data_4IGI
# 
_entry.id   4IGI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IGI         
RCSB  RCSB076722   
WWPDB D_1000076722 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4IGI 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mikolajek, H.'  1 
'Becker, A.K.A.' 2 
'Paulsson, M.'   3 
'Wagener, R.'    4 
'Werner, J.M.'   5 
# 
_citation.id                        primary 
_citation.title                     
'A structure of a collagen VI VWA domain displays N and C termini at opposite sides of the protein' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                199 
_citation.page_last                 208 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24332716 
_citation.pdbx_database_id_DOI      10.1016/j.str.2013.06.028 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, A.K.'  1 ? 
primary 'Mikolajek, H.' 2 ? 
primary 'Paulsson, M.'  3 ? 
primary 'Wagener, R.'   4 ? 
primary 'Werner, J.M.'  5 ? 
# 
_cell.entry_id           4IGI 
_cell.length_a           37.730 
_cell.length_b           58.460 
_cell.length_c           39.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IGI 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Collagen alpha3(VI)' 21711.709 1   ? ? 'Collagen VI Alpha3 N5, UNP residues 1022-1224' ? 
2 water   nat water                 18.015    240 ? ? ?                                               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGP
TPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDF
AVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGP
TPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDF
AVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   GLU n 
1 4   LYS n 
1 5   ASP n 
1 6   VAL n 
1 7   VAL n 
1 8   PHE n 
1 9   LEU n 
1 10  ILE n 
1 11  ASP n 
1 12  GLY n 
1 13  SER n 
1 14  GLU n 
1 15  GLY n 
1 16  VAL n 
1 17  ARG n 
1 18  SER n 
1 19  GLY n 
1 20  PHE n 
1 21  PRO n 
1 22  LEU n 
1 23  LEU n 
1 24  LYS n 
1 25  ASP n 
1 26  PHE n 
1 27  VAL n 
1 28  GLN n 
1 29  ARG n 
1 30  VAL n 
1 31  VAL n 
1 32  GLU n 
1 33  SER n 
1 34  LEU n 
1 35  ASP n 
1 36  VAL n 
1 37  GLY n 
1 38  PRO n 
1 39  ASP n 
1 40  ARG n 
1 41  VAL n 
1 42  ARG n 
1 43  VAL n 
1 44  ALA n 
1 45  LEU n 
1 46  VAL n 
1 47  GLN n 
1 48  TYR n 
1 49  SER n 
1 50  ASP n 
1 51  ARG n 
1 52  THR n 
1 53  ARG n 
1 54  PRO n 
1 55  GLU n 
1 56  PHE n 
1 57  TYR n 
1 58  LEU n 
1 59  ASN n 
1 60  SER n 
1 61  HIS n 
1 62  MET n 
1 63  ASP n 
1 64  GLN n 
1 65  GLN n 
1 66  GLY n 
1 67  VAL n 
1 68  ILE n 
1 69  SER n 
1 70  ALA n 
1 71  ILE n 
1 72  ARG n 
1 73  ARG n 
1 74  LEU n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  GLY n 
1 79  GLY n 
1 80  PRO n 
1 81  THR n 
1 82  PRO n 
1 83  ASN n 
1 84  THR n 
1 85  GLY n 
1 86  ALA n 
1 87  ALA n 
1 88  LEU n 
1 89  GLU n 
1 90  PHE n 
1 91  VAL n 
1 92  LEU n 
1 93  ARG n 
1 94  ASN n 
1 95  ILE n 
1 96  LEU n 
1 97  THR n 
1 98  SER n 
1 99  SER n 
1 100 THR n 
1 101 GLY n 
1 102 SER n 
1 103 ARG n 
1 104 ILE n 
1 105 ALA n 
1 106 GLU n 
1 107 GLY n 
1 108 VAL n 
1 109 PRO n 
1 110 GLN n 
1 111 LEU n 
1 112 LEU n 
1 113 ILE n 
1 114 VAL n 
1 115 LEU n 
1 116 THR n 
1 117 ALA n 
1 118 GLU n 
1 119 PRO n 
1 120 SER n 
1 121 GLY n 
1 122 ASP n 
1 123 ASP n 
1 124 VAL n 
1 125 ARG n 
1 126 GLY n 
1 127 PRO n 
1 128 SER n 
1 129 VAL n 
1 130 VAL n 
1 131 LEU n 
1 132 LYS n 
1 133 GLN n 
1 134 GLY n 
1 135 GLY n 
1 136 ALA n 
1 137 VAL n 
1 138 PRO n 
1 139 ILE n 
1 140 GLY n 
1 141 ILE n 
1 142 GLY n 
1 143 ILE n 
1 144 GLY n 
1 145 ASN n 
1 146 ALA n 
1 147 ASP n 
1 148 ILE n 
1 149 SER n 
1 150 GLU n 
1 151 MET n 
1 152 GLN n 
1 153 THR n 
1 154 ILE n 
1 155 SER n 
1 156 PHE n 
1 157 ILE n 
1 158 PRO n 
1 159 ASP n 
1 160 PHE n 
1 161 ALA n 
1 162 VAL n 
1 163 ALA n 
1 164 ILE n 
1 165 PRO n 
1 166 THR n 
1 167 PHE n 
1 168 ARG n 
1 169 GLU n 
1 170 LEU n 
1 171 GLY n 
1 172 THR n 
1 173 ILE n 
1 174 GLN n 
1 175 GLN n 
1 176 VAL n 
1 177 ILE n 
1 178 SER n 
1 179 GLU n 
1 180 ARG n 
1 181 VAL n 
1 182 ILE n 
1 183 GLN n 
1 184 LEU n 
1 185 ASN n 
1 186 ARG n 
1 187 GLU n 
1 188 GLU n 
1 189 LEU n 
1 190 SER n 
1 191 SER n 
1 192 LEU n 
1 193 LYS n 
1 194 PRO n 
1 195 ILE n 
1 196 LEU n 
1 197 THR n 
1 198 PRO n 
1 199 SER n 
1 200 THR n 
1 201 GLY n 
1 202 ALA n 
1 203 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Col6a3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    C57Bl6 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Rosetta' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET 15b' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9Z0I9_MOUSE 
_struct_ref.pdbx_db_accession          Q9Z0I9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLNSHMDQQGVISAIRRLTLLGGP
TPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEPSGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDF
AVAIPTFRELGTIQQVISERVIQLNREELSSLKPILTPSTGAG
;
_struct_ref.pdbx_align_begin           1022 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4IGI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 203 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Z0I9 
_struct_ref_seq.db_align_beg                  1022 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1224 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1022 
_struct_ref_seq.pdbx_auth_seq_align_end       1224 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4IGI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.83 
_exptl_crystal.density_percent_sol   32.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.1M sodium cacodylate, 1M tri-sodium citrate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-10-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ACCEL Fixed exit Double Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97780 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97780 
# 
_reflns.entry_id                     4IGI 
_reflns.observed_criterion_sigma_I   10.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             36 
_reflns.d_resolution_high            1.2 
_reflns.number_obs                   47672 
_reflns.number_all                   114428 
_reflns.percent_possible_obs         97 
_reflns.pdbx_Rmerge_I_obs            0.045 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        8.5 
_reflns.pdbx_redundancy              2.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.20 
_reflns_shell.d_res_low                   1.26 
_reflns_shell.percent_possible_all        93.8 
_reflns_shell.Rmerge_I_obs                0.174 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         4.5 
_reflns_shell.pdbx_redundancy             2.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           6693 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4IGI 
_refine.ls_number_reflns_obs                     47631 
_refine.ls_number_reflns_all                     47631 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.0 
_refine.ls_d_res_high                            1.2 
_refine.ls_percent_reflns_obs                    96.83 
_refine.ls_R_factor_obs                          0.1210 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1196 
_refine.ls_R_factor_R_free                       0.1478 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_number_reflns_R_free                  2413 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               10.98 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3GXB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.08 
_refine.pdbx_overall_phase_error                 13.73 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1497 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             240 
_refine_hist.number_atoms_total               1737 
_refine_hist.d_res_high                       1.2 
_refine_hist.d_res_low                        36.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.011  ? ? 1642 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.486  ? ? 2254 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 12.896 ? ? 628  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.078  ? ? 269  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.010  ? ? 304  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' 17 1.2    1.2225  2488 0.1570 90.00 0.1981 . . 133 . . . . 
'X-RAY DIFFRACTION' 17 1.2225 1.2490  2593 0.1223 95.00 0.1983 . . 121 . . . . 
'X-RAY DIFFRACTION' 17 1.2490 1.2781  2643 0.1172 97.00 0.1507 . . 143 . . . . 
'X-RAY DIFFRACTION' 17 1.2781 1.3101  2676 0.1176 97.00 0.1659 . . 128 . . . . 
'X-RAY DIFFRACTION' 17 1.3101 1.3455  2650 0.1106 97.00 0.1542 . . 155 . . . . 
'X-RAY DIFFRACTION' 17 1.3455 1.3851  2655 0.1076 97.00 0.1625 . . 136 . . . . 
'X-RAY DIFFRACTION' 17 1.3851 1.4298  2680 0.1132 97.00 0.1686 . . 120 . . . . 
'X-RAY DIFFRACTION' 17 1.4298 1.4809  2667 0.1081 98.00 0.1442 . . 157 . . . . 
'X-RAY DIFFRACTION' 17 1.4809 1.5402  2648 0.0988 97.00 0.1531 . . 136 . . . . 
'X-RAY DIFFRACTION' 17 1.5402 1.6103  2670 0.0976 97.00 0.1277 . . 142 . . . . 
'X-RAY DIFFRACTION' 17 1.6103 1.6952  2683 0.1065 97.00 0.1518 . . 145 . . . . 
'X-RAY DIFFRACTION' 17 1.6952 1.8014  2687 0.1069 98.00 0.1525 . . 157 . . . . 
'X-RAY DIFFRACTION' 17 1.8014 1.9404  2688 0.1077 98.00 0.1381 . . 129 . . . . 
'X-RAY DIFFRACTION' 17 1.9404 2.1357  2672 0.1027 98.00 0.1280 . . 170 . . . . 
'X-RAY DIFFRACTION' 17 2.1357 2.4447  2703 0.1085 98.00 0.1340 . . 146 . . . . 
'X-RAY DIFFRACTION' 17 2.4447 3.0798  2694 0.1323 97.00 0.1450 . . 143 . . . . 
'X-RAY DIFFRACTION' 17 3.0798 36.0713 2721 0.1473 97.00 0.1555 . . 152 . . . . 
# 
_struct.entry_id                  4IGI 
_struct.title                     'Crystal structure of the Collagen VI alpha3 N5 domain' 
_struct.pdbx_descriptor           'Collagen alpha3(VI)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IGI 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'Cell Adhesion, Collagen VI 3N5' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  11 SER A 13  ? ARG A 17  ? SER A 1034 ARG A 1038 1 ? 5  
HELX_P HELX_P2  12 GLY A 19  ? SER A 33  ? GLY A 1040 SER A 1054 1 ? 15 
HELX_P HELX_P3  13 ASP A 63  ? ARG A 73  ? ASP A 1084 ARG A 1094 1 ? 11 
HELX_P HELX_P4  14 ASN A 83  ? ILE A 95  ? ASN A 1104 ILE A 1116 1 ? 13 
HELX_P HELX_P5  15 THR A 97  ? GLY A 101 ? THR A 1118 GLY A 1122 1 ? 5  
HELX_P HELX_P6  16 ARG A 103 ? GLY A 107 ? ARG A 1124 GLY A 1128 1 ? 5  
HELX_P HELX_P7  17 VAL A 124 ? GLY A 134 ? VAL A 1145 GLY A 1155 1 ? 11 
HELX_P HELX_P8  18 ASP A 147 ? SER A 155 ? ASP A 1168 SER A 1176 1 ? 9  
HELX_P HELX_P9  19 ILE A 157 ? ALA A 161 ? ILE A 1178 ALA A 1182 1 ? 5  
HELX_P HELX_P10 20 THR A 166 ? LEU A 192 ? THR A 1187 LEU A 1213 1 ? 27 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
7  ? 7  ? 
8  ? 8  ? 
9  ? 9  ? 
10 ? 10 ? 
11 ? 11 ? 
12 ? 12 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
7  1 LYS A 4   ? ASP A 11  ? LYS A 1025 ASP A 1032 
8  1 VAL A 41  ? TYR A 48  ? VAL A 1062 TYR A 1069 
9  1 THR A 52  ? PHE A 56  ? THR A 1073 PHE A 1077 
10 1 GLN A 110 ? THR A 116 ? GLN A 1131 THR A 1137 
11 1 ALA A 136 ? ILE A 143 ? ALA A 1157 ILE A 1164 
12 1 VAL A 162 ? ILE A 164 ? VAL A 1183 ILE A 1185 
# 
_database_PDB_matrix.entry_id          4IGI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4IGI 
_atom_sites.fract_transf_matrix[1][1]   0.026504 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.011234 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017106 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.027735 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLU A 1 3   ? 27.587 1.790   22.673 1.00 15.56 ? 1024 GLU A N    1 
ATOM   2    C CA   . GLU A 1 3   ? 28.215 0.726   23.450 1.00 13.87 ? 1024 GLU A CA   1 
ATOM   3    C C    . GLU A 1 3   ? 29.080 1.319   24.556 1.00 12.38 ? 1024 GLU A C    1 
ATOM   4    O O    . GLU A 1 3   ? 29.954 2.155   24.288 1.00 11.66 ? 1024 GLU A O    1 
ATOM   5    C CB   . GLU A 1 3   ? 29.107 -0.137  22.565 1.00 18.32 ? 1024 GLU A CB   1 
ATOM   6    C CG   . GLU A 1 3   ? 28.398 -0.714  21.365 1.00 25.03 ? 1024 GLU A CG   1 
ATOM   7    C CD   . GLU A 1 3   ? 29.376 -1.403  20.422 1.00 37.99 ? 1024 GLU A CD   1 
ATOM   8    O OE1  . GLU A 1 3   ? 30.105 -0.673  19.731 1.00 41.53 ? 1024 GLU A OE1  1 
ATOM   9    O OE2  . GLU A 1 3   ? 29.448 -2.652  20.399 1.00 45.70 ? 1024 GLU A OE2  1 
ATOM   10   H HA   . GLU A 1 3   ? 27.526 0.159   23.855 1.00 16.65 ? 1024 GLU A HA   1 
ATOM   11   H HB2  . GLU A 1 3   ? 29.845 0.403   22.243 1.00 21.98 ? 1024 GLU A HB2  1 
ATOM   12   H HB3  . GLU A 1 3   ? 29.448 -0.877  23.092 1.00 21.98 ? 1024 GLU A HB3  1 
ATOM   13   H HG2  . GLU A 1 3   ? 27.748 -1.370  21.661 1.00 30.04 ? 1024 GLU A HG2  1 
ATOM   14   H HG3  . GLU A 1 3   ? 27.959 0.001   20.878 1.00 30.04 ? 1024 GLU A HG3  1 
ATOM   15   N N    . LYS A 1 4   ? 28.856 0.888   25.791 1.00 10.00 ? 1025 LYS A N    1 
ATOM   16   C CA   . LYS A 1 4   ? 29.675 1.293   26.917 1.00 8.74  ? 1025 LYS A CA   1 
ATOM   17   C C    . LYS A 1 4   ? 29.692 0.119   27.874 1.00 6.82  ? 1025 LYS A C    1 
ATOM   18   O O    . LYS A 1 4   ? 28.670 -0.527  28.098 1.00 7.89  ? 1025 LYS A O    1 
ATOM   19   C CB   . LYS A 1 4   ? 29.058 2.474   27.672 1.00 12.28 ? 1025 LYS A CB   1 
ATOM   20   C CG   . LYS A 1 4   ? 28.784 3.701   26.848 1.00 15.43 ? 1025 LYS A CG   1 
ATOM   21   C CD   . LYS A 1 4   ? 28.098 4.783   27.684 1.00 19.56 ? 1025 LYS A CD   1 
ATOM   22   C CE   . LYS A 1 4   ? 27.551 5.914   26.836 1.00 22.73 ? 1025 LYS A CE   1 
ATOM   23   N NZ   . LYS A 1 4   ? 28.626 6.632   26.132 1.00 21.81 ? 1025 LYS A NZ   1 
ATOM   24   H H    . LYS A 1 4   ? 28.221 0.348   26.004 1.00 12.00 ? 1025 LYS A H    1 
ATOM   25   H HA   . LYS A 1 4   ? 30.587 1.511   26.632 1.00 10.49 ? 1025 LYS A HA   1 
ATOM   26   H HB2  . LYS A 1 4   ? 28.213 2.186   28.053 1.00 14.73 ? 1025 LYS A HB2  1 
ATOM   27   H HB3  . LYS A 1 4   ? 29.663 2.731   28.385 1.00 14.73 ? 1025 LYS A HB3  1 
ATOM   28   H HG2  . LYS A 1 4   ? 29.622 4.058   26.516 1.00 18.52 ? 1025 LYS A HG2  1 
ATOM   29   H HG3  . LYS A 1 4   ? 28.200 3.469   26.110 1.00 18.52 ? 1025 LYS A HG3  1 
ATOM   30   H HD2  . LYS A 1 4   ? 27.357 4.386   28.169 1.00 23.47 ? 1025 LYS A HD2  1 
ATOM   31   H HD3  . LYS A 1 4   ? 28.740 5.157   28.307 1.00 23.47 ? 1025 LYS A HD3  1 
ATOM   32   H HE2  . LYS A 1 4   ? 26.943 5.552   26.172 1.00 27.27 ? 1025 LYS A HE2  1 
ATOM   33   H HE3  . LYS A 1 4   ? 27.087 6.546   27.406 1.00 27.27 ? 1025 LYS A HE3  1 
ATOM   34   H HZ1  . LYS A 1 4   ? 28.282 7.290   25.642 1.00 26.18 ? 1025 LYS A HZ1  1 
ATOM   35   H HZ2  . LYS A 1 4   ? 29.197 6.978   26.721 1.00 26.18 ? 1025 LYS A HZ2  1 
ATOM   36   H HZ3  . LYS A 1 4   ? 29.066 6.072   25.597 1.00 26.18 ? 1025 LYS A HZ3  1 
ATOM   37   N N    . ASP A 1 5   ? 30.838 -0.116  28.501 1.00 6.86  ? 1026 ASP A N    1 
ATOM   38   C CA   . ASP A 1 5   ? 30.980 -1.053  29.609 1.00 6.17  ? 1026 ASP A CA   1 
ATOM   39   C C    . ASP A 1 5   ? 31.126 -0.202  30.863 1.00 6.70  ? 1026 ASP A C    1 
ATOM   40   O O    . ASP A 1 5   ? 32.017 0.636   30.966 1.00 8.76  ? 1026 ASP A O    1 
ATOM   41   C CB   . ASP A 1 5   ? 32.225 -1.921  29.407 1.00 6.30  ? 1026 ASP A CB   1 
ATOM   42   C CG   . ASP A 1 5   ? 32.084 -2.910  28.266 1.00 7.03  ? 1026 ASP A CG   1 
ATOM   43   O OD1  . ASP A 1 5   ? 30.931 -3.273  27.901 1.00 7.61  ? 1026 ASP A OD1  1 
ATOM   44   O OD2  . ASP A 1 5   ? 33.134 -3.340  27.744 1.00 7.54  ? 1026 ASP A OD2  1 
ATOM   45   H H    . ASP A 1 5   ? 31.577 0.271   28.294 1.00 8.23  ? 1026 ASP A H    1 
ATOM   46   H HA   . ASP A 1 5   ? 30.187 -1.623  29.685 1.00 7.40  ? 1026 ASP A HA   1 
ATOM   47   H HB2  . ASP A 1 5   ? 32.981 -1.345  29.212 1.00 7.56  ? 1026 ASP A HB2  1 
ATOM   48   H HB3  . ASP A 1 5   ? 32.393 -2.423  30.219 1.00 7.56  ? 1026 ASP A HB3  1 
ATOM   49   N N    . VAL A 1 6   ? 30.208 -0.346  31.798 1.00 5.87  ? 1027 VAL A N    1 
ATOM   50   C CA   . VAL A 1 6   ? 30.159 0.494   33.000 1.00 5.96  ? 1027 VAL A CA   1 
ATOM   51   C C    . VAL A 1 6   ? 30.317 -0.414  34.218 1.00 5.04  ? 1027 VAL A C    1 
ATOM   52   O O    . VAL A 1 6   ? 29.512 -1.326  34.436 1.00 6.56  ? 1027 VAL A O    1 
ATOM   53   C CB   . VAL A 1 6   ? 28.819 1.256   33.096 1.00 6.99  ? 1027 VAL A CB   1 
ATOM   54   C CG1  . VAL A 1 6   ? 28.746 2.093   34.377 1.00 8.02  ? 1027 VAL A CG1  1 
ATOM   55   C CG2  . VAL A 1 6   ? 28.636 2.155   31.874 1.00 6.97  ? 1027 VAL A CG2  1 
ATOM   56   H H    . VAL A 1 6   ? 29.582 -0.935  31.767 1.00 7.05  ? 1027 VAL A H    1 
ATOM   57   H HA   . VAL A 1 6   ? 30.895 1.141   32.987 1.00 7.15  ? 1027 VAL A HA   1 
ATOM   58   H HB   . VAL A 1 6   ? 28.082 0.610   33.112 1.00 8.39  ? 1027 VAL A HB   1 
ATOM   59   H HG11 . VAL A 1 6   ? 27.903 2.552   34.402 1.00 9.62  ? 1027 VAL A HG11 1 
ATOM   60   H HG12 . VAL A 1 6   ? 28.825 1.510   35.135 1.00 9.62  ? 1027 VAL A HG12 1 
ATOM   61   H HG13 . VAL A 1 6   ? 29.465 2.729   34.375 1.00 9.62  ? 1027 VAL A HG13 1 
ATOM   62   H HG21 . VAL A 1 6   ? 27.799 2.620   31.951 1.00 8.37  ? 1027 VAL A HG21 1 
ATOM   63   H HG22 . VAL A 1 6   ? 29.359 2.785   31.839 1.00 8.37  ? 1027 VAL A HG22 1 
ATOM   64   H HG23 . VAL A 1 6   ? 28.636 1.611   31.083 1.00 8.37  ? 1027 VAL A HG23 1 
ATOM   65   N N    . VAL A 1 7   ? 31.377 -0.189  34.973 1.00 5.60  ? 1028 VAL A N    1 
ATOM   66   C CA   . VAL A 1 7   ? 31.675 -0.962  36.165 1.00 5.33  ? 1028 VAL A CA   1 
ATOM   67   C C    . VAL A 1 7   ? 31.605 -0.071  37.387 1.00 4.64  ? 1028 VAL A C    1 
ATOM   68   O O    . VAL A 1 7   ? 32.223 0.988   37.433 1.00 5.90  ? 1028 VAL A O    1 
ATOM   69   C CB   . VAL A 1 7   ? 33.092 -1.590  36.068 1.00 6.44  ? 1028 VAL A CB   1 
ATOM   70   C CG1  . VAL A 1 7   ? 33.396 -2.372  37.335 1.00 7.14  ? 1028 VAL A CG1  1 
ATOM   71   C CG2  . VAL A 1 7   ? 33.214 -2.432  34.820 1.00 8.36  ? 1028 VAL A CG2  1 
ATOM   72   H H    . VAL A 1 7   ? 31.957 0.425   34.811 1.00 6.72  ? 1028 VAL A H    1 
ATOM   73   H HA   . VAL A 1 7   ? 31.018 -1.683  36.263 1.00 6.40  ? 1028 VAL A HA   1 
ATOM   74   H HB   . VAL A 1 7   ? 33.749 -0.867  36.002 1.00 7.73  ? 1028 VAL A HB   1 
ATOM   75   H HG11 . VAL A 1 7   ? 34.274 -2.754  37.262 1.00 8.56  ? 1028 VAL A HG11 1 
ATOM   76   H HG12 . VAL A 1 7   ? 33.360 -1.775  38.086 1.00 8.56  ? 1028 VAL A HG12 1 
ATOM   77   H HG13 . VAL A 1 7   ? 32.743 -3.068  37.437 1.00 8.56  ? 1028 VAL A HG13 1 
ATOM   78   H HG21 . VAL A 1 7   ? 34.096 -2.808  34.783 1.00 10.04 ? 1028 VAL A HG21 1 
ATOM   79   H HG22 . VAL A 1 7   ? 32.559 -3.133  34.851 1.00 10.04 ? 1028 VAL A HG22 1 
ATOM   80   H HG23 . VAL A 1 7   ? 33.062 -1.875  34.053 1.00 10.04 ? 1028 VAL A HG23 1 
ATOM   81   N N    . PHE A 1 8   ? 30.826 -0.496  38.370 1.00 4.50  ? 1029 PHE A N    1 
ATOM   82   C CA   . PHE A 1 8   ? 30.785 0.161   39.663 1.00 5.04  ? 1029 PHE A CA   1 
ATOM   83   C C    . PHE A 1 8   ? 31.712 -0.581  40.628 1.00 4.99  ? 1029 PHE A C    1 
ATOM   84   O O    . PHE A 1 8   ? 31.579 -1.792  40.812 1.00 6.71  ? 1029 PHE A O    1 
ATOM   85   C CB   . PHE A 1 8   ? 29.346 0.134   40.207 1.00 5.11  ? 1029 PHE A CB   1 
ATOM   86   C CG   . PHE A 1 8   ? 28.378 0.979   39.438 1.00 5.65  ? 1029 PHE A CG   1 
ATOM   87   C CD1  . PHE A 1 8   ? 27.654 0.456   38.396 1.00 5.99  ? 1029 PHE A CD1  1 
ATOM   88   C CD2  . PHE A 1 8   ? 28.183 2.320   39.775 1.00 6.08  ? 1029 PHE A CD2  1 
ATOM   89   C CE1  . PHE A 1 8   ? 26.773 1.240   37.656 1.00 7.03  ? 1029 PHE A CE1  1 
ATOM   90   C CE2  . PHE A 1 8   ? 27.292 3.092   39.071 1.00 7.52  ? 1029 PHE A CE2  1 
ATOM   91   C CZ   . PHE A 1 8   ? 26.592 2.568   38.011 1.00 7.45  ? 1029 PHE A CZ   1 
ATOM   92   H H    . PHE A 1 8   ? 30.304 -1.176  38.310 1.00 5.40  ? 1029 PHE A H    1 
ATOM   93   H HA   . PHE A 1 8   ? 31.082 1.091   39.580 1.00 6.04  ? 1029 PHE A HA   1 
ATOM   94   H HB2  . PHE A 1 8   ? 29.022 -0.780  40.184 1.00 6.13  ? 1029 PHE A HB2  1 
ATOM   95   H HB3  . PHE A 1 8   ? 29.354 0.455   41.123 1.00 6.13  ? 1029 PHE A HB3  1 
ATOM   96   H HD1  . PHE A 1 8   ? 27.784 -0.432  38.154 1.00 7.19  ? 1029 PHE A HD1  1 
ATOM   97   H HD2  . PHE A 1 8   ? 28.656 2.691   40.485 1.00 7.29  ? 1029 PHE A HD2  1 
ATOM   98   H HE1  . PHE A 1 8   ? 26.291 0.870   36.952 1.00 8.43  ? 1029 PHE A HE1  1 
ATOM   99   H HE2  . PHE A 1 8   ? 27.177 3.986   39.301 1.00 9.03  ? 1029 PHE A HE2  1 
ATOM   100  H HZ   . PHE A 1 8   ? 25.993 3.099   37.539 1.00 8.94  ? 1029 PHE A HZ   1 
ATOM   101  N N    . LEU A 1 9   ? 32.641 0.151   41.208 1.00 4.98  ? 1030 LEU A N    1 
ATOM   102  C CA   . LEU A 1 9   ? 33.557 -0.385  42.208 1.00 4.96  ? 1030 LEU A CA   1 
ATOM   103  C C    . LEU A 1 9   ? 33.198 0.315   43.499 1.00 5.54  ? 1030 LEU A C    1 
ATOM   104  O O    . LEU A 1 9   ? 33.400 1.519   43.651 1.00 5.80  ? 1030 LEU A O    1 
ATOM   105  C CB   . LEU A 1 9   ? 34.995 -0.126  41.804 1.00 5.84  ? 1030 LEU A CB   1 
ATOM   106  C CG   . LEU A 1 9   ? 36.035 -0.628  42.815 1.00 6.38  ? 1030 LEU A CG   1 
ATOM   107  C CD1  . LEU A 1 9   ? 35.950 -2.142  43.028 1.00 6.19  ? 1030 LEU A CD1  1 
ATOM   108  C CD2  . LEU A 1 9   ? 37.406 -0.216  42.359 1.00 7.21  ? 1030 LEU A CD2  1 
ATOM   109  H H    . LEU A 1 9   ? 32.768 0.984   41.039 1.00 5.98  ? 1030 LEU A H    1 
ATOM   110  H HA   . LEU A 1 9   ? 33.419 -1.350  42.313 1.00 5.96  ? 1030 LEU A HA   1 
ATOM   111  H HB2  . LEU A 1 9   ? 35.165 -0.572  40.959 1.00 7.00  ? 1030 LEU A HB2  1 
ATOM   112  H HB3  . LEU A 1 9   ? 35.121 0.830   41.701 1.00 7.00  ? 1030 LEU A HB3  1 
ATOM   113  H HG   . LEU A 1 9   ? 35.869 -0.202  43.670 1.00 7.65  ? 1030 LEU A HG   1 
ATOM   114  H HD11 . LEU A 1 9   ? 36.617 -2.405  43.665 1.00 7.43  ? 1030 LEU A HD11 1 
ATOM   115  H HD12 . LEU A 1 9   ? 35.076 -2.362  43.358 1.00 7.43  ? 1030 LEU A HD12 1 
ATOM   116  H HD13 . LEU A 1 9   ? 36.105 -2.583  42.189 1.00 7.43  ? 1030 LEU A HD13 1 
ATOM   117  H HD21 . LEU A 1 9   ? 38.054 -0.532  42.993 1.00 8.65  ? 1030 LEU A HD21 1 
ATOM   118  H HD22 . LEU A 1 9   ? 37.577 -0.602  41.496 1.00 8.65  ? 1030 LEU A HD22 1 
ATOM   119  H HD23 . LEU A 1 9   ? 37.441 0.741   42.303 1.00 8.65  ? 1030 LEU A HD23 1 
ATOM   120  N N    A ILE A 1 10  ? 32.648 -0.461  44.427 0.52 6.14  ? 1031 ILE A N    1 
ATOM   121  N N    B ILE A 1 10  ? 32.616 -0.446  44.416 0.48 5.30  ? 1031 ILE A N    1 
ATOM   122  C CA   A ILE A 1 10  ? 31.977 0.063   45.602 0.52 8.73  ? 1031 ILE A CA   1 
ATOM   123  C CA   B ILE A 1 10  ? 32.018 0.106   45.614 0.48 6.96  ? 1031 ILE A CA   1 
ATOM   124  C C    A ILE A 1 10  ? 32.667 -0.372  46.899 0.52 7.16  ? 1031 ILE A C    1 
ATOM   125  C C    B ILE A 1 10  ? 32.728 -0.361  46.866 0.48 5.67  ? 1031 ILE A C    1 
ATOM   126  O O    A ILE A 1 10  ? 32.779 -1.568  47.190 0.52 6.89  ? 1031 ILE A O    1 
ATOM   127  O O    B ILE A 1 10  ? 32.923 -1.556  47.089 0.48 7.19  ? 1031 ILE A O    1 
ATOM   128  C CB   A ILE A 1 10  ? 30.519 -0.463  45.652 0.52 10.58 ? 1031 ILE A CB   1 
ATOM   129  C CB   B ILE A 1 10  ? 30.548 -0.329  45.724 0.48 9.73  ? 1031 ILE A CB   1 
ATOM   130  C CG1  A ILE A 1 10  ? 29.808 -0.243  44.308 0.52 9.32  ? 1031 ILE A CG1  1 
ATOM   131  C CG1  B ILE A 1 10  ? 29.752 0.311   44.599 0.48 11.62 ? 1031 ILE A CG1  1 
ATOM   132  C CG2  A ILE A 1 10  ? 29.764 0.169   46.799 0.52 14.69 ? 1031 ILE A CG2  1 
ATOM   133  C CG2  B ILE A 1 10  ? 29.985 -0.010  47.104 0.48 11.46 ? 1031 ILE A CG2  1 
ATOM   134  C CD1  A ILE A 1 10  ? 29.609 1.175   43.974 0.52 9.92  ? 1031 ILE A CD1  1 
ATOM   135  C CD1  B ILE A 1 10  ? 28.401 -0.297  44.418 0.48 10.26 ? 1031 ILE A CD1  1 
ATOM   136  H H    A ILE A 1 10  ? 32.653 -1.320  44.393 0.52 7.37  ? 1031 ILE A H    1 
ATOM   137  H H    B ILE A 1 10  ? 32.557 -1.302  44.363 0.48 6.36  ? 1031 ILE A H    1 
ATOM   138  H HA   A ILE A 1 10  ? 31.959 1.042   45.565 0.52 10.47 ? 1031 ILE A HA   1 
ATOM   139  H HA   B ILE A 1 10  ? 32.054 1.085   45.579 0.48 8.36  ? 1031 ILE A HA   1 
ATOM   140  H HB   A ILE A 1 10  ? 30.555 -1.419  45.814 0.52 12.70 ? 1031 ILE A HB   1 
ATOM   141  H HB   B ILE A 1 10  ? 30.513 -1.290  45.603 0.48 11.68 ? 1031 ILE A HB   1 
ATOM   142  H HG12 A ILE A 1 10  ? 30.341 -0.643  43.603 0.52 11.18 ? 1031 ILE A HG12 1 
ATOM   143  H HG12 B ILE A 1 10  ? 29.632 1.254   44.795 0.48 13.95 ? 1031 ILE A HG12 1 
ATOM   144  H HG13 A ILE A 1 10  ? 28.936 -0.666  44.342 0.52 11.18 ? 1031 ILE A HG13 1 
ATOM   145  H HG13 B ILE A 1 10  ? 30.241 0.206   43.768 0.48 13.95 ? 1031 ILE A HG13 1 
ATOM   146  H HG21 A ILE A 1 10  ? 28.867 -0.172  46.808 0.52 17.63 ? 1031 ILE A HG21 1 
ATOM   147  H HG21 B ILE A 1 10  ? 29.068 -0.293  47.140 0.48 13.75 ? 1031 ILE A HG21 1 
ATOM   148  H HG22 A ILE A 1 10  ? 30.207 -0.050  47.622 0.52 17.63 ? 1031 ILE A HG22 1 
ATOM   149  H HG22 B ILE A 1 10  ? 30.498 -0.478  47.767 0.48 13.75 ? 1031 ILE A HG22 1 
ATOM   150  H HG23 A ILE A 1 10  ? 29.751 1.122   46.676 0.52 17.63 ? 1031 ILE A HG23 1 
ATOM   151  H HG23 B ILE A 1 10  ? 30.042 0.936   47.254 0.48 13.75 ? 1031 ILE A HG23 1 
ATOM   152  H HD11 A ILE A 1 10  ? 29.163 1.236   43.126 0.52 11.90 ? 1031 ILE A HD11 1 
ATOM   153  H HD11 B ILE A 1 10  ? 27.952 0.150   43.696 0.48 12.31 ? 1031 ILE A HD11 1 
ATOM   154  H HD12 A ILE A 1 10  ? 29.074 1.585   44.657 0.52 11.90 ? 1031 ILE A HD12 1 
ATOM   155  H HD12 B ILE A 1 10  ? 28.503 -1.229  44.213 0.48 12.31 ? 1031 ILE A HD12 1 
ATOM   156  H HD13 A ILE A 1 10  ? 30.465 1.607   43.925 0.52 11.90 ? 1031 ILE A HD13 1 
ATOM   157  H HD13 B ILE A 1 10  ? 27.900 -0.192  45.230 0.48 12.31 ? 1031 ILE A HD13 1 
ATOM   158  N N    . ASP A 1 11  ? 33.104 0.600   47.692 1.00 7.38  ? 1032 ASP A N    1 
ATOM   159  C CA   . ASP A 1 11  ? 33.650 0.371   49.027 1.00 7.52  ? 1032 ASP A CA   1 
ATOM   160  C C    . ASP A 1 11  ? 32.559 -0.299  49.843 1.00 8.95  ? 1032 ASP A C    1 
ATOM   161  O O    . ASP A 1 11  ? 31.481 0.267   50.027 1.00 9.16  ? 1032 ASP A O    1 
ATOM   162  C CB   . ASP A 1 11  ? 33.980 1.751   49.557 1.00 9.61  ? 1032 ASP A CB   1 
ATOM   163  C CG   . ASP A 1 11  ? 34.555 1.782   50.970 1.00 9.89  ? 1032 ASP A CG   1 
ATOM   164  O OD1  . ASP A 1 11  ? 34.545 0.781   51.704 1.00 9.74  ? 1032 ASP A OD1  1 
ATOM   165  O OD2  . ASP A 1 11  ? 34.990 2.907   51.341 1.00 9.86  ? 1032 ASP A OD2  1 
ATOM   166  H H    . ASP A 1 11  ? 33.074 1.435   47.488 0.48 8.86  ? 1032 ASP A H    1 
ATOM   167  H HA   . ASP A 1 11  ? 34.453 -0.189  48.997 1.00 9.03  ? 1032 ASP A HA   1 
ATOM   168  H HB2  . ASP A 1 11  ? 34.633 2.159   48.967 1.00 11.53 ? 1032 ASP A HB2  1 
ATOM   169  H HB3  . ASP A 1 11  ? 33.169 2.282   49.560 1.00 11.53 ? 1032 ASP A HB3  1 
ATOM   170  N N    . GLY A 1 12  ? 32.846 -1.508  50.329 1.00 7.40  ? 1033 GLY A N    1 
ATOM   171  C CA   . GLY A 1 12  ? 31.945 -2.267  51.175 1.00 8.43  ? 1033 GLY A CA   1 
ATOM   172  C C    . GLY A 1 12  ? 32.516 -2.470  52.567 1.00 8.08  ? 1033 GLY A C    1 
ATOM   173  O O    . GLY A 1 12  ? 32.117 -3.380  53.267 1.00 9.21  ? 1033 GLY A O    1 
ATOM   174  H H    . GLY A 1 12  ? 33.586 -1.917  50.173 1.00 8.88  ? 1033 GLY A H    1 
ATOM   175  H HA2  . GLY A 1 12  ? 31.100 -1.798  51.253 1.00 10.12 ? 1033 GLY A HA2  1 
ATOM   176  H HA3  . GLY A 1 12  ? 31.781 -3.136  50.778 1.00 10.12 ? 1033 GLY A HA3  1 
ATOM   177  N N    . SER A 1 13  ? 33.442 -1.613  52.972 1.00 9.43  ? 1034 SER A N    1 
ATOM   178  C CA   . SER A 1 13  ? 34.040 -1.722  54.287 1.00 8.92  ? 1034 SER A CA   1 
ATOM   179  C C    . SER A 1 13  ? 33.050 -1.210  55.355 1.00 11.28 ? 1034 SER A C    1 
ATOM   180  O O    . SER A 1 13  ? 31.994 -0.650  55.046 1.00 10.62 ? 1034 SER A O    1 
ATOM   181  C CB   . SER A 1 13  ? 35.344 -0.947  54.315 1.00 10.32 ? 1034 SER A CB   1 
ATOM   182  O OG   . SER A 1 13  ? 35.163 0.458   54.287 1.00 12.11 ? 1034 SER A OG   1 
ATOM   183  H H    . SER A 1 13  ? 33.741 -0.958  52.501 1.00 11.32 ? 1034 SER A H    1 
ATOM   184  H HA   . SER A 1 13  ? 34.237 -2.663  54.477 1.00 10.70 ? 1034 SER A HA   1 
ATOM   185  H HB2  . SER A 1 13  ? 35.822 -1.180  55.126 1.00 12.38 ? 1034 SER A HB2  1 
ATOM   186  H HB3  . SER A 1 13  ? 35.871 -1.205  53.542 1.00 12.38 ? 1034 SER A HB3  1 
ATOM   187  H HG   . SER A 1 13  ? 34.363 0.637   54.260 1.00 14.54 ? 1034 SER A HG   1 
ATOM   188  N N    . GLU A 1 14  ? 33.393 -1.407  56.619 1.00 12.81 ? 1035 GLU A N    1 
ATOM   189  C CA   . GLU A 1 14  ? 32.468 -1.047  57.691 1.00 13.95 ? 1035 GLU A CA   1 
ATOM   190  C C    . GLU A 1 14  ? 32.085 0.435   57.693 1.00 13.76 ? 1035 GLU A C    1 
ATOM   191  O O    . GLU A 1 14  ? 30.984 0.790   58.122 1.00 16.01 ? 1035 GLU A O    1 
ATOM   192  C CB   . GLU A 1 14  ? 33.080 -1.412  59.042 1.00 16.42 ? 1035 GLU A CB   1 
ATOM   193  C CG   . GLU A 1 14  ? 33.360 -2.876  59.225 1.00 18.31 ? 1035 GLU A CG   1 
ATOM   194  C CD   . GLU A 1 14  ? 32.129 -3.728  59.057 1.00 19.84 ? 1035 GLU A CD   1 
ATOM   195  O OE1  . GLU A 1 14  ? 31.075 -3.325  59.600 1.00 21.01 ? 1035 GLU A OE1  1 
ATOM   196  O OE2  . GLU A 1 14  ? 32.242 -4.779  58.375 1.00 21.28 ? 1035 GLU A OE2  1 
ATOM   197  H H    . GLU A 1 14  ? 34.141 -1.740  56.883 1.00 15.37 ? 1035 GLU A H    1 
ATOM   198  H HA   . GLU A 1 14  ? 31.645 -1.568  57.585 1.00 16.74 ? 1035 GLU A HA   1 
ATOM   199  H HB2  . GLU A 1 14  ? 33.921 -0.938  59.141 1.00 19.70 ? 1035 GLU A HB2  1 
ATOM   200  H HB3  . GLU A 1 14  ? 32.468 -1.141  59.744 1.00 19.70 ? 1035 GLU A HB3  1 
ATOM   201  H HG2  . GLU A 1 14  ? 34.013 -3.158  58.564 1.00 21.97 ? 1035 GLU A HG2  1 
ATOM   202  H HG3  . GLU A 1 14  ? 33.708 -3.023  60.118 1.00 21.97 ? 1035 GLU A HG3  1 
ATOM   203  N N    . GLY A 1 15  ? 32.979 1.295   57.199 1.00 15.94 ? 1036 GLY A N    1 
ATOM   204  C CA   . GLY A 1 15  ? 32.715 2.725   57.084 1.00 18.21 ? 1036 GLY A CA   1 
ATOM   205  C C    . GLY A 1 15  ? 31.525 3.098   56.199 1.00 15.63 ? 1036 GLY A C    1 
ATOM   206  O O    . GLY A 1 15  ? 31.007 4.215   56.261 1.00 19.78 ? 1036 GLY A O    1 
ATOM   207  H H    . GLY A 1 15  ? 33.760 1.066   56.920 1.00 19.12 ? 1036 GLY A H    1 
ATOM   208  H HA2  . GLY A 1 15  ? 32.552 3.086   57.969 1.00 21.85 ? 1036 GLY A HA2  1 
ATOM   209  H HA3  . GLY A 1 15  ? 33.502 3.161   56.723 1.00 21.85 ? 1036 GLY A HA3  1 
ATOM   210  N N    A VAL A 1 16  ? 31.104 2.145   55.387 0.82 12.24 ? 1037 VAL A N    1 
ATOM   211  N N    B VAL A 1 16  ? 31.064 2.160   55.380 0.18 14.89 ? 1037 VAL A N    1 
ATOM   212  C CA   A VAL A 1 16  ? 30.000 2.333   54.460 0.82 12.14 ? 1037 VAL A CA   1 
ATOM   213  C CA   B VAL A 1 16  ? 29.921 2.427   54.510 0.18 13.86 ? 1037 VAL A CA   1 
ATOM   214  C C    A VAL A 1 16  ? 28.698 1.659   54.954 0.82 11.49 ? 1037 VAL A C    1 
ATOM   215  C C    B VAL A 1 16  ? 28.670 1.667   54.955 0.18 12.60 ? 1037 VAL A C    1 
ATOM   216  O O    A VAL A 1 16  ? 27.639 1.888   54.402 0.82 11.25 ? 1037 VAL A O    1 
ATOM   217  O O    B VAL A 1 16  ? 27.614 1.803   54.344 0.18 12.59 ? 1037 VAL A O    1 
ATOM   218  C CB   A VAL A 1 16  ? 30.428 1.803   53.044 0.82 12.90 ? 1037 VAL A CB   1 
ATOM   219  C CB   B VAL A 1 16  ? 30.232 2.056   53.039 0.18 14.21 ? 1037 VAL A CB   1 
ATOM   220  C CG1  A VAL A 1 16  ? 29.280 1.786   52.051 0.82 16.70 ? 1037 VAL A CG1  1 
ATOM   221  C CG1  B VAL A 1 16  ? 30.292 0.570   52.883 0.18 11.47 ? 1037 VAL A CG1  1 
ATOM   222  C CG2  A VAL A 1 16  ? 31.607 2.650   52.513 0.82 14.12 ? 1037 VAL A CG2  1 
ATOM   223  C CG2  B VAL A 1 16  ? 29.184 2.616   52.091 0.18 17.93 ? 1037 VAL A CG2  1 
ATOM   224  H H    A VAL A 1 16  ? 31.451 1.359   55.352 0.82 14.69 ? 1037 VAL A H    1 
ATOM   225  H H    B VAL A 1 16  ? 31.390 1.368   55.308 0.18 17.87 ? 1037 VAL A H    1 
ATOM   226  H HA   A VAL A 1 16  ? 29.823 3.293   54.376 0.82 14.57 ? 1037 VAL A HA   1 
ATOM   227  H HA   B VAL A 1 16  ? 29.717 3.385   54.542 0.18 16.63 ? 1037 VAL A HA   1 
ATOM   228  H HB   A VAL A 1 16  ? 30.748 0.882   53.140 0.82 15.47 ? 1037 VAL A HB   1 
ATOM   229  H HB   B VAL A 1 16  ? 31.104 2.428   52.788 0.18 17.05 ? 1037 VAL A HB   1 
ATOM   230  H HG11 A VAL A 1 16  ? 29.601 1.455   51.209 0.82 20.04 ? 1037 VAL A HG11 1 
ATOM   231  H HG11 B VAL A 1 16  ? 30.485 0.360   51.967 0.18 13.76 ? 1037 VAL A HG11 1 
ATOM   232  H HG12 A VAL A 1 16  ? 28.587 1.213   52.386 0.82 20.04 ? 1037 VAL A HG12 1 
