0.1027  453 PRO C CB  
1472 C CG  . PRO C 11 ? 0.4508 0.4761 0.4569 0.0501  -0.0456 0.0937  453 PRO C CG  
1473 C CD  . PRO C 11 ? 0.4450 0.4649 0.4481 0.0464  -0.0372 0.0854  453 PRO C CD  
1474 N N   . HIS C 12 ? 0.4925 0.5375 0.5284 0.0919  -0.0137 0.0951  454 HIS C N   
1475 C CA  . HIS C 12 ? 0.5232 0.5625 0.5641 0.1135  0.0004  0.0949  454 HIS C CA  
1476 C C   . HIS C 12 ? 0.5193 0.5945 0.5773 0.1186  0.0107  0.0960  454 HIS C C   
1477 O O   . HIS C 12 ? 0.5338 0.6167 0.6029 0.1397  0.0234  0.0985  454 HIS C O   
1478 C CB  . HIS C 12 ? 0.5484 0.5378 0.5616 0.1150  0.0081  0.0815  454 HIS C CB  
1479 C CG  . HIS C 12 ? 0.5788 0.5581 0.5724 0.0970  0.0079  0.0694  454 HIS C CG  
1480 N ND1 . HIS C 12 ? 0.5503 0.5380 0.5413 0.0775  -0.0036 0.0705  454 HIS C ND1 
1481 C CD2 . HIS C 12 ? 0.6248 0.5865 0.5990 0.0970  0.0177  0.0566  454 HIS C CD2 
1482 C CE1 . HIS C 12 ? 0.5719 0.5495 0.5459 0.0671  -0.0012 0.0612  454 HIS C CE1 
1483 N NE2 . HIS C 12 ? 0.6087 0.5718 0.5710 0.0776  0.0108  0.0526  454 HIS C NE2 
1484 N N   . GLN C 13 ? 0.5029 0.6001 0.5643 0.0998  0.0062  0.0953  455 GLN C N   
1485 C CA  . GLN C 13 ? 0.5004 0.6322 0.5775 0.1001  0.0165  0.0980  455 GLN C CA  
1486 C C   . GLN C 13 ? 0.4892 0.6702 0.5981 0.0906  0.0070  0.1107  455 GLN C C   
1487 O O   . GLN C 13 ? 0.4909 0.7121 0.6276 0.1011  0.0142  0.1199  455 GLN C O   
1488 C CB  . GLN C 13 ? 0.4988 0.6152 0.5536 0.0851  0.0208  0.0886  455 GLN C CB  
1489 C CG  . GLN C 13 ? 0.5038 0.5758 0.5256 0.0907  0.0281  0.0746  455 GLN C CG  
1490 C CD  . GLN C 13 ? 0.4826 0.5498 0.4840 0.0796  0.0339  0.0680  455 GLN C CD  
1491 O OE1 . GLN C 13 ? 0.4648 0.5442 0.4690 0.0624  0.0271  0.0728  455 GLN C OE1 
1492 N NE2 . GLN C 13 ? 0.4857 0.5329 0.4641 0.0897  0.0466  0.0569  455 GLN C NE2 
1493 N N   . LEU C 14 ? 0.4808 0.6592 0.5857 0.0704  -0.0090 0.1105  456 LEU C N   
1494 C CA  . LEU C 14 ? 0.4729 0.6911 0.6023 0.0554  -0.0204 0.1188  456 LEU C CA  
1495 C C   . LEU C 14 ? 0.4750 0.6844 0.5966 0.0465  -0.0388 0.1186  456 LEU C C   
1496 O O   . LEU C 14 ? 0.4733 0.6441 0.5690 0.0458  -0.0416 0.1114  456 LEU C O   
1497 C CB  . LEU C 14 ? 0.4677 0.6902 0.5962 0.0346  -0.0179 0.1165  456 LEU C CB  
1498 C CG  . LEU C 14 ? 0.4607 0.7257 0.6181 0.0164  -0.0247 0.1251  456 LEU C CG  
1499 C CD1 . LEU C 14 ? 0.4481 0.7647 0.6410 0.0287  -0.0161 0.1373  456 LEU C CD1 
1500 C CD2 . LEU C 14 ? 0.4397 0.6928 0.5888 -0.0036 -0.0210 0.1228  456 LEU C CD2 
1501 N N   . ASP C 15 ? 0.4819 0.7299 0.6258 0.0390  -0.0512 0.1266  457 ASP C N   
1502 C CA  . ASP C 15 ? 0.4890 0.7350 0.6239 0.0311  -0.0691 0.1265  457 ASP C CA  
1503 C C   . ASP C 15 ? 0.4851 0.7229 0.6096 0.0041  -0.0795 0.1177  457 ASP C C   
1504 O O   . ASP C 15 ? 0.4955 0.7370 0.6126 -0.0059 -0.0948 0.1157  457 ASP C O   
1505 C CB  . ASP C 15 ? 0.4925 0.7864 0.6548 0.0397  -0.0788 0.1403  457 ASP C CB  
1506 C CG  . ASP C 15 ? 0.5316 0.8188 0.6783 0.0429  -0.0933 0.1432  457 ASP C CG  
1507 O OD1 . ASP C 15 ? 0.5628 0.8123 0.6792 0.0346  -0.0967 0.1334  457 ASP C OD1 
1508 O OD2 . ASP C 15 ? 0.6176 0.9407 0.7831 0.0549  -0.1010 0.1569  457 ASP C OD2 
1509 N N   . GLN C 16 ? 0.4786 0.7034 0.6006 -0.0069 -0.0708 0.1126  458 GLN C N   
1510 C CA  . GLN C 16 ? 0.4757 0.6876 0.5894 -0.0309 -0.0782 0.1053  458 GLN C CA  
1511 C C   . GLN C 16 ? 0.4695 0.6370 0.5580 -0.0330 -0.0696 0.0971  458 GLN C C   
1512 O O   . GLN C 16 ? 0.4649 0.6193 0.5462 -0.0198 -0.0573 0.0976  458 GLN C O   
1513 C CB  . GLN C 16 ? 0.4761 0.7235 0.6184 -0.0477 -0.0791 0.1113  458 GLN C CB  
1514 C CG  . GLN C 16 ? 0.4907 0.7838 0.6573 -0.0556 -0.0947 0.1174  458 GLN C CG  
1515 C CD  . GLN C 16 ? 0.5330 0.8778 0.7355 -0.0417 -0.0882 0.1321  458 GLN C CD  
1516 O OE1 . GLN C 16 ? 0.5692 0.9134 0.7766 -0.0261 -0.0702 0.1362  458 GLN C OE1 
1517 N NE2 . GLN C 16 ? 0.5374 0.9288 0.7644 -0.0466 -0.1028 0.1399  458 GLN C NE2 
1518 N N   . LYS C 17 ? 0.4717 0.6163 0.5459 -0.0489 -0.0766 0.0895  459 LYS C N   
1519 C CA  . LYS C 17 ? 0.4681 0.5742 0.5212 -0.0504 -0.0700 0.0838  459 LYS C CA  
1520 C C   . LYS C 17 ? 0.4606 0.5679 0.5210 -0.0544 -0.0585 0.0893  459 LYS C C   
1521 O O   . LYS C 17 ? 0.4599 0.5900 0.5403 -0.0663 -0.0578 0.0953  459 LYS C O   
1522 C CB  . LYS C 17 ? 0.4822 0.5632 0.5193 -0.0634 -0.0789 0.0746  459 LYS C CB  
1523 C CG  . LYS C 17 ? 0.4915 0.5604 0.5096 -0.0545 -0.0850 0.0687  459 LYS C CG  
1524 C CD  . LYS C 17 ? 0.5391 0.6018 0.5467 -0.0679 -0.0968 0.0595  459 LYS C CD  
1525 C CE  . LYS C 17 ? 0.5654 0.6250 0.5542 -0.0583 -0.1023 0.0562  459 LYS C CE  
1526 N NZ  . LYS C 17 ? 0.5861 0.6444 0.5610 -0.0712 -0.1147 0.0459  459 LYS C NZ  
1527 N N   . VAL C 18 ? 0.4578 0.5424 0.5016 -0.0452 -0.0499 0.0881  460 VAL C N   
1528 C CA  . VAL C 18 ? 0.4585 0.5459 0.5029 -0.0438 -0.0377 0.0940  460 VAL C CA  
1529 C C   . VAL C 18 ? 0.4687 0.5316 0.5021 -0.0548 -0.0365 0.0955  460 VAL C C   
1530 O O   . VAL C 18 ? 0.4746 0.5456 0.5154 -0.0628 -0.0296 0.1040  460 VAL C O   
1531 C CB  . VAL C 18 ? 0.4525 0.5338 0.4837 -0.0260 -0.0297 0.0914  460 VAL C CB  
1532 C CG1 . VAL C 18 ? 0.4590 0.5373 0.4805 -0.0248 -0.0185 0.0948  460 VAL C CG1 
1533 C CG2 . VAL C 18 ? 0.4590 0.5651 0.5052 -0.0134 -0.0271 0.0931  460 VAL C CG2 
1534 N N   . LEU C 19 ? 0.4742 0.5084 0.4912 -0.0541 -0.0421 0.0892  461 LEU C N   
1535 C CA  . LEU C 19 ? 0.4931 0.5017 0.4998 -0.0599 -0.0406 0.0918  461 LEU C CA  
1536 C C   . LEU C 19 ? 0.5000 0.4821 0.4940 -0.0583 -0.0472 0.0837  461 LEU C C   
1537 O O   . LEU C 19 ? 0.4925 0.4762 0.4816 -0.0512 -0.0517 0.0768  461 LEU C O   
1538 C CB  . LEU C 19 ? 0.4878 0.4938 0.4828 -0.0516 -0.0324 0.0977  461 LEU C CB  
1539 C CG  . LEU C 19 ? 0.4911 0.4910 0.4717 -0.0385 -0.0333 0.0917  461 LEU C CG  
1540 C CD1 . LEU C 19 ? 0.5268 0.5054 0.4946 -0.0367 -0.0353 0.0934  461 LEU C CD1 
1541 C CD2 . LEU C 19 ? 0.5078 0.5221 0.4834 -0.0310 -0.0256 0.0928  461 LEU C CD2 
1542 N N   . GLU C 20 ? 0.5216 0.4793 0.5104 -0.0638 -0.0464 0.0857  462 GLU C N   
1543 C CA  . GLU C 20 ? 0.5388 0.4697 0.5149 -0.0590 -0.0492 0.0790  462 GLU C CA  
1544 C C   . GLU C 20 ? 0.5404 0.4589 0.5081 -0.0491 -0.0442 0.0864  462 GLU C C   
1545 O O   . GLU C 20 ? 0.5470 0.4646 0.5163 -0.0515 -0.0396 0.0973  462 GLU C O   
1546 C CB  . GLU C 20 ? 0.5609 0.4689 0.5369 -0.0715 -0.0523 0.0737  462 GLU C CB  
1547 C CG  . GLU C 20 ? 0.5894 0.5074 0.5673 -0.0799 -0.0609 0.0626  462 GLU C CG  
1548 C CD  . GLU C 20 ? 0.6786 0.5691 0.6511 -0.0940 -0.0653 0.0533  462 GLU C CD  
1549 O OE1 . GLU C 20 ? 0.7194 0.5748 0.6809 -0.0903 -0.0607 0.0516  462 GLU C OE1 
1550 O OE2 . GLU C 20 ? 0.6989 0.6029 0.6782 -0.1087 -0.0738 0.0475  462 GLU C OE2 
1551 N N   . LYS C 21 ? 0.5346 0.4471 0.4941 -0.0382 -0.0454 0.0821  463 LYS C N   
1552 C CA  . LYS C 21 ? 0.5388 0.4457 0.4934 -0.0285 -0.0427 0.0897  463 LYS C CA  
1553 C C   . LYS C 21 ? 0.5459 0.4349 0.4958 -0.0204 -0.0423 0.0851  463 LYS C C   
1554 O O   . LYS C 21 ? 0.5373 0.4283 0.4838 -0.0182 -0.0442 0.0755  463 LYS C O   
1555 C CB  . LYS C 21 ? 0.5230 0.4506 0.4751 -0.0228 -0.0437 0.0908  463 LYS C CB  
1556 C CG  . LYS C 21 ? 0.5445 0.4842 0.4943 -0.0246 -0.0413 0.0993  463 LYS C CG  
1557 C CD  . LYS C 21 ? 0.6518 0.5852 0.5972 -0.0202 -0.0406 0.1111  463 LYS C CD  
1558 C CE  . LYS C 21 ? 0.7097 0.6543 0.6489 -0.0232 -0.0376 0.1209  463 LYS C CE  
1559 N NZ  . LYS C 21 ? 0.7516 0.6897 0.6866 -0.0189 -0.0374 0.1360  463 LYS C NZ  
1560 N N   . GLN C 22 ? 0.5569 0.4291 0.5064 -0.0146 -0.0389 0.0931  464 GLN C N   
1561 C CA  . GLN C 22 ? 0.5670 0.4265 0.5140 -0.0020 -0.0360 0.0912  464 GLN C CA  
1562 C C   . GLN C 22 ? 0.5491 0.4321 0.5001 0.0078  -0.0371 0.0993  464 GLN C C   
1563 O O   . GLN C 22 ? 0.5557 0.4468 0.5093 0.0103  -0.0380 0.1120  464 GLN C O   
1564 C CB  . GLN C 22 ? 0.5997 0.4274 0.5461 0.0020  -0.0310 0.0965  464 GLN C CB  
1565 C CG  . GLN C 22 ? 0.6418 0.4400 0.5823 -0.0088 -0.0304 0.0843  464 GLN C CG  
1566 C CD  . GLN C 22 ? 0.7037 0.4617 0.6418 -0.0041 -0.0242 0.0883  464 GLN C CD  
1567 O OE1 . GLN C 22 ? 0.7148 0.4657 0.6584 -0.0040 -0.0221 0.1043  464 GLN C OE1 
1568 N NE2 . GLN C 22 ? 0.7348 0.4640 0.6626 0.0006  -0.0206 0.0738  464 GLN C NE2 
1569 N N   . LEU C 23 ? 0.5293 0.4248 0.4802 0.0117  -0.0378 0.0924  465 LEU C N   
1570 C CA  . LEU C 23 ? 0.5061 0.4256 0.4629 0.0173  -0.0398 0.0985  465 LEU C CA  
1571 C C   . LEU C 23 ? 0.5051 0.4248 0.4663 0.0299  -0.0345 0.0985  465 LEU C C   
1572 O O   . LEU C 23 ? 0.5120 0.4191 0.4664 0.0317  -0.0302 0.0882  465 LEU C O   
1573 C CB  . LEU C 23 ? 0.4863 0.4218 0.4412 0.0093  -0.0440 0.0923  465 LEU C CB  
1574 C CG  . LEU C 23 ? 0.4738 0.4131 0.4250 -0.0004 -0.0471 0.0909  465 LEU C CG  
1575 C CD1 . LEU C 23 ? 0.4362 0.3846 0.3857 -0.0042 -0.0492 0.0841  465 LEU C CD1 
1576 C CD2 . LEU C 23 ? 0.4375 0.3864 0.3875 -0.0012 -0.0495 0.1001  465 LEU C CD2 
1577 N N   . PRO C 24 ? 0.4970 0.4338 0.4693 0.0390  -0.0345 0.1103  466 PRO C N   
1578 C CA  . PRO C 24 ? 0.4982 0.4422 0.4786 0.0526  -0.0277 0.1120  466 PRO C CA  
1579 C C   . PRO C 24 ? 0.4810 0.4397 0.4605 0.0484  -0.0266 0.1047  466 PRO C C   
1580 O O   . PRO C 24 ? 0.4600 0.4335 0.4401 0.0368  -0.0333 0.1043  466 PRO C O   
1581 C CB  . PRO C 24 ? 0.4938 0.4643 0.4903 0.0596  -0.0313 0.1286  466 PRO C CB  
1582 C CG  . PRO C 24 ? 0.4998 0.4635 0.4910 0.0537  -0.0377 0.1355  466 PRO C CG  
1583 C CD  . PRO C 24 ? 0.4915 0.4450 0.4693 0.0378  -0.0409 0.1234  466 PRO C CD  
1584 N N   . GLY C 25 ? 0.4899 0.4421 0.4661 0.0585  -0.0172 0.0992  467 GLY C N   
1585 C CA  . GLY C 25 ? 0.4782 0.4435 0.4512 0.0561  -0.0140 0.0944  467 GLY C CA  
1586 C C   . GLY C 25 ? 0.4564 0.4563 0.4472 0.0525  -0.0168 0.1055  467 GLY C C   
1587 O O   . GLY C 25 ? 0.4476 0.4565 0.4362 0.0424  -0.0191 0.1038  467 GLY C O   
1588 N N   . SER C 26 ? 0.4473 0.4665 0.4564 0.0599  -0.0173 0.1177  468 SER C N   
1589 C CA  . SER C 26 ? 0.4303 0.4868 0.4598 0.0543  -0.0220 0.1292  468 SER C CA  
1590 C C   . SER C 26 ? 0.4185 0.4808 0.4468 0.0363  -0.0360 0.1297  468 SER C C   
1591 O O   . SER C 26 ? 0.4148 0.5035 0.4566 0.0267  -0.0419 0.1361  468 SER C O   
1592 C CB  . SER C 26 ? 0.4385 0.5196 0.4903 0.0699  -0.0185 0.1435  468 SER C CB  
1593 O OG  . SER C 26 ? 0.4236 0.4931 0.4738 0.0755  -0.0238 0.1485  468 SER C OG  
1594 N N   . MET C 27 ? 0.4198 0.4575 0.4317 0.0312  -0.0407 0.1225  469 MET C N   
1595 C CA  . MET C 27 ? 0.4160 0.4544 0.4213 0.0165  -0.0513 0.1201  469 MET C CA  
1596 C C   . MET C 27 ? 0.4133 0.4545 0.4171 0.0040  -0.0532 0.1148  469 MET C C   
1597 O O   . MET C 27 ? 0.4140 0.4411 0.4099 0.0044  -0.0477 0.1083  469 MET C O   
1598 C CB  . MET C 27 ? 0.4186 0.4310 0.4072 0.0149  -0.0519 0.1132  469 MET C CB  
1599 C CG  . MET C 27 ? 0.4206 0.4345 0.4005 0.0038  -0.0602 0.1115  469 MET C CG  
1600 S SD  . MET C 27 ? 0.4854 0.4781 0.4517 0.0046  -0.0585 0.1097  469 MET C SD  
1601 C CE  . MET C 27 ? 0.4201 0.4233 0.3752 -0.0055 -0.0666 0.1096  469 MET C CE  
1602 N N   . THR C 28 ? 0.4171 0.4753 0.4274 -0.0076 -0.0617 0.1179  470 THR C N   
1603 C CA  . THR C 28 ? 0.4210 0.4763 0.4299 -0.0211 -0.0638 0.1135  470 THR C CA  
1604 C C   . THR C 28 ? 0.4283 0.4569 0.4178 -0.0266 -0.0659 0.1022  470 THR C C   
1605 O O   . THR C 28 ? 0.4294 0.4496 0.4083 -0.0239 -0.0680 0.0988  470 THR C O   
1606 C CB  . THR C 28 ? 0.4239 0.5040 0.4464 -0.0347 -0.0730 0.1191  470 THR C CB  
1607 O OG1 . THR C 28 ? 0.4386 0.5211 0.4522 -0.0400 -0.0835 0.1168  470 THR C OG1 
1608 C CG2 . THR C 28 ? 0.4105 0.5249 0.4581 -0.0281 -0.0700 0.1328  470 THR C CG2 
1609 N N   . ILE C 29 ? 0.4381 0.4544 0.4241 -0.0334 -0.0643 0.0982  471 ILE C N   
1610 C CA  . ILE C 29 ? 0.4496 0.4415 0.4201 -0.0353 -0.0643 0.0887  471 ILE C CA  
1611 C C   . ILE C 29 ? 0.4623 0.4492 0.4226 -0.0435 -0.0714 0.0819  471 ILE C C   
1612 O O   . ILE C 29 ? 0.4641 0.4377 0.4114 -0.0399 -0.0699 0.0751  471 ILE C O   
1613 C CB  . ILE C 29 ? 0.4581 0.4369 0.4283 -0.0390 -0.0607 0.0889  471 ILE C CB  
1614 C CG1 . ILE C 29 ? 0.4523 0.4370 0.4266 -0.0303 -0.0533 0.0952  471 ILE C CG1 
1615 C CG2 . ILE C 29 ? 0.4706 0.4251 0.4275 -0.0382 -0.0602 0.0805  471 ILE C CG2 
1616 C CD1 . ILE C 29 ? 0.4264 0.4065 0.3926 -0.0186 -0.0502 0.0913  471 ILE C CD1 
1617 N N   . GLN C 30 ? 0.4707 0.4709 0.4366 -0.0551 -0.0789 0.0838  472 GLN C N   
1618 C CA  . GLN C 30 ? 0.4910 0.4874 0.4424 -0.0641 -0.0869 0.0756  472 GLN C CA  
1619 C C   . GLN C 30 ? 0.4841 0.4910 0.4274 -0.0567 -0.0889 0.0777  472 GLN C C   
1620 O O   . GLN C 30 ? 0.4984 0.4953 0.4224 -0.0587 -0.0905 0.0694  472 GLN C O   
1621 C CB  . GLN C 30 ? 0.5102 0.5195 0.4685 -0.0817 -0.0970 0.0761  472 GLN C CB  
1622 C CG  . GLN C 30 ? 0.5294 0.5770 0.5056 -0.0831 -0.1043 0.0885  472 GLN C CG  
1623 C CD  . GLN C 30 ? 0.5996 0.6625 0.5755 -0.1030 -0.1188 0.0857  472 GLN C CD  
1624 O OE1 . GLN C 30 ? 0.6360 0.6751 0.5927 -0.1157 -0.1231 0.0715  472 GLN C OE1 
1625 N NE2 . GLN C 30 ? 0.5991 0.7020 0.5961 -0.1056 -0.1265 0.0987  472 GLN C NE2 
1626 N N   . LYS C 31 ? 0.4672 0.4919 0.4238 -0.0472 -0.0872 0.0891  473 LYS C N   
1627 C CA  . LYS C 31 ? 0.4655 0.4964 0.4159 -0.0390 -0.0877 0.0945  473 LYS C CA  
1628 C C   . LYS C 31 ? 0.4600 0.4701 0.4009 -0.0309 -0.0787 0.0901  473 LYS C C   
1629 O O   . LYS C 31 ? 0.4680 0.4761 0.3972 -0.0287 -0.0782 0.0909  473 LYS C O   
1630 C CB  . LYS C 31 ? 0.4561 0.5085 0.4247 -0.0298 -0.0880 0.1089  473 LYS C CB  
1631 C CG  . LYS C 31 ? 0.4562 0.5400 0.4385 -0.0370 -0.0984 0.1170  473 LYS C CG  
1632 C CD  . LYS C 31 ? 0.4761 0.5692 0.4422 -0.0478 -0.1106 0.1145  473 LYS C CD  
1633 C CE  . LYS C 31 ? 0.5069 0.6332 0.4879 -0.0598 -0.1235 0.1204  473 LYS C CE  
1634 N NZ  . LYS C 31 ? 0.5266 0.6569 0.4863 -0.0758 -0.1369 0.1118  473 LYS C NZ  
1635 N N   . VAL C 32 ? 0.4487 0.4465 0.3952 -0.0274 -0.0721 0.0868  474 VAL C N   
1636 C CA  . VAL C 32 ? 0.4443 0.4266 0.3846 -0.0223 -0.0654 0.0820  474 VAL C CA  
1637 C C   . VAL C 32 ? 0.4549 0.4275 0.3812 -0.0264 -0.0651 0.0730  474 VAL C C   
1638 O O   . VAL C 32 ? 0.4583 0.4285 0.3768 -0.0237 -0.0615 0.0718  474 VAL C O   
1639 C CB  . VAL C 32 ? 0.4338 0.4089 0.3812 -0.0183 -0.0606 0.0807  474 VAL C CB  
1640 C CG1 . VAL C 32 ? 0.4282 0.3933 0.3714 -0.0148 -0.0564 0.0766  474 VAL C CG1 
1641 C CG2 . VAL C 32 ? 0.4269 0.4096 0.3845 -0.0124 -0.0585 0.0874  474 VAL C CG2 
1642 N N   . LYS C 33 ? 0.4648 0.4308 0.3878 -0.0329 -0.0677 0.0669  475 LYS C N   
1643 C CA  . LYS C 33 ? 0.4905 0.4425 0.3975 -0.0356 -0.0664 0.0562  475 LYS C CA  
1644 C C   . LYS C 33 ? 0.5116 0.4715 0.4026 -0.0386 -0.0697 0.0544  475 LYS C C   
1645 O O   . LYS C 33 ? 0.5238 0.4767 0.4004 -0.0352 -0.0642 0.0479  475 LYS C O   
1646 C CB  . LYS C 33 ? 0.5051 0.4433 0.4106 -0.0441 -0.0694 0.0500  475 LYS C CB  
1647 C CG  . LYS C 33 ? 0.5079 0.4340 0.4236 -0.0396 -0.0642 0.0523  475 LYS C CG  
1648 C CD  . LYS C 33 ? 0.5431 0.4502 0.4564 -0.0491 -0.0661 0.0476  475 LYS C CD  
1649 C CE  . LYS C 33 ? 0.5274 0.4218 0.4491 -0.0434 -0.0605 0.0529  475 LYS C CE  
1650 N NZ  . LYS C 33 ? 0.5726 0.4472 0.4945 -0.0549 -0.0623 0.0519  475 LYS C NZ  
1651 N N   . GLY C 34 ? 0.5177 0.4953 0.4116 -0.0436 -0.0781 0.0615  476 GLY C N   
1652 C CA  . GLY C 34 ? 0.5328 0.5227 0.4108 -0.0459 -0.0829 0.0635  476 GLY C CA  
1653 C C   . GLY C 34 ? 0.5325 0.5233 0.4057 -0.0368 -0.0748 0.0693  476 GLY C C   
1654 O O   . GLY C 34 ? 0.5522 0.5406 0.4054 -0.0367 -0.0711 0.0641  476 GLY C O   
1655 N N   . LEU C 35 ? 0.5147 0.5080 0.4052 -0.0301 -0.0712 0.0797  477 LEU C N   
1656 C CA  . LEU C 35 ? 0.5187 0.5105 0.4090 -0.0244 -0.0636 0.0864  477 LEU C CA  
1657 C C   . LEU C 35 ? 0.5240 0.5070 0.4084 -0.0228 -0.0546 0.0775  477 LEU C C   
1658 O O   . LEU C 35 ? 0.5330 0.5202 0.4069 -0.0218 -0.0488 0.0799  477 LEU C O   
1659 C CB  . LEU C 35 ? 0.5044 0.4930 0.4138 -0.0192 -0.0615 0.0947  477 LEU C CB  
1660 C CG  . LEU C 35 ? 0.5175 0.5008 0.4303 -0.0163 -0.0552 0.1030  477 LEU C CG  
1661 C CD1 . LEU C 35 ? 0.5271 0.5040 0.4536 -0.0111 -0.0556 0.1106  477 LEU C CD1 
1662 C CD2 . LEU C 35 ? 0.5171 0.4941 0.4329 -0.0176 -0.0482 0.0963  477 LEU C CD2 
1663 N N   . LEU C 36 ? 0.5218 0.4950 0.4140 -0.0217 -0.0526 0.0693  478 LEU C N   
1664 C CA  . LEU C 36 ? 0.5294 0.4974 0.4206 -0.0173 -0.0442 0.0627  478 LEU C CA  
1665 C C   . LEU C 36 ? 0.5570 0.5206 0.4270 -0.0170 -0.0406 0.0528  478 LEU C C   
1666 O O   . LEU C 36 ? 0.5660 0.5326 0.4316 -0.0116 -0.0311 0.0507  478 LEU C O   
1667 C CB  . LEU C 36 ? 0.5191 0.4782 0.4229 -0.0146 -0.0441 0.0588  478 LEU C CB  
1668 C CG  . LEU C 36 ? 0.4905 0.4524 0.4110 -0.0138 -0.0460 0.0653  478 LEU C CG  
1669 C CD1 . LEU C 36 ? 0.4453 0.3995 0.3721 -0.0116 -0.0472 0.0623  478 LEU C CD1 
1670 C CD2 . LEU C 36 ? 0.4321 0.4016 0.3606 -0.0125 -0.0414 0.0697  478 LEU C CD2 
1671 N N   . SER C 37 ? 0.5736 0.5310 0.4305 -0.0234 -0.0481 0.0461  479 SER C N   
1672 C CA  . SER C 37 ? 0.6077 0.5564 0.4384 -0.0251 -0.0463 0.0333  479 SER C CA  
1673 C C   . SER C 37 ? 0.6242 0.5876 0.4360 -0.0245 -0.0432 0.0374  479 SER C C   
1674 O O   . SER C 37 ? 0.6491 0.6088 0.4425 -0.0196 -0.0335 0.0290  479 SER C O   
1675 C CB  . SER C 37 ? 0.6215 0.5613 0.4437 -0.0363 -0.0577 0.0254  479 SER C CB  
1676 O OG  . SER C 37 ? 0.6744 0.6070 0.4658 -0.0410 -0.0588 0.0123  479 SER C OG  
1677 N N   . ARG C 38 ? 0.6153 0.5950 0.4313 -0.0281 -0.0501 0.0513  480 ARG C N   
1678 C CA  . ARG C 38 ? 0.6337 0.6283 0.4329 -0.0273 -0.0472 0.0603  480 ARG C CA  
1679 C C   . ARG C 38 ? 0.6284 0.6279 0.4365 -0.0205 -0.0330 0.0677  480 ARG C C   
1680 O O   . ARG C 38 ? 0.6483 0.6573 0.4386 -0.0186 -0.0249 0.0708  480 ARG C O   
1681 C CB  . ARG C 38 ? 0.6243 0.6335 0.4291 -0.0307 -0.0581 0.0766  480 ARG C CB  
1682 C CG  . ARG C 38 ? 0.6463 0.6622 0.4393 -0.0391 -0.0732 0.0721  480 ARG C CG  
1683 C CD  . ARG C 38 ? 0.6461 0.6825 0.4472 -0.0390 -0.0834 0.0915  480 ARG C CD  
1684 N NE  . ARG C 38 ? 0.6475 0.6821 0.4804 -0.0332 -0.0822 0.1028  480 ARG C NE  
1685 C CZ  . ARG C 38 ? 0.6573 0.6925 0.5103 -0.0349 -0.0882 0.1010  480 ARG C CZ  
1686 N NH1 . ARG C 38 ? 0.6632 0.7009 0.5115 -0.0443 -0.0968 0.0897  480 ARG C NH1 
1687 N NH2 . ARG C 38 ? 0.6257 0.6580 0.5027 -0.0278 -0.0848 0.1102  480 ARG C NH2 
1688 N N   . LEU C 39 ? 0.6030 0.5985 0.4384 -0.0179 -0.0304 0.0711  481 LEU C N   
1689 C CA  . LEU C 39 ? 0.5949 0.5981 0.4445 -0.0145 -0.0192 0.0782  481 LEU C CA  
1690 C C   . LEU C 39 ? 0.6046 0.6085 0.4518 -0.0073 -0.0075 0.0675  481 LEU C C   
1691 O O   . LEU C 39 ? 0.6098 0.6280 0.4569 -0.0042 0.0044  0.0727  481 LEU C O   
1692 C CB  . LEU C 39 ? 0.5677 0.5673 0.4451 -0.0160 -0.0229 0.0844  481 LEU C CB  
1693 C CG  . LEU C 39 ? 0.5555 0.5633 0.4526 -0.0161 -0.0150 0.0899  481 LEU C CG  
1694 C CD1 . LEU C 39 ? 0.5478 0.5662 0.4435 -0.0205 -0.0086 0.1044  481 LEU C CD1 
1695 C CD2 . LEU C 39 ? 0.5256 0.5258 0.4431 -0.0184 -0.0215 0.0902  481 LEU C CD2 
1696 N N   . LEU C 40 ? 0.6008 0.5898 0.4480 -0.0037 -0.0098 0.0543  482 LEU C N   
1697 C CA  . LEU C 40 ? 0.6109 0.5972 0.4593 0.0066  0.0016  0.0452  482 LEU C CA  
1698 C C   . LEU C 40 ? 0.6475 0.6234 0.4637 0.0110  0.0082  0.0308  482 LEU C C   
1699 O O   . LEU C 40 ? 0.6647 0.6395 0.4780 0.0225  0.0214  0.0236  482 LEU C O   
1700 C CB  . LEU C 40 ? 0.5985 0.5711 0.4644 0.0102  -0.0028 0.0406  482 LEU C CB  
1701 C CG  . LEU C 40 ? 0.5585 0.5411 0.4532 0.0080  -0.0078 0.0514  482 LEU C CG  
1702 C CD1 . LEU C 40 ? 0.5289 0.4954 0.4307 0.0084  -0.0155 0.0476  482 LEU C CD1 
1703 C CD2 . LEU C 40 ? 0.5560 0.5588 0.4697 0.0148  0.0018  0.0571  482 LEU C CD2 
1704 N N   . LYS C 41 ? 0.6626 0.6322 0.4545 0.0021  -0.0011 0.0266  483 LYS C N   
1705 C CA  . LYS C 41 ? 0.7059 0.6607 0.4618 0.0025  0.0012  0.0092  483 LYS C CA  
1706 C C   . LYS C 41 ? 0.7202 0.6456 0.4750 0.0083  0.0041  -0.0076 483 LYS C C   
1707 O O   . LYS C 41 ? 0.7522 0.6657 0.4908 0.0194  0.0175  -0.0204 483 LYS C O   
1708 C CB  . LYS C 41 ? 0.7308 0.7010 0.4640 0.0091  0.0157  0.0096  483 LYS C CB  
1709 C CG  . LYS C 41 ? 0.7530 0.7389 0.4647 -0.0006 0.0078  0.0188  483 LYS C CG  
1710 C CD  . LYS C 41 ? 0.7879 0.8006 0.5051 0.0026  0.0193  0.0375  483 LYS C CD  
1711 C CE  . LYS C 41 ? 0.8156 0.8417 0.5217 -0.0070 0.0079  0.0533  483 LYS C CE  
1712 N NZ  . LYS C 41 ? 0.8314 0.8801 0.5362 -0.0052 0.0200  0.0724  483 LYS C NZ  
1713 N N   . VAL C 42 ? 0.6995 0.6129 0.4720 0.0016  -0.0076 -0.0062 484 VAL C N   
1714 C CA  . VAL C 42 ? 0.7113 0.5938 0.4856 0.0042  -0.0075 -0.0179 484 VAL C CA  
1715 C C   . VAL C 42 ? 0.7133 0.5847 0.4839 -0.0130 -0.0244 -0.0209 484 VAL C C   
1716 O O   . VAL C 42 ? 0.6799 0.5713 0.4663 -0.0212 -0.0347 -0.0076 484 VAL C O   
1717 C CB  . VAL C 42 ? 0.6817 0.5678 0.4902 0.0146  -0.0030 -0.0072 484 VAL C CB  
1718 C CG1 . VAL C 42 ? 0.6962 0.5504 0.5086 0.0160  -0.0050 -0.0141 484 VAL C CG1 
1719 C CG2 . VAL C 42 ? 0.6717 0.5735 0.4879 0.0310  0.0130  -0.0040 484 VAL C CG2 
1720 N N   . PRO C 43 ? 0.7544 0.5940 0.5051 -0.0190 -0.0268 -0.0382 485 PRO C N   
1721 C CA  . PRO C 43 ? 0.7617 0.5945 0.5110 -0.0385 -0.0434 -0.0407 485 PRO C CA  
1722 C C   . PRO C 43 ? 0.7271 0.5684 0.5111 -0.0423 -0.0500 -0.0249 485 PRO C C   
1723 O O   . PRO C 43 ? 0.7117 0.5452 0.5144 -0.0311 -0.0422 -0.0190 485 PRO C O   
1724 C CB  . PRO C 43 ? 0.8139 0.6032 0.5400 -0.0424 -0.0411 -0.0623 485 PRO C CB  
1725 C CG  . PRO C 43 ? 0.8393 0.6189 0.5402 -0.0262 -0.0249 -0.0747 485 PRO C CG  
1726 C CD  . PRO C 43 ? 0.7976 0.6059 0.5243 -0.0087 -0.0139 -0.0571 485 PRO C CD  
1727 N N   . VAL C 44 ? 0.7163 0.5762 0.5078 -0.0569 -0.0640 -0.0175 486 VAL C N   
1728 C CA  . VAL C 44 ? 0.6868 0.5577 0.5086 -0.0607 -0.0693 -0.0030 486 VAL C CA  
1729 C C   . VAL C 44 ? 0.6980 0.5393 0.5286 -0.0618 -0.0661 -0.0061 486 VAL C C   
1730 O O   . VAL C 44 ? 0.6760 0.5218 0.5286 -0.0553 -0.0627 0.0059  486 VAL C O   
1731 C CB  . VAL C 44 ? 0.6820 0.5780 0.5099 -0.0762 -0.0843 0.0038  486 VAL C CB  
1732 C CG1 . VAL C 44 ? 0.6632 0.5653 0.5192 -0.0820 -0.0881 0.0151  486 VAL C CG1 
1733 C CG2 . VAL C 44 ? 0.6621 0.5898 0.4914 -0.0702 -0.0861 0.0155  486 VAL C CG2 
1734 N N   . SER C 45 ? 0.7373 0.5462 0.5483 -0.0701 -0.0668 -0.0222 487 SER C N   
1735 C CA  . SER C 45 ? 0.7554 0.5298 0.5727 -0.0733 -0.0641 -0.0245 487 SER C CA  
1736 C C   . SER C 45 ? 0.7552 0.5093 0.5770 -0.0518 -0.0495 -0.0227 487 SER C C   
1737 O O   . SER C 45 ? 0.7679 0.4966 0.5989 -0.0507 -0.0463 -0.0187 487 SER C O   
1738 C CB  . SER C 45 ? 0.8094 0.5500 0.6027 -0.0911 -0.0701 -0.0438 487 SER C CB  
1739 O OG  . SER C 45 ? 0.8383 0.5642 0.5993 -0.0845 -0.0647 -0.0624 487 SER C OG  
1740 N N   . ASP C 46 ? 0.7433 0.5114 0.5604 -0.0349 -0.0407 -0.0233 488 ASP C N   
1741 C CA  . ASP C 46 ? 0.7390 0.4975 0.5639 -0.0131 -0.0274 -0.0201 488 ASP C CA  
1742 C C   . ASP C 46 ? 0.6891 0.4783 0.5417 -0.0044 -0.0272 -0.0007 488 ASP C C   
1743 O O   . ASP C 46 ? 0.6854 0.4700 0.5498 0.0110  -0.0198 0.0059  488 ASP C O   
1744 C CB  . ASP C 46 ? 0.7573 0.5169 0.5637 0.0005  -0.0162 -0.0314 488 ASP C CB  
1745 C CG  . ASP C 46 ? 0.8268 0.5440 0.6026 -0.0005 -0.0111 -0.0534 488 ASP C CG  
1746 O OD1 . ASP C 46 ? 0.8648 0.5445 0.6379 -0.0078 -0.0136 -0.0589 488 ASP C OD1 
1747 O OD2 . ASP C 46 ? 0.8812 0.6008 0.6339 0.0057  -0.0037 -0.0656 488 ASP C OD2 
1748 N N   . LEU C 47 ? 0.6527 0.4723 0.5145 -0.0137 -0.0356 0.0080  489 LEU C N   
1749 C CA  . LEU C 47 ? 0.6124 0.4596 0.4950 -0.0073 -0.0359 0.0228  489 LEU C CA  
1750 C C   . LEU C 47 ? 0.6044 0.4476 0.5021 -0.0088 -0.0388 0.0336  489 LEU C C   
1751 O O   . LEU C 47 ? 0.6117 0.4478 0.5100 -0.0216 -0.0447 0.0349  489 LEU C O   
1752 C CB  . LEU C 47 ? 0.5906 0.4658 0.4751 -0.0150 -0.0423 0.0273  489 LEU C CB  
1753 C CG  . LEU C 47 ? 0.5841 0.4723 0.4567 -0.0121 -0.0387 0.0231  489 LEU C CG  
1754 C CD1 . LEU C 47 ? 0.5497 0.4585 0.4224 -0.0214 -0.0468 0.0293  489 LEU C CD1 
1755 C CD2 . LEU C 47 ? 0.5110 0.4128 0.3945 0.0008  -0.0301 0.0285  489 LEU C CD2 
1756 N N   . LEU C 48 ? 0.5904 0.4414 0.5003 0.0038  -0.0349 0.0424  490 LEU C N   
1757 C CA  . LEU C 48 ? 0.5805 0.4322 0.5016 0.0043  -0.0372 0.0545  490 LEU C CA  
1758 C C   . LEU C 48 ? 0.5412 0.4232 0.4725 0.0057  -0.0406 0.0627  490 LEU C C   
1759 O O   . LEU C 48 ? 0.5275 0.4244 0.4645 0.0147  -0.0387 0.0644  490 LEU C O   
1760 C CB  . LEU C 48 ? 0.5988 0.4322 0.5229 0.0180  -0.0314 0.0591  490 LEU C CB  
1761 C CG  . LEU C 48 ? 0.6620 0.4545 0.5761 0.0170  -0.0273 0.0529  490 LEU C CG  
1762 C CD1 . LEU C 48 ? 0.6869 0.4632 0.6055 0.0367  -0.0196 0.0586  490 LEU C CD1 
1763 C CD2 . LEU C 48 ? 0.6916 0.4700 0.6062 0.0010  -0.0321 0.0582  490 LEU C CD2 
1764 N N   . LEU C 49 ? 0.5271 0.4181 0.4610 -0.0035 -0.0451 0.0672  491 LEU C N   
1765 C CA  . LEU C 49 ? 0.5050 0.4179 0.4446 -0.0022 -0.0473 0.0724  491 LEU C CA  
1766 C C   . LEU C 49 ? 0.5057 0.4218 0.4480 0.0009  -0.0476 0.0819  491 LEU C C   
1767 O O   . LEU C 49 ? 0.5157 0.4233 0.4578 -0.0035 -0.0469 0.0876  491 LEU C O   
1768 C CB  . LEU C 49 ? 0.4972 0.4208 0.4373 -0.0106 -0.0503 0.0713  491 LEU C CB  
1769 C CG  . LEU C 49 ? 0.5080 0.4400 0.4456 -0.0118 -0.0512 0.0664  491 LEU C CG  
1770 C CD1 . LEU C 49 ? 0.5207 0.4642 0.4620 -0.0165 -0.0540 0.0700  491 LEU C CD1 
1771 C CD2 . LEU C 49 ? 0.5000 0.4405 0.4402 -0.0056 -0.0494 0.0662  491 LEU C CD2 
1772 N N   . SER C 50 ? 0.4948 0.4248 0.4390 0.0074  -0.0490 0.0841  492 SER C N   
1773 C CA  . SER C 50 ? 0.4956 0.4346 0.4374 0.0093  -0.0508 0.0914  492 SER C CA  
1774 C C   . SER C 50 ? 0.4884 0.4432 0.4293 0.0084  -0.0540 0.0865  492 SER C C   
1775 O O   . SER C 50 ? 0.4758 0.4336 0.4205 0.0063  -0.0543 0.0803  492 SER C O   
1776 C CB  . SER C 50 ? 0.5037 0.4405 0.4460 0.0183  -0.0511 0.1001  492 SER C CB  
1777 O OG  . SER C 50 ? 0.4961 0.4419 0.4453 0.0254  -0.0525 0.0980  492 SER C OG  
1778 N N   . TYR C 51 ? 0.4967 0.4595 0.4305 0.0091  -0.0559 0.0892  493 TYR C N   
1779 C CA  . TYR C 51 ? 0.5010 0.4733 0.4311 0.0068  -0.0596 0.0825  493 TYR C CA  
1780 C C   . TYR C 51 ? 0.5215 0.5053 0.4424 0.0092  -0.0650 0.0851  493 TYR C C   
1781 O O   . TYR C 51 ? 0.5339 0.5190 0.4491 0.0138  -0.0646 0.0943  493 TYR C O   
1782 C CB  . TYR C 51 ? 0.4921 0.4594 0.4181 0.0033  -0.0561 0.0772  493 TYR C CB  
1783 C CG  . TYR C 51 ? 0.4920 0.4607 0.4066 0.0054  -0.0526 0.0791  493 TYR C CG  
1784 C CD1 . TYR C 51 ? 0.4693 0.4385 0.3710 0.0057  -0.0533 0.0717  493 TYR C CD1 
1785 C CD2 . TYR C 51 ? 0.4323 0.4009 0.3481 0.0064  -0.0477 0.0878  493 TYR C CD2 
1786 C CE1 . TYR C 51 ? 0.4287 0.3996 0.3170 0.0096  -0.0478 0.0723  493 TYR C CE1 
1787 C CE2 . TYR C 51 ? 0.4228 0.3967 0.3290 0.0090  -0.0422 0.0911  493 TYR C CE2 
1788 C CZ  . TYR C 51 ? 0.4427 0.4183 0.3340 0.0119  -0.0415 0.0830  493 TYR C CZ  
1789 O OH  . TYR C 51 ? 0.4455 0.4268 0.3241 0.0163  -0.0339 0.0852  493 TYR C OH  
1790 N N   . GLU C 52 ? 0.5336 0.5257 0.4525 0.0048  -0.0708 0.0779  494 GLU C N   
1791 C CA  . GLU C 52 ? 0.5646 0.5693 0.4710 0.0044  -0.0783 0.0778  494 GLU C CA  
1792 C C   . GLU C 52 ? 0.5828 0.5832 0.4763 -0.0034 -0.0810 0.0645  494 GLU C C   
1793 O O   . GLU C 52 ? 0.5776 0.5663 0.4766 -0.0083 -0.0780 0.0571  494 GLU C O   
1794 C CB  . GLU C 52 ? 0.5653 0.5902 0.4834 0.0069  -0.0865 0.0846  494 GLU C CB  
1795 C CG  . GLU C 52 ? 0.5704 0.6065 0.5040 -0.0002 -0.0912 0.0788  494 GLU C CG  
1796 C CD  . GLU C 52 ? 0.6298 0.6909 0.5814 0.0055  -0.0967 0.0886  494 GLU C CD  
1797 O OE1 . GLU C 52 ? 0.6512 0.7195 0.6008 0.0158  -0.0985 0.0998  494 GLU C OE1 
1798 O OE2 . GLU C 52 ? 0.6416 0.7163 0.6107 0.0006  -0.0983 0.0866  494 GLU C OE2 
1799 N N   . SER C 53 ? 0.6144 0.6219 0.4883 -0.0043 -0.0866 0.0618  495 SER C N   
1800 C CA  . SER C 53 ? 0.6457 0.6438 0.5010 -0.0115 -0.0890 0.0465  495 SER C CA  
1801 C C   . SER C 53 ? 0.6703 0.6863 0.5166 -0.0196 -0.1037 0.0421  495 SER C C   
1802 O O   . SER C 53 ? 0.6746 0.7116 0.5182 -0.0150 -0.1101 0.0528  495 SER C O   
1803 C CB  . SER C 53 ? 0.6604 0.6478 0.4930 -0.0047 -0.0796 0.0439  495 SER C CB  
1804 O OG  . SER C 53 ? 0.7158 0.6920 0.5241 -0.0095 -0.0814 0.0274  495 SER C OG  
1805 N N   . PRO C 54 ? 0.6926 0.7004 0.5348 -0.0324 -0.1097 0.0273  496 PRO C N   
1806 C CA  . PRO C 54 ? 0.7226 0.7458 0.5518 -0.0444 -0.1254 0.0190  496 PRO C CA  
1807 C C   . PRO C 54 ? 0.7600 0.7830 0.5515 -0.0411 -0.1276 0.0129  496 PRO C C   
1808 O O   . PRO C 54 ? 0.7848 0.8275 0.5621 -0.0492 -0.1426 0.0093  496 PRO C O   
1809 C CB  . PRO C 54 ? 0.7389 0.7405 0.5696 -0.0599 -0.1273 0.0026  496 PRO C CB  
1810 C CG  . PRO C 54 ? 0.7290 0.7004 0.5649 -0.0519 -0.1108 0.0018  496 PRO C CG  
1811 C CD  . PRO C 54 ? 0.6878 0.6722 0.5410 -0.0379 -0.1031 0.0195  496 PRO C CD  
1812 N N   . LYS C 55 ? 0.7688 0.7732 0.5444 -0.0296 -0.1129 0.0124  497 LYS C N   
1813 C CA  . LYS C 55 ? 0.8028 0.8096 0.5421 -0.0234 -0.1108 0.0097  497 LYS C CA  
1814 C C   . LYS C 55 ? 0.7930 0.8272 0.5335 -0.0138 -0.1132 0.0317  497 LYS C C   
1815 O O   . LYS C 55 ? 0.8192 0.8625 0.5291 -0.0096 -0.1139 0.0335  497 LYS C O   
1816 C CB  . LYS C 55 ? 0.8111 0.7924 0.5373 -0.0134 -0.0918 0.0034  497 LYS C CB  
1817 C CG  . LYS C 55 ? 0.8490 0.7991 0.5579 -0.0189 -0.0883 -0.0203 497 LYS C CG  
1818 C CD  . LYS C 55 ? 0.8786 0.8106 0.5756 -0.0041 -0.0682 -0.0231 497 LYS C CD  
1819 C CE  . LYS C 55 ? 0.9295 0.8266 0.6029 -0.0055 -0.0627 -0.0474 497 LYS C CE  
1820 N NZ  . LYS C 55 ? 0.9510 0.8364 0.6137 0.0126  -0.0415 -0.0485 497 LYS C NZ  
1821 N N   . LYS C 56 ? 0.7583 0.8029 0.5321 -0.0097 -0.1133 0.0484  498 LYS C N   
1822 C CA  . LYS C 56 ? 0.7453 0.8085 0.5249 0.0008  -0.1139 0.0709  498 LYS C CA  
1823 C C   . LYS C 56 ? 0.7190 0.7978 0.5329 0.0010  -0.1219 0.0815  498 LYS C C   
1824 O O   . LYS C 56 ? 0.6979 0.7701 0.5335 0.0090  -0.1135 0.0934  498 LYS C O   
1825 C CB  . LYS C 56 ? 0.7330 0.7804 0.5164 0.0105  -0.0964 0.0810  498 LYS C CB  
1826 C CG  . LYS C 56 ? 0.7450 0.8007 0.5068 0.0188  -0.0915 0.0961  498 LYS C CG  
1827 C CD  . LYS C 56 ? 0.7683 0.8198 0.4933 0.0184  -0.0853 0.0835  498 LYS C CD  
1828 C CE  . LYS C 56 ? 0.7855 0.8470 0.4898 0.0269  -0.0772 0.1013  498 LYS C CE  
1829 N NZ  . LYS C 56 ? 0.7932 0.8626 0.4527 0.0270  -0.0783 0.0913  498 LYS C NZ  
1830 N N   . PRO C 57 ? 0.7247 0.8250 0.5437 -0.0081 -0.1377 0.0766  499 PRO C N   
1831 C CA  . PRO C 57 ? 0.6998 0.8166 0.5551 -0.0086 -0.1426 0.0837  499 PRO C CA  
1832 C C   . PRO C 57 ? 0.6869 0.8194 0.5606 0.0073  -0.1417 0.1068  499 PRO C C   
1833 O O   . PRO C 57 ? 0.7061 0.8568 0.5674 0.0144  -0.1490 0.1199  499 PRO C O   
1834 C CB  . PRO C 57 ? 0.7164 0.8592 0.5709 -0.0235 -0.1610 0.0749  499 PRO C CB  
1835 C CG  . PRO C 57 ? 0.7509 0.8971 0.5658 -0.0265 -0.1689 0.0689  499 PRO C CG  
1836 C CD  . PRO C 57 ? 0.7555 0.8678 0.5470 -0.0196 -0.1517 0.0634  499 PRO C CD  
1837 N N   . GLY C 58 ? 0.6564 0.7800 0.5576 0.0134  -0.1324 0.1115  500 GLY C N   
1838 C CA  . GLY C 58 ? 0.6464 0.7769 0.5661 0.0298  -0.1291 0.1308  500 GLY C CA  
1839 C C   . GLY C 58 ? 0.6402 0.7393 0.5536 0.0392  -0.1147 0.1383  500 GLY C C   
1840 O O   . GLY C 58 ? 0.6365 0.7299 0.5648 0.0521  -0.1093 0.1515  500 GLY C O   
1841 N N   . ARG C 59 ? 0.6326 0.7111 0.5255 0.0325  -0.1080 0.1294  501 ARG C N   
1842 C CA  A ARG C 59 ? 0.6304 0.6849 0.5172 0.0378  -0.0958 0.1375  501 ARG C CA  
1843 C CA  B ARG C 59 ? 0.6319 0.6864 0.5185 0.0377  -0.0958 0.1374  501 ARG C CA  