ATOM   233  H HG12 B VAL A 1 16  ? 30.984 0.224   53.452 0.18 13.76 ? 1037 VAL A HG12 1 
ATOM   234  H HG13 A VAL A 1 16  ? 28.945 2.679   51.946 0.82 20.04 ? 1037 VAL A HG13 1 
ATOM   235  H HG13 B VAL A 1 16  ? 29.444 0.196   53.133 0.18 13.76 ? 1037 VAL A HG13 1 
ATOM   236  H HG21 A VAL A 1 16  ? 31.863 2.321   51.649 0.82 16.94 ? 1037 VAL A HG21 1 
ATOM   237  H HG21 B VAL A 1 16  ? 29.411 2.366   51.192 0.18 21.52 ? 1037 VAL A HG21 1 
ATOM   238  H HG22 A VAL A 1 16  ? 31.327 3.566   52.446 0.82 16.94 ? 1037 VAL A HG22 1 
ATOM   239  H HG22 B VAL A 1 16  ? 28.326 2.254   52.325 0.18 21.52 ? 1037 VAL A HG22 1 
ATOM   240  H HG23 A VAL A 1 16  ? 32.344 2.576   53.124 0.82 16.94 ? 1037 VAL A HG23 1 
ATOM   241  H HG23 B VAL A 1 16  ? 29.170 3.573   52.171 0.18 21.52 ? 1037 VAL A HG23 1 
ATOM   242  N N    . ARG A 1 17  ? 28.778 0.872   56.015 1.00 11.02 ? 1038 ARG A N    1 
ATOM   243  C CA   . ARG A 1 17  ? 27.630 0.054   56.441 1.00 12.60 ? 1038 ARG A CA   1 
ATOM   244  C C    . ARG A 1 17  ? 26.334 0.880   56.576 1.00 12.14 ? 1038 ARG A C    1 
ATOM   245  O O    . ARG A 1 17  ? 25.269 0.490   56.081 1.00 12.39 ? 1038 ARG A O    1 
ATOM   246  C CB   . ARG A 1 17  ? 27.936 -0.719  57.732 1.00 13.07 ? 1038 ARG A CB   1 
ATOM   247  C CG   . ARG A 1 17  ? 26.884 -1.764  58.064 1.00 15.64 ? 1038 ARG A CG   1 
ATOM   248  C CD   . ARG A 1 17  ? 27.344 -2.791  59.103 1.00 20.42 ? 1038 ARG A CD   1 
ATOM   249  N NE   . ARG A 1 17  ? 28.476 -3.676  58.748 1.00 19.68 ? 1038 ARG A NE   1 
ATOM   250  C CZ   . ARG A 1 17  ? 28.409 -4.808  58.034 1.00 19.51 ? 1038 ARG A CZ   1 
ATOM   251  N NH1  . ARG A 1 17  ? 27.286 -5.200  57.459 1.00 17.42 ? 1038 ARG A NH1  1 
ATOM   252  N NH2  . ARG A 1 17  ? 29.509 -5.529  57.832 1.00 21.18 ? 1038 ARG A NH2  1 
ATOM   253  H H    . ARG A 1 17  ? 29.482 0.788   56.502 0.18 13.23 ? 1038 ARG A H    1 
ATOM   254  H HA   . ARG A 1 17  ? 27.466 -0.615  55.743 1.00 15.12 ? 1038 ARG A HA   1 
ATOM   255  H HB2  . ARG A 1 17  ? 28.788 -1.172  57.633 1.00 15.68 ? 1038 ARG A HB2  1 
ATOM   256  H HB3  . ARG A 1 17  ? 27.979 -0.092  58.471 1.00 15.68 ? 1038 ARG A HB3  1 
ATOM   257  H HG2  . ARG A 1 17  ? 26.098 -1.317  58.416 1.00 18.77 ? 1038 ARG A HG2  1 
ATOM   258  H HG3  . ARG A 1 17  ? 26.654 -2.245  57.253 1.00 18.77 ? 1038 ARG A HG3  1 
ATOM   259  H HD2  . ARG A 1 17  ? 27.603 -2.309  59.904 1.00 24.50 ? 1038 ARG A HD2  1 
ATOM   260  H HD3  . ARG A 1 17  ? 26.590 -3.365  59.310 1.00 24.50 ? 1038 ARG A HD3  1 
ATOM   261  H HE   . ARG A 1 17  ? 29.254 -3.441  59.028 1.00 23.61 ? 1038 ARG A HE   1 
ATOM   262  H HH11 . ARG A 1 17  ? 26.562 -4.753  57.582 1.00 20.91 ? 1038 ARG A HH11 1 
ATOM   263  H HH12 . ARG A 1 17  ? 27.272 -5.921  56.991 1.00 20.91 ? 1038 ARG A HH12 1 
ATOM   264  H HH21 . ARG A 1 17  ? 30.256 -5.280  58.178 1.00 25.42 ? 1038 ARG A HH21 1 
ATOM   265  H HH22 . ARG A 1 17  ? 29.476 -6.237  57.345 1.00 25.42 ? 1038 ARG A HH22 1 
ATOM   266  N N    . SER A 1 18  ? 26.392 2.001   57.267 1.00 13.07 ? 1039 SER A N    1 
ATOM   267  C CA   . SER A 1 18  ? 25.187 2.774   57.466 1.00 15.85 ? 1039 SER A CA   1 
ATOM   268  C C    . SER A 1 18  ? 24.694 3.453   56.186 1.00 15.29 ? 1039 SER A C    1 
ATOM   269  O O    . SER A 1 18  ? 23.494 3.629   56.023 1.00 20.38 ? 1039 SER A O    1 
ATOM   270  C CB   . SER A 1 18  ? 25.375 3.802   58.590 1.00 23.31 ? 1039 SER A CB   1 
ATOM   271  O OG   . SER A 1 18  ? 26.448 4.686   58.326 1.00 28.01 ? 1039 SER A OG   1 
ATOM   272  H H    . SER A 1 18  ? 27.101 2.330   57.625 1.00 15.69 ? 1039 SER A H    1 
ATOM   273  H HA   . SER A 1 18  ? 24.479 2.160   57.755 1.00 19.02 ? 1039 SER A HA   1 
ATOM   274  H HB2  . SER A 1 18  ? 24.560 4.320   58.679 1.00 27.97 ? 1039 SER A HB2  1 
ATOM   275  H HB3  . SER A 1 18  ? 25.556 3.330   59.418 1.00 27.97 ? 1039 SER A HB3  1 
ATOM   276  H HG   . SER A 1 18  ? 26.795 4.499   57.607 1.00 33.61 ? 1039 SER A HG   1 
ATOM   277  N N    . GLY A 1 19  ? 25.608 3.808   55.276 1.00 12.23 ? 1040 GLY A N    1 
ATOM   278  C CA   . GLY A 1 19  ? 25.234 4.480   54.041 1.00 12.27 ? 1040 GLY A CA   1 
ATOM   279  C C    . GLY A 1 19  ? 24.951 3.529   52.895 1.00 10.03 ? 1040 GLY A C    1 
ATOM   280  O O    . GLY A 1 19  ? 24.488 3.965   51.845 1.00 10.14 ? 1040 GLY A O    1 
ATOM   281  H H    . GLY A 1 19  ? 26.453 3.668   55.356 1.00 14.67 ? 1040 GLY A H    1 
ATOM   282  H HA2  . GLY A 1 19  ? 24.438 5.013   54.196 1.00 14.73 ? 1040 GLY A HA2  1 
ATOM   283  H HA3  . GLY A 1 19  ? 25.951 5.075   53.772 1.00 14.73 ? 1040 GLY A HA3  1 
ATOM   284  N N    . PHE A 1 20  ? 25.152 2.228   53.101 1.00 9.87  ? 1041 PHE A N    1 
ATOM   285  C CA   . PHE A 1 20  ? 25.053 1.269   51.995 1.00 9.17  ? 1041 PHE A CA   1 
ATOM   286  C C    . PHE A 1 20  ? 23.682 1.301   51.288 1.00 9.19  ? 1041 PHE A C    1 
ATOM   287  O O    . PHE A 1 20  ? 23.639 1.253   50.076 1.00 9.46  ? 1041 PHE A O    1 
ATOM   288  C CB   . PHE A 1 20  ? 25.457 -0.138  52.453 1.00 10.11 ? 1041 PHE A CB   1 
ATOM   289  C CG   . PHE A 1 20  ? 25.771 -1.105  51.319 1.00 10.46 ? 1041 PHE A CG   1 
ATOM   290  C CD1  . PHE A 1 20  ? 26.847 -0.881  50.471 1.00 11.59 ? 1041 PHE A CD1  1 
ATOM   291  C CD2  . PHE A 1 20  ? 25.004 -2.247  51.126 1.00 11.04 ? 1041 PHE A CD2  1 
ATOM   292  C CE1  . PHE A 1 20  ? 27.142 -1.784  49.462 1.00 13.40 ? 1041 PHE A CE1  1 
ATOM   293  C CE2  . PHE A 1 20  ? 25.312 -3.144  50.113 1.00 10.95 ? 1041 PHE A CE2  1 
ATOM   294  C CZ   . PHE A 1 20  ? 26.377 -2.908  49.274 1.00 11.82 ? 1041 PHE A CZ   1 
ATOM   295  H H    . PHE A 1 20  ? 25.345 1.877   53.862 1.00 11.84 ? 1041 PHE A H    1 
ATOM   296  H HA   . PHE A 1 20  ? 25.713 1.536   51.321 1.00 11.00 ? 1041 PHE A HA   1 
ATOM   297  H HB2  . PHE A 1 20  ? 26.250 -0.068  53.007 1.00 12.13 ? 1041 PHE A HB2  1 
ATOM   298  H HB3  . PHE A 1 20  ? 24.729 -0.517  52.970 1.00 12.13 ? 1041 PHE A HB3  1 
ATOM   299  H HD1  . PHE A 1 20  ? 27.378 -0.127  50.587 1.00 13.90 ? 1041 PHE A HD1  1 
ATOM   300  H HD2  . PHE A 1 20  ? 24.284 -2.419  51.690 1.00 13.24 ? 1041 PHE A HD2  1 
ATOM   301  H HE1  . PHE A 1 20  ? 27.862 -1.620  48.897 1.00 16.08 ? 1041 PHE A HE1  1 
ATOM   302  H HE2  . PHE A 1 20  ? 24.787 -3.902  49.990 1.00 13.14 ? 1041 PHE A HE2  1 
ATOM   303  H HZ   . PHE A 1 20  ? 26.578 -3.505  48.589 1.00 14.19 ? 1041 PHE A HZ   1 
ATOM   304  N N    . PRO A 1 21  ? 22.569 1.391   52.015 1.00 9.92  ? 1042 PRO A N    1 
ATOM   305  C CA   . PRO A 1 21  ? 21.303 1.438   51.275 1.00 10.77 ? 1042 PRO A CA   1 
ATOM   306  C C    . PRO A 1 21  ? 21.209 2.663   50.358 1.00 10.29 ? 1042 PRO A C    1 
ATOM   307  O O    . PRO A 1 21  ? 20.623 2.593   49.277 1.00 10.62 ? 1042 PRO A O    1 
ATOM   308  C CB   . PRO A 1 21  ? 20.243 1.527   52.392 1.00 15.16 ? 1042 PRO A CB   1 
ATOM   309  C CG   . PRO A 1 21  ? 20.882 0.866   53.548 1.00 18.48 ? 1042 PRO A CG   1 
ATOM   310  C CD   . PRO A 1 21  ? 22.351 1.242   53.462 1.00 12.64 ? 1042 PRO A CD   1 
ATOM   311  H HA   . PRO A 1 21  ? 21.171 0.618   50.755 1.00 12.92 ? 1042 PRO A HA   1 
ATOM   312  H HB2  . PRO A 1 21  ? 20.049 2.456   52.589 1.00 18.20 ? 1042 PRO A HB2  1 
ATOM   313  H HB3  . PRO A 1 21  ? 19.440 1.053   52.124 1.00 18.20 ? 1042 PRO A HB3  1 
ATOM   314  H HG2  . PRO A 1 21  ? 20.490 1.199   54.371 1.00 22.18 ? 1042 PRO A HG2  1 
ATOM   315  H HG3  . PRO A 1 21  ? 20.769 -0.095  53.478 1.00 22.18 ? 1042 PRO A HG3  1 
ATOM   316  H HD2  . PRO A 1 21  ? 22.514 2.082   53.919 1.00 15.17 ? 1042 PRO A HD2  1 
ATOM   317  H HD3  . PRO A 1 21  ? 22.905 0.529   53.817 1.00 15.17 ? 1042 PRO A HD3  1 
ATOM   318  N N    . LEU A 1 22  ? 21.788 3.784   50.777 1.00 10.36 ? 1043 LEU A N    1 
ATOM   319  C CA   . LEU A 1 22  ? 21.796 4.980   49.930 1.00 10.51 ? 1043 LEU A CA   1 
ATOM   320  C C    . LEU A 1 22  ? 22.720 4.797   48.734 1.00 9.62  ? 1043 LEU A C    1 
ATOM   321  O O    . LEU A 1 22  ? 22.452 5.288   47.641 1.00 10.32 ? 1043 LEU A O    1 
ATOM   322  C CB   . LEU A 1 22  ? 22.194 6.216   50.747 1.00 10.80 ? 1043 LEU A CB   1 
ATOM   323  C CG   . LEU A 1 22  ? 21.135 6.648   51.762 1.00 16.29 ? 1043 LEU A CG   1 
ATOM   324  C CD1  . LEU A 1 22  ? 21.638 7.724   52.689 1.00 16.71 ? 1043 LEU A CD1  1 
ATOM   325  C CD2  . LEU A 1 22  ? 19.896 7.149   51.041 1.00 21.98 ? 1043 LEU A CD2  1 
ATOM   326  H H    . LEU A 1 22  ? 22.180 3.881   51.536 1.00 12.43 ? 1043 LEU A H    1 
ATOM   327  H HA   . LEU A 1 22  ? 20.890 5.128   49.587 1.00 12.61 ? 1043 LEU A HA   1 
ATOM   328  H HB2  . LEU A 1 22  ? 23.010 6.020   51.234 1.00 12.96 ? 1043 LEU A HB2  1 
ATOM   329  H HB3  . LEU A 1 22  ? 22.344 6.958   50.140 1.00 12.96 ? 1043 LEU A HB3  1 
ATOM   330  H HG   . LEU A 1 22  ? 20.881 5.882   52.300 1.00 19.55 ? 1043 LEU A HG   1 
ATOM   331  H HD11 . LEU A 1 22  ? 20.939 7.959   53.303 1.00 20.05 ? 1043 LEU A HD11 1 
ATOM   332  H HD12 . LEU A 1 22  ? 22.399 7.391   53.170 1.00 20.05 ? 1043 LEU A HD12 1 
ATOM   333  H HD13 . LEU A 1 22  ? 21.889 8.492   52.170 1.00 20.05 ? 1043 LEU A HD13 1 
ATOM   334  H HD21 . LEU A 1 22  ? 19.243 7.416   51.692 1.00 26.38 ? 1043 LEU A HD21 1 
ATOM   335  H HD22 . LEU A 1 22  ? 20.136 7.899   50.492 1.00 26.38 ? 1043 LEU A HD22 1 
ATOM   336  H HD23 . LEU A 1 22  ? 19.545 6.441   50.496 1.00 26.38 ? 1043 LEU A HD23 1 
ATOM   337  N N    . LEU A 1 23  ? 23.812 4.093   48.940 1.00 8.67  ? 1044 LEU A N    1 
ATOM   338  C CA   . LEU A 1 23  ? 24.675 3.759   47.834 1.00 9.26  ? 1044 LEU A CA   1 
ATOM   339  C C    . LEU A 1 23  ? 23.986 2.846   46.811 1.00 8.85  ? 1044 LEU A C    1 
ATOM   340  O O    . LEU A 1 23  ? 24.100 3.054   45.604 1.00 9.12  ? 1044 LEU A O    1 
ATOM   341  C CB   . LEU A 1 23  ? 25.874 3.084   48.429 1.00 13.95 ? 1044 LEU A CB   1 
ATOM   342  C CG   . LEU A 1 23  ? 27.097 2.858   47.600 1.00 24.67 ? 1044 LEU A CG   1 
ATOM   343  C CD1  . LEU A 1 23  ? 27.574 4.135   46.950 1.00 32.80 ? 1044 LEU A CD1  1 
ATOM   344  C CD2  . LEU A 1 23  ? 28.121 2.351   48.606 1.00 31.06 ? 1044 LEU A CD2  1 
ATOM   345  H H    . LEU A 1 23  ? 24.074 3.798   49.705 1.00 10.40 ? 1044 LEU A H    1 
ATOM   346  H HA   . LEU A 1 23  ? 24.966 4.578   47.381 1.00 11.12 ? 1044 LEU A HA   1 
ATOM   347  H HB2  . LEU A 1 23  ? 26.154 3.612   49.193 1.00 16.73 ? 1044 LEU A HB2  1 
ATOM   348  H HB3  . LEU A 1 23  ? 25.589 2.211   48.742 1.00 16.73 ? 1044 LEU A HB3  1 
ATOM   349  H HG   . LEU A 1 23  ? 26.936 2.181   46.924 1.00 29.61 ? 1044 LEU A HG   1 
ATOM   350  H HD11 . LEU A 1 23  ? 26.878 4.476   46.383 1.00 39.36 ? 1044 LEU A HD11 1 
ATOM   351  H HD12 . LEU A 1 23  ? 27.782 4.775   47.635 1.00 39.36 ? 1044 LEU A HD12 1 
ATOM   352  H HD13 . LEU A 1 23  ? 28.358 3.946   46.429 1.00 39.36 ? 1044 LEU A HD13 1 
ATOM   353  H HD21 . LEU A 1 23  ? 27.792 1.542   49.005 1.00 37.27 ? 1044 LEU A HD21 1 
ATOM   354  H HD22 . LEU A 1 23  ? 28.948 2.178   48.150 1.00 37.27 ? 1044 LEU A HD22 1 
ATOM   355  H HD23 . LEU A 1 23  ? 28.252 3.020   49.282 1.00 37.27 ? 1044 LEU A HD23 1 
ATOM   356  N N    . LYS A 1 24  ? 23.271 1.844   47.292 1.00 8.18  ? 1045 LYS A N    1 
ATOM   357  C CA   . LYS A 1 24  ? 22.525 0.950   46.401 1.00 8.12  ? 1045 LYS A CA   1 
ATOM   358  C C    . LYS A 1 24  ? 21.494 1.757   45.602 1.00 8.26  ? 1045 LYS A C    1 
ATOM   359  O O    . LYS A 1 24  ? 21.276 1.512   44.413 1.00 8.86  ? 1045 LYS A O    1 
ATOM   360  C CB   . LYS A 1 24  ? 21.826 -0.150  47.198 1.00 8.41  ? 1045 LYS A CB   1 
ATOM   361  C CG   . LYS A 1 24  ? 22.782 -1.223  47.743 1.00 9.74  ? 1045 LYS A CG   1 
ATOM   362  C CD   . LYS A 1 24  ? 22.133 -2.129  48.793 1.00 10.30 ? 1045 LYS A CD   1 
ATOM   363  C CE   . LYS A 1 24  ? 20.905 -2.837  48.283 1.00 10.90 ? 1045 LYS A CE   1 
ATOM   364  N NZ   . LYS A 1 24  ? 20.447 -3.869  49.277 1.00 9.96  ? 1045 LYS A NZ   1 
ATOM   365  H H    . LYS A 1 24  ? 23.196 1.655   48.128 1.00 9.82  ? 1045 LYS A H    1 
ATOM   366  H HA   . LYS A 1 24  ? 23.145 0.529   45.770 1.00 9.74  ? 1045 LYS A HA   1 
ATOM   367  H HB2  . LYS A 1 24  ? 21.370 0.252   47.953 1.00 10.09 ? 1045 LYS A HB2  1 
ATOM   368  H HB3  . LYS A 1 24  ? 21.181 -0.591  46.622 1.00 10.09 ? 1045 LYS A HB3  1 
ATOM   369  H HG2  . LYS A 1 24  ? 23.079 -1.783  47.008 1.00 11.69 ? 1045 LYS A HG2  1 
ATOM   370  H HG3  . LYS A 1 24  ? 23.544 -0.786  48.154 1.00 11.69 ? 1045 LYS A HG3  1 
ATOM   371  H HD2  . LYS A 1 24  ? 22.775 -2.803  49.067 1.00 12.36 ? 1045 LYS A HD2  1 
ATOM   372  H HD3  . LYS A 1 24  ? 21.873 -1.590  49.556 1.00 12.36 ? 1045 LYS A HD3  1 
ATOM   373  H HE2  . LYS A 1 24  ? 20.190 -2.194  48.156 1.00 13.08 ? 1045 LYS A HE2  1 
ATOM   374  H HE3  . LYS A 1 24  ? 21.112 -3.284  47.448 1.00 13.08 ? 1045 LYS A HE3  1 
ATOM   375  H HZ1  . LYS A 1 24  ? 20.253 -3.479  50.053 1.00 11.95 ? 1045 LYS A HZ1  1 
ATOM   376  H HZ2  . LYS A 1 24  ? 19.722 -4.284  48.972 1.00 11.95 ? 1045 LYS A HZ2  1 
ATOM   377  H HZ3  . LYS A 1 24  ? 21.090 -4.470  49.409 1.00 11.95 ? 1045 LYS A HZ3  1 
ATOM   378  N N    . ASP A 1 25  ? 20.824 2.693   46.269 1.00 8.23  ? 1046 ASP A N    1 
ATOM   379  C CA   . ASP A 1 25  ? 19.861 3.555   45.578 1.00 9.18  ? 1046 ASP A CA   1 
ATOM   380  C C    . ASP A 1 25  ? 20.526 4.368   44.477 1.00 8.05  ? 1046 ASP A C    1 
ATOM   381  O O    . ASP A 1 25  ? 20.027 4.446   43.368 1.00 7.80  ? 1046 ASP A O    1 
ATOM   382  C CB   . ASP A 1 25  ? 19.201 4.485   46.592 1.00 10.14 ? 1046 ASP A CB   1 
ATOM   383  C CG   . ASP A 1 25  ? 18.178 5.345   45.980 1.00 18.22 ? 1046 ASP A CG   1 
ATOM   384  O OD1  . ASP A 1 25  ? 17.024 4.913   45.912 1.00 22.48 ? 1046 ASP A OD1  1 
ATOM   385  O OD2  . ASP A 1 25  ? 18.526 6.466   45.603 1.00 20.76 ? 1046 ASP A OD2  1 
ATOM   386  H H    . ASP A 1 25  ? 20.904 2.850   47.110 1.00 9.88  ? 1046 ASP A H    1 
ATOM   387  H HA   . ASP A 1 25  ? 19.164 2.999   45.172 1.00 11.02 ? 1046 ASP A HA   1 
ATOM   388  H HB2  . ASP A 1 25  ? 18.774 3.952   47.280 1.00 12.16 ? 1046 ASP A HB2  1 
ATOM   389  H HB3  . ASP A 1 25  ? 19.879 5.057   46.985 1.00 12.16 ? 1046 ASP A HB3  1 
ATOM   390  N N    . PHE A 1 26  ? 21.675 4.941   44.794 1.00 8.25  ? 1047 PHE A N    1 
ATOM   391  C CA   . PHE A 1 26  ? 22.427 5.751   43.827 1.00 8.37  ? 1047 PHE A CA   1 
ATOM   392  C C    . PHE A 1 26  ? 22.791 4.954   42.589 1.00 7.89  ? 1047 PHE A C    1 
ATOM   393  O O    . PHE A 1 26  ? 22.633 5.412   41.471 1.00 7.53  ? 1047 PHE A O    1 
ATOM   394  C CB   . PHE A 1 26  ? 23.692 6.289   44.466 1.00 8.39  ? 1047 PHE A CB   1 
ATOM   395  C CG   . PHE A 1 26  ? 24.567 7.021   43.511 1.00 8.61  ? 1047 PHE A CG   1 
ATOM   396  C CD1  . PHE A 1 26  ? 24.254 8.307   43.106 1.00 12.21 ? 1047 PHE A CD1  1 
ATOM   397  C CD2  . PHE A 1 26  ? 25.681 6.414   42.975 1.00 8.80  ? 1047 PHE A CD2  1 
ATOM   398  C CE1  . PHE A 1 26  ? 25.034 8.967   42.209 1.00 13.93 ? 1047 PHE A CE1  1 
ATOM   399  C CE2  . PHE A 1 26  ? 26.491 7.088   42.085 1.00 12.03 ? 1047 PHE A CE2  1 
ATOM   400  C CZ   . PHE A 1 26  ? 26.169 8.365   41.707 1.00 13.10 ? 1047 PHE A CZ   1 
ATOM   401  H H    . PHE A 1 26  ? 22.050 4.880   45.565 1.00 9.90  ? 1047 PHE A H    1 
ATOM   402  H HA   . PHE A 1 26  ? 21.877 6.513   43.549 1.00 10.04 ? 1047 PHE A HA   1 
ATOM   403  H HB2  . PHE A 1 26  ? 23.449 6.902   45.178 1.00 10.07 ? 1047 PHE A HB2  1 
ATOM   404  H HB3  . PHE A 1 26  ? 24.201 5.547   44.829 1.00 10.07 ? 1047 PHE A HB3  1 
ATOM   405  H HD1  . PHE A 1 26  ? 23.495 8.723   43.447 1.00 14.65 ? 1047 PHE A HD1  1 
ATOM   406  H HD2  . PHE A 1 26  ? 25.906 5.551   43.239 1.00 10.57 ? 1047 PHE A HD2  1 
ATOM   407  H HE1  . PHE A 1 26  ? 24.820 9.836   41.958 1.00 16.72 ? 1047 PHE A HE1  1 
ATOM   408  H HE2  . PHE A 1 26  ? 27.248 6.675   41.735 1.00 14.43 ? 1047 PHE A HE2  1 
ATOM   409  H HZ   . PHE A 1 26  ? 26.704 8.818   41.096 1.00 15.72 ? 1047 PHE A HZ   1 
ATOM   410  N N    . VAL A 1 27  ? 23.282 3.738   42.785 1.00 7.08  ? 1048 VAL A N    1 
ATOM   411  C CA   . VAL A 1 27  ? 23.689 2.909   41.650 1.00 7.22  ? 1048 VAL A CA   1 
ATOM   412  C C    . VAL A 1 27  ? 22.474 2.631   40.755 1.00 6.38  ? 1048 VAL A C    1 
ATOM   413  O O    . VAL A 1 27  ? 22.560 2.693   39.531 1.00 6.76  ? 1048 VAL A O    1 
ATOM   414  C CB   . VAL A 1 27  ? 24.407 1.624   42.102 1.00 7.43  ? 1048 VAL A CB   1 
ATOM   415  C CG1  . VAL A 1 27  ? 24.739 0.707   40.911 1.00 7.42  ? 1048 VAL A CG1  1 
ATOM   416  C CG2  . VAL A 1 27  ? 25.684 1.971   42.884 1.00 9.00  ? 1048 VAL A CG2  1 
ATOM   417  H H    . VAL A 1 27  ? 23.391 3.369   43.555 1.00 8.49  ? 1048 VAL A H    1 
ATOM   418  H HA   . VAL A 1 27  ? 24.330 3.421   41.113 1.00 8.66  ? 1048 VAL A HA   1 
ATOM   419  H HB   . VAL A 1 27  ? 23.814 1.128   42.704 1.00 8.91  ? 1048 VAL A HB   1 
ATOM   420  H HG11 . VAL A 1 27  ? 25.184 -0.079  41.237 1.00 8.90  ? 1048 VAL A HG11 1 
ATOM   421  H HG12 . VAL A 1 27  ? 23.924 0.462   40.468 1.00 8.90  ? 1048 VAL A HG12 1 
ATOM   422  H HG13 . VAL A 1 27  ? 25.313 1.180   40.304 1.00 8.90  ? 1048 VAL A HG13 1 
ATOM   423  H HG21 . VAL A 1 27  ? 26.115 1.157   43.156 1.00 10.80 ? 1048 VAL A HG21 1 
ATOM   424  H HG22 . VAL A 1 27  ? 26.269 2.478   42.317 1.00 10.80 ? 1048 VAL A HG22 1 
ATOM   425  H HG23 . VAL A 1 27  ? 25.446 2.490   43.656 1.00 10.80 ? 1048 VAL A HG23 1 
ATOM   426  N N    . GLN A 1 28  ? 21.336 2.323   41.371 1.00 6.82  ? 1049 GLN A N    1 
ATOM   427  C CA   . GLN A 1 28  ? 20.115 2.135   40.588 1.00 6.50  ? 1049 GLN A CA   1 
ATOM   428  C C    . GLN A 1 28  ? 19.728 3.382   39.798 1.00 7.14  ? 1049 GLN A C    1 
ATOM   429  O O    . GLN A 1 28  ? 19.328 3.271   38.626 1.00 7.91  ? 1049 GLN A O    1 
ATOM   430  C CB   . GLN A 1 28  ? 18.972 1.758   41.490 1.00 7.87  ? 1049 GLN A CB   1 
ATOM   431  C CG   . GLN A 1 28  ? 19.131 0.395   42.098 1.00 8.71  ? 1049 GLN A CG   1 
ATOM   432  C CD   . GLN A 1 28  ? 18.064 0.121   43.135 1.00 11.43 ? 1049 GLN A CD   1 
ATOM   433  O OE1  . GLN A 1 28  ? 16.882 -0.026  42.808 1.00 10.86 ? 1049 GLN A OE1  1 
ATOM   434  N NE2  . GLN A 1 28  ? 18.481 0.027   44.394 1.00 14.25 ? 1049 GLN A NE2  1 
ATOM   435  H H    . GLN A 1 28  ? 21.242 2.220   42.220 1.00 8.18  ? 1049 GLN A H    1 
ATOM   436  H HA   . GLN A 1 28  ? 20.254 1.403   39.951 1.00 7.80  ? 1049 GLN A HA   1 
ATOM   437  H HB2  . GLN A 1 28  ? 18.915 2.403   42.212 1.00 9.44  ? 1049 GLN A HB2  1 
ATOM   438  H HB3  . GLN A 1 28  ? 18.150 1.763   40.975 1.00 9.44  ? 1049 GLN A HB3  1 
ATOM   439  H HG2  . GLN A 1 28  ? 19.056 -0.276  41.401 1.00 10.45 ? 1049 GLN A HG2  1 
ATOM   440  H HG3  . GLN A 1 28  ? 19.997 0.336   42.530 1.00 10.45 ? 1049 GLN A HG3  1 
ATOM   441  H HE21 . GLN A 1 28  ? 19.316 0.120   44.579 1.00 17.10 ? 1049 GLN A HE21 1 
ATOM   442  H HE22 . GLN A 1 28  ? 17.916 -0.128  45.024 1.00 17.10 ? 1049 GLN A HE22 1 
ATOM   443  N N    . ARG A 1 29  ? 19.848 4.561   40.411 1.00 7.72  ? 1050 ARG A N    1 
ATOM   444  C CA   . ARG A 1 29  ? 19.527 5.813   39.718 1.00 8.05  ? 1050 ARG A CA   1 
ATOM   445  C C    . ARG A 1 29  ? 20.375 5.987   38.473 1.00 8.54  ? 1050 ARG A C    1 
ATOM   446  O O    . ARG A 1 29  ? 19.863 6.427   37.435 1.00 10.93 ? 1050 ARG A O    1 
ATOM   447  C CB   . ARG A 1 29  ? 19.747 7.019   40.617 1.00 10.07 ? 1050 ARG A CB   1 
ATOM   448  C CG   . ARG A 1 29  ? 18.870 7.080   41.819 1.00 13.15 ? 1050 ARG A CG   1 
ATOM   449  C CD   . ARG A 1 29  ? 19.386 8.123   42.740 1.00 26.68 ? 1050 ARG A CD   1 
ATOM   450  N NE   . ARG A 1 29  ? 18.500 8.262   43.886 1.00 33.10 ? 1050 ARG A NE   1 
ATOM   451  C CZ   . ARG A 1 29  ? 17.568 9.195   44.007 1.00 33.31 ? 1050 ARG A CZ   1 
ATOM   452  N NH1  . ARG A 1 29  ? 17.409 10.107  43.049 1.00 31.18 ? 1050 ARG A NH1  1 
ATOM   453  N NH2  . ARG A 1 29  ? 16.806 9.203   45.098 1.00 32.70 ? 1050 ARG A NH2  1 
ATOM   454  H H    . ARG A 1 29  ? 20.112 4.663   41.223 1.00 9.27  ? 1050 ARG A H    1 
ATOM   455  H HA   . ARG A 1 29  ? 18.585 5.800   39.448 1.00 9.66  ? 1050 ARG A HA   1 
ATOM   456  H HB2  . ARG A 1 29  ? 20.666 7.008   40.927 1.00 12.08 ? 1050 ARG A HB2  1 
ATOM   457  H HB3  . ARG A 1 29  ? 19.588 7.823   40.099 1.00 12.08 ? 1050 ARG A HB3  1 
ATOM   458  H HG2  . ARG A 1 29  ? 17.967 7.316   41.555 1.00 15.78 ? 1050 ARG A HG2  1 
ATOM   459  H HG3  . ARG A 1 29  ? 18.882 6.225   42.278 1.00 15.78 ? 1050 ARG A HG3  1 
ATOM   460  H HD2  . ARG A 1 29  ? 20.266 7.868   43.059 1.00 32.02 ? 1050 ARG A HD2  1 
ATOM   461  H HD3  . ARG A 1 29  ? 19.426 8.974   42.277 1.00 32.02 ? 1050 ARG A HD3  1 
ATOM   462  H HE   . ARG A 1 29  ? 18.588 7.698   44.530 1.00 39.72 ? 1050 ARG A HE   1 
ATOM   463  H HH11 . ARG A 1 29  ? 17.906 10.084  42.347 1.00 37.42 ? 1050 ARG A HH11 1 
ATOM   464  H HH12 . ARG A 1 29  ? 16.806 10.715  43.129 1.00 37.42 ? 1050 ARG A HH12 1 
ATOM   465  H HH21 . ARG A 1 29  ? 16.925 8.611   45.710 1.00 39.24 ? 1050 ARG A HH21 1 
ATOM   466  H HH22 . ARG A 1 29  ? 16.203 9.809   45.197 1.00 39.24 ? 1050 ARG A HH22 1 
ATOM   467  N N    . VAL A 1 30  ? 21.655 5.656   38.562 1.00 6.99  ? 1051 VAL A N    1 
ATOM   468  C CA   . VAL A 1 30  ? 22.531 5.762   37.408 1.00 7.54  ? 1051 VAL A CA   1 
ATOM   469  C C    . VAL A 1 30  ? 22.142 4.724   36.362 1.00 7.55  ? 1051 VAL A C    1 
ATOM   470  O O    . VAL A 1 30  ? 21.988 5.032   35.177 1.00 7.52  ? 1051 VAL A O    1 
ATOM   471  C CB   . VAL A 1 30  ? 24.028 5.659   37.804 1.00 7.78  ? 1051 VAL A CB   1 
ATOM   472  C CG1  . VAL A 1 30  ? 24.912 5.680   36.579 1.00 7.15  ? 1051 VAL A CG1  1 
ATOM   473  C CG2  . VAL A 1 30  ? 24.416 6.804   38.766 1.00 8.15  ? 1051 VAL A CG2  1 
ATOM   474  H H    . VAL A 1 30  ? 22.038 5.367   39.276 1.00 8.39  ? 1051 VAL A H    1 
ATOM   475  H HA   . VAL A 1 30  ? 22.399 6.645   37.004 1.00 9.05  ? 1051 VAL A HA   1 
ATOM   476  H HB   . VAL A 1 30  ? 24.177 4.810   38.270 1.00 9.33  ? 1051 VAL A HB   1 
ATOM   477  H HG11 . VAL A 1 30  ? 25.829 5.615   36.855 1.00 8.57  ? 1051 VAL A HG11 1 
ATOM   478  H HG12 . VAL A 1 30  ? 24.684 4.935   36.018 1.00 8.57  ? 1051 VAL A HG12 1 
ATOM   479  H HG13 . VAL A 1 30  ? 24.769 6.503   36.106 1.00 8.57  ? 1051 VAL A HG13 1 
ATOM   480  H HG21 . VAL A 1 30  ? 25.345 6.718   38.995 1.00 9.78  ? 1051 VAL A HG21 1 
ATOM   481  H HG22 . VAL A 1 30  ? 24.263 7.644   38.328 1.00 9.78  ? 1051 VAL A HG22 1 
ATOM   482  H HG23 . VAL A 1 30  ? 23.876 6.743   39.557 1.00 9.78  ? 1051 VAL A HG23 1 
ATOM   483  N N    . VAL A 1 31  ? 21.966 3.482   36.784 1.00 6.00  ? 1052 VAL A N    1 
ATOM   484  C CA   . VAL A 1 31  ? 21.666 2.414   35.837 1.00 6.50  ? 1052 VAL A CA   1 
ATOM   485  C C    . VAL A 1 31  ? 20.345 2.666   35.087 1.00 7.24  ? 1052 VAL A C    1 
ATOM   486  O O    . VAL A 1 31  ? 20.252 2.379   33.899 1.00 7.01  ? 1052 VAL A O    1 
ATOM   487  C CB   . VAL A 1 31  ? 21.677 1.037   36.554 1.00 6.21  ? 1052 VAL A CB   1 
ATOM   488  C CG1  . VAL A 1 31  ? 21.048 -0.050  35.684 1.00 7.64  ? 1052 VAL A CG1  1 
ATOM   489  C CG2  . VAL A 1 31  ? 23.090 0.682   36.917 1.00 6.90  ? 1052 VAL A CG2  1 
ATOM   490  H H    . VAL A 1 31  ? 22.013 3.229   37.605 1.00 7.20  ? 1052 VAL A H    1 
ATOM   491  H HA   . VAL A 1 31  ? 22.380 2.394   35.165 1.00 7.80  ? 1052 VAL A HA   1 
ATOM   492  H HB   . VAL A 1 31  ? 21.157 1.103   37.382 1.00 7.45  ? 1052 VAL A HB   1 
ATOM   493  H HG11 . VAL A 1 31  ? 21.073 -0.883  36.159 1.00 9.17  ? 1052 VAL A HG11 1 
ATOM   494  H HG12 . VAL A 1 31  ? 20.139 0.192   35.492 1.00 9.17  ? 1052 VAL A HG12 1 
ATOM   495  H HG13 . VAL A 1 31  ? 21.547 -0.123  34.867 1.00 9.17  ? 1052 VAL A HG13 1 
ATOM   496  H HG21 . VAL A 1 31  ? 23.093 -0.169  37.360 1.00 8.27  ? 1052 VAL A HG21 1 
ATOM   497  H HG22 . VAL A 1 31  ? 23.616 0.637   36.115 1.00 8.27  ? 1052 VAL A HG22 1 
ATOM   498  H HG23 . VAL A 1 31  ? 23.440 1.358   37.502 1.00 8.27  ? 1052 VAL A HG23 1 
ATOM   499  N N    . GLU A 1 32  ? 19.341 3.211   35.775 1.00 7.62  ? 1053 GLU A N    1 
ATOM   500  C CA   . GLU A 1 32  ? 18.052 3.452   35.143 1.00 9.28  ? 1053 GLU A CA   1 
ATOM   501  C C    . GLU A 1 32  ? 18.166 4.406   33.961 1.00 10.37 ? 1053 GLU A C    1 
ATOM   502  O O    . GLU A 1 32  ? 17.321 4.399   33.089 1.00 13.72 ? 1053 GLU A O    1 
ATOM   503  C CB   . GLU A 1 32  ? 17.069 4.031   36.158 1.00 12.60 ? 1053 GLU A CB   1 
ATOM   504  C CG   . GLU A 1 32  ? 16.622 3.113   37.239 1.00 16.90 ? 1053 GLU A CG   1 
ATOM   505  C CD   . GLU A 1 32  ? 16.070 3.877   38.436 1.00 19.47 ? 1053 GLU A CD   1 
ATOM   506  O OE1  . GLU A 1 32  ? 15.920 5.078   38.329 1.00 17.89 ? 1053 GLU A OE1  1 
ATOM   507  O OE2  . GLU A 1 32  ? 15.843 3.271   39.485 1.00 22.19 ? 1053 GLU A OE2  1 
ATOM   508  H H    . GLU A 1 32  ? 19.384 3.447   36.601 1.00 9.15  ? 1053 GLU A H    1 
ATOM   509  H HA   . GLU A 1 32  ? 17.690 2.602   34.817 1.00 11.13 ? 1053 GLU A HA   1 
ATOM   510  H HB2  . GLU A 1 32  ? 17.488 4.795   36.585 1.00 15.12 ? 1053 GLU A HB2  1 
ATOM   511  H HB3  . GLU A 1 32  ? 16.276 4.323   35.682 1.00 15.12 ? 1053 GLU A HB3  1 
ATOM   512  H HG2  . GLU A 1 32  ? 15.920 2.536   36.898 1.00 20.28 ? 1053 GLU A HG2  1 
ATOM   513  H HG3  . GLU A 1 32  ? 17.376 2.581   37.539 1.00 20.28 ? 1053 GLU A HG3  1 
ATOM   514  N N    A SER A 1 33  ? 19.212 5.227   33.954 0.43 10.73 ? 1054 SER A N    1 
ATOM   515  N N    B SER A 1 33  ? 19.214 5.219   33.949 0.57 9.65  ? 1054 SER A N    1 
ATOM   516  C CA   A SER A 1 33  ? 19.433 6.191   32.881 0.43 11.11 ? 1054 SER A CA   1 
ATOM   517  C CA   B SER A 1 33  ? 19.443 6.189   32.890 0.57 11.69 ? 1054 SER A CA   1 
ATOM   518  C C    A SER A 1 33  ? 20.176 5.606   31.688 0.43 11.46 ? 1054 SER A C    1 
ATOM   519  C C    B SER A 1 33  ? 20.186 5.613   31.698 0.57 11.64 ? 1054 SER A C    1 
ATOM   520  O O    A SER A 1 33  ? 20.284 6.266   30.654 0.43 15.45 ? 1054 SER A O    1 
ATOM   521  O O    B SER A 1 33  ? 20.309 6.289   30.675 0.57 15.31 ? 1054 SER A O    1 
ATOM   522  C CB   A SER A 1 33  ? 20.193 7.420   33.398 0.43 11.61 ? 1054 SER A CB   1 
ATOM   523  C CB   B SER A 1 33  ? 20.227 7.387   33.429 0.57 15.59 ? 1054 SER A CB   1 
ATOM   524  O OG   A SER A 1 33  ? 21.545 7.121   33.731 0.43 11.97 ? 1054 SER A OG   1 
ATOM   525  O OG   B SER A 1 33  ? 19.446 8.142   34.339 0.57 20.38 ? 1054 SER A OG   1 
ATOM   526  H H    A SER A 1 33  ? 19.815 5.246   34.567 0.43 12.88 ? 1054 SER A H    1 
ATOM   527  H H    B SER A 1 33  ? 19.821 5.226   34.558 0.57 11.58 ? 1054 SER A H    1 
ATOM   528  H HA   A SER A 1 33  ? 18.560 6.499   32.559 0.43 13.33 ? 1054 SER A HA   1 
ATOM   529  H HA   B SER A 1 33  ? 18.576 6.517   32.572 0.57 14.03 ? 1054 SER A HA   1 
ATOM   530  H HB2  A SER A 1 33  ? 20.186 8.102   32.708 0.43 13.93 ? 1054 SER A HB2  1 
ATOM   531  H HB2  B SER A 1 33  ? 21.020 7.064   33.886 0.57 18.71 ? 1054 SER A HB2  1 
ATOM   532  H HB3  A SER A 1 33  ? 19.744 7.753   34.191 0.43 13.93 ? 1054 SER A HB3  1 
ATOM   533  H HB3  B SER A 1 33  ? 20.483 7.955   32.685 0.57 18.71 ? 1054 SER A HB3  1 
ATOM   534  H HG   A SER A 1 33  ? 21.700 6.328   33.590 0.43 14.36 ? 1054 SER A HG   1 
ATOM   535  H HG   B SER A 1 33  ? 19.880 8.780   34.618 0.57 24.46 ? 1054 SER A HG   1 
ATOM   536  N N    . LEU A 1 34  ? 20.699 4.391   31.834 1.00 9.86  ? 1055 LEU A N    1 
ATOM   537  C CA   . LEU A 1 34  ? 21.494 3.759   30.797 1.00 10.12 ? 1055 LEU A CA   1 
ATOM   538  C C    . LEU A 1 34  ? 20.647 2.840   29.949 1.00 9.64  ? 1055 LEU A C    1 
ATOM   539  O O    . LEU A 1 34  ? 19.663 2.276   30.430 1.00 10.99 ? 1055 LEU A O    1 
ATOM   540  C CB   . LEU A 1 34  ? 22.594 2.927   31.461 1.00 12.28 ? 1055 LEU A CB   1 
ATOM   541  C CG   . LEU A 1 34  ? 23.521 3.718   32.373 1.00 16.79 ? 1055 LEU A CG   1 
ATOM   542  C CD1  . LEU A 1 34  ? 24.566 2.814   33.012 1.00 17.84 ? 1055 LEU A CD1  1 
ATOM   543  C CD2  . LEU A 1 34  ? 24.174 4.879   31.667 1.00 21.42 ? 1055 LEU A CD2  1 
ATOM   544  H H    . LEU A 1 34  ? 20.601 3.904   32.536 0.43 11.83 ? 1055 LEU A H    1 
ATOM   545  H HA   . LEU A 1 34  ? 21.905 4.439   30.223 1.00 12.14 ? 1055 LEU A HA   1 
ATOM   546  H HB2  . LEU A 1 34  ? 22.178 2.233   31.996 1.00 14.74 ? 1055 LEU A HB2  1 
ATOM   547  H HB3  . LEU A 1 34  ? 23.139 2.523   30.768 1.00 14.74 ? 1055 LEU A HB3  1 
ATOM   548  H HG   . LEU A 1 34  ? 22.987 4.088   33.093 1.00 20.15 ? 1055 LEU A HG   1 
ATOM   549  H HD11 . LEU A 1 34  ? 25.131 3.344   33.579 1.00 21.41 ? 1055 LEU A HD11 1 
ATOM   550  H HD12 . LEU A 1 34  ? 24.120 2.141   33.531 1.00 21.41 ? 1055 LEU A HD12 1 
ATOM   551  H HD13 . LEU A 1 34  ? 25.088 2.403   32.320 1.00 21.41 ? 1055 LEU A HD13 1 
ATOM   552  H HD21 . LEU A 1 34  ? 24.745 5.340   32.287 1.00 25.70 ? 1055 LEU A HD21 1 
ATOM   553  H HD22 . LEU A 1 34  ? 24.692 4.546   30.931 1.00 25.70 ? 1055 LEU A HD22 1 
ATOM   554  H HD23 . LEU A 1 34  ? 23.492 5.473   31.346 1.00 25.70 ? 1055 LEU A HD23 1 
ATOM   555  N N    . ASP A 1 35  ? 21.054 2.653   28.700 1.00 10.01 ? 1056 ASP A N    1 
ATOM   556  C CA   . ASP A 1 35  ? 20.390 1.739   27.790 1.00 9.88  ? 1056 ASP A CA   1 
ATOM   557  C C    . ASP A 1 35  ? 21.042 0.373   27.916 1.00 8.45  ? 1056 ASP A C    1 
ATOM   558  O O    . ASP A 1 35  ? 22.013 0.073   27.245 1.00 9.19  ? 1056 ASP A O    1 
ATOM   559  C CB   . ASP A 1 35  ? 20.549 2.272   26.374 1.00 13.44 ? 1056 ASP A CB   1 
ATOM   560  C CG   . ASP A 1 35  ? 19.822 1.451   25.339 1.00 19.73 ? 1056 ASP A CG   1 
ATOM   561  O OD1  . ASP A 1 35  ? 19.043 0.547   25.706 1.00 18.87 ? 1056 ASP A OD1  1 
ATOM   562  O OD2  . ASP A 1 35  ? 20.027 1.722   24.135 1.00 24.57 ? 1056 ASP A OD2  1 
ATOM   563  H H    . ASP A 1 35  ? 21.730 3.054   28.352 1.00 12.01 ? 1056 ASP A H    1 
ATOM   564  H HA   . ASP A 1 35  ? 19.437 1.669   28.008 1.00 11.86 ? 1056 ASP A HA   1 
ATOM   565  H HB2  . ASP A 1 35  ? 20.198 3.176   26.337 1.00 16.13 ? 1056 ASP A HB2  1 
ATOM   566  H HB3  . ASP A 1 35  ? 21.492 2.275   26.143 1.00 16.13 ? 1056 ASP A HB3  1 
ATOM   567  N N    . VAL A 1 36  ? 20.540 -0.423  28.853 1.00 8.51  ? 1057 VAL A N    1 
ATOM   568  C CA   . VAL A 1 36  ? 21.190 -1.668  29.230 1.00 7.79  ? 1057 VAL A CA   1 
ATOM   569  C C    . VAL A 1 36  ? 20.840 -2.813  28.301 1.00 8.18  ? 1057 VAL A C    1 
ATOM   570  O O    . VAL A 1 36  ? 19.672 -3.134  28.100 1.00 9.54  ? 1057 VAL A O    1 
ATOM   571  C CB   . VAL A 1 36  ? 20.814 -2.060  30.672 1.00 8.85  ? 1057 VAL A CB   1 
ATOM   572  C CG1  . VAL A 1 36  ? 21.384 -3.429  31.041 1.00 8.75  ? 1057 VAL A CG1  1 
ATOM   573  C CG2  . VAL A 1 36  ? 21.301 -1.008  31.661 1.00 9.45  ? 1057 VAL A CG2  1 
ATOM   574  H H    . VAL A 1 36  ? 19.816 -0.261  29.289 1.00 10.21 ? 1057 VAL A H    1 
ATOM   575  H HA   . VAL A 1 36  ? 22.161 -1.540  29.196 1.00 9.35  ? 1057 VAL A HA   1 
ATOM   576  H HB   . VAL A 1 36  ? 19.838 -2.112  30.742 1.00 10.62 ? 1057 VAL A HB   1 
ATOM   577  H HG11 . VAL A 1 36  ? 21.131 -3.641  31.942 1.00 10.50 ? 1057 VAL A HG11 1 
ATOM   578  H HG12 . VAL A 1 36  ? 21.030 -4.088  30.438 1.00 10.50 ? 1057 VAL A HG12 1 
ATOM   579  H HG13 . VAL A 1 36  ? 22.341 -3.399  30.968 1.00 10.50 ? 1057 VAL A HG13 1 
ATOM   580  H HG21 . VAL A 1 36  ? 21.054 -1.276  32.549 1.00 11.34 ? 1057 VAL A HG21 1 
ATOM   581  H HG22 . VAL A 1 36  ? 22.256 -0.935  31.594 1.00 11.34 ? 1057 VAL A HG22 1 
ATOM   582  H HG23 . VAL A 1 36  ? 20.892 -0.166  31.448 1.00 11.34 ? 1057 VAL A HG23 1 
ATOM   583  N N    . GLY A 1 37  ? 21.854 -3.444  27.716 1.00 7.80  ? 1058 GLY A N    1 
ATOM   584  C CA   . GLY A 1 37  ? 21.678 -4.668  26.966 1.00 8.83  ? 1058 GLY A CA   1 
ATOM   585  C C    . GLY A 1 37  ? 23.008 -5.076  26.387 1.00 8.76  ? 1058 GLY A C    1 
ATOM   586  O O    . GLY A 1 37  ? 23.926 -4.268  26.312 1.00 8.56  ? 1058 GLY A O    1 
ATOM   587  H H    . GLY A 1 37  ? 22.669 -3.171  27.744 1.00 9.36  ? 1058 GLY A H    1 
ATOM   588  H HA2  . GLY A 1 37  ? 21.354 -5.374  27.548 1.00 10.59 ? 1058 GLY A HA2  1 
ATOM   589  H HA3  . GLY A 1 37  ? 21.044 -4.532  26.245 1.00 10.59 ? 1058 GLY A HA3  1 
ATOM   590  N N    . PRO A 1 38  ? 23.118 -6.322  25.927 1.00 9.79  ? 1059 PRO A N    1 
ATOM   591  C CA   . PRO A 1 38  ? 24.447 -6.828  25.550 1.00 10.56 ? 1059 PRO A CA   1 
ATOM   592  C C    . PRO A 1 38  ? 25.115 -6.040  24.429 1.00 10.47 ? 1059 PRO A C    1 
ATOM   593  O O    . PRO A 1 38  ? 26.338 -5.912  24.401 1.00 11.33 ? 1059 PRO A O    1 
ATOM   594  C CB   . PRO A 1 38  ? 24.159 -8.274  25.149 1.00 13.50 ? 1059 PRO A CB   1 
ATOM   595  C CG   . PRO A 1 38  ? 22.973 -8.645  26.008 1.00 13.28 ? 1059 PRO A CG   1 
ATOM   596  C CD   . PRO A 1 38  ? 22.129 -7.404  26.015 1.00 11.81 ? 1059 PRO A CD   1 
ATOM   597  H HA   . PRO A 1 38  ? 25.037 -6.827  26.332 1.00 12.67 ? 1059 PRO A HA   1 
ATOM   598  H HB2  . PRO A 1 38  ? 23.933 -8.318  24.206 1.00 16.20 ? 1059 PRO A HB2  1 
ATOM   599  H HB3  . PRO A 1 38  ? 24.925 -8.834  25.352 1.00 16.20 ? 1059 PRO A HB3  1 
ATOM   600  H HG2  . PRO A 1 38  ? 22.494 -9.388  25.608 1.00 15.93 ? 1059 PRO A HG2  1 
ATOM   601  H HG3  . PRO A 1 38  ? 23.271 -8.866  26.905 1.00 15.93 ? 1059 PRO A HG3  1 
ATOM   602  H HD2  . PRO A 1 38  ? 21.542 -7.390  25.243 1.00 14.18 ? 1059 PRO A HD2  1 
ATOM   603  H HD3  . PRO A 1 38  ? 21.629 -7.340  26.844 1.00 14.18 ? 1059 PRO A HD3  1 
ATOM   604  N N    . ASP A 1 39  ? 24.333 -5.517  23.494 1.00 10.85 ? 1060 ASP A N    1 
ATOM   605  C CA   . ASP A 1 39  ? 24.901 -4.731  22.415 1.00 12.98 ? 1060 ASP A CA   1 
ATOM   606  C C    . ASP A 1 39  ? 24.882 -3.228  22.672 1.00 11.90 ? 1060 ASP A C    1 
ATOM   607  O O    . ASP A 1 39  ? 25.255 -2.450  21.809 1.00 14.77 ? 1060 ASP A O    1 
ATOM   608  C CB   . ASP A 1 39  ? 24.164 -5.043  21.110 1.00 19.50 ? 1060 ASP A CB   1 
ATOM   609  C CG   . ASP A 1 39  ? 24.324 -6.485  20.695 1.00 32.18 ? 1060 ASP A CG   1 
ATOM   610  O OD1  . ASP A 1 39  ? 25.408 -7.058  20.938 1.00 37.80 ? 1060 ASP A OD1  1 
ATOM   611  O OD2  . ASP A 1 39  ? 23.364 -7.043  20.127 1.00 40.25 ? 1060 ASP A OD2  1 
ATOM   612  H H    . ASP A 1 39  ? 23.478 -5.603  23.464 1.00 13.03 ? 1060 ASP A H    1 
ATOM   613  H HA   . ASP A 1 39  ? 25.837 -4.996  22.297 1.00 15.57 ? 1060 ASP A HA   1 
ATOM   614  H HB2  . ASP A 1 39  ? 23.218 -4.867  21.229 1.00 23.40 ? 1060 ASP A HB2  1 
ATOM   615  H HB3  . ASP A 1 39  ? 24.521 -4.485  20.402 1.00 23.40 ? 1060 ASP A HB3  1 
ATOM   616  N N    A ARG A 1 40  ? 24.489 -2.853  23.885 0.52 10.82 ? 1061 ARG A N    1 
ATOM   617  N N    B ARG A 1 40  ? 24.470 -2.854  23.879 0.48 10.39 ? 1061 ARG A N    1 
ATOM   618  C CA   A ARG A 1 40  ? 24.487 -1.453  24.291 0.52 10.66 ? 1061 ARG A CA   1 
ATOM   619  C CA   B ARG A 1 40  ? 24.481 -1.456  24.292 0.48 10.47 ? 1061 ARG A CA   1 
ATOM   620  C C    A ARG A 1 40  ? 25.336 -1.252  25.540 0.52 9.69  ? 1061 ARG A C    1 
ATOM   621  C C    B ARG A 1 40  ? 25.332 -1.270  25.543 0.48 11.35 ? 1061 ARG A C    1 
ATOM   622  O O    A ARG A 1 40  ? 26.560 -1.377  25.497 0.52 9.89  ? 1061 ARG A O    1 
ATOM   623  O O    B ARG A 1 40  ? 26.554 -1.404  25.499 0.48 12.18 ? 1061 ARG A O    1 
ATOM   624  C CB   A ARG A 1 40  ? 23.056 -0.978  24.551 0.50 20.00 ? 1061 ARG A CB   1 
ATOM   625  C CB   B ARG A 1 40  ? 23.055 -0.969  24.555 0.50 20.00 ? 1061 ARG A CB   1 
ATOM   626  C CG   A ARG A 1 40  ? 22.195 -0.888  23.302 0.50 20.00 ? 1061 ARG A CG   1 
ATOM   627  C CG   B ARG A 1 40  ? 22.224 -0.771  23.297 0.50 20.00 ? 1061 ARG A CG   1 
ATOM   628  C CD   A ARG A 1 40  ? 21.226 -2.056  23.214 0.50 20.00 ? 1061 ARG A CD   1 
ATOM   629  C CD   B ARG A 1 40  ? 20.752 -1.040  23.560 0.50 20.00 ? 1061 ARG A CD   1 
ATOM   630  N NE   A ARG A 1 40  ? 20.136 -1.936  24.178 0.50 20.00 ? 1061 ARG A NE   1 
ATOM   631  N NE   B ARG A 1 40  ? 20.451 -2.468  23.581 0.50 20.00 ? 1061 ARG A NE   1 
ATOM   632  C CZ   A ARG A 1 40  ? 19.460 -2.968  24.673 0.50 20.00 ? 1061 ARG A CZ   1 
ATOM   633  C CZ   B ARG A 1 40  ? 19.647 -3.050  24.464 0.50 20.00 ? 1061 ARG A CZ   1 
ATOM   634  N NH1  A ARG A 1 40  ? 19.761 -4.203  24.296 0.50 20.00 ? 1061 ARG A NH1  1 
ATOM   635  N NH1  B ARG A 1 40  ? 19.058 -2.325  25.406 0.50 20.00 ? 1061 ARG A NH1  1 
ATOM   636  N NH2  A ARG A 1 40  ? 18.483 -2.765  25.546 0.50 20.00 ? 1061 ARG A NH2  1 
ATOM   637  N NH2  B ARG A 1 40  ? 19.431 -4.357  24.408 0.50 20.00 ? 1061 ARG A NH2  1 
ATOM   638  H H    A ARG A 1 40  ? 24.162 -3.388  24.474 0.52 12.98 ? 1061 ARG A H    1 
ATOM   639  H H    B ARG A 1 40  ? 24.125 -3.387  24.459 0.48 12.46 ? 1061 ARG A H    1 
ATOM   640  H HA   A ARG A 1 40  ? 24.865 -0.907  23.570 0.52 12.79 ? 1061 ARG A HA   1 
ATOM   641  H HA   B ARG A 1 40  ? 24.865 -0.910  23.575 0.48 12.56 ? 1061 ARG A HA   1 
ATOM   642  N N    . VAL A 1 41  ? 24.683 -0.904  26.644 1.00 9.01  ? 1062 VAL A N    1 
ATOM   643  C CA   . VAL A 1 41  ? 25.458 -0.742  27.865 1.00 7.44  ? 1062 VAL A CA   1 
ATOM   644  C C    . VAL A 1 41  ? 25.448 -2.049  28.651 1.00 6.17  ? 1062 VAL A C    1 
ATOM   645  O O    . VAL A 1 41  ? 24.398 -2.646  28.910 1.00 7.64  ? 1062 VAL A O    1 
ATOM   646  C CB   . VAL A 1 41  ? 24.924 0.390   28.740 1.00 7.53  ? 1062 VAL A CB   1 
ATOM   647  C CG1  . VAL A 1 41  ? 25.746 0.521   30.023 1.00 8.68  ? 1062 VAL A CG1  1 
ATOM   648  C CG2  . VAL A 1 41  ? 24.942 1.683   27.974 1.00 10.37 ? 1062 VAL A CG2  1 
ATOM   649  H H    . VAL A 1 41  ? 23.840 -0.761  26.733 0.48 10.82 ? 1062 VAL A H    1 
ATOM   650  H HA   . VAL A 1 41  ? 26.386 -0.535  27.630 1.00 8.93  ? 1062 VAL A HA   1 
ATOM   651  H HB   . VAL A 1 41  ? 23.997 0.195   28.989 1.00 9.03  ? 1062 VAL A HB   1 
ATOM   652  H HG11 . VAL A 1 41  ? 25.388 1.238   30.551 1.00 10.41 ? 1062 VAL A HG11 1 
ATOM   653  H HG12 . VAL A 1 41  ? 25.694 -0.304  30.512 1.00 10.41 ? 1062 VAL A HG12 1 
ATOM   654  H HG13 . VAL A 1 41  ? 26.659 0.708   29.792 1.00 10.41 ? 1062 VAL A HG13 1 
ATOM   655  H HG21 . VAL A 1 41  ? 24.604 2.383   28.537 1.00 12.45 ? 1062 VAL A HG21 1 
ATOM   656  H HG22 . VAL A 1 41  ? 25.845 1.878   27.713 1.00 12.45 ? 1062 VAL A HG22 1 
ATOM   657  H HG23 . VAL A 1 41  ? 24.388 1.592   27.196 1.00 12.45 ? 1062 VAL A HG23 1 
ATOM   658  N N    . ARG A 1 42  ? 26.638 -2.490  29.046 1.00 5.99  ? 1063 ARG A N    1 
ATOM   659  C CA   . ARG A 1 42  ? 26.850 -3.605  29.980 1.00 6.45  ? 1063 ARG A CA   1 
ATOM   660  C C    . ARG A 1 42  ? 27.265 -3.051  31.322 1.00 6.19  ? 1063 ARG A C    1 
ATOM   661  O O    . ARG A 1 42  ? 28.023 -2.069  31.366 1.00 6.66  ? 1063 ARG A O    1 
ATOM   662  C CB   . ARG A 1 42  ? 27.920 -4.543  29.458 1.00 6.32  ? 1063 ARG A CB   1 
ATOM   663  C CG   . ARG A 1 42  ? 27.532 -5.238  28.143 1.00 7.13  ? 1063 ARG A CG   1 
ATOM   664  C CD   . ARG A 1 42  ? 28.639 -6.144  27.636 1.00 7.06  ? 1063 ARG A CD   1 
ATOM   665  N NE   . ARG A 1 42  ? 28.235 -6.674  26.345 1.00 8.32  ? 1063 ARG A NE   1 
ATOM   666  C CZ   . ARG A 1 42  ? 28.829 -7.683  25.719 1.00 10.85 ? 1063 ARG A CZ   1 
ATOM   667  N NH1  . ARG A 1 42  ? 29.867 -8.267  26.258 1.00 13.55 ? 1063 ARG A NH1  1 
ATOM   668  N NH2  . ARG A 1 42  ? 28.361 -8.101  24.544 1.00 11.47 ? 1063 ARG A NH2  1 
ATOM   669  H H    . ARG A 1 42  ? 27.377 -2.144  28.775 1.00 7.19  ? 1063 ARG A H    1 
ATOM   670  H HA   . ARG A 1 42  ? 26.016 -4.108  30.090 1.00 7.73  ? 1063 ARG A HA   1 
ATOM   671  H HB2  . ARG A 1 42  ? 28.731 -4.037  29.300 1.00 7.59  ? 1063 ARG A HB2  1 
ATOM   672  H HB3  . ARG A 1 42  ? 28.084 -5.231  30.122 1.00 7.59  ? 1063 ARG A HB3  1 
ATOM   673  H HG2  . ARG A 1 42  ? 26.741 -5.780  28.289 1.00 8.56  ? 1063 ARG A HG2  1 
ATOM   674  H HG3  . ARG A 1 42  ? 27.358 -4.566  27.466 1.00 8.56  ? 1063 ARG A HG3  1 
ATOM   675  H HD2  . ARG A 1 42  ? 29.457 -5.636  27.525 1.00 8.47  ? 1063 ARG A HD2  1 
ATOM   676  H HD3  . ARG A 1 42  ? 28.770 -6.883  28.251 1.00 8.47  ? 1063 ARG A HD3  1 
ATOM   677  H HE   . ARG A 1 42  ? 27.561 -6.306  25.957 1.00 9.98  ? 1063 ARG A HE   1 
ATOM   678  H HH11 . ARG A 1 42  ? 30.164 -7.999  27.019 1.00 16.25 ? 1063 ARG A HH11 1 
ATOM   679  H HH12 . ARG A 1 42  ? 30.253 -8.919  25.851 1.00 16.25 ? 1063 ARG A HH12 1 
ATOM   680  H HH21 . ARG A 1 42  ? 27.680 -7.713  24.190 1.00 13.77 ? 1063 ARG A HH21 1 
ATOM   681  H HH22 . ARG A 1 42  ? 28.748 -8.750  24.133 1.00 13.77 ? 1063 ARG A HH22 1 
ATOM   682  N N    . VAL A 1 43  ? 26.733 -3.647  32.396 1.00 5.84  ? 1064 VAL A N    1 
ATOM   683  C CA   . VAL A 1 43  ? 27.016 -3.178  33.747 1.00 5.72  ? 1064 VAL A CA   1 
ATOM   684  C C    . VAL A 1 43  ? 27.606 -4.279  34.598 1.00 5.36  ? 1064 VAL A C    1 
ATOM   685  O O    . VAL A 1 43  ? 27.118 -5.423  34.571 1.00 6.91  ? 1064 VAL A O    1 
ATOM   686  C CB   . VAL A 1 43  ? 25.730 -2.652  34.417 1.00 5.82  ? 1064 VAL A CB   1 
ATOM   687  C CG1  . VAL A 1 43  ? 26.061 -2.022  35.767 1.00 6.25  ? 1064 VAL A CG1  1 
ATOM   688  C CG2  . VAL A 1 43  ? 25.027 -1.640  33.500 1.00 7.24  ? 1064 VAL A CG2  1 
ATOM   689  H H    . VAL A 1 43  ? 26.205 -4.325  32.363 1.00 7.01  ? 1064 VAL A H    1 
ATOM   690  H HA   . VAL A 1 43  ? 27.663 -2.444  33.705 1.00 6.86  ? 1064 VAL A HA   1 
ATOM   691  H HB   . VAL A 1 43  ? 25.117 -3.401  34.571 1.00 6.98  ? 1064 VAL A HB   1 
ATOM   692  H HG11 . VAL A 1 43  ? 25.250 -1.700  36.168 1.00 7.50  ? 1064 VAL A HG11 1 
ATOM   693  H HG12 . VAL A 1 43  ? 26.464 -2.686  36.331 1.00 7.50  ? 1064 VAL A HG12 1 
ATOM   694  H HG13 . VAL A 1 43  ? 26.670 -1.293  35.631 1.00 7.50  ? 1064 VAL A HG13 1 
ATOM   695  H HG21 . VAL A 1 43  ? 24.231 -1.326  33.934 1.00 8.69  ? 1064 VAL A HG21 1 
ATOM   696  H HG22 . VAL A 1 43  ? 25.622 -0.905  33.333 1.00 8.69  ? 1064 VAL A HG22 1 
ATOM   697  H HG23 . VAL A 1 43  ? 24.801 -2.073  32.674 1.00 8.69  ? 1064 VAL A HG23 1 
ATOM   698  N N    . ALA A 1 44  ? 28.629 -3.942  35.368 1.00 5.49  ? 1065 ALA A N    1 
ATOM   699  C CA   . ALA A 1 44  ? 29.202 -4.847  36.356 1.00 4.87  ? 1065 ALA A CA   1 
ATOM   700  C C    . ALA A 1 44  ? 29.314 -4.124  37.678 1.00 5.17  ? 1065 ALA A C    1 
ATOM   701  O O    . ALA A 1 44  ? 29.290 -2.891  37.724 1.00 5.43  ? 1065 ALA A O    1 
ATOM   702  C CB   . ALA A 1 44  ? 30.590 -5.313  35.933 1.00 5.77  ? 1065 ALA A CB   1 
ATOM   703  H H    . ALA A 1 44  ? 29.020 -3.176  35.338 1.00 6.58  ? 1065 ALA A H    1 
ATOM   704  H HA   . ALA A 1 44  ? 28.623 -5.630  36.469 1.00 5.84  ? 1065 ALA A HA   1 
ATOM   705  H HB1  . ALA A 1 44  ? 30.938 -5.907  36.603 1.00 6.92  ? 1065 ALA A HB1  1 
ATOM   706  H HB2  . ALA A 1 44  ? 30.523 -5.772  35.092 1.00 6.92  ? 1065 ALA A HB2  1 
ATOM   707  H HB3  . ALA A 1 44  ? 31.163 -4.548  35.844 1.00 6.92  ? 1065 ALA A HB3  1 
ATOM   708  N N    . LEU A 1 45  ? 29.488 -4.888  38.751 1.00 5.63  ? 1066 LEU A N    1 
ATOM   709  C CA   . LEU A 1 45  ? 29.623 -4.300  40.088 1.00 5.57  ? 1066 LEU A CA   1 
ATOM   710  C C    . LEU A 1 45  ? 30.497 -5.185  40.928 1.00 4.94  ? 1066 LEU A C    1 
ATOM   711  O O    . LEU A 1 45  ? 30.302 -6.408  40.998 1.00 6.37  ? 1066 LEU A O    1 
ATOM   712  C CB   . LEU A 1 45  ? 28.261 -4.086  40.720 1.00 5.97  ? 1066 LEU A CB   1 
ATOM   713  C CG   . LEU A 1 45  ? 28.231 -3.252  42.016 1.00 5.82  ? 1066 LEU A CG   1 
ATOM   714  C CD1  . LEU A 1 45  ? 26.920 -2.504  42.154 1.00 8.31  ? 1066 LEU A CD1  1 
ATOM   715  C CD2  . LEU A 1 45  ? 28.425 -4.148  43.249 1.00 6.92  ? 1066 LEU A CD2  1 
ATOM   716  H H    . LEU A 1 45  ? 29.532 -5.747  38.737 1.00 6.75  ? 1066 LEU A H    1 
ATOM   717  H HA   . LEU A 1 45  ? 30.061 -3.427  40.010 1.00 6.68  ? 1066 LEU A HA   1 
ATOM   718  H HB2  . LEU A 1 45  ? 27.694 -3.635  40.075 1.00 7.16  ? 1066 LEU A HB2  1 
ATOM   719  H HB3  . LEU A 1 45  ? 27.882 -4.955  40.928 1.00 7.16  ? 1066 LEU A HB3  1 
ATOM   720  H HG   . LEU A 1 45  ? 28.952 -2.603  41.995 1.00 6.98  ? 1066 LEU A HG   1 
ATOM   721  H HD11 . LEU A 1 45  ? 26.934 -1.996  42.969 1.00 9.97  ? 1066 LEU A HD11 1 
ATOM   722  H HD12 . LEU A 1 45  ? 26.816 -1.915  41.403 1.00 9.97  ? 1066 LEU A HD12 1 
ATOM   723  H HD13 . LEU A 1 45  ? 26.199 -3.138  42.176 1.00 9.97  ? 1066 LEU A HD13 1 
ATOM   724  H HD21 . LEU A 1 45  ? 28.402 -3.601  44.038 1.00 8.31  ? 1066 LEU A HD21 1 
ATOM   725  H HD22 . LEU A 1 45  ? 27.717 -4.796  43.279 1.00 8.31  ? 1066 LEU A HD22 1 
ATOM   726  H HD23 . LEU A 1 45  ? 29.273 -4.592  43.183 1.00 8.31  ? 1066 LEU A HD23 1 
ATOM   727  N N    . VAL A 1 46  ? 31.450 -4.552  41.602 1.00 5.01  ? 1067 VAL A N    1 
ATOM   728  C CA   . VAL A 1 46  ? 32.411 -5.215  42.473 1.00 5.65  ? 1067 VAL A CA   1 
ATOM   729  C C    . VAL A 1 46  ? 32.423 -4.467  43.800 1.00 5.57  ? 1067 VAL A C    1 
ATOM   730  O O    . VAL A 1 46  ? 32.500 -3.238  43.788 1.00 6.16  ? 1067 VAL A O    1 
ATOM   731  C CB   . VAL A 1 46  ? 33.826 -5.179  41.862 1.00 5.94  ? 1067 VAL A CB   1 
ATOM   732  C CG1  . VAL A 1 46  ? 34.867 -5.817  42.774 1.00 7.62  ? 1067 VAL A CG1  1 
ATOM   733  C CG2  . VAL A 1 46  ? 33.818 -5.826  40.492 1.00 6.98  ? 1067 VAL A CG2  1 
ATOM   734  H H    . VAL A 1 46  ? 31.563 -3.701  41.567 1.00 6.01  ? 1067 VAL A H    1 
ATOM   735  H HA   . VAL A 1 46  ? 32.146 -6.146  42.627 1.00 6.77  ? 1067 VAL A HA   1 
ATOM   736  H HB   . VAL A 1 46  ? 34.083 -4.241  41.739 1.00 7.13  ? 1067 VAL A HB   1 
ATOM   737  H HG11 . VAL A 1 46  ? 35.727 -5.768  42.349 1.00 9.14  ? 1067 VAL A HG11 1 
ATOM   738  H HG12 . VAL A 1 46  ? 34.886 -5.340  43.607 1.00 9.14  ? 1067 VAL A HG12 1 
ATOM   739  H HG13 . VAL A 1 46  ? 34.628 -6.734  42.927 1.00 9.14  ? 1067 VAL A HG13 1 
ATOM   740  H HG21 . VAL A 1 46  ? 34.705 -5.795  40.126 1.00 8.38  ? 1067 VAL A HG21 1 
ATOM   741  H HG22 . VAL A 1 46  ? 33.531 -6.738  40.579 1.00 8.38  ? 1067 VAL A HG22 1 
ATOM   742  H HG23 . VAL A 1 46  ? 33.212 -5.345  39.923 1.00 8.38  ? 1067 VAL A HG23 1 
ATOM   743  N N    . GLN A 1 47  ? 32.313 -5.178  44.913 1.00 5.55  ? 1068 GLN A N    1 
ATOM   744  C CA   . GLN A 1 47  ? 32.533 -4.578  46.214 1.00 7.13  ? 1068 GLN A CA   1 
ATOM   745  C C    . GLN A 1 47  ? 33.965 -4.822  46.668 1.00 6.23  ? 1068 GLN A C    1 
ATOM   746  O O    . GLN A 1 47  ? 34.581 -5.826  46.295 1.00 7.88  ? 1068 GLN A O    1 
ATOM   747  C CB   . GLN A 1 47  ? 31.596 -5.131  47.285 1.00 7.66  ? 1068 GLN A CB   1 
ATOM   748  C CG   . GLN A 1 47  ? 30.173 -4.706  47.157 1.00 8.24  ? 1068 GLN A CG   1 
ATOM   749  C CD   . GLN A 1 47  ? 29.420 -5.002  48.455 1.00 8.69  ? 1068 GLN A CD   1 
ATOM   750  O OE1  . GLN A 1 47  ? 29.706 -4.433  49.523 1.00 8.97  ? 1068 GLN A OE1  1 
ATOM   751  N NE2  . GLN A 1 47  ? 28.478 -5.904  48.375 1.00 9.61  ? 1068 GLN A NE2  1 
ATOM   752  H H    . GLN A 1 47  ? 32.111 -6.013  44.940 1.00 6.66  ? 1068 GLN A H    1 
ATOM   753  H HA   . GLN A 1 47  ? 32.391 -3.610  46.151 1.00 8.56  ? 1068 GLN A HA   1 
ATOM   754  H HB2  . GLN A 1 47  ? 31.617 -6.100  47.242 1.00 9.19  ? 1068 GLN A HB2  1 
ATOM   755  H HB3  . GLN A 1 47  ? 31.912 -4.837  48.154 1.00 9.19  ? 1068 GLN A HB3  1 
ATOM   756  H HG2  . GLN A 1 47  ? 30.133 -3.751  46.988 1.00 9.89  ? 1068 GLN A HG2  1 
ATOM   757  H HG3  . GLN A 1 47  ? 29.750 -5.198  46.436 1.00 9.89  ? 1068 GLN A HG3  1 
ATOM   758  H HE21 . GLN A 1 47  ? 28.316 -6.290  47.623 1.00 11.53 ? 1068 GLN A HE21 1 
ATOM   759  H HE22 . GLN A 1 47  ? 28.021 -6.112  49.072 1.00 11.53 ? 1068 GLN A HE22 1 
ATOM   760  N N    . TYR A 1 48  ? 34.481 -3.958  47.517 1.00 7.17  ? 1069 TYR A N    1 
ATOM   761  C CA   . TYR A 1 48  ? 35.821 -4.181  48.033 1.00 7.50  ? 1069 TYR A CA   1 
ATOM   762  C C    . TYR A 1 48  ? 35.989 -3.600  49.428 1.00 8.22  ? 1069 TYR A C    1 
ATOM   763  O O    . TYR A 1 48  ? 35.337 -2.627  49.820 1.00 9.18  ? 1069 TYR A O    1 
ATOM   764  C CB   . TYR A 1 48  ? 36.893 -3.568  47.104 1.00 8.16  ? 1069 TYR A CB   1 
ATOM   765  C CG   . TYR A 1 48  ? 36.999 -2.063  47.161 1.00 7.24  ? 1069 TYR A CG   1 
ATOM   766  C CD1  . TYR A 1 48  ? 36.122 -1.265  46.454 1.00 7.26  ? 1069 TYR A CD1  1 
ATOM   767  C CD2  . TYR A 1 48  ? 37.971 -1.449  47.929 1.00 8.12  ? 1069 TYR A CD2  1 
ATOM   768  C CE1  . TYR A 1 48  ? 36.210 0.118   46.500 1.00 7.08  ? 1069 TYR A CE1  1 
ATOM   769  C CE2  . TYR A 1 48  ? 38.063 -0.068  47.999 1.00 8.03  ? 1069 TYR A CE2  1 
ATOM   770  C CZ   . TYR A 1 48  ? 37.204 0.709   47.257 1.00 8.16  ? 1069 TYR A CZ   1 
ATOM   771  O OH   . TYR A 1 48  ? 37.269 2.077   47.302 1.00 8.81  ? 1069 TYR A OH   1 
ATOM   772  H H    . TYR A 1 48  ? 34.091 -3.249  47.807 1.00 8.60  ? 1069 TYR A H    1 
ATOM   773  H HA   . TYR A 1 48  ? 35.984 -5.145  48.087 1.00 9.00  ? 1069 TYR A HA   1 
ATOM   774  H HB2  . TYR A 1 48  ? 37.758 -3.933  47.349 1.00 9.79  ? 1069 TYR A HB2  1 
ATOM   775  H HB3  . TYR A 1 48  ? 36.684 -3.813  46.189 1.00 9.79  ? 1069 TYR A HB3  1 
ATOM   776  H HD1  . TYR A 1 48  ? 35.465 -1.662  45.929 1.00 8.71  ? 1069 TYR A HD1  1 
ATOM   777  H HD2  . TYR A 1 48  ? 38.566 -1.971  48.418 1.00 9.75  ? 1069 TYR A HD2  1 
ATOM   778  H HE1  . TYR A 1 48  ? 35.619 0.643   46.010 1.00 8.50  ? 1069 TYR A HE1  1 
ATOM   779  H HE2  . TYR A 1 48  ? 38.731 0.331   48.509 1.00 9.64  ? 1069 TYR A HE2  1 
ATOM   780  H HH   . TYR A 1 48  ? 37.993 2.333   47.014 1.00 10.57 ? 1069 TYR A HH   1 
ATOM   781  N N    A SER A 1 49  ? 36.877 -4.274  50.152 0.77 8.44  ? 1070 SER A N    1 
ATOM   782  N N    B SER A 1 49  ? 36.871 -4.284  50.150 0.23 9.01  ? 1070 SER A N    1 
ATOM   783  C CA   A SER A 1 49  ? 37.457 -3.715  51.367 0.77 8.30  ? 1070 SER A CA   1 
ATOM   784  C CA   B SER A 1 49  ? 37.415 -3.755  51.394 0.23 11.18 ? 1070 SER A CA   1 
ATOM   785  C C    A SER A 1 49  ? 38.941 -4.048  51.460 0.77 10.12 ? 1070 SER A C    1 
ATOM   786  C C    B SER A 1 49  ? 38.911 -4.032  51.489 0.23 10.99 ? 1070 SER A C    1 
ATOM   787  O O    A SER A 1 49  ? 39.764 -3.463  50.756 0.77 11.38 ? 1070 SER A O    1 
ATOM   788  O O    B SER A 1 49  ? 39.710 -3.434  50.768 0.23 10.99 ? 1070 SER A O    1 
ATOM   789  C CB   A SER A 1 49  ? 36.725 -4.249  52.599 0.77 8.03  ? 1070 SER A CB   1 
ATOM   790  C CB   B SER A 1 49  ? 36.695 -4.372  52.594 0.23 14.14 ? 1070 SER A CB   1 
ATOM   791  O OG   A SER A 1 49  ? 36.784 -5.664  52.653 0.77 8.32  ? 1070 SER A OG   1 
ATOM   792  O OG   B SER A 1 49  ? 35.344 -3.948  52.650 0.23 17.60 ? 1070 SER A OG   1 
ATOM   793  H H    A SER A 1 49  ? 37.204 -5.037  49.929 0.77 10.13 ? 1070 SER A H    1 
ATOM   794  H H    B SER A 1 49  ? 37.217 -5.033  49.908 0.23 10.81 ? 1070 SER A H    1 
ATOM   795  H HA   A SER A 1 49  ? 37.361 -2.739  51.352 0.77 9.96  ? 1070 SER A HA   1 
ATOM   796  H HA   B SER A 1 49  ? 37.280 -2.785  51.420 0.23 13.42 ? 1070 SER A HA   1 
ATOM   797  H HB2  A SER A 1 49  ? 37.143 -3.886  53.396 0.77 9.64  ? 1070 SER A HB2  1 
ATOM   798  H HB2  B SER A 1 49  ? 36.719 -5.338  52.514 0.23 16.97 ? 1070 SER A HB2  1 
ATOM   799  H HB3  A SER A 1 49  ? 35.796 -3.974  52.558 0.77 9.64  ? 1070 SER A HB3  1 
ATOM   800  H HB3  B SER A 1 49  ? 37.145 -4.096  53.408 0.23 16.97 ? 1070 SER A HB3  1 
ATOM   801  H HG   A SER A 1 49  ? 36.252 -5.946  53.210 0.77 9.98  ? 1070 SER A HG   1 
ATOM   802  H HG   B SER A 1 49  ? 34.870 -4.558  52.926 0.23 21.12 ? 1070 SER A HG   1 
ATOM   803  N N    . ASP A 1 50  ? 39.278 -4.986  52.339 1.00 12.18 ? 1071 ASP A N    1 
ATOM   804  C CA   . ASP A 1 50  ? 40.644 -5.497  52.247 1.00 14.75 ? 1071 ASP A CA   1 
ATOM   805  C C    . ASP A 1 50  ? 40.726 -6.712  51.331 1.00 14.72 ? 1071 ASP A C    1 
ATOM   806  O O    . ASP A 1 50  ? 41.739 -7.402  51.285 1.00 18.73 ? 1071 ASP A O    1 
ATOM   807  C CB   . ASP A 1 50  ? 41.226 -5.800  53.619 1.00 18.84 ? 1071 ASP A CB   1 
ATOM   808  C CG   . ASP A 1 50  ? 40.447 -6.833  54.377 1.00 21.81 ? 1071 ASP A CG   1 
ATOM   809  O OD1  . ASP A 1 50  ? 39.341 -7.227  53.989 1.00 21.48 ? 1071 ASP A OD1  1 
ATOM   810  O OD2  . ASP A 1 50  ? 40.970 -7.251  55.424 1.00 26.67 ? 1071 ASP A OD2  1 
ATOM   811  H H    . ASP A 1 50  ? 38.798 -5.324  52.968 0.23 14.61 ? 1071 ASP A H    1 
ATOM   812  H HA   . ASP A 1 50  ? 41.203 -4.798  51.846 1.00 17.69 ? 1071 ASP A HA   1 
ATOM   813  H HB2  . ASP A 1 50  ? 42.132 -6.129  53.510 1.00 22.61 ? 1071 ASP A HB2  1 
ATOM   814  H HB3  . ASP A 1 50  ? 41.232 -4.985  54.145 1.00 22.61 ? 1071 ASP A HB3  1 
ATOM   815  N N    . ARG A 1 51  ? 39.638 -6.981  50.628 1.00 12.67 ? 1072 ARG A N    1 
ATOM   816  C CA   . ARG A 1 51  ? 39.532 -8.031  49.628 1.00 12.77 ? 1072 ARG A CA   1 
ATOM   817  C C    . ARG A 1 51  ? 38.491 -7.551  48.630 1.00 10.98 ? 1072 ARG A C    1 
ATOM   818  O O    . ARG A 1 51  ? 37.756 -6.603  48.905 1.00 10.21 ? 1072 ARG A O    1 
ATOM   819  C CB   . ARG A 1 51  ? 39.080 -9.335  50.293 1.00 15.99 ? 1072 ARG A CB   1 
ATOM   820  C CG   . ARG A 1 51  ? 37.722 -9.256  50.981 1.00 19.53 ? 1072 ARG A CG   1 
ATOM   821  C CD   . ARG A 1 51  ? 37.641 -10.173 52.191 1.00 26.55 ? 1072 ARG A CD   1 
ATOM   822  N NE   . ARG A 1 51  ? 36.306 -10.203 52.787 1.00 22.81 ? 1072 ARG A NE   1 
ATOM   823  C CZ   . ARG A 1 51  ? 35.927 -9.509  53.860 1.00 23.92 ? 1072 ARG A CZ   1 
ATOM   824  N NH1  . ARG A 1 51  ? 36.776 -8.703  54.493 1.00 22.95 ? 1072 ARG A NH1  1 
ATOM   825  N NH2  . ARG A 1 51  ? 34.684 -9.640  54.322 1.00 25.83 ? 1072 ARG A NH2  1 
ATOM   826  H H    . ARG A 1 51  ? 38.905 -6.541  50.720 1.00 15.21 ? 1072 ARG A H    1 
ATOM   827  H HA   . ARG A 1 51  ? 40.390 -8.168  49.174 1.00 15.32 ? 1072 ARG A HA   1 
ATOM   828  H HB2  . ARG A 1 51  ? 39.027 -10.027 49.615 1.00 19.19 ? 1072 ARG A HB2  1 
ATOM   829  H HB3  . ARG A 1 51  ? 39.735 -9.585  50.963 1.00 19.19 ? 1072 ARG A HB3  1 
ATOM   830  H HG2  . ARG A 1 51  ? 37.569 -8.346  51.281 1.00 23.43 ? 1072 ARG A HG2  1 
ATOM   831  H HG3  . ARG A 1 51  ? 37.031 -9.521  50.354 1.00 23.43 ? 1072 ARG A HG3  1 
ATOM   832  H HD2  . ARG A 1 51  ? 37.868 -11.076 51.919 1.00 31.86 ? 1072 ARG A HD2  1 
ATOM   833  H HD3  . ARG A 1 51  ? 38.264 -9.862  52.866 1.00 31.86 ? 1072 ARG A HD3  1 
ATOM   834  H HE   . ARG A 1 51  ? 35.719 -10.710 52.416 1.00 27.38 ? 1072 ARG A HE   1 
ATOM   835  H HH11 . ARG A 1 51  ? 37.582 -8.617  54.207 1.00 27.54 ? 1072 ARG A HH11 1 
ATOM   836  H HH12 . ARG A 1 51  ? 36.516 -8.262  55.184 1.00 27.54 ? 1072 ARG A HH12 1 
ATOM   837  H HH21 . ARG A 1 51  ? 34.128 -10.158 53.918 1.00 31.00 ? 1072 ARG A HH21 1 
ATOM   838  H HH22 . ARG A 1 51  ? 34.432 -9.191  55.010 1.00 31.00 ? 1072 ARG A HH22 1 
ATOM   839  N N    . THR A 1 52  ? 38.363 -8.231  47.508 1.00 11.44 ? 1073 THR A N    1 
ATOM   840  C CA   . THR A 1 52  ? 37.357 -7.871  46.519 1.00 11.24 ? 1073 THR A CA   1 
ATOM   841  C C    . THR A 1 52  ? 36.285 -8.956  46.444 1.00 11.29 ? 1073 THR A C    1 
ATOM   842  O O    . THR A 1 52  ? 36.525 -10.141 46.769 1.00 13.59 ? 1073 THR A O    1 
ATOM   843  C CB   . THR A 1 52  ? 37.987 -7.694  45.145 1.00 12.04 ? 1073 THR A CB   1 
ATOM   844  O OG1  . THR A 1 52  ? 38.784 -8.834  44.822 1.00 15.56 ? 1073 THR A OG1  1 
ATOM   845  C CG2  . THR A 1 52  ? 38.860 -6.448  45.093 1.00 14.25 ? 1073 THR A CG2  1 
ATOM   846  H H    . THR A 1 52  ? 38.846 -8.909  47.291 1.00 13.73 ? 1073 THR A H    1 
ATOM   847  H HA   . THR A 1 52  ? 36.931 -7.028  46.778 1.00 13.49 ? 1073 THR A HA   1 
ATOM   848  H HB   . THR A 1 52  ? 37.285 -7.599  44.483 1.00 14.45 ? 1073 THR A HB   1 
ATOM   849  H HG1  . THR A 1 52  ? 39.123 -8.738  44.081 1.00 18.67 ? 1073 THR A HG1  1 
ATOM   850  H HG21 . THR A 1 52  ? 39.247 -6.355  44.220 1.00 17.09 ? 1073 THR A HG21 1 
ATOM   851  H HG22 . THR A 1 52  ? 38.331 -5.670  45.285 1.00 17.09 ? 1073 THR A HG22 1 
ATOM   852  H HG23 . THR A 1 52  ? 39.565 -6.514  45.742 1.00 17.09 ? 1073 THR A HG23 1 
ATOM   853  N N    . ARG A 1 53  ? 35.098 -8.570  46.016 1.00 10.32 ? 1074 ARG A N    1 
ATOM   854  C CA   . ARG A 1 53  ? 34.055 -9.538  45.719 1.00 10.02 ? 1074 ARG A CA   1 
ATOM   855  C C    . ARG A 1 53  ? 33.272 -9.066  44.510 1.00 8.52  ? 1074 ARG A C    1 
ATOM   856  O O    . ARG A 1 53  ? 32.469 -8.158  44.621 1.00 7.69  ? 1074 ARG A O    1 
ATOM   857  C CB   . ARG A 1 53  ? 33.095 -9.734  46.903 1.00 10.31 ? 1074 ARG A CB   1 
ATOM   858  C CG   . ARG A 1 53  ? 32.099 -10.860 46.642 1.00 12.96 ? 1074 ARG A CG   1 
ATOM   859  C CD   . ARG A 1 53  ? 31.325 -11.241 47.892 1.00 13.36 ? 1074 ARG A CD   1 
ATOM   860  N NE   . ARG A 1 53  ? 30.337 -10.218 48.188 1.00 12.92 ? 1074 ARG A NE   1 
ATOM   861  C CZ   . ARG A 1 53  ? 29.707 -10.079 49.349 1.00 12.43 ? 1074 ARG A CZ   1 
ATOM   862  N NH1  . ARG A 1 53  ? 29.984 -10.869 50.380 1.00 14.25 ? 1074 ARG A NH1  1 
ATOM   863  N NH2  . ARG A 1 53  ? 28.801 -9.127  49.485 1.00 12.98 ? 1074 ARG A NH2  1 
ATOM   864  H H    . ARG A 1 53  ? 34.868 -7.752  45.887 1.00 12.38 ? 1074 ARG A H    1 
ATOM   865  H HA   . ARG A 1 53  ? 34.464 -10.403 45.505 1.00 12.02 ? 1074 ARG A HA   1 
ATOM   866  H HB2  . ARG A 1 53  ? 33.607 -9.959  47.696 1.00 12.37 ? 1074 ARG A HB2  1 
ATOM   867  H HB3  . ARG A 1 53  ? 32.595 -8.915  47.048 1.00 12.37 ? 1074 ARG A HB3  1 
ATOM   868  H HG2  . ARG A 1 53  ? 31.463 -10.573 45.968 1.00 15.55 ? 1074 ARG A HG2  1 
ATOM   869  H HG3  . ARG A 1 53  ? 32.580 -11.645 46.334 1.00 15.55 ? 1074 ARG A HG3  1 
ATOM   870  H HD2  . ARG A 1 53  ? 30.865 -12.082 47.747 1.00 16.03 ? 1074 ARG A HD2  1 
ATOM   871  H HD3  . ARG A 1 53  ? 31.934 -11.310 48.644 1.00 16.03 ? 1074 ARG A HD3  1 
ATOM   872  H HE   . ARG A 1 53  ? 30.146 -9.659  47.563 1.00 15.50 ? 1074 ARG A HE   1 
ATOM   873  H HH11 . ARG A 1 53  ? 30.567 -11.496 50.297 1.00 17.10 ? 1074 ARG A HH11 1 
ATOM   874  H HH12 . ARG A 1 53  ? 29.572 -10.761 51.127 1.00 17.10 ? 1074 ARG A HH12 1 
ATOM   875  H HH21 . ARG A 1 53  ? 28.624 -8.604  48.826 1.00 15.57 ? 1074 ARG A HH21 1 
ATOM   876  H HH22 . ARG A 1 53  ? 28.402 -9.018  50.239 1.00 15.57 ? 1074 ARG A HH22 1 
ATOM   877  N N    . PRO A 1 54  ? 33.522 -9.661  43.347 1.00 8.61  ? 1075 PRO A N    1 
ATOM   878  C CA   . PRO A 1 54  ? 32.652 -9.355  42.217 1.00 7.92  ? 1075 PRO A CA   1 
ATOM   879  C C    . PRO A 1 54  ? 31.223 -9.771  42.568 1.00 7.57  ? 1075 PRO A C    1 
ATOM   880  O O    . PRO A 1 54  ? 30.998 -10.879 43.065 1.00 10.52 ? 1075 PRO A O    1 
ATOM   881  C CB   . PRO A 1 54  ? 33.237 -10.205 41.081 1.00 10.10 ? 1075 PRO A CB   1 
ATOM   882  C CG   . PRO A 1 54  ? 34.607 -10.523 41.507 1.00 12.07 ? 1075 PRO A CG   1 
ATOM   883  C CD   . PRO A 1 54  ? 34.573 -10.626 42.994 1.00 10.46 ? 1075 PRO A CD   1 
ATOM   884  H HA   . PRO A 1 54  ? 32.687 -8.403  41.986 1.00 9.51  ? 1075 PRO A HA   1 
ATOM   885  H HB2  . PRO A 1 54  ? 32.714 -11.014 40.975 1.00 12.12 ? 1075 PRO A HB2  1 
ATOM   886  H HB3  . PRO A 1 54  ? 33.245 -9.690  40.258 1.00 12.12 ? 1075 PRO A HB3  1 
ATOM   887  H HG2  . PRO A 1 54  ? 34.879 -11.367 41.115 1.00 14.48 ? 1075 PRO A HG2  1 
ATOM   888  H HG3  . PRO A 1 54  ? 35.205 -9.811  41.230 1.00 14.48 ? 1075 PRO A HG3  1 
ATOM   889  H HD2  . PRO A 1 54  ? 34.320 -11.521 43.268 1.00 12.55 ? 1075 PRO A HD2  1 
ATOM   890  H HD3  . PRO A 1 54  ? 35.424 -10.359 43.374 1.00 12.55 ? 1075 PRO A HD3  1 
ATOM   891  N N    . GLU A 1 55  ? 30.267 -8.903  42.302 1.00 6.97  ? 1076 GLU A N    1 
ATOM   892  C CA   . GLU A 1 55  ? 28.863 -9.193  42.519 1.00 7.26  ? 1076 GLU A CA   1 
ATOM   893  C C    . GLU A 1 55  ? 28.188 -9.645  41.235 1.00 7.51  ? 1076 GLU A C    1 
ATOM   894  O O    . GLU A 1 55  ? 27.401 -10.584 41.250 1.00 10.82 ? 1076 GLU A O    1 
ATOM   895  C CB   . GLU A 1 55  ? 28.157 -7.981  43.101 1.00 7.50  ? 1076 GLU A CB   1 
ATOM   896  C CG   . GLU A 1 55  ? 28.721 -7.572  44.465 1.00 8.33  ? 1076 GLU A CG   1 
ATOM   897  C CD   . GLU A 1 55  ? 28.295 -8.490  45.597 1.00 11.53 ? 1076 GLU A CD   1 
ATOM   898  O OE1  . GLU A 1 55  ? 27.693 -9.561  45.351 1.00 16.26 ? 1076 GLU A OE1  1 
ATOM   899  O OE2  . GLU A 1 55  ? 28.543 -8.138  46.749 1.00 14.09 ? 1076 GLU A OE2  1 
ATOM   900  H H    . GLU A 1 55  ? 30.409 -8.116  41.985 1.00 8.37  ? 1076 GLU A H    1 
ATOM   901  H HA   . GLU A 1 55  ? 28.789 -9.922  43.168 1.00 8.71  ? 1076 GLU A HA   1 
ATOM   902  H HB2  . GLU A 1 55  ? 28.263 -7.231  42.495 1.00 9.01  ? 1076 GLU A HB2  1 
ATOM   903  H HB3  . GLU A 1 55  ? 27.216 -8.186  43.214 1.00 9.01  ? 1076 GLU A HB3  1 
ATOM   904  H HG2  . GLU A 1 55  ? 29.690 -7.585  44.420 1.00 10.00 ? 1076 GLU A HG2  1 
ATOM   905  H HG3  . GLU A 1 55  ? 28.412 -6.677  44.676 1.00 10.00 ? 1076 GLU A HG3  1 
ATOM   906  N N    . PHE A 1 56  ? 28.508 -8.985  40.119 1.00 6.37  ? 1077 PHE A N    1 
ATOM   907  C CA   . PHE A 1 56  ? 28.086 -9.432  38.803 1.00 6.53  ? 1077 PHE A CA   1 
ATOM   908  C C    . PHE A 1 56  ? 29.044 -8.833  37.790 1.00 6.23  ? 1077 PHE A C    1 
ATOM   909  O O    . PHE A 1 56  ? 29.692 -7.808  38.060 1.00 6.24  ? 1077 PHE A O    1 
ATOM   910  C CB   . PHE A 1 56  ? 26.596 -9.154  38.495 1.00 7.20  ? 1077 PHE A CB   1 
ATOM   911  C CG   . PHE A 1 56  ? 26.156 -7.723  38.657 1.00 7.01  ? 1077 PHE A CG   1 
ATOM   912  C CD1  . PHE A 1 56  ? 26.215 -6.860  37.592 1.00 7.11  ? 1077 PHE A CD1  1 
ATOM   913  C CD2  . PHE A 1 56  ? 25.615 -7.270  39.852 1.00 6.74  ? 1077 PHE A CD2  1 
ATOM   914  C CE1  . PHE A 1 56  ? 25.772 -5.549  37.720 1.00 7.12  ? 1077 PHE A CE1  1 
ATOM   915  C CE2  . PHE A 1 56  ? 25.165 -5.963  39.986 1.00 7.35  ? 1077 PHE A CE2  1 
ATOM   916  C CZ   . PHE A 1 56  ? 25.243 -5.095  38.932 1.00 6.90  ? 1077 PHE A CZ   1 
ATOM   917  H H    . PHE A 1 56  ? 28.977 -8.265  40.105 1.00 7.64  ? 1077 PHE A H    1 
ATOM   918  H HA   . PHE A 1 56  ? 28.204 -10.404 38.765 1.00 7.83  ? 1077 PHE A HA   1 
ATOM   919  H HB2  . PHE A 1 56  ? 26.420 -9.410  37.576 1.00 8.65  ? 1077 PHE A HB2  1 
ATOM   920  H HB3  . PHE A 1 56  ? 26.053 -9.694  39.090 1.00 8.65  ? 1077 PHE A HB3  1 
ATOM   921  H HD1  . PHE A 1 56  ? 26.563 -7.151  36.780 1.00 8.54  ? 1077 PHE A HD1  1 
ATOM   922  H HD2  . PHE A 1 56  ? 25.554 -7.851  40.576 1.00 8.09  ? 1077 PHE A HD2  1 
ATOM   923  H HE1  . PHE A 1 56  ? 25.830 -4.969  36.996 1.00 8.54  ? 1077 PHE A HE1  1 
ATOM   924  H HE2  . PHE A 1 56  ? 24.820 -5.674  40.799 1.00 8.81  ? 1077 PHE A HE2  1 
ATOM   925  H HZ   . PHE A 1 56  ? 24.952 -4.216  39.022 1.00 8.28  ? 1077 PHE A HZ   1 
ATOM   926  N N    . TYR A 1 57  ? 29.130 -9.474  36.623 1.00 6.00  ? 1078 TYR A N    1 
ATOM   927  C CA   . TYR A 1 57  ? 30.102 -9.140  35.600 1.00 6.61  ? 1078 TYR A CA   1 
ATOM   928  C C    . TYR A 1 57  ? 29.401 -8.480  34.416 1.00 6.21  ? 1078 TYR A C    1 
ATOM   929  O O    . TYR A 1 57  ? 28.176 -8.482  34.317 1.00 6.64  ? 1078 TYR A O    1 
ATOM   930  C CB   . TYR A 1 57  ? 30.777 -10.440 35.134 1.00 7.20  ? 1078 TYR A CB   1 
ATOM   931  C CG   . TYR A 1 57  ? 31.521 -11.145 36.242 1.00 8.01  ? 1078 TYR A CG   1 
ATOM   932  C CD1  . TYR A 1 57  ? 32.822 -10.836 36.529 1.00 7.99  ? 1078 TYR A CD1  1 
ATOM   933  C CD2  . TYR A 1 57  ? 30.892 -12.088 37.039 1.00 9.02  ? 1078 TYR A CD2  1 
ATOM   934  C CE1  . TYR A 1 57  ? 33.513 -11.477 37.535 1.00 9.25  ? 1078 TYR A CE1  1 
ATOM   935  C CE2  . TYR A 1 57  ? 31.566 -12.730 38.076 1.00 11.68 ? 1078 TYR A CE2  1 
ATOM   936  C CZ   . TYR A 1 57  ? 32.883 -12.416 38.308 1.00 10.23 ? 1078 TYR A CZ   1 
ATOM   937  O OH   . TYR A 1 57  ? 33.591 -13.035 39.329 1.00 12.49 ? 1078 TYR A OH   1 
ATOM   938  H H    . TYR A 1 57  ? 28.616 -10.127 36.402 1.00 7.20  ? 1078 TYR A H    1 
ATOM   939  H HA   . TYR A 1 57  ? 30.781 -8.531  35.958 1.00 7.93  ? 1078 TYR A HA   1 
ATOM   940  H HB2  . TYR A 1 57  ? 30.098 -11.045 34.797 1.00 8.64  ? 1078 TYR A HB2  1 
ATOM   941  H HB3  . TYR A 1 57  ? 31.412 -10.231 34.432 1.00 8.64  ? 1078 TYR A HB3  1 
ATOM   942  H HD1  . TYR A 1 57  ? 33.264 -10.208 36.005 1.00 9.59  ? 1078 TYR A HD1  1 
ATOM   943  H HD2  . TYR A 1 57  ? 30.003 -12.305 36.873 1.00 10.82 ? 1078 TYR A HD2  1 
ATOM   944  H HE1  . TYR A 1 57  ? 34.401 -11.256 37.703 1.00 11.10 ? 1078 TYR A HE1  1 
ATOM   945  H HE2  . TYR A 1 57  ? 31.136 -13.372 38.593 1.00 14.02 ? 1078 TYR A HE2  1 
ATOM   946  H HH   . TYR A 1 57  ? 33.615 -13.844 39.203 1.00 14.99 ? 1078 TYR A HH   1 
ATOM   947  N N    . LEU A 1 58  ? 30.192 -7.940  33.487 1.00 5.92  ? 1079 LEU A N    1 
ATOM   948  C CA   . LEU A 1 58  ? 29.649 -7.265  32.321 1.00 6.00  ? 1079 LEU A CA   1 
ATOM   949  C C    . LEU A 1 58  ? 28.760 -8.180  31.493 1.00 7.16  ? 1079 LEU A C    1 
ATOM   950  O O    . LEU A 1 58  ? 27.863 -7.684  30.808 1.00 8.24  ? 1079 LEU A O    1 
ATOM   951  C CB   . LEU A 1 58  ? 30.775 -6.664  31.498 1.00 6.67  ? 1079 LEU A CB   1 
ATOM   952  C CG   . LEU A 1 58  ? 31.452 -5.474  32.169 1.00 5.65  ? 1079 LEU A CG   1 
ATOM   953  C CD1  . LEU A 1 58  ? 32.783 -5.187  31.496 1.00 6.88  ? 1079 LEU A CD1  1 
ATOM   954  C CD2  . LEU A 1 58  ? 30.566 -4.235  32.141 1.00 5.89  ? 1079 LEU A CD2  1 