1844 C C   . ARG C 59 ? 0.6119 0.6424 0.5083 0.0326  -0.0850 0.1267  501 ARG C C   
1845 O O   . ARG C 59 ? 0.6048 0.6314 0.4964 0.0239  -0.0840 0.1121  501 ARG C O   
1846 C CB  A ARG C 59 ? 0.6488 0.7047 0.5064 0.0363  -0.0948 0.1403  501 ARG C CB  
1847 C CB  B ARG C 59 ? 0.6504 0.7063 0.5078 0.0360  -0.0949 0.1396  501 ARG C CB  
1848 C CG  A ARG C 59 ? 0.6441 0.7270 0.4850 0.0394  -0.1078 0.1487  501 ARG C CG  
1849 C CG  B ARG C 59 ? 0.6558 0.7195 0.5033 0.0460  -0.0964 0.1617  501 ARG C CG  
1850 C CD  A ARG C 59 ? 0.5586 0.6459 0.4019 0.0527  -0.1079 0.1743  501 ARG C CD  
1851 C CD  B ARG C 59 ? 0.5932 0.6848 0.4461 0.0528  -0.1108 0.1720  501 ARG C CD  
1852 N NE  A ARG C 59 ? 0.4799 0.5753 0.3514 0.0620  -0.1124 0.1835  501 ARG C NE  
1853 N NE  B ARG C 59 ? 0.5343 0.6235 0.4171 0.0626  -0.1097 0.1811  501 ARG C NE  
1854 C CZ  A ARG C 59 ? 0.4306 0.5578 0.3119 0.0634  -0.1265 0.1845  501 ARG C CZ  
1855 C CZ  B ARG C 59 ? 0.5105 0.5774 0.4025 0.0730  -0.1002 0.1959  501 ARG C CZ  
1856 N NH1 A ARG C 59 ? 0.4051 0.5561 0.2684 0.0531  -0.1394 0.1748  501 ARG C NH1 
1857 N NH1 B ARG C 59 ? 0.5038 0.5510 0.3806 0.0725  -0.0913 0.2053  501 ARG C NH1 
1858 N NH2 A ARG C 59 ? 0.3471 0.4828 0.2568 0.0749  -0.1275 0.1946  501 ARG C NH2 
1859 N NH2 B ARG C 59 ? 0.4759 0.5394 0.3927 0.0836  -0.0985 0.2011  501 ARG C NH2 
1860 N N   . GLU C 60 ? 0.6083 0.6215 0.5173 0.0381  -0.0774 0.1343  502 GLU C N   
1861 C CA  . GLU C 60 ? 0.5973 0.5904 0.5147 0.0327  -0.0692 0.1252  502 GLU C CA  
1862 C C   . GLU C 60 ? 0.6024 0.5798 0.5121 0.0291  -0.0611 0.1297  502 GLU C C   
1863 O O   . GLU C 60 ? 0.6189 0.5870 0.5272 0.0333  -0.0578 0.1435  502 GLU C O   
1864 C CB  . GLU C 60 ? 0.5964 0.5792 0.5308 0.0390  -0.0662 0.1269  502 GLU C CB  
1865 C CG  . GLU C 60 ? 0.6014 0.6032 0.5493 0.0424  -0.0712 0.1228  502 GLU C CG  
1866 C CD  . GLU C 60 ? 0.6409 0.6307 0.6027 0.0500  -0.0645 0.1222  502 GLU C CD  
1867 O OE1 . GLU C 60 ? 0.6319 0.5969 0.5907 0.0466  -0.0574 0.1168  502 GLU C OE1 
1868 O OE2 . GLU C 60 ? 0.6345 0.6415 0.6101 0.0595  -0.0664 0.1266  502 GLU C OE2 
1869 N N   . ILE C 61 ? 0.5920 0.5673 0.4990 0.0216  -0.0575 0.1196  503 ILE C N   
1870 C CA  . ILE C 61 ? 0.5932 0.5600 0.4990 0.0171  -0.0494 0.1238  503 ILE C CA  
1871 C C   . ILE C 61 ? 0.5841 0.5364 0.5044 0.0118  -0.0469 0.1191  503 ILE C C   
1872 O O   . ILE C 61 ? 0.5683 0.5217 0.4938 0.0094  -0.0487 0.1080  503 ILE C O   
1873 C CB  . ILE C 61 ? 0.5923 0.5689 0.4878 0.0146  -0.0460 0.1167  503 ILE C CB  
1874 C CG1 . ILE C 61 ? 0.6180 0.6071 0.4926 0.0189  -0.0485 0.1185  503 ILE C CG1 
1875 C CG2 . ILE C 61 ? 0.5932 0.5684 0.4936 0.0106  -0.0370 0.1228  503 ILE C CG2 
1876 C CD1 . ILE C 61 ? 0.6107 0.6060 0.4777 0.0180  -0.0566 0.1044  503 ILE C CD1 
1877 N N   . GLU C 62 ? 0.5986 0.5362 0.5237 0.0090  -0.0431 0.1278  504 GLU C N   
1878 C CA  . GLU C 62 ? 0.6017 0.5231 0.5364 0.0025  -0.0423 0.1218  504 GLU C CA  
1879 C C   . GLU C 62 ? 0.5899 0.5199 0.5296 -0.0068 -0.0410 0.1162  504 GLU C C   
1880 O O   . GLU C 62 ? 0.5941 0.5376 0.5328 -0.0084 -0.0375 0.1215  504 GLU C O   
1881 C CB  . GLU C 62 ? 0.6272 0.5252 0.5642 0.0002  -0.0392 0.1316  504 GLU C CB  
1882 C CG  . GLU C 62 ? 0.6555 0.5397 0.5914 0.0124  -0.0400 0.1359  504 GLU C CG  
1883 C CD  . GLU C 62 ? 0.7198 0.5747 0.6565 0.0117  -0.0357 0.1476  504 GLU C CD  
1884 O OE1 . GLU C 62 ? 0.7354 0.5889 0.6709 0.0046  -0.0325 0.1601  504 GLU C OE1 
1885 O OE2 . GLU C 62 ? 0.7512 0.5829 0.6897 0.0189  -0.0343 0.1447  504 GLU C OE2 
1886 N N   . LEU C 63 ? 0.5817 0.5063 0.5261 -0.0113 -0.0435 0.1063  505 LEU C N   
1887 C CA  . LEU C 63 ? 0.5752 0.5100 0.5262 -0.0195 -0.0441 0.1031  505 LEU C CA  
1888 C C   . LEU C 63 ? 0.5904 0.5111 0.5457 -0.0308 -0.0463 0.1006  505 LEU C C   
1889 O O   . LEU C 63 ? 0.5928 0.5078 0.5453 -0.0328 -0.0499 0.0907  505 LEU C O   
1890 C CB  . LEU C 63 ? 0.5549 0.4995 0.5049 -0.0157 -0.0466 0.0941  505 LEU C CB  
1891 C CG  . LEU C 63 ? 0.5316 0.4842 0.4756 -0.0072 -0.0461 0.0922  505 LEU C CG  
1892 C CD1 . LEU C 63 ? 0.5222 0.4766 0.4664 -0.0062 -0.0486 0.0842  505 LEU C CD1 
1893 C CD2 . LEU C 63 ? 0.5209 0.4852 0.4631 -0.0051 -0.0417 0.0965  505 LEU C CD2 
1894 N N   . GLU C 64 ? 0.6068 0.5216 0.5672 -0.0395 -0.0442 0.1095  506 GLU C N   
1895 C CA  . GLU C 64 ? 0.6334 0.5298 0.5966 -0.0537 -0.0472 0.1062  506 GLU C CA  
1896 C C   . GLU C 64 ? 0.6286 0.5437 0.6018 -0.0675 -0.0526 0.1037  506 GLU C C   
1897 O O   . GLU C 64 ? 0.6398 0.5488 0.6078 -0.0731 -0.0587 0.0923  506 GLU C O   
1898 C CB  . GLU C 64 ? 0.6606 0.5372 0.6256 -0.0594 -0.0431 0.1176  506 GLU C CB  
1899 C CG  . GLU C 64 ? 0.6920 0.5349 0.6467 -0.0505 -0.0412 0.1153  506 GLU C CG  
1900 C CD  . GLU C 64 ? 0.7356 0.5546 0.6828 -0.0543 -0.0446 0.0986  506 GLU C CD  
1901 O OE1 . GLU C 64 ? 0.7570 0.5626 0.7053 -0.0716 -0.0481 0.0935  506 GLU C OE1 
1902 O OE2 . GLU C 64 ? 0.7501 0.5652 0.6895 -0.0407 -0.0438 0.0903  506 GLU C OE2 
1903 N N   . ASN C 65 ? 0.6153 0.5559 0.6025 -0.0722 -0.0501 0.1149  507 ASN C N   
1904 C CA  . ASN C 65 ? 0.6036 0.5691 0.6062 -0.0853 -0.0555 0.1165  507 ASN C CA  
1905 C C   . ASN C 65 ? 0.5843 0.5662 0.5851 -0.0792 -0.0613 0.1083  507 ASN C C   
1906 O O   . ASN C 65 ? 0.5633 0.5604 0.5646 -0.0650 -0.0573 0.1104  507 ASN C O   
1907 C CB  . ASN C 65 ? 0.5960 0.5917 0.6166 -0.0869 -0.0487 0.1321  507 ASN C CB  
1908 C CG  . ASN C 65 ? 0.6047 0.6245 0.6471 -0.1062 -0.0544 0.1379  507 ASN C CG  
1909 O OD1 . ASN C 65 ? 0.5962 0.6271 0.6420 -0.1125 -0.0645 0.1308  507 ASN C OD1 
1910 N ND2 . ASN C 65 ? 0.6103 0.6415 0.6680 -0.1165 -0.0484 0.1523  507 ASN C ND2 
1911 N N   . ASP C 66 ? 0.5922 0.5685 0.5889 -0.0908 -0.0707 0.0993  508 ASP C N   
1912 C CA  . ASP C 66 ? 0.5779 0.5673 0.5693 -0.0864 -0.0771 0.0929  508 ASP C CA  
1913 C C   . ASP C 66 ? 0.5525 0.5808 0.5620 -0.0820 -0.0783 0.1033  508 ASP C C   
1914 O O   . ASP C 66 ? 0.5461 0.5831 0.5515 -0.0713 -0.0796 0.1022  508 ASP C O   
1915 C CB  . ASP C 66 ? 0.6040 0.5822 0.5846 -0.1020 -0.0877 0.0816  508 ASP C CB  
1916 C CG  . ASP C 66 ? 0.6410 0.5807 0.5980 -0.0980 -0.0850 0.0677  508 ASP C CG  
1917 O OD1 . ASP C 66 ? 0.6507 0.5781 0.6027 -0.0824 -0.0763 0.0683  508 ASP C OD1 
1918 O OD2 . ASP C 66 ? 0.7105 0.6334 0.6539 -0.1104 -0.0915 0.0558  508 ASP C OD2 
1919 N N   . LEU C 67 ? 0.5423 0.5939 0.5730 -0.0895 -0.0768 0.1148  509 LEU C N   
1920 C CA  . LEU C 67 ? 0.5180 0.6107 0.5701 -0.0840 -0.0771 0.1262  509 LEU C CA  
1921 C C   . LEU C 67 ? 0.4928 0.5944 0.5497 -0.0637 -0.0635 0.1333  509 LEU C C   
1922 O O   . LEU C 67 ? 0.4840 0.6155 0.5572 -0.0539 -0.0609 0.1421  509 LEU C O   
1923 C CB  . LEU C 67 ? 0.5282 0.6508 0.6051 -0.1033 -0.0830 0.1358  509 LEU C CB  
1924 C CG  . LEU C 67 ? 0.5512 0.6795 0.6274 -0.1244 -0.1000 0.1296  509 LEU C CG  
1925 C CD1 . LEU C 67 ? 0.5474 0.7205 0.6562 -0.1411 -0.1064 0.1430  509 LEU C CD1 
1926 C CD2 . LEU C 67 ? 0.5397 0.6718 0.6016 -0.1158 -0.1087 0.1232  509 LEU C CD2 
1927 N N   . LYS C 68 ? 0.4823 0.5580 0.5239 -0.0567 -0.0551 0.1293  510 LYS C N   
1928 C CA  . LYS C 68 ? 0.4638 0.5441 0.5036 -0.0393 -0.0430 0.1329  510 LYS C CA  
1929 C C   . LYS C 68 ? 0.4510 0.5165 0.4759 -0.0248 -0.0428 0.1242  510 LYS C C   
1930 O O   . LYS C 68 ? 0.4466 0.4911 0.4577 -0.0274 -0.0490 0.1152  510 LYS C O   
1931 C CB  . LYS C 68 ? 0.4711 0.5361 0.5012 -0.0400 -0.0352 0.1350  510 LYS C CB  
1932 C CG  . LYS C 68 ? 0.4906 0.5704 0.5370 -0.0543 -0.0321 0.1475  510 LYS C CG  
1933 C CD  . LYS C 68 ? 0.5033 0.6244 0.5734 -0.0505 -0.0248 0.1599  510 LYS C CD  
1934 C CE  . LYS C 68 ? 0.5489 0.6855 0.6333 -0.0624 -0.0172 0.1745  510 LYS C CE  
1935 N NZ  . LYS C 68 ? 0.5483 0.7319 0.6601 -0.0582 -0.0087 0.1880  510 LYS C NZ  
1936 N N   . SER C 69 ? 0.4460 0.5221 0.4743 -0.0095 -0.0346 0.1270  511 SER C N   
1937 C CA  . SER C 69 ? 0.4394 0.4991 0.4553 0.0031  -0.0335 0.1197  511 SER C CA  
1938 C C   . SER C 69 ? 0.4426 0.4763 0.4371 0.0060  -0.0303 0.1102  511 SER C C   
1939 O O   . SER C 69 ? 0.4481 0.4802 0.4373 0.0033  -0.0263 0.1115  511 SER C O   
1940 C CB  . SER C 69 ? 0.4414 0.5162 0.4674 0.0193  -0.0247 0.1252  511 SER C CB  
1941 O OG  . SER C 69 ? 0.4614 0.5438 0.4868 0.0257  -0.0126 0.1275  511 SER C OG  
1942 N N   . LEU C 70 ? 0.4411 0.4568 0.4246 0.0109  -0.0324 0.1024  512 LEU C N   
1943 C CA  . LEU C 70 ? 0.4401 0.4359 0.4058 0.0133  -0.0309 0.0933  512 LEU C CA  
1944 C C   . LEU C 70 ? 0.4518 0.4485 0.4092 0.0225  -0.0214 0.0919  512 LEU C C   
1945 O O   . LEU C 70 ? 0.4630 0.4536 0.4066 0.0213  -0.0206 0.0883  512 LEU C O   
1946 C CB  . LEU C 70 ? 0.4389 0.4185 0.3984 0.0151  -0.0341 0.0870  512 LEU C CB  
1947 C CG  . LEU C 70 ? 0.4145 0.3900 0.3745 0.0069  -0.0418 0.0860  512 LEU C CG  
1948 C CD1 . LEU C 70 ? 0.3826 0.3465 0.3399 0.0093  -0.0425 0.0841  512 LEU C CD1 
1949 C CD2 . LEU C 70 ? 0.4115 0.3803 0.3640 0.0012  -0.0446 0.0815  512 LEU C CD2 
1950 N N   . GLN C 71 ? 0.4596 0.4651 0.4246 0.0330  -0.0138 0.0950  513 GLN C N   
1951 C CA  . GLN C 71 ? 0.4838 0.4899 0.4386 0.0444  -0.0020 0.0922  513 GLN C CA  
1952 C C   . GLN C 71 ? 0.4820 0.5094 0.4403 0.0420  0.0042  0.1010  513 GLN C C   
1953 O O   . GLN C 71 ? 0.4996 0.5256 0.4410 0.0479  0.0125  0.0978  513 GLN C O   
1954 C CB  . GLN C 71 ? 0.4981 0.5063 0.4615 0.0597  0.0066  0.0936  513 GLN C CB  
1955 C CG  . GLN C 71 ? 0.5185 0.5571 0.5108 0.0613  0.0064  0.1085  513 GLN C CG  
1956 C CD  . GLN C 71 ? 0.5763 0.6154 0.5794 0.0785  0.0126  0.1120  513 GLN C CD  
1957 O OE1 . GLN C 71 ? 0.5892 0.6586 0.6173 0.0838  0.0139  0.1255  513 GLN C OE1 
1958 N NE2 . GLN C 71 ? 0.6101 0.6156 0.5954 0.0870  0.0160  0.1008  513 GLN C NE2 
1959 N N   . PHE C 72 ? 0.4671 0.5137 0.4459 0.0323  0.0001  0.1123  514 PHE C N   
1960 C CA  . PHE C 72 ? 0.4654 0.5291 0.4496 0.0255  0.0048  0.1228  514 PHE C CA  
1961 C C   . PHE C 72 ? 0.4667 0.5124 0.4294 0.0202  0.0019  0.1193  514 PHE C C   
1962 O O   . PHE C 72 ? 0.4794 0.5322 0.4329 0.0218  0.0098  0.1251  514 PHE C O   
1963 C CB  . PHE C 72 ? 0.4538 0.5348 0.4625 0.0112  -0.0023 0.1332  514 PHE C CB  
1964 C CG  . PHE C 72 ? 0.4637 0.5560 0.4785 0.0003  0.0016  0.1446  514 PHE C CG  
1965 C CD1 . PHE C 72 ? 0.4874 0.6107 0.5181 0.0030  0.0135  0.1572  514 PHE C CD1 
1966 C CD2 . PHE C 72 ? 0.4616 0.5333 0.4669 -0.0115 -0.0050 0.1443  514 PHE C CD2 
1967 C CE1 . PHE C 72 ? 0.5016 0.6351 0.5385 -0.0088 0.0182  0.1702  514 PHE C CE1 
1968 C CE2 . PHE C 72 ? 0.4533 0.5303 0.4636 -0.0217 -0.0007 0.1569  514 PHE C CE2 
1969 C CZ  . PHE C 72 ? 0.4588 0.5666 0.4847 -0.0217 0.0107  0.1703  514 PHE C CZ  
1970 N N   . TYR C 73 ? 0.4567 0.4821 0.4121 0.0150  -0.0090 0.1113  515 TYR C N   
1971 C CA  . TYR C 73 ? 0.4598 0.4709 0.3985 0.0119  -0.0134 0.1090  515 TYR C CA  
1972 C C   . TYR C 73 ? 0.4738 0.4753 0.3895 0.0199  -0.0125 0.0986  515 TYR C C   
1973 O O   . TYR C 73 ? 0.4793 0.4718 0.3831 0.0176  -0.0192 0.0955  515 TYR C O   
1974 C CB  . TYR C 73 ? 0.4480 0.4455 0.3915 0.0040  -0.0241 0.1058  515 TYR C CB  
1975 C CG  . TYR C 73 ? 0.4590 0.4581 0.4165 -0.0067 -0.0264 0.1140  515 TYR C CG  
1976 C CD1 . TYR C 73 ? 0.4917 0.4867 0.4469 -0.0113 -0.0244 0.1233  515 TYR C CD1 
1977 C CD2 . TYR C 73 ? 0.4553 0.4576 0.4263 -0.0133 -0.0314 0.1124  515 TYR C CD2 
1978 C CE1 . TYR C 73 ? 0.5104 0.5005 0.4775 -0.0233 -0.0266 0.1295  515 TYR C CE1 
1979 C CE2 . TYR C 73 ? 0.4650 0.4658 0.4459 -0.0257 -0.0350 0.1171  515 TYR C CE2 
1980 C CZ  . TYR C 73 ? 0.4989 0.4914 0.4783 -0.0313 -0.0323 0.1248  515 TYR C CZ  
1981 O OH  . TYR C 73 ? 0.5311 0.5161 0.5195 -0.0458 -0.0359 0.1280  515 TYR C OH  
1982 N N   . SER C 74 ? 0.4855 0.4893 0.3952 0.0294  -0.0043 0.0929  516 SER C N   
1983 C CA  . SER C 74 ? 0.5104 0.5014 0.3948 0.0358  -0.0030 0.0799  516 SER C CA  
1984 C C   . SER C 74 ? 0.5100 0.4825 0.3892 0.0305  -0.0144 0.0685  516 SER C C   
1985 O O   . SER C 74 ? 0.5317 0.4949 0.3900 0.0301  -0.0179 0.0582  516 SER C O   
1986 C CB  . SER C 74 ? 0.5276 0.5253 0.3900 0.0369  0.0001  0.0830  516 SER C CB  
1987 O OG  . SER C 74 ? 0.5524 0.5686 0.4180 0.0421  0.0134  0.0939  516 SER C OG  
1988 N N   . VAL C 75 ? 0.4977 0.4670 0.3952 0.0255  -0.0204 0.0704  517 VAL C N   
1989 C CA  . VAL C 75 ? 0.5007 0.4559 0.3968 0.0201  -0.0290 0.0620  517 VAL C CA  
1990 C C   . VAL C 75 ? 0.5276 0.4654 0.4135 0.0248  -0.0254 0.0506  517 VAL C C   
1991 O O   . VAL C 75 ? 0.5380 0.4733 0.4301 0.0332  -0.0174 0.0520  517 VAL C O   
1992 C CB  . VAL C 75 ? 0.4787 0.4353 0.3938 0.0148  -0.0339 0.0673  517 VAL C CB  
1993 C CG1 . VAL C 75 ? 0.4809 0.4255 0.3958 0.0098  -0.0399 0.0605  517 VAL C CG1 
1994 C CG2 . VAL C 75 ? 0.4556 0.4207 0.3769 0.0097  -0.0376 0.0751  517 VAL C CG2 
1995 N N   . GLU C 76 ? 0.5486 0.4743 0.4196 0.0193  -0.0315 0.0396  518 GLU C N   
1996 C CA  . GLU C 76 ? 0.5832 0.4853 0.4407 0.0212  -0.0286 0.0262  518 GLU C CA  
1997 C C   . GLU C 76 ? 0.5835 0.4712 0.4491 0.0111  -0.0362 0.0226  518 GLU C C   
1998 O O   . GLU C 76 ? 0.5591 0.4590 0.4376 0.0028  -0.0440 0.0288  518 GLU C O   
1999 C CB  . GLU C 76 ? 0.6102 0.5072 0.4388 0.0206  -0.0294 0.0137  518 GLU C CB  
2000 C CG  . GLU C 76 ? 0.6538 0.5605 0.4693 0.0329  -0.0175 0.0159  518 GLU C CG  
2001 C CD  . GLU C 76 ? 0.7377 0.6462 0.5210 0.0312  -0.0199 0.0062  518 GLU C CD  
2002 O OE1 . GLU C 76 ? 0.7265 0.6514 0.5076 0.0233  -0.0305 0.0119  518 GLU C OE1 
2003 O OE2 . GLU C 76 ? 0.8123 0.7060 0.5712 0.0390  -0.0109 -0.0068 518 GLU C OE2 
2004 N N   . ASN C 77 ? 0.6133 0.4738 0.4715 0.0127  -0.0323 0.0132  519 ASN C N   
2005 C CA  . ASN C 77 ? 0.6250 0.4668 0.4878 0.0011  -0.0382 0.0091  519 ASN C CA  
2006 C C   . ASN C 77 ? 0.6266 0.4775 0.4835 -0.0147 -0.0507 0.0024  519 ASN C C   
2007 O O   . ASN C 77 ? 0.6471 0.4981 0.4832 -0.0165 -0.0538 -0.0083 519 ASN C O   
2008 C CB  . ASN C 77 ? 0.6682 0.4723 0.5176 0.0061  -0.0309 -0.0024 519 ASN C CB  
2009 C CG  . ASN C 77 ? 0.6879 0.4698 0.5498 -0.0005 -0.0317 0.0016  519 ASN C CG  
2010 O OD1 . ASN C 77 ? 0.6936 0.4862 0.5749 0.0032  -0.0302 0.0169  519 ASN C OD1 
2011 N ND2 . ASN C 77 ? 0.7441 0.4937 0.5931 -0.0113 -0.0343 -0.0121 519 ASN C ND2 
2012 N N   . GLY C 78 ? 0.6094 0.4719 0.4846 -0.0253 -0.0575 0.0098  520 GLY C N   
2013 C CA  . GLY C 78 ? 0.6080 0.4862 0.4847 -0.0398 -0.0695 0.0064  520 GLY C CA  
2014 C C   . GLY C 78 ? 0.5853 0.4969 0.4699 -0.0366 -0.0741 0.0160  520 GLY C C   
2015 O O   . GLY C 78 ? 0.5843 0.5153 0.4744 -0.0455 -0.0839 0.0165  520 GLY C O   
2016 N N   . ASP C 79 ? 0.5685 0.4870 0.4553 -0.0239 -0.0670 0.0245  521 ASP C N   
2017 C CA  . ASP C 79 ? 0.5508 0.4931 0.4446 -0.0196 -0.0694 0.0345  521 ASP C CA  
2018 C C   . ASP C 79 ? 0.5316 0.4858 0.4468 -0.0226 -0.0710 0.0428  521 ASP C C   
2019 O O   . ASP C 79 ? 0.5263 0.4722 0.4504 -0.0267 -0.0686 0.0432  521 ASP C O   
2020 C CB  . ASP C 79 ? 0.5442 0.4870 0.4346 -0.0083 -0.0611 0.0408  521 ASP C CB  
2021 C CG  . ASP C 79 ? 0.5688 0.5118 0.4377 -0.0036 -0.0591 0.0365  521 ASP C CG  
2022 O OD1 . ASP C 79 ? 0.6157 0.5579 0.4687 -0.0090 -0.0658 0.0273  521 ASP C OD1 
2023 O OD2 . ASP C 79 ? 0.5550 0.5010 0.4222 0.0046  -0.0510 0.0425  521 ASP C OD2 
2024 N N   . CYS C 80 ? 0.5276 0.5004 0.4494 -0.0192 -0.0741 0.0500  522 CYS C N   
2025 C CA  . CYS C 80 ? 0.5212 0.5060 0.4611 -0.0193 -0.0738 0.0567  522 CYS C CA  
2026 C C   . CYS C 80 ? 0.5032 0.4847 0.4458 -0.0106 -0.0675 0.0631  522 CYS C C   
2027 O O   . CYS C 80 ? 0.5117 0.4935 0.4483 -0.0048 -0.0669 0.0670  522 CYS C O   
2028 C CB  . CYS C 80 ? 0.5220 0.5304 0.4700 -0.0205 -0.0817 0.0601  522 CYS C CB  
2029 S SG  . CYS C 80 ? 0.5798 0.6080 0.5527 -0.0196 -0.0795 0.0673  522 CYS C SG  
2030 N N   . LEU C 81 ? 0.4872 0.4647 0.4372 -0.0111 -0.0629 0.0644  523 LEU C N   