ATOM   955  H H    . LEU A 1 58  ? 31.052 -7.954  33.514 1.00 7.10  ? 1079 LEU A H    1 
ATOM   956  H HA   . LEU A 1 58  ? 29.090 -6.522  32.631 1.00 7.20  ? 1079 LEU A HA   1 
ATOM   957  H HB2  . LEU A 1 58  ? 31.451 -7.343  31.347 1.00 8.00  ? 1079 LEU A HB2  1 
ATOM   958  H HB3  . LEU A 1 58  ? 30.416 -6.361  30.649 1.00 8.00  ? 1079 LEU A HB3  1 
ATOM   959  H HG   . LEU A 1 58  ? 31.628 -5.694  33.097 1.00 6.78  ? 1079 LEU A HG   1 
ATOM   960  H HD11 . LEU A 1 58  ? 33.196 -4.436  31.929 1.00 8.25  ? 1079 LEU A HD11 1 
ATOM   961  H HD12 . LEU A 1 58  ? 33.345 -5.961  31.574 1.00 8.25  ? 1079 LEU A HD12 1 
ATOM   962  H HD13 . LEU A 1 58  ? 32.627 -4.986  30.570 1.00 8.25  ? 1079 LEU A HD13 1 
ATOM   963  H HD21 . LEU A 1 58  ? 31.027 -3.512  32.572 1.00 7.07  ? 1079 LEU A HD21 1 
ATOM   964  H HD22 . LEU A 1 58  ? 30.378 -4.006  31.228 1.00 7.07  ? 1079 LEU A HD22 1 
ATOM   965  H HD23 . LEU A 1 58  ? 29.748 -4.426  32.606 1.00 7.07  ? 1079 LEU A HD23 1 
ATOM   966  N N    . ASN A 1 59  ? 29.026 -9.493  31.503 1.00 7.49  ? 1080 ASN A N    1 
ATOM   967  C CA   . ASN A 1 59  ? 28.205 -10.468 30.781 1.00 8.52  ? 1080 ASN A CA   1 
ATOM   968  C C    . ASN A 1 59  ? 27.113 -11.122 31.630 1.00 8.11  ? 1080 ASN A C    1 
ATOM   969  O O    . ASN A 1 59  ? 26.449 -12.045 31.141 1.00 9.65  ? 1080 ASN A O    1 
ATOM   970  C CB   . ASN A 1 59  ? 29.103 -11.544 30.115 1.00 9.19  ? 1080 ASN A CB   1 
ATOM   971  C CG   . ASN A 1 59  ? 29.888 -12.361 31.107 1.00 10.47 ? 1080 ASN A CG   1 
ATOM   972  O OD1  . ASN A 1 59  ? 29.664 -12.292 32.309 1.00 11.25 ? 1080 ASN A OD1  1 
ATOM   973  N ND2  . ASN A 1 59  ? 30.832 -13.167 30.591 1.00 13.61 ? 1080 ASN A ND2  1 
ATOM   974  H H    . ASN A 1 59  ? 29.685 -9.846  31.928 1.00 8.99  ? 1080 ASN A H    1 
ATOM   975  H HA   . ASN A 1 59  ? 27.749 -9.992  30.055 1.00 10.23 ? 1080 ASN A HA   1 
ATOM   976  H HB2  . ASN A 1 59  ? 28.542 -12.150 29.606 1.00 11.03 ? 1080 ASN A HB2  1 
ATOM   977  H HB3  . ASN A 1 59  ? 29.735 -11.104 29.524 1.00 11.03 ? 1080 ASN A HB3  1 
ATOM   978  H HD21 . ASN A 1 59  ? 30.957 -13.193 29.741 1.00 16.33 ? 1080 ASN A HD21 1 
ATOM   979  H HD22 . ASN A 1 59  ? 31.310 -13.656 31.112 1.00 16.33 ? 1080 ASN A HD22 1 
ATOM   980  N N    . SER A 1 60  ? 26.855 -10.642 32.840 1.00 8.44  ? 1081 SER A N    1 
ATOM   981  C CA   . SER A 1 60  ? 25.897 -11.343 33.701 1.00 8.45  ? 1081 SER A CA   1 
ATOM   982  C C    . SER A 1 60  ? 24.436 -11.146 33.314 1.00 7.49  ? 1081 SER A C    1 
ATOM   983  O O    . SER A 1 60  ? 23.685 -12.119 33.306 1.00 8.75  ? 1081 SER A O    1 
ATOM   984  C CB   . SER A 1 60  ? 26.086 -10.913 35.154 1.00 8.09  ? 1081 SER A CB   1 
ATOM   985  O OG   . SER A 1 60  ? 27.311 -11.381 35.661 1.00 8.46  ? 1081 SER A OG   1 
ATOM   986  H H    . SER A 1 60  ? 27.207 -9.936  33.182 1.00 10.12 ? 1081 SER A H    1 
ATOM   987  H HA   . SER A 1 60  ? 26.085 -12.303 33.652 1.00 10.14 ? 1081 SER A HA   1 
ATOM   988  H HB2  . SER A 1 60  ? 26.075 -9.944  35.201 1.00 9.71  ? 1081 SER A HB2  1 
ATOM   989  H HB3  . SER A 1 60  ? 25.364 -11.279 35.688 1.00 9.71  ? 1081 SER A HB3  1 
ATOM   990  H HG   . SER A 1 60  ? 27.401 -11.145 36.441 1.00 10.16 ? 1081 SER A HG   1 
ATOM   991  N N    . HIS A 1 61  ? 24.036 -9.903  33.048 1.00 8.16  ? 1082 HIS A N    1 
ATOM   992  C CA   . HIS A 1 61  ? 22.649 -9.547  32.790 1.00 8.70  ? 1082 HIS A CA   1 
ATOM   993  C C    . HIS A 1 61  ? 22.490 -8.934  31.435 1.00 9.38  ? 1082 HIS A C    1 
ATOM   994  O O    . HIS A 1 61  ? 23.428 -8.336  30.918 1.00 11.35 ? 1082 HIS A O    1 
ATOM   995  C CB   . HIS A 1 61  ? 22.139 -8.552  33.820 1.00 10.27 ? 1082 HIS A CB   1 
ATOM   996  C CG   . HIS A 1 61  ? 22.337 -9.027  35.198 1.00 9.45  ? 1082 HIS A CG   1 
ATOM   997  N ND1  . HIS A 1 61  ? 21.614 -10.061 35.758 1.00 12.69 ? 1082 HIS A ND1  1 
ATOM   998  C CD2  . HIS A 1 61  ? 23.235 -8.633  36.118 1.00 10.66 ? 1082 HIS A CD2  1 
ATOM   999  C CE1  . HIS A 1 61  ? 22.086 -10.273 36.977 1.00 13.32 ? 1082 HIS A CE1  1 
ATOM   1000 N NE2  . HIS A 1 61  ? 23.066 -9.425  37.207 1.00 15.63 ? 1082 HIS A NE2  1 
ATOM   1001 H H    . HIS A 1 61  ? 24.571 -9.231  33.012 1.00 9.79  ? 1082 HIS A H    1 
ATOM   1002 H HA   . HIS A 1 61  ? 22.092 -10.352 32.834 1.00 10.44 ? 1082 HIS A HA   1 
ATOM   1003 H HB2  . HIS A 1 61  ? 22.618 -7.715  33.718 1.00 12.32 ? 1082 HIS A HB2  1 
ATOM   1004 H HB3  . HIS A 1 61  ? 21.189 -8.411  33.683 1.00 12.32 ? 1082 HIS A HB3  1 
ATOM   1005 H HD1  . HIS A 1 61  ? 20.983 -10.502 35.375 1.00 15.23 ? 1082 HIS A HD1  1 
ATOM   1006 H HD2  . HIS A 1 61  ? 23.872 -7.962  36.016 1.00 12.79 ? 1082 HIS A HD2  1 
ATOM   1007 H HE1  . HIS A 1 61  ? 21.765 -10.906 37.578 1.00 15.98 ? 1082 HIS A HE1  1 
ATOM   1008 H HE2  . HIS A 1 61  ? 23.508 -9.362  37.942 1.00 18.75 ? 1082 HIS A HE2  1 
ATOM   1009 N N    . MET A 1 62  ? 21.278 -9.007  30.905 1.00 9.58  ? 1083 MET A N    1 
ATOM   1010 C CA   . MET A 1 62  ? 21.020 -8.551  29.563 1.00 9.73  ? 1083 MET A CA   1 
ATOM   1011 C C    . MET A 1 62  ? 19.948 -7.464  29.501 1.00 9.63  ? 1083 MET A C    1 
ATOM   1012 O O    . MET A 1 62  ? 19.605 -7.007  28.429 1.00 9.63  ? 1083 MET A O    1 
ATOM   1013 C CB   . MET A 1 62  ? 20.718 -9.737  28.631 1.00 12.49 ? 1083 MET A CB   1 
ATOM   1014 C CG   . MET A 1 62  ? 19.727 -10.734 29.180 1.00 14.58 ? 1083 MET A CG   1 
ATOM   1015 S SD   . MET A 1 62  ? 18.090 -10.068 29.487 1.00 17.55 ? 1083 MET A SD   1 
ATOM   1016 C CE   . MET A 1 62  ? 17.542 -9.673  27.826 1.00 21.70 ? 1083 MET A CE   1 
ATOM   1017 H H    . MET A 1 62  ? 20.587 -9.321  31.309 1.00 11.50 ? 1083 MET A H    1 
ATOM   1018 H HA   . MET A 1 62  ? 21.851 -8.151  29.231 1.00 11.68 ? 1083 MET A HA   1 
ATOM   1019 H HB2  . MET A 1 62  ? 20.357 -9.392  27.799 1.00 14.98 ? 1083 MET A HB2  1 
ATOM   1020 H HB3  . MET A 1 62  ? 21.545 -10.211 28.456 1.00 14.98 ? 1083 MET A HB3  1 
ATOM   1021 H HG2  . MET A 1 62  ? 19.634 -11.460 28.543 1.00 17.50 ? 1083 MET A HG2  1 
ATOM   1022 H HG3  . MET A 1 62  ? 20.067 -11.078 30.020 1.00 17.50 ? 1083 MET A HG3  1 
ATOM   1023 H HE1  . MET A 1 62  ? 16.658 -9.301  27.868 1.00 26.03 ? 1083 MET A HE1  1 
ATOM   1024 H HE2  . MET A 1 62  ? 18.148 -9.035  27.441 1.00 26.03 ? 1083 MET A HE2  1 
ATOM   1025 H HE3  . MET A 1 62  ? 17.535 -10.477 27.300 1.00 26.03 ? 1083 MET A HE3  1 
ATOM   1026 N N    . ASP A 1 63  ? 19.444 -7.022  30.648 1.00 9.26  ? 1084 ASP A N    1 
ATOM   1027 C CA   . ASP A 1 63  ? 18.487 -5.942  30.647 1.00 8.74  ? 1084 ASP A CA   1 
ATOM   1028 C C    . ASP A 1 63  ? 18.455 -5.219  31.986 1.00 8.31  ? 1084 ASP A C    1 
ATOM   1029 O O    . ASP A 1 63  ? 19.093 -5.632  32.966 1.00 7.85  ? 1084 ASP A O    1 
ATOM   1030 C CB   . ASP A 1 63  ? 17.084 -6.402  30.179 1.00 9.16  ? 1084 ASP A CB   1 
ATOM   1031 C CG   . ASP A 1 63  ? 16.380 -7.355  31.136 1.00 9.18  ? 1084 ASP A CG   1 
ATOM   1032 O OD1  . ASP A 1 63  ? 16.840 -7.548  32.281 1.00 9.24  ? 1084 ASP A OD1  1 
ATOM   1033 O OD2  . ASP A 1 63  ? 15.329 -7.913  30.729 1.00 11.24 ? 1084 ASP A OD2  1 
ATOM   1034 H H    . ASP A 1 63  ? 19.640 -7.330  31.426 1.00 11.12 ? 1084 ASP A H    1 
ATOM   1035 H HA   . ASP A 1 63  ? 18.793 -5.284  29.989 1.00 10.49 ? 1084 ASP A HA   1 
ATOM   1036 H HB2  . ASP A 1 63  ? 16.520 -5.620  30.075 1.00 10.99 ? 1084 ASP A HB2  1 
ATOM   1037 H HB3  . ASP A 1 63  ? 17.175 -6.855  29.326 1.00 10.99 ? 1084 ASP A HB3  1 
ATOM   1038 N N    A GLN A 1 64  ? 17.731 -4.113  32.025 0.28 8.37  ? 1085 GLN A N    1 
ATOM   1039 N N    B GLN A 1 64  ? 17.747 -4.102  31.994 0.72 8.65  ? 1085 GLN A N    1 
ATOM   1040 C CA   A GLN A 1 64  ? 17.701 -3.303  33.219 0.28 8.00  ? 1085 GLN A CA   1 
ATOM   1041 C CA   B GLN A 1 64  ? 17.624 -3.252  33.149 0.72 10.21 ? 1085 GLN A CA   1 
ATOM   1042 C C    A GLN A 1 64  ? 17.151 -4.085  34.399 0.28 7.80  ? 1085 GLN A C    1 
ATOM   1043 C C    B GLN A 1 64  ? 17.113 -4.030  34.369 0.72 8.71  ? 1085 GLN A C    1 
ATOM   1044 O O    A GLN A 1 64  ? 17.699 -4.015  35.496 0.28 5.59  ? 1085 GLN A O    1 
ATOM   1045 O O    B GLN A 1 64  ? 17.673 -3.913  35.462 0.72 9.24  ? 1085 GLN A O    1 
ATOM   1046 C CB   A GLN A 1 64  ? 16.861 -2.061  32.991 0.28 7.18  ? 1085 GLN A CB   1 
ATOM   1047 C CB   B GLN A 1 64  ? 16.686 -2.109  32.750 0.72 14.22 ? 1085 GLN A CB   1 
ATOM   1048 C CG   A GLN A 1 64  ? 16.940 -1.092  34.126 0.28 6.83  ? 1085 GLN A CG   1 
ATOM   1049 C CG   B GLN A 1 64  ? 16.413 -1.076  33.764 0.72 16.67 ? 1085 GLN A CG   1 
ATOM   1050 C CD   A GLN A 1 64  ? 16.189 0.195   33.837 0.28 8.62  ? 1085 GLN A CD   1 
ATOM   1051 C CD   B GLN A 1 64  ? 17.487 -0.006  33.926 0.72 13.21 ? 1085 GLN A CD   1 
ATOM   1052 O OE1  A GLN A 1 64  ? 16.497 0.927   32.880 0.28 8.95  ? 1085 GLN A OE1  1 
ATOM   1053 O OE1  B GLN A 1 64  ? 17.588 0.493   35.007 0.72 15.37 ? 1085 GLN A OE1  1 
ATOM   1054 N NE2  A GLN A 1 64  ? 15.183 0.472   34.651 0.28 12.04 ? 1085 GLN A NE2  1 
ATOM   1055 N NE2  B GLN A 1 64  ? 18.271 0.359   32.861 0.72 12.49 ? 1085 GLN A NE2  1 
ATOM   1056 H H    A GLN A 1 64  ? 17.252 -3.814  31.376 0.28 10.04 ? 1085 GLN A H    1 
ATOM   1057 H H    B GLN A 1 64  ? 17.314 -3.811  31.311 0.72 10.37 ? 1085 GLN A H    1 
ATOM   1058 H HA   A GLN A 1 64  ? 18.613 -3.020  33.439 0.28 9.60  ? 1085 GLN A HA   1 
ATOM   1059 H HA   B GLN A 1 64  ? 18.500 -2.872  33.369 0.72 12.26 ? 1085 GLN A HA   1 
ATOM   1060 H HB2  A GLN A 1 64  ? 17.174 -1.611  32.190 0.28 8.61  ? 1085 GLN A HB2  1 
ATOM   1061 H HB2  B GLN A 1 64  ? 17.071 -1.659  31.982 0.72 17.06 ? 1085 GLN A HB2  1 
ATOM   1062 H HB3  A GLN A 1 64  ? 15.933 -2.322  32.883 0.28 8.61  ? 1085 GLN A HB3  1 
ATOM   1063 H HB3  B GLN A 1 64  ? 15.832 -2.495  32.499 0.72 17.06 ? 1085 GLN A HB3  1 
ATOM   1064 H HG2  A GLN A 1 64  ? 16.551 -1.497  34.917 0.28 8.20  ? 1085 GLN A HG2  1 
ATOM   1065 H HG2  B GLN A 1 64  ? 15.587 -0.625  33.526 0.72 20.00 ? 1085 GLN A HG2  1 
ATOM   1066 H HG3  A GLN A 1 64  ? 17.870 -0.868  34.289 0.28 8.20  ? 1085 GLN A HG3  1 
ATOM   1067 H HG3  B GLN A 1 64  ? 16.306 -1.513  34.624 0.72 20.00 ? 1085 GLN A HG3  1 
ATOM   1068 H HE21 A GLN A 1 64  ? 14.721 1.188   34.536 0.28 14.45 ? 1085 GLN A HE21 1 
ATOM   1069 H HE21 B GLN A 1 64  ? 18.875 0.963   32.958 0.72 14.99 ? 1085 GLN A HE21 1 
ATOM   1070 H HE22 A GLN A 1 64  ? 14.992 -0.063  35.296 0.28 14.45 ? 1085 GLN A HE22 1 
ATOM   1071 H HE22 B GLN A 1 64  ? 18.158 -0.017  32.095 0.72 14.99 ? 1085 GLN A HE22 1 
ATOM   1072 N N    . GLN A 1 65  ? 16.083 -4.844  34.190 1.00 8.05  ? 1086 GLN A N    1 
ATOM   1073 C CA   . GLN A 1 65  ? 15.501 -5.571  35.313 1.00 8.49  ? 1086 GLN A CA   1 
ATOM   1074 C C    . GLN A 1 65  ? 16.534 -6.455  35.986 1.00 7.42  ? 1086 GLN A C    1 
ATOM   1075 O O    . GLN A 1 65  ? 16.609 -6.540  37.221 1.00 8.16  ? 1086 GLN A O    1 
ATOM   1076 C CB   . GLN A 1 65  ? 14.322 -6.418  34.862 1.00 9.57  ? 1086 GLN A CB   1 
ATOM   1077 C CG   . GLN A 1 65  ? 13.700 -7.204  36.027 1.00 11.01 ? 1086 GLN A CG   1 
ATOM   1078 C CD   . GLN A 1 65  ? 12.475 -8.030  35.636 1.00 12.82 ? 1086 GLN A CD   1 
ATOM   1079 O OE1  . GLN A 1 65  ? 12.135 -8.158  34.461 1.00 14.78 ? 1086 GLN A OE1  1 
ATOM   1080 N NE2  . GLN A 1 65  ? 11.812 -8.618  36.630 1.00 14.74 ? 1086 GLN A NE2  1 
ATOM   1081 H H    . GLN A 1 65  ? 15.698 -4.972  33.432 0.28 9.66  ? 1086 GLN A H    1 
ATOM   1082 H HA   . GLN A 1 65  ? 15.175 -4.927  35.975 1.00 10.19 ? 1086 GLN A HA   1 
ATOM   1083 H HB2  . GLN A 1 65  ? 13.638 -5.839  34.489 1.00 11.48 ? 1086 GLN A HB2  1 
ATOM   1084 H HB3  . GLN A 1 65  ? 14.623 -7.053  34.194 1.00 11.48 ? 1086 GLN A HB3  1 
ATOM   1085 H HG2  . GLN A 1 65  ? 14.366 -7.814  36.382 1.00 13.21 ? 1086 GLN A HG2  1 
ATOM   1086 H HG3  . GLN A 1 65  ? 13.428 -6.578  36.716 1.00 13.21 ? 1086 GLN A HG3  1 
ATOM   1087 H HE21 . GLN A 1 65  ? 12.081 -8.523  37.442 1.00 17.69 ? 1086 GLN A HE21 1 
ATOM   1088 H HE22 . GLN A 1 65  ? 11.116 -9.094  36.461 1.00 17.69 ? 1086 GLN A HE22 1 
ATOM   1089 N N    . GLY A 1 66  ? 17.326 -7.153  35.180 1.00 7.18  ? 1087 GLY A N    1 
ATOM   1090 C CA   . GLY A 1 66  ? 18.331 -8.050  35.734 1.00 7.46  ? 1087 GLY A CA   1 
ATOM   1091 C C    . GLY A 1 66  ? 19.361 -7.312  36.589 1.00 6.97  ? 1087 GLY A C    1 
ATOM   1092 O O    . GLY A 1 66  ? 19.726 -7.724  37.699 1.00 6.99  ? 1087 GLY A O    1 
ATOM   1093 H H    . GLY A 1 66  ? 17.303 -7.127  34.321 1.00 8.62  ? 1087 GLY A H    1 
ATOM   1094 H HA2  . GLY A 1 66  ? 17.898 -8.720  36.286 1.00 8.95  ? 1087 GLY A HA2  1 
ATOM   1095 H HA3  . GLY A 1 66  ? 18.797 -8.500  35.012 1.00 8.95  ? 1087 GLY A HA3  1 
ATOM   1096 N N    . VAL A 1 67  ? 19.847 -6.192  36.066 1.00 6.29  ? 1088 VAL A N    1 
ATOM   1097 C CA   . VAL A 1 67  ? 20.853 -5.412  36.764 1.00 5.96  ? 1088 VAL A CA   1 
ATOM   1098 C C    . VAL A 1 67  ? 20.262 -4.814  38.054 1.00 5.84  ? 1088 VAL A C    1 
ATOM   1099 O O    . VAL A 1 67  ? 20.883 -4.877  39.101 1.00 6.67  ? 1088 VAL A O    1 
ATOM   1100 C CB   . VAL A 1 67  ? 21.434 -4.337  35.850 1.00 6.18  ? 1088 VAL A CB   1 
ATOM   1101 C CG1  . VAL A 1 67  ? 22.435 -3.484  36.624 1.00 6.16  ? 1088 VAL A CG1  1 
ATOM   1102 C CG2  . VAL A 1 67  ? 22.135 -4.944  34.636 1.00 7.55  ? 1088 VAL A CG2  1 
ATOM   1103 H H    . VAL A 1 67  ? 19.609 -5.864  35.308 1.00 7.55  ? 1088 VAL A H    1 
ATOM   1104 H HA   . VAL A 1 67  ? 21.586 -6.008  37.023 1.00 7.15  ? 1088 VAL A HA   1 
ATOM   1105 H HB   . VAL A 1 67  ? 20.713 -3.755  35.531 1.00 7.42  ? 1088 VAL A HB   1 
ATOM   1106 H HG11 . VAL A 1 67  ? 22.793 -2.814  36.037 1.00 7.39  ? 1088 VAL A HG11 1 
ATOM   1107 H HG12 . VAL A 1 67  ? 21.985 -3.068  37.362 1.00 7.39  ? 1088 VAL A HG12 1 
ATOM   1108 H HG13 . VAL A 1 67  ? 23.142 -4.048  36.946 1.00 7.39  ? 1088 VAL A HG13 1 
ATOM   1109 H HG21 . VAL A 1 67  ? 22.484 -4.235  34.091 1.00 9.06  ? 1088 VAL A HG21 1 
ATOM   1110 H HG22 . VAL A 1 67  ? 22.851 -5.508  34.938 1.00 9.06  ? 1088 VAL A HG22 1 
ATOM   1111 H HG23 . VAL A 1 67  ? 21.500 -5.460  34.134 1.00 9.06  ? 1088 VAL A HG23 1 
ATOM   1112 N N    . ILE A 1 68  ? 19.102 -4.180  37.942 1.00 5.83  ? 1089 ILE A N    1 
ATOM   1113 C CA   . ILE A 1 68  ? 18.489 -3.519  39.080 1.00 6.23  ? 1089 ILE A CA   1 
ATOM   1114 C C    . ILE A 1 68  ? 18.171 -4.516  40.185 1.00 6.19  ? 1089 ILE A C    1 
ATOM   1115 O O    . ILE A 1 68  ? 18.405 -4.243  41.360 1.00 7.17  ? 1089 ILE A O    1 
ATOM   1116 C CB   . ILE A 1 68  ? 17.223 -2.746  38.631 1.00 6.73  ? 1089 ILE A CB   1 
ATOM   1117 C CG1  . ILE A 1 68  ? 17.601 -1.538  37.737 1.00 7.71  ? 1089 ILE A CG1  1 
ATOM   1118 C CG2  . ILE A 1 68  ? 16.380 -2.312  39.832 1.00 7.76  ? 1089 ILE A CG2  1 
ATOM   1119 C CD1  . ILE A 1 68  ? 18.347 -0.415  38.404 1.00 9.17  ? 1089 ILE A CD1  1 
ATOM   1120 H H    . ILE A 1 68  ? 18.649 -4.119  37.213 1.00 7.00  ? 1089 ILE A H    1 
ATOM   1121 H HA   . ILE A 1 68  ? 19.123 -2.866  39.442 1.00 7.47  ? 1089 ILE A HA   1 
ATOM   1122 H HB   . ILE A 1 68  ? 16.684 -3.350  38.097 1.00 8.07  ? 1089 ILE A HB   1 
ATOM   1123 H HG12 . ILE A 1 68  ? 18.157 -1.861  37.011 1.00 9.25  ? 1089 ILE A HG12 1 
ATOM   1124 H HG13 . ILE A 1 68  ? 16.783 -1.164  37.373 1.00 9.25  ? 1089 ILE A HG13 1 
ATOM   1125 H HG21 . ILE A 1 68  ? 15.607 -1.838  39.516 1.00 9.31  ? 1089 ILE A HG21 1 
ATOM   1126 H HG22 . ILE A 1 68  ? 16.109 -3.092  40.322 1.00 9.31  ? 1089 ILE A HG22 1 
ATOM   1127 H HG23 . ILE A 1 68  ? 16.909 -1.740  40.394 1.00 9.31  ? 1089 ILE A HG23 1 
ATOM   1128 H HD11 . ILE A 1 68  ? 18.524 0.270   37.756 1.00 11.00 ? 1089 ILE A HD11 1 
ATOM   1129 H HD12 . ILE A 1 68  ? 17.808 -0.062  39.116 1.00 11.00 ? 1089 ILE A HD12 1 
ATOM   1130 H HD13 . ILE A 1 68  ? 19.173 -0.755  38.756 1.00 11.00 ? 1089 ILE A HD13 1 
ATOM   1131 N N    A SER A 1 69  ? 17.636 -5.674  39.812 0.53 6.58  ? 1090 SER A N    1 
ATOM   1132 N N    B SER A 1 69  ? 17.649 -5.688  39.831 0.47 8.26  ? 1090 SER A N    1 
ATOM   1133 C CA   A SER A 1 69  ? 17.337 -6.692  40.795 0.53 8.05  ? 1090 SER A CA   1 
ATOM   1134 C CA   B SER A 1 69  ? 17.371 -6.672  40.860 0.47 7.21  ? 1090 SER A CA   1 
ATOM   1135 C C    A SER A 1 69  ? 18.600 -7.156  41.540 0.53 7.35  ? 1090 SER A C    1 
ATOM   1136 C C    B SER A 1 69  ? 18.636 -7.088  41.579 0.47 7.54  ? 1090 SER A C    1 
ATOM   1137 O O    A SER A 1 69  ? 18.576 -7.384  42.748 0.53 8.32  ? 1090 SER A O    1 
ATOM   1138 O O    B SER A 1 69  ? 18.641 -7.240  42.801 0.47 9.44  ? 1090 SER A O    1 
ATOM   1139 C CB   A SER A 1 69  ? 16.629 -7.872  40.128 0.53 10.17 ? 1090 SER A CB   1 
ATOM   1140 C CB   B SER A 1 69  ? 16.701 -7.909  40.278 0.47 8.01  ? 1090 SER A CB   1 
ATOM   1141 O OG   A SER A 1 69  ? 15.359 -7.504  39.593 0.53 11.17 ? 1090 SER A OG   1 
ATOM   1142 O OG   B SER A 1 69  ? 16.617 -8.955  41.244 0.47 11.71 ? 1090 SER A OG   1 
ATOM   1143 H H    A SER A 1 69  ? 17.441 -5.888  39.002 0.53 7.90  ? 1090 SER A H    1 
ATOM   1144 H H    B SER A 1 69  ? 17.453 -5.928  39.029 0.47 9.91  ? 1090 SER A H    1 
ATOM   1145 H HA   A SER A 1 69  ? 16.723 -6.315  41.459 0.53 9.66  ? 1090 SER A HA   1 
ATOM   1146 H HA   B SER A 1 69  ? 16.762 -6.279  41.520 0.47 8.65  ? 1090 SER A HA   1 
ATOM   1147 H HB2  A SER A 1 69  ? 17.186 -8.203  39.407 0.53 12.20 ? 1090 SER A HB2  1 
ATOM   1148 H HB2  B SER A 1 69  ? 15.805 -7.674  39.990 0.47 9.61  ? 1090 SER A HB2  1 
ATOM   1149 H HB3  A SER A 1 69  ? 16.498 -8.570  40.788 0.53 12.20 ? 1090 SER A HB3  1 
ATOM   1150 H HB3  B SER A 1 69  ? 17.220 -8.221  39.521 0.47 9.61  ? 1090 SER A HB3  1 
ATOM   1151 H HG   A SER A 1 69  ? 15.216 -6.709  39.734 0.53 13.41 ? 1090 SER A HG   1 
ATOM   1152 H HG   B SER A 1 69  ? 16.947 -8.709  41.953 0.47 14.05 ? 1090 SER A HG   1 
ATOM   1153 N N    . ALA A 1 70  ? 19.699 -7.299  40.821 1.00 7.18  ? 1091 ALA A N    1 
ATOM   1154 C CA   . ALA A 1 70  ? 20.952 -7.670  41.421 1.00 7.60  ? 1091 ALA A CA   1 
ATOM   1155 C C    . ALA A 1 70  ? 21.471 -6.603  42.373 1.00 7.38  ? 1091 ALA A C    1 
ATOM   1156 O O    . ALA A 1 70  ? 21.982 -6.901  43.440 1.00 9.67  ? 1091 ALA A O    1 
ATOM   1157 C CB   . ALA A 1 70  ? 21.961 -7.992  40.348 1.00 8.64  ? 1091 ALA A CB   1 
ATOM   1158 H H    . ALA A 1 70  ? 19.727 -7.207  39.966 0.47 8.61  ? 1091 ALA A H    1 
ATOM   1159 H HA   . ALA A 1 70  ? 20.813 -8.486  41.946 1.00 9.12  ? 1091 ALA A HA   1 
ATOM   1160 H HB1  . ALA A 1 70  ? 22.791 -8.238  40.763 1.00 10.37 ? 1091 ALA A HB1  1 
ATOM   1161 H HB2  . ALA A 1 70  ? 21.631 -8.722  39.818 1.00 10.37 ? 1091 ALA A HB2  1 
ATOM   1162 H HB3  . ALA A 1 70  ? 22.087 -7.217  39.796 1.00 10.37 ? 1091 ALA A HB3  1 
ATOM   1163 N N    . ILE A 1 71  ? 21.341 -5.338  42.012 1.00 7.07  ? 1092 ILE A N    1 
ATOM   1164 C CA   . ILE A 1 71  ? 21.778 -4.269  42.904 1.00 6.55  ? 1092 ILE A CA   1 
ATOM   1165 C C    . ILE A 1 71  ? 20.946 -4.270  44.179 1.00 7.06  ? 1092 ILE A C    1 
ATOM   1166 O O    . ILE A 1 71  ? 21.482 -4.142  45.286 1.00 7.65  ? 1092 ILE A O    1 
ATOM   1167 C CB   . ILE A 1 71  ? 21.676 -2.901  42.220 1.00 6.63  ? 1092 ILE A CB   1 
ATOM   1168 C CG1  . ILE A 1 71  ? 22.634 -2.825  41.033 1.00 7.13  ? 1092 ILE A CG1  1 
ATOM   1169 C CG2  . ILE A 1 71  ? 21.968 -1.795  43.205 1.00 7.53  ? 1092 ILE A CG2  1 
ATOM   1170 C CD1  . ILE A 1 71  ? 22.259 -1.729  40.022 1.00 8.13  ? 1092 ILE A CD1  1 
ATOM   1171 H H    . ILE A 1 71  ? 21.007 -5.069  41.267 1.00 8.48  ? 1092 ILE A H    1 
ATOM   1172 H HA   . ILE A 1 71  ? 22.715 -4.418  43.150 1.00 7.86  ? 1092 ILE A HA   1 
ATOM   1173 H HB   . ILE A 1 71  ? 20.770 -2.789  41.891 1.00 7.96  ? 1092 ILE A HB   1 
ATOM   1174 H HG12 . ILE A 1 71  ? 23.527 -2.636  41.361 1.00 8.55  ? 1092 ILE A HG12 1 
ATOM   1175 H HG13 . ILE A 1 71  ? 22.627 -3.676  40.567 1.00 8.55  ? 1092 ILE A HG13 1 
ATOM   1176 H HG21 . ILE A 1 71  ? 21.898 -0.950  42.754 1.00 9.04  ? 1092 ILE A HG21 1 
ATOM   1177 H HG22 . ILE A 1 71  ? 21.330 -1.839  43.921 1.00 9.04  ? 1092 ILE A HG22 1 
ATOM   1178 H HG23 . ILE A 1 71  ? 22.857 -1.911  43.549 1.00 9.04  ? 1092 ILE A HG23 1 
ATOM   1179 H HD11 . ILE A 1 71  ? 22.897 -1.734  39.305 1.00 9.76  ? 1092 ILE A HD11 1 
ATOM   1180 H HD12 . ILE A 1 71  ? 21.380 -1.908  39.680 1.00 9.76  ? 1092 ILE A HD12 1 
ATOM   1181 H HD13 . ILE A 1 71  ? 22.271 -0.878  40.466 1.00 9.76  ? 1092 ILE A HD13 1 
ATOM   1182 N N    . ARG A 1 72  ? 19.634 -4.409  44.042 1.00 7.13  ? 1093 ARG A N    1 
ATOM   1183 C CA   . ARG A 1 72  ? 18.728 -4.344  45.170 1.00 7.64  ? 1093 ARG A CA   1 
ATOM   1184 C C    . ARG A 1 72  ? 19.018 -5.430  46.208 1.00 8.60  ? 1093 ARG A C    1 
ATOM   1185 O O    . ARG A 1 72  ? 18.779 -5.225  47.395 1.00 10.32 ? 1093 ARG A O    1 
ATOM   1186 C CB   . ARG A 1 72  ? 17.271 -4.434  44.715 1.00 7.85  ? 1093 ARG A CB   1 
ATOM   1187 C CG   . ARG A 1 72  ? 16.774 -3.178  44.027 1.00 7.96  ? 1093 ARG A CG   1 
ATOM   1188 C CD   . ARG A 1 72  ? 15.393 -3.426  43.504 1.00 10.03 ? 1093 ARG A CD   1 
ATOM   1189 N NE   . ARG A 1 72  ? 14.806 -2.244  42.892 1.00 10.19 ? 1093 ARG A NE   1 
ATOM   1190 C CZ   . ARG A 1 72  ? 13.660 -2.259  42.219 1.00 10.68 ? 1093 ARG A CZ   1 
ATOM   1191 N NH1  . ARG A 1 72  ? 12.972 -3.388  42.135 1.00 13.01 ? 1093 ARG A NH1  1 
ATOM   1192 N NH2  . ARG A 1 72  ? 13.187 -1.154  41.655 1.00 11.31 ? 1093 ARG A NH2  1 
ATOM   1193 H H    . ARG A 1 72  ? 19.240 -4.545  43.289 1.00 8.56  ? 1093 ARG A H    1 
ATOM   1194 H HA   . ARG A 1 72  ? 18.846 -3.477  45.611 1.00 9.16  ? 1093 ARG A HA   1 
ATOM   1195 H HB2  . ARG A 1 72  ? 17.182 -5.170  44.091 1.00 9.43  ? 1093 ARG A HB2  1 
ATOM   1196 H HB3  . ARG A 1 72  ? 16.710 -4.589  45.491 1.00 9.43  ? 1093 ARG A HB3  1 
ATOM   1197 H HG2  . ARG A 1 72  ? 16.740 -2.447  44.663 1.00 9.56  ? 1093 ARG A HG2  1 
ATOM   1198 H HG3  . ARG A 1 72  ? 17.356 -2.960  43.282 1.00 9.56  ? 1093 ARG A HG3  1 
ATOM   1199 H HD2  . ARG A 1 72  ? 15.429 -4.125  42.832 1.00 12.04 ? 1093 ARG A HD2  1 
ATOM   1200 H HD3  . ARG A 1 72  ? 14.820 -3.699  44.238 1.00 12.04 ? 1093 ARG A HD3  1 
ATOM   1201 H HE   . ARG A 1 72  ? 15.285 -1.530  42.855 1.00 12.23 ? 1093 ARG A HE   1 
ATOM   1202 H HH11 . ARG A 1 72  ? 13.280 -4.106  42.494 1.00 15.61 ? 1093 ARG A HH11 1 
ATOM   1203 H HH12 . ARG A 1 72  ? 12.226 -3.406  41.709 1.00 15.61 ? 1093 ARG A HH12 1 
ATOM   1204 H HH21 . ARG A 1 72  ? 13.626 -0.417  41.718 1.00 13.57 ? 1093 ARG A HH21 1 
ATOM   1205 H HH22 . ARG A 1 72  ? 12.434 -1.171  41.239 1.00 13.57 ? 1093 ARG A HH22 1 
ATOM   1206 N N    . ARG A 1 73  ? 19.546 -6.561  45.758 1.00 8.71  ? 1094 ARG A N    1 
ATOM   1207 C CA   . ARG A 1 73  ? 19.782 -7.691  46.644 1.00 10.90 ? 1094 ARG A CA   1 
ATOM   1208 C C    . ARG A 1 73  ? 21.153 -7.659  47.317 1.00 9.18  ? 1094 ARG A C    1 
ATOM   1209 O O    . ARG A 1 73  ? 21.460 -8.535  48.126 1.00 10.65 ? 1094 ARG A O    1 
ATOM   1210 C CB   . ARG A 1 73  ? 19.626 -9.003  45.871 1.00 20.00 ? 1094 ARG A CB   1 
ATOM   1211 C CG   . ARG A 1 73  ? 18.297 -9.142  45.146 1.00 20.00 ? 1094 ARG A CG   1 
ATOM   1212 C CD   . ARG A 1 73  ? 18.225 -10.447 44.371 1.00 20.00 ? 1094 ARG A CD   1 
ATOM   1213 N NE   . ARG A 1 73  ? 19.531 -10.852 43.859 1.00 20.00 ? 1094 ARG A NE   1 
ATOM   1214 C CZ   . ARG A 1 73  ? 19.830 -10.950 42.568 1.00 20.00 ? 1094 ARG A CZ   1 
ATOM   1215 N NH1  . ARG A 1 73  ? 18.915 -10.672 41.650 1.00 20.00 ? 1094 ARG A NH1  1 
ATOM   1216 N NH2  . ARG A 1 73  ? 21.045 -11.327 42.194 1.00 20.00 ? 1094 ARG A NH2  1 
ATOM   1217 H H    . ARG A 1 73  ? 19.776 -6.700  44.941 1.00 10.45 ? 1094 ARG A H    1 
ATOM   1218 H HA   . ARG A 1 73  ? 19.104 -7.681  47.352 1.00 13.08 ? 1094 ARG A HA   1 
ATOM   1219 N N    . LEU A 1 74  ? 21.983 -6.670  46.994 1.00 7.68  ? 1095 LEU A N    1 
ATOM   1220 C CA   . LEU A 1 74  ? 23.333 -6.643  47.566 1.00 7.62  ? 1095 LEU A CA   1 
ATOM   1221 C C    . LEU A 1 74  ? 23.317 -6.547  49.079 1.00 7.54  ? 1095 LEU A C    1 
ATOM   1222 O O    . LEU A 1 74  ? 22.522 -5.821  49.663 1.00 8.28  ? 1095 LEU A O    1 
ATOM   1223 C CB   . LEU A 1 74  ? 24.099 -5.442  47.032 1.00 8.35  ? 1095 LEU A CB   1 
ATOM   1224 C CG   . LEU A 1 74  ? 24.411 -5.430  45.540 1.00 9.71  ? 1095 LEU A CG   1 
ATOM   1225 C CD1  . LEU A 1 74  ? 25.028 -4.101  45.161 1.00 10.50 ? 1095 LEU A CD1  1 
ATOM   1226 C CD2  . LEU A 1 74  ? 25.317 -6.587  45.154 1.00 12.58 ? 1095 LEU A CD2  1 
ATOM   1227 H H    . LEU A 1 74  ? 21.808 -6.030  46.448 1.00 9.21  ? 1095 LEU A H    1 
ATOM   1228 H HA   . LEU A 1 74  ? 23.813 -7.459  47.311 1.00 9.14  ? 1095 LEU A HA   1 
ATOM   1229 H HB2  . LEU A 1 74  ? 23.581 -4.644  47.221 1.00 10.02 ? 1095 LEU A HB2  1 
ATOM   1230 H HB3  . LEU A 1 74  ? 24.947 -5.391  47.501 1.00 10.02 ? 1095 LEU A HB3  1 
ATOM   1231 H HG   . LEU A 1 74  ? 23.581 -5.525  45.046 1.00 11.65 ? 1095 LEU A HG   1 
ATOM   1232 H HD11 . LEU A 1 74  ? 25.220 -4.103  44.220 1.00 12.60 ? 1095 LEU A HD11 1 
ATOM   1233 H HD12 . LEU A 1 74  ? 24.407 -3.398  45.367 1.00 12.60 ? 1095 LEU A HD12 1 
ATOM   1234 H HD13 . LEU A 1 74  ? 25.838 -3.979  45.661 1.00 12.60 ? 1095 LEU A HD13 1 
ATOM   1235 H HD21 . LEU A 1 74  ? 25.490 -6.546  44.211 1.00 15.10 ? 1095 LEU A HD21 1 
ATOM   1236 H HD22 . LEU A 1 74  ? 26.141 -6.514  45.642 1.00 15.10 ? 1095 LEU A HD22 1 
ATOM   1237 H HD23 . LEU A 1 74  ? 24.879 -7.413  45.371 1.00 15.10 ? 1095 LEU A HD23 1 
ATOM   1238 N N    . THR A 1 75  ? 24.263 -7.237  49.697 1.00 8.12  ? 1096 THR A N    1 
ATOM   1239 C CA   . THR A 1 75  ? 24.540 -7.052  51.112 1.00 8.64  ? 1096 THR A CA   1 
ATOM   1240 C C    . THR A 1 75  ? 25.976 -6.612  51.266 1.00 7.98  ? 1096 THR A C    1 
ATOM   1241 O O    . THR A 1 75  ? 26.840 -6.944  50.449 1.00 8.15  ? 1096 THR A O    1 
ATOM   1242 C CB   . THR A 1 75  ? 24.276 -8.340  51.903 1.00 11.79 ? 1096 THR A CB   1 
ATOM   1243 O OG1  . THR A 1 75  ? 25.053 -9.400  51.349 1.00 12.73 ? 1096 THR A OG1  1 
ATOM   1244 C CG2  . THR A 1 75  ? 22.812 -8.731  51.838 1.00 14.89 ? 1096 THR A CG2  1 
ATOM   1245 H H    . THR A 1 75  ? 24.764 -7.824  49.316 1.00 9.74  ? 1096 THR A H    1 
ATOM   1246 H HA   . THR A 1 75  ? 23.960 -6.346  51.467 1.00 10.37 ? 1096 THR A HA   1 
ATOM   1247 H HB   . THR A 1 75  ? 24.520 -8.207  52.833 1.00 14.15 ? 1096 THR A HB   1 
ATOM   1248 H HG1  . THR A 1 75  ? 25.851 -9.214  51.392 1.00 15.28 ? 1096 THR A HG1  1 
ATOM   1249 H HG21 . THR A 1 75  ? 22.666 -9.538  52.338 1.00 17.86 ? 1096 THR A HG21 1 
ATOM   1250 H HG22 . THR A 1 75  ? 22.269 -8.032  52.208 1.00 17.86 ? 1096 THR A HG22 1 
ATOM   1251 H HG23 . THR A 1 75  ? 22.553 -8.879  50.925 1.00 17.86 ? 1096 THR A HG23 1 
ATOM   1252 N N    . LEU A 1 76  ? 26.228 -5.843  52.312 1.00 8.97  ? 1097 LEU A N    1 
ATOM   1253 C CA   . LEU A 1 76  ? 27.536 -5.240  52.486 1.00 9.30  ? 1097 LEU A CA   1 
ATOM   1254 C C    . LEU A 1 76  ? 28.607 -6.320  52.630 1.00 8.55  ? 1097 LEU A C    1 
ATOM   1255 O O    . LEU A 1 76  ? 28.467 -7.256  53.417 1.00 9.21  ? 1097 LEU A O    1 
ATOM   1256 C CB   . LEU A 1 76  ? 27.507 -4.350  53.725 1.00 11.82 ? 1097 LEU A CB   1 
ATOM   1257 C CG   . LEU A 1 76  ? 28.804 -3.542  53.875 1.00 15.58 ? 1097 LEU A CG   1 
ATOM   1258 C CD1  . LEU A 1 76  ? 28.729 -2.284  53.083 1.00 15.60 ? 1097 LEU A CD1  1 
ATOM   1259 C CD2  . LEU A 1 76  ? 29.140 -3.212  55.318 1.00 20.62 ? 1097 LEU A CD2  1 
ATOM   1260 H H    . LEU A 1 76  ? 25.662 -5.654  52.932 1.00 10.76 ? 1097 LEU A H    1 
ATOM   1261 H HA   . LEU A 1 76  ? 27.751 -4.687  51.706 1.00 11.16 ? 1097 LEU A HA   1 
ATOM   1262 H HB2  . LEU A 1 76  ? 26.768 -3.726  53.653 1.00 14.18 ? 1097 LEU A HB2  1 
ATOM   1263 H HB3  . LEU A 1 76  ? 27.402 -4.905  54.514 1.00 14.18 ? 1097 LEU A HB3  1 
ATOM   1264 H HG   . LEU A 1 76  ? 29.537 -4.068  53.519 1.00 18.70 ? 1097 LEU A HG   1 
ATOM   1265 H HD11 . LEU A 1 76  ? 29.549 -1.797  53.192 1.00 18.72 ? 1097 LEU A HD11 1 
ATOM   1266 H HD12 . LEU A 1 76  ? 28.600 -2.505  52.157 1.00 18.72 ? 1097 LEU A HD12 1 
ATOM   1267 H HD13 . LEU A 1 76  ? 27.991 -1.758  53.400 1.00 18.72 ? 1097 LEU A HD13 1 
ATOM   1268 H HD21 . LEU A 1 76  ? 29.958 -2.709  55.340 1.00 24.74 ? 1097 LEU A HD21 1 
ATOM   1269 H HD22 . LEU A 1 76  ? 28.426 -2.693  55.694 1.00 24.74 ? 1097 LEU A HD22 1 
ATOM   1270 H HD23 . LEU A 1 76  ? 29.245 -4.030  55.809 1.00 24.74 ? 1097 LEU A HD23 1 
ATOM   1271 N N    . LEU A 1 77  ? 29.707 -6.166  51.896 1.00 7.54  ? 1098 LEU A N    1 
ATOM   1272 C CA   . LEU A 1 77  ? 30.810 -7.113  51.982 1.00 8.39  ? 1098 LEU A CA   1 
ATOM   1273 C C    . LEU A 1 77  ? 31.367 -7.145  53.406 1.00 8.75  ? 1098 LEU A C    1 
ATOM   1274 O O    . LEU A 1 77  ? 31.596 -8.223  53.965 1.00 10.66 ? 1098 LEU A O    1 
ATOM   1275 C CB   . LEU A 1 77  ? 31.898 -6.701  50.990 1.00 9.01  ? 1098 LEU A CB   1 
ATOM   1276 C CG   . LEU A 1 77  ? 33.209 -7.472  51.025 1.00 10.12 ? 1098 LEU A CG   1 
ATOM   1277 C CD1  . LEU A 1 77  ? 32.988 -8.952  50.716 1.00 11.40 ? 1098 LEU A CD1  1 
ATOM   1278 C CD2  . LEU A 1 77  ? 34.178 -6.834  50.025 1.00 10.26 ? 1098 LEU A CD2  1 
ATOM   1279 H H    . LEU A 1 77  ? 29.838 -5.521  51.343 1.00 9.05  ? 1098 LEU A H    1 
ATOM   1280 H HA   . LEU A 1 77  ? 30.494 -8.010  51.748 1.00 10.07 ? 1098 LEU A HA   1 
ATOM   1281 H HB2  . LEU A 1 77  ? 31.537 -6.794  50.094 1.00 10.81 ? 1098 LEU A HB2  1 
ATOM   1282 H HB3  . LEU A 1 77  ? 32.112 -5.769  51.151 1.00 10.81 ? 1098 LEU A HB3  1 
ATOM   1283 H HG   . LEU A 1 77  ? 33.597 -7.401  51.911 1.00 12.15 ? 1098 LEU A HG   1 
ATOM   1284 H HD11 . LEU A 1 77  ? 33.833 -9.407  50.746 1.00 13.68 ? 1098 LEU A HD11 1 
ATOM   1285 H HD12 . LEU A 1 77  ? 32.392 -9.323  51.371 1.00 13.68 ? 1098 LEU A HD12 1 
ATOM   1286 H HD13 . LEU A 1 77  ? 32.603 -9.034  49.840 1.00 13.68 ? 1098 LEU A HD13 1 
ATOM   1287 H HD21 . LEU A 1 77  ? 35.007 -7.316  50.043 1.00 12.32 ? 1098 LEU A HD21 1 
ATOM   1288 H HD22 . LEU A 1 77  ? 33.792 -6.876  49.147 1.00 12.32 ? 1098 LEU A HD22 1 
ATOM   1289 H HD23 . LEU A 1 77  ? 34.325 -5.918  50.274 1.00 12.32 ? 1098 LEU A HD23 1 
ATOM   1290 N N    . GLY A 1 78  ? 31.607 -5.967  53.977 1.00 8.71  ? 1099 GLY A N    1 
ATOM   1291 C CA   . GLY A 1 78  ? 32.214 -5.826  55.273 1.00 10.00 ? 1099 GLY A CA   1 
ATOM   1292 C C    . GLY A 1 78  ? 33.728 -5.762  55.162 1.00 10.76 ? 1099 GLY A C    1 
ATOM   1293 O O    . GLY A 1 78  ? 34.320 -6.085  54.127 1.00 11.66 ? 1099 GLY A O    1 
ATOM   1294 H H    . GLY A 1 78  ? 31.416 -5.214  53.610 1.00 10.46 ? 1099 GLY A H    1 
ATOM   1295 H HA2  . GLY A 1 78  ? 31.897 -5.013  55.696 1.00 12.00 ? 1099 GLY A HA2  1 
ATOM   1296 H HA3  . GLY A 1 78  ? 31.974 -6.583  55.831 1.00 12.00 ? 1099 GLY A HA3  1 
ATOM   1297 N N    . GLY A 1 79  ? 34.379 -5.348  56.235 1.00 12.51 ? 1100 GLY A N    1 
ATOM   1298 C CA   . GLY A 1 79  ? 35.820 -5.411  56.304 1.00 12.66 ? 1100 GLY A CA   1 
ATOM   1299 C C    . GLY A 1 79  ? 36.392 -4.131  56.845 1.00 12.72 ? 1100 GLY A C    1 
ATOM   1300 O O    . GLY A 1 79  ? 35.711 -3.110  56.961 1.00 13.47 ? 1100 GLY A O    1 
ATOM   1301 H H    . GLY A 1 79  ? 34.005 -5.025  56.939 1.00 15.01 ? 1100 GLY A H    1 
ATOM   1302 H HA2  . GLY A 1 79  ? 36.089 -6.141  56.882 1.00 15.19 ? 1100 GLY A HA2  1 
ATOM   1303 H HA3  . GLY A 1 79  ? 36.184 -5.564  55.418 1.00 15.19 ? 1100 GLY A HA3  1 
ATOM   1304 N N    . PRO A 1 80  ? 37.664 -4.178  57.228 1.00 14.14 ? 1101 PRO A N    1 
ATOM   1305 C CA   . PRO A 1 80  ? 38.152 -3.068  58.048 1.00 17.75 ? 1101 PRO A CA   1 
ATOM   1306 C C    . PRO A 1 80  ? 38.442 -1.804  57.291 1.00 19.83 ? 1101 PRO A C    1 
ATOM   1307 O O    . PRO A 1 80  ? 38.414 -0.705  57.858 1.00 27.96 ? 1101 PRO A O    1 
ATOM   1308 C CB   . PRO A 1 80  ? 39.430 -3.643  58.668 1.00 20.52 ? 1101 PRO A CB   1 
ATOM   1309 C CG   . PRO A 1 80  ? 39.877 -4.698  57.697 1.00 20.89 ? 1101 PRO A CG   1 
ATOM   1310 C CD   . PRO A 1 80  ? 38.608 -5.308  57.199 1.00 18.19 ? 1101 PRO A CD   1 
ATOM   1311 H HA   . PRO A 1 80  ? 37.511 -2.871  58.762 1.00 21.29 ? 1101 PRO A HA   1 
ATOM   1312 H HB2  . PRO A 1 80  ? 40.098 -2.946  58.751 1.00 24.62 ? 1101 PRO A HB2  1 
ATOM   1313 H HB3  . PRO A 1 80  ? 39.228 -4.034  59.532 1.00 24.62 ? 1101 PRO A HB3  1 
ATOM   1314 H HG2  . PRO A 1 80  ? 40.371 -4.287  56.970 1.00 25.06 ? 1101 PRO A HG2  1 
ATOM   1315 H HG3  . PRO A 1 80  ? 40.421 -5.357  58.155 1.00 25.06 ? 1101 PRO A HG3  1 