2031 C CA  . LEU C 81 ? 0.4728 0.4460 0.4237 -0.0058 -0.0585 0.0680  523 LEU C CA  
2032 C C   . LEU C 81 ? 0.4641 0.4462 0.4234 -0.0016 -0.0573 0.0708  523 LEU C C   
2033 O O   . LEU C 81 ? 0.4615 0.4536 0.4293 -0.0038 -0.0563 0.0707  523 LEU C O   
2034 C CB  . LEU C 81 ? 0.4743 0.4393 0.4243 -0.0083 -0.0550 0.0674  523 LEU C CB  
2035 C CG  . LEU C 81 ? 0.4767 0.4363 0.4240 -0.0063 -0.0528 0.0692  523 LEU C CG  
2036 C CD1 . LEU C 81 ? 0.4998 0.4571 0.4438 -0.0047 -0.0527 0.0712  523 LEU C CD1 
2037 C CD2 . LEU C 81 ? 0.4970 0.4549 0.4437 -0.0089 -0.0517 0.0700  523 LEU C CD2 
2038 N N   . LEU C 82 ? 0.4572 0.4349 0.4151 0.0050  -0.0560 0.0740  524 LEU C N   
2039 C CA  . LEU C 82 ? 0.4554 0.4376 0.4207 0.0130  -0.0533 0.0767  524 LEU C CA  
2040 C C   . LEU C 82 ? 0.4562 0.4214 0.4164 0.0153  -0.0472 0.0735  524 LEU C C   
2041 O O   . LEU C 82 ? 0.4606 0.4099 0.4141 0.0148  -0.0469 0.0741  524 LEU C O   
2042 C CB  . LEU C 82 ? 0.4657 0.4527 0.4328 0.0206  -0.0565 0.0840  524 LEU C CB  
2043 C CG  . LEU C 82 ? 0.4697 0.4814 0.4445 0.0203  -0.0638 0.0873  524 LEU C CG  
2044 C CD1 . LEU C 82 ? 0.4940 0.5071 0.4586 0.0105  -0.0699 0.0830  524 LEU C CD1 
2045 C CD2 . LEU C 82 ? 0.5162 0.5350 0.4946 0.0316  -0.0662 0.0975  524 LEU C CD2 
2046 N N   . VAL C 83 ? 0.4528 0.4221 0.4152 0.0168  -0.0423 0.0701  525 VAL C N   
2047 C CA  . VAL C 83 ? 0.4618 0.4151 0.4140 0.0174  -0.0370 0.0640  525 VAL C CA  
2048 C C   . VAL C 83 ? 0.4826 0.4310 0.4369 0.0298  -0.0298 0.0626  525 VAL C C   
2049 O O   . VAL C 83 ? 0.4831 0.4504 0.4483 0.0366  -0.0256 0.0651  525 VAL C O   
2050 C CB  . VAL C 83 ? 0.4610 0.4212 0.4084 0.0112  -0.0350 0.0608  525 VAL C CB  
2051 C CG1 . VAL C 83 ? 0.4690 0.4135 0.4005 0.0096  -0.0323 0.0535  525 VAL C CG1 
2052 C CG2 . VAL C 83 ? 0.4308 0.3961 0.3795 0.0022  -0.0408 0.0640  525 VAL C CG2 
2053 N N   . ARG C 84 ? 0.5048 0.4275 0.4498 0.0326  -0.0277 0.0589  526 ARG C N   
2054 C CA  . ARG C 84 ? 0.5322 0.4402 0.4756 0.0463  -0.0190 0.0556  526 ARG C CA  
2055 C C   . ARG C 84 ? 0.5631 0.4436 0.4861 0.0420  -0.0149 0.0424  526 ARG C C   
2056 O O   . ARG C 84 ? 0.5618 0.4337 0.4747 0.0277  -0.0213 0.0386  526 ARG C O   
2057 C CB  . ARG C 84 ? 0.5425 0.4374 0.4923 0.0550  -0.0199 0.0641  526 ARG C CB  
2058 C CG  . ARG C 84 ? 0.5335 0.4572 0.5016 0.0636  -0.0234 0.0769  526 ARG C CG  
2059 C CD  . ARG C 84 ? 0.5579 0.4670 0.5293 0.0744  -0.0238 0.0875  526 ARG C CD  
2060 N NE  . ARG C 84 ? 0.5545 0.4947 0.5410 0.0815  -0.0299 0.1008  526 ARG C NE  
2061 C CZ  . ARG C 84 ? 0.5285 0.4829 0.5135 0.0726  -0.0396 0.1072  526 ARG C CZ  
2062 N NH1 . ARG C 84 ? 0.5006 0.4421 0.4728 0.0583  -0.0425 0.1027  526 ARG C NH1 
2063 N NH2 . ARG C 84 ? 0.4997 0.4833 0.4957 0.0785  -0.0465 0.1180  526 ARG C NH2 
2064 N N   . TRP C 85 ? 0.5904 0.4590 0.5073 0.0549  -0.0042 0.0352  527 TRP C N   
2065 C CA  . TRP C 85 ? 0.6297 0.4673 0.5225 0.0526  0.0007  0.0195  527 TRP C CA  
2066 C C   . TRP C 85 ? 0.6700 0.4892 0.5602 0.0733  0.0146  0.0140  527 TRP C C   
2067 O O   . TRP C 85 ? 0.7128 0.4941 0.5827 0.0750  0.0200  0.0001  527 TRP C O   
2068 C CB  . TRP C 85 ? 0.6265 0.4784 0.5040 0.0427  0.0001  0.0117  527 TRP C CB  
2069 C CG  . TRP C 85 ? 0.6053 0.4867 0.4891 0.0529  0.0096  0.0148  527 TRP C CG  
2070 C CD1 . TRP C 85 ? 0.6165 0.4950 0.4883 0.0656  0.0236  0.0058  527 TRP C CD1 
2071 C CD2 . TRP C 85 ? 0.5610 0.4793 0.4649 0.0501  0.0067  0.0277  527 TRP C CD2 
2072 N NE1 . TRP C 85 ? 0.6020 0.5178 0.4881 0.0706  0.0300  0.0147  527 TRP C NE1 
2073 C CE2 . TRP C 85 ? 0.5609 0.4999 0.4670 0.0599  0.0191  0.0279  527 TRP C CE2 
2074 C CE3 . TRP C 85 ? 0.5154 0.4495 0.4346 0.0401  -0.0042 0.0383  527 TRP C CE3 
2075 C CZ2 . TRP C 85 ? 0.5039 0.4788 0.4295 0.0571  0.0195  0.0397  527 TRP C CZ2 
2076 C CZ3 . TRP C 85 ? 0.4546 0.4196 0.3899 0.0382  -0.0040 0.0475  527 TRP C CZ3 
2077 C CH2 . TRP C 85 ? 0.4806 0.4657 0.4202 0.0453  0.0072  0.0487  527 TRP C CH2 
2078 O OXT . TRP C 85 ? 0.6648 0.5067 0.5740 0.0895  0.0211  0.0232  527 TRP C OXT 
2079 N N   . GLN D 2  ? 0.6779 0.5757 0.7212 -0.0653 0.1171  0.1292  444 GLN D N   
2080 C CA  . GLN D 2  ? 0.6472 0.5374 0.7412 -0.0609 0.1197  0.1124  444 GLN D CA  
2081 C C   . GLN D 2  ? 0.6105 0.4924 0.7234 -0.0482 0.0999  0.1078  444 GLN D C   
2082 O O   . GLN D 2  ? 0.5836 0.4714 0.7111 -0.0428 0.0927  0.0847  444 GLN D O   
2083 C CB  . GLN D 2  ? 0.6714 0.5487 0.7913 -0.0695 0.1362  0.1271  444 GLN D CB  
2084 C CG  . GLN D 2  ? 0.6733 0.5547 0.8370 -0.0732 0.1469  0.1030  444 GLN D CG  
2085 C CD  . GLN D 2  ? 0.7368 0.6002 0.9413 -0.0771 0.1532  0.1107  444 GLN D CD  
2086 O OE1 . GLN D 2  ? 0.7481 0.5971 0.9685 -0.0697 0.1412  0.1133  444 GLN D OE1 
2087 N NE2 . GLN D 2  ? 0.7286 0.5924 0.9541 -0.0897 0.1746  0.1123  444 GLN D NE2 
2088 N N   . LEU D 3  ? 0.6118 0.4804 0.7263 -0.0439 0.0920  0.1309  445 LEU D N   
2089 C CA  . LEU D 3  ? 0.5765 0.4385 0.7089 -0.0326 0.0767  0.1260  445 LEU D CA  
2090 C C   . LEU D 3  ? 0.5748 0.4442 0.6789 -0.0265 0.0606  0.1399  445 LEU D C   
2091 O O   . LEU D 3  ? 0.6009 0.4669 0.6956 -0.0267 0.0563  0.1688  445 LEU D O   
2092 C CB  . LEU D 3  ? 0.5813 0.4224 0.7544 -0.0310 0.0815  0.1352  445 LEU D CB  
2093 C CG  . LEU D 3  ? 0.5547 0.3884 0.7536 -0.0216 0.0725  0.1217  445 LEU D CG  
2094 C CD1 . LEU D 3  ? 0.4851 0.3284 0.6877 -0.0224 0.0702  0.0884  445 LEU D CD1 
2095 C CD2 . LEU D 3  ? 0.5588 0.3698 0.8009 -0.0213 0.0813  0.1307  445 LEU D CD2 
2096 N N   . LEU D 4  ? 0.5403 0.4209 0.6336 -0.0217 0.0505  0.1206  446 LEU D N   
2097 C CA  . LEU D 4  ? 0.5399 0.4323 0.6054 -0.0190 0.0361  0.1278  446 LEU D CA  
2098 C C   . LEU D 4  ? 0.5212 0.4099 0.6082 -0.0084 0.0224  0.1316  446 LEU D C   
2099 O O   . LEU D 4  ? 0.4979 0.3830 0.6051 -0.0036 0.0223  0.1125  446 LEU D O   
2100 C CB  . LEU D 4  ? 0.5242 0.4306 0.5674 -0.0219 0.0358  0.1042  446 LEU D CB  
2101 C CG  . LEU D 4  ? 0.5264 0.4393 0.5547 -0.0318 0.0521  0.0940  446 LEU D CG  
2102 C CD1 . LEU D 4  ? 0.4516 0.3735 0.4792 -0.0308 0.0527  0.0669  446 LEU D CD1 
2103 C CD2 . LEU D 4  ? 0.5398 0.4603 0.5292 -0.0425 0.0569  0.1120  446 LEU D CD2 
2104 N N   . THR D 5  ? 0.5351 0.4268 0.6188 -0.0057 0.0111  0.1571  447 THR D N   
2105 C CA  . THR D 5  ? 0.5246 0.4181 0.6324 0.0044  -0.0019 0.1604  447 THR D CA  
2106 C C   . THR D 5  ? 0.5139 0.4260 0.5978 0.0037  -0.0140 0.1472  447 THR D C   
2107 O O   . THR D 5  ? 0.5362 0.4636 0.5906 -0.0015 -0.0249 0.1587  447 THR D O   
2108 C CB  . THR D 5  ? 0.5534 0.4442 0.6792 0.0094  -0.0116 0.1956  447 THR D CB  
2109 O OG1 . THR D 5  ? 0.5554 0.4248 0.7103 0.0099  0.0019  0.2069  447 THR D OG1 
2110 C CG2 . THR D 5  ? 0.5369 0.4323 0.6977 0.0207  -0.0235 0.1967  447 THR D CG2 
2111 N N   . LEU D 6  ? 0.4837 0.3948 0.5795 0.0071  -0.0117 0.1230  448 LEU D N   
2112 C CA  . LEU D 6  ? 0.4757 0.4009 0.5556 0.0058  -0.0207 0.1095  448 LEU D CA  
2113 C C   . LEU D 6  ? 0.4665 0.3950 0.5750 0.0134  -0.0284 0.1093  448 LEU D C   
2114 O O   . LEU D 6  ? 0.4556 0.3730 0.5935 0.0189  -0.0205 0.1034  448 LEU D O   
2115 C CB  . LEU D 6  ? 0.4544 0.3773 0.5235 0.0022  -0.0119 0.0845  448 LEU D CB  
2116 C CG  . LEU D 6  ? 0.4700 0.3917 0.5201 -0.0049 -0.0011 0.0795  448 LEU D CG  
2117 C CD1 . LEU D 6  ? 0.4511 0.3726 0.5021 -0.0058 0.0042  0.0569  448 LEU D CD1 
2118 C CD2 . LEU D 6  ? 0.4927 0.4263 0.5094 -0.0132 -0.0038 0.0893  448 LEU D CD2 
2119 N N   . LYS D 7  ? 0.4709 0.4166 0.5716 0.0121  -0.0427 0.1137  449 LYS D N   
2120 C CA  . LYS D 7  ? 0.4616 0.4151 0.5919 0.0179  -0.0496 0.1115  449 LYS D CA  
2121 C C   . LYS D 7  ? 0.4426 0.3971 0.5639 0.0141  -0.0450 0.0873  449 LYS D C   
2122 O O   . LYS D 7  ? 0.4446 0.4020 0.5369 0.0069  -0.0451 0.0772  449 LYS D O   
2123 C CB  . LYS D 7  ? 0.4781 0.4524 0.6108 0.0176  -0.0700 0.1309  449 LYS D CB  
2124 C CG  . LYS D 7  ? 0.5253 0.4980 0.6587 0.0197  -0.0763 0.1607  449 LYS D CG  
2125 C CD  . LYS D 7  ? 0.5766 0.5724 0.7182 0.0207  -0.1006 0.1860  449 LYS D CD  
2126 C CE  . LYS D 7  ? 0.6078 0.5996 0.7424 0.0211  -0.1064 0.2202  449 LYS D CE  
2127 N NZ  . LYS D 7  ? 0.6193 0.6285 0.7857 0.0280  -0.1302 0.2525  449 LYS D NZ  
2128 N N   . ILE D 8  ? 0.4200 0.3712 0.5680 0.0184  -0.0390 0.0783  450 ILE D N   
2129 C CA  . ILE D 8  ? 0.4003 0.3490 0.5406 0.0145  -0.0327 0.0597  450 ILE D CA  
2130 C C   . ILE D 8  ? 0.3924 0.3549 0.5517 0.0139  -0.0388 0.0574  450 ILE D C   
2131 O O   . ILE D 8  ? 0.3913 0.3608 0.5833 0.0194  -0.0404 0.0647  450 ILE D O   
2132 C CB  . ILE D 8  ? 0.3921 0.3259 0.5395 0.0160  -0.0178 0.0491  450 ILE D CB  
2133 C CG1 . ILE D 8  ? 0.3824 0.3042 0.5244 0.0168  -0.0116 0.0515  450 ILE D CG1 
2134 C CG2 . ILE D 8  ? 0.3853 0.3161 0.5172 0.0109  -0.0139 0.0360  450 ILE D CG2 
2135 C CD1 . ILE D 8  ? 0.3811 0.3019 0.4968 0.0125  -0.0135 0.0515  450 ILE D CD1 
2136 N N   . LYS D 9  ? 0.3834 0.3494 0.5281 0.0072  -0.0408 0.0465  451 LYS D N   
2137 C CA  . LYS D 9  ? 0.3785 0.3568 0.5416 0.0038  -0.0448 0.0415  451 LYS D CA  
2138 C C   . LYS D 9  ? 0.3734 0.3404 0.5313 -0.0007 -0.0334 0.0288  451 LYS D C   
2139 O O   . LYS D 9  ? 0.3711 0.3261 0.5067 -0.0031 -0.0298 0.0234  451 LYS D O   
2140 C CB  . LYS D 9  ? 0.3957 0.3911 0.5480 -0.0030 -0.0610 0.0417  451 LYS D CB  
2141 C CG  . LYS D 9  ? 0.4051 0.4166 0.5807 -0.0088 -0.0674 0.0348  451 LYS D CG  
2142 C CD  . LYS D 9  ? 0.4625 0.4927 0.6232 -0.0186 -0.0845 0.0308  451 LYS D CD  
2143 C CE  . LYS D 9  ? 0.5336 0.5836 0.6941 -0.0161 -0.1033 0.0496  451 LYS D CE  
2144 N NZ  . LYS D 9  ? 0.5816 0.6561 0.7269 -0.0286 -0.1229 0.0449  451 LYS D NZ  
2145 N N   . TYR D 10 ? 0.3682 0.3399 0.5503 -0.0019 -0.0272 0.0260  452 TYR D N   
2146 C CA  . TYR D 10 ? 0.3690 0.3334 0.5489 -0.0085 -0.0183 0.0185  452 TYR D CA  
2147 C C   . TYR D 10 ? 0.3732 0.3521 0.5724 -0.0153 -0.0256 0.0141  452 TYR D C   
2148 O O   . TYR D 10 ? 0.3741 0.3650 0.6035 -0.0165 -0.0222 0.0140  452 TYR D O   
2149 C CB  . TYR D 10 ? 0.3648 0.3240 0.5541 -0.0084 -0.0020 0.0173  452 TYR D CB  
2150 C CG  . TYR D 10 ? 0.3666 0.3161 0.5445 -0.0033 0.0052  0.0179  452 TYR D CG  
2151 C CD1 . TYR D 10 ? 0.3463 0.2974 0.5422 -0.0020 0.0191  0.0138  452 TYR D CD1 
2152 C CD2 . TYR D 10 ? 0.3745 0.3141 0.5278 -0.0011 0.0001  0.0197  452 TYR D CD2 
2153 C CE1 . TYR D 10 ? 0.3699 0.3116 0.5575 0.0005  0.0268  0.0100  452 TYR D CE1 
2154 C CE2 . TYR D 10 ? 0.3684 0.3002 0.5151 0.0016  0.0064  0.0182  452 TYR D CE2 
2155 C CZ  . TYR D 10 ? 0.3919 0.3242 0.5549 0.0020  0.0192  0.0127  452 TYR D CZ  
2156 O OH  . TYR D 10 ? 0.3788 0.3027 0.5368 0.0026  0.0263  0.0072  452 TYR D OH  
2157 N N   . PRO D 11 ? 0.3801 0.3590 0.5652 -0.0209 -0.0344 0.0079  453 PRO D N   
2158 C CA  . PRO D 11 ? 0.3883 0.3840 0.5909 -0.0296 -0.0442 0.0004  453 PRO D CA  
2159 C C   . PRO D 11 ? 0.3950 0.3907 0.6254 -0.0366 -0.0346 -0.0043 453 PRO D C   
2160 O O   . PRO D 11 ? 0.3965 0.4124 0.6550 -0.0422 -0.0422 -0.0082 453 PRO D O   
2161 C CB  . PRO D 11 ? 0.3979 0.3872 0.5758 -0.0357 -0.0488 -0.0106 453 PRO D CB  
2162 C CG  . PRO D 11 ? 0.3949 0.3613 0.5515 -0.0298 -0.0380 -0.0080 453 PRO D CG  
2163 C CD  . PRO D 11 ? 0.3792 0.3446 0.5350 -0.0204 -0.0346 0.0048  453 PRO D CD  
2164 N N   . HIS D 12 ? 0.4000 0.3753 0.6236 -0.0371 -0.0190 -0.0023 454 HIS D N   
2165 C CA  . HIS D 12 ? 0.4142 0.3874 0.6609 -0.0454 -0.0070 -0.0035 454 HIS D CA  
2166 C C   . HIS D 12 ? 0.4145 0.4007 0.6860 -0.0440 0.0032  0.0005  454 HIS D C   
2167 O O   . HIS D 12 ? 0.4213 0.4113 0.7174 -0.0523 0.0145  -0.0011 454 HIS D O   
2168 C CB  . HIS D 12 ? 0.4202 0.3674 0.6495 -0.0482 0.0046  0.0014  454 HIS D CB  
2169 C CG  . HIS D 12 ? 0.4464 0.3810 0.6705 -0.0514 -0.0011 -0.0057 454 HIS D CG  
2170 N ND1 . HIS D 12 ? 0.5031 0.4153 0.7116 -0.0486 0.0031  0.0005  454 HIS D ND1 
2171 C CD2 . HIS D 12 ? 0.4605 0.4028 0.6955 -0.0575 -0.0103 -0.0204 454 HIS D CD2 
2172 C CE1 . HIS D 12 ? 0.5379 0.4426 0.7535 -0.0518 -0.0006 -0.0107 454 HIS D CE1 
2173 N NE2 . HIS D 12 ? 0.5475 0.4699 0.7760 -0.0583 -0.0078 -0.0253 454 HIS D NE2 
2174 N N   . GLN D 13 ? 0.4082 0.4005 0.6774 -0.0342 0.0017  0.0047  455 GLN D N   
2175 C CA  . GLN D 13 ? 0.4140 0.4179 0.7124 -0.0315 0.0140  0.0053  455 GLN D CA  
2176 C C   . GLN D 13 ? 0.4146 0.4446 0.7518 -0.0257 -0.0007 0.0069  455 GLN D C   
2177 O O   . GLN D 13 ? 0.4163 0.4646 0.7980 -0.0273 0.0049  0.0045  455 GLN D O   
2178 C CB  . GLN D 13 ? 0.4100 0.4001 0.6858 -0.0255 0.0266  0.0073  455 GLN D CB  
2179 C CG  . GLN D 13 ? 0.4014 0.3704 0.6392 -0.0319 0.0387  0.0089  455 GLN D CG  
2180 C CD  . GLN D 13 ? 0.4020 0.3643 0.6231 -0.0305 0.0539  0.0065  455 GLN D CD  
2181 O OE1 . GLN D 13 ? 0.3979 0.3609 0.6205 -0.0221 0.0507  0.0044  455 GLN D OE1 
2182 N NE2 . GLN D 13 ? 0.3713 0.3273 0.5760 -0.0404 0.0715  0.0064  455 GLN D NE2 
2183 N N   . LEU D 14 ? 0.4212 0.4542 0.7431 -0.0193 -0.0196 0.0126  456 LEU D N   
2184 C CA  . LEU D 14 ? 0.4301 0.4867 0.7836 -0.0123 -0.0368 0.0208  456 LEU D CA  
2185 C C   . LEU D 14 ? 0.4432 0.5053 0.7676 -0.0132 -0.0605 0.0261  456 LEU D C   
2186 O O   . LEU D 14 ? 0.4459 0.4893 0.7278 -0.0126 -0.0591 0.0261  456 LEU D O   
2187 C CB  . LEU D 14 ? 0.4261 0.4777 0.7965 -0.0001 -0.0267 0.0275  456 LEU D CB  
2188 C CG  . LEU D 14 ? 0.4217 0.4952 0.8415 0.0102  -0.0396 0.0398  456 LEU D CG  
2189 C CD1 . LEU D 14 ? 0.4092 0.5092 0.8889 0.0079  -0.0387 0.0360  456 LEU D CD1 
2190 C CD2 . LEU D 14 ? 0.3936 0.4522 0.8248 0.0213  -0.0251 0.0433  456 LEU D CD2 
2191 N N   . ASP D 15 ? 0.4578 0.5482 0.8057 -0.0160 -0.0821 0.0302  457 ASP D N   
2192 C CA  . ASP D 15 ? 0.4801 0.5815 0.7968 -0.0206 -0.1056 0.0343  457 ASP D CA  
2193 C C   . ASP D 15 ? 0.4867 0.5878 0.7913 -0.0098 -0.1155 0.0546  457 ASP D C   
2194 O O   . ASP D 15 ? 0.5088 0.6134 0.7750 -0.0141 -0.1296 0.0597  457 ASP D O   
2195 C CB  . ASP D 15 ? 0.4932 0.6291 0.8373 -0.0301 -0.1279 0.0314  457 ASP D CB  
2196 C CG  . ASP D 15 ? 0.5372 0.6792 0.8387 -0.0446 -0.1427 0.0195  457 ASP D CG  
2197 O OD1 . ASP D 15 ? 0.5556 0.6762 0.8090 -0.0455 -0.1356 0.0158  457 ASP D OD1 
2198 O OD2 . ASP D 15 ? 0.5965 0.7661 0.9152 -0.0564 -0.1604 0.0114  457 ASP D OD2 
2199 N N   . GLN D 16 ? 0.4727 0.5692 0.8117 0.0029  -0.1061 0.0654  458 GLN D N   
2200 C CA  . GLN D 16 ? 0.4728 0.5653 0.8114 0.0139  -0.1128 0.0864  458 GLN D CA  
2201 C C   . GLN D 16 ? 0.4599 0.5194 0.7663 0.0176  -0.0918 0.0821  458 GLN D C   
2202 O O   . GLN D 16 ? 0.4388 0.4812 0.7354 0.0147  -0.0717 0.0654  458 GLN D O   
2203 C CB  . GLN D 16 ? 0.4730 0.5801 0.8791 0.0261  -0.1151 0.1001  458 GLN D CB  
2204 C CG  . GLN D 16 ? 0.4849 0.6307 0.9292 0.0249  -0.1442 0.1132  458 GLN D CG  
2205 C CD  . GLN D 16 ? 0.5293 0.6942 1.0097 0.0171  -0.1408 0.0951  458 GLN D CD  
2206 O OE1 . GLN D 16 ? 0.5420 0.6898 1.0145 0.0117  -0.1160 0.0743  458 GLN D OE1 
2207 N NE2 . GLN D 16 ? 0.5326 0.7346 1.0544 0.0156  -0.1668 0.1049  458 GLN D NE2 
2208 N N   . LYS D 17 ? 0.4667 0.5189 0.7569 0.0229  -0.0976 0.0988  459 LYS D N   
2209 C CA  . LYS D 17 ? 0.4544 0.4784 0.7217 0.0260  -0.0795 0.0954  459 LYS D CA  
2210 C C   . LYS D 17 ? 0.4377 0.4489 0.7446 0.0344  -0.0594 0.0899  459 LYS D C   
2211 O O   . LYS D 17 ? 0.4389 0.4606 0.7974 0.0426  -0.0613 0.0986  459 LYS D O   
2212 C CB  . LYS D 17 ? 0.4719 0.4917 0.7148 0.0275  -0.0891 0.1152  459 LYS D CB  
2213 C CG  . LYS D 17 ? 0.4918 0.5134 0.6785 0.0159  -0.0953 0.1095  459 LYS D CG  
2214 C CD  . LYS D 17 ? 0.5535 0.5908 0.7207 0.0127  -0.1157 0.1327  459 LYS D CD  
2215 C CE  . LYS D 17 ? 0.5815 0.6284 0.6967 -0.0020 -0.1219 0.1206  459 LYS D CE  
2216 N NZ  . LYS D 17 ? 0.6219 0.6895 0.7110 -0.0086 -0.1434 0.1430  459 LYS D NZ  