ATOM   1316 H HD2  . PRO A 1 80  ? 38.721 -5.633  56.292 1.00 21.82 ? 1101 PRO A HD2  1 
ATOM   1317 H HD3  . PRO A 1 80  ? 38.313 -6.012  57.797 1.00 21.82 ? 1101 PRO A HD3  1 
ATOM   1318 N N    . THR A 1 81  ? 38.748 -1.935  56.024 1.00 16.49 ? 1102 THR A N    1 
ATOM   1319 C CA   . THR A 1 81  ? 39.365 -0.827  55.328 1.00 19.02 ? 1102 THR A CA   1 
ATOM   1320 C C    . THR A 1 81  ? 39.094 -0.963  53.882 1.00 16.28 ? 1102 THR A C    1 
ATOM   1321 O O    . THR A 1 81  ? 38.937 -2.065  53.409 1.00 17.94 ? 1102 THR A O    1 
ATOM   1322 C CB   . THR A 1 81  ? 40.911 -0.849  55.426 1.00 28.34 ? 1102 THR A CB   1 
ATOM   1323 O OG1  . THR A 1 81  ? 41.445 -1.835  54.541 1.00 38.44 ? 1102 THR A OG1  1 
ATOM   1324 C CG2  . THR A 1 81  ? 41.365 -1.182  56.819 1.00 29.25 ? 1102 THR A CG2  1 
ATOM   1325 H H    . THR A 1 81  ? 38.614 -2.639  55.547 1.00 19.79 ? 1102 THR A H    1 
ATOM   1326 H HA   . THR A 1 81  ? 39.020 0.030   55.654 1.00 22.83 ? 1102 THR A HA   1 
ATOM   1327 H HB   . THR A 1 81  ? 41.262 0.023   55.188 1.00 34.01 ? 1102 THR A HB   1 
ATOM   1328 H HG1  . THR A 1 81  ? 41.231 -1.664  53.768 1.00 46.13 ? 1102 THR A HG1  1 
ATOM   1329 H HG21 . THR A 1 81  ? 41.035 -2.047  57.074 1.00 35.10 ? 1102 THR A HG21 1 
ATOM   1330 H HG22 . THR A 1 81  ? 42.325 -1.191  56.858 1.00 35.10 ? 1102 THR A HG22 1 
ATOM   1331 H HG23 . THR A 1 81  ? 41.034 -0.527  57.438 1.00 35.10 ? 1102 THR A HG23 1 
ATOM   1332 N N    . PRO A 1 82  ? 39.121 0.150   53.159 1.00 17.97 ? 1103 PRO A N    1 
ATOM   1333 C CA   . PRO A 1 82  ? 39.011 0.043   51.710 1.00 15.11 ? 1103 PRO A CA   1 
ATOM   1334 C C    . PRO A 1 82  ? 40.397 0.121   51.086 1.00 12.39 ? 1103 PRO A C    1 
ATOM   1335 O O    . PRO A 1 82  ? 40.995 1.187   51.025 1.00 13.67 ? 1103 PRO A O    1 
ATOM   1336 C CB   . PRO A 1 82  ? 38.189 1.272   51.346 1.00 16.59 ? 1103 PRO A CB   1 
ATOM   1337 C CG   . PRO A 1 82  ? 38.546 2.252   52.342 1.00 19.55 ? 1103 PRO A CG   1 
ATOM   1338 C CD   . PRO A 1 82  ? 38.846 1.519   53.618 1.00 19.92 ? 1103 PRO A CD   1 
ATOM   1339 H HA   . PRO A 1 82  ? 38.549 -0.778  51.439 1.00 18.14 ? 1103 PRO A HA   1 
ATOM   1340 H HB2  . PRO A 1 82  ? 38.431 1.578   50.458 1.00 19.91 ? 1103 PRO A HB2  1 
ATOM   1341 H HB3  . PRO A 1 82  ? 37.243 1.061   51.393 1.00 19.91 ? 1103 PRO A HB3  1 
ATOM   1342 H HG2  . PRO A 1 82  ? 39.330 2.739   52.044 1.00 23.46 ? 1103 PRO A HG2  1 
ATOM   1343 H HG3  . PRO A 1 82  ? 37.803 2.861   52.472 1.00 23.46 ? 1103 PRO A HG3  1 
ATOM   1344 H HD2  . PRO A 1 82  ? 39.629 1.895   54.050 1.00 23.90 ? 1103 PRO A HD2  1 
ATOM   1345 H HD3  . PRO A 1 82  ? 38.074 1.531   54.206 1.00 23.90 ? 1103 PRO A HD3  1 
ATOM   1346 N N    . ASN A 1 83  ? 40.917 -1.004  50.616 1.00 12.63 ? 1104 ASN A N    1 
ATOM   1347 C CA   . ASN A 1 83  ? 42.189 -1.009  49.889 1.00 10.55 ? 1104 ASN A CA   1 
ATOM   1348 C C    . ASN A 1 83  ? 41.871 -0.706  48.429 1.00 9.26  ? 1104 ASN A C    1 
ATOM   1349 O O    . ASN A 1 83  ? 41.726 -1.590  47.596 1.00 8.46  ? 1104 ASN A O    1 
ATOM   1350 C CB   . ASN A 1 83  ? 42.912 -2.350  50.036 1.00 12.77 ? 1104 ASN A CB   1 
ATOM   1351 C CG   . ASN A 1 83  ? 43.579 -2.524  51.395 1.00 16.79 ? 1104 ASN A CG   1 
ATOM   1352 O OD1  . ASN A 1 83  ? 43.960 -1.556  52.049 1.00 21.09 ? 1104 ASN A OD1  1 
ATOM   1353 N ND2  . ASN A 1 83  ? 43.753 -3.773  51.800 1.00 17.17 ? 1104 ASN A ND2  1 
ATOM   1354 H H    . ASN A 1 83  ? 40.557 -1.780  50.702 1.00 15.16 ? 1104 ASN A H    1 
ATOM   1355 H HA   . ASN A 1 83  ? 42.770 -0.300  50.237 1.00 12.66 ? 1104 ASN A HA   1 
ATOM   1356 H HB2  . ASN A 1 83  ? 42.269 -3.068  49.925 1.00 15.33 ? 1104 ASN A HB2  1 
ATOM   1357 H HB3  . ASN A 1 83  ? 43.600 -2.414  49.355 1.00 15.33 ? 1104 ASN A HB3  1 
ATOM   1358 H HD21 . ASN A 1 83  ? 43.495 -4.426  51.303 1.00 20.60 ? 1104 ASN A HD21 1 
ATOM   1359 H HD22 . ASN A 1 83  ? 44.125 -3.931  52.559 1.00 20.60 ? 1104 ASN A HD22 1 
ATOM   1360 N N    . THR A 1 84  ? 41.718 0.576   48.138 1.00 8.43  ? 1105 THR A N    1 
ATOM   1361 C CA   . THR A 1 84  ? 41.207 1.009   46.844 1.00 7.93  ? 1105 THR A CA   1 
ATOM   1362 C C    . THR A 1 84  ? 42.190 0.719   45.730 1.00 7.44  ? 1105 THR A C    1 
ATOM   1363 O O    . THR A 1 84  ? 41.774 0.384   44.639 1.00 7.76  ? 1105 THR A O    1 
ATOM   1364 C CB   . THR A 1 84  ? 40.859 2.502   46.929 1.00 8.75  ? 1105 THR A CB   1 
ATOM   1365 O OG1  . THR A 1 84  ? 39.881 2.622   47.954 1.00 8.97  ? 1105 THR A OG1  1 
ATOM   1366 C CG2  . THR A 1 84  ? 40.302 3.081   45.626 1.00 10.16 ? 1105 THR A CG2  1 
ATOM   1367 H H    . THR A 1 84  ? 41.904 1.221   48.675 1.00 10.11 ? 1105 THR A H    1 
ATOM   1368 H HA   . THR A 1 84  ? 40.381 0.519   46.649 1.00 9.51  ? 1105 THR A HA   1 
ATOM   1369 H HB   . THR A 1 84  ? 41.651 3.005   47.177 1.00 10.50 ? 1105 THR A HB   1 
ATOM   1370 H HG1  . THR A 1 84  ? 39.660 3.407   48.040 1.00 10.76 ? 1105 THR A HG1  1 
ATOM   1371 H HG21 . THR A 1 84  ? 40.104 4.013   45.740 1.00 12.19 ? 1105 THR A HG21 1 
ATOM   1372 H HG22 . THR A 1 84  ? 40.947 2.983   44.922 1.00 12.19 ? 1105 THR A HG22 1 
ATOM   1373 H HG23 . THR A 1 84  ? 39.498 2.619   45.379 1.00 12.19 ? 1105 THR A HG23 1 
ATOM   1374 N N    . GLY A 1 85  ? 43.475 0.880   45.987 1.00 7.85  ? 1106 GLY A N    1 
ATOM   1375 C CA   . GLY A 1 85  ? 44.453 0.615   44.949 1.00 7.99  ? 1106 GLY A CA   1 
ATOM   1376 C C    . GLY A 1 85  ? 44.445 -0.828  44.449 1.00 8.00  ? 1106 GLY A C    1 
ATOM   1377 O O    . GLY A 1 85  ? 44.389 -1.097  43.240 1.00 8.43  ? 1106 GLY A O    1 
ATOM   1378 H H    . GLY A 1 85  ? 43.804 1.136   46.740 1.00 9.42  ? 1106 GLY A H    1 
ATOM   1379 H HA2  . GLY A 1 85  ? 44.282 1.198   44.193 1.00 9.59  ? 1106 GLY A HA2  1 
ATOM   1380 H HA3  . GLY A 1 85  ? 45.340 0.812   45.289 1.00 9.59  ? 1106 GLY A HA3  1 
ATOM   1381 N N    . ALA A 1 86  ? 44.467 -1.774  45.383 1.00 7.81  ? 1107 ALA A N    1 
ATOM   1382 C CA   . ALA A 1 86  ? 44.361 -3.179  45.029 1.00 8.13  ? 1107 ALA A CA   1 
ATOM   1383 C C    . ALA A 1 86  ? 43.063 -3.479  44.301 1.00 7.64  ? 1107 ALA A C    1 
ATOM   1384 O O    . ALA A 1 86  ? 43.046 -4.244  43.345 1.00 7.87  ? 1107 ALA A O    1 
ATOM   1385 C CB   . ALA A 1 86  ? 44.488 -4.051  46.277 1.00 9.71  ? 1107 ALA A CB   1 
ATOM   1386 H H    . ALA A 1 86  ? 44.542 -1.625  46.227 1.00 9.37  ? 1107 ALA A H    1 
ATOM   1387 H HA   . ALA A 1 86  ? 45.101 -3.408  44.428 1.00 9.75  ? 1107 ALA A HA   1 
ATOM   1388 H HB1  . ALA A 1 86  ? 44.416 -4.974  46.022 1.00 11.65 ? 1107 ALA A HB1  1 
ATOM   1389 H HB2  . ALA A 1 86  ? 45.342 -3.890  46.685 1.00 11.65 ? 1107 ALA A HB2  1 
ATOM   1390 H HB3  . ALA A 1 86  ? 43.784 -3.824  46.889 1.00 11.65 ? 1107 ALA A HB3  1 
ATOM   1391 N N    . ALA A 1 87  ? 41.970 -2.869  44.747 1.00 6.84  ? 1108 ALA A N    1 
ATOM   1392 C CA   . ALA A 1 87  ? 40.680 -3.097  44.097 1.00 7.31  ? 1108 ALA A CA   1 
ATOM   1393 C C    . ALA A 1 87  ? 40.678 -2.572  42.672 1.00 6.76  ? 1108 ALA A C    1 
ATOM   1394 O O    . ALA A 1 87  ? 40.136 -3.222  41.763 1.00 6.32  ? 1108 ALA A O    1 
ATOM   1395 C CB   . ALA A 1 87  ? 39.570 -2.464  44.908 1.00 7.56  ? 1108 ALA A CB   1 
ATOM   1396 H H    . ALA A 1 87  ? 41.945 -2.327  45.414 1.00 8.21  ? 1108 ALA A H    1 
ATOM   1397 H HA   . ALA A 1 87  ? 40.511 -4.062  44.061 1.00 8.77  ? 1108 ALA A HA   1 
ATOM   1398 H HB1  . ALA A 1 87  ? 38.732 -2.622  44.468 1.00 9.07  ? 1108 ALA A HB1  1 
ATOM   1399 H HB2  . ALA A 1 87  ? 39.561 -2.857  45.784 1.00 9.07  ? 1108 ALA A HB2  1 
ATOM   1400 H HB3  . ALA A 1 87  ? 39.732 -1.520  44.974 1.00 9.07  ? 1108 ALA A HB3  1 
ATOM   1401 N N    . LEU A 1 88  ? 41.292 -1.421  42.441 1.00 6.30  ? 1109 LEU A N    1 
ATOM   1402 C CA   . LEU A 1 88  ? 41.368 -0.854  41.098 1.00 6.76  ? 1109 LEU A CA   1 
ATOM   1403 C C    . LEU A 1 88  ? 42.121 -1.803  40.168 1.00 5.69  ? 1109 LEU A C    1 
ATOM   1404 O O    . LEU A 1 88  ? 41.657 -2.079  39.064 1.00 6.17  ? 1109 LEU A O    1 
ATOM   1405 C CB   . LEU A 1 88  ? 42.070 0.501   41.124 1.00 7.27  ? 1109 LEU A CB   1 
ATOM   1406 C CG   . LEU A 1 88  ? 41.292 1.664   41.718 1.00 7.49  ? 1109 LEU A CG   1 
ATOM   1407 C CD1  . LEU A 1 88  ? 42.231 2.816   41.949 1.00 10.05 ? 1109 LEU A CD1  1 
ATOM   1408 C CD2  . LEU A 1 88  ? 40.113 2.068   40.848 1.00 9.10  ? 1109 LEU A CD2  1 
ATOM   1409 H H    . LEU A 1 88  ? 41.676 -0.945  43.046 1.00 7.56  ? 1109 LEU A H    1 
ATOM   1410 H HA   . LEU A 1 88  ? 40.462 -0.727  40.745 1.00 8.11  ? 1109 LEU A HA   1 
ATOM   1411 H HB2  . LEU A 1 88  ? 42.886 0.408   41.641 1.00 8.72  ? 1109 LEU A HB2  1 
ATOM   1412 H HB3  . LEU A 1 88  ? 42.295 0.742   40.212 1.00 8.72  ? 1109 LEU A HB3  1 
ATOM   1413 H HG   . LEU A 1 88  ? 40.941 1.394   42.580 1.00 8.98  ? 1109 LEU A HG   1 
ATOM   1414 H HD11 . LEU A 1 88  ? 41.738 3.549   42.323 1.00 12.06 ? 1109 LEU A HD11 1 
ATOM   1415 H HD12 . LEU A 1 88  ? 42.920 2.539   42.557 1.00 12.06 ? 1109 LEU A HD12 1 
ATOM   1416 H HD13 . LEU A 1 88  ? 42.618 3.076   41.110 1.00 12.06 ? 1109 LEU A HD13 1 
ATOM   1417 H HD21 . LEU A 1 88  ? 39.656 2.803   41.264 1.00 10.92 ? 1109 LEU A HD21 1 
ATOM   1418 H HD22 . LEU A 1 88  ? 40.438 2.331   39.984 1.00 10.92 ? 1109 LEU A HD22 1 
ATOM   1419 H HD23 . LEU A 1 88  ? 39.518 1.320   40.761 1.00 10.92 ? 1109 LEU A HD23 1 
ATOM   1420 N N    . GLU A 1 89  ? 43.281 -2.298  40.587 1.00 6.60  ? 1110 GLU A N    1 
ATOM   1421 C CA   . GLU A 1 89  ? 44.042 -3.208  39.747 1.00 7.14  ? 1110 GLU A CA   1 
ATOM   1422 C C    . GLU A 1 89  ? 43.308 -4.513  39.513 1.00 7.06  ? 1110 GLU A C    1 
ATOM   1423 O O    . GLU A 1 89  ? 43.332 -5.071  38.419 1.00 7.97  ? 1110 GLU A O    1 
ATOM   1424 C CB   . GLU A 1 89  ? 45.430 -3.453  40.301 1.00 8.67  ? 1110 GLU A CB   1 
ATOM   1425 C CG   . GLU A 1 89  ? 46.304 -2.219  40.134 1.00 10.15 ? 1110 GLU A CG   1 
ATOM   1426 C CD   . GLU A 1 89  ? 47.781 -2.496  40.386 1.00 12.10 ? 1110 GLU A CD   1 
ATOM   1427 O OE1  . GLU A 1 89  ? 48.131 -3.539  40.987 1.00 14.97 ? 1110 GLU A OE1  1 
ATOM   1428 O OE2  . GLU A 1 89  ? 48.605 -1.680  39.972 1.00 13.08 ? 1110 GLU A OE2  1 
ATOM   1429 H H    . GLU A 1 89  ? 43.645 -2.124  41.346 1.00 7.92  ? 1110 GLU A H    1 
ATOM   1430 H HA   . GLU A 1 89  ? 44.156 -2.785  38.870 1.00 8.56  ? 1110 GLU A HA   1 
ATOM   1431 H HB2  . GLU A 1 89  ? 45.368 -3.659  41.247 1.00 10.40 ? 1110 GLU A HB2  1 
ATOM   1432 H HB3  . GLU A 1 89  ? 45.843 -4.189  39.822 1.00 10.40 ? 1110 GLU A HB3  1 
ATOM   1433 H HG2  . GLU A 1 89  ? 46.213 -1.889  39.226 1.00 12.18 ? 1110 GLU A HG2  1 
ATOM   1434 H HG3  . GLU A 1 89  ? 46.015 -1.541  40.764 1.00 12.18 ? 1110 GLU A HG3  1 
ATOM   1435 N N    . PHE A 1 90  ? 42.620 -4.999  40.539 1.00 6.41  ? 1111 PHE A N    1 
ATOM   1436 C CA   . PHE A 1 90  ? 41.815 -6.208  40.390 1.00 6.46  ? 1111 PHE A CA   1 
ATOM   1437 C C    . PHE A 1 90  ? 40.786 -6.011  39.294 1.00 6.07  ? 1111 PHE A C    1 
ATOM   1438 O O    . PHE A 1 90  ? 40.581 -6.895  38.465 1.00 6.54  ? 1111 PHE A O    1 
ATOM   1439 C CB   . PHE A 1 90  ? 41.117 -6.547  41.717 1.00 7.46  ? 1111 PHE A CB   1 
ATOM   1440 C CG   . PHE A 1 90  ? 40.121 -7.668  41.600 1.00 9.33  ? 1111 PHE A CG   1 
ATOM   1441 C CD1  . PHE A 1 90  ? 40.494 -8.977  41.668 1.00 9.62  ? 1111 PHE A CD1  1 
ATOM   1442 C CD2  . PHE A 1 90  ? 38.764 -7.376  41.379 1.00 9.75  ? 1111 PHE A CD2  1 
ATOM   1443 C CE1  . PHE A 1 90  ? 39.535 -9.995  41.515 1.00 10.85 ? 1111 PHE A CE1  1 
ATOM   1444 C CE2  . PHE A 1 90  ? 37.834 -8.367  41.234 1.00 10.37 ? 1111 PHE A CE2  1 
ATOM   1445 C CZ   . PHE A 1 90  ? 38.237 -9.677  41.295 1.00 11.93 ? 1111 PHE A CZ   1 
ATOM   1446 H H    . PHE A 1 90  ? 42.601 -4.652  41.326 1.00 7.69  ? 1111 PHE A H    1 
ATOM   1447 H HA   . PHE A 1 90  ? 42.395 -6.958  40.143 1.00 7.75  ? 1111 PHE A HA   1 
ATOM   1448 H HB2  . PHE A 1 90  ? 41.788 -6.811  42.365 1.00 8.95  ? 1111 PHE A HB2  1 
ATOM   1449 H HB3  . PHE A 1 90  ? 40.645 -5.761  42.032 1.00 8.95  ? 1111 PHE A HB3  1 
ATOM   1450 H HD1  . PHE A 1 90  ? 41.388 -9.198  41.802 1.00 11.54 ? 1111 PHE A HD1  1 
ATOM   1451 H HD2  . PHE A 1 90  ? 38.495 -6.488  41.321 1.00 11.70 ? 1111 PHE A HD2  1 
ATOM   1452 H HE1  . PHE A 1 90  ? 39.792 -10.887 41.564 1.00 13.02 ? 1111 PHE A HE1  1 
ATOM   1453 H HE2  . PHE A 1 90  ? 36.940 -8.156  41.089 1.00 12.44 ? 1111 PHE A HE2  1 
ATOM   1454 H HZ   . PHE A 1 90  ? 37.606 -10.356 41.213 1.00 14.32 ? 1111 PHE A HZ   1 
ATOM   1455 N N    . VAL A 1 91  ? 40.131 -4.860  39.285 1.00 5.84  ? 1112 VAL A N    1 
ATOM   1456 C CA   . VAL A 1 91  ? 39.161 -4.580  38.241 1.00 5.52  ? 1112 VAL A CA   1 
ATOM   1457 C C    . VAL A 1 91  ? 39.828 -4.577  36.860 1.00 6.14  ? 1112 VAL A C    1 
ATOM   1458 O O    . VAL A 1 91  ? 39.318 -5.213  35.917 1.00 6.51  ? 1112 VAL A O    1 
ATOM   1459 C CB   . VAL A 1 91  ? 38.425 -3.254  38.521 1.00 6.46  ? 1112 VAL A CB   1 
ATOM   1460 C CG1  . VAL A 1 91  ? 37.645 -2.802  37.285 1.00 7.75  ? 1112 VAL A CG1  1 
ATOM   1461 C CG2  . VAL A 1 91  ? 37.481 -3.413  39.687 1.00 6.75  ? 1112 VAL A CG2  1 
ATOM   1462 H H    . VAL A 1 91  ? 40.228 -4.232  39.864 1.00 7.01  ? 1112 VAL A H    1 
ATOM   1463 H HA   . VAL A 1 91  ? 38.490 -5.294  38.241 1.00 6.62  ? 1112 VAL A HA   1 
ATOM   1464 H HB   . VAL A 1 91  ? 39.080 -2.560  38.745 1.00 7.75  ? 1112 VAL A HB   1 
ATOM   1465 H HG11 . VAL A 1 91  ? 37.197 -1.977  37.484 1.00 9.30  ? 1112 VAL A HG11 1 
ATOM   1466 H HG12 . VAL A 1 91  ? 38.259 -2.675  36.558 1.00 9.30  ? 1112 VAL A HG12 1 
ATOM   1467 H HG13 . VAL A 1 91  ? 37.002 -3.478  37.058 1.00 9.30  ? 1112 VAL A HG13 1 
ATOM   1468 H HG21 . VAL A 1 91  ? 37.035 -2.578  39.843 1.00 8.10  ? 1112 VAL A HG21 1 
ATOM   1469 H HG22 . VAL A 1 91  ? 36.838 -4.094  39.476 1.00 8.10  ? 1112 VAL A HG22 1 
ATOM   1470 H HG23 . VAL A 1 91  ? 37.985 -3.666  40.464 1.00 8.10  ? 1112 VAL A HG23 1 
ATOM   1471 N N    . LEU A 1 92  ? 40.931 -3.847  36.706 1.00 6.43  ? 1113 LEU A N    1 
ATOM   1472 C CA   . LEU A 1 92  ? 41.610 -3.808  35.419 1.00 7.01  ? 1113 LEU A CA   1 
ATOM   1473 C C    . LEU A 1 92  ? 41.951 -5.211  34.913 1.00 7.76  ? 1113 LEU A C    1 
ATOM   1474 O O    . LEU A 1 92  ? 41.734 -5.540  33.758 1.00 8.74  ? 1113 LEU A O    1 
ATOM   1475 C CB   . LEU A 1 92  ? 42.893 -3.003  35.499 1.00 8.50  ? 1113 LEU A CB   1 
ATOM   1476 C CG   . LEU A 1 92  ? 43.660 -2.940  34.171 1.00 11.72 ? 1113 LEU A CG   1 
ATOM   1477 C CD1  . LEU A 1 92  ? 42.885 -2.172  33.114 1.00 13.46 ? 1113 LEU A CD1  1 
ATOM   1478 C CD2  . LEU A 1 92  ? 45.038 -2.362  34.432 1.00 14.06 ? 1113 LEU A CD2  1 
ATOM   1479 H H    . LEU A 1 92  ? 41.300 -3.373  37.322 1.00 7.72  ? 1113 LEU A H    1 
ATOM   1480 H HA   . LEU A 1 92  ? 41.023 -3.381  34.760 1.00 8.42  ? 1113 LEU A HA   1 
ATOM   1481 H HB2  . LEU A 1 92  ? 42.678 -2.095  35.762 1.00 10.20 ? 1113 LEU A HB2  1 
ATOM   1482 H HB3  . LEU A 1 92  ? 43.476 -3.408  36.160 1.00 10.20 ? 1113 LEU A HB3  1 
ATOM   1483 H HG   . LEU A 1 92  ? 43.781 -3.845  33.843 1.00 14.06 ? 1113 LEU A HG   1 
ATOM   1484 H HD11 . LEU A 1 92  ? 43.397 -2.155  32.302 1.00 16.15 ? 1113 LEU A HD11 1 
ATOM   1485 H HD12 . LEU A 1 92  ? 42.044 -2.610  32.963 1.00 16.15 ? 1113 LEU A HD12 1 
ATOM   1486 H HD13 . LEU A 1 92  ? 42.736 -1.276  33.426 1.00 16.15 ? 1113 LEU A HD13 1 
ATOM   1487 H HD21 . LEU A 1 92  ? 45.522 -2.321  33.604 1.00 16.88 ? 1113 LEU A HD21 1 
ATOM   1488 H HD22 . LEU A 1 92  ? 44.943 -1.481  34.800 1.00 16.88 ? 1113 LEU A HD22 1 
ATOM   1489 H HD23 . LEU A 1 92  ? 45.501 -2.929  35.054 1.00 16.88 ? 1113 LEU A HD23 1 
ATOM   1490 N N    . ARG A 1 93  ? 42.531 -6.035  35.788 1.00 7.24  ? 1114 ARG A N    1 
ATOM   1491 C CA   . ARG A 1 93  ? 43.132 -7.283  35.355 1.00 7.86  ? 1114 ARG A CA   1 
ATOM   1492 C C    . ARG A 1 93  ? 42.129 -8.430  35.268 1.00 6.56  ? 1114 ARG A C    1 
ATOM   1493 O O    . ARG A 1 93  ? 42.406 -9.407  34.573 1.00 7.47  ? 1114 ARG A O    1 
ATOM   1494 C CB   . ARG A 1 93  ? 44.274 -7.670  36.271 1.00 10.81 ? 1114 ARG A CB   1 
ATOM   1495 C CG   . ARG A 1 93  ? 45.290 -6.564  36.361 1.00 15.76 ? 1114 ARG A CG   1 
ATOM   1496 C CD   . ARG A 1 93  ? 46.637 -6.971  36.073 1.00 18.37 ? 1114 ARG A CD   1 
ATOM   1497 N NE   . ARG A 1 93  ? 47.589 -5.888  36.286 1.00 16.75 ? 1114 ARG A NE   1 
ATOM   1498 C CZ   . ARG A 1 93  ? 48.156 -5.156  35.326 1.00 16.42 ? 1114 ARG A CZ   1 
ATOM   1499 N NH1  . ARG A 1 93  ? 47.831 -5.321  34.046 1.00 17.52 ? 1114 ARG A NH1  1 
ATOM   1500 N NH2  . ARG A 1 93  ? 49.058 -4.242  35.642 1.00 16.39 ? 1114 ARG A NH2  1 
ATOM   1501 H H    . ARG A 1 93  ? 42.587 -5.890  36.634 1.00 8.69  ? 1114 ARG A H    1 
ATOM   1502 H HA   . ARG A 1 93  ? 43.505 -7.152  34.458 1.00 9.44  ? 1114 ARG A HA   1 
ATOM   1503 H HB2  . ARG A 1 93  ? 43.929 -7.842  37.162 1.00 12.97 ? 1114 ARG A HB2  1 
ATOM   1504 H HB3  . ARG A 1 93  ? 44.714 -8.461  35.922 1.00 12.97 ? 1114 ARG A HB3  1 
ATOM   1505 H HG2  . ARG A 1 93  ? 45.050 -5.870  35.727 1.00 18.91 ? 1114 ARG A HG2  1 
ATOM   1506 H HG3  . ARG A 1 93  ? 45.277 -6.204  37.261 1.00 18.91 ? 1114 ARG A HG3  1 
ATOM   1507 H HD2  . ARG A 1 93  ? 46.879 -7.707  36.657 1.00 22.05 ? 1114 ARG A HD2  1 
ATOM   1508 H HD3  . ARG A 1 93  ? 46.695 -7.247  35.145 1.00 22.05 ? 1114 ARG A HD3  1 
ATOM   1509 H HE   . ARG A 1 93  ? 47.802 -5.706  37.099 1.00 20.10 ? 1114 ARG A HE   1 
ATOM   1510 H HH11 . ARG A 1 93  ? 47.259 -5.923  33.822 1.00 21.02 ? 1114 ARG A HH11 1 
ATOM   1511 H HH12 . ARG A 1 93  ? 48.201 -4.833  33.442 1.00 21.02 ? 1114 ARG A HH12 1 
ATOM   1512 H HH21 . ARG A 1 93  ? 49.268 -4.112  36.466 1.00 19.67 ? 1114 ARG A HH21 1 
ATOM   1513 H HH22 . ARG A 1 93  ? 49.404 -3.749  35.028 1.00 19.67 ? 1114 ARG A HH22 1 
ATOM   1514 N N    . ASN A 1 94  ? 40.981 -8.297  35.927 1.00 7.03  ? 1115 ASN A N    1 
ATOM   1515 C CA   . ASN A 1 94  ? 40.008 -9.385  35.995 1.00 7.00  ? 1115 ASN A CA   1 
ATOM   1516 C C    . ASN A 1 94  ? 38.614 -9.071  35.516 1.00 7.36  ? 1115 ASN A C    1 
ATOM   1517 O O    . ASN A 1 94  ? 37.898 -9.982  35.097 1.00 11.04 ? 1115 ASN A O    1 
ATOM   1518 C CB   . ASN A 1 94  ? 39.960 -9.958  37.403 1.00 7.06  ? 1115 ASN A CB   1 
ATOM   1519 C CG   . ASN A 1 94  ? 41.311 -10.443 37.828 1.00 7.51  ? 1115 ASN A CG   1 
ATOM   1520 O OD1  . ASN A 1 94  ? 41.815 -11.452 37.306 1.00 7.35  ? 1115 ASN A OD1  1 
ATOM   1521 N ND2  . ASN A 1 94  ? 41.940 -9.734  38.748 1.00 9.65  ? 1115 ASN A ND2  1 
ATOM   1522 H H    . ASN A 1 94  ? 40.741 -7.584  36.345 1.00 8.44  ? 1115 ASN A H    1 
ATOM   1523 H HA   . ASN A 1 94  ? 40.339 -10.104 35.417 1.00 8.41  ? 1115 ASN A HA   1 
ATOM   1524 H HB2  . ASN A 1 94  ? 39.674 -9.268  38.021 1.00 8.47  ? 1115 ASN A HB2  1 
ATOM   1525 H HB3  . ASN A 1 94  ? 39.345 -10.708 37.424 1.00 8.47  ? 1115 ASN A HB3  1 
ATOM   1526 H HD21 . ASN A 1 94  ? 41.571 -9.028  39.073 1.00 11.58 ? 1115 ASN A HD21 1 
ATOM   1527 H HD22 . ASN A 1 94  ? 42.718 -9.977  39.020 1.00 11.58 ? 1115 ASN A HD22 1 
ATOM   1528 N N    . ILE A 1 95  ? 38.184 -7.822  35.621 1.00 6.34  ? 1116 ILE A N    1 
ATOM   1529 C CA   . ILE A 1 95  ? 36.815 -7.430  35.267 1.00 6.63  ? 1116 ILE A CA   1 
ATOM   1530 C C    . ILE A 1 95  ? 36.713 -6.725  33.921 1.00 7.13  ? 1116 ILE A C    1 
ATOM   1531 O O    . ILE A 1 95  ? 35.716 -6.899  33.198 1.00 7.70  ? 1116 ILE A O    1 
ATOM   1532 C CB   . ILE A 1 95  ? 36.237 -6.556  36.408 1.00 6.58  ? 1116 ILE A CB   1 
ATOM   1533 C CG1  . ILE A 1 95  ? 36.382 -7.290  37.761 1.00 8.19  ? 1116 ILE A CG1  1 
ATOM   1534 C CG2  . ILE A 1 95  ? 34.797 -6.118  36.124 1.00 7.89  ? 1116 ILE A CG2  1 
ATOM   1535 C CD1  . ILE A 1 95  ? 35.639 -8.577  37.880 1.00 9.83  ? 1116 ILE A CD1  1 
ATOM   1536 H H    . ILE A 1 95  ? 38.669 -7.168  35.899 1.00 7.61  ? 1116 ILE A H    1 
ATOM   1537 H HA   . ILE A 1 95  ? 36.267 -8.241  35.213 1.00 7.96  ? 1116 ILE A HA   1 
ATOM   1538 H HB   . ILE A 1 95  ? 36.778 -5.752  36.457 1.00 7.90  ? 1116 ILE A HB   1 
ATOM   1539 H HG12 . ILE A 1 95  ? 37.321 -7.482  37.906 1.00 9.83  ? 1116 ILE A HG12 1 
ATOM   1540 H HG13 . ILE A 1 95  ? 36.060 -6.703  38.463 1.00 9.83  ? 1116 ILE A HG13 1 
ATOM   1541 H HG21 . ILE A 1 95  ? 34.484 -5.581  36.856 1.00 9.47  ? 1116 ILE A HG21 1 
ATOM   1542 H HG22 . ILE A 1 95  ? 34.781 -5.607  35.312 1.00 9.47  ? 1116 ILE A HG22 1 
ATOM   1543 H HG23 . ILE A 1 95  ? 34.246 -6.899  36.031 1.00 9.47  ? 1116 ILE A HG23 1 
ATOM   1544 H HD11 . ILE A 1 95  ? 35.795 -8.947  38.752 1.00 11.79 ? 1116 ILE A HD11 1 
ATOM   1545 H HD12 . ILE A 1 95  ? 34.702 -8.408  37.758 1.00 11.79 ? 1116 ILE A HD12 1 
ATOM   1546 H HD13 . ILE A 1 95  ? 35.954 -9.182  37.205 1.00 11.79 ? 1116 ILE A HD13 1 
ATOM   1547 N N    . LEU A 1 96  ? 37.738 -5.962  33.561 1.00 6.15  ? 1117 LEU A N    1 
ATOM   1548 C CA   . LEU A 1 96  ? 37.795 -5.344  32.242 1.00 6.86  ? 1117 LEU A CA   1 
ATOM   1549 C C    . LEU A 1 96  ? 38.481 -6.299  31.271 1.00 5.98  ? 1117 LEU A C    1 
ATOM   1550 O O    . LEU A 1 96  ? 39.504 -5.964  30.673 1.00 7.69  ? 1117 LEU A O    1 
ATOM   1551 C CB   . LEU A 1 96  ? 38.554 -4.018  32.302 1.00 7.23  ? 1117 LEU A CB   1 
ATOM   1552 C CG   . LEU A 1 96  ? 38.022 -3.001  33.314 1.00 7.58  ? 1117 LEU A CG   1 
ATOM   1553 C CD1  . LEU A 1 96  ? 38.757 -1.676  33.178 1.00 9.09  ? 1117 LEU A CD1  1 
ATOM   1554 C CD2  . LEU A 1 96  ? 36.524 -2.806  33.141 1.00 9.88  ? 1117 LEU A CD2  1 
ATOM   1555 H H    . LEU A 1 96  ? 38.415 -5.786  34.062 1.00 7.39  ? 1117 LEU A H    1 
ATOM   1556 H HA   . LEU A 1 96  ? 36.885 -5.170  31.920 1.00 8.24  ? 1117 LEU A HA   1 
ATOM   1557 H HB2  . LEU A 1 96  ? 39.477 -4.203  32.534 1.00 8.68  ? 1117 LEU A HB2  1 
ATOM   1558 H HB3  . LEU A 1 96  ? 38.517 -3.603  31.426 1.00 8.68  ? 1117 LEU A HB3  1 
ATOM   1559 H HG   . LEU A 1 96  ? 38.178 -3.338  34.210 1.00 9.09  ? 1117 LEU A HG   1 
ATOM   1560 H HD11 . LEU A 1 96  ? 38.403 -1.055  33.819 1.00 10.91 ? 1117 LEU A HD11 1 
ATOM   1561 H HD12 . LEU A 1 96  ? 39.692 -1.819  33.343 1.00 10.91 ? 1117 LEU A HD12 1 
ATOM   1562 H HD13 . LEU A 1 96  ? 38.629 -1.338  32.289 1.00 10.91 ? 1117 LEU A HD13 1 
ATOM   1563 H HD21 . LEU A 1 96  ? 36.212 -2.183  33.802 1.00 11.86 ? 1117 LEU A HD21 1 
ATOM   1564 H HD22 . LEU A 1 96  ? 36.353 -2.464  32.261 1.00 11.86 ? 1117 LEU A HD22 1 
ATOM   1565 H HD23 . LEU A 1 96  ? 36.084 -3.652  33.255 1.00 11.86 ? 1117 LEU A HD23 1 
ATOM   1566 N N    . THR A 1 97  ? 37.917 -7.495  31.127 1.00 7.17  ? 1118 THR A N    1 
ATOM   1567 C CA   . THR A 1 97  ? 38.537 -8.547  30.330 1.00 7.76  ? 1118 THR A CA   1 
ATOM   1568 C C    . THR A 1 97  ? 37.525 -9.166  29.389 1.00 7.05  ? 1118 THR A C    1 
ATOM   1569 O O    . THR A 1 97  ? 36.345 -9.283  29.706 1.00 7.73  ? 1118 THR A O    1 
ATOM   1570 C CB   . THR A 1 97  ? 39.148 -9.663  31.216 1.00 12.38 ? 1118 THR A CB   1 
ATOM   1571 O OG1  . THR A 1 97  ? 38.101 -10.353 31.898 1.00 19.15 ? 1118 THR A OG1  1 
ATOM   1572 C CG2  . THR A 1 97  ? 40.113 -9.073  32.250 1.00 9.30  ? 1118 THR A CG2  1 
ATOM   1573 H H    . THR A 1 97  ? 37.174 -7.728  31.493 1.00 8.60  ? 1118 THR A H    1 
ATOM   1574 H HA   . THR A 1 97  ? 39.257 -8.157  29.790 1.00 9.31  ? 1118 THR A HA   1 
ATOM   1575 H HB   . THR A 1 97  ? 39.638 -10.288 30.659 1.00 14.85 ? 1118 THR A HB   1 
ATOM   1576 H HG1  . THR A 1 97  ? 38.415 -10.945 32.369 1.00 22.98 ? 1118 THR A HG1  1 
ATOM   1577 H HG21 . THR A 1 97  ? 40.483 -9.775  32.790 1.00 11.16 ? 1118 THR A HG21 1 
ATOM   1578 H HG22 . THR A 1 97  ? 40.828 -8.612  31.805 1.00 11.16 ? 1118 THR A HG22 1 
ATOM   1579 H HG23 . THR A 1 97  ? 39.648 -8.455  32.817 1.00 11.16 ? 1118 THR A HG23 1 
ATOM   1580 N N    A SER A 1 98  ? 38.023 -9.627  28.260 0.86 7.86  ? 1119 SER A N    1 
ATOM   1581 N N    B SER A 1 98  ? 37.982 -9.580  28.218 0.14 8.02  ? 1119 SER A N    1 
ATOM   1582 C CA   A SER A 1 98  ? 37.155 -10.249 27.268 0.86 8.26  ? 1119 SER A CA   1 
ATOM   1583 C CA   B SER A 1 98  ? 37.081 -10.165 27.231 0.14 8.10  ? 1119 SER A CA   1 
ATOM   1584 C C    A SER A 1 98  ? 36.365 -11.430 27.858 0.86 8.23  ? 1119 SER A C    1 
ATOM   1585 C C    B SER A 1 98  ? 36.352 -11.394 27.778 0.14 7.57  ? 1119 SER A C    1 
ATOM   1586 O O    A SER A 1 98  ? 35.175 -11.607 27.593 0.86 9.19  ? 1119 SER A O    1 
ATOM   1587 O O    B SER A 1 98  ? 35.199 -11.646 27.430 0.14 7.34  ? 1119 SER A O    1 
ATOM   1588 C CB   A SER A 1 98  ? 37.974 -10.699 26.069 0.86 11.18 ? 1119 SER A CB   1 
ATOM   1589 C CB   B SER A 1 98  ? 37.860 -10.541 25.978 0.14 6.84  ? 1119 SER A CB   1 
ATOM   1590 O OG   A SER A 1 98  ? 38.675 -9.607  25.487 0.86 14.77 ? 1119 SER A OG   1 
ATOM   1591 O OG   B SER A 1 98  ? 38.942 -11.387 26.317 0.14 4.94  ? 1119 SER A OG   1 
ATOM   1592 H H    A SER A 1 98  ? 38.854 -9.596  28.040 0.86 9.43  ? 1119 SER A H    1 
ATOM   1593 H H    B SER A 1 98  ? 38.804 -9.535  27.968 0.14 9.63  ? 1119 SER A H    1 
ATOM   1594 H HA   A SER A 1 98  ? 36.507 -9.583  26.955 0.86 9.92  ? 1119 SER A HA   1 
ATOM   1595 H HA   B SER A 1 98  ? 36.407 -9.499  26.980 0.14 9.72  ? 1119 SER A HA   1 
ATOM   1596 H HB2  A SER A 1 98  ? 38.615 -11.366 26.359 0.86 13.42 ? 1119 SER A HB2  1 
ATOM   1597 H HB2  B SER A 1 98  ? 37.271 -11.007 25.365 0.14 8.20  ? 1119 SER A HB2  1 
ATOM   1598 H HB3  A SER A 1 98  ? 37.378 -11.080 25.405 0.86 13.42 ? 1119 SER A HB3  1 
ATOM   1599 H HB3  B SER A 1 98  ? 38.204 -9.734  25.563 0.14 8.20  ? 1119 SER A HB3  1 
ATOM   1600 H HG   A SER A 1 98  ? 39.111 -9.866  24.842 0.86 17.72 ? 1119 SER A HG   1 
ATOM   1601 H HG   B SER A 1 98  ? 39.361 -11.589 25.642 0.14 5.93  ? 1119 SER A HG   1 
ATOM   1602 N N    A SER A 1 99  ? 37.022 -12.235 28.673 0.86 7.21  ? 1120 SER A N    1 
ATOM   1603 N N    B SER A 1 99  ? 37.025 -12.157 28.633 0.14 7.04  ? 1120 SER A N    1 
ATOM   1604 C CA   A SER A 1 99  ? 36.389 -13.431 29.200 0.86 7.83  ? 1120 SER A CA   1 
ATOM   1605 C CA   B SER A 1 99  ? 36.449 -13.379 29.192 0.14 8.22  ? 1120 SER A CA   1 
ATOM   1606 C C    A SER A 1 99  ? 35.237 -13.137 30.110 0.86 8.16  ? 1120 SER A C    1 
ATOM   1607 C C    B SER A 1 99  ? 35.236 -13.115 30.069 0.14 8.31  ? 1120 SER A C    1 
ATOM   1608 O O    A SER A 1 99  ? 34.397 -14.004 30.301 0.86 9.73  ? 1120 SER A O    1 
ATOM   1609 O O    B SER A 1 99  ? 34.347 -13.956 30.168 0.14 8.63  ? 1120 SER A O    1 
ATOM   1610 C CB   A SER A 1 99  ? 37.411 -14.315 29.928 0.86 8.80  ? 1120 SER A CB   1 
ATOM   1611 C CB   B SER A 1 99  ? 37.495 -14.142 30.007 0.14 7.23  ? 1120 SER A CB   1 
ATOM   1612 O OG   A SER A 1 99  ? 37.880 -13.712 31.120 0.86 9.46  ? 1120 SER A OG   1 
ATOM   1613 O OG   B SER A 1 99  ? 36.891 -15.182 30.761 0.14 7.59  ? 1120 SER A OG   1 
ATOM   1614 H H    A SER A 1 99  ? 37.832 -12.115 28.936 0.86 8.65  ? 1120 SER A H    1 
ATOM   1615 H H    B SER A 1 99  ? 37.823 -11.989 28.908 0.14 8.45  ? 1120 SER A H    1 
ATOM   1616 H HA   A SER A 1 99  ? 36.039 -13.951 28.446 0.86 9.40  ? 1120 SER A HA   1 
ATOM   1617 H HA   B SER A 1 99  ? 36.164 -13.958 28.454 0.14 9.86  ? 1120 SER A HA   1 
ATOM   1618 H HB2  A SER A 1 99  ? 36.989 -15.160 30.152 0.86 10.56 ? 1120 SER A HB2  1 
ATOM   1619 H HB2  B SER A 1 99  ? 38.146 -14.529 29.401 0.14 8.68  ? 1120 SER A HB2  1 
ATOM   1620 H HB3  A SER A 1 99  ? 38.165 -14.470 29.339 0.86 10.56 ? 1120 SER A HB3  1 
ATOM   1621 H HB3  B SER A 1 99  ? 37.933 -13.525 30.615 0.14 8.68  ? 1120 SER A HB3  1 
ATOM   1622 H HG   A SER A 1 99  ? 37.524 -12.981 31.224 0.86 11.35 ? 1120 SER A HG   1 
ATOM   1623 H HG   B SER A 1 99  ? 37.461 -15.583 31.193 0.14 9.10  ? 1120 SER A HG   1 
ATOM   1624 N N    . THR A 1 100 ? 35.205 -11.952 30.707 1.00 7.62  ? 1121 THR A N    1 
ATOM   1625 C CA   . THR A 1 100 ? 34.137 -11.624 31.658 1.00 7.59  ? 1121 THR A CA   1 
ATOM   1626 C C    . THR A 1 100 ? 33.153 -10.620 31.085 1.00 8.17  ? 1121 THR A C    1 
ATOM   1627 O O    . THR A 1 100 ? 32.355 -10.067 31.818 1.00 9.43  ? 1121 THR A O    1 
ATOM   1628 C CB   . THR A 1 100 ? 34.704 -11.106 32.983 1.00 9.49  ? 1121 THR A CB   1 
ATOM   1629 O OG1  . THR A 1 100 ? 35.471 -9.925  32.746 1.00 14.10 ? 1121 THR A OG1  1 
ATOM   1630 C CG2  . THR A 1 100 ? 35.575 -12.147 33.645 1.00 9.46  ? 1121 THR A CG2  1 
ATOM   1631 H H    . THR A 1 100 ? 35.787 -11.328 30.597 0.14 9.15  ? 1121 THR A H    1 
ATOM   1632 H HA   . THR A 1 100 ? 33.637 -12.443 31.855 1.00 9.11  ? 1121 THR A HA   1 
ATOM   1633 H HB   . THR A 1 100 ? 33.972 -10.896 33.584 1.00 11.39 ? 1121 THR A HB   1 
ATOM   1634 H HG1  . THR A 1 100 ? 36.090 -10.090 32.234 1.00 16.92 ? 1121 THR A HG1  1 
ATOM   1635 H HG21 . THR A 1 100 ? 35.922 -11.806 34.473 1.00 11.35 ? 1121 THR A HG21 1 
ATOM   1636 H HG22 . THR A 1 100 ? 35.062 -12.939 33.824 1.00 11.35 ? 1121 THR A HG22 1 
ATOM   1637 H HG23 . THR A 1 100 ? 36.309 -12.374 33.069 1.00 11.35 ? 1121 THR A HG23 1 
ATOM   1638 N N    . GLY A 1 101 ? 33.170 -10.422 29.770 1.00 6.96  ? 1122 GLY A N    1 
ATOM   1639 C CA   . GLY A 1 101 ? 32.159 -9.633  29.111 1.00 7.28  ? 1122 GLY A CA   1 
ATOM   1640 C C    . GLY A 1 101 ? 32.558 -8.233  28.711 1.00 6.70  ? 1122 GLY A C    1 
ATOM   1641 O O    . GLY A 1 101 ? 31.730 -7.505  28.159 1.00 7.76  ? 1122 GLY A O    1 
ATOM   1642 H H    . GLY A 1 101 ? 33.767 -10.740 29.240 1.00 8.35  ? 1122 GLY A H    1 
ATOM   1643 H HA2  . GLY A 1 101 ? 31.877 -10.100 28.309 1.00 8.74  ? 1122 GLY A HA2  1 
ATOM   1644 H HA3  . GLY A 1 101 ? 31.390 -9.563  29.698 1.00 8.74  ? 1122 GLY A HA3  1 
ATOM   1645 N N    . SER A 1 102 ? 33.799 -7.822  28.956 1.00 6.83  ? 1123 SER A N    1 
ATOM   1646 C CA   . SER A 1 102 ? 34.243 -6.505  28.515 1.00 6.81  ? 1123 SER A CA   1 
ATOM   1647 C C    . SER A 1 102 ? 34.511 -6.513  27.021 1.00 7.42  ? 1123 SER A C    1 
ATOM   1648 O O    . SER A 1 102 ? 35.070 -7.468  26.494 1.00 8.48  ? 1123 SER A O    1 
ATOM   1649 C CB   . SER A 1 102 ? 35.522 -6.108  29.240 1.00 7.57  ? 1123 SER A CB   1 
ATOM   1650 O OG   . SER A 1 102 ? 36.078 -4.938  28.665 1.00 7.02  ? 1123 SER A OG   1 
ATOM   1651 H H    . SER A 1 102 ? 34.397 -8.281  29.370 1.00 8.20  ? 1123 SER A H    1 
ATOM   1652 H HA   . SER A 1 102 ? 33.550 -5.839  28.708 1.00 8.17  ? 1123 SER A HA   1 
ATOM   1653 H HB2  . SER A 1 102 ? 35.317 -5.935  30.173 1.00 9.08  ? 1123 SER A HB2  1 
ATOM   1654 H HB3  . SER A 1 102 ? 36.164 -6.832  29.169 1.00 9.08  ? 1123 SER A HB3  1 
ATOM   1655 H HG   . SER A 1 102 ? 36.766 -4.731  29.060 1.00 8.43  ? 1123 SER A HG   1 
ATOM   1656 N N    . ARG A 1 103 ? 34.138 -5.420  26.366 1.00 7.01  ? 1124 ARG A N    1 
ATOM   1657 C CA   . ARG A 1 103 ? 34.430 -5.157  24.967 1.00 7.62  ? 1124 ARG A CA   1 
ATOM   1658 C C    . ARG A 1 103 ? 35.644 -4.232  24.818 1.00 6.79  ? 1124 ARG A C    1 
ATOM   1659 O O    . ARG A 1 103 ? 35.816 -3.563  23.782 1.00 8.57  ? 1124 ARG A O    1 
ATOM   1660 C CB   . ARG A 1 103 ? 33.180 -4.579  24.345 1.00 7.88  ? 1124 ARG A CB   1 
ATOM   1661 C CG   . ARG A 1 103 ? 32.045 -5.610  24.325 1.00 8.84  ? 1124 ARG A CG   1 
ATOM   1662 C CD   . ARG A 1 103 ? 30.702 -4.956  24.028 1.00 9.91  ? 1124 ARG A CD   1 
ATOM   1663 N NE   . ARG A 1 103 ? 30.283 -4.088  25.117 1.00 9.05  ? 1124 ARG A NE   1 
ATOM   1664 C CZ   . ARG A 1 103 ? 29.162 -3.389  25.127 1.00 10.05 ? 1124 ARG A CZ   1 
ATOM   1665 N NH1  . ARG A 1 103 ? 28.355 -3.403  24.077 1.00 11.38 ? 1124 ARG A NH1  1 
ATOM   1666 N NH2  . ARG A 1 103 ? 28.859 -2.635  26.179 1.00 9.42  ? 1124 ARG A NH2  1 
ATOM   1667 H H    . ARG A 1 103 ? 33.691 -4.785  26.735 1.00 8.42  ? 1124 ARG A H    1 
ATOM   1668 H HA   . ARG A 1 103 ? 34.633 -6.003  24.515 1.00 9.15  ? 1124 ARG A HA   1 
ATOM   1669 H HB2  . ARG A 1 103 ? 32.888 -3.813  24.864 1.00 9.46  ? 1124 ARG A HB2  1 
ATOM   1670 H HB3  . ARG A 1 103 ? 33.369 -4.314  23.431 1.00 9.46  ? 1124 ARG A HB3  1 
ATOM   1671 H HG2  . ARG A 1 103 ? 32.222 -6.267  23.634 1.00 10.61 ? 1124 ARG A HG2  1 
ATOM   1672 H HG3  . ARG A 1 103 ? 31.988 -6.040  25.192 1.00 10.61 ? 1124 ARG A HG3  1 
ATOM   1673 H HD2  . ARG A 1 103 ? 30.777 -4.420  23.223 1.00 11.89 ? 1124 ARG A HD2  1 
ATOM   1674 H HD3  . ARG A 1 103 ? 30.029 -5.645  23.912 1.00 11.89 ? 1124 ARG A HD3  1 
ATOM   1675 H HE   . ARG A 1 103 ? 30.800 -4.025  25.801 1.00 10.86 ? 1124 ARG A HE   1 
ATOM   1676 H HH11 . ARG A 1 103 ? 28.547 -3.891  23.395 1.00 13.66 ? 1124 ARG A HH11 1 
ATOM   1677 H HH12 . ARG A 1 103 ? 27.631 -2.940  24.084 1.00 13.66 ? 1124 ARG A HH12 1 
ATOM   1678 H HH21 . ARG A 1 103 ? 29.386 -2.614  26.859 1.00 11.30 ? 1124 ARG A HH21 1 
ATOM   1679 H HH22 . ARG A 1 103 ? 28.138 -2.167  26.179 1.00 11.30 ? 1124 ARG A HH22 1 
ATOM   1680 N N    . ILE A 1 104 ? 36.526 -4.228  25.816 1.00 7.77  ? 1125 ILE A N    1 
ATOM   1681 C CA   . ILE A 1 104 ? 37.740 -3.418  25.779 1.00 8.61  ? 1125 ILE A CA   1 
ATOM   1682 C C    . ILE A 1 104 ? 38.543 -3.660  24.503 1.00 9.33  ? 1125 ILE A C    1 
ATOM   1683 O O    . ILE A 1 104 ? 39.094 -2.713  23.916 1.00 9.82  ? 1125 ILE A O    1 
ATOM   1684 C CB   . ILE A 1 104 ? 38.590 -3.672  27.064 1.00 8.03  ? 1125 ILE A CB   1 
ATOM   1685 C CG1  . ILE A 1 104 ? 39.756 -2.695  27.160 1.00 9.46  ? 1125 ILE A CG1  1 
ATOM   1686 C CG2  . ILE A 1 104 ? 39.067 -5.135  27.191 1.00 9.23  ? 1125 ILE A CG2  1 
ATOM   1687 C CD1  . ILE A 1 104 ? 40.521 -2.735  28.461 1.00 10.09 ? 1125 ILE A CD1  1 
ATOM   1688 H H    . ILE A 1 104 ? 36.441 -4.692  26.534 1.00 9.33  ? 1125 ILE A H    1 
ATOM   1689 H HA   . ILE A 1 104 ? 37.480 -2.473  25.784 1.00 10.33 ? 1125 ILE A HA   1 
ATOM   1690 H HB   . ILE A 1 104 ? 38.012 -3.497  27.823 1.00 9.63  ? 1125 ILE A HB   1 
ATOM   1691 H HG12 . ILE A 1 104 ? 40.382 -2.893  26.446 1.00 11.35 ? 1125 ILE A HG12 1 
ATOM   1692 H HG13 . ILE A 1 104 ? 39.413 -1.795  27.051 1.00 11.35 ? 1125 ILE A HG13 1 
ATOM   1693 H HG21 . ILE A 1 104 ? 39.581 -5.227  27.996 1.00 11.08 ? 1125 ILE A HG21 1 
ATOM   1694 H HG22 . ILE A 1 104 ? 38.300 -5.711  27.224 1.00 11.08 ? 1125 ILE A HG22 1 
ATOM   1695 H HG23 . ILE A 1 104 ? 39.609 -5.354  26.429 1.00 11.08 ? 1125 ILE A HG23 1 
ATOM   1696 H HD11 . ILE A 1 104 ? 41.231 -2.090  28.426 1.00 12.11 ? 1125 ILE A HD11 1 
ATOM   1697 H HD12 . ILE A 1 104 ? 39.923 -2.526  29.182 1.00 12.11 ? 1125 ILE A HD12 1 
ATOM   1698 H HD13 . ILE A 1 104 ? 40.885 -3.616  28.582 1.00 12.11 ? 1125 ILE A HD13 1 
ATOM   1699 N N    . ALA A 1 105 ? 38.601 -4.905  24.026 1.00 9.74  ? 1126 ALA A N    1 
ATOM   1700 C CA   . ALA A 1 105 ? 39.465 -5.205  22.890 1.00 11.47 ? 1126 ALA A CA   1 
ATOM   1701 C C    . ALA A 1 105 ? 38.960 -4.497  21.638 1.00 10.27 ? 1126 ALA A C    1 
ATOM   1702 O O    . ALA A 1 105 ? 39.727 -4.245  20.731 1.00 11.86 ? 1126 ALA A O    1 
ATOM   1703 C CB   . ALA A 1 105 ? 39.533 -6.710  22.649 1.00 13.52 ? 1126 ALA A CB   1 
ATOM   1704 H H    . ALA A 1 105 ? 38.161 -5.577  24.334 1.00 11.68 ? 1126 ALA A H    1 
ATOM   1705 H HA   . ALA A 1 105 ? 40.371 -4.883  23.080 1.00 13.76 ? 1126 ALA A HA   1 
ATOM   1706 H HB1  . ALA A 1 105 ? 40.107 -6.881  21.899 1.00 16.23 ? 1126 ALA A HB1  1 
ATOM   1707 H HB2  . ALA A 1 105 ? 39.886 -7.136  23.434 1.00 16.23 ? 1126 ALA A HB2  1 
ATOM   1708 H HB3  . ALA A 1 105 ? 38.649 -7.037  22.467 1.00 16.23 ? 1126 ALA A HB3  1 
ATOM   1709 N N    . GLU A 1 106 ? 37.658 -4.216  21.588 1.00 10.05 ? 1127 GLU A N    1 
ATOM   1710 C CA   . GLU A 1 106 ? 36.993 -3.588  20.456 1.00 11.74 ? 1127 GLU A CA   1 
ATOM   1711 C C    . GLU A 1 106 ? 36.926 -2.081  20.597 1.00 11.17 ? 1127 GLU A C    1 
ATOM   1712 O O    . GLU A 1 106 ? 36.300 -1.395  19.786 1.00 14.46 ? 1127 GLU A O    1 
ATOM   1713 C CB   . GLU A 1 106 ? 35.557 -4.117  20.342 1.00 15.08 ? 1127 GLU A CB   1 
ATOM   1714 C CG   . GLU A 1 106 ? 35.469 -5.623  20.235 1.00 21.74 ? 1127 GLU A CG   1 
ATOM   1715 C CD   . GLU A 1 106 ? 34.064 -6.154  20.479 1.00 30.41 ? 1127 GLU A CD   1 
ATOM   1716 O OE1  . GLU A 1 106 ? 33.113 -5.363  20.689 1.00 27.25 ? 1127 GLU A OE1  1 
ATOM   1717 O OE2  . GLU A 1 106 ? 33.909 -7.390  20.451 1.00 39.54 ? 1127 GLU A OE2  1 
ATOM   1718 H H    . GLU A 1 106 ? 37.117 -4.391  22.233 1.00 12.06 ? 1127 GLU A H    1 
ATOM   1719 H HA   . GLU A 1 106 ? 37.474 -3.804  19.630 1.00 14.08 ? 1127 GLU A HA   1 
ATOM   1720 H HB2  . GLU A 1 106 ? 35.061 -3.846  21.130 1.00 18.10 ? 1127 GLU A HB2  1 
ATOM   1721 H HB3  . GLU A 1 106 ? 35.147 -3.739  19.549 1.00 18.10 ? 1127 GLU A HB3  1 
ATOM   1722 H HG2  . GLU A 1 106 ? 35.740 -5.892  19.343 1.00 26.08 ? 1127 GLU A HG2  1 
ATOM   1723 H HG3  . GLU A 1 106 ? 36.058 -6.021  20.894 1.00 26.08 ? 1127 GLU A HG3  1 
ATOM   1724 N N    . GLY A 1 107 ? 37.538 -1.535  21.637 1.00 10.75 ? 1128 GLY A N    1 
ATOM   1725 C CA   . GLY A 1 107 ? 37.572 -0.090  21.796 1.00 11.70 ? 1128 GLY A CA   1 
ATOM   1726 C C    . GLY A 1 107 ? 36.318 0.503   22.412 1.00 10.78 ? 1128 GLY A C    1 
ATOM   1727 O O    . GLY A 1 107 ? 36.108 1.714   22.329 1.00 15.35 ? 1128 GLY A O    1 
ATOM   1728 H H    . GLY A 1 107 ? 37.937 -1.974  22.260 1.00 12.90 ? 1128 GLY A H    1 
ATOM   1729 H HA2  . GLY A 1 107 ? 38.325 0.148   22.359 1.00 14.04 ? 1128 GLY A HA2  1 
ATOM   1730 H HA3  . GLY A 1 107 ? 37.703 0.321   20.927 1.00 14.04 ? 1128 GLY A HA3  1 
ATOM   1731 N N    . VAL A 1 108 ? 35.484 -0.317  23.039 1.00 9.45  ? 1129 VAL A N    1 
ATOM   1732 C CA   . VAL A 1 108 ? 34.329 0.193   23.746 1.00 8.87  ? 1129 VAL A CA   1 
ATOM   1733 C C    . VAL A 1 108 ? 34.809 0.880   25.021 1.00 8.04  ? 1129 VAL A C    1 
ATOM   1734 O O    . VAL A 1 108 ? 35.645 0.352   25.743 1.00 8.28  ? 1129 VAL A O    1 
ATOM   1735 C CB   . VAL A 1 108 ? 33.360 -0.956  24.053 1.00 8.11  ? 1129 VAL A CB   1 
ATOM   1736 C CG1  . VAL A 1 108 ? 32.279 -0.561  25.074 1.00 8.42  ? 1129 VAL A CG1  1 
ATOM   1737 C CG2  . VAL A 1 108 ? 32.732 -1.489  22.756 1.00 9.75  ? 1129 VAL A CG2  1 
ATOM   1738 H H    . VAL A 1 108 ? 35.568 -1.173  23.068 1.00 11.34 ? 1129 VAL A H    1 
ATOM   1739 H HA   . VAL A 1 108 ? 33.867 0.854   23.189 1.00 10.64 ? 1129 VAL A HA   1 
ATOM   1740 H HB   . VAL A 1 108 ? 33.874 -1.691  24.448 1.00 9.73  ? 1129 VAL A HB   1 
ATOM   1741 H HG11 . VAL A 1 108 ? 31.704 -1.314  25.227 1.00 10.11 ? 1129 VAL A HG11 1 
ATOM   1742 H HG12 . VAL A 1 108 ? 32.704 -0.301  25.895 1.00 10.11 ? 1129 VAL A HG12 1 
ATOM   1743 H HG13 . VAL A 1 108 ? 31.770 0.173   24.722 1.00 10.11 ? 1129 VAL A HG13 1 
ATOM   1744 H HG21 . VAL A 1 108 ? 32.131 -2.206  22.972 1.00 11.70 ? 1129 VAL A HG21 1 
ATOM   1745 H HG22 . VAL A 1 108 ? 32.253 -0.778  22.326 1.00 11.70 ? 1129 VAL A HG22 1 
ATOM   1746 H HG23 . VAL A 1 108 ? 33.430 -1.809  22.180 1.00 11.70 ? 1129 VAL A HG23 1 
ATOM   1747 N N    . PRO A 1 109 ? 34.261 2.059   25.329 1.00 8.19  ? 1130 PRO A N    1 
ATOM   1748 C CA   . PRO A 1 109 ? 34.644 2.746   26.565 1.00 7.79  ? 1130 PRO A CA   1 
ATOM   1749 C C    . PRO A 1 109 ? 34.475 1.873   27.802 1.00 7.40  ? 1130 PRO A C    1 
ATOM   1750 O O    . PRO A 1 109 ? 33.439 1.245   27.996 1.00 8.31  ? 1130 PRO A O    1 
ATOM   1751 C CB   . PRO A 1 109 ? 33.684 3.936   26.618 1.00 9.84  ? 1130 PRO A CB   1 
ATOM   1752 C CG   . PRO A 1 109 ? 33.432 4.266   25.164 1.00 11.15 ? 1130 PRO A CG   1 
ATOM   1753 C CD   . PRO A 1 109 ? 33.358 2.883   24.508 1.00 9.46  ? 1130 PRO A CD   1 
ATOM   1754 H HA   . PRO A 1 109 ? 35.568 3.069   26.510 1.00 9.35  ? 1130 PRO A HA   1 
ATOM   1755 H HB2  . PRO A 1 109 ? 32.861 3.677   27.062 1.00 11.81 ? 1130 PRO A HB2  1 
ATOM   1756 H HB3  . PRO A 1 109 ? 34.106 4.681   27.074 1.00 11.81 ? 1130 PRO A HB3  1 
ATOM   1757 H HG2  . PRO A 1 109 ? 32.593 4.743   25.070 1.00 13.38 ? 1130 PRO A HG2  1 
ATOM   1758 H HG3  . PRO A 1 109 ? 34.171 4.783   24.806 1.00 13.38 ? 1130 PRO A HG3  1 
ATOM   1759 H HD2  . PRO A 1 109 ? 32.452 2.537   24.552 1.00 11.36 ? 1130 PRO A HD2  1 
ATOM   1760 H HD3  . PRO A 1 109 ? 33.678 2.925   23.593 1.00 11.36 ? 1130 PRO A HD3  1 
ATOM   1761 N N    . GLN A 1 110 ? 35.498 1.903   28.642 1.00 7.59  ? 1131 GLN A N    1 
ATOM   1762 C CA   . GLN A 1 110 ? 35.524 1.183   29.906 1.00 7.16  ? 1131 GLN A CA   1 
ATOM   1763 C C    . GLN A 1 110 ? 35.379 2.205   31.036 1.00 7.03  ? 1131 GLN A C    1 
ATOM   1764 O O    . GLN A 1 110 ? 36.373 2.804   31.475 1.00 9.53  ? 1131 GLN A O    1 
ATOM   1765 C CB   . GLN A 1 110 ? 36.845 0.421   30.053 1.00 8.11  ? 1131 GLN A CB   1 
ATOM   1766 C CG   . GLN A 1 110 ? 37.153 -0.540  28.916 1.00 8.84  ? 1131 GLN A CG   1 
ATOM   1767 C CD   . GLN A 1 110 ? 36.159 -1.679  28.875 1.00 7.99  ? 1131 GLN A CD   1 
ATOM   1768 O OE1  . GLN A 1 110 ? 36.095 -2.518  29.786 1.00 8.82  ? 1131 GLN A OE1  1 
ATOM   1769 N NE2  . GLN A 1 110 ? 35.374 -1.717  27.810 1.00 7.47  ? 1131 GLN A NE2  1 
ATOM   1770 H H    . GLN A 1 110 ? 36.217 2.352   28.496 1.00 9.11  ? 1131 GLN A H    1 
ATOM   1771 H HA   . GLN A 1 110 ? 34.779 0.548   29.948 1.00 8.60  ? 1131 GLN A HA   1 
ATOM   1772 H HB2  . GLN A 1 110 ? 37.570 1.064   30.098 1.00 9.73  ? 1131 GLN A HB2  1 
ATOM   1773 H HB3  . GLN A 1 110 ? 36.815 -0.095  30.874 1.00 9.73  ? 1131 GLN A HB3  1 
ATOM   1774 H HG2  . GLN A 1 110 ? 37.106 -0.064  28.072 1.00 10.61 ? 1131 GLN A HG2  1 
ATOM   1775 H HG3  . GLN A 1 110 ? 38.039 -0.913  29.043 1.00 10.61 ? 1131 GLN A HG3  1 
ATOM   1776 H HE21 . GLN A 1 110 ? 35.450 -1.116  27.199 1.00 8.96  ? 1131 GLN A HE21 1 
ATOM   1777 H HE22 . GLN A 1 110 ? 34.788 -2.341  27.730 1.00 8.96  ? 1131 GLN A HE22 1 
ATOM   1778 N N    . LEU A 1 111 ? 34.149 2.433   31.481 1.00 6.11  ? 1132 LEU A N    1 
ATOM   1779 C CA   . LEU A 1 111 ? 33.863 3.488   32.444 1.00 6.86  ? 1132 LEU A CA   1 
ATOM   1780 C C    . LEU A 1 111 ? 33.767 2.879   33.825 1.00 6.68  ? 1132 LEU A C    1 
ATOM   1781 O O    . LEU A 1 111 ? 33.031 1.941   34.027 1.00 10.21 ? 1132 LEU A O    1 
ATOM   1782 C CB   . LEU A 1 111 ? 32.543 4.189   32.076 1.00 7.70  ? 1132 LEU A CB   1 
ATOM   1783 C CG   . LEU A 1 111 ? 32.521 4.720   30.623 1.00 11.16 ? 1132 LEU A CG   1 
ATOM   1784 C CD1  . LEU A 1 111 ? 31.226 5.452   30.354 1.00 12.16 ? 1132 LEU A CD1  1 
ATOM   1785 C CD2  . LEU A 1 111 ? 33.734 5.557   30.238 1.00 10.66 ? 1132 LEU A CD2  1 
ATOM   1786 H H    . LEU A 1 111 ? 33.456 1.986   31.238 1.00 7.33  ? 1132 LEU A H    1 
ATOM   1787 H HA   . LEU A 1 111 ? 34.585 4.149   32.438 1.00 8.23  ? 1132 LEU A HA   1 
ATOM   1788 H HB2  . LEU A 1 111 ? 31.813 3.557   32.174 1.00 9.24  ? 1132 LEU A HB2  1 
ATOM   1789 H HB3  . LEU A 1 111 ? 32.410 4.943   32.672 1.00 9.24  ? 1132 LEU A HB3  1 
ATOM   1790 H HG   . LEU A 1 111 ? 32.525 3.949   30.035 1.00 13.39 ? 1132 LEU A HG   1 
ATOM   1791 H HD11 . LEU A 1 111 ? 31.231 5.773   29.450 1.00 14.59 ? 1132 LEU A HD11 1 
ATOM   1792 H HD12 . LEU A 1 111 ? 30.493 4.846   30.483 1.00 14.59 ? 1132 LEU A HD12 1 
ATOM   1793 H HD13 . LEU A 1 111 ? 31.152 6.189   30.964 1.00 14.59 ? 1132 LEU A HD13 1 
ATOM   1794 H HD21 . LEU A 1 111 ? 33.639 5.844   29.327 1.00 12.80 ? 1132 LEU A HD21 1 
ATOM   1795 H HD22 . LEU A 1 111 ? 33.784 6.320   30.818 1.00 12.80 ? 1132 LEU A HD22 1 
ATOM   1796 H HD23 . LEU A 1 111 ? 34.525 5.021   30.332 1.00 12.80 ? 1132 LEU A HD23 1 
ATOM   1797 N N    . LEU A 1 112 ? 34.569 3.397   34.742 1.00 5.76  ? 1133 LEU A N    1 
ATOM   1798 C CA   . LEU A 1 112 ? 34.718 2.782   36.066 1.00 5.58  ? 1133 LEU A CA   1 
ATOM   1799 C C    . LEU A 1 112 ? 34.315 3.809   37.104 1.00 6.02  ? 1133 LEU A C    1 
ATOM   1800 O O    . LEU A 1 112 ? 35.037 4.786   37.333 1.00 8.02  ? 1133 LEU A O    1 
ATOM   1801 C CB   . LEU A 1 112 ? 36.176 2.363   36.271 1.00 7.28  ? 1133 LEU A CB   1 
ATOM   1802 C CG   . LEU A 1 112 ? 36.518 1.787   37.644 1.00 8.11  ? 1133 LEU A CG   1 
ATOM   1803 C CD1  . LEU A 1 112 ? 35.660 0.587   37.983 1.00 8.33  ? 1133 LEU A CD1  1 
ATOM   1804 C CD2  . LEU A 1 112 ? 38.002 1.399   37.639 1.00 9.77  ? 1133 LEU A CD2  1 
ATOM   1805 H H    . LEU A 1 112 ? 35.043 4.106   34.629 1.00 6.91  ? 1133 LEU A H    1 
ATOM   1806 H HA   . LEU A 1 112 ? 34.138 1.995   36.144 1.00 6.70  ? 1133 LEU A HA   1 
ATOM   1807 H HB2  . LEU A 1 112 ? 36.396 1.687   35.610 1.00 8.73  ? 1133 LEU A HB2  1 
ATOM   1808 H HB3  . LEU A 1 112 ? 36.740 3.141   36.135 1.00 8.73  ? 1133 LEU A HB3  1 
ATOM   1809 H HG   . LEU A 1 112 ? 36.380 2.466   38.323 1.00 9.74  ? 1133 LEU A HG   1 
ATOM   1810 H HD11 . LEU A 1 112 ? 35.910 0.261   38.851 1.00 10.00 ? 1133 LEU A HD11 1 
ATOM   1811 H HD12 . LEU A 1 112 ? 34.738 0.853   37.985 1.00 10.00 ? 1133 LEU A HD12 1 
ATOM   1812 H HD13 . LEU A 1 112 ? 35.803 -0.095  37.323 1.00 10.00 ? 1133 LEU A HD13 1 
ATOM   1813 H HD21 . LEU A 1 112 ? 38.232 1.035   38.497 1.00 11.72 ? 1133 LEU A HD21 1 
ATOM   1814 H HD22 . LEU A 1 112 ? 38.151 0.743   36.954 1.00 11.72 ? 1133 LEU A HD22 1 
ATOM   1815 H HD23 . LEU A 1 112 ? 38.529 2.182   37.464 1.00 11.72 ? 1133 LEU A HD23 1 
ATOM   1816 N N    . ILE A 1 113 ? 33.166 3.612   37.746 1.00 5.29  ? 1134 ILE A N    1 
ATOM   1817 C CA   . ILE A 1 113 ? 32.649 4.533   38.734 1.00 5.68  ? 1134 ILE A CA   1 
ATOM   1818 C C    . ILE A 1 113 ? 33.025 3.989   40.104 1.00 5.53  ? 1134 ILE A C    1 
ATOM   1819 O O    . ILE A 1 113 ? 32.600 2.882   40.457 1.00 6.01  ? 1134 ILE A O    1 
ATOM   1820 C CB   . ILE A 1 113 ? 31.148 4.691   38.581 1.00 6.12  ? 1134 ILE A CB   1 
ATOM   1821 C CG1  . ILE A 1 113 ? 30.823 5.287   37.202 1.00 8.84  ? 1134 ILE A CG1  1 
ATOM   1822 C CG2  . ILE A 1 113 ? 30.593 5.557   39.693 1.00 8.14  ? 1134 ILE A CG2  1 
ATOM   1823 C CD1  . ILE A 1 113 ? 29.354 5.268   36.826 1.00 9.60  ? 1134 ILE A CD1  1 
ATOM   1824 H H    . ILE A 1 113 ? 32.659 2.930   37.618 1.00 6.34  ? 1134 ILE A H    1 
ATOM   1825 H HA   . ILE A 1 113 ? 33.069 5.411   38.618 1.00 6.82  ? 1134 ILE A HA   1 
ATOM   1826 H HB   . ILE A 1 113 ? 30.739 3.813   38.641 1.00 7.34  ? 1134 ILE A HB   1 
ATOM   1827 H HG12 . ILE A 1 113 ? 31.116 6.212   37.189 1.00 10.60 ? 1134 ILE A HG12 1 
ATOM   1828 H HG13 . ILE A 1 113 ? 31.305 4.784   36.527 1.00 10.60 ? 1134 ILE A HG13 1 
ATOM   1829 H HG21 . ILE A 1 113 ? 29.644 5.644   39.578 1.00 9.77  ? 1134 ILE A HG21 1 
ATOM   1830 H HG22 . ILE A 1 113 ? 30.784 5.142   40.537 1.00 9.77  ? 1134 ILE A HG22 1 
ATOM   1831 H HG23 . ILE A 1 113 ? 31.008 6.422   39.652 1.00 9.77  ? 1134 ILE A HG23 1 
ATOM   1832 H HD11 . ILE A 1 113 ? 29.250 5.658   35.955 1.00 11.52 ? 1134 ILE A HD11 1 
ATOM   1833 H HD12 . ILE A 1 113 ? 29.046 4.358   36.817 1.00 11.52 ? 1134 ILE A HD12 1 
ATOM   1834 H HD13 . ILE A 1 113 ? 28.859 5.775   37.473 1.00 11.52 ? 1134 ILE A HD13 1 
ATOM   1835 N N    . VAL A 1 114 ? 33.840 4.732   40.853 1.00 5.19  ? 1135 VAL A N    1 
ATOM   1836 C CA   . VAL A 1 114 ? 34.372 4.280   42.121 1.00 5.53  ? 1135 VAL A CA   1 
ATOM   1837 C C    . VAL A 1 114 ? 33.718 5.097   43.223 1.00 6.09  ? 1135 VAL A C    1 
ATOM   1838 O O    . VAL A 1 114 ? 33.679 6.334   43.148 1.00 7.41  ? 1135 VAL A O    1 
ATOM   1839 C CB   . VAL A 1 114 ? 35.881 4.494   42.160 1.00 6.64  ? 1135 VAL A CB   1 
ATOM   1840 C CG1  . VAL A 1 114 ? 36.464 3.935   43.446 1.00 8.01  ? 1135 VAL A CG1  1 
ATOM   1841 C CG2  . VAL A 1 114 ? 36.546 3.876   40.936 1.00 7.09  ? 1135 VAL A CG2  1 
ATOM   1842 H H    . VAL A 1 114 ? 34.102 5.521   40.634 1.00 6.23  ? 1135 VAL A H    1 
ATOM   1843 H HA   . VAL A 1 114 ? 34.173 3.331   42.257 1.00 6.63  ? 1135 VAL A HA   1 
ATOM   1844 H HB   . VAL A 1 114 ? 36.063 5.457   42.143 1.00 7.97  ? 1135 VAL A HB   1 
ATOM   1845 H HG11 . VAL A 1 114 ? 37.413 4.080   43.449 1.00 9.61  ? 1135 VAL A HG11 1 
ATOM   1846 H HG12 . VAL A 1 114 ? 36.061 4.384   44.193 1.00 9.61  ? 1135 VAL A HG12 1 
ATOM   1847 H HG13 . VAL A 1 114 ? 36.276 2.994   43.490 1.00 9.61  ? 1135 VAL A HG13 1 
ATOM   1848 H HG21 . VAL A 1 114 ? 37.493 4.025   40.986 1.00 8.51  ? 1135 VAL A HG21 1 
ATOM   1849 H HG22 . VAL A 1 114 ? 36.362 2.933   40.924 1.00 8.51  ? 1135 VAL A HG22 1 
ATOM   1850 H HG23 . VAL A 1 114 ? 36.190 4.289   40.145 1.00 8.51  ? 1135 VAL A HG23 1 
ATOM   1851 N N    . LEU A 1 115 ? 33.169 4.428   44.240 1.00 6.29  ? 1136 LEU A N    1 
ATOM   1852 C CA   . LEU A 1 115 ? 32.510 5.080   45.362 1.00 7.26  ? 1136 LEU A CA   1 
ATOM   1853 C C    . LEU A 1 115 ? 33.185 4.632   46.653 1.00 6.84  ? 1136 LEU A C    1 
ATOM   1854 O O    . LEU A 1 115 ? 33.240 3.439   46.947 1.00 7.30  ? 1136 LEU A O    1 
ATOM   1855 C CB   . LEU A 1 115 ? 31.019 4.728   45.394 1.00 8.61  ? 1136 LEU A CB   1 
ATOM   1856 C CG   . LEU A 1 115 ? 30.194 5.354   44.265 1.00 9.09  ? 1136 LEU A CG   1 
ATOM   1857 C CD1  . LEU A 1 115 ? 29.331 4.317   43.519 1.00 14.97 ? 1136 LEU A CD1  1 
ATOM   1858 C CD2  . LEU A 1 115 ? 29.343 6.518   44.749 1.00 11.07 ? 1136 LEU A CD2  1 
ATOM   1859 H H    . LEU A 1 115 ? 33.168 3.570   44.299 1.00 7.55  ? 1136 LEU A H    1 
ATOM   1860 H HA   . LEU A 1 115 ? 32.602 6.052   45.279 1.00 8.71  ? 1136 LEU A HA   1 
ATOM   1861 H HB2  . LEU A 1 115 ? 30.926 3.765   45.328 1.00 10.34 ? 1136 LEU A HB2  1 
ATOM   1862 H HB3  . LEU A 1 115 ? 30.646 5.035   46.235 1.00 10.34 ? 1136 LEU A HB3  1 
ATOM   1863 H HG   . LEU A 1 115 ? 30.816 5.716   43.615 1.00 10.90 ? 1136 LEU A HG   1 
ATOM   1864 H HD11 . LEU A 1 115 ? 28.839 4.762   42.826 1.00 17.96 ? 1136 LEU A HD11 1 
ATOM   1865 H HD12 . LEU A 1 115 ? 29.906 3.650   43.136 1.00 17.96 ? 1136 LEU A HD12 1 
ATOM   1866 H HD13 . LEU A 1 115 ? 28.726 3.909   44.142 1.00 17.96 ? 1136 LEU A HD13 1 
ATOM   1867 H HD21 . LEU A 1 115 ? 28.848 6.873   44.007 1.00 13.28 ? 1136 LEU A HD21 1 
ATOM   1868 H HD22 . LEU A 1 115 ? 28.739 6.203   45.426 1.00 13.28 ? 1136 LEU A HD22 1 
ATOM   1869 H HD23 . LEU A 1 115 ? 29.918 7.195   45.113 1.00 13.28 ? 1136 LEU A HD23 1 
ATOM   1870 N N    . THR A 1 116 ? 33.691 5.596   47.432 1.00 7.38  ? 1137 THR A N    1 
ATOM   1871 C CA   . THR A 1 116 ? 34.330 5.283   48.706 1.00 7.54  ? 1137 THR A CA   1 
ATOM   1872 C C    . THR A 1 116 ? 34.108 6.404   49.688 1.00 7.90  ? 1137 THR A C    1 
ATOM   1873 O O    . THR A 1 116 ? 33.852 7.538   49.294 1.00 8.22  ? 1137 THR A O    1 
ATOM   1874 C CB   . THR A 1 116 ? 35.825 4.968   48.519 1.00 8.43  ? 1137 THR A CB   1 
ATOM   1875 O OG1  . THR A 1 116 ? 36.443 4.556   49.751 1.00 9.19  ? 1137 THR A OG1  1 
ATOM   1876 C CG2  . THR A 1 116 ? 36.578 6.139   47.969 1.00 9.76  ? 1137 THR A CG2  1 
ATOM   1877 H H    . THR A 1 116 ? 33.674 6.434   47.243 1.00 8.85  ? 1137 THR A H    1 
ATOM   1878 H HA   . THR A 1 116 ? 33.906 4.481   49.076 1.00 9.05  ? 1137 THR A HA   1 
ATOM   1879 H HB   . THR A 1 116 ? 35.907 4.244   47.878 1.00 10.11 ? 1137 THR A HB   1 
ATOM   1880 H HG1  . THR A 1 116 ? 36.076 3.881   50.036 1.00 11.03 ? 1137 THR A HG1  1 
ATOM   1881 H HG21 . THR A 1 116 ? 37.505 5.913   47.864 1.00 11.71 ? 1137 THR A HG21 1 
ATOM   1882 H HG22 . THR A 1 116 ? 36.219 6.388   47.115 1.00 11.71 ? 1137 THR A HG22 1 
ATOM   1883 H HG23 . THR A 1 116 ? 36.505 6.886   48.568 1.00 11.71 ? 1137 THR A HG23 1 
ATOM   1884 N N    . ALA A 1 117 ? 34.214 6.067   50.972 1.00 8.70  ? 1138 ALA A N    1 
ATOM   1885 C CA   . ALA A 1 117 ? 33.912 7.027   52.025 1.00 9.81  ? 1138 ALA A CA   1 
ATOM   1886 C C    . ALA A 1 117 ? 35.064 7.254   53.007 1.00 10.48 ? 1138 ALA A C    1 
ATOM   1887 O O    . ALA A 1 117 ? 34.859 7.858   54.041 1.00 12.34 ? 1138 ALA A O    1 
ATOM   1888 C CB   . ALA A 1 117 ? 32.656 6.609   52.782 1.00 11.98 ? 1138 ALA A CB   1 
ATOM   1889 H H    . ALA A 1 117 ? 34.457 5.292   51.256 1.00 10.44 ? 1138 ALA A H    1 
ATOM   1890 H HA   . ALA A 1 117 ? 33.720 7.890   51.602 1.00 11.77 ? 1138 ALA A HA   1 
ATOM   1891 H HB1  . ALA A 1 117 ? 32.477 7.255   53.469 1.00 14.37 ? 1138 ALA A HB1  1 
ATOM   1892 H HB2  . ALA A 1 117 ? 31.920 6.571   52.168 1.00 14.37 ? 1138 ALA A HB2  1 
ATOM   1893 H HB3  . ALA A 1 117 ? 32.802 5.745   53.174 1.00 14.37 ? 1138 ALA A HB3  1 
ATOM   1894 N N    . GLU A 1 118 ? 36.261 6.775   52.695 1.00 11.07 ? 1139 GLU A N    1 
ATOM   1895 C CA   . GLU A 1 118 ? 37.399 6.993   53.570 1.00 11.86 ? 1139 GLU A CA   1 
ATOM   1896 C C    . GLU A 1 118 ? 38.673 7.045   52.757 1.00 10.78 ? 1139 GLU A C    1 
ATOM   1897 O O    . GLU A 1 118 ? 38.695 6.590   51.614 1.00 10.21 ? 1139 GLU A O    1 
ATOM   1898 C CB   . GLU A 1 118 ? 37.471 5.887   54.631 1.00 17.14 ? 1139 GLU A CB   1 
ATOM   1899 C CG   . GLU A 1 118 ? 37.466 4.466   54.095 1.00 29.01 ? 1139 GLU A CG   1 
ATOM   1900 C CD   . GLU A 1 118 ? 36.049 3.837   53.926 1.00 40.17 ? 1139 GLU A CD   1 
ATOM   1901 O OE1  . GLU A 1 118 ? 35.007 4.449   54.253 1.00 38.85 ? 1139 GLU A OE1  1 
ATOM   1902 O OE2  . GLU A 1 118 ? 35.990 2.681   53.457 1.00 44.28 ? 1139 GLU A OE2  1 
ATOM   1903 H H    . GLU A 1 118 ? 36.438 6.322   51.986 1.00 13.29 ? 1139 GLU A H    1 
ATOM   1904 H HA   . GLU A 1 118 ? 37.293 7.852   54.030 1.00 14.24 ? 1139 GLU A HA   1 
ATOM   1905 H HB2  . GLU A 1 118 ? 38.289 6.003   55.140 1.00 20.56 ? 1139 GLU A HB2  1 
ATOM   1906 H HB3  . GLU A 1 118 ? 36.708 5.978   55.222 1.00 20.56 ? 1139 GLU A HB3  1 
ATOM   1907 H HG2  . GLU A 1 118 ? 37.894 4.463   53.224 1.00 34.82 ? 1139 GLU A HG2  1 
ATOM   1908 H HG3  . GLU A 1 118 ? 37.966 3.903   54.706 1.00 34.82 ? 1139 GLU A HG3  1 
ATOM   1909 N N    . PRO A 1 119 ? 39.736 7.603   53.332 1.00 11.63 ? 1140 PRO A N    1 
ATOM   1910 C CA   . PRO A 1 119 ? 41.023 7.488   52.648 1.00 10.51 ? 1140 PRO A CA   1 
ATOM   1911 C C    . PRO A 1 119 ? 41.383 6.020   52.420 1.00 11.24 ? 1140 PRO A C    1 
ATOM   1912 O O    . PRO A 1 119 ? 41.069 5.157   53.237 1.00 12.78 ? 1140 PRO A O    1 
ATOM   1913 C CB   . PRO A 1 119 ? 41.999 8.178   53.611 1.00 13.61 ? 1140 PRO A CB   1 
ATOM   1914 C CG   . PRO A 1 119 ? 41.141 9.110   54.360 1.00 15.13 ? 1140 PRO A CG   1 
ATOM   1915 C CD   . PRO A 1 119 ? 39.865 8.369   54.584 1.00 14.44 ? 1140 PRO A CD   1 
ATOM   1916 H HA   . PRO A 1 119 ? 41.007 7.965   51.792 1.00 12.61 ? 1140 PRO A HA   1 
ATOM   1917 H HB2  . PRO A 1 119 ? 42.400 7.522   54.203 1.00 16.34 ? 1140 PRO A HB2  1 
ATOM   1918 H HB3  . PRO A 1 119 ? 42.678 8.656   53.109 1.00 16.34 ? 1140 PRO A HB3  1 
ATOM   1919 H HG2  . PRO A 1 119 ? 41.561 9.334   55.205 1.00 18.16 ? 1140 PRO A HG2  1 
ATOM   1920 H HG3  . PRO A 1 119 ? 40.986 9.908   53.831 1.00 18.16 ? 1140 PRO A HG3  1 
ATOM   1921 H HD2  . PRO A 1 119 ? 39.944 7.772   55.344 1.00 17.33 ? 1140 PRO A HD2  1 
ATOM   1922 H HD3  . PRO A 1 119 ? 39.123 8.987   54.686 1.00 17.33 ? 1140 PRO A HD3  1 
ATOM   1923 N N    . SER A 1 120 ? 42.037 5.722   51.313 1.00 9.82  ? 1141 SER A N    1 
ATOM   1924 C CA   . SER A 1 120 ? 42.375 4.347   50.993 1.00 8.78  ? 1141 SER A CA   1 
ATOM   1925 C C    . SER A 1 120 ? 43.308 3.756   52.041 1.00 9.81  ? 1141 SER A C    1 
ATOM   1926 O O    . SER A 1 120 ? 44.195 4.445   52.582 1.00 11.48 ? 1141 SER A O    1 
ATOM   1927 C CB   . SER A 1 120 ? 43.042 4.295   49.621 1.00 8.94  ? 1141 SER A CB   1 
ATOM   1928 O OG   . SER A 1 120 ? 43.303 2.969   49.252 1.00 9.20  ? 1141 SER A OG   1 
ATOM   1929 H H    . SER A 1 120 ? 42.297 6.296   50.728 1.00 11.79 ? 1141 SER A H    1 
ATOM   1930 H HA   . SER A 1 120 ? 41.558 3.807   50.963 1.00 10.54 ? 1141 SER A HA   1 
ATOM   1931 H HB2  . SER A 1 120 ? 42.450 4.696   48.966 1.00 10.73 ? 1141 SER A HB2  1 
ATOM   1932 H HB3  . SER A 1 120 ? 43.879 4.784   49.657 1.00 10.73 ? 1141 SER A HB3  1 
ATOM   1933 H HG   . SER A 1 120 ? 43.661 2.949   48.514 1.00 11.04 ? 1141 SER A HG   1 
ATOM   1934 N N    . GLY A 1 121 ? 43.144 2.463   52.296 1.00 11.12 ? 1142 GLY A N    1 
ATOM   1935 C CA   . GLY A 1 121 ? 44.080 1.711   53.108 1.00 11.35 ? 1142 GLY A CA   1 
ATOM   1936 C C    . GLY A 1 121 ? 45.372 1.316   52.416 1.00 13.85 ? 1142 GLY A C    1 
ATOM   1937 O O    . GLY A 1 121 ? 46.253 0.717   53.061 1.00 17.46 ? 1142 GLY A O    1 
ATOM   1938 H H    . GLY A 1 121 ? 42.486 1.994   52.003 1.00 13.34 ? 1142 GLY A H    1 
ATOM   1939 H HA2  . GLY A 1 121 ? 44.310 2.239   53.888 1.00 13.62 ? 1142 GLY A HA2  1 
ATOM   1940 H HA3  . GLY A 1 121 ? 43.646 0.899   53.413 1.00 13.62 ? 1142 GLY A HA3  1 
ATOM   1941 N N    . ASP A 1 122 ? 45.492 1.624   51.125 1.00 12.00 ? 1143 ASP A N    1 
ATOM   1942 C CA   . ASP A 1 122 ? 46.717 1.375   50.377 1.00 12.06 ? 1143 ASP A CA   1 
ATOM   1943 C C    . ASP A 1 122 ? 46.970 2.531   49.413 1.00 12.19 ? 1143 ASP A C    1 
ATOM   1944 O O    . ASP A 1 122 ? 46.151 3.462   49.329 1.00 12.03 ? 1143 ASP A O    1 
ATOM   1945 C CB   . ASP A 1 122 ? 46.687 0.014   49.656 1.00 11.61 ? 1143 ASP A CB   1 
ATOM   1946 C CG   . ASP A 1 122 ? 45.607 -0.082  48.607 1.00 10.93 ? 1143 ASP A CG   1 
ATOM   1947 O OD1  . ASP A 1 122 ? 44.924 0.927   48.347 1.00 11.00 ? 1143 ASP A OD1  1 
ATOM   1948 O OD2  . ASP A 1 122 ? 45.468 -1.174  48.037 1.00 12.07 ? 1143 ASP A OD2  1 
ATOM   1949 H H    . ASP A 1 122 ? 44.867 1.982   50.656 1.00 14.40 ? 1143 ASP A H    1 
ATOM   1950 H HA   . ASP A 1 122 ? 47.466 1.353   51.009 1.00 14.47 ? 1143 ASP A HA   1 
ATOM   1951 H HB2  . ASP A 1 122 ? 47.540 -0.129  49.218 1.00 13.93 ? 1143 ASP A HB2  1 
ATOM   1952 H HB3  . ASP A 1 122 ? 46.530 -0.685  50.310 1.00 13.93 ? 1143 ASP A HB3  1 
ATOM   1953 N N    . ASP A 1 123 ? 48.079 2.463   48.674 1.00 13.53 ? 1144 ASP A N    1 
ATOM   1954 C CA   . ASP A 1 123 ? 48.441 3.471   47.685 1.00 14.58 ? 1144 ASP A CA   1 
ATOM   1955 C C    . ASP A 1 123 ? 47.565 3.366   46.466 1.00 12.02 ? 1144 ASP A C    1 
ATOM   1956 O O    . ASP A 1 123 ? 47.481 2.297   45.843 1.00 14.82 ? 1144 ASP A O    1 
ATOM   1957 C CB   . ASP A 1 123 ? 49.880 3.249   47.196 1.00 18.82 ? 1144 ASP A CB   1 
ATOM   1958 C CG   . ASP A 1 123 ? 50.231 4.162   46.023 1.00 21.40 ? 1144 ASP A CG   1 
ATOM   1959 O OD1  . ASP A 1 123 ? 50.031 5.392   46.216 1.00 20.75 ? 1144 ASP A OD1  1 
ATOM   1960 O OD2  . ASP A 1 123 ? 50.673 3.683   44.915 1.00 20.60 ? 1144 ASP A OD2  1 
ATOM   1961 H H    . ASP A 1 123 ? 48.650 1.823   48.732 1.00 16.24 ? 1144 ASP A H    1 
ATOM   1962 H HA   . ASP A 1 123 ? 48.362 4.370   48.067 1.00 17.50 ? 1144 ASP A HA   1 
ATOM   1963 H HB2  . ASP A 1 123 ? 50.496 3.438   47.921 1.00 22.58 ? 1144 ASP A HB2  1 
ATOM   1964 H HB3  . ASP A 1 123 ? 49.980 2.329   46.904 1.00 22.58 ? 1144 ASP A HB3  1 
ATOM   1965 N N    . VAL A 1 124 ? 46.944 4.478   46.089 1.00 10.32 ? 1145 VAL A N    1 
ATOM   1966 C CA   . VAL A 1 124 ? 46.182 4.507   44.848 1.00 9.28  ? 1145 VAL A CA   1 
ATOM   1967 C C    . VAL A 1 124 ? 46.960 5.100   43.699 1.00 9.80  ? 1145 VAL A C    1 
ATOM   1968 O O    . VAL A 1 124 ? 46.501 5.028   42.585 1.00 10.04 ? 1145 VAL A O    1 
ATOM   1969 C CB   . VAL A 1 124 ? 44.847 5.255   44.974 1.00 9.39  ? 1145 VAL A CB   1 
ATOM   1970 C CG1  . VAL A 1 124 ? 44.022 4.686   46.087 1.00 9.86  ? 1145 VAL A CG1  1 
ATOM   1971 C CG2  . VAL A 1 124 ? 45.044 6.754   45.153 1.00 10.16 ? 1145 VAL A CG2  1 
ATOM   1972 H H    . VAL A 1 124 ? 46.948 5.218   46.527 1.00 12.38 ? 1145 VAL A H    1 
ATOM   1973 H HA   . VAL A 1 124 ? 45.970 3.582   44.602 1.00 11.13 ? 1145 VAL A HA   1 
ATOM   1974 H HB   . VAL A 1 124 ? 44.343 5.126   44.144 1.00 11.26 ? 1145 VAL A HB   1 
ATOM   1975 H HG11 . VAL A 1 124 ? 43.195 5.172   46.142 1.00 11.84 ? 1145 VAL A HG11 1 
ATOM   1976 H HG12 . VAL A 1 124 ? 43.846 3.760   45.902 1.00 11.84 ? 1145 VAL A HG12 1 
ATOM   1977 H HG13 . VAL A 1 124 ? 44.508 4.770   46.910 1.00 11.84 ? 1145 VAL A HG13 1 
ATOM   1978 H HG21 . VAL A 1 124 ? 44.184 7.175   45.227 1.00 12.19 ? 1145 VAL A HG21 1 
ATOM   1979 H HG22 . VAL A 1 124 ? 45.555 6.909   45.951 1.00 12.19 ? 1145 VAL A HG22 1 
ATOM   1980 H HG23 . VAL A 1 124 ? 45.514 7.100   44.390 1.00 12.19 ? 1145 VAL A HG23 1 
ATOM   1981 N N    . ARG A 1 125 ? 48.133 5.674   43.964 1.00 10.70 ? 1146 ARG A N    1 
ATOM   1982 C CA   . ARG A 1 125 ? 48.877 6.378   42.932 1.00 12.41 ? 1146 ARG A CA   1 
ATOM   1983 C C    . ARG A 1 125 ? 49.311 5.429   41.806 1.00 10.22 ? 1146 ARG A C    1 
ATOM   1984 O O    . ARG A 1 125 ? 49.009 5.655   40.638 1.00 9.82  ? 1146 ARG A O    1 
ATOM   1985 C CB   . ARG A 1 125 ? 50.101 7.048   43.552 1.00 15.15 ? 1146 ARG A CB   1 
ATOM   1986 C CG   . ARG A 1 125 ? 50.921 7.873   42.610 1.00 23.64 ? 1146 ARG A CG   1 
ATOM   1987 C CD   . ARG A 1 125 ? 52.452 7.855   42.962 1.00 29.15 ? 1146 ARG A CD   1 
ATOM   1988 N NE   . ARG A 1 125 ? 53.026 6.509   42.919 1.00 34.92 ? 1146 ARG A NE   1 
ATOM   1989 C CZ   . ARG A 1 125 ? 53.323 5.856   41.801 1.00 31.65 ? 1146 ARG A CZ   1 
ATOM   1990 N NH1  . ARG A 1 125 ? 53.102 6.435   40.632 1.00 35.63 ? 1146 ARG A NH1  1 
ATOM   1991 N NH2  . ARG A 1 125 ? 53.832 4.632   41.852 1.00 27.07 ? 1146 ARG A NH2  1 
ATOM   1992 H H    . ARG A 1 125 ? 48.516 5.668   44.734 1.00 12.84 ? 1146 ARG A H    1 
ATOM   1993 H HA   . ARG A 1 125 ? 48.309 7.075   42.543 1.00 14.89 ? 1146 ARG A HA   1 
ATOM   1994 H HB2  . ARG A 1 125 ? 49.803 7.632   44.268 1.00 18.17 ? 1146 ARG A HB2  1 
ATOM   1995 H HB3  . ARG A 1 125 ? 50.678 6.359   43.915 1.00 18.17 ? 1146 ARG A HB3  1 
ATOM   1996 H HG2  . ARG A 1 125 ? 50.815 7.525   41.711 1.00 28.37 ? 1146 ARG A HG2  1 
ATOM   1997 H HG3  . ARG A 1 125 ? 50.615 8.793   42.648 1.00 28.37 ? 1146 ARG A HG3  1 
ATOM   1998 H HD2  . ARG A 1 125 ? 52.930 8.405   42.322 1.00 34.98 ? 1146 ARG A HD2  1 
ATOM   1999 H HD3  . ARG A 1 125 ? 52.574 8.205   43.858 1.00 34.98 ? 1146 ARG A HD3  1 
ATOM   2000 H HE   . ARG A 1 125 ? 53.182 6.115   43.668 1.00 41.91 ? 1146 ARG A HE   1 
ATOM   2001 H HH11 . ARG A 1 125 ? 52.768 7.227   40.600 1.00 42.75 ? 1146 ARG A HH11 1 
ATOM   2002 H HH12 . ARG A 1 125 ? 53.292 6.019   39.904 1.00 42.75 ? 1146 ARG A HH12 1 
ATOM   2003 H HH21 . ARG A 1 125 ? 53.977 4.258   42.613 1.00 32.49 ? 1146 ARG A HH21 1 
ATOM   2004 H HH22 . ARG A 1 125 ? 54.025 4.216   41.125 1.00 32.49 ? 1146 ARG A HH22 1 
ATOM   2005 N N    . GLY A 1 126 ? 50.038 4.380   42.149 1.00 10.38 ? 1147 GLY A N    1 
ATOM   2006 C CA   . GLY A 1 126 ? 50.508 3.445   41.139 1.00 10.10 ? 1147 GLY A CA   1 
ATOM   2007 C C    . GLY A 1 126 ? 49.359 2.780   40.409 1.00 9.18  ? 1147 GLY A C    1 
ATOM   2008 O O    . GLY A 1 126 ? 49.337 2.722   39.188 1.00 9.95  ? 1147 GLY A O    1 
ATOM   2009 H H    . GLY A 1 126 ? 50.273 4.186   42.953 1.00 12.45 ? 1147 GLY A H    1 
ATOM   2010 H HA2  . GLY A 1 126 ? 51.056 3.914   40.490 1.00 12.12 ? 1147 GLY A HA2  1 
ATOM   2011 H HA3  . GLY A 1 126 ? 51.048 2.756   41.559 1.00 12.12 ? 1147 GLY A HA3  1 
ATOM   2012 N N    . PRO A 1 127 ? 48.388 2.264   41.156 1.00 9.35  ? 1148 PRO A N    1 
ATOM   2013 C CA   . PRO A 1 127 ? 47.226 1.696   40.485 1.00 9.27  ? 1148 PRO A CA   1 
ATOM   2014 C C    . PRO A 1 127 ? 46.535 2.677   39.548 1.00 8.62  ? 1148 PRO A C    1 
ATOM   2015 O O    . PRO A 1 127 ? 46.050 2.253   38.486 1.00 9.55  ? 1148 PRO A O    1 
ATOM   2016 C CB   . PRO A 1 127 ? 46.337 1.276   41.656 1.00 9.60  ? 1148 PRO A CB   1 
ATOM   2017 C CG   . PRO A 1 127 ? 47.363 0.829   42.694 1.00 11.35 ? 1148 PRO A CG   1 
ATOM   2018 C CD   . PRO A 1 127 ? 48.462 1.877   42.572 1.00 10.38 ? 1148 PRO A CD   1 
ATOM   2019 H HA   . PRO A 1 127 ? 47.487 0.899   39.978 1.00 11.13 ? 1148 PRO A HA   1 
ATOM   2020 H HB2  . PRO A 1 127 ? 45.821 2.033   41.975 1.00 11.52 ? 1148 PRO A HB2  1 
ATOM   2021 H HB3  . PRO A 1 127 ? 45.761 0.542   41.393 1.00 11.52 ? 1148 PRO A HB3  1 
ATOM   2022 H HG2  . PRO A 1 127 ? 46.967 0.842   43.580 1.00 13.62 ? 1148 PRO A HG2  1 
ATOM   2023 H HG3  . PRO A 1 127 ? 47.697 -0.054  42.473 1.00 13.62 ? 1148 PRO A HG3  1 
ATOM   2024 H HD2  . PRO A 1 127 ? 48.271 2.638   43.143 1.00 12.46 ? 1148 PRO A HD2  1 
ATOM   2025 H HD3  . PRO A 1 127 ? 49.327 1.487   42.773 1.00 12.46 ? 1148 PRO A HD3  1 
ATOM   2026 N N    A SER A 1 128 ? 46.446 3.959   39.913 0.69 7.83  ? 1149 SER A N    1 
ATOM   2027 N N    B SER A 1 128 ? 46.464 3.953   39.916 0.31 9.34  ? 1149 SER A N    1 
ATOM   2028 C CA   A SER A 1 128 ? 45.766 4.907   39.041 0.69 7.80  ? 1149 SER A CA   1 
ATOM   2029 C CA   B SER A 1 128 ? 45.781 4.928   39.076 0.31 9.37  ? 1149 SER A CA   1 
ATOM   2030 C C    A SER A 1 128 ? 46.474 5.000   37.703 0.69 9.37  ? 1149 SER A C    1 
ATOM   2031 C C    B SER A 1 128 ? 46.476 5.064   37.724 0.31 9.10  ? 1149 SER A C    1 
ATOM   2032 O O    A SER A 1 128 ? 45.819 5.085   36.666 0.69 9.35  ? 1149 SER A O    1 
ATOM   2033 O O    B SER A 1 128 ? 45.816 5.232   36.699 0.31 7.41  ? 1149 SER A O    1 
ATOM   2034 C CB   A SER A 1 128 ? 45.636 6.295   39.677 0.69 9.81  ? 1149 SER A CB   1 
ATOM   2035 C CB   B SER A 1 128 ? 45.686 6.284   39.780 0.31 12.11 ? 1149 SER A CB   1 
ATOM   2036 O OG   A SER A 1 128 ? 46.874 6.998   39.736 0.69 9.94  ? 1149 SER A OG   1 