2217 N N   . VAL D 18 ? 0.4239 0.4142 0.7073 0.0315  -0.0406 0.0743  460 VAL D N   
2218 C CA  . VAL D 18 ? 0.4165 0.3951 0.7223 0.0339  -0.0184 0.0607  460 VAL D CA  
2219 C C   . VAL D 18 ? 0.4236 0.3836 0.7358 0.0395  -0.0086 0.0635  460 VAL D C   
2220 O O   . VAL D 18 ? 0.4211 0.3756 0.7713 0.0443  0.0066  0.0568  460 VAL D O   
2221 C CB  . VAL D 18 ? 0.4084 0.3784 0.6800 0.0243  -0.0062 0.0423  460 VAL D CB  
2222 C CG1 . VAL D 18 ? 0.4112 0.3686 0.6880 0.0229  0.0165  0.0274  460 VAL D CG1 
2223 C CG2 . VAL D 18 ? 0.4139 0.3992 0.6923 0.0185  -0.0108 0.0384  460 VAL D CG2 
2224 N N   . LEU D 19 ? 0.4316 0.3822 0.7103 0.0377  -0.0150 0.0712  461 LEU D N   
2225 C CA  . LEU D 19 ? 0.4472 0.3793 0.7313 0.0407  -0.0054 0.0735  461 LEU D CA  
2226 C C   . LEU D 19 ? 0.4607 0.3889 0.7137 0.0384  -0.0158 0.0886  461 LEU D C   
2227 O O   . LEU D 19 ? 0.4633 0.4017 0.6829 0.0332  -0.0275 0.0918  461 LEU D O   
2228 C CB  . LEU D 19 ? 0.4454 0.3633 0.7168 0.0349  0.0139  0.0496  461 LEU D CB  
2229 C CG  . LEU D 19 ? 0.4505 0.3651 0.6738 0.0261  0.0132  0.0391  461 LEU D CG  
2230 C CD1 . LEU D 19 ? 0.4803 0.3809 0.6910 0.0235  0.0182  0.0362  461 LEU D CD1 
2231 C CD2 . LEU D 19 ? 0.4612 0.3771 0.6750 0.0199  0.0238  0.0214  461 LEU D CD2 
2232 N N   . GLU D 20 ? 0.4750 0.3881 0.7416 0.0413  -0.0090 0.0963  462 GLU D N   
2233 C CA  . GLU D 20 ? 0.4903 0.3967 0.7278 0.0371  -0.0121 0.1076  462 GLU D CA  
2234 C C   . GLU D 20 ? 0.4865 0.3759 0.7173 0.0322  0.0040  0.0898  462 GLU D C   
2235 O O   . GLU D 20 ? 0.4856 0.3659 0.7406 0.0332  0.0168  0.0739  462 GLU D O   
2236 C CB  . GLU D 20 ? 0.5159 0.4202 0.7753 0.0427  -0.0200 0.1379  462 GLU D CB  
2237 C CG  . GLU D 20 ? 0.5489 0.4747 0.7904 0.0420  -0.0419 0.1595  462 GLU D CG  
2238 C CD  . GLU D 20 ? 0.6167 0.5425 0.8759 0.0467  -0.0532 0.1957  462 GLU D CD  
2239 O OE1 . GLU D 20 ? 0.6542 0.5606 0.9212 0.0469  -0.0427 0.2062  462 GLU D OE1 
2240 O OE2 . GLU D 20 ? 0.6501 0.5963 0.9160 0.0494  -0.0737 0.2154  462 GLU D OE2 
2241 N N   . LYS D 21 ? 0.4880 0.3756 0.6870 0.0258  0.0036  0.0904  463 LYS D N   
2242 C CA  . LYS D 21 ? 0.4897 0.3651 0.6865 0.0204  0.0158  0.0756  463 LYS D CA  
2243 C C   . LYS D 21 ? 0.4977 0.3700 0.6786 0.0155  0.0170  0.0876  463 LYS D C   
2244 O O   . LYS D 21 ? 0.5017 0.3845 0.6546 0.0129  0.0096  0.0972  463 LYS D O   
2245 C CB  . LYS D 21 ? 0.4761 0.3568 0.6519 0.0155  0.0170  0.0529  463 LYS D CB  
2246 C CG  . LYS D 21 ? 0.5078 0.3798 0.6907 0.0101  0.0273  0.0339  463 LYS D CG  
2247 C CD  . LYS D 21 ? 0.5950 0.4614 0.8020 0.0111  0.0368  0.0207  463 LYS D CD  
2248 C CE  . LYS D 21 ? 0.6556 0.5149 0.8655 0.0025  0.0466  -0.0008 463 LYS D CE  
2249 N NZ  . LYS D 21 ? 0.7051 0.5571 0.9408 0.0015  0.0607  -0.0176 463 LYS D NZ  
2250 N N   . GLN D 22 ? 0.5051 0.3632 0.7051 0.0126  0.0283  0.0852  464 GLN D N   
2251 C CA  . GLN D 22 ? 0.5131 0.3678 0.7031 0.0060  0.0338  0.0936  464 GLN D CA  
2252 C C   . GLN D 22 ? 0.4960 0.3556 0.6743 -0.0009 0.0380  0.0707  464 GLN D C   
2253 O O   . GLN D 22 ? 0.4924 0.3472 0.6868 -0.0035 0.0428  0.0519  464 GLN D O   
2254 C CB  . GLN D 22 ? 0.5364 0.3724 0.7611 0.0057  0.0441  0.1059  464 GLN D CB  
2255 C CG  . GLN D 22 ? 0.5779 0.4102 0.8126 0.0117  0.0379  0.1395  464 GLN D CG  
2256 C CD  . GLN D 22 ? 0.6399 0.4503 0.9120 0.0109  0.0494  0.1555  464 GLN D CD  
2257 O OE1 . GLN D 22 ? 0.6450 0.4405 0.9509 0.0093  0.0620  0.1364  464 GLN D OE1 
2258 N NE2 . GLN D 22 ? 0.6690 0.4771 0.9345 0.0106  0.0454  0.1908  464 GLN D NE2 
2259 N N   . LEU D 23 ? 0.4866 0.3574 0.6384 -0.0045 0.0359  0.0716  465 LEU D N   
2260 C CA  . LEU D 23 ? 0.4659 0.3449 0.6120 -0.0085 0.0368  0.0524  465 LEU D CA  
2261 C C   . LEU D 23 ? 0.4722 0.3553 0.6137 -0.0152 0.0459  0.0556  465 LEU D C   
2262 O O   . LEU D 23 ? 0.4891 0.3764 0.6096 -0.0169 0.0477  0.0685  465 LEU D O   
2263 C CB  . LEU D 23 ? 0.4511 0.3410 0.5774 -0.0050 0.0268  0.0448  465 LEU D CB  
2264 C CG  . LEU D 23 ? 0.4433 0.3324 0.5712 0.0001  0.0196  0.0410  465 LEU D CG  
2265 C CD1 . LEU D 23 ? 0.4119 0.3105 0.5209 0.0019  0.0116  0.0383  465 LEU D CD1 
2266 C CD2 . LEU D 23 ? 0.4198 0.3056 0.5601 -0.0021 0.0213  0.0252  465 LEU D CD2 
2267 N N   . PRO D 24 ? 0.4607 0.3451 0.6221 -0.0205 0.0521  0.0428  466 PRO D N   
2268 C CA  . PRO D 24 ? 0.4645 0.3553 0.6293 -0.0275 0.0637  0.0430  466 PRO D CA  
2269 C C   . PRO D 24 ? 0.4533 0.3573 0.5962 -0.0265 0.0631  0.0388  466 PRO D C   
2270 O O   . PRO D 24 ? 0.4354 0.3452 0.5736 -0.0212 0.0527  0.0288  466 PRO D O   
2271 C CB  . PRO D 24 ? 0.4561 0.3518 0.6510 -0.0318 0.0639  0.0250  466 PRO D CB  
2272 C CG  . PRO D 24 ? 0.4513 0.3366 0.6568 -0.0305 0.0577  0.0195  466 PRO D CG  
2273 C CD  . PRO D 24 ? 0.4456 0.3280 0.6278 -0.0219 0.0487  0.0263  466 PRO D CD  
2274 N N   . GLY D 25 ? 0.4677 0.3756 0.5977 -0.0329 0.0762  0.0458  467 GLY D N   
2275 C CA  . GLY D 25 ? 0.4649 0.3848 0.5755 -0.0342 0.0804  0.0371  467 GLY D CA  
2276 C C   . GLY D 25 ? 0.4422 0.3727 0.5806 -0.0322 0.0819  0.0166  467 GLY D C   
2277 O O   . GLY D 25 ? 0.4337 0.3706 0.5669 -0.0289 0.0795  0.0058  467 GLY D O   
2278 N N   . SER D 26 ? 0.4333 0.3659 0.6057 -0.0345 0.0851  0.0116  468 SER D N   
2279 C CA  . SER D 26 ? 0.4143 0.3603 0.6217 -0.0324 0.0830  -0.0044 468 SER D CA  
2280 C C   . SER D 26 ? 0.3941 0.3411 0.6086 -0.0243 0.0610  -0.0089 468 SER D C   
2281 O O   . SER D 26 ? 0.3821 0.3412 0.6263 -0.0217 0.0539  -0.0177 468 SER D O   
2282 C CB  . SER D 26 ? 0.4203 0.3726 0.6640 -0.0401 0.0934  -0.0079 468 SER D CB  
2283 O OG  . SER D 26 ? 0.3987 0.3408 0.6482 -0.0428 0.0865  -0.0027 468 SER D OG  
2284 N N   . MET D 27 ? 0.3905 0.3261 0.5795 -0.0210 0.0506  -0.0014 469 MET D N   
2285 C CA  . MET D 27 ? 0.3796 0.3150 0.5666 -0.0156 0.0328  -0.0042 469 MET D CA  
2286 C C   . MET D 27 ? 0.3748 0.3150 0.5597 -0.0094 0.0276  -0.0074 469 MET D C   
2287 O O   . MET D 27 ? 0.3778 0.3145 0.5443 -0.0086 0.0342  -0.0064 469 MET D O   
2288 C CB  . MET D 27 ? 0.3865 0.3092 0.5508 -0.0143 0.0282  0.0032  469 MET D CB  
2289 C CG  . MET D 27 ? 0.3797 0.3023 0.5397 -0.0120 0.0142  -0.0008 469 MET D CG  
2290 S SD  . MET D 27 ? 0.4886 0.3978 0.6327 -0.0109 0.0146  0.0040  469 MET D SD  
2291 C CE  . MET D 27 ? 0.3670 0.2803 0.5083 -0.0142 0.0040  -0.0068 469 MET D CE  
2292 N N   . THR D 28 ? 0.3727 0.3210 0.5775 -0.0061 0.0149  -0.0107 470 THR D N   
2293 C CA  . THR D 28 ? 0.3799 0.3308 0.5941 0.0005  0.0099  -0.0120 470 THR D CA  
2294 C C   . THR D 28 ? 0.3859 0.3264 0.5730 0.0035  0.0011  -0.0060 470 THR D C   
2295 O O   . THR D 28 ? 0.3882 0.3241 0.5562 0.0012  -0.0051 -0.0016 470 THR D O   
2296 C CB  . THR D 28 ? 0.3794 0.3441 0.6317 0.0037  -0.0028 -0.0123 470 THR D CB  
2297 O OG1 . THR D 28 ? 0.3702 0.3378 0.6123 0.0012  -0.0206 -0.0067 470 THR D OG1 
2298 C CG2 . THR D 28 ? 0.3692 0.3477 0.6582 0.0006  0.0074  -0.0201 470 THR D CG2 
2299 N N   . ILE D 29 ? 0.3940 0.3310 0.5837 0.0076  0.0028  -0.0078 471 ILE D N   
2300 C CA  . ILE D 29 ? 0.3991 0.3268 0.5685 0.0093  -0.0039 -0.0028 471 ILE D CA  
2301 C C   . ILE D 29 ? 0.3992 0.3275 0.5667 0.0100  -0.0196 0.0067  471 ILE D C   
2302 O O   . ILE D 29 ? 0.4008 0.3236 0.5445 0.0077  -0.0227 0.0110  471 ILE D O   
2303 C CB  . ILE D 29 ? 0.4070 0.3298 0.5864 0.0121  0.0015  -0.0091 471 ILE D CB  
2304 C CG1 . ILE D 29 ? 0.4213 0.3468 0.5965 0.0080  0.0185  -0.0220 471 ILE D CG1 
2305 C CG2 . ILE D 29 ? 0.4182 0.3318 0.5790 0.0117  -0.0040 -0.0045 471 ILE D CG2 
2306 C CD1 . ILE D 29 ? 0.4278 0.3535 0.5674 0.0018  0.0228  -0.0191 471 ILE D CD1 
2307 N N   . GLN D 30 ? 0.4007 0.3381 0.5934 0.0121  -0.0290 0.0099  472 GLN D N   
2308 C CA  . GLN D 30 ? 0.4122 0.3549 0.5986 0.0100  -0.0462 0.0201  472 GLN D CA  
2309 C C   . GLN D 30 ? 0.4143 0.3577 0.5724 0.0020  -0.0464 0.0164  472 GLN D C   
2310 O O   . GLN D 30 ? 0.4248 0.3652 0.5581 -0.0018 -0.0518 0.0211  472 GLN D O   
2311 C CB  . GLN D 30 ? 0.4199 0.3778 0.6423 0.0126  -0.0587 0.0242  472 GLN D CB  
2312 C CG  . GLN D 30 ? 0.4385 0.4065 0.6513 0.0088  -0.0808 0.0373  472 GLN D CG  
2313 C CD  . GLN D 30 ? 0.5051 0.4945 0.7548 0.0092  -0.0958 0.0398  472 GLN D CD  
2314 O OE1 . GLN D 30 ? 0.5042 0.4989 0.7996 0.0172  -0.0932 0.0392  472 GLN D OE1 
2315 N NE2 . GLN D 30 ? 0.5297 0.5333 0.7625 -0.0004 -0.1112 0.0406  472 GLN D NE2 
2316 N N   . LYS D 31 ? 0.4067 0.3535 0.5718 -0.0013 -0.0384 0.0072  473 LYS D N   
2317 C CA  . LYS D 31 ? 0.4092 0.3541 0.5576 -0.0088 -0.0353 0.0008  473 LYS D CA  
2318 C C   . LYS D 31 ? 0.4057 0.3369 0.5322 -0.0081 -0.0249 0.0009  473 LYS D C   
2319 O O   . LYS D 31 ? 0.4122 0.3402 0.5246 -0.0130 -0.0234 -0.0034 473 LYS D O   
2320 C CB  . LYS D 31 ? 0.4026 0.3524 0.5718 -0.0129 -0.0282 -0.0076 473 LYS D CB  
2321 C CG  . LYS D 31 ? 0.3959 0.3639 0.5924 -0.0159 -0.0401 -0.0102 473 LYS D CG  
2322 C CD  . LYS D 31 ? 0.4245 0.4030 0.6074 -0.0219 -0.0592 -0.0090 473 LYS D CD  
2323 C CE  . LYS D 31 ? 0.4626 0.4639 0.6781 -0.0244 -0.0752 -0.0091 473 LYS D CE  
2324 N NZ  . LYS D 31 ? 0.4623 0.4767 0.6680 -0.0255 -0.0993 0.0029  473 LYS D NZ  
2325 N N   . VAL D 32 ? 0.4003 0.3255 0.5268 -0.0029 -0.0175 0.0042  474 VAL D N   
2326 C CA  . VAL D 32 ? 0.4026 0.3192 0.5133 -0.0016 -0.0116 0.0067  474 VAL D CA  
2327 C C   . VAL D 32 ? 0.4088 0.3236 0.5061 -0.0020 -0.0171 0.0097  474 VAL D C   
2328 O O   . VAL D 32 ? 0.4186 0.3298 0.5068 -0.0039 -0.0131 0.0083  474 VAL D O   
2329 C CB  . VAL D 32 ? 0.3973 0.3123 0.5071 0.0015  -0.0057 0.0088  474 VAL D CB  
2330 C CG1 . VAL D 32 ? 0.3957 0.3066 0.4928 0.0025  -0.0051 0.0128  474 VAL D CG1 
2331 C CG2 . VAL D 32 ? 0.3894 0.3055 0.5054 -0.0005 0.0032  0.0083  474 VAL D CG2 
2332 N N   . LYS D 33 ? 0.4110 0.3277 0.5112 -0.0003 -0.0248 0.0145  475 LYS D N   
2333 C CA  . LYS D 33 ? 0.4204 0.3347 0.5079 -0.0021 -0.0296 0.0211  475 LYS D CA  
2334 C C   . LYS D 33 ? 0.4374 0.3567 0.5085 -0.0095 -0.0338 0.0200  475 LYS D C   
2335 O O   . LYS D 33 ? 0.4484 0.3655 0.5015 -0.0141 -0.0306 0.0213  475 LYS D O   
2336 C CB  . LYS D 33 ? 0.4206 0.3341 0.5212 0.0015  -0.0375 0.0299  475 LYS D CB  
2337 C CG  . LYS D 33 ? 0.4038 0.3106 0.5180 0.0061  -0.0314 0.0273  475 LYS D CG  
2338 C CD  . LYS D 33 ? 0.4522 0.3558 0.5885 0.0101  -0.0380 0.0353  475 LYS D CD  
2339 C CE  . LYS D 33 ? 0.4306 0.3256 0.5829 0.0126  -0.0301 0.0288  475 LYS D CE  
2340 N NZ  . LYS D 33 ? 0.4547 0.3446 0.6391 0.0179  -0.0353 0.0367  475 LYS D NZ  
2341 N N   . GLY D 34 ? 0.4464 0.3740 0.5241 -0.0122 -0.0398 0.0157  476 GLY D N   
2342 C CA  . GLY D 34 ? 0.4680 0.4031 0.5286 -0.0221 -0.0442 0.0097  476 GLY D CA  
2343 C C   . GLY D 34 ? 0.4743 0.4027 0.5257 -0.0263 -0.0293 -0.0032 476 GLY D C   
2344 O O   . GLY D 34 ? 0.4944 0.4236 0.5238 -0.0341 -0.0256 -0.0078 476 GLY D O   
2345 N N   . LEU D 35 ? 0.4646 0.3862 0.5345 -0.0214 -0.0196 -0.0079 477 LEU D N   
2346 C CA  . LEU D 35 ? 0.4781 0.3916 0.5512 -0.0224 -0.0054 -0.0168 477 LEU D CA  
2347 C C   . LEU D 35 ? 0.4803 0.3902 0.5444 -0.0205 0.0007  -0.0132 477 LEU D C   
2348 O O   . LEU D 35 ? 0.4916 0.4006 0.5488 -0.0263 0.0102  -0.0231 477 LEU D O   
2349 C CB  . LEU D 35 ? 0.4642 0.3709 0.5600 -0.0167 0.0013  -0.0150 477 LEU D CB  
2350 C CG  . LEU D 35 ? 0.4778 0.3747 0.5887 -0.0158 0.0144  -0.0202 477 LEU D CG  
2351 C CD1 . LEU D 35 ? 0.4808 0.3716 0.6131 -0.0167 0.0197  -0.0215 477 LEU D CD1 
2352 C CD2 . LEU D 35 ? 0.4706 0.3643 0.5865 -0.0077 0.0169  -0.0092 477 LEU D CD2 
2353 N N   . LEU D 36 ? 0.4721 0.3810 0.5386 -0.0138 -0.0032 -0.0016 478 LEU D N   
2354 C CA  . LEU D 36 ? 0.4743 0.3816 0.5389 -0.0126 0.0021  0.0018  478 LEU D CA  
2355 C C   . LEU D 36 ? 0.5012 0.4111 0.5447 -0.0207 0.0034  0.0018  478 LEU D C   
2356 O O   . LEU D 36 ? 0.5150 0.4248 0.5575 -0.0237 0.0144  -0.0023 478 LEU D O   
2357 C CB  . LEU D 36 ? 0.4601 0.3668 0.5318 -0.0065 -0.0033 0.0111  478 LEU D CB  
2358 C CG  . LEU D 36 ? 0.4285 0.3350 0.5132 -0.0008 -0.0034 0.0131  478 LEU D CG  
2359 C CD1 . LEU D 36 ? 0.3961 0.3036 0.4805 0.0012  -0.0090 0.0168  478 LEU D CD1 
2360 C CD2 . LEU D 36 ? 0.3813 0.2890 0.4782 0.0016  0.0017  0.0141  478 LEU D CD2 
2361 N N   . SER D 37 ? 0.5147 0.4282 0.5431 -0.0246 -0.0078 0.0077  479 SER D N   
2362 C CA  . SER D 37 ? 0.5402 0.4574 0.5419 -0.0340 -0.0099 0.0131  479 SER D CA  
2363 C C   . SER D 37 ? 0.5652 0.4864 0.5473 -0.0454 0.0024  -0.0024 479 SER D C   
2364 O O   . SER D 37 ? 0.5870 0.5091 0.5511 -0.0530 0.0121  -0.0019 479 SER D O   
2365 C CB  . SER D 37 ? 0.5492 0.4726 0.5435 -0.0354 -0.0282 0.0243  479 SER D CB  
2366 O OG  . SER D 37 ? 0.5839 0.5120 0.5481 -0.0455 -0.0331 0.0347  479 SER D OG  
2367 N N   . ARG D 38 ? 0.5667 0.4900 0.5540 -0.0479 0.0041  -0.0177 480 ARG D N   
2368 C CA  . ARG D 38 ? 0.5962 0.5224 0.5689 -0.0600 0.0177  -0.0388 480 ARG D CA  
2369 C C   . ARG D 38 ? 0.5896 0.5090 0.5817 -0.0571 0.0397  -0.0492 480 ARG D C   
2370 O O   . ARG D 38 ? 0.6154 0.5373 0.5941 -0.0677 0.0563  -0.0649 480 ARG D O   
2371 C CB  . ARG D 38 ? 0.5957 0.5236 0.5792 -0.0632 0.0147  -0.0541 480 ARG D CB  
2372 C CG  . ARG D 38 ? 0.6179 0.5579 0.5870 -0.0683 -0.0074 -0.0469 480 ARG D CG  
2373 C CD  . ARG D 38 ? 0.6489 0.5926 0.6316 -0.0744 -0.0086 -0.0657 480 ARG D CD  
2374 N NE  . ARG D 38 ? 0.6278 0.5638 0.6489 -0.0622 -0.0091 -0.0608 480 ARG D NE  
2375 C CZ  . ARG D 38 ? 0.6232 0.5660 0.6576 -0.0566 -0.0246 -0.0480 480 ARG D CZ  
2376 N NH1 . ARG D 38 ? 0.6609 0.6178 0.6796 -0.0599 -0.0437 -0.0367 480 ARG D NH1 
2377 N NH2 . ARG D 38 ? 0.5550 0.4909 0.6201 -0.0479 -0.0205 -0.0453 480 ARG D NH2 
2378 N N   . LEU D 39 ? 0.5557 0.4686 0.5803 -0.0433 0.0395  -0.0405 481 LEU D N   
2379 C CA  . LEU D 39 ? 0.5477 0.4572 0.6009 -0.0377 0.0551  -0.0453 481 LEU D CA  
2380 C C   . LEU D 39 ? 0.5512 0.4650 0.5972 -0.0404 0.0618  -0.0390 481 LEU D C   
2381 O O   . LEU D 39 ? 0.5645 0.4803 0.6221 -0.0440 0.0807  -0.0509 481 LEU D O   
2382 C CB  . LEU D 39 ? 0.5165 0.4215 0.6014 -0.0238 0.0475  -0.0340 481 LEU D CB  
2383 C CG  . LEU D 39 ? 0.5179 0.4207 0.6420 -0.0158 0.0583  -0.0360 481 LEU D CG  
2384 C CD1 . LEU D 39 ? 0.5091 0.4056 0.6517 -0.0192 0.0745  -0.0551 481 LEU D CD1 
2385 C CD2 . LEU D 39 ? 0.5132 0.4145 0.6549 -0.0049 0.0453  -0.0195 481 LEU D CD2 
2386 N N   . LEU D 40 ? 0.5410 0.4556 0.5730 -0.0391 0.0483  -0.0214 482 LEU D N   
2387 C CA  . LEU D 40 ? 0.5387 0.4553 0.5716 -0.0411 0.0535  -0.0127 482 LEU D CA  
2388 C C   . LEU D 40 ? 0.5726 0.4917 0.5674 -0.0552 0.0585  -0.0090 482 LEU D C   
2389 O O   . LEU D 40 ? 0.5797 0.5001 0.5737 -0.0602 0.0681  -0.0031 482 LEU D O   
2390 C CB  . LEU D 40 ? 0.5154 0.4292 0.5605 -0.0325 0.0383  0.0031  482 LEU D CB  
2391 C CG  . LEU D 40 ? 0.4920 0.4062 0.5682 -0.0211 0.0327  0.0032  482 LEU D CG  
2392 C CD1 . LEU D 40 ? 0.4750 0.3866 0.5522 -0.0166 0.0183  0.0139  482 LEU D CD1 
2393 C CD2 . LEU D 40 ? 0.4658 0.3864 0.5715 -0.0190 0.0432  -0.0009 482 LEU D CD2 
2394 N N   . LYS D 41 ? 0.5971 0.5185 0.5604 -0.0629 0.0513  -0.0113 483 LYS D N   
2395 C CA  . LYS D 41 ? 0.6373 0.5631 0.5569 -0.0771 0.0489  -0.0013 483 LYS D CA  
2396 C C   . LYS D 41 ? 0.6302 0.5505 0.5517 -0.0731 0.0369  0.0255  483 LYS D C   
2397 O O   . LYS D 41 ? 0.6496 0.5690 0.5571 -0.0816 0.0460  0.0359  483 LYS D O   
2398 C CB  . LYS D 41 ? 0.6746 0.6061 0.5730 -0.0923 0.0743  -0.0166 483 LYS D CB  
2399 C CG  . LYS D 41 ? 0.6926 0.6264 0.6048 -0.0945 0.0924  -0.0478 483 LYS D CG  
2400 C CD  . LYS D 41 ? 0.7530 0.6904 0.6437 -0.1007 0.0811  -0.0596 483 LYS D CD  
2401 C CE  . LYS D 41 ? 0.7679 0.7037 0.6799 -0.1031 0.1012  -0.0922 483 LYS D CE  
2402 N NZ  . LYS D 41 ? 0.8158 0.7580 0.7020 -0.1213 0.1285  -0.1148 483 LYS D NZ  
2403 N N   . VAL D 42 ? 0.6030 0.5186 0.5458 -0.0608 0.0189  0.0348  484 VAL D N   
2404 C CA  . VAL D 42 ? 0.5967 0.5046 0.5506 -0.0554 0.0070  0.0565  484 VAL D CA  
2405 C C   . VAL D 42 ? 0.5910 0.5004 0.5467 -0.0496 -0.0144 0.0652  484 VAL D C   
2406 O O   . VAL D 42 ? 0.5681 0.4802 0.5392 -0.0427 -0.0182 0.0528  484 VAL D O   
2407 C CB  . VAL D 42 ? 0.5661 0.4677 0.5583 -0.0450 0.0113  0.0526  484 VAL D CB  
2408 C CG1 . VAL D 42 ? 0.5617 0.4540 0.5715 -0.0390 -0.0005 0.0681  484 VAL D CG1 
2409 C CG2 . VAL D 42 ? 0.5628 0.4661 0.5622 -0.0507 0.0301  0.0467  484 VAL D CG2 
2410 N N   . PRO D 43 ? 0.6153 0.5237 0.5593 -0.0526 -0.0281 0.0882  485 PRO D N   
2411 C CA  . PRO D 43 ? 0.6153 0.5290 0.5678 -0.0470 -0.0497 0.0976  485 PRO D CA  
2412 C C   . PRO D 43 ? 0.5810 0.4892 0.5767 -0.0321 -0.0532 0.0913  485 PRO D C   
2413 O O   . PRO D 43 ? 0.5603 0.4577 0.5781 -0.0262 -0.0446 0.0893  485 PRO D O   
2414 C CB  . PRO D 43 ? 0.6481 0.5585 0.5911 -0.0507 -0.0622 0.1288  485 PRO D CB  
2415 C CG  . PRO D 43 ? 0.6726 0.5813 0.5803 -0.0648 -0.0467 0.1327  485 PRO D CG  
2416 C CD  . PRO D 43 ? 0.6482 0.5515 0.5733 -0.0617 -0.0244 0.1089  485 PRO D CD  
2417 N N   . VAL D 44 ? 0.5783 0.4957 0.5850 -0.0280 -0.0649 0.0864  486 VAL D N   
2418 C CA  . VAL D 44 ? 0.5554 0.4700 0.6004 -0.0159 -0.0661 0.0795  486 VAL D CA  
2419 C C   . VAL D 44 ? 0.5574 0.4598 0.6321 -0.0079 -0.0676 0.0923  486 VAL D C   
2420 O O   . VAL D 44 ? 0.5369 0.4312 0.6316 -0.0024 -0.0571 0.0810  486 VAL D O   
2421 C CB  . VAL D 44 ? 0.5582 0.4870 0.6151 -0.0144 -0.0798 0.0768  486 VAL D CB  
2422 C CG1 . VAL D 44 ? 0.5394 0.4662 0.6383 -0.0030 -0.0783 0.0711  486 VAL D CG1 
2423 C CG2 . VAL D 44 ? 0.5577 0.4952 0.5937 -0.0226 -0.0745 0.0583  486 VAL D CG2 
2424 N N   . SER D 45 ? 0.5781 0.4792 0.6559 -0.0084 -0.0807 0.1158  487 SER D N   
2425 C CA  . SER D 45 ? 0.5812 0.4680 0.6953 -0.0007 -0.0819 0.1291  487 SER D CA  
2426 C C   . SER D 45 ? 0.5772 0.4476 0.6933 -0.0030 -0.0655 0.1246  487 SER D C   
2427 O O   . SER D 45 ? 0.5761 0.4332 0.7279 0.0030  -0.0618 0.1252  487 SER D O   
2428 C CB  . SER D 45 ? 0.6162 0.5045 0.7355 -0.0007 -0.1014 0.1610  487 SER D CB  
2429 O OG  . SER D 45 ? 0.6353 0.5232 0.7115 -0.0130 -0.1025 0.1782  487 SER D OG  
2430 N N   . ASP D 46 ? 0.5757 0.4482 0.6585 -0.0121 -0.0550 0.1177  488 ASP D N   
2431 C CA  . ASP D 46 ? 0.5682 0.4306 0.6552 -0.0158 -0.0399 0.1111  488 ASP D CA  
2432 C C   . ASP D 46 ? 0.5341 0.3990 0.6337 -0.0119 -0.0304 0.0856  488 ASP D C   
2433 O O   . ASP D 46 ? 0.5286 0.3870 0.6421 -0.0138 -0.0219 0.0787  488 ASP D O   
2434 C CB  . ASP D 46 ? 0.5871 0.4534 0.6385 -0.0278 -0.0314 0.1158  488 ASP D CB  
2435 C CG  . ASP D 46 ? 0.6443 0.5039 0.6818 -0.0353 -0.0360 0.1447  488 ASP D CG  
2436 O OD1 . ASP D 46 ? 0.6562 0.5038 0.7207 -0.0300 -0.0444 0.1627  488 ASP D OD1 
2437 O OD2 . ASP D 46 ? 0.7079 0.5741 0.7079 -0.0471 -0.0298 0.1496  488 ASP D OD2 
2438 N N   . LEU D 47 ? 0.5121 0.3874 0.6066 -0.0081 -0.0327 0.0729  489 LEU D N   
2439 C CA  . LEU D 47 ? 0.4876 0.3673 0.5865 -0.0059 -0.0254 0.0538  489 LEU D CA  
2440 C C   . LEU D 47 ? 0.4831 0.3582 0.6073 -0.0009 -0.0240 0.0441  489 LEU D C   
2441 O O   . LEU D 47 ? 0.4919 0.3642 0.6350 0.0043  -0.0284 0.0467  489 LEU D O   
2442 C CB  . LEU D 47 ? 0.4793 0.3693 0.5644 -0.0049 -0.0263 0.0461  489 LEU D CB  
2443 C CG  . LEU D 47 ? 0.4722 0.3677 0.5350 -0.0111 -0.0212 0.0441  489 LEU D CG  
2444 C CD1 . LEU D 47 ? 0.4631 0.3655 0.5207 -0.0102 -0.0224 0.0357  489 LEU D CD1 
2445 C CD2 . LEU D 47 ? 0.4259 0.3219 0.4924 -0.0128 -0.0111 0.0377  489 LEU D CD2 
2446 N N   . LEU D 48 ? 0.4711 0.3476 0.5974 -0.0032 -0.0178 0.0318  490 LEU D N   
2447 C CA  . LEU D 48 ? 0.4668 0.3414 0.6096 -0.0022 -0.0145 0.0176  490 LEU D CA  
2448 C C   . LEU D 48 ? 0.4527 0.3394 0.5806 -0.0033 -0.0129 0.0062  490 LEU D C   
2449 O O   . LEU D 48 ? 0.4523 0.3459 0.5711 -0.0067 -0.0134 0.0055  490 LEU D O   
2450 C CB  . LEU D 48 ? 0.4766 0.3424 0.6359 -0.0075 -0.0105 0.0136  490 LEU D CB  
2451 C CG  . LEU D 48 ? 0.5151 0.3650 0.6945 -0.0074 -0.0107 0.0280  490 LEU D CG  
2452 C CD1 . LEU D 48 ? 0.5452 0.3892 0.7338 -0.0157 -0.0055 0.0271  490 LEU D CD1 
2453 C CD2 . LEU D 48 ? 0.5379 0.3771 0.7491 -0.0016 -0.0095 0.0242  490 LEU D CD2 
2454 N N   . LEU D 49 ? 0.4455 0.3356 0.5736 -0.0005 -0.0110 -0.0006 491 LEU D N   
2455 C CA  . LEU D 49 ? 0.4371 0.3377 0.5482 -0.0021 -0.0097 -0.0062 491 LEU D CA  
2456 C C   . LEU D 49 ? 0.4423 0.3471 0.5507 -0.0072 -0.0048 -0.0216 491 LEU D C   
2457 O O   . LEU D 49 ? 0.4505 0.3497 0.5747 -0.0075 0.0018  -0.0328 491 LEU D O   
2458 C CB  . LEU D 49 ? 0.4318 0.3354 0.5397 0.0017  -0.0089 -0.0020 491 LEU D CB  
2459 C CG  . LEU D 49 ? 0.4399 0.3447 0.5394 0.0031  -0.0127 0.0082  491 LEU D CG  
2460 C CD1 . LEU D 49 ? 0.4505 0.3591 0.5487 0.0043  -0.0105 0.0083  491 LEU D CD1 
2461 C CD2 . LEU D 49 ? 0.4526 0.3611 0.5434 0.0010  -0.0136 0.0106  491 LEU D CD2 
2462 N N   . SER D 50 ? 0.4461 0.3619 0.5355 -0.0117 -0.0080 -0.0223 492 SER D N   
2463 C CA  . SER D 50 ? 0.4736 0.3982 0.5484 -0.0195 -0.0048 -0.0359 492 SER D CA  
2464 C C   . SER D 50 ? 0.4828 0.4203 0.5334 -0.0214 -0.0109 -0.0252 492 SER D C   
2465 O O   . SER D 50 ? 0.4728 0.4107 0.5263 -0.0160 -0.0167 -0.0097 492 SER D O   
2466 C CB  . SER D 50 ? 0.4807 0.4066 0.5617 -0.0274 -0.0065 -0.0501 492 SER D CB  
2467 O OG  . SER D 50 ? 0.4845 0.4179 0.5656 -0.0287 -0.0173 -0.0409 492 SER D OG  
2468 N N   . TYR D 51 ? 0.5077 0.4554 0.5354 -0.0298 -0.0083 -0.0331 493 TYR D N   
2469 C CA  . TYR D 51 ? 0.5264 0.4872 0.5300 -0.0329 -0.0166 -0.0185 493 TYR D CA  
2470 C C   . TYR D 51 ? 0.5684 0.5461 0.5449 -0.0463 -0.0225 -0.0286 493 TYR D C   
2471 O O   . TYR D 51 ? 0.5836 0.5614 0.5559 -0.0549 -0.0138 -0.0525 493 TYR D O   
2472 C CB  . TYR D 51 ? 0.5298 0.4872 0.5245 -0.0304 -0.0077 -0.0084 493 TYR D CB  
2473 C CG  . TYR D 51 ? 0.5441 0.5058 0.5178 -0.0397 0.0064  -0.0221 493 TYR D CG  
2474 C CD1 . TYR D 51 ? 0.5538 0.5279 0.4921 -0.0491 0.0060  -0.0132 493 TYR D CD1 
2475 C CD2 . TYR D 51 ? 0.5013 0.4555 0.4925 -0.0396 0.0212  -0.0429 493 TYR D CD2 
2476 C CE1 . TYR D 51 ? 0.5567 0.5360 0.4716 -0.0602 0.0226  -0.0274 493 TYR D CE1 
2477 C CE2 . TYR D 51 ? 0.5147 0.4739 0.4916 -0.0486 0.0383  -0.0590 493 TYR D CE2 
2478 C CZ  . TYR D 51 ? 0.5559 0.5279 0.4918 -0.0599 0.0404  -0.0526 493 TYR D CZ  
2479 O OH  . TYR D 51 ? 0.5692 0.5474 0.4868 -0.0713 0.0609  -0.0700 493 TYR D OH  
2480 N N   . GLU D 52 ? 0.5914 0.5843 0.5530 -0.0486 -0.0379 -0.0109 494 GLU D N   
2481 C CA  . GLU D 52 ? 0.6441 0.6583 0.5706 -0.0632 -0.0475 -0.0148 494 GLU D CA  
2482 C C   . GLU D 52 ? 0.6738 0.6968 0.5721 -0.0647 -0.0528 0.0112  494 GLU D C   
2483 O O   . GLU D 52 ? 0.6526 0.6682 0.5690 -0.0530 -0.0561 0.0352  494 GLU D O   
2484 C CB  . GLU D 52 ? 0.6462 0.6766 0.5834 -0.0679 -0.0667 -0.0176 494 GLU D CB  
2485 C CG  . GLU D 52 ? 0.6489 0.6831 0.6165 -0.0561 -0.0818 0.0071  494 GLU D CG  
2486 C CD  . GLU D 52 ? 0.7272 0.7790 0.7148 -0.0612 -0.0982 0.0009  494 GLU D CD  
2487 O OE1 . GLU D 52 ? 0.7328 0.7780 0.7358 -0.0657 -0.0911 -0.0220 494 GLU D OE1 
2488 O OE2 . GLU D 52 ? 0.7565 0.8290 0.7498 -0.0606 -0.1184 0.0204  494 GLU D OE2 
2489 N N   . SER D 53 ? 0.7301 0.7679 0.5839 -0.0804 -0.0516 0.0055  495 SER D N   
2490 C CA  . SER D 53 ? 0.7738 0.8214 0.5937 -0.0852 -0.0569 0.0331  495 SER D CA  
2491 C C   . SER D 53 ? 0.8169 0.8931 0.6091 -0.0965 -0.0837 0.0451  495 SER D C   
2492 O O   . SER D 53 ? 0.8339 0.9243 0.6150 -0.1084 -0.0898 0.0202  495 SER D O   
2493 C CB  . SER D 53 ? 0.8038 0.8488 0.5881 -0.0969 -0.0330 0.0200  495 SER D CB  
2494 O OG  . SER D 53 ? 0.8459 0.8950 0.6021 -0.1004 -0.0339 0.0510  495 SER D OG  
2495 N N   . PRO D 54 ? 0.8419 0.9269 0.6272 -0.0930 -0.1009 0.0840  496 PRO D N   
2496 C CA  . PRO D 54 ? 0.8892 1.0057 0.6466 -0.1043 -0.1305 0.1017  496 PRO D CA  
2497 C C   . PRO D 54 ? 0.9523 1.0886 0.6396 -0.1296 -0.1275 0.0865  496 PRO D C   
2498 O O   . PRO D 54 ? 0.9923 1.1588 0.6507 -0.1441 -0.1519 0.0879  496 PRO D O   
2499 C CB  . PRO D 54 ? 0.8998 1.0145 0.6693 -0.0932 -0.1436 0.1500  496 PRO D CB  
2500 C CG  . PRO D 54 ? 0.8454 0.9285 0.6681 -0.0730 -0.1251 0.1509  496 PRO D CG  
2501 C CD  . PRO D 54 ? 0.8225 0.8887 0.6354 -0.0773 -0.0961 0.1143  496 PRO D CD  
2502 N N   . LYS D 55 ? 0.9649 1.0864 0.6271 -0.1360 -0.0971 0.0702  497 LYS D N   
2503 C CA  . LYS D 55 ? 1.0262 1.1636 0.6227 -0.1613 -0.0850 0.0485  497 LYS D CA  
2504 C C   . LYS D 55 ? 1.0291 1.1758 0.6240 -0.1736 -0.0821 0.0004  497 LYS D C   
2505 O O   . LYS D 55 ? 1.0851 1.2508 0.6258 -0.1977 -0.0772 -0.0234 497 LYS D O   
2506 C CB  . LYS D 55 ? 1.0339 1.1530 0.6155 -0.1632 -0.0504 0.0453  497 LYS D CB  
2507 C CG  . LYS D 55 ? 1.0459 1.1558 0.6279 -0.1545 -0.0524 0.0926  497 LYS D CG  
2508 C CD  . LYS D 55 ? 1.0687 1.1608 0.6458 -0.1570 -0.0156 0.0836  497 LYS D CD  
2509 C CE  . LYS D 55 ? 1.0965 1.1788 0.6727 -0.1519 -0.0152 0.1300  497 LYS D CE  
2510 N NZ  . LYS D 55 ? 1.1056 1.1738 0.6783 -0.1570 0.0216  0.1200  497 LYS D NZ  
2511 N N   . LYS D 56 ? 0.9735 1.1057 0.6274 -0.1586 -0.0832 -0.0148 498 LYS D N   
2512 C CA  . LYS D 56 ? 0.9716 1.1072 0.6355 -0.1687 -0.0791 -0.0586 498 LYS D CA  
2513 C C   . LYS D 56 ? 0.9180 1.0448 0.6450 -0.1525 -0.0923 -0.0579 498 LYS D C   
2514 O O   . LYS D 56 ? 0.8808 0.9833 0.6488 -0.1426 -0.0737 -0.0783 498 LYS D O   
2515 C CB  . LYS D 56 ? 0.9653 1.0782 0.6351 -0.1699 -0.0410 -0.0924 498 LYS D CB  
2516 C CG  . LYS D 56 ? 0.9918 1.1104 0.6511 -0.1888 -0.0279 -0.1424 498 LYS D CG  
2517 C CD  . LYS D 56 ? 0.9944 1.0982 0.6474 -0.1939 0.0107  -0.1714 498 LYS D CD  
2518 C CE  . LYS D 56 ? 1.0380 1.1523 0.6671 -0.2184 0.0257  -0.2226 498 LYS D CE  
2519 N NZ  . LYS D 56 ? 1.0526 1.1577 0.6715 -0.2259 0.0657  -0.2512 498 LYS D NZ  
2520 N N   . PRO D 57 ? 0.9177 1.0658 0.6542 -0.1504 -0.1244 -0.0332 499 PRO D N   
2521 C CA  . PRO D 57 ? 0.8684 1.0105 0.6666 -0.1345 -0.1359 -0.0266 499 PRO D CA  
2522 C C   . PRO D 57 ? 0.8549 0.9912 0.6807 -0.1409 -0.1278 -0.0659 499 PRO D C   
2523 O O   . PRO D 57 ? 0.8921 1.0382 0.6890 -0.1611 -0.1224 -0.0990 499 PRO D O   
2524 C CB  . PRO D 57 ? 0.8899 1.0652 0.6861 -0.1372 -0.1725 0.0027  499 PRO D CB  
2525 C CG  . PRO D 57 ? 0.9455 1.1381 0.6794 -0.1496 -0.1806 0.0230  499 PRO D CG  
2526 C CD  . PRO D 57 ? 0.9725 1.1560 0.6615 -0.1659 -0.1525 -0.0127 499 PRO D CD  
2527 N N   . GLY D 58 ? 0.8055 0.9253 0.6870 -0.1252 -0.1252 -0.0625 500 GLY D N   
2528 C CA  . GLY D 58 ? 0.7884 0.8997 0.7041 -0.1298 -0.1178 -0.0929 500 GLY D CA  
2529 C C   . GLY D 58 ? 0.7733 0.8530 0.6987 -0.1272 -0.0873 -0.1179 500 GLY D C   
2530 O O   . GLY D 58 ? 0.7505 0.8127 0.7168 -0.1231 -0.0781 -0.1308 500 GLY D O   
2531 N N   . ARG D 59 ? 0.7856 0.8587 0.6768 -0.1297 -0.0714 -0.1226 501 ARG D N   
2532 C CA  . ARG D 59 ? 0.7758 0.8228 0.6805 -0.1272 -0.0427 -0.1465 501 ARG D CA  
2533 C C   . ARG D 59 ? 0.7317 0.7555 0.6605 -0.1058 -0.0321 -0.1233 501 ARG D C   
2534 O O   . ARG D 59 ? 0.7285 0.7561 0.6389 -0.0990 -0.0361 -0.0975 501 ARG D O   
2535 C CB  . ARG D 59 ? 0.8240 0.8793 0.6833 -0.1443 -0.0274 -0.1710 501 ARG D CB  
2536 C CG  . ARG D 59 ? 0.8774 0.9578 0.7058 -0.1697 -0.0368 -0.2000 501 ARG D CG  
2537 C CD  . ARG D 59 ? 0.9155 0.9989 0.7050 -0.1881 -0.0127 -0.2347 501 ARG D CD  
2538 N NE  . ARG D 59 ? 0.9751 1.0893 0.7178 -0.2156 -0.0253 -0.2580 501 ARG D NE  
2539 C CZ  . ARG D 59 ? 0.9884 1.1069 0.7482 -0.2303 -0.0273 -0.2939 501 ARG D CZ  
2540 N NH1 . ARG D 59 ? 0.9584 1.0498 0.7830 -0.2191 -0.0163 -0.3072 501 ARG D NH1 
2541 N NH2 . ARG D 59 ? 1.0308 1.1813 0.7428 -0.2577 -0.0409 -0.3156 501 ARG D NH2 
2542 N N   . GLU D 60 ? 0.6994 0.6995 0.6701 -0.0964 -0.0193 -0.1321 502 GLU D N   
2543 C CA  . GLU D 60 ? 0.6606 0.6412 0.6554 -0.0780 -0.0122 -0.1121 502 GLU D CA  
2544 C C   . GLU D 60 ? 0.6612 0.6244 0.6708 -0.0746 0.0102  -0.1280 502 GLU D C   
2545 O O   . GLU D 60 ? 0.6750 0.6288 0.7054 -0.0801 0.0220  -0.1540 502 GLU D O   
2546 C CB  . GLU D 60 ? 0.6279 0.5975 0.6602 -0.0686 -0.0190 -0.1009 502 GLU D CB  
2547 C CG  . GLU D 60 ? 0.6316 0.6158 0.6619 -0.0653 -0.0377 -0.0779 502 GLU D CG  
2548 C CD  . GLU D 60 ? 0.6432 0.6173 0.7094 -0.0582 -0.0394 -0.0698 502 GLU D CD  
2549 O OE1 . GLU D 60 ? 0.6164 0.5713 0.6985 -0.0479 -0.0299 -0.0619 502 GLU D OE1 
2550 O OE2 . GLU D 60 ? 0.6444 0.6317 0.7223 -0.0642 -0.0504 -0.0710 502 GLU D OE2 
2551 N N   . ILE D 61 ? 0.6442 0.6032 0.6500 -0.0652 0.0162  -0.1124 503 ILE D N   
2552 C CA  . ILE D 61 ? 0.6401 0.5854 0.6697 -0.0593 0.0353  -0.1230 503 ILE D CA  
2553 C C   . ILE D 61 ? 0.6039 0.5339 0.6688 -0.0429 0.0308  -0.1032 503 ILE D C   
2554 O O   . ILE D 61 ? 0.5834 0.5155 0.6405 -0.0358 0.0213  -0.0798 503 ILE D O   
2555 C CB  . ILE D 61 ? 0.6598 0.6142 0.6626 -0.0638 0.0481  -0.1239 503 ILE D CB  
2556 C CG1 . ILE D 61 ? 0.7085 0.6772 0.6749 -0.0830 0.0580  -0.1499 503 ILE D CG1 
2557 C CG2 . ILE D 61 ? 0.6421 0.5847 0.6809 -0.0540 0.0650  -0.1282 503 ILE D CG2 
2558 C CD1 . ILE D 61 ? 0.7479 0.7375 0.6623 -0.0942 0.0410  -0.1352 503 ILE D CD1 
2559 N N   . GLU D 62 ? 0.5992 0.5140 0.7029 -0.0382 0.0377  -0.1129 504 GLU D N   
2560 C CA  . GLU D 62 ? 0.5764 0.4779 0.7118 -0.0247 0.0329  -0.0942 504 GLU D CA  
2561 C C   . GLU D 62 ? 0.5648 0.4693 0.7033 -0.0171 0.0366  -0.0841 504 GLU D C   
2562 O O   . GLU D 62 ? 0.5755 0.4843 0.7175 -0.0196 0.0510  -0.0985 504 GLU D O   
2563 C CB  . GLU D 62 ? 0.5842 0.4691 0.7639 -0.0217 0.0406  -0.1053 504 GLU D CB  
2564 C CG  . GLU D 62 ? 0.6138 0.4944 0.7983 -0.0324 0.0433  -0.1250 504 GLU D CG  
2565 C CD  . GLU D 62 ? 0.6494 0.5259 0.8349 -0.0324 0.0297  -0.1085 504 GLU D CD  
2566 O OE1 . GLU D 62 ? 0.6417 0.5037 0.8543 -0.0239 0.0266  -0.0910 504 GLU D OE1 
2567 O OE2 . GLU D 62 ? 0.6723 0.5618 0.8326 -0.0417 0.0220  -0.1121 504 GLU D OE2 
2568 N N   . LEU D 63 ? 0.5450 0.4484 0.6833 -0.0094 0.0252  -0.0616 505 LEU D N   
2569 C CA  . LEU D 63 ? 0.5358 0.4421 0.6839 -0.0031 0.0267  -0.0530 505 LEU D CA  
2570 C C   . LEU D 63 ? 0.5327 0.4301 0.7182 0.0059  0.0214  -0.0446 505 LEU D C   
2571 O O   . LEU D 63 ? 0.5224 0.4184 0.7057 0.0100  0.0090  -0.0268 505 LEU D O   
2572 C CB  . LEU D 63 ? 0.5212 0.4337 0.6433 -0.0029 0.0185  -0.0368 505 LEU D CB  
2573 C CG  . LEU D 63 ? 0.5278 0.4493 0.6157 -0.0108 0.0205  -0.0378 505 LEU D CG  
2574 C CD1 . LEU D 63 ? 0.5143 0.4379 0.5880 -0.0087 0.0115  -0.0197 505 LEU D CD1 
2575 C CD2 . LEU D 63 ? 0.5259 0.4544 0.6059 -0.0167 0.0355  -0.0491 505 LEU D CD2 
2576 N N   . GLU D 64 ? 0.5480 0.4403 0.7687 0.0082  0.0314  -0.0579 506 GLU D N   
2577 C CA  . GLU D 64 ? 0.5514 0.4338 0.8155 0.0172  0.0255  -0.0480 506 GLU D CA  
2578 C C   . GLU D 64 ? 0.5418 0.4325 0.8337 0.0254  0.0200  -0.0371 506 GLU D C   
2579 O O   . GLU D 64 ? 0.5438 0.4323 0.8504 0.0315  0.0044  -0.0165 506 GLU D O   
2580 C CB  . GLU D 64 ? 0.5750 0.4461 0.8757 0.0169  0.0393  -0.0677 506 GLU D CB  
2581 C CG  . GLU D 64 ? 0.5932 0.4553 0.8772 0.0081  0.0417  -0.0784 506 GLU D CG  
2582 C CD  . GLU D 64 ? 0.6300 0.4836 0.9062 0.0093  0.0262  -0.0553 506 GLU D CD  
2583 O OE1 . GLU D 64 ? 0.6395 0.4857 0.9405 0.0175  0.0168  -0.0338 506 GLU D OE1 
2584 O OE2 . GLU D 64 ? 0.6442 0.5004 0.8898 0.0010  0.0233  -0.0578 506 GLU D OE2 
2585 N N   . ASN D 65 ? 0.5340 0.4359 0.8324 0.0241  0.0326  -0.0504 507 ASN D N   
2586 C CA  . ASN D 65 ? 0.5183 0.4317 0.8516 0.0306  0.0293  -0.0442 507 ASN D CA  
2587 C C   . ASN D 65 ? 0.5021 0.4255 0.8076 0.0285  0.0154  -0.0287 507 ASN D C   
2588 O O   . ASN D 65 ? 0.4960 0.4267 0.7782 0.0223  0.0240  -0.0349 507 ASN D O   
2589 C CB  . ASN D 65 ? 0.5255 0.4475 0.8821 0.0283  0.0527  -0.0672 507 ASN D CB  