ATOM   2037 O OG   B SER A 1 128 ? 44.808 6.210   40.891 0.31 14.97 ? 1149 SER A OG   1 
ATOM   2038 H H    A SER A 1 128 ? 46.763 4.294   40.640 0.69 9.40  ? 1149 SER A H    1 
ATOM   2039 H H    B SER A 1 128 ? 46.799 4.276   40.640 0.31 11.21 ? 1149 SER A H    1 
ATOM   2040 H HA   A SER A 1 128 ? 44.859 4.576   38.872 0.69 9.36  ? 1149 SER A HA   1 
ATOM   2041 H HA   B SER A 1 128 ? 44.868 4.613   38.910 0.31 11.24 ? 1149 SER A HA   1 
ATOM   2042 H HB2  A SER A 1 128 ? 45.009 6.818   39.153 0.69 11.78 ? 1149 SER A HB2  1 
ATOM   2043 H HB2  B SER A 1 128 ? 46.568 6.542   40.090 0.31 14.53 ? 1149 SER A HB2  1 
ATOM   2044 H HB3  A SER A 1 128 ? 45.297 6.191   40.580 0.69 11.78 ? 1149 SER A HB3  1 
ATOM   2045 H HB3  B SER A 1 128 ? 45.348 6.942   39.153 0.31 14.53 ? 1149 SER A HB3  1 
ATOM   2046 H HG   A SER A 1 128 ? 47.472 6.539   39.413 0.69 11.93 ? 1149 SER A HG   1 
ATOM   2047 H HG   B SER A 1 128 ? 44.506 5.451   40.960 0.31 17.97 ? 1149 SER A HG   1 
ATOM   2048 N N    . VAL A 1 129 ? 47.804 4.993   37.734 1.00 9.47  ? 1150 VAL A N    1 
ATOM   2049 C CA   . VAL A 1 129 ? 48.597 5.043   36.509 1.00 9.65  ? 1150 VAL A CA   1 
ATOM   2050 C C    . VAL A 1 129 ? 48.333 3.800   35.672 1.00 9.55  ? 1150 VAL A C    1 
ATOM   2051 O O    . VAL A 1 129 ? 48.079 3.893   34.479 1.00 10.41 ? 1150 VAL A O    1 
ATOM   2052 C CB   . VAL A 1 129 ? 50.083 5.199   36.843 1.00 10.43 ? 1150 VAL A CB   1 
ATOM   2053 C CG1  . VAL A 1 129 ? 50.922 5.031   35.582 1.00 12.52 ? 1150 VAL A CG1  1 
ATOM   2054 C CG2  . VAL A 1 129 ? 50.323 6.571   37.449 1.00 13.39 ? 1150 VAL A CG2  1 
ATOM   2055 H H    . VAL A 1 129 ? 48.276 4.937   38.451 0.31 11.37 ? 1150 VAL A H    1 
ATOM   2056 H HA   . VAL A 1 129 ? 48.322 5.824   35.984 1.00 11.58 ? 1150 VAL A HA   1 
ATOM   2057 H HB   . VAL A 1 129 ? 50.350 4.516   37.493 1.00 12.52 ? 1150 VAL A HB   1 
ATOM   2058 H HG11 . VAL A 1 129 ? 51.850 5.131   35.809 1.00 15.03 ? 1150 VAL A HG11 1 
ATOM   2059 H HG12 . VAL A 1 129 ? 50.767 4.156   35.218 1.00 15.03 ? 1150 VAL A HG12 1 
ATOM   2060 H HG13 . VAL A 1 129 ? 50.666 5.701   34.945 1.00 15.03 ? 1150 VAL A HG13 1 
ATOM   2061 H HG21 . VAL A 1 129 ? 51.256 6.662   37.656 1.00 16.07 ? 1150 VAL A HG21 1 
ATOM   2062 H HG22 . VAL A 1 129 ? 50.061 7.242   36.815 1.00 16.07 ? 1150 VAL A HG22 1 
ATOM   2063 H HG23 . VAL A 1 129 ? 49.800 6.654   38.249 1.00 16.07 ? 1150 VAL A HG23 1 
ATOM   2064 N N    . VAL A 1 130 ? 48.356 2.637   36.306 1.00 9.77  ? 1151 VAL A N    1 
ATOM   2065 C CA   . VAL A 1 130 ? 48.148 1.397   35.596 1.00 10.86 ? 1151 VAL A CA   1 
ATOM   2066 C C    . VAL A 1 130 ? 46.777 1.368   34.927 1.00 9.33  ? 1151 VAL A C    1 
ATOM   2067 O O    . VAL A 1 130 ? 46.641 0.933   33.791 1.00 10.24 ? 1151 VAL A O    1 
ATOM   2068 C CB   . VAL A 1 130 ? 48.307 0.229   36.586 1.00 13.09 ? 1151 VAL A CB   1 
ATOM   2069 C CG1  . VAL A 1 130 ? 47.853 -1.082  35.981 1.00 16.46 ? 1151 VAL A CG1  1 
ATOM   2070 C CG2  . VAL A 1 130 ? 49.761 0.150   37.053 1.00 15.91 ? 1151 VAL A CG2  1 
ATOM   2071 H H    . VAL A 1 130 ? 48.491 2.544   37.151 1.00 11.72 ? 1151 VAL A H    1 
ATOM   2072 H HA   . VAL A 1 130 ? 48.831 1.305   34.899 1.00 13.03 ? 1151 VAL A HA   1 
ATOM   2073 H HB   . VAL A 1 130 ? 47.749 0.405   37.372 1.00 15.71 ? 1151 VAL A HB   1 
ATOM   2074 H HG11 . VAL A 1 130 ? 47.968 -1.781  36.628 1.00 19.75 ? 1151 VAL A HG11 1 
ATOM   2075 H HG12 . VAL A 1 130 ? 46.926 -1.010  35.738 1.00 19.75 ? 1151 VAL A HG12 1 
ATOM   2076 H HG13 . VAL A 1 130 ? 48.382 -1.266  35.201 1.00 19.75 ? 1151 VAL A HG13 1 
ATOM   2077 H HG21 . VAL A 1 130 ? 49.851 -0.580  37.669 1.00 19.09 ? 1151 VAL A HG21 1 
ATOM   2078 H HG22 . VAL A 1 130 ? 50.326 0.008   36.290 1.00 19.09 ? 1151 VAL A HG22 1 
ATOM   2079 H HG23 . VAL A 1 130 ? 49.995 0.975   37.485 1.00 19.09 ? 1151 VAL A HG23 1 
ATOM   2080 N N    A LEU A 1 131 ? 45.752 1.845   35.613 0.53 8.62  ? 1152 LEU A N    1 
ATOM   2081 N N    B LEU A 1 131 ? 45.751 1.828   35.638 0.47 9.33  ? 1152 LEU A N    1 
ATOM   2082 C CA   A LEU A 1 131 ? 44.424 1.828   35.013 0.53 8.30  ? 1152 LEU A CA   1 
ATOM   2083 C CA   B LEU A 1 131 ? 44.392 1.846   35.092 0.47 9.95  ? 1152 LEU A CA   1 
ATOM   2084 C C    A LEU A 1 131 ? 44.301 2.759   33.821 0.53 9.89  ? 1152 LEU A C    1 
ATOM   2085 C C    B LEU A 1 131 ? 44.290 2.753   33.862 0.47 9.78  ? 1152 LEU A C    1 
ATOM   2086 O O    A LEU A 1 131 ? 43.719 2.410   32.793 0.53 11.49 ? 1152 LEU A O    1 
ATOM   2087 O O    B LEU A 1 131 ? 43.727 2.369   32.842 0.47 10.00 ? 1152 LEU A O    1 
ATOM   2088 C CB   A LEU A 1 131 ? 43.382 2.216   36.043 0.53 9.56  ? 1152 LEU A CB   1 
ATOM   2089 C CB   B LEU A 1 131 ? 43.385 2.300   36.163 0.47 9.74  ? 1152 LEU A CB   1 
ATOM   2090 C CG   A LEU A 1 131 ? 42.700 1.001   36.637 0.53 9.54  ? 1152 LEU A CG   1 
ATOM   2091 C CG   B LEU A 1 131 ? 42.735 1.229   37.048 0.47 10.72 ? 1152 LEU A CG   1 
ATOM   2092 C CD1  A LEU A 1 131 ? 43.695 0.168   37.437 0.53 7.68  ? 1152 LEU A CD1  1 
ATOM   2093 C CD1  B LEU A 1 131 ? 41.638 0.484   36.309 0.47 8.49  ? 1152 LEU A CD1  1 
ATOM   2094 C CD2  A LEU A 1 131 ? 41.578 1.485   37.479 0.53 9.90  ? 1152 LEU A CD2  1 
ATOM   2095 C CD2  B LEU A 1 131 ? 43.770 0.234   37.567 0.47 12.25 ? 1152 LEU A CD2  1 
ATOM   2096 H H    A LEU A 1 131 ? 45.792 2.176   36.406 0.53 10.35 ? 1152 LEU A H    1 
ATOM   2097 H H    B LEU A 1 131 ? 45.813 2.135   36.439 0.47 11.20 ? 1152 LEU A H    1 
ATOM   2098 H HA   A LEU A 1 131 ? 44.224 0.919   34.708 0.53 9.96  ? 1152 LEU A HA   1 
ATOM   2099 H HA   B LEU A 1 131 ? 44.149 0.937   34.817 0.47 11.94 ? 1152 LEU A HA   1 
ATOM   2100 H HB2  A LEU A 1 131 ? 43.810 2.706   36.762 0.53 11.47 ? 1152 LEU A HB2  1 
ATOM   2101 H HB2  B LEU A 1 131 ? 43.841 2.917   36.757 0.47 11.69 ? 1152 LEU A HB2  1 
ATOM   2102 H HB3  A LEU A 1 131 ? 42.705 2.767   35.619 0.53 11.47 ? 1152 LEU A HB3  1 
ATOM   2103 H HB3  B LEU A 1 131 ? 42.664 2.769   35.714 0.47 11.69 ? 1152 LEU A HB3  1 
ATOM   2104 H HG   A LEU A 1 131 ? 42.338 0.451   35.925 0.53 11.45 ? 1152 LEU A HG   1 
ATOM   2105 H HG   B LEU A 1 131 ? 42.332 1.662   37.816 0.47 12.86 ? 1152 LEU A HG   1 
ATOM   2106 H HD11 A LEU A 1 131 ? 43.241 -0.594  37.802 0.53 9.22  ? 1152 LEU A HD11 1 
ATOM   2107 H HD11 B LEU A 1 131 ? 41.259 -0.175  36.896 0.47 10.19 ? 1152 LEU A HD11 1 
ATOM   2108 H HD12 A LEU A 1 131 ? 44.401 -0.119  36.854 0.53 9.22  ? 1152 LEU A HD12 1 
ATOM   2109 H HD12 B LEU A 1 131 ? 40.962 1.110   36.040 0.47 10.19 ? 1152 LEU A HD12 1 
ATOM   2110 H HD13 A LEU A 1 131 ? 44.054 0.707   38.146 0.53 9.22  ? 1152 LEU A HD13 1 
ATOM   2111 H HD13 B LEU A 1 131 ? 42.016 0.056   35.537 0.47 10.19 ? 1152 LEU A HD13 1 
ATOM   2112 H HD21 A LEU A 1 131 ? 41.131 0.729   37.867 0.53 11.88 ? 1152 LEU A HD21 1 
ATOM   2113 H HD21 B LEU A 1 131 ? 44.425 0.707   38.085 0.47 14.70 ? 1152 LEU A HD21 1 
ATOM   2114 H HD22 A LEU A 1 131 ? 41.929 2.049   38.172 0.53 11.88 ? 1152 LEU A HD22 1 
ATOM   2115 H HD22 B LEU A 1 131 ? 43.328 -0.419  38.114 0.47 14.70 ? 1152 LEU A HD22 1 
ATOM   2116 H HD23 A LEU A 1 131 ? 40.967 1.981   36.930 0.53 11.88 ? 1152 LEU A HD23 1 
ATOM   2117 H HD23 B LEU A 1 131 ? 44.191 -0.196  36.819 0.47 14.70 ? 1152 LEU A HD23 1 
ATOM   2118 N N    . LYS A 1 132 ? 44.856 3.951   33.951 1.00 8.81  ? 1153 LYS A N    1 
ATOM   2119 C CA   . LYS A 1 132 ? 44.808 4.920   32.857 1.00 9.66  ? 1153 LYS A CA   1 
ATOM   2120 C C    . LYS A 1 132 ? 45.611 4.419   31.674 1.00 10.77 ? 1153 LYS A C    1 
ATOM   2121 O O    . LYS A 1 132 ? 45.179 4.586   30.543 1.00 12.71 ? 1153 LYS A O    1 
ATOM   2122 C CB   . LYS A 1 132 ? 45.342 6.274   33.288 1.00 12.20 ? 1153 LYS A CB   1 
ATOM   2123 C CG   . LYS A 1 132 ? 44.470 6.930   34.264 1.00 13.92 ? 1153 LYS A CG   1 
ATOM   2124 C CD   . LYS A 1 132 ? 45.182 8.104   34.901 1.00 14.20 ? 1153 LYS A CD   1 
ATOM   2125 C CE   . LYS A 1 132 ? 44.307 8.697   35.968 1.00 13.98 ? 1153 LYS A CE   1 
ATOM   2126 N NZ   . LYS A 1 132 ? 44.915 9.828   36.691 1.00 14.59 ? 1153 LYS A NZ   1 
ATOM   2127 H H    . LYS A 1 132 ? 45.272 4.229   34.650 0.47 10.57 ? 1153 LYS A H    1 
ATOM   2128 H HA   . LYS A 1 132 ? 43.879 5.035   32.569 1.00 11.59 ? 1153 LYS A HA   1 
ATOM   2129 H HB2  . LYS A 1 132 ? 46.215 6.156   33.695 1.00 14.64 ? 1153 LYS A HB2  1 
ATOM   2130 H HB3  . LYS A 1 132 ? 45.412 6.849   32.511 1.00 14.64 ? 1153 LYS A HB3  1 
ATOM   2131 H HG2  . LYS A 1 132 ? 43.674 7.259   33.817 1.00 16.71 ? 1153 LYS A HG2  1 
ATOM   2132 H HG3  . LYS A 1 132 ? 44.232 6.300   34.961 1.00 16.71 ? 1153 LYS A HG3  1 
ATOM   2133 H HD2  . LYS A 1 132 ? 46.009 7.803   35.310 1.00 17.04 ? 1153 LYS A HD2  1 
ATOM   2134 H HD3  . LYS A 1 132 ? 45.359 8.783   34.231 1.00 17.04 ? 1153 LYS A HD3  1 
ATOM   2135 H HE2  . LYS A 1 132 ? 43.488 9.015   35.557 1.00 16.77 ? 1153 LYS A HE2  1 
ATOM   2136 H HE3  . LYS A 1 132 ? 44.100 8.007   36.619 1.00 16.77 ? 1153 LYS A HE3  1 
ATOM   2137 H HZ1  . LYS A 1 132 ? 45.106 10.485  36.122 1.00 17.50 ? 1153 LYS A HZ1  1 
ATOM   2138 H HZ2  . LYS A 1 132 ? 44.349 10.134  37.307 1.00 17.50 ? 1153 LYS A HZ2  1 
ATOM   2139 H HZ3  . LYS A 1 132 ? 45.665 9.565   37.092 1.00 17.50 ? 1153 LYS A HZ3  1 
ATOM   2140 N N    . GLN A 1 133 ? 46.768 3.803   31.921 1.00 10.02 ? 1154 GLN A N    1 
ATOM   2141 C CA   . GLN A 1 133 ? 47.576 3.234   30.833 1.00 10.87 ? 1154 GLN A CA   1 
ATOM   2142 C C    . GLN A 1 133 ? 46.873 2.037   30.182 1.00 12.12 ? 1154 GLN A C    1 
ATOM   2143 O O    . GLN A 1 133 ? 47.103 1.723   29.019 1.00 15.38 ? 1154 GLN A O    1 
ATOM   2144 C CB   . GLN A 1 133 ? 48.923 2.749   31.380 1.00 12.90 ? 1154 GLN A CB   1 
ATOM   2145 C CG   . GLN A 1 133 ? 49.893 3.811   31.924 1.00 15.92 ? 1154 GLN A CG   1 
ATOM   2146 C CD   . GLN A 1 133 ? 51.197 3.173   32.607 1.00 24.95 ? 1154 GLN A CD   1 
ATOM   2147 O OE1  . GLN A 1 133 ? 51.132 2.123   33.293 1.00 27.21 ? 1154 GLN A OE1  1 
ATOM   2148 N NE2  . GLN A 1 133 ? 52.338 3.820   32.433 1.00 26.47 ? 1154 GLN A NE2  1 
ATOM   2149 H H    . GLN A 1 133 ? 47.108 3.701   32.704 1.00 12.03 ? 1154 GLN A H    1 
ATOM   2150 H HA   . GLN A 1 133 ? 47.739 3.916   30.148 1.00 13.05 ? 1154 GLN A HA   1 
ATOM   2151 H HB2  . GLN A 1 133 ? 48.747 2.129   32.104 1.00 15.48 ? 1154 GLN A HB2  1 
ATOM   2152 H HB3  . GLN A 1 133 ? 49.385 2.282   30.667 1.00 15.48 ? 1154 GLN A HB3  1 
ATOM   2153 H HG2  . GLN A 1 133 ? 50.185 4.377   31.192 1.00 19.11 ? 1154 GLN A HG2  1 
ATOM   2154 H HG3  . GLN A 1 133 ? 49.435 4.344   32.593 1.00 19.11 ? 1154 GLN A HG3  1 
ATOM   2155 H HE21 . GLN A 1 133 ? 52.354 4.545   31.972 1.00 31.76 ? 1154 GLN A HE21 1 
ATOM   2156 H HE22 . GLN A 1 133 ? 53.062 3.514   32.781 1.00 31.76 ? 1154 GLN A HE22 1 
ATOM   2157 N N    . GLY A 1 134 ? 46.013 1.373   30.941 1.00 11.53 ? 1155 GLY A N    1 
ATOM   2158 C CA   . GLY A 1 134 ? 45.393 0.142   30.499 1.00 12.58 ? 1155 GLY A CA   1 
ATOM   2159 C C    . GLY A 1 134 ? 44.033 0.310   29.854 1.00 11.60 ? 1155 GLY A C    1 
ATOM   2160 O O    . GLY A 1 134 ? 43.414 -0.700  29.474 1.00 14.22 ? 1155 GLY A O    1 
ATOM   2161 H H    . GLY A 1 134 ? 45.772 1.622   31.728 1.00 13.83 ? 1155 GLY A H    1 
ATOM   2162 H HA2  . GLY A 1 134 ? 45.976 -0.292  29.857 1.00 15.10 ? 1155 GLY A HA2  1 
ATOM   2163 H HA3  . GLY A 1 134 ? 45.291 -0.451  31.260 1.00 15.10 ? 1155 GLY A HA3  1 
ATOM   2164 N N    . GLY A 1 135 ? 43.559 1.546   29.726 1.00 11.87 ? 1156 GLY A N    1 
ATOM   2165 C CA   . GLY A 1 135 ? 42.316 1.800   29.014 1.00 13.83 ? 1156 GLY A CA   1 
ATOM   2166 C C    . GLY A 1 135 ? 41.094 2.042   29.876 1.00 15.18 ? 1156 GLY A C    1 
ATOM   2167 O O    . GLY A 1 135 ? 40.006 2.242   29.356 1.00 16.58 ? 1156 GLY A O    1 
ATOM   2168 H H    . GLY A 1 135 ? 43.937 2.250   30.042 1.00 14.25 ? 1156 GLY A H    1 
ATOM   2169 H HA2  . GLY A 1 135 ? 42.436 2.578   28.448 1.00 16.60 ? 1156 GLY A HA2  1 
ATOM   2170 H HA3  . GLY A 1 135 ? 42.126 1.041   28.440 1.00 16.60 ? 1156 GLY A HA3  1 
ATOM   2171 N N    . ALA A 1 136 ? 41.232 2.020   31.191 1.00 10.92 ? 1157 ALA A N    1 
ATOM   2172 C CA   . ALA A 1 136 ? 40.088 2.376   32.042 1.00 9.15  ? 1157 ALA A CA   1 
ATOM   2173 C C    . ALA A 1 136 ? 39.876 3.881   32.097 1.00 7.98  ? 1157 ALA A C    1 
ATOM   2174 O O    . ALA A 1 136 ? 40.831 4.663   32.051 1.00 8.65  ? 1157 ALA A O    1 
ATOM   2175 C CB   . ALA A 1 136 ? 40.285 1.841   33.426 1.00 10.02 ? 1157 ALA A CB   1 
ATOM   2176 H H    . ALA A 1 136 ? 41.951 1.811   31.614 1.00 13.10 ? 1157 ALA A H    1 
ATOM   2177 H HA   . ALA A 1 136 ? 39.277 1.969   31.673 1.00 10.98 ? 1157 ALA A HA   1 
ATOM   2178 H HB1  . ALA A 1 136 ? 39.528 2.084   33.965 1.00 12.02 ? 1157 ALA A HB1  1 
ATOM   2179 H HB2  . ALA A 1 136 ? 40.363 0.885   33.382 1.00 12.02 ? 1157 ALA A HB2  1 
ATOM   2180 H HB3  . ALA A 1 136 ? 41.086 2.219   33.796 1.00 12.02 ? 1157 ALA A HB3  1 
ATOM   2181 N N    . VAL A 1 137 ? 38.618 4.292   32.232 1.00 7.25  ? 1158 VAL A N    1 
ATOM   2182 C CA   . VAL A 1 137 ? 38.243 5.698   32.354 1.00 7.22  ? 1158 VAL A CA   1 
ATOM   2183 C C    . VAL A 1 137 ? 37.489 5.863   33.680 1.00 5.89  ? 1158 VAL A C    1 
ATOM   2184 O O    . VAL A 1 137 ? 36.273 5.706   33.721 1.00 6.33  ? 1158 VAL A O    1 
ATOM   2185 C CB   . VAL A 1 137 ? 37.361 6.139   31.158 1.00 8.32  ? 1158 VAL A CB   1 
ATOM   2186 C CG1  . VAL A 1 137 ? 37.011 7.619   31.277 1.00 8.20  ? 1158 VAL A CG1  1 
ATOM   2187 C CG2  . VAL A 1 137 ? 38.082 5.874   29.856 1.00 11.42 ? 1158 VAL A CG2  1 
ATOM   2188 H H    . VAL A 1 137 ? 37.944 3.758   32.256 1.00 8.70  ? 1158 VAL A H    1 
ATOM   2189 H HA   . VAL A 1 137 ? 39.048 6.256   32.376 1.00 8.66  ? 1158 VAL A HA   1 
ATOM   2190 H HB   . VAL A 1 137 ? 36.528 5.624   31.161 1.00 9.98  ? 1158 VAL A HB   1 
ATOM   2191 H HG11 . VAL A 1 137 ? 36.465 7.872   30.528 1.00 9.84  ? 1158 VAL A HG11 1 
ATOM   2192 H HG12 . VAL A 1 137 ? 36.529 7.761   32.096 1.00 9.84  ? 1158 VAL A HG12 1 
ATOM   2193 H HG13 . VAL A 1 137 ? 37.822 8.133   31.280 1.00 9.84  ? 1158 VAL A HG13 1 
ATOM   2194 H HG21 . VAL A 1 137 ? 37.522 6.153   29.127 1.00 13.71 ? 1158 VAL A HG21 1 
ATOM   2195 H HG22 . VAL A 1 137 ? 38.903 6.370   29.847 1.00 13.71 ? 1158 VAL A HG22 1 
ATOM   2196 H HG23 . VAL A 1 137 ? 38.266 4.934   29.787 1.00 13.71 ? 1158 VAL A HG23 1 
ATOM   2197 N N    . PRO A 1 138 ? 38.213 6.171   34.768 1.00 5.74  ? 1159 PRO A N    1 
ATOM   2198 C CA   . PRO A 1 138 ? 37.542 6.174   36.062 1.00 5.29  ? 1159 PRO A CA   1 
ATOM   2199 C C    . PRO A 1 138 ? 36.938 7.517   36.419 1.00 5.48  ? 1159 PRO A C    1 
ATOM   2200 O O    . PRO A 1 138 ? 37.427 8.575   36.015 1.00 6.08  ? 1159 PRO A O    1 
ATOM   2201 C CB   . PRO A 1 138 ? 38.647 5.747   37.052 1.00 5.95  ? 1159 PRO A CB   1 
ATOM   2202 C CG   . PRO A 1 138 ? 39.739 5.159   36.179 1.00 6.92  ? 1159 PRO A CG   1 
ATOM   2203 C CD   . PRO A 1 138 ? 39.665 6.016   34.941 1.00 6.19  ? 1159 PRO A CD   1 
ATOM   2204 H HA   . PRO A 1 138 ? 36.834 5.497   36.070 1.00 6.35  ? 1159 PRO A HA   1 
ATOM   2205 H HB2  . PRO A 1 138 ? 38.972 6.523   37.535 1.00 7.14  ? 1159 PRO A HB2  1 
ATOM   2206 H HB3  . PRO A 1 138 ? 38.299 5.080   37.664 1.00 7.14  ? 1159 PRO A HB3  1 
ATOM   2207 H HG2  . PRO A 1 138 ? 40.600 5.249   36.617 1.00 8.31  ? 1159 PRO A HG2  1 
ATOM   2208 H HG3  . PRO A 1 138 ? 39.542 4.232   35.976 1.00 8.31  ? 1159 PRO A HG3  1 
ATOM   2209 H HD2  . PRO A 1 138 ? 40.086 6.877   35.094 1.00 7.42  ? 1159 PRO A HD2  1 
ATOM   2210 H HD3  . PRO A 1 138 ? 40.053 5.555   34.181 1.00 7.42  ? 1159 PRO A HD3  1 
ATOM   2211 N N    . ILE A 1 139 ? 35.903 7.447   37.236 1.00 5.28  ? 1160 ILE A N    1 
ATOM   2212 C CA   . ILE A 1 139 ? 35.229 8.583   37.844 1.00 5.44  ? 1160 ILE A CA   1 
ATOM   2213 C C    . ILE A 1 139 ? 35.178 8.299   39.335 1.00 5.33  ? 1160 ILE A C    1 
ATOM   2214 O O    . ILE A 1 139 ? 34.494 7.372   39.778 1.00 5.94  ? 1160 ILE A O    1 
ATOM   2215 C CB   . ILE A 1 139 ? 33.805 8.748   37.291 1.00 6.51  ? 1160 ILE A CB   1 
ATOM   2216 C CG1  . ILE A 1 139 ? 33.861 8.966   35.771 1.00 9.25  ? 1160 ILE A CG1  1 
ATOM   2217 C CG2  . ILE A 1 139 ? 33.109 9.902   38.016 1.00 8.54  ? 1160 ILE A CG2  1 
ATOM   2218 C CD1  . ILE A 1 139 ? 32.518 8.740   35.095 1.00 12.32 ? 1160 ILE A CD1  1 
ATOM   2219 H H    . ILE A 1 139 ? 35.550 6.699   37.470 1.00 6.34  ? 1160 ILE A H    1 
ATOM   2220 H HA   . ILE A 1 139 ? 35.737 9.406   37.686 1.00 6.53  ? 1160 ILE A HA   1 
ATOM   2221 H HB   . ILE A 1 139 ? 33.311 7.932   37.467 1.00 7.81  ? 1160 ILE A HB   1 
ATOM   2222 H HG12 . ILE A 1 139 ? 34.137 9.879   35.593 1.00 11.10 ? 1160 ILE A HG12 1 
ATOM   2223 H HG13 . ILE A 1 139 ? 34.499 8.345   35.386 1.00 11.10 ? 1160 ILE A HG13 1 
ATOM   2224 H HG21 . ILE A 1 139 ? 32.221 9.999   37.667 1.00 10.25 ? 1160 ILE A HG21 1 
ATOM   2225 H HG22 . ILE A 1 139 ? 33.072 9.703   38.955 1.00 10.25 ? 1160 ILE A HG22 1 
ATOM   2226 H HG23 . ILE A 1 139 ? 33.609 10.708  37.871 1.00 10.25 ? 1160 ILE A HG23 1 
ATOM   2227 H HD11 . ILE A 1 139 ? 32.614 8.889   34.151 1.00 14.79 ? 1160 ILE A HD11 1 
ATOM   2228 H HD12 . ILE A 1 139 ? 32.236 7.836   35.256 1.00 14.79 ? 1160 ILE A HD12 1 
ATOM   2229 H HD13 . ILE A 1 139 ? 31.877 9.354   35.460 1.00 14.79 ? 1160 ILE A HD13 1 
ATOM   2230 N N    . GLY A 1 140 ? 35.947 9.059   40.110 1.00 5.74  ? 1161 GLY A N    1 
ATOM   2231 C CA   . GLY A 1 140 ? 36.058 8.831   41.547 1.00 5.87  ? 1161 GLY A CA   1 
ATOM   2232 C C    . GLY A 1 140 ? 35.073 9.702   42.311 1.00 5.86  ? 1161 GLY A C    1 
ATOM   2233 O O    . GLY A 1 140 ? 35.151 10.938  42.239 1.00 7.28  ? 1161 GLY A O    1 
ATOM   2234 H H    . GLY A 1 140 ? 36.418 9.720   39.825 1.00 6.89  ? 1161 GLY A H    1 
ATOM   2235 H HA2  . GLY A 1 140 ? 35.873 7.900   41.746 1.00 7.04  ? 1161 GLY A HA2  1 
ATOM   2236 H HA3  . GLY A 1 140 ? 36.958 9.041   41.844 1.00 7.04  ? 1161 GLY A HA3  1 
ATOM   2237 N N    . ILE A 1 141 ? 34.176 9.059   43.050 1.00 5.95  ? 1162 ILE A N    1 
ATOM   2238 C CA   . ILE A 1 141 ? 33.190 9.730   43.875 1.00 6.80  ? 1162 ILE A CA   1 
ATOM   2239 C C    . ILE A 1 141 ? 33.547 9.490   45.322 1.00 6.40  ? 1162 ILE A C    1 
ATOM   2240 O O    . ILE A 1 141 ? 33.406 8.377   45.852 1.00 7.48  ? 1162 ILE A O    1 
ATOM   2241 C CB   . ILE A 1 141 ? 31.772 9.212   43.574 1.00 6.51  ? 1162 ILE A CB   1 
ATOM   2242 C CG1  . ILE A 1 141 ? 31.431 9.380   42.095 1.00 8.07  ? 1162 ILE A CG1  1 
ATOM   2243 C CG2  . ILE A 1 141 ? 30.777 9.925   44.461 1.00 7.75  ? 1162 ILE A CG2  1 
ATOM   2244 C CD1  . ILE A 1 141 ? 30.137 8.724   41.664 1.00 8.11  ? 1162 ILE A CD1  1 
ATOM   2245 H H    . ILE A 1 141 ? 34.120 8.201   43.088 1.00 7.14  ? 1162 ILE A H    1 
ATOM   2246 H HA   . ILE A 1 141 ? 33.216 10.695  43.701 1.00 8.16  ? 1162 ILE A HA   1 
ATOM   2247 H HB   . ILE A 1 141 ? 31.744 8.266   43.786 1.00 7.81  ? 1162 ILE A HB   1 
ATOM   2248 H HG12 . ILE A 1 141 ? 31.359 10.328  41.900 1.00 9.68  ? 1162 ILE A HG12 1 
ATOM   2249 H HG13 . ILE A 1 141 ? 32.147 8.993   41.567 1.00 9.68  ? 1162 ILE A HG13 1 
ATOM   2250 H HG21 . ILE A 1 141 ? 29.896 9.597   44.268 1.00 9.29  ? 1162 ILE A HG21 1 
ATOM   2251 H HG22 . ILE A 1 141 ? 30.997 9.752   45.380 1.00 9.29  ? 1162 ILE A HG22 1 
ATOM   2252 H HG23 . ILE A 1 141 ? 30.821 10.868  44.285 1.00 9.29  ? 1162 ILE A HG23 1 
ATOM   2253 H HD11 . ILE A 1 141 ? 30.005 8.881   40.726 1.00 9.73  ? 1162 ILE A HD11 1 
ATOM   2254 H HD12 . ILE A 1 141 ? 30.193 7.781   41.835 1.00 9.73  ? 1162 ILE A HD12 1 
ATOM   2255 H HD13 . ILE A 1 141 ? 29.412 9.105   42.166 1.00 9.73  ? 1162 ILE A HD13 1 
ATOM   2256 N N    . GLY A 1 142 ? 34.008 10.552  45.970 1.00 6.70  ? 1163 GLY A N    1 
ATOM   2257 C CA   . GLY A 1 142 ? 34.375 10.505  47.375 1.00 8.33  ? 1163 GLY A CA   1 
ATOM   2258 C C    . GLY A 1 142 ? 33.260 11.041  48.242 1.00 9.11  ? 1163 GLY A C    1 
ATOM   2259 O O    . GLY A 1 142 ? 32.802 12.180  48.062 1.00 10.12 ? 1163 GLY A O    1 
ATOM   2260 H H    . GLY A 1 142 ? 34.119 11.324  45.609 1.00 8.04  ? 1163 GLY A H    1 
ATOM   2261 H HA2  . GLY A 1 142 ? 34.560 9.589   47.636 1.00 10.00 ? 1163 GLY A HA2  1 
ATOM   2262 H HA3  . GLY A 1 142 ? 35.170 11.039  47.524 1.00 10.00 ? 1163 GLY A HA3  1 
ATOM   2263 N N    . ILE A 1 143 ? 32.830 10.241  49.211 1.00 9.35  ? 1164 ILE A N    1 
ATOM   2264 C CA   . ILE A 1 143 ? 31.800 10.593  50.161 1.00 9.97  ? 1164 ILE A CA   1 
ATOM   2265 C C    . ILE A 1 143 ? 32.453 10.844  51.516 1.00 10.46 ? 1164 ILE A C    1 
ATOM   2266 O O    . ILE A 1 143 ? 33.362 10.130  51.925 1.00 11.22 ? 1164 ILE A O    1 
ATOM   2267 C CB   . ILE A 1 143 ? 30.782 9.464   50.278 1.00 10.27 ? 1164 ILE A CB   1 
ATOM   2268 C CG1  . ILE A 1 143 ? 30.184 9.165   48.897 1.00 11.90 ? 1164 ILE A CG1  1 
ATOM   2269 C CG2  . ILE A 1 143 ? 29.685 9.813   51.300 1.00 11.55 ? 1164 ILE A CG2  1 
ATOM   2270 C CD1  . ILE A 1 143 ? 29.757 7.704   48.688 1.00 16.43 ? 1164 ILE A CD1  1 
ATOM   2271 H H    . ILE A 1 143 ? 33.142 9.450   49.337 1.00 11.22 ? 1164 ILE A H    1 
ATOM   2272 H HA   . ILE A 1 143 ? 31.340 11.408  49.872 1.00 11.97 ? 1164 ILE A HA   1 
ATOM   2273 H HB   . ILE A 1 143 ? 31.244 8.669   50.588 1.00 12.33 ? 1164 ILE A HB   1 
ATOM   2274 H HG12 . ILE A 1 143 ? 29.399 9.721   48.773 1.00 14.28 ? 1164 ILE A HG12 1 
ATOM   2275 H HG13 . ILE A 1 143 ? 30.846 9.378   48.221 1.00 14.28 ? 1164 ILE A HG13 1 
ATOM   2276 H HG21 . ILE A 1 143 ? 29.062 9.084   51.350 1.00 13.86 ? 1164 ILE A HG21 1 
ATOM   2277 H HG22 . ILE A 1 143 ? 30.092 9.956   52.158 1.00 13.86 ? 1164 ILE A HG22 1 
ATOM   2278 H HG23 . ILE A 1 143 ? 29.234 10.611  51.014 1.00 13.86 ? 1164 ILE A HG23 1 
ATOM   2279 H HD11 . ILE A 1 143 ? 29.396 7.608   47.804 1.00 19.72 ? 1164 ILE A HD11 1 
ATOM   2280 H HD12 . ILE A 1 143 ? 30.524 7.137   48.793 1.00 19.72 ? 1164 ILE A HD12 1 
ATOM   2281 H HD13 . ILE A 1 143 ? 29.090 7.478   49.340 1.00 19.72 ? 1164 ILE A HD13 1 
ATOM   2282 N N    . GLY A 1 144 ? 31.987 11.868  52.221 1.00 13.59 ? 1165 GLY A N    1 
ATOM   2283 C CA   . GLY A 1 144 ? 32.418 12.107  53.589 1.00 15.64 ? 1165 GLY A CA   1 
ATOM   2284 C C    . GLY A 1 144 ? 33.917 12.288  53.689 1.00 16.51 ? 1165 GLY A C    1 
ATOM   2285 O O    . GLY A 1 144 ? 34.487 13.170  53.038 1.00 18.05 ? 1165 GLY A O    1 
ATOM   2286 H H    . GLY A 1 144 ? 31.417 12.441  51.927 1.00 16.31 ? 1165 GLY A H    1 
ATOM   2287 H HA2  . GLY A 1 144 ? 31.987 12.907  53.929 1.00 18.77 ? 1165 GLY A HA2  1 
ATOM   2288 H HA3  . GLY A 1 144 ? 32.160 11.357  54.146 1.00 18.77 ? 1165 GLY A HA3  1 
ATOM   2289 N N    . ASN A 1 145 ? 34.542 11.422  54.484 1.00 16.23 ? 1166 ASN A N    1 
ATOM   2290 C CA   . ASN A 1 145 ? 35.972 11.455  54.742 1.00 18.16 ? 1166 ASN A CA   1 
ATOM   2291 C C    . ASN A 1 145 ? 36.863 10.974  53.586 1.00 14.57 ? 1166 ASN A C    1 
ATOM   2292 O O    . ASN A 1 145 ? 38.068 10.949  53.728 1.00 14.66 ? 1166 ASN A O    1 
ATOM   2293 C CB   . ASN A 1 145 ? 36.303 10.611  55.992 1.00 21.89 ? 1166 ASN A CB   1 
ATOM   2294 C CG   . ASN A 1 145 ? 35.644 11.142  57.245 1.00 29.53 ? 1166 ASN A CG   1 
ATOM   2295 O OD1  . ASN A 1 145 ? 35.332 12.326  57.333 1.00 29.79 ? 1166 ASN A OD1  1 
ATOM   2296 N ND2  . ASN A 1 145 ? 35.420 10.269  58.219 1.00 33.32 ? 1166 ASN A ND2  1 
ATOM   2297 H H    . ASN A 1 145 ? 34.140 10.785  54.898 1.00 19.47 ? 1166 ASN A H    1 
ATOM   2298 H HA   . ASN A 1 145 ? 36.227 12.381  54.938 1.00 21.80 ? 1166 ASN A HA   1 
ATOM   2299 H HB2  . ASN A 1 145 ? 35.993 9.703   55.852 1.00 26.27 ? 1166 ASN A HB2  1 
ATOM   2300 H HB3  . ASN A 1 145 ? 37.263 10.617  56.133 1.00 26.27 ? 1166 ASN A HB3  1 
ATOM   2301 H HD21 . ASN A 1 145 ? 35.649 9.446   58.119 1.00 39.98 ? 1166 ASN A HD21 1 
ATOM   2302 H HD22 . ASN A 1 145 ? 35.047 10.526  58.950 1.00 39.98 ? 1166 ASN A HD22 1 
ATOM   2303 N N    . ALA A 1 146 ? 36.290 10.581  52.459 1.00 12.03 ? 1167 ALA A N    1 
ATOM   2304 C CA   . ALA A 1 146 ? 37.136 10.231  51.315 1.00 11.12 ? 1167 ALA A CA   1 
ATOM   2305 C C    . ALA A 1 146 ? 38.083 11.390  50.981 1.00 10.00 ? 1167 ALA A C    1 
ATOM   2306 O O    . ALA A 1 146 ? 37.754 12.564  51.144 1.00 11.66 ? 1167 ALA A O    1 
ATOM   2307 C CB   . ALA A 1 146 ? 36.297 9.916   50.123 1.00 9.63  ? 1167 ALA A CB   1 
ATOM   2308 H H    . ALA A 1 146 ? 35.443 10.508  52.326 1.00 14.44 ? 1167 ALA A H    1 
ATOM   2309 H HA   . ALA A 1 146 ? 37.674 9.442   51.535 1.00 13.34 ? 1167 ALA A HA   1 
ATOM   2310 H HB1  . ALA A 1 146 ? 36.872 9.690   49.388 1.00 11.55 ? 1167 ALA A HB1  1 
ATOM   2311 H HB2  . ALA A 1 146 ? 35.725 9.174   50.332 1.00 11.55 ? 1167 ALA A HB2  1 
ATOM   2312 H HB3  . ALA A 1 146 ? 35.768 10.685  49.902 1.00 11.55 ? 1167 ALA A HB3  1 
ATOM   2313 N N    . ASP A 1 147 ? 39.262 11.031  50.529 1.00 9.83  ? 1168 ASP A N    1 
ATOM   2314 C CA   . ASP A 1 147 ? 40.308 12.007  50.252 1.00 10.13 ? 1168 ASP A CA   1 
ATOM   2315 C C    . ASP A 1 147 ? 40.131 12.590  48.848 1.00 9.84  ? 1168 ASP A C    1 
ATOM   2316 O O    . ASP A 1 147 ? 40.105 11.878  47.849 1.00 9.43  ? 1168 ASP A O    1 
ATOM   2317 C CB   . ASP A 1 147 ? 41.675 11.344  50.413 1.00 11.74 ? 1168 ASP A CB   1 
ATOM   2318 C CG   . ASP A 1 147 ? 42.810 12.315  50.266 1.00 13.66 ? 1168 ASP A CG   1 
ATOM   2319 O OD1  . ASP A 1 147 ? 43.258 12.524  49.142 1.00 12.50 ? 1168 ASP A OD1  1 
ATOM   2320 O OD2  . ASP A 1 147 ? 43.255 12.891  51.273 1.00 17.33 ? 1168 ASP A OD2  1 
ATOM   2321 H H    . ASP A 1 147 ? 39.492 10.217  50.369 1.00 11.79 ? 1168 ASP A H    1 
ATOM   2322 H HA   . ASP A 1 147 ? 40.244 12.740  50.899 1.00 12.16 ? 1168 ASP A HA   1 
ATOM   2323 H HB2  . ASP A 1 147 ? 41.732 10.948  51.297 1.00 14.09 ? 1168 ASP A HB2  1 
ATOM   2324 H HB3  . ASP A 1 147 ? 41.776 10.659  49.734 1.00 14.09 ? 1168 ASP A HB3  1 
ATOM   2325 N N    . ILE A 1 148 ? 40.031 13.910  48.788 1.00 10.02 ? 1169 ILE A N    1 
ATOM   2326 C CA   . ILE A 1 148 ? 39.771 14.619  47.550 1.00 10.16 ? 1169 ILE A CA   1 
ATOM   2327 C C    . ILE A 1 148 ? 40.876 14.360  46.529 1.00 8.94  ? 1169 ILE A C    1 
ATOM   2328 O O    . ILE A 1 148 ? 40.603 14.114  45.353 1.00 8.62  ? 1169 ILE A O    1 
ATOM   2329 C CB   . ILE A 1 148 ? 39.626 16.128  47.838 1.00 13.42 ? 1169 ILE A CB   1 
ATOM   2330 C CG1  . ILE A 1 148 ? 38.279 16.359  48.528 1.00 18.19 ? 1169 ILE A CG1  1 
ATOM   2331 C CG2  . ILE A 1 148 ? 39.750 16.978  46.575 1.00 15.68 ? 1169 ILE A CG2  1 
ATOM   2332 C CD1  . ILE A 1 148 ? 38.100 17.745  49.034 1.00 20.35 ? 1169 ILE A CD1  1 
ATOM   2333 H H    . ILE A 1 148 ? 40.111 14.428  49.470 1.00 12.03 ? 1169 ILE A H    1 
ATOM   2334 H HA   . ILE A 1 148 ? 38.925 14.300  47.170 1.00 12.19 ? 1169 ILE A HA   1 
ATOM   2335 H HB   . ILE A 1 148 ? 40.331 16.389  48.451 1.00 16.10 ? 1169 ILE A HB   1 
ATOM   2336 H HG12 . ILE A 1 148 ? 37.567 16.180  47.893 1.00 21.83 ? 1169 ILE A HG12 1 
ATOM   2337 H HG13 . ILE A 1 148 ? 38.206 15.755  49.283 1.00 21.83 ? 1169 ILE A HG13 1 
ATOM   2338 H HG21 . ILE A 1 148 ? 39.653 17.904  46.812 1.00 18.82 ? 1169 ILE A HG21 1 
ATOM   2339 H HG22 . ILE A 1 148 ? 40.613 16.829  46.182 1.00 18.82 ? 1169 ILE A HG22 1 
ATOM   2340 H HG23 . ILE A 1 148 ? 39.060 16.723  45.958 1.00 18.82 ? 1169 ILE A HG23 1 
ATOM   2341 H HD11 . ILE A 1 148 ? 37.239 17.817  49.452 1.00 24.42 ? 1169 ILE A HD11 1 
ATOM   2342 H HD12 . ILE A 1 148 ? 38.791 17.936  49.673 1.00 24.42 ? 1169 ILE A HD12 1 
ATOM   2343 H HD13 . ILE A 1 148 ? 38.158 18.357  48.296 1.00 24.42 ? 1169 ILE A HD13 1 
ATOM   2344 N N    A SER A 1 149 ? 42.113 14.458  46.983 0.57 9.25  ? 1170 SER A N    1 
ATOM   2345 N N    B SER A 1 149 ? 42.127 14.433  46.953 0.43 9.96  ? 1170 SER A N    1 
ATOM   2346 C CA   A SER A 1 149 ? 43.227 14.203  46.107 0.57 8.52  ? 1170 SER A CA   1 
ATOM   2347 C CA   B SER A 1 149 ? 43.219 14.191  46.022 0.43 10.39 ? 1170 SER A CA   1 
ATOM   2348 C C    A SER A 1 149 ? 43.191 12.786  45.539 0.57 8.05  ? 1170 SER A C    1 
ATOM   2349 C C    B SER A 1 149 ? 43.236 12.755  45.517 0.43 9.32  ? 1170 SER A C    1 
ATOM   2350 O O    A SER A 1 149 ? 43.429 12.594  44.338 0.57 7.21  ? 1170 SER A O    1 
ATOM   2351 O O    B SER A 1 149 ? 43.557 12.508  44.350 0.43 9.01  ? 1170 SER A O    1 
ATOM   2352 C CB   A SER A 1 149 ? 44.548 14.434  46.827 0.57 10.89 ? 1170 SER A CB   1 
ATOM   2353 C CB   B SER A 1 149 ? 44.559 14.520  46.662 0.43 11.33 ? 1170 SER A CB   1 
ATOM   2354 O OG   A SER A 1 149 ? 45.587 14.423  45.874 0.57 12.11 ? 1170 SER A OG   1 
ATOM   2355 O OG   B SER A 1 149 ? 44.653 15.899  46.924 0.43 15.08 ? 1170 SER A OG   1 
ATOM   2356 H H    A SER A 1 149 ? 42.328 14.670  47.788 0.57 11.10 ? 1170 SER A H    1 
ATOM   2357 H H    B SER A 1 149 ? 42.370 14.617  47.758 0.43 11.96 ? 1170 SER A H    1 
ATOM   2358 H HA   A SER A 1 149 ? 43.184 14.828  45.354 0.57 10.22 ? 1170 SER A HA   1 
ATOM   2359 H HA   B SER A 1 149 ? 43.107 14.778  45.246 0.43 12.47 ? 1170 SER A HA   1 
ATOM   2360 H HB2  A SER A 1 149 ? 44.527 15.296  47.271 0.57 13.07 ? 1170 SER A HB2  1 
ATOM   2361 H HB2  B SER A 1 149 ? 44.640 14.032  47.496 0.43 13.60 ? 1170 SER A HB2  1 
ATOM   2362 H HB3  A SER A 1 149 ? 44.693 13.724  47.472 0.57 13.07 ? 1170 SER A HB3  1 
ATOM   2363 H HB3  B SER A 1 149 ? 45.271 14.263  46.056 0.43 13.60 ? 1170 SER A HB3  1 
ATOM   2364 H HG   A SER A 1 149 ? 46.308 14.546  46.244 0.57 14.53 ? 1170 SER A HG   1 
ATOM   2365 H HG   B SER A 1 149 ? 45.377 16.070  47.268 0.43 18.10 ? 1170 SER A HG   1 
ATOM   2366 N N    . GLU A 1 150 ? 42.925 11.802  46.383 1.00 8.39  ? 1171 GLU A N    1 
ATOM   2367 C CA   . GLU A 1 150 ? 42.870 10.422  45.923 1.00 7.45  ? 1171 GLU A CA   1 
ATOM   2368 C C    . GLU A 1 150 ? 41.821 10.251  44.841 1.00 6.92  ? 1171 GLU A C    1 
ATOM   2369 O O    . GLU A 1 150 ? 42.051 9.576   43.837 1.00 7.02  ? 1171 GLU A O    1 
ATOM   2370 C CB   . GLU A 1 150 ? 42.571 9.451   47.061 1.00 8.58  ? 1171 GLU A CB   1 
ATOM   2371 C CG   . GLU A 1 150 ? 43.734 9.284   47.994 1.00 10.27 ? 1171 GLU A CG   1 
ATOM   2372 C CD   . GLU A 1 150 ? 43.518 8.305   49.122 1.00 13.12 ? 1171 GLU A CD   1 
ATOM   2373 O OE1  . GLU A 1 150 ? 42.398 7.779   49.324 1.00 11.43 ? 1171 GLU A OE1  1 
ATOM   2374 O OE2  . GLU A 1 150 ? 44.508 8.083   49.840 1.00 16.72 ? 1171 GLU A OE2  1 
ATOM   2375 H H    . GLU A 1 150 ? 42.762 11.917  47.220 0.43 10.07 ? 1171 GLU A H    1 
ATOM   2376 H HA   . GLU A 1 150 ? 43.739 10.180  45.541 1.00 8.94  ? 1171 GLU A HA   1 
ATOM   2377 H HB2  . GLU A 1 150 ? 41.819 9.787   47.575 1.00 10.30 ? 1171 GLU A HB2  1 
ATOM   2378 H HB3  . GLU A 1 150 ? 42.357 8.581   46.688 1.00 10.30 ? 1171 GLU A HB3  1 
ATOM   2379 H HG2  . GLU A 1 150 ? 44.497 8.975   47.481 1.00 12.33 ? 1171 GLU A HG2  1 
ATOM   2380 H HG3  . GLU A 1 150 ? 43.936 10.146  48.390 1.00 12.33 ? 1171 GLU A HG3  1 
ATOM   2381 N N    . MET A 1 151 ? 40.644 10.849  45.035 1.00 6.49  ? 1172 MET A N    1 
ATOM   2382 C CA   . MET A 1 151 ? 39.585 10.694  44.045 1.00 6.46  ? 1172 MET A CA   1 
ATOM   2383 C C    . MET A 1 151 ? 39.965 11.373  42.730 1.00 6.38  ? 1172 MET A C    1 
ATOM   2384 O O    . MET A 1 151 ? 39.662 10.847  41.658 1.00 6.44  ? 1172 MET A O    1 
ATOM   2385 C CB   . MET A 1 151 ? 38.232 11.208  44.547 1.00 7.60  ? 1172 MET A CB   1 
ATOM   2386 C CG   . MET A 1 151 ? 37.681 10.428  45.702 1.00 9.44  ? 1172 MET A CG   1 
ATOM   2387 S SD   . MET A 1 151 ? 37.300 8.728   45.322 1.00 10.89 ? 1172 MET A SD   1 
ATOM   2388 C CE   . MET A 1 151 ? 38.687 8.162   46.053 1.00 8.91  ? 1172 MET A CE   1 
ATOM   2389 H H    . MET A 1 151 ? 40.439 11.336  45.713 1.00 7.79  ? 1172 MET A H    1 
ATOM   2390 H HA   . MET A 1 151 ? 39.477 9.736   43.868 1.00 7.75  ? 1172 MET A HA   1 
ATOM   2391 H HB2  . MET A 1 151 ? 38.335 12.129  44.833 1.00 9.12  ? 1172 MET A HB2  1 
ATOM   2392 H HB3  . MET A 1 151 ? 37.590 11.159  43.822 1.00 9.12  ? 1172 MET A HB3  1 
ATOM   2393 H HG2  . MET A 1 151 ? 38.333 10.432  46.419 1.00 11.33 ? 1172 MET A HG2  1 
ATOM   2394 H HG3  . MET A 1 151 ? 36.862 10.854  46.002 1.00 11.33 ? 1172 MET A HG3  1 
ATOM   2395 H HE1  . MET A 1 151 ? 38.713 7.205   45.975 1.00 10.69 ? 1172 MET A HE1  1 
ATOM   2396 H HE2  . MET A 1 151 ? 39.450 8.547   45.615 1.00 10.69 ? 1172 MET A HE2  1 
ATOM   2397 H HE3  . MET A 1 151 ? 38.678 8.415   46.979 1.00 10.69 ? 1172 MET A HE3  1 