2590 C CG  . ASN D 65 ? 0.5232 0.4577 0.9374 0.0366  0.0513  -0.0639 507 ASN D CG  
2591 O OD1 . ASN D 65 ? 0.5225 0.4627 0.9512 0.0426  0.0294  -0.0429 507 ASN D OD1 
2592 N ND2 . ASN D 65 ? 0.5337 0.4751 0.9817 0.0357  0.0749  -0.0857 507 ASN D ND2 
2593 N N   . ASP D 66 ? 0.4951 0.4181 0.8032 0.0325  -0.0050 -0.0088 508 ASP D N   
2594 C CA  . ASP D 66 ? 0.4844 0.4159 0.7655 0.0287  -0.0182 0.0026  508 ASP D CA  
2595 C C   . ASP D 66 ? 0.4723 0.4200 0.7725 0.0274  -0.0159 -0.0026 508 ASP D C   
2596 O O   . ASP D 66 ? 0.4698 0.4231 0.7477 0.0218  -0.0210 0.0001  508 ASP D O   
2597 C CB  . ASP D 66 ? 0.4939 0.4250 0.7754 0.0312  -0.0398 0.0233  508 ASP D CB  
2598 C CG  . ASP D 66 ? 0.5339 0.4492 0.7916 0.0298  -0.0410 0.0305  508 ASP D CG  
2599 O OD1 . ASP D 66 ? 0.5725 0.4826 0.7951 0.0241  -0.0331 0.0235  508 ASP D OD1 
2600 O OD2 . ASP D 66 ? 0.5916 0.5002 0.8696 0.0342  -0.0500 0.0448  508 ASP D OD2 
2601 N N   . LEU D 67 ? 0.4668 0.4216 0.8131 0.0319  -0.0063 -0.0117 509 LEU D N   
2602 C CA  . LEU D 67 ? 0.4534 0.4261 0.8298 0.0307  -0.0031 -0.0169 509 LEU D CA  
2603 C C   . LEU D 67 ? 0.4444 0.4183 0.8028 0.0225  0.0207  -0.0321 509 LEU D C   
2604 O O   . LEU D 67 ? 0.4398 0.4264 0.8122 0.0181  0.0246  -0.0349 509 LEU D O   
2605 C CB  . LEU D 67 ? 0.4573 0.4402 0.9021 0.0401  -0.0036 -0.0184 509 LEU D CB  
2606 C CG  . LEU D 67 ? 0.4758 0.4628 0.9478 0.0483  -0.0317 0.0035  509 LEU D CG  
2607 C CD1 . LEU D 67 ? 0.4866 0.4820 1.0373 0.0599  -0.0301 0.0027  509 LEU D CD1 
2608 C CD2 . LEU D 67 ? 0.4585 0.4618 0.9148 0.0428  -0.0554 0.0165  509 LEU D CD2 
2609 N N   . LYS D 68 ? 0.4391 0.4007 0.7664 0.0191  0.0356  -0.0409 510 LYS D N   
2610 C CA  . LYS D 68 ? 0.4384 0.4012 0.7411 0.0100  0.0575  -0.0520 510 LYS D CA  
2611 C C   . LYS D 68 ? 0.4282 0.3844 0.6806 0.0038  0.0513  -0.0410 510 LYS D C   
2612 O O   . LYS D 68 ? 0.4196 0.3683 0.6529 0.0065  0.0348  -0.0305 510 LYS D O   
2613 C CB  . LYS D 68 ? 0.4571 0.4138 0.7519 0.0074  0.0759  -0.0688 510 LYS D CB  
2614 C CG  . LYS D 68 ? 0.4684 0.4299 0.8207 0.0132  0.0888  -0.0846 510 LYS D CG  
2615 C CD  . LYS D 68 ? 0.4897 0.4665 0.8698 0.0086  0.1105  -0.0968 510 LYS D CD  
2616 C CE  . LYS D 68 ? 0.5255 0.5096 0.9792 0.0175  0.1198  -0.1098 510 LYS D CE  
2617 N NZ  . LYS D 68 ? 0.5302 0.5327 1.0209 0.0133  0.1409  -0.1212 510 LYS D NZ  
2618 N N   . SER D 69 ? 0.4274 0.3863 0.6618 -0.0045 0.0661  -0.0425 511 SER D N   
2619 C CA  . SER D 69 ? 0.4225 0.3743 0.6188 -0.0094 0.0618  -0.0301 511 SER D CA  
2620 C C   . SER D 69 ? 0.4332 0.3785 0.5866 -0.0134 0.0655  -0.0285 511 SER D C   
2621 O O   . SER D 69 ? 0.4443 0.3915 0.5928 -0.0155 0.0749  -0.0409 511 SER D O   
2622 C CB  . SER D 69 ? 0.4273 0.3841 0.6316 -0.0166 0.0739  -0.0274 511 SER D CB  
2623 O OG  . SER D 69 ? 0.4375 0.3999 0.6378 -0.0238 0.0969  -0.0356 511 SER D OG  
2624 N N   . LEU D 70 ? 0.4340 0.3729 0.5602 -0.0150 0.0577  -0.0145 512 LEU D N   
2625 C CA  . LEU D 70 ? 0.4510 0.3880 0.5387 -0.0195 0.0577  -0.0088 512 LEU D CA  
2626 C C   . LEU D 70 ? 0.4818 0.4256 0.5495 -0.0300 0.0760  -0.0116 512 LEU D C   
2627 O O   . LEU D 70 ? 0.5028 0.4513 0.5449 -0.0359 0.0805  -0.0199 512 LEU D O   
2628 C CB  . LEU D 70 ? 0.4481 0.3783 0.5232 -0.0179 0.0468  0.0093  512 LEU D CB  
2629 C CG  . LEU D 70 ? 0.4178 0.3420 0.5065 -0.0104 0.0323  0.0114  512 LEU D CG  
2630 C CD1 . LEU D 70 ? 0.3780 0.2952 0.4664 -0.0099 0.0292  0.0251  512 LEU D CD1 
2631 C CD2 . LEU D 70 ? 0.4100 0.3341 0.4893 -0.0075 0.0230  0.0077  512 LEU D CD2 
2632 N N   . GLN D 71 ? 0.4856 0.4303 0.5643 -0.0339 0.0872  -0.0057 513 GLN D N   
2633 C CA  . GLN D 71 ? 0.5149 0.4665 0.5801 -0.0454 0.1092  -0.0076 513 GLN D CA  
2634 C C   . GLN D 71 ? 0.5265 0.4874 0.5939 -0.0495 0.1249  -0.0321 513 GLN D C   
2635 O O   . GLN D 71 ? 0.5560 0.5229 0.5869 -0.0610 0.1381  -0.0369 513 GLN D O   
2636 C CB  . GLN D 71 ? 0.5103 0.4624 0.6108 -0.0466 0.1192  -0.0053 513 GLN D CB  
2637 C CG  . GLN D 71 ? 0.5516 0.5031 0.6357 -0.0582 0.1359  0.0088  513 GLN D CG  
2638 C CD  . GLN D 71 ? 0.5603 0.5072 0.6821 -0.0578 0.1374  0.0155  513 GLN D CD  
2639 O OE1 . GLN D 71 ? 0.5582 0.4932 0.6741 -0.0585 0.1315  0.0347  513 GLN D OE1 
2640 N NE2 . GLN D 71 ? 0.5632 0.5200 0.7295 -0.0568 0.1447  -0.0013 513 GLN D NE2 
2641 N N   . PHE D 72 ? 0.5034 0.4656 0.6151 -0.0407 0.1235  -0.0473 514 PHE D N   
2642 C CA  . PHE D 72 ? 0.5137 0.4823 0.6445 -0.0417 0.1393  -0.0724 514 PHE D CA  
2643 C C   . PHE D 72 ? 0.5310 0.4970 0.6277 -0.0455 0.1365  -0.0829 514 PHE D C   
2644 O O   . PHE D 72 ? 0.5591 0.5314 0.6435 -0.0553 0.1566  -0.1038 514 PHE D O   
2645 C CB  . PHE D 72 ? 0.4835 0.4523 0.6737 -0.0287 0.1310  -0.0791 514 PHE D CB  
2646 C CG  . PHE D 72 ? 0.5092 0.4820 0.7334 -0.0269 0.1470  -0.1038 514 PHE D CG  
2647 C CD1 . PHE D 72 ? 0.5417 0.5263 0.8033 -0.0302 0.1716  -0.1190 514 PHE D CD1 
2648 C CD2 . PHE D 72 ? 0.5044 0.4687 0.7288 -0.0225 0.1399  -0.1132 514 PHE D CD2 
2649 C CE1 . PHE D 72 ? 0.5466 0.5344 0.8482 -0.0279 0.1895  -0.1444 514 PHE D CE1 
2650 C CE2 . PHE D 72 ? 0.5261 0.4912 0.7889 -0.0208 0.1569  -0.1377 514 PHE D CE2 
2651 C CZ  . PHE D 72 ? 0.5380 0.5148 0.8409 -0.0228 0.1821  -0.1539 514 PHE D CZ  
2652 N N   . TYR D 73 ? 0.5183 0.4763 0.6023 -0.0392 0.1128  -0.0707 515 TYR D N   
2653 C CA  . TYR D 73 ? 0.5356 0.4923 0.5913 -0.0432 0.1058  -0.0786 515 TYR D CA  
2654 C C   . TYR D 73 ? 0.5664 0.5303 0.5651 -0.0558 0.1044  -0.0684 515 TYR D C   
2655 O O   . TYR D 73 ? 0.5799 0.5459 0.5526 -0.0597 0.0920  -0.0694 515 TYR D O   
2656 C CB  . TYR D 73 ? 0.5092 0.4566 0.5771 -0.0323 0.0820  -0.0673 515 TYR D CB  
2657 C CG  . TYR D 73 ? 0.5035 0.4437 0.6154 -0.0230 0.0800  -0.0784 515 TYR D CG  
2658 C CD1 . TYR D 73 ? 0.5340 0.4708 0.6513 -0.0259 0.0851  -0.0981 515 TYR D CD1 
2659 C CD2 . TYR D 73 ? 0.4777 0.4146 0.6261 -0.0122 0.0713  -0.0679 515 TYR D CD2 
2660 C CE1 . TYR D 73 ? 0.5404 0.4677 0.7027 -0.0168 0.0830  -0.1042 515 TYR D CE1 
2661 C CE2 . TYR D 73 ? 0.4786 0.4093 0.6671 -0.0035 0.0664  -0.0721 515 TYR D CE2 
2662 C CZ  . TYR D 73 ? 0.5227 0.4471 0.7199 -0.0051 0.0729  -0.0887 515 TYR D CZ  
2663 O OH  . TYR D 73 ? 0.5421 0.4574 0.7833 0.0037  0.0686  -0.0897 515 TYR D OH  
2664 N N   . SER D 74 ? 0.5827 0.5513 0.5648 -0.0627 0.1155  -0.0563 516 SER D N   
2665 C CA  . SER D 74 ? 0.6215 0.5978 0.5491 -0.0757 0.1149  -0.0408 516 SER D CA  
2666 C C   . SER D 74 ? 0.6138 0.5878 0.5233 -0.0710 0.0874  -0.0155 516 SER D C   
2667 O O   . SER D 74 ? 0.6448 0.6283 0.5106 -0.0809 0.0797  -0.0039 516 SER D O   
2668 C CB  . SER D 74 ? 0.6679 0.6568 0.5578 -0.0924 0.1308  -0.0647 516 SER D CB  
2669 O OG  . SER D 74 ? 0.6893 0.6824 0.5929 -0.0993 0.1617  -0.0843 516 SER D OG  
2670 N N   . VAL D 75 ? 0.5763 0.5394 0.5208 -0.0564 0.0728  -0.0071 517 VAL D N   
2671 C CA  . VAL D 75 ? 0.5684 0.5287 0.5081 -0.0503 0.0506  0.0153  517 VAL D CA  
2672 C C   . VAL D 75 ? 0.5969 0.5570 0.5183 -0.0546 0.0509  0.0434  517 VAL D C   
2673 O O   . VAL D 75 ? 0.5996 0.5545 0.5324 -0.0563 0.0660  0.0478  517 VAL D O   
2674 C CB  . VAL D 75 ? 0.5238 0.4724 0.5039 -0.0361 0.0410  0.0163  517 VAL D CB  
2675 C CG1 . VAL D 75 ? 0.5212 0.4682 0.5009 -0.0304 0.0221  0.0342  517 VAL D CG1 
2676 C CG2 . VAL D 75 ? 0.5057 0.4525 0.5060 -0.0323 0.0420  -0.0064 517 VAL D CG2 
2677 N N   . GLU D 76 ? 0.6223 0.5891 0.5192 -0.0569 0.0342  0.0634  518 GLU D N   
2678 C CA  . GLU D 76 ? 0.6614 0.6284 0.5399 -0.0614 0.0321  0.0954  518 GLU D CA  
2679 C C   . GLU D 76 ? 0.6451 0.6039 0.5507 -0.0491 0.0138  0.1205  518 GLU D C   
2680 O O   . GLU D 76 ? 0.6139 0.5721 0.5419 -0.0398 0.0011  0.1127  518 GLU D O   
2681 C CB  . GLU D 76 ? 0.7140 0.6997 0.5367 -0.0773 0.0278  0.1028  518 GLU D CB  
2682 C CG  . GLU D 76 ? 0.7761 0.7680 0.5660 -0.0934 0.0536  0.0890  518 GLU D CG  
2683 C CD  . GLU D 76 ? 0.8736 0.8870 0.6003 -0.1123 0.0495  0.0906  518 GLU D CD  
2684 O OE1 . GLU D 76 ? 0.8786 0.9045 0.5923 -0.1141 0.0310  0.0802  518 GLU D OE1 
2685 O OE2 . GLU D 76 ? 0.9382 0.9572 0.6271 -0.1271 0.0654  0.1015  518 GLU D OE2 
2686 N N   . ASN D 77 ? 0.6697 0.6216 0.5761 -0.0499 0.0148  0.1505  519 ASN D N   
2687 C CA  . ASN D 77 ? 0.6677 0.6115 0.6039 -0.0389 -0.0005 0.1768  519 ASN D CA  
2688 C C   . ASN D 77 ? 0.6776 0.6386 0.6025 -0.0370 -0.0257 0.1875  519 ASN D C   
2689 O O   . ASN D 77 ? 0.7133 0.6924 0.5945 -0.0485 -0.0347 0.1978  519 ASN D O   
2690 C CB  . ASN D 77 ? 0.7011 0.6344 0.6377 -0.0423 0.0058  0.2106  519 ASN D CB  
2691 C CG  . ASN D 77 ? 0.7004 0.6172 0.6876 -0.0287 -0.0017 0.2310  519 ASN D CG  
2692 O OD1 . ASN D 77 ? 0.6900 0.5942 0.7173 -0.0196 0.0039  0.2119  519 ASN D OD1 
2693 N ND2 . ASN D 77 ? 0.7597 0.6769 0.7461 -0.0280 -0.0142 0.2700  519 ASN D ND2 
2694 N N   . GLY D 78 ? 0.6477 0.6052 0.6120 -0.0242 -0.0363 0.1831  520 GLY D N   
2695 C CA  . GLY D 78 ? 0.6538 0.6291 0.6208 -0.0212 -0.0600 0.1917  520 GLY D CA  
2696 C C   . GLY D 78 ? 0.6377 0.6258 0.5933 -0.0250 -0.0639 0.1607  520 GLY D C   
2697 O O   . GLY D 78 ? 0.6462 0.6508 0.6075 -0.0241 -0.0828 0.1634  520 GLY D O   
2698 N N   . ASP D 79 ? 0.6226 0.6035 0.5676 -0.0293 -0.0464 0.1319  521 ASP D N   
2699 C CA  . ASP D 79 ? 0.6084 0.5965 0.5498 -0.0323 -0.0475 0.1027  521 ASP D CA  
2700 C C   . ASP D 79 ? 0.5732 0.5554 0.5562 -0.0207 -0.0525 0.0957  521 ASP D C   
2701 O O   . ASP D 79 ? 0.5554 0.5261 0.5697 -0.0105 -0.0508 0.1071  521 ASP D O   
2702 C CB  . ASP D 79 ? 0.6016 0.5823 0.5306 -0.0381 -0.0269 0.0765  521 ASP D CB  
2703 C CG  . ASP D 79 ? 0.6475 0.6414 0.5300 -0.0542 -0.0208 0.0698  521 ASP D CG  
2704 O OD1 . ASP D 79 ? 0.6713 0.6824 0.5231 -0.0628 -0.0354 0.0844  521 ASP D OD1 
2705 O OD2 . ASP D 79 ? 0.6324 0.6210 0.5099 -0.0589 -0.0010 0.0490  521 ASP D OD2 
2706 N N   . CYS D 80 ? 0.5714 0.5609 0.5548 -0.0239 -0.0565 0.0756  522 CYS D N   
2707 C CA  . CYS D 80 ? 0.5522 0.5380 0.5704 -0.0159 -0.0594 0.0687  522 CYS D CA  
2708 C C   . CYS D 80 ? 0.5248 0.4968 0.5490 -0.0153 -0.0454 0.0460  522 CYS D C   
2709 O O   . CYS D 80 ? 0.5378 0.5114 0.5458 -0.0229 -0.0407 0.0288  522 CYS D O   
2710 C CB  . CYS D 80 ? 0.5612 0.5675 0.5839 -0.0202 -0.0770 0.0681  522 CYS D CB  
2711 S SG  . CYS D 80 ? 0.5946 0.5998 0.6636 -0.0122 -0.0785 0.0623  522 CYS D SG  
2712 N N   . LEU D 81 ? 0.4939 0.4529 0.5424 -0.0070 -0.0389 0.0463  523 LEU D N   
2713 C CA  . LEU D 81 ? 0.4731 0.4208 0.5291 -0.0059 -0.0298 0.0310  523 LEU D CA  
2714 C C   . LEU D 81 ? 0.4584 0.4084 0.5313 -0.0056 -0.0337 0.0256  523 LEU D C   
2715 O O   . LEU D 81 ? 0.4490 0.4008 0.5403 -0.0012 -0.0357 0.0328  523 LEU D O   
2716 C CB  . LEU D 81 ? 0.4603 0.3953 0.5270 -0.0002 -0.0213 0.0342  523 LEU D CB  
2717 C CG  . LEU D 81 ? 0.4641 0.3897 0.5340 0.0003  -0.0142 0.0235  523 LEU D CG  
2718 C CD1 . LEU D 81 ? 0.4919 0.4181 0.5519 -0.0033 -0.0084 0.0158  523 LEU D CD1 
2719 C CD2 . LEU D 81 ? 0.4914 0.4095 0.5716 0.0038  -0.0098 0.0268  523 LEU D CD2 
2720 N N   . LEU D 82 ? 0.4569 0.4059 0.5273 -0.0108 -0.0325 0.0120  524 LEU D N   
2721 C CA  . LEU D 82 ? 0.4446 0.3935 0.5323 -0.0123 -0.0337 0.0073  524 LEU D CA  
2722 C C   . LEU D 82 ? 0.4310 0.3642 0.5263 -0.0095 -0.0249 0.0054  524 LEU D C   
2723 O O   . LEU D 82 ? 0.4316 0.3559 0.5228 -0.0091 -0.0204 0.0003  524 LEU D O   
2724 C CB  . LEU D 82 ? 0.4569 0.4143 0.5426 -0.0215 -0.0386 -0.0056 524 LEU D CB  
2725 C CG  . LEU D 82 ? 0.4798 0.4578 0.5524 -0.0271 -0.0514 -0.0029 524 LEU D CG  
2726 C CD1 . LEU D 82 ? 0.5229 0.5027 0.5663 -0.0340 -0.0483 -0.0125 524 LEU D CD1 
2727 C CD2 . LEU D 82 ? 0.5224 0.5148 0.6095 -0.0349 -0.0609 -0.0105 524 LEU D CD2 
2728 N N   . VAL D 83 ? 0.4180 0.3497 0.5253 -0.0080 -0.0226 0.0105  525 VAL D N   
2729 C CA  . VAL D 83 ? 0.4037 0.3236 0.5107 -0.0067 -0.0161 0.0132  525 VAL D CA  
2730 C C   . VAL D 83 ? 0.4068 0.3241 0.5249 -0.0116 -0.0129 0.0132  525 VAL D C   
2731 O O   . VAL D 83 ? 0.4037 0.3298 0.5344 -0.0139 -0.0117 0.0133  525 VAL D O   
2732 C CB  . VAL D 83 ? 0.4036 0.3232 0.5086 -0.0032 -0.0118 0.0181  525 VAL D CB  
2733 C CG1 . VAL D 83 ? 0.4024 0.3132 0.4983 -0.0048 -0.0075 0.0201  525 VAL D CG1 
2734 C CG2 . VAL D 83 ? 0.3703 0.2913 0.4701 0.0008  -0.0137 0.0199  525 VAL D CG2 
2735 N N   . ARG D 84 ? 0.4128 0.3182 0.5309 -0.0131 -0.0112 0.0144  526 ARG D N   
2736 C CA  . ARG D 84 ? 0.4252 0.3238 0.5550 -0.0188 -0.0072 0.0172  526 ARG D CA  
2737 C C   . ARG D 84 ? 0.4337 0.3204 0.5553 -0.0186 -0.0049 0.0298  526 ARG D C   
2738 O O   . ARG D 84 ? 0.4317 0.3157 0.5441 -0.0138 -0.0091 0.0332  526 ARG D O   
2739 C CB  . ARG D 84 ? 0.4302 0.3243 0.5750 -0.0223 -0.0087 0.0073  526 ARG D CB  
2740 C CG  . ARG D 84 ? 0.4388 0.3482 0.5876 -0.0263 -0.0136 -0.0053 526 ARG D CG  
2741 C CD  . ARG D 84 ? 0.4506 0.3551 0.6145 -0.0337 -0.0129 -0.0198 526 ARG D CD  
2742 N NE  . ARG D 84 ? 0.4434 0.3665 0.6091 -0.0410 -0.0201 -0.0323 526 ARG D NE  
2743 C CZ  . ARG D 84 ? 0.4555 0.3906 0.6035 -0.0424 -0.0265 -0.0415 526 ARG D CZ  
2744 N NH1 . ARG D 84 ? 0.4210 0.3501 0.5516 -0.0368 -0.0234 -0.0412 526 ARG D NH1 
2745 N NH2 . ARG D 84 ? 0.4512 0.4066 0.5986 -0.0508 -0.0365 -0.0503 526 ARG D NH2 
2746 N N   . TRP D 85 ? 0.4485 0.3303 0.5736 -0.0249 0.0011  0.0379  527 TRP D N   
2747 C CA  . TRP D 85 ? 0.4682 0.3396 0.5820 -0.0270 0.0013  0.0546  527 TRP D CA  
2748 C C   . TRP D 85 ? 0.4875 0.3493 0.6142 -0.0350 0.0084  0.0639  527 TRP D C   
2749 O O   . TRP D 85 ? 0.5137 0.3671 0.6291 -0.0395 0.0100  0.0824  527 TRP D O   
2750 C CB  . TRP D 85 ? 0.4726 0.3515 0.5586 -0.0289 0.0038  0.0586  527 TRP D CB  
2751 C CG  . TRP D 85 ? 0.4619 0.3505 0.5462 -0.0345 0.0161  0.0517  527 TRP D CG  
2752 C CD1 . TRP D 85 ? 0.4693 0.3578 0.5451 -0.0442 0.0282  0.0583  527 TRP D CD1 
2753 C CD2 . TRP D 85 ? 0.4433 0.3438 0.5385 -0.0306 0.0187  0.0378  527 TRP D CD2 
2754 N NE1 . TRP D 85 ? 0.4663 0.3668 0.5516 -0.0462 0.0399  0.0461  527 TRP D NE1 
2755 C CE2 . TRP D 85 ? 0.4338 0.3414 0.5334 -0.0370 0.0329  0.0349  527 TRP D CE2 
2756 C CE3 . TRP D 85 ? 0.3898 0.2956 0.4930 -0.0226 0.0109  0.0296  527 TRP D CE3 
2757 C CZ2 . TRP D 85 ? 0.3821 0.3020 0.5014 -0.0336 0.0381  0.0240  527 TRP D CZ2 
2758 C CZ3 . TRP D 85 ? 0.3562 0.2733 0.4734 -0.0201 0.0143  0.0225  527 TRP D CZ3 
2759 C CH2 . TRP D 85 ? 0.3709 0.2949 0.4997 -0.0246 0.0271  0.0197  527 TRP D CH2 
2760 O OXT . TRP D 85 ? 0.4815 0.3446 0.6304 -0.0384 0.0121  0.0536  527 TRP D OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASN 1  443 ?   ?   ?   A . n 
A 1 2  GLN 2  444 444 GLN GLN A . n 
A 1 3  LEU 3  445 445 LEU LEU A . n 
A 1 4  LEU 4  446 446 LEU LEU A . n 
A 1 5  THR 5  447 447 THR THR A . n 
A 1 6  LEU 6  448 448 LEU LEU A . n 
A 1 7  LYS 7  449 449 LYS LYS A . n 
A 1 8  ILE 8  450 450 ILE ILE A . n 
A 1 9  LYS 9  451 451 LYS LYS A . n 
A 1 10 TYR 10 452 452 TYR TYR A . n 
A 1 11 PRO 11 453 453 PRO PRO A . n 
A 1 12 HIS 12 454 454 HIS HIS A . n 
A 1 13 GLN 13 455 455 GLN GLN A . n 
A 1 14 LEU 14 456 456 LEU LEU A . n 
A 1 15 ASP 15 457 457 ASP ASP A . n 
A 1 16 GLN 16 458 458 GLN GLN A . n 
A 1 17 LYS 17 459 459 LYS LYS A . n 
A 1 18 VAL 18 460 460 VAL VAL A . n 
A 1 19 LEU 19 461 461 LEU LEU A . n 
A 1 20 GLU 20 462 462 GLU GLU A . n 
A 1 21 LYS 21 463 463 LYS LYS A . n 
A 1 22 GLN 22 464 464 GLN GLN A . n 
A 1 23 LEU 23 465 465 LEU LEU A . n 
A 1 24 PRO 24 466 466 PRO PRO A . n 
A 1 25 GLY 25 467 467 GLY GLY A . n 
A 1 26 SER 26 468 468 SER SER A . n 
A 1 27 MET 27 469 469 MET MET A . n 
A 1 28 THR 28 470 470 THR THR A . n 
A 1 29 ILE 29 471 471 ILE ILE A . n 
A 1 30 GLN 30 472 472 GLN GLN A . n 
A 1 31 LYS 31 473 473 LYS LYS A . n 
A 1 32 VAL 32 474 474 VAL VAL A . n 
A 1 33 LYS 33 475 475 LYS LYS A . n 
A 1 34 GLY 34 476 476 GLY GLY A . n 
A 1 35 LEU 35 477 477 LEU LEU A . n 
A 1 36 LEU 36 478 478 LEU LEU A . n 
A 1 37 SER 37 479 479 SER SER A . n 
A 1 38 ARG 38 480 480 ARG ARG A . n 
A 1 39 LEU 39 481 481 LEU LEU A . n 
A 1 40 LEU 40 482 482 LEU LEU A . n 
A 1 41 LYS 41 483 483 LYS LYS A . n 
A 1 42 VAL 42 484 484 VAL VAL A . n 
A 1 43 PRO 43 485 485 PRO PRO A . n 
A 1 44 VAL 44 486 486 VAL VAL A . n 
A 1 45 SER 45 487 487 SER SER A . n 
A 1 46 ASP 46 488 488 ASP ASP A . n 
A 1 47 LEU 47 489 489 LEU LEU A . n 
A 1 48 LEU 48 490 490 LEU LEU A . n 
A 1 49 LEU 49 491 491 LEU LEU A . n 
A 1 50 SER 50 492 492 SER SER A . n 
A 1 51 TYR 51 493 493 TYR TYR A . n 
A 1 52 GLU 52 494 494 GLU GLU A . n 
A 1 53 SER 53 495 495 SER SER A . n 
A 1 54 PRO 54 496 496 PRO PRO A . n 
A 1 55 LYS 55 497 497 LYS LYS A . n 
A 1 56 LYS 56 498 498 LYS LYS A . n 
A 1 57 PRO 57 499 499 PRO PRO A . n 
A 1 58 GLY 58 500 500 GLY GLY A . n 
A 1 59 ARG 59 501 501 ARG ARG A . n 
A 1 60 GLU 60 502 502 GLU GLU A . n 
A 1 61 ILE 61 503 503 ILE ILE A . n 
A 1 62 GLU 62 504 504 GLU GLU A . n 
A 1 63 LEU 63 505 505 LEU LEU A . n 
A 1 64 GLU 64 506 506 GLU GLU A . n 
A 1 65 ASN 65 507 507 ASN ASN A . n 
A 1 66 ASP 66 508 508 ASP ASP A . n 
A 1 67 LEU 67 509 509 LEU LEU A . n 
A 1 68 LYS 68 510 510 LYS LYS A . n 
A 1 69 SER 69 511 511 SER SER A . n 
A 1 70 LEU 70 512 512 LEU LEU A . n 
A 1 71 GLN 71 513 513 GLN GLN A . n 
A 1 72 PHE 72 514 514 PHE PHE A . n 
A 1 73 TYR 73 515 515 TYR TYR A . n 
A 1 74 SER 74 516 516 SER SER A . n 
A 1 75 VAL 75 517 517 VAL VAL A . n 
A 1 76 GLU 76 518 518 GLU GLU A . n 
A 1 77 ASN 77 519 519 ASN ASN A . n 
A 1 78 GLY 78 520 520 GLY GLY A . n 
A 1 79 ASP 79 521 521 ASP ASP A . n 
A 1 80 CYS 80 522 522 CYS CYS A . n 
A 1 81 LEU 81 523 523 LEU LEU A . n 
A 1 82 LEU 82 524 524 LEU LEU A . n 
A 1 83 VAL 83 525 525 VAL VAL A . n 
A 1 84 ARG 84 526 526 ARG ARG A . n 
A 1 85 TRP 85 527 527 TRP TRP A . n 
B 1 1  ASN 1  443 ?   ?   ?   B . n 
B 1 2  GLN 2  444 444 GLN GLN B . n 
B 1 3  LEU 3  445 445 LEU LEU B . n 
B 1 4  LEU 4  446 446 LEU LEU B . n 
B 1 5  THR 5  447 447 THR THR B . n 
B 1 6  LEU 6  448 448 LEU LEU B . n 
B 1 7  LYS 7  449 449 LYS LYS B . n 
B 1 8  ILE 8  450 450 ILE ILE B . n 
B 1 9  LYS 9  451 451 LYS LYS B . n 
B 1 10 TYR 10 452 452 TYR TYR B . n 
B 1 11 PRO 11 453 453 PRO PRO B . n 
B 1 12 HIS 12 454 454 HIS HIS B . n 
B 1 13 GLN 13 455 455 GLN GLN B . n 
B 1 14 LEU 14 456 456 LEU LEU B . n 
B 1 15 ASP 15 457 457 ASP ASP B . n 
B 1 16 GLN 16 458 458 GLN GLN B . n 
B 1 17 LYS 17 459 459 LYS LYS B . n 
B 1 18 VAL 18 460 460 VAL VAL B . n 
B 1 19 LEU 19 461 461 LEU LEU B . n 
B 1 20 GLU 20 462 462 GLU GLU B . n 
B 1 21 LYS 21 463 463 LYS LYS B . n 
B 1 22 GLN 22 464 464 GLN GLN B . n 
B 1 23 LEU 23 465 465 LEU LEU B . n 
B 1 24 PRO 24 466 466 PRO PRO B . n 
B 1 25 GLY 25 467 467 GLY GLY B . n 
B 1 26 SER 26 468 468 SER SER B . n 
B 1 27 MET 27 469 469 MET MET B . n 
B 1 28 THR 28 470 470 THR THR B . n 
B 1 29 ILE 29 471 471 ILE ILE B . n 
B 1 30 GLN 30 472 472 GLN GLN B . n 
B 1 31 LYS 31 473 473 LYS LYS B . n 
B 1 32 VAL 32 474 474 VAL VAL B . n 
B 1 33 LYS 33 475 475 LYS LYS B . n 
B 1 34 GLY 34 476 476 GLY GLY B . n 
B 1 35 LEU 35 477 477 LEU LEU B . n 
B 1 36 LEU 36 478 478 LEU LEU B . n 
B 1 37 SER 37 479 479 SER SER B . n 
B 1 38 ARG 38 480 480 ARG ARG B . n 
B 1 39 LEU 39 481 481 LEU LEU B . n 
B 1 40 LEU 40 482 482 LEU LEU B . n 
B 1 41 LYS 41 483 483 LYS LYS B . n 
B 1 42 VAL 42 484 484 VAL VAL B . n 
B 1 43 PRO 43 485 485 PRO PRO B . n 
B 1 44 VAL 44 486 486 VAL VAL B . n 
B 1 45 SER 45 487 487 SER SER B . n 
B 1 46 ASP 46 488 488 ASP ASP B . n 
B 1 47 LEU 47 489 489 LEU LEU B . n 
B 1 48 LEU 48 490 490 LEU LEU B . n 
B 1 49 LEU 49 491 491 LEU LEU B . n 
B 1 50 SER 50 492 492 SER SER B . n 
B 1 51 TYR 51 493 493 TYR TYR B . n 
B 1 52 GLU 52 494 494 GLU GLU B . n 
B 1 53 SER 53 495 495 SER SER B . n 
B 1 54 PRO 54 496 496 PRO PRO B . n 
B 1 55 LYS 55 497 497 LYS LYS B . n 
B 1 56 LYS 56 498 498 LYS LYS B . n 
B 1 57 PRO 57 499 499 PRO PRO B . n 
B 1 58 GLY 58 500 500 GLY GLY B . n 
B 1 59 ARG 59 501 501 ARG ARG B . n 
B 1 60 GLU 60 502 502 GLU GLU B . n 
B 1 61 ILE 61 503 503 ILE ILE B . n 
B 1 62 GLU 62 504 504 GLU GLU B . n 
B 1 63 LEU 63 505 505 LEU LEU B . n 
B 1 64 GLU 64 506 506 GLU GLU B . n 
B 1 65 ASN 65 507 507 ASN ASN B . n 
B 1 66 ASP 66 508 508 ASP ASP B . n 
B 1 67 LEU 67 509 509 LEU LEU B . n 
B 1 68 LYS 68 510 510 LYS LYS B . n 
B 1 69 SER 69 511 511 SER SER B . n 
B 1 70 LEU 70 512 512 LEU LEU B . n 
B 1 71 GLN 71 513 513 GLN GLN B . n 
B 1 72 PHE 72 514 514 PHE PHE B . n 
B 1 73 TYR 73 515 515 TYR TYR B . n 
B 1 74 SER 74 516 516 SER SER B . n 
B 1 75 VAL 75 517 517 VAL VAL B . n 
B 1 76 GLU 76 518 518 GLU GLU B . n 
B 1 77 ASN 77 519 519 ASN ASN B . n 
B 1 78 GLY 78 520 520 GLY GLY B . n 
B 1 79 ASP 79 521 521 ASP ASP B . n 
B 1 80 CYS 80 522 522 CYS CYS B . n 
B 1 81 LEU 81 523 523 LEU LEU B . n 
B 1 82 LEU 82 524 524 LEU LEU B . n 
B 1 83 VAL 83 525 525 VAL VAL B . n 
B 1 84 ARG 84 526 526 ARG ARG B . n 
B 1 85 TRP 85 527 527 TRP TRP B . n 
C 1 1  ASN 1  443 ?   ?   ?   C . n 
C 1 2  GLN 2  444 444 GLN GLN C . n 
C 1 3  LEU 3  445 445 LEU LEU C . n 
C 1 4  LEU 4  446 446 LEU LEU C . n 
C 1 5  THR 5  447 447 THR THR C . n 
C 1 6  LEU 6  448 448 LEU LEU C . n 
C 1 7  LYS 7  449 449 LYS LYS C . n 
C 1 8  ILE 8  450 450 ILE ILE C . n 
C 1 9  LYS 9  451 451 LYS LYS C . n 
C 1 10 TYR 10 452 452 TYR TYR C . n 
C 1 11 PRO 11 453 453 PRO PRO C . n 
C 1 12 HIS 12 454 454 HIS HIS C . n 
C 1 13 GLN 13 455 455 GLN GLN C . n 
C 1 14 LEU 14 456 456 LEU LEU C . n 
C 1 15 ASP 15 457 457 ASP ASP C . n 
C 1 16 GLN 16 458 458 GLN GLN C . n 
C 1 17 LYS 17 459 459 LYS LYS C . n 
C 1 18 VAL 18 460 460 VAL VAL C . n 
C 1 19 LEU 19 461 461 LEU LEU C . n 
C 1 20 GLU 20 462 462 GLU GLU C . n 
C 1 21 LYS 21 463 463 LYS LYS C . n 
C 1 22 GLN 22 464 464 GLN GLN C . n 
C 1 23 LEU 23 465 465 LEU LEU C . n 
C 1 24 PRO 24 466 466 PRO PRO C . n 
C 1 25 GLY 25 467 467 GLY GLY C . n 
C 1 26 SER 26 468 468 SER SER C . n 
C 1 27 MET 27 469 469 MET MET C . n 
C 1 28 THR 28 470 470 THR THR C . n 
C 1 29 ILE 29 471 471 ILE ILE C . n 
C 1 30 GLN 30 472 472 GLN GLN C . n 
C 1 31 LYS 31 473 473 LYS LYS C . n 
C 1 32 VAL 32 474 474 VAL VAL C . n 
C 1 33 LYS 33 475 475 LYS LYS C . n 
C 1 34 GLY 34 476 476 GLY GLY C . n 
C 1 35 LEU 35 477 477 LEU LEU C . n 
C 1 36 LEU 36 478 478 LEU LEU C . n 
C 1 37 SER 37 479 479 SER SER C . n 
C 1 38 ARG 38 480 480 ARG ARG C . n 
C 1 39 LEU 39 481 481 LEU LEU C . n 
C 1 40 LEU 40 482 482 LEU LEU C . n 
C 1 41 LYS 41 483 483 LYS LYS C . n 
C 1 42 VAL 42 484 484 VAL VAL C . n 
C 1 43 PRO 43 485 485 PRO PRO C . n 
C 1 44 VAL 44 486 486 VAL VAL C . n 
C 1 45 SER 45 487 487 SER SER C . n 
C 1 46 ASP 46 488 488 ASP ASP C . n 
C 1 47 LEU 47 489 489 LEU LEU C . n 
C 1 48 LEU 48 490 490 LEU LEU C . n 
C 1 49 LEU 49 491 491 LEU LEU C . n 
C 1 50 SER 50 492 492 SER SER C . n 
C 1 51 TYR 51 493 493 TYR TYR C . n 
C 1 52 GLU 52 494 494 GLU GLU C . n 
C 1 53 SER 53 495 495 SER SER C . n 
C 1 54 PRO 54 496 496 PRO PRO C . n 
C 1 55 LYS 55 497 497 LYS LYS C . n 
C 1 56 LYS 56 498 498 LYS LYS C . n 
C 1 57 PRO 57 499 499 PRO PRO C . n 
C 1 58 GLY 58 500 500 GLY GLY C . n 
C 1 59 ARG 59 501 501 ARG ARG C . n 
C 1 60 GLU 60 502 502 GLU GLU C . n 
C 1 61 ILE 61 503 503 ILE ILE C . n 
C 1 62 GLU 62 504 504 GLU GLU C . n 
C 1 63 LEU 63 505 505 LEU LEU C . n 
C 1 64 GLU 64 506 506 GLU GLU C . n 
C 1 65 ASN 65 507 507 ASN ASN C . n 
C 1 66 ASP 66 508 508 ASP ASP C . n 
C 1 67 LEU 67 509 509 LEU LEU C . n 
C 1 68 LYS 68 510 510 LYS LYS C . n 
C 1 69 SER 69 511 511 SER SER C . n 
C 1 70 LEU 70 512 512 LEU LEU C . n 
C 1 71 GLN 71 513 513 GLN GLN C . n 
C 1 72 PHE 72 514 514 PHE PHE C . n 
C 1 73 TYR 73 515 515 TYR TYR C . n 
C 1 74 SER 74 516 516 SER SER C . n 
C 1 75 VAL 75 517 517 VAL VAL C . n 
C 1 76 GLU 76 518 518 GLU GLU C . n 
C 1 77 ASN 77 519 519 ASN ASN C . n 
C 1 78 GLY 78 520 520 GLY GLY C . n 
C 1 79 ASP 79 521 521 ASP ASP C . n 
C 1 80 CYS 80 522 522 CYS CYS C . n 
C 1 81 LEU 81 523 523 LEU LEU C . n 
C 1 82 LEU 82 524 524 LEU LEU C . n 
C 1 83 VAL 83 525 525 VAL VAL C . n 
C 1 84 ARG 84 526 526 ARG ARG C . n 
C 1 85 TRP 85 527 527 TRP TRP C . n 
D 1 1  ASN 1  443 ?   ?   ?   D . n 
D 1 2  GLN 2  444 444 GLN GLN D . n 
D 1 3  LEU 3  445 445 LEU LEU D . n 
D 1 4  LEU 4  446 446 LEU LEU D . n 
D 1 5  THR 5  447 447 THR THR D . n 
D 1 6  LEU 6  448 448 LEU LEU D . n 
D 1 7  LYS 7  449 449 LYS LYS D . n 
D 1 8  ILE 8  450 450 ILE ILE D . n 
D 1 9  LYS 9  451 451 LYS LYS D . n 
D 1 10 TYR 10 452 452 TYR TYR D . n 
D 1 11 PRO 11 453 453 PRO PRO D . n 
D 1 12 HIS 12 454 454 HIS HIS D . n 
D 1 13 GLN 13 455 455 GLN GLN D . n 
D 1 14 LEU 14 456 456 LEU LEU D . n 
D 1 15 ASP 15 457 457 ASP ASP D . n 
D 1 16 GLN 16 458 458 GLN GLN D . n 
D 1 17 LYS 17 459 459 LYS LYS D . n 
D 1 18 VAL 18 460 460 VAL VAL D . n 
D 1 19 LEU 19 461 461 LEU LEU D . n 
D 1 20 GLU 20 462 462 GLU GLU D . n 
D 1 21 LYS 21 463 463 LYS LYS D . n 
D 1 22 GLN 22 464 464 GLN GLN D . n 
D 1 23 LEU 23 465 465 LEU LEU D . n 
D 1 24 PRO 24 466 466 PRO PRO D . n 
D 1 25 GLY 25 467 467 GLY GLY D . n 
D 1 26 SER 26 468 468 SER SER D . n 
D 1 27 MET 27 469 469 MET MET D . n 
D 1 28 THR 28 470 470 THR THR D . n 
D 1 29 ILE 29 471 471 ILE ILE D . n 
D 1 30 GLN 30 472 472 GLN GLN D . n 
D 1 31 LYS 31 473 473 LYS LYS D . n 
D 1 32 VAL 32 474 474 VAL VAL D . n 
D 1 33 LYS 33 475 475 LYS LYS D . n 
D 1 34 GLY 34 476 476 GLY GLY D . n 
D 1 35 LEU 35 477 477 LEU LEU D . n 
D 1 36 LEU 36 478 478 LEU LEU D . n 
D 1 37 SER 37 479 479 SER SER D . n 
D 1 38 ARG 38 480 480 ARG ARG D . n 
D 1 39 LEU 39 481 481 LEU LEU D . n 
D 1 40 LEU 40 482 482 LEU LEU D . n 
D 1 41 LYS 41 483 483 LYS LYS D . n 
D 1 42 VAL 42 484 484 VAL VAL D . n 
D 1 43 PRO 43 485 485 PRO PRO D . n 
D 1 44 VAL 44 486 486 VAL VAL D . n 
D 1 45 SER 45 487 487 SER SER D . n 
D 1 46 ASP 46 488 488 ASP ASP D . n 
D 1 47 LEU 47 489 489 LEU LEU D . n 
D 1 48 LEU 48 490 490 LEU LEU D . n 
D 1 49 LEU 49 491 491 LEU LEU D . n 
D 1 50 SER 50 492 492 SER SER D . n 
D 1 51 TYR 51 493 493 TYR TYR D . n 
D 1 52 GLU 52 494 494 GLU GLU D . n 
D 1 53 SER 53 495 495 SER SER D . n 
D 1 54 PRO 54 496 496 PRO PRO D . n 
D 1 55 LYS 55 497 497 LYS LYS D . n 
D 1 56 LYS 56 498 498 LYS LYS D . n 
D 1 57 PRO 57 499 499 PRO PRO D . n 
D 1 58 GLY 58 500 500 GLY GLY D . n 
D 1 59 ARG 59 501 501 ARG ARG D . n 
D 1 60 GLU 60 502 502 GLU GLU D . n 
D 1 61 ILE 61 503 503 ILE ILE D . n 
D 1 62 GLU 62 504 504 GLU GLU D . n 
D 1 63 LEU 63 505 505 LEU LEU D . n 
D 1 64 GLU 64 506 506 GLU GLU D . n 
D 1 65 ASN 65 507 507 ASN ASN D . n 
D 1 66 ASP 66 508 508 ASP ASP D . n 
D 1 67 LEU 67 509 509 LEU LEU D . n 
D 1 68 LYS 68 510 510 LYS LYS D . n 
D 1 69 SER 69 511 511 SER SER D . n 
D 1 70 LEU 70 512 512 LEU LEU D . n 
D 1 71 GLN 71 513 513 GLN GLN D . n 
D 1 72 PHE 72 514 514 PHE PHE D . n 
D 1 73 TYR 73 515 515 TYR TYR D . n 
D 1 74 SER 74 516 516 SER SER D . n 
D 1 75 VAL 75 517 517 VAL VAL D . n 
D 1 76 GLU 76 518 518 GLU GLU D . n 
D 1 77 ASN 77 519 519 ASN ASN D . n 
D 1 78 GLY 78 520 520 GLY GLY D . n 
D 1 79 ASP 79 521 521 ASP ASP D . n 
D 1 80 CYS 80 522 522 CYS CYS D . n 
D 1 81 LEU 81 523 523 LEU LEU D . n 
D 1 82 LEU 82 524 524 LEU LEU D . n 
D 1 83 VAL 83 525 525 VAL VAL D . n 
D 1 84 ARG 84 526 526 ARG ARG D . n 
D 1 85 TRP 85 527 527 TRP TRP D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E 
2 1 B,F 
3 1 C,G 
4 1 D,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-06-18 
2 'Structure model' 1 1 2016-06-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -2.5588  15.8594 -6.9764  0.0217 0.0152 0.0090 0.0096  -0.0111 -0.0012 2.8930 2.1871 2.5329 0.3001 
-0.1079 -0.3457 0.0255  0.1630  0.0704  -0.0976 -0.0654 0.0456  0.0033  -0.0614 0.0399  
'X-RAY DIFFRACTION' 2 ? refined -19.7816 6.7107  -24.5067 0.1338 0.0547 0.0647 -0.0124 -0.0168 -0.0525 4.3511 2.0190 3.7357 
-0.1689 0.1557  0.5061  0.0584  0.0663  0.0526  -0.1239 -0.0589 0.1047  -0.1323 -0.0684 0.0005  
'X-RAY DIFFRACTION' 3 ? refined -1.4693  27.3232 -31.0290 0.1320 0.0887 0.0780 -0.0061 -0.0522 0.0702  3.1933 2.4376 3.5664 
-0.0473 -0.4013 -0.9602 -0.0351 -0.0256 -0.0445 0.0059  0.0521  -0.0411 0.0576  0.0660  -0.0170 
'X-RAY DIFFRACTION' 4 ? refined -14.1704 39.2756 -3.4641  0.1069 0.0277 0.1794 0.0005  -0.0104 0.0173  5.3558 4.1414 1.6932 1.5051 
-0.8193 0.2357  -0.0318 0.3720  0.0052  -0.2394 0.1015  -0.0015 -0.0028 -0.0772 -0.0697 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 444 ? ? A 527 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 444 ? ? B 527 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 444 ? ? C 527 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 444 ? ? D 527 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DNA    'data collection' .        ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
XDS    'data reduction'  .        ? 4 
SCALA  'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 498 ? ? -113.37 75.85 
2 1 LEU B 505 ? ? -119.09 76.33 
3 1 TYR C 452 ? ? -110.04 79.76 
4 1 LYS D 498 ? ? -158.60 68.55 
5 1 LEU D 505 ? ? -103.68 78.30 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 443 ? A ASN 1 
2 1 Y 1 B ASN 443 ? B ASN 1 
3 1 Y 1 C ASN 443 ? C ASN 1 
4 1 Y 1 D ASN 443 ? D ASN 1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1  601 1  HOH HOH A . 
E 2 HOH 2  602 2  HOH HOH A . 
E 2 HOH 3  603 3  HOH HOH A . 
E 2 HOH 4  604 4  HOH HOH A . 
E 2 HOH 5  605 5  HOH HOH A . 
E 2 HOH 6  606 6  HOH HOH A . 
E 2 HOH 7  607 11 HOH HOH A . 
E 2 HOH 8  608 29 HOH HOH A . 
E 2 HOH 9  609 30 HOH HOH A . 
E 2 HOH 10 610 31 HOH HOH A . 
E 2 HOH 11 611 44 HOH HOH A . 
E 2 HOH 12 612 45 HOH HOH A . 
E 2 HOH 13 613 48 HOH HOH A . 
E 2 HOH 14 614 50 HOH HOH A . 
E 2 HOH 15 615 51 HOH HOH A . 
E 2 HOH 16 616 55 HOH HOH A . 
E 2 HOH 17 617 56 HOH HOH A . 
E 2 HOH 18 618 58 HOH HOH A . 
E 2 HOH 19 619 61 HOH HOH A . 
E 2 HOH 20 620 70 HOH HOH A . 
E 2 HOH 21 621 71 HOH HOH A . 
E 2 HOH 22 622 75 HOH HOH A . 
F 2 HOH 1  601 7  HOH HOH B . 
F 2 HOH 2  602 8  HOH HOH B . 
F 2 HOH 3  603 12 HOH HOH B . 
F 2 HOH 4  604 13 HOH HOH B . 
F 2 HOH 5  605 14 HOH HOH B . 
F 2 HOH 6  606 15 HOH HOH B . 
F 2 HOH 7  607 17 HOH HOH B . 
F 2 HOH 8  608 18 HOH HOH B . 
F 2 HOH 9  609 27 HOH HOH B . 
F 2 HOH 10 610 32 HOH HOH B . 
F 2 HOH 11 611 33 HOH HOH B . 
F 2 HOH 12 612 43 HOH HOH B . 
F 2 HOH 13 613 49 HOH HOH B . 
F 2 HOH 14 614 57 HOH HOH B . 
F 2 HOH 15 615 59 HOH HOH B . 
F 2 HOH 16 616 60 HOH HOH B . 
F 2 HOH 17 617 62 HOH HOH B . 
F 2 HOH 18 618 64 HOH HOH B . 
F 2 HOH 19 619 65 HOH HOH B . 
F 2 HOH 20 620 73 HOH HOH B . 
F 2 HOH 21 621 74 HOH HOH B . 
F 2 HOH 22 622 76 HOH HOH B . 
F 2 HOH 23 623 77 HOH HOH B . 
G 2 HOH 1  601 9  HOH HOH C . 
G 2 HOH 2  602 10 HOH HOH C . 
G 2 HOH 3  603 19 HOH HOH C . 
G 2 HOH 4  604 20 HOH HOH C . 
G 2 HOH 5  605 21 HOH HOH C . 
G 2 HOH 6  606 25 HOH HOH C . 
G 2 HOH 7  607 26 HOH HOH C . 
G 2 HOH 8  608 28 HOH HOH C . 
G 2 HOH 9  609 34 HOH HOH C . 
G 2 HOH 10 610 35 HOH HOH C . 
G 2 HOH 11 611 36 HOH HOH C . 
G 2 HOH 12 612 37 HOH HOH C . 
G 2 HOH 13 613 38 HOH HOH C . 
G 2 HOH 14 614 66 HOH HOH C . 
G 2 HOH 15 615 68 HOH HOH C . 
G 2 HOH 16 616 72 HOH HOH C . 
H 2 HOH 1  601 16 HOH HOH D . 
H 2 HOH 2  602 22 HOH HOH D . 
H 2 HOH 3  603 23 HOH HOH D . 
H 2 HOH 4  604 24 HOH HOH D . 
H 2 HOH 5  605 39 HOH HOH D . 
H 2 HOH 6  606 40 HOH HOH D . 
H 2 HOH 7  607 41 HOH HOH D . 
H 2 HOH 8  608 42 HOH HOH D . 
H 2 HOH 9  609 46 HOH HOH D . 
H 2 HOH 10 610 47 HOH HOH D . 
H 2 HOH 11 611 52 HOH HOH D . 
H 2 HOH 12 612 53 HOH HOH D . 
H 2 HOH 13 613 54 HOH HOH D . 
H 2 HOH 14 614 63 HOH HOH D . 
H 2 HOH 15 615 67 HOH HOH D . 
H 2 HOH 16 616 69 HOH HOH D . 
#