ATOM   2398 N N    . GLN A 1 152 ? 40.598 12.535  42.796 1.00 6.59  ? 1173 GLN A N    1 
ATOM   2399 C CA   . GLN A 1 152 ? 41.097 13.176  41.589 1.00 6.15  ? 1173 GLN A CA   1 
ATOM   2400 C C    . GLN A 1 152 ? 42.145 12.336  40.868 1.00 6.55  ? 1173 GLN A C    1 
ATOM   2401 O O    . GLN A 1 152 ? 42.152 12.236  39.652 1.00 7.85  ? 1173 GLN A O    1 
ATOM   2402 C CB   . GLN A 1 152 ? 41.738 14.516  41.949 1.00 6.79  ? 1173 GLN A CB   1 
ATOM   2403 C CG   . GLN A 1 152 ? 40.760 15.618  42.266 1.00 7.01  ? 1173 GLN A CG   1 
ATOM   2404 C CD   . GLN A 1 152 ? 41.454 16.834  42.811 1.00 8.76  ? 1173 GLN A CD   1 
ATOM   2405 O OE1  . GLN A 1 152 ? 42.673 16.893  42.856 1.00 12.17 ? 1173 GLN A OE1  1 
ATOM   2406 N NE2  . GLN A 1 152 ? 40.683 17.825  43.206 1.00 9.45  ? 1173 GLN A NE2  1 
ATOM   2407 H H    . GLN A 1 152 ? 40.752 12.971  43.521 1.00 7.91  ? 1173 GLN A H    1 
ATOM   2408 H HA   . GLN A 1 152 ? 40.352 13.342  40.974 1.00 7.38  ? 1173 GLN A HA   1 
ATOM   2409 H HB2  . GLN A 1 152 ? 42.301 14.390  42.728 1.00 8.15  ? 1173 GLN A HB2  1 
ATOM   2410 H HB3  . GLN A 1 152 ? 42.279 14.811  41.200 1.00 8.15  ? 1173 GLN A HB3  1 
ATOM   2411 H HG2  . GLN A 1 152 ? 40.292 15.873  41.456 1.00 8.41  ? 1173 GLN A HG2  1 
ATOM   2412 H HG3  . GLN A 1 152 ? 40.130 15.303  42.933 1.00 8.41  ? 1173 GLN A HG3  1 
ATOM   2413 H HE21 . GLN A 1 152 ? 39.828 17.755  43.145 1.00 11.34 ? 1173 GLN A HE21 1 
ATOM   2414 H HE22 . GLN A 1 152 ? 41.034 18.542  43.525 1.00 11.34 ? 1173 GLN A HE22 1 
ATOM   2415 N N    . THR A 1 153 ? 43.039 11.715  41.640 1.00 6.15  ? 1174 THR A N    1 
ATOM   2416 C CA   . THR A 1 153 ? 44.135 10.910  41.113 1.00 7.07  ? 1174 THR A CA   1 
ATOM   2417 C C    . THR A 1 153 ? 43.606 9.690   40.379 1.00 6.79  ? 1174 THR A C    1 
ATOM   2418 O O    . THR A 1 153 ? 44.085 9.338   39.294 1.00 7.25  ? 1174 THR A O    1 
ATOM   2419 C CB   . THR A 1 153 ? 45.079 10.477  42.264 1.00 8.06  ? 1174 THR A CB   1 
ATOM   2420 O OG1  . THR A 1 153 ? 45.716 11.637  42.797 1.00 9.53  ? 1174 THR A OG1  1 
ATOM   2421 C CG2  . THR A 1 153 ? 46.110 9.464   41.809 1.00 9.21  ? 1174 THR A CG2  1 
ATOM   2422 H H    . THR A 1 153 ? 43.027 11.749  42.499 1.00 7.38  ? 1174 THR A H    1 
ATOM   2423 H HA   . THR A 1 153 ? 44.654 11.447  40.478 1.00 8.49  ? 1174 THR A HA   1 
ATOM   2424 H HB   . THR A 1 153 ? 44.548 10.064  42.963 1.00 9.67  ? 1174 THR A HB   1 
ATOM   2425 H HG1  . THR A 1 153 ? 45.153 12.158  43.085 1.00 11.44 ? 1174 THR A HG1  1 
ATOM   2426 H HG21 . THR A 1 153 ? 46.675 9.219   42.544 1.00 11.05 ? 1174 THR A HG21 1 
ATOM   2427 H HG22 . THR A 1 153 ? 45.672 8.678   41.476 1.00 11.05 ? 1174 THR A HG22 1 
ATOM   2428 H HG23 . THR A 1 153 ? 46.651 9.839   41.110 1.00 11.05 ? 1174 THR A HG23 1 
ATOM   2429 N N    A ILE A 1 154 ? 42.614 9.040   40.978 0.61 5.61  ? 1175 ILE A N    1 
ATOM   2430 N N    B ILE A 1 154 ? 42.619 9.014   40.952 0.39 6.15  ? 1175 ILE A N    1 
ATOM   2431 C CA   A ILE A 1 154 ? 41.996 7.858   40.401 0.61 6.06  ? 1175 ILE A CA   1 
ATOM   2432 C CA   B ILE A 1 154 ? 42.099 7.825   40.293 0.39 6.64  ? 1175 ILE A CA   1 
ATOM   2433 C C    A ILE A 1 154 ? 41.267 8.218   39.109 0.61 6.40  ? 1175 ILE A C    1 
ATOM   2434 C C    B ILE A 1 154 ? 41.222 8.189   39.092 0.39 6.11  ? 1175 ILE A C    1 
ATOM   2435 O O    A ILE A 1 154 ? 41.294 7.477   38.134 0.61 9.20  ? 1175 ILE A O    1 
ATOM   2436 O O    B ILE A 1 154 ? 41.115 7.423   38.148 0.39 4.52  ? 1175 ILE A O    1 
ATOM   2437 C CB   A ILE A 1 154 ? 41.034 7.213   41.419 0.61 7.84  ? 1175 ILE A CB   1 
ATOM   2438 C CB   B ILE A 1 154 ? 41.376 6.857   41.271 0.39 5.62  ? 1175 ILE A CB   1 
ATOM   2439 C CG1  A ILE A 1 154 ? 41.845 6.512   42.505 0.61 8.85  ? 1175 ILE A CG1  1 
ATOM   2440 C CG1  B ILE A 1 154 ? 40.046 7.414   41.780 0.39 4.86  ? 1175 ILE A CG1  1 
ATOM   2441 C CG2  A ILE A 1 154 ? 40.114 6.236   40.743 0.61 8.35  ? 1175 ILE A CG2  1 
ATOM   2442 C CG2  B ILE A 1 154 ? 42.276 6.521   42.446 0.39 7.05  ? 1175 ILE A CG2  1 
ATOM   2443 C CD1  A ILE A 1 154 ? 41.050 6.193   43.744 0.61 8.75  ? 1175 ILE A CD1  1 
ATOM   2444 C CD1  B ILE A 1 154 ? 39.231 6.372   42.565 0.39 6.02  ? 1175 ILE A CD1  1 
ATOM   2445 H H    A ILE A 1 154 ? 42.277 9.271   41.734 0.61 6.74  ? 1175 ILE A H    1 
ATOM   2446 H H    B ILE A 1 154 ? 42.243 9.215   41.699 0.39 7.38  ? 1175 ILE A H    1 
ATOM   2447 H HA   A ILE A 1 154 ? 42.693 7.205   40.184 0.61 7.27  ? 1175 ILE A HA   1 
ATOM   2448 H HA   B ILE A 1 154 ? 42.866 7.332   39.935 0.39 7.97  ? 1175 ILE A HA   1 
ATOM   2449 H HB   A ILE A 1 154 ? 40.500 7.911   41.829 0.61 9.40  ? 1175 ILE A HB   1 
ATOM   2450 H HB   B ILE A 1 154 ? 41.191 6.034   40.792 0.39 6.74  ? 1175 ILE A HB   1 
ATOM   2451 H HG12 A ILE A 1 154 ? 42.187 5.677   42.150 0.61 10.62 ? 1175 ILE A HG12 1 
ATOM   2452 H HG12 B ILE A 1 154 ? 40.222 8.164   42.369 0.39 5.83  ? 1175 ILE A HG12 1 
ATOM   2453 H HG13 A ILE A 1 154 ? 42.582 7.086   42.765 0.61 10.62 ? 1175 ILE A HG13 1 
ATOM   2454 H HG13 B ILE A 1 154 ? 39.514 7.703   41.022 0.39 5.83  ? 1175 ILE A HG13 1 
ATOM   2455 H HG21 A ILE A 1 154 ? 39.529 5.852   41.400 0.61 10.02 ? 1175 ILE A HG21 1 
ATOM   2456 H HG21 B ILE A 1 154 ? 41.810 5.923   43.035 0.39 8.45  ? 1175 ILE A HG21 1 
ATOM   2457 H HG22 A ILE A 1 154 ? 39.600 6.700   40.078 0.61 10.02 ? 1175 ILE A HG22 1 
ATOM   2458 H HG22 B ILE A 1 154 ? 43.074 6.101   42.118 0.39 8.45  ? 1175 ILE A HG22 1 
ATOM   2459 H HG23 A ILE A 1 154 ? 40.640 5.548   40.329 0.61 10.02 ? 1175 ILE A HG23 1 
ATOM   2460 H HG23 B ILE A 1 154 ? 42.498 7.331   42.910 0.39 8.45  ? 1175 ILE A HG23 1 
ATOM   2461 H HD11 A ILE A 1 154 ? 41.623 5.756   44.378 0.61 10.50 ? 1175 ILE A HD11 1 
ATOM   2462 H HD11 B ILE A 1 154 ? 38.411 6.775   42.859 0.39 7.22  ? 1175 ILE A HD11 1 
ATOM   2463 H HD12 A ILE A 1 154 ? 40.712 7.011   44.116 0.61 10.50 ? 1175 ILE A HD12 1 
ATOM   2464 H HD12 B ILE A 1 154 ? 39.043 5.626   41.991 0.39 7.22  ? 1175 ILE A HD12 1 
ATOM   2465 H HD13 A ILE A 1 154 ? 40.322 5.615   43.507 0.61 10.50 ? 1175 ILE A HD13 1 
ATOM   2466 H HD13 B ILE A 1 154 ? 39.744 6.082   43.323 0.39 7.22  ? 1175 ILE A HD13 1 
ATOM   2467 N N    . SER A 1 155 ? 40.597 9.359   39.113 1.00 5.51  ? 1176 SER A N    1 
ATOM   2468 C CA   . SER A 1 155 ? 39.776 9.791   37.999 1.00 5.70  ? 1176 SER A CA   1 
ATOM   2469 C C    . SER A 1 155 ? 40.613 9.991   36.754 1.00 5.34  ? 1176 SER A C    1 
ATOM   2470 O O    . SER A 1 155 ? 41.778 10.366  36.823 1.00 6.42  ? 1176 SER A O    1 
ATOM   2471 C CB   . SER A 1 155 ? 39.030 11.067  38.362 1.00 5.41  ? 1176 SER A CB   1 
ATOM   2472 O OG   . SER A 1 155 ? 38.095 10.869  39.408 1.00 6.02  ? 1176 SER A OG   1 
ATOM   2473 H H    . SER A 1 155 ? 40.618 9.918   39.767 0.39 6.62  ? 1176 SER A H    1 
ATOM   2474 H HA   . SER A 1 155 ? 39.112 9.097   37.807 1.00 6.84  ? 1176 SER A HA   1 
ATOM   2475 H HB2  . SER A 1 155 ? 39.674 11.734  38.644 1.00 6.49  ? 1176 SER A HB2  1 
ATOM   2476 H HB3  . SER A 1 155 ? 38.555 11.382  37.577 1.00 6.49  ? 1176 SER A HB3  1 
ATOM   2477 H HG   . SER A 1 155 ? 38.108 10.086  39.652 1.00 7.23  ? 1176 SER A HG   1 
ATOM   2478 N N    . PHE A 1 156 ? 40.010 9.770   35.604 1.00 5.74  ? 1177 PHE A N    1 
ATOM   2479 C CA   . PHE A 1 156 ? 40.751 9.871   34.334 1.00 6.04  ? 1177 PHE A CA   1 
ATOM   2480 C C    . PHE A 1 156 ? 41.455 11.213  34.199 1.00 5.80  ? 1177 PHE A C    1 
ATOM   2481 O O    . PHE A 1 156 ? 42.630 11.268  33.831 1.00 6.89  ? 1177 PHE A O    1 
ATOM   2482 C CB   . PHE A 1 156 ? 39.741 9.630   33.210 1.00 7.67  ? 1177 PHE A CB   1 
ATOM   2483 C CG   . PHE A 1 156 ? 40.333 9.472   31.855 1.00 10.57 ? 1177 PHE A CG   1 
ATOM   2484 C CD1  . PHE A 1 156 ? 40.947 8.302   31.477 1.00 14.72 ? 1177 PHE A CD1  1 
ATOM   2485 C CD2  . PHE A 1 156 ? 40.210 10.495  30.934 1.00 15.75 ? 1177 PHE A CD2  1 
ATOM   2486 C CE1  . PHE A 1 156 ? 41.444 8.143   30.199 1.00 20.74 ? 1177 PHE A CE1  1 
ATOM   2487 C CE2  . PHE A 1 156 ? 40.711 10.333  29.639 1.00 20.28 ? 1177 PHE A CE2  1 
ATOM   2488 C CZ   . PHE A 1 156 ? 41.331 9.157   29.299 1.00 20.49 ? 1177 PHE A CZ   1 
ATOM   2489 H H    . PHE A 1 156 ? 39.180 9.562   35.517 1.00 6.89  ? 1177 PHE A H    1 
ATOM   2490 H HA   . PHE A 1 156 ? 41.428 9.164   34.296 1.00 7.25  ? 1177 PHE A HA   1 
ATOM   2491 H HB2  . PHE A 1 156 ? 39.247 8.820   33.409 1.00 9.20  ? 1177 PHE A HB2  1 
ATOM   2492 H HB3  . PHE A 1 156 ? 39.131 10.383  33.177 1.00 9.20  ? 1177 PHE A HB3  1 
ATOM   2493 H HD1  . PHE A 1 156 ? 41.019 7.604   32.087 1.00 17.66 ? 1177 PHE A HD1  1 
ATOM   2494 H HD2  . PHE A 1 156 ? 39.782 11.286  31.172 1.00 18.90 ? 1177 PHE A HD2  1 
ATOM   2495 H HE1  . PHE A 1 156 ? 41.868 7.351   29.959 1.00 24.88 ? 1177 PHE A HE1  1 
ATOM   2496 H HE2  . PHE A 1 156 ? 40.643 11.023  29.020 1.00 24.34 ? 1177 PHE A HE2  1 
ATOM   2497 H HZ   . PHE A 1 156 ? 41.678 9.053   28.443 1.00 24.59 ? 1177 PHE A HZ   1 
ATOM   2498 N N    . ILE A 1 157 ? 40.714 12.279  34.483 1.00 6.17  ? 1178 ILE A N    1 
ATOM   2499 C CA   . ILE A 1 157 ? 41.265 13.609  34.727 1.00 6.34  ? 1178 ILE A CA   1 
ATOM   2500 C C    . ILE A 1 157 ? 40.618 14.111  36.007 1.00 6.35  ? 1178 ILE A C    1 
ATOM   2501 O O    . ILE A 1 157 ? 39.547 13.666  36.395 1.00 6.29  ? 1178 ILE A O    1 
ATOM   2502 C CB   . ILE A 1 157 ? 41.007 14.598  33.559 1.00 7.32  ? 1178 ILE A CB   1 
ATOM   2503 C CG1  . ILE A 1 157 ? 39.502 14.808  33.292 1.00 8.54  ? 1178 ILE A CG1  1 
ATOM   2504 C CG2  . ILE A 1 157 ? 41.713 14.111  32.318 1.00 9.60  ? 1178 ILE A CG2  1 
ATOM   2505 C CD1  . ILE A 1 157 ? 39.178 15.883  32.255 1.00 10.20 ? 1178 ILE A CD1  1 
ATOM   2506 H H    . ILE A 1 157 ? 39.857 12.256  34.542 1.00 7.41  ? 1178 ILE A H    1 
ATOM   2507 H HA   . ILE A 1 157 ? 42.232 13.542  34.871 1.00 7.61  ? 1178 ILE A HA   1 
ATOM   2508 H HB   . ILE A 1 157 ? 41.390 15.456  33.803 1.00 8.79  ? 1178 ILE A HB   1 
ATOM   2509 H HG12 . ILE A 1 157 ? 39.125 13.972  32.975 1.00 10.24 ? 1178 ILE A HG12 1 
ATOM   2510 H HG13 . ILE A 1 157 ? 39.073 15.064  34.124 1.00 10.24 ? 1178 ILE A HG13 1 
ATOM   2511 H HG21 . ILE A 1 157 ? 41.548 14.729  31.602 1.00 11.52 ? 1178 ILE A HG21 1 
ATOM   2512 H HG22 . ILE A 1 157 ? 42.655 14.058  32.494 1.00 11.52 ? 1178 ILE A HG22 1 
ATOM   2513 H HG23 . ILE A 1 157 ? 41.373 13.243  32.086 1.00 11.52 ? 1178 ILE A HG23 1 
ATOM   2514 H HD11 . ILE A 1 157 ? 38.225 15.943  32.154 1.00 12.24 ? 1178 ILE A HD11 1 
ATOM   2515 H HD12 . ILE A 1 157 ? 39.530 16.724  32.556 1.00 12.24 ? 1178 ILE A HD12 1 
ATOM   2516 H HD13 . ILE A 1 157 ? 39.581 15.641  31.418 1.00 12.24 ? 1178 ILE A HD13 1 
ATOM   2517 N N    . PRO A 1 158 ? 41.278 15.035  36.712 1.00 6.21  ? 1179 PRO A N    1 
ATOM   2518 C CA   . PRO A 1 158 ? 40.738 15.478  38.015 1.00 6.84  ? 1179 PRO A CA   1 
ATOM   2519 C C    . PRO A 1 158 ? 39.312 16.035  37.972 1.00 5.67  ? 1179 PRO A C    1 
ATOM   2520 O O    . PRO A 1 158 ? 38.566 15.856  38.918 1.00 6.79  ? 1179 PRO A O    1 
ATOM   2521 C CB   . PRO A 1 158 ? 41.752 16.525  38.483 1.00 6.33  ? 1179 PRO A CB   1 
ATOM   2522 C CG   . PRO A 1 158 ? 43.045 16.073  37.849 1.00 7.75  ? 1179 PRO A CG   1 
ATOM   2523 C CD   . PRO A 1 158 ? 42.634 15.562  36.475 1.00 6.85  ? 1179 PRO A CD   1 
ATOM   2524 H HA   . PRO A 1 158 ? 40.756 14.727  38.645 1.00 8.21  ? 1179 PRO A HA   1 
ATOM   2525 H HB2  . PRO A 1 158 ? 41.495 17.402  38.160 1.00 7.60  ? 1179 PRO A HB2  1 
ATOM   2526 H HB3  . PRO A 1 158 ? 41.817 16.514  39.450 1.00 7.60  ? 1179 PRO A HB3  1 
ATOM   2527 H HG2  . PRO A 1 158 ? 43.654 16.824  37.770 1.00 9.30  ? 1179 PRO A HG2  1 
ATOM   2528 H HG3  . PRO A 1 158 ? 43.440 15.362  38.377 1.00 9.30  ? 1179 PRO A HG3  1 
ATOM   2529 H HD2  . PRO A 1 158 ? 42.608 16.291  35.835 1.00 8.22  ? 1179 PRO A HD2  1 
ATOM   2530 H HD3  . PRO A 1 158 ? 43.228 14.853  36.184 1.00 8.22  ? 1179 PRO A HD3  1 
ATOM   2531 N N    . ASP A 1 159 ? 38.959 16.715  36.897 1.00 6.55  ? 1180 ASP A N    1 
ATOM   2532 C CA   . ASP A 1 159 ? 37.635 17.306  36.740 1.00 7.05  ? 1180 ASP A CA   1 
ATOM   2533 C C    . ASP A 1 159 ? 36.540 16.292  37.009 1.00 6.77  ? 1180 ASP A C    1 
ATOM   2534 O O    . ASP A 1 159 ? 35.511 16.613  37.601 1.00 8.77  ? 1180 ASP A O    1 
ATOM   2535 C CB   . ASP A 1 159 ? 37.521 17.837  35.302 1.00 8.16  ? 1180 ASP A CB   1 
ATOM   2536 C CG   . ASP A 1 159 ? 36.266 18.600  35.016 1.00 8.54  ? 1180 ASP A CG   1 
ATOM   2537 O OD1  . ASP A 1 159 ? 35.578 19.086  35.917 1.00 10.72 ? 1180 ASP A OD1  1 
ATOM   2538 O OD2  . ASP A 1 159 ? 35.998 18.723  33.801 1.00 12.26 ? 1180 ASP A OD2  1 
ATOM   2539 H H    . ASP A 1 159 ? 39.478 16.854  36.226 1.00 7.86  ? 1180 ASP A H    1 
ATOM   2540 H HA   . ASP A 1 159 ? 37.530 18.056  37.362 1.00 8.45  ? 1180 ASP A HA   1 
ATOM   2541 H HB2  . ASP A 1 159 ? 38.270 18.428  35.131 1.00 9.80  ? 1180 ASP A HB2  1 
ATOM   2542 H HB3  . ASP A 1 159 ? 37.553 17.084  34.691 1.00 9.80  ? 1180 ASP A HB3  1 
ATOM   2543 N N    . PHE A 1 160 ? 36.763 15.042  36.595 1.00 6.38  ? 1181 PHE A N    1 
ATOM   2544 C CA   . PHE A 1 160 ? 35.711 14.046  36.716 1.00 7.54  ? 1181 PHE A CA   1 
ATOM   2545 C C    . PHE A 1 160 ? 35.358 13.672  38.169 1.00 7.22  ? 1181 PHE A C    1 
ATOM   2546 O O    . PHE A 1 160 ? 34.253 13.159  38.404 1.00 8.48  ? 1181 PHE A O    1 
ATOM   2547 C CB   . PHE A 1 160 ? 36.064 12.763  35.981 1.00 7.95  ? 1181 PHE A CB   1 
ATOM   2548 C CG   . PHE A 1 160 ? 36.141 12.849  34.474 1.00 8.24  ? 1181 PHE A CG   1 
ATOM   2549 C CD1  . PHE A 1 160 ? 35.915 14.010  33.763 1.00 9.81  ? 1181 PHE A CD1  1 
ATOM   2550 C CD2  . PHE A 1 160 ? 36.455 11.695  33.791 1.00 10.03 ? 1181 PHE A CD2  1 
ATOM   2551 C CE1  . PHE A 1 160 ? 36.011 14.004  32.373 1.00 12.34 ? 1181 PHE A CE1  1 
ATOM   2552 C CE2  . PHE A 1 160 ? 36.547 11.692  32.424 1.00 11.38 ? 1181 PHE A CE2  1 
ATOM   2553 C CZ   . PHE A 1 160 ? 36.331 12.835  31.714 1.00 12.19 ? 1181 PHE A CZ   1 
ATOM   2554 H H    . PHE A 1 160 ? 37.497 14.757  36.249 1.00 7.66  ? 1181 PHE A H    1 
ATOM   2555 H HA   . PHE A 1 160 ? 34.899 14.406  36.302 1.00 9.05  ? 1181 PHE A HA   1 
ATOM   2556 H HB2  . PHE A 1 160 ? 36.930 12.461  36.297 1.00 9.54  ? 1181 PHE A HB2  1 
ATOM   2557 H HB3  . PHE A 1 160 ? 35.393 12.096  36.197 1.00 9.54  ? 1181 PHE A HB3  1 
ATOM   2558 H HD1  . PHE A 1 160 ? 35.703 14.796  34.212 1.00 11.77 ? 1181 PHE A HD1  1 
ATOM   2559 H HD2  . PHE A 1 160 ? 36.609 10.909  34.264 1.00 12.03 ? 1181 PHE A HD2  1 
ATOM   2560 H HE1  . PHE A 1 160 ? 35.860 14.785  31.891 1.00 14.81 ? 1181 PHE A HE1  1 
ATOM   2561 H HE2  . PHE A 1 160 ? 36.762 10.905  31.977 1.00 13.66 ? 1181 PHE A HE2  1 
ATOM   2562 H HZ   . PHE A 1 160 ? 36.392 12.825  30.786 1.00 14.63 ? 1181 PHE A HZ   1 
ATOM   2563 N N    . ALA A 1 161 ? 36.279 13.870  39.107 1.00 6.65  ? 1182 ALA A N    1 
ATOM   2564 C CA   . ALA A 1 161 ? 36.048 13.506  40.489 1.00 6.29  ? 1182 ALA A CA   1 
ATOM   2565 C C    . ALA A 1 161 ? 34.944 14.340  41.101 1.00 7.10  ? 1182 ALA A C    1 
ATOM   2566 O O    . ALA A 1 161 ? 34.732 15.496  40.737 1.00 8.68  ? 1182 ALA A O    1 
ATOM   2567 C CB   . ALA A 1 161 ? 37.329 13.698  41.263 1.00 6.91  ? 1182 ALA A CB   1 
ATOM   2568 H H    . ALA A 1 161 ? 37.052 14.217  38.961 1.00 7.98  ? 1182 ALA A H    1 
ATOM   2569 H HA   . ALA A 1 161 ? 35.790 12.562  40.541 1.00 7.54  ? 1182 ALA A HA   1 
ATOM   2570 H HB1  . ALA A 1 161 ? 37.178 13.457  42.180 1.00 8.29  ? 1182 ALA A HB1  1 
ATOM   2571 H HB2  . ALA A 1 161 ? 38.009 13.136  40.884 1.00 8.29  ? 1182 ALA A HB2  1 
ATOM   2572 H HB3  . ALA A 1 161 ? 37.594 14.618  41.205 1.00 8.29  ? 1182 ALA A HB3  1 
ATOM   2573 N N    . VAL A 1 162 ? 34.271 13.749  42.063 1.00 7.68  ? 1183 VAL A N    1 
ATOM   2574 C CA   . VAL A 1 162 ? 33.239 14.406  42.833 1.00 9.62  ? 1183 VAL A CA   1 
ATOM   2575 C C    . VAL A 1 162 ? 33.536 14.234  44.328 1.00 8.42  ? 1183 VAL A C    1 
ATOM   2576 O O    . VAL A 1 162 ? 33.924 13.152  44.751 1.00 9.46  ? 1183 VAL A O    1 
ATOM   2577 C CB   . VAL A 1 162 ? 31.851 13.764  42.554 1.00 14.71 ? 1183 VAL A CB   1 
ATOM   2578 C CG1  . VAL A 1 162 ? 30.777 14.469  43.352 1.00 21.27 ? 1183 VAL A CG1  1 
ATOM   2579 C CG2  . VAL A 1 162 ? 31.502 13.805  41.074 1.00 15.33 ? 1183 VAL A CG2  1 
ATOM   2580 H H    . VAL A 1 162 ? 34.400 12.932  42.298 1.00 9.22  ? 1183 VAL A H    1 
ATOM   2581 H HA   . VAL A 1 162 ? 33.206 15.361  42.616 1.00 11.55 ? 1183 VAL A HA   1 
ATOM   2582 H HB   . VAL A 1 162 ? 31.871 12.825  42.835 1.00 17.65 ? 1183 VAL A HB   1 
ATOM   2583 H HG11 . VAL A 1 162 ? 31.181 15.170  43.867 1.00 25.52 ? 1183 VAL A HG11 1 
ATOM   2584 H HG12 . VAL A 1 162 ? 30.130 14.838  42.746 1.00 25.52 ? 1183 VAL A HG12 1 
ATOM   2585 H HG13 . VAL A 1 162 ? 30.355 13.834  43.935 1.00 25.52 ? 1183 VAL A HG13 1 
ATOM   2586 H HG21 . VAL A 1 162 ? 32.220 14.226  40.596 1.00 18.39 ? 1183 VAL A HG21 1 
ATOM   2587 H HG22 . VAL A 1 162 ? 31.380 12.907  40.757 1.00 18.39 ? 1183 VAL A HG22 1 
ATOM   2588 H HG23 . VAL A 1 162 ? 30.692 14.306  40.958 1.00 18.39 ? 1183 VAL A HG23 1 
ATOM   2589 N N    . ALA A 1 163 ? 33.327 15.289  45.113 1.00 10.12 ? 1184 ALA A N    1 
ATOM   2590 C CA   . ALA A 1 163 ? 33.362 15.225  46.575 1.00 12.04 ? 1184 ALA A CA   1 
ATOM   2591 C C    . ALA A 1 163 ? 32.002 15.598  47.097 1.00 12.18 ? 1184 ALA A C    1 
ATOM   2592 O O    . ALA A 1 163 ? 31.525 16.687  46.826 1.00 16.32 ? 1184 ALA A O    1 
ATOM   2593 C CB   . ALA A 1 163 ? 34.420 16.175  47.133 1.00 14.05 ? 1184 ALA A CB   1 
ATOM   2594 H H    . ALA A 1 163 ? 33.158 16.078  44.813 1.00 12.14 ? 1184 ALA A H    1 
ATOM   2595 H HA   . ALA A 1 163 ? 33.573 14.312  46.863 1.00 14.44 ? 1184 ALA A HA   1 
ATOM   2596 H HB1  . ALA A 1 163 ? 34.421 16.112  48.091 1.00 16.86 ? 1184 ALA A HB1  1 
ATOM   2597 H HB2  . ALA A 1 163 ? 35.279 15.923  46.787 1.00 16.86 ? 1184 ALA A HB2  1 
ATOM   2598 H HB3  . ALA A 1 163 ? 34.207 17.071  46.863 1.00 16.86 ? 1184 ALA A HB3  1 
ATOM   2599 N N    . ILE A 1 164 ? 31.367 14.705  47.839 1.00 10.53 ? 1185 ILE A N    1 
ATOM   2600 C CA   . ILE A 1 164 ? 30.123 15.059  48.509 1.00 13.34 ? 1185 ILE A CA   1 
ATOM   2601 C C    . ILE A 1 164 ? 30.245 14.745  49.988 1.00 12.03 ? 1185 ILE A C    1 
ATOM   2602 O O    . ILE A 1 164 ? 30.878 13.781  50.369 1.00 14.23 ? 1185 ILE A O    1 
ATOM   2603 C CB   . ILE A 1 164 ? 28.906 14.350  47.932 1.00 17.08 ? 1185 ILE A CB   1 
ATOM   2604 C CG1  . ILE A 1 164 ? 29.138 12.848  47.890 1.00 17.32 ? 1185 ILE A CG1  1 
ATOM   2605 C CG2  . ILE A 1 164 ? 28.539 14.912  46.572 1.00 22.04 ? 1185 ILE A CG2  1 
ATOM   2606 C CD1  . ILE A 1 164 ? 27.866 12.087  47.695 1.00 20.13 ? 1185 ILE A CD1  1 
ATOM   2607 H H    . ILE A 1 164 ? 31.629 13.897  47.970 1.00 12.63 ? 1185 ILE A H    1 
ATOM   2608 H HA   . ILE A 1 164 ? 29.979 16.024  48.417 1.00 16.00 ? 1185 ILE A HA   1 
ATOM   2609 H HB   . ILE A 1 164 ? 28.160 14.514  48.529 1.00 20.49 ? 1185 ILE A HB   1 
ATOM   2610 H HG12 . ILE A 1 164 ? 29.732 12.639  47.152 1.00 20.78 ? 1185 ILE A HG12 1 
ATOM   2611 H HG13 . ILE A 1 164 ? 29.535 12.564  48.728 1.00 20.78 ? 1185 ILE A HG13 1 
ATOM   2612 H HG21 . ILE A 1 164 ? 27.770 14.443  46.238 1.00 26.45 ? 1185 ILE A HG21 1 
ATOM   2613 H HG22 . ILE A 1 164 ? 28.339 15.846  46.664 1.00 26.45 ? 1185 ILE A HG22 1 
ATOM   2614 H HG23 . ILE A 1 164 ? 29.280 14.793  45.974 1.00 26.45 ? 1185 ILE A HG23 1 
ATOM   2615 H HD11 . ILE A 1 164 ? 28.064 11.148  47.675 1.00 24.15 ? 1185 ILE A HD11 1 
ATOM   2616 H HD12 . ILE A 1 164 ? 27.271 12.282  48.423 1.00 24.15 ? 1185 ILE A HD12 1 
ATOM   2617 H HD13 . ILE A 1 164 ? 27.466 12.355  46.864 1.00 24.15 ? 1185 ILE A HD13 1 
ATOM   2618 N N    . PRO A 1 165 ? 29.639 15.581  50.837 1.00 13.35 ? 1186 PRO A N    1 
ATOM   2619 C CA   . PRO A 1 165 ? 29.918 15.466  52.267 1.00 13.54 ? 1186 PRO A CA   1 
ATOM   2620 C C    . PRO A 1 165 ? 29.257 14.287  52.959 1.00 13.69 ? 1186 PRO A C    1 
ATOM   2621 O O    . PRO A 1 165 ? 29.825 13.800  53.926 1.00 16.86 ? 1186 PRO A O    1 
ATOM   2622 C CB   . PRO A 1 165 ? 29.333 16.754  52.836 1.00 15.93 ? 1186 PRO A CB   1 
ATOM   2623 C CG   . PRO A 1 165 ? 29.216 17.671  51.719 1.00 21.31 ? 1186 PRO A CG   1 
ATOM   2624 C CD   . PRO A 1 165 ? 29.001 16.859  50.500 1.00 15.26 ? 1186 PRO A CD   1 
ATOM   2625 H HA   . PRO A 1 165 ? 30.884 15.444  52.430 1.00 16.25 ? 1186 PRO A HA   1 
ATOM   2626 H HB2  . PRO A 1 165 ? 28.461 16.572  53.219 1.00 19.12 ? 1186 PRO A HB2  1 
ATOM   2627 H HB3  . PRO A 1 165 ? 29.932 17.112  53.509 1.00 19.12 ? 1186 PRO A HB3  1 
ATOM   2628 H HG2  . PRO A 1 165 ? 28.462 18.262  51.868 1.00 25.58 ? 1186 PRO A HG2  1 
ATOM   2629 H HG3  . PRO A 1 165 ? 30.035 18.185  51.640 1.00 25.58 ? 1186 PRO A HG3  1 
ATOM   2630 H HD2  . PRO A 1 165 ? 28.052 16.733  50.339 1.00 18.31 ? 1186 PRO A HD2  1 
ATOM   2631 H HD3  . PRO A 1 165 ? 29.441 17.268  49.738 1.00 18.31 ? 1186 PRO A HD3  1 
ATOM   2632 N N    . THR A 1 166 ? 28.119 13.818  52.460 1.00 15.83 ? 1187 THR A N    1 
ATOM   2633 C CA   . THR A 1 166 ? 27.357 12.755  53.148 1.00 17.19 ? 1187 THR A CA   1 
ATOM   2634 C C    . THR A 1 166 ? 26.721 11.810  52.158 1.00 16.13 ? 1187 THR A C    1 
ATOM   2635 O O    . THR A 1 166 ? 26.525 12.178  51.018 1.00 15.74 ? 1187 THR A O    1 
ATOM   2636 C CB   . THR A 1 166 ? 26.196 13.343  53.984 1.00 20.46 ? 1187 THR A CB   1 
ATOM   2637 O OG1  . THR A 1 166 ? 25.244 13.937  53.089 1.00 23.41 ? 1187 THR A OG1  1 
ATOM   2638 C CG2  . THR A 1 166 ? 26.716 14.407  54.951 1.00 21.63 ? 1187 THR A CG2  1 
ATOM   2639 H H    . THR A 1 166 ? 27.760 14.091  51.728 1.00 18.99 ? 1187 THR A H    1 
ATOM   2640 H HA   . THR A 1 166 ? 27.950 12.246  53.739 1.00 20.63 ? 1187 THR A HA   1 
ATOM   2641 H HB   . THR A 1 166 ? 25.769 12.638  54.495 1.00 24.55 ? 1187 THR A HB   1 
ATOM   2642 H HG1  . THR A 1 166 ? 24.620 14.255  53.515 1.00 28.09 ? 1187 THR A HG1  1 
ATOM   2643 H HG21 . THR A 1 166 ? 25.989 14.766  55.465 1.00 25.96 ? 1187 THR A HG21 1 
ATOM   2644 H HG22 . THR A 1 166 ? 27.360 14.020  55.549 1.00 25.96 ? 1187 THR A HG22 1 
ATOM   2645 H HG23 . THR A 1 166 ? 27.133 15.119  54.461 1.00 25.96 ? 1187 THR A HG23 1 
ATOM   2646 N N    . PHE A 1 167 ? 26.370 10.600  52.604 1.00 16.20 ? 1188 PHE A N    1 
ATOM   2647 C CA   . PHE A 1 167 ? 25.639 9.688   51.744 1.00 16.18 ? 1188 PHE A CA   1 
ATOM   2648 C C    . PHE A 1 167 ? 24.292 10.308  51.388 1.00 17.16 ? 1188 PHE A C    1 
ATOM   2649 O O    . PHE A 1 167 ? 23.757 10.045  50.317 1.00 19.15 ? 1188 PHE A O    1 
ATOM   2650 C CB   . PHE A 1 167 ? 25.424 8.342   52.400 1.00 14.61 ? 1188 PHE A CB   1 
ATOM   2651 C CG   . PHE A 1 167 ? 26.650 7.515   52.463 1.00 13.37 ? 1188 PHE A CG   1 
ATOM   2652 C CD1  . PHE A 1 167 ? 27.019 6.692   51.426 1.00 16.53 ? 1188 PHE A CD1  1 
ATOM   2653 C CD2  . PHE A 1 167 ? 27.406 7.515   53.613 1.00 16.57 ? 1188 PHE A CD2  1 
ATOM   2654 C CE1  . PHE A 1 167 ? 28.164 5.932   51.527 1.00 21.12 ? 1188 PHE A CE1  1 
ATOM   2655 C CE2  . PHE A 1 167 ? 28.525 6.780   53.715 1.00 20.27 ? 1188 PHE A CE2  1 
ATOM   2656 C CZ   . PHE A 1 167 ? 28.909 5.975   52.691 1.00 19.38 ? 1188 PHE A CZ   1 
ATOM   2657 H H    . PHE A 1 167 ? 26.542 10.293  53.389 1.00 19.44 ? 1188 PHE A H    1 
ATOM   2658 H HA   . PHE A 1 167 ? 26.144 9.549   50.916 1.00 19.41 ? 1188 PHE A HA   1 
ATOM   2659 H HB2  . PHE A 1 167 ? 25.112 8.481   53.308 1.00 17.54 ? 1188 PHE A HB2  1 
ATOM   2660 H HB3  . PHE A 1 167 ? 24.758 7.849   51.895 1.00 17.54 ? 1188 PHE A HB3  1 
ATOM   2661 H HD1  . PHE A 1 167 ? 26.515 6.674   50.645 1.00 19.83 ? 1188 PHE A HD1  1 
ATOM   2662 H HD2  . PHE A 1 167 ? 27.157 8.065   54.320 1.00 19.89 ? 1188 PHE A HD2  1 
ATOM   2663 H HE1  . PHE A 1 167 ? 28.425 5.383   50.823 1.00 25.34 ? 1188 PHE A HE1  1 
ATOM   2664 H HE2  . PHE A 1 167 ? 29.026 6.805   54.498 1.00 24.32 ? 1188 PHE A HE2  1 
ATOM   2665 H HZ   . PHE A 1 167 ? 29.680 5.461   52.768 1.00 23.26 ? 1188 PHE A HZ   1 
ATOM   2666 N N    . ARG A 1 168 ? 23.753 11.128  52.291 1.00 20.92 ? 1189 ARG A N    1 
ATOM   2667 C CA   . ARG A 1 168 ? 22.476 11.783  52.062 1.00 23.21 ? 1189 ARG A CA   1 
ATOM   2668 C C    . ARG A 1 168 ? 22.504 12.621  50.786 1.00 21.19 ? 1189 ARG A C    1 
ATOM   2669 O O    . ARG A 1 168 ? 21.486 12.768  50.126 1.00 22.94 ? 1189 ARG A O    1 
ATOM   2670 C CB   . ARG A 1 168 ? 22.084 12.654  53.274 1.00 25.61 ? 1189 ARG A CB   1 
ATOM   2671 C CG   . ARG A 1 168 ? 20.791 13.448  53.095 1.00 31.71 ? 1189 ARG A CG   1 
ATOM   2672 C CD   . ARG A 1 168 ? 20.405 14.233  54.347 1.00 35.04 ? 1189 ARG A CD   1 
ATOM   2673 N NE   . ARG A 1 168 ? 21.143 15.487  54.476 1.00 43.67 ? 1189 ARG A NE   1 
ATOM   2674 C CZ   . ARG A 1 168 ? 20.993 16.343  55.485 1.00 52.55 ? 1189 ARG A CZ   1 
ATOM   2675 N NH1  . ARG A 1 168 ? 20.147 16.069  56.476 1.00 53.96 ? 1189 ARG A NH1  1 
ATOM   2676 N NH2  . ARG A 1 168 ? 21.715 17.459  55.527 1.00 55.71 ? 1189 ARG A NH2  1 
ATOM   2677 H H    . ARG A 1 168 ? 24.113 11.320  53.048 1.00 25.10 ? 1189 ARG A H    1 
ATOM   2678 H HA   . ARG A 1 168 ? 21.786 11.095  51.953 1.00 27.86 ? 1189 ARG A HA   1 
ATOM   2679 H HB2  . ARG A 1 168 ? 21.970 12.077  54.046 1.00 30.73 ? 1189 ARG A HB2  1 
ATOM   2680 H HB3  . ARG A 1 168 ? 22.798 13.288  53.443 1.00 30.73 ? 1189 ARG A HB3  1 
ATOM   2681 H HG2  . ARG A 1 168 ? 20.906 14.081  52.368 1.00 38.06 ? 1189 ARG A HG2  1 
ATOM   2682 H HG3  . ARG A 1 168 ? 20.068 12.835  52.890 1.00 38.06 ? 1189 ARG A HG3  1 
ATOM   2683 H HD2  . ARG A 1 168 ? 19.459 14.444  54.310 1.00 42.05 ? 1189 ARG A HD2  1 
ATOM   2684 H HD3  . ARG A 1 168 ? 20.594 13.692  55.130 1.00 42.05 ? 1189 ARG A HD3  1 
ATOM   2685 H HE   . ARG A 1 168 ? 21.710 15.685  53.861 1.00 52.41 ? 1189 ARG A HE   1 
ATOM   2686 H HH11 . ARG A 1 168 ? 19.682 15.346  56.456 1.00 64.75 ? 1189 ARG A HH11 1 
ATOM   2687 H HH12 . ARG A 1 168 ? 20.056 16.622  57.128 1.00 64.75 ? 1189 ARG A HH12 1 
ATOM   2688 H HH21 . ARG A 1 168 ? 22.266 17.639  54.891 1.00 66.85 ? 1189 ARG A HH21 1 
ATOM   2689 H HH22 . ARG A 1 168 ? 21.620 18.009  56.181 1.00 66.85 ? 1189 ARG A HH22 1 
ATOM   2690 N N    . GLU A 1 169 ? 23.670 13.165  50.437 1.00 20.09 ? 1190 GLU A N    1 
ATOM   2691 C CA   . GLU A 1 169 ? 23.779 14.045  49.274 1.00 17.81 ? 1190 GLU A CA   1 
ATOM   2692 C C    . GLU A 1 169 ? 24.130 13.293  47.996 1.00 17.52 ? 1190 GLU A C    1 
ATOM   2693 O O    . GLU A 1 169 ? 24.236 13.875  46.924 1.00 15.90 ? 1190 GLU A O    1 
ATOM   2694 C CB   . GLU A 1 169 ? 24.833 15.139  49.504 1.00 21.71 ? 1190 GLU A CB   1 
ATOM   2695 C CG   . GLU A 1 169 ? 24.376 16.267  50.404 1.00 28.28 ? 1190 GLU A CG   1 
ATOM   2696 C CD   . GLU A 1 169 ? 24.879 16.131  51.820 1.00 38.54 ? 1190 GLU A CD   1 
ATOM   2697 O OE1  . GLU A 1 169 ? 26.099 16.308  52.041 1.00 38.08 ? 1190 GLU A OE1  1 
ATOM   2698 O OE2  . GLU A 1 169 ? 24.052 15.852  52.717 1.00 42.86 ? 1190 GLU A OE2  1 
ATOM   2699 H H    . GLU A 1 169 ? 24.411 13.040  50.856 1.00 24.11 ? 1190 GLU A H    1 
ATOM   2700 H HA   . GLU A 1 169 ? 22.915 14.487  49.133 1.00 21.37 ? 1190 GLU A HA   1 
ATOM   2701 H HB2  . GLU A 1 169 ? 25.615 14.736  49.911 1.00 26.06 ? 1190 GLU A HB2  1 
ATOM   2702 H HB3  . GLU A 1 169 ? 25.072 15.525  48.647 1.00 26.06 ? 1190 GLU A HB3  1 
ATOM   2703 H HG2  . GLU A 1 169 ? 24.706 17.107  50.048 1.00 33.94 ? 1190 GLU A HG2  1 
ATOM   2704 H HG3  . GLU A 1 169 ? 23.407 16.277  50.431 1.00 33.94 ? 1190 GLU A HG3  1 
ATOM   2705 N N    . LEU A 1 170 ? 24.293 11.988  48.084 1.00 18.71 ? 1191 LEU A N    1 
ATOM   2706 C CA   . LEU A 1 170 ? 24.706 11.225  46.935 1.00 20.62 ? 1191 LEU A CA   1 
ATOM   2707 C C    . LEU A 1 170 ? 23.675 11.346  45.799 1.00 17.21 ? 1191 LEU A C    1 
ATOM   2708 O O    . LEU A 1 170 ? 24.017 11.483  44.626 1.00 19.22 ? 1191 LEU A O    1 
ATOM   2709 C CB   . LEU A 1 170 ? 24.930 9.802   47.409 1.00 24.36 ? 1191 LEU A CB   1 
ATOM   2710 C CG   . LEU A 1 170 ? 25.648 8.833   46.527 1.00 17.75 ? 1191 LEU A CG   1 
ATOM   2711 C CD1  . LEU A 1 170 ? 26.946 9.325   45.955 1.00 14.02 ? 1191 LEU A CD1  1 
ATOM   2712 C CD2  . LEU A 1 170 ? 25.818 7.565   47.333 1.00 18.40 ? 1191 LEU A CD2  1 
ATOM   2713 H H    . LEU A 1 170 ? 24.172 11.524  48.798 1.00 22.45 ? 1191 LEU A H    1 
ATOM   2714 H HA   . LEU A 1 170 ? 25.561 11.574  46.607 1.00 24.74 ? 1191 LEU A HA   1 
ATOM   2715 H HB2  . LEU A 1 170 ? 25.433 9.847   48.237 1.00 29.24 ? 1191 LEU A HB2  1 
ATOM   2716 H HB3  . LEU A 1 170 ? 24.060 9.415   47.593 1.00 29.24 ? 1191 LEU A HB3  1 
ATOM   2717 H HG   . LEU A 1 170 ? 25.069 8.620   45.778 1.00 21.30 ? 1191 LEU A HG   1 
ATOM   2718 H HD11 . LEU A 1 170 ? 27.327 8.635   45.407 1.00 16.82 ? 1191 LEU A HD11 1 
ATOM   2719 H HD12 . LEU A 1 170 ? 26.776 10.108  45.426 1.00 16.82 ? 1191 LEU A HD12 1 
ATOM   2720 H HD13 . LEU A 1 170 ? 27.543 9.539   46.675 1.00 16.82 ? 1191 LEU A HD13 1 
ATOM   2721 H HD21 . LEU A 1 170 ? 26.278 6.914   46.798 1.00 22.09 ? 1191 LEU A HD21 1 
ATOM   2722 H HD22 . LEU A 1 170 ? 26.330 7.763   48.121 1.00 22.09 ? 1191 LEU A HD22 1 
ATOM   2723 H HD23 . LEU A 1 170 ? 24.952 7.234   47.580 1.00 22.09 ? 1191 LEU A HD23 1 
ATOM   2724 N N    . GLY A 1 171 ? 22.393 11.408  46.135 1.00 19.30 ? 1192 GLY A N    1 
ATOM   2725 C CA   . GLY A 1 171 ? 21.382 11.483  45.099 1.00 19.21 ? 1192 GLY A CA   1 
ATOM   2726 C C    . GLY A 1 171 ? 21.483 12.755  44.259 1.00 18.95 ? 1192 GLY A C    1 
ATOM   2727 O O    . GLY A 1 171 ? 21.091 12.766  43.083 1.00 20.11 ? 1192 GLY A O    1 
ATOM   2728 H H    . GLY A 1 171 ? 22.089 11.408  46.940 1.00 23.17 ? 1192 GLY A H    1 
ATOM   2729 H HA2  . GLY A 1 171 ? 21.470 10.719  44.508 1.00 23.05 ? 1192 GLY A HA2  1 
ATOM   2730 H HA3  . GLY A 1 171 ? 20.502 11.455  45.506 1.00 23.05 ? 1192 GLY A HA3  1 
ATOM   2731 N N    . THR A 1 172 ? 22.006 13.822  44.855 1.00 15.13 ? 1193 THR A N    1 
ATOM   2732 C CA   . THR A 1 172 ? 22.095 15.102  44.173 1.00 12.89 ? 1193 THR A CA   1 
ATOM   2733 C C    . THR A 1 172 ? 23.106 15.083  43.014 1.00 10.28 ? 1193 THR A C    1 
ATOM   2734 O O    . THR A 1 172 ? 23.081 16.000  42.177 1.00 11.46 ? 1193 THR A O    1 
ATOM   2735 C CB   . THR A 1 172 ? 22.469 16.276  45.130 1.00 11.71 ? 1193 THR A CB   1 
ATOM   2736 O OG1  . THR A 1 172 ? 23.839 16.147  45.568 1.00 11.51 ? 1193 THR A OG1  1 
ATOM   2737 C CG2  . THR A 1 172 ? 21.541 16.367  46.329 1.00 15.18 ? 1193 THR A CG2  1 
ATOM   2738 H H    . THR A 1 172 ? 22.317 13.828  45.657 1.00 18.16 ? 1193 THR A H    1 
ATOM   2739 H HA   . THR A 1 172 ? 21.217 15.307  43.790 1.00 15.47 ? 1193 THR A HA   1 
ATOM   2740 H HB   . THR A 1 172 ? 22.385 17.108  44.637 1.00 14.06 ? 1193 THR A HB   1 
ATOM   2741 H HG1  . THR A 1 172 ? 23.940 15.438  45.967 1.00 13.81 ? 1193 THR A HG1  1 
ATOM   2742 H HG21 . THR A 1 172 ? 21.803 17.099  46.892 1.00 18.21 ? 1193 THR A HG21 1 
ATOM   2743 H HG22 . THR A 1 172 ? 20.638 16.507  46.035 1.00 18.21 ? 1193 THR A HG22 1 
ATOM   2744 H HG23 . THR A 1 172 ? 21.581 15.553  46.837 1.00 18.21 ? 1193 THR A HG23 1 
ATOM   2745 N N    . ILE A 1 173 ? 23.974 14.075  42.938 1.00 10.66 ? 1194 ILE A N    1 
ATOM   2746 C CA   . ILE A 1 173 ? 24.942 14.002  41.844 1.00 9.94  ? 1194 ILE A CA   1 
ATOM   2747 C C    . ILE A 1 173 ? 24.618 12.921  40.816 1.00 12.07 ? 1194 ILE A C    1 
ATOM   2748 O O    . ILE A 1 173 ? 25.388 12.693  39.890 1.00 12.56 ? 1194 ILE A O    1 
ATOM   2749 C CB   . ILE A 1 173 ? 26.389 13.813  42.353 1.00 11.63 ? 1194 ILE A CB   1 
ATOM   2750 C CG1  . ILE A 1 173 ? 26.542 12.492  43.102 1.00 14.51 ? 1194 ILE A CG1  1 
ATOM   2751 C CG2  . ILE A 1 173 ? 26.785 15.037  43.192 1.00 13.93 ? 1194 ILE A CG2  1 
ATOM   2752 C CD1  . ILE A 1 173 ? 27.951 12.036  43.241 1.00 18.45 ? 1194 ILE A CD1  1 
ATOM   2753 H H    . ILE A 1 173 ? 24.023 13.427  43.501 1.00 12.79 ? 1194 ILE A H    1 
ATOM   2754 H HA   . ILE A 1 173 ? 24.919 14.859  41.369 1.00 11.93 ? 1194 ILE A HA   1 
ATOM   2755 H HB   . ILE A 1 173 ? 26.974 13.783  41.580 1.00 13.95 ? 1194 ILE A HB   1 
ATOM   2756 H HG12 . ILE A 1 173 ? 26.175 12.595  43.994 1.00 17.41 ? 1194 ILE A HG12 1 
ATOM   2757 H HG13 . ILE A 1 173 ? 26.054 11.804  42.624 1.00 17.41 ? 1194 ILE A HG13 1 
ATOM   2758 H HG21 . ILE A 1 173 ? 27.684 14.920  43.508 1.00 16.71 ? 1194 ILE A HG21 1 
ATOM   2759 H HG22 . ILE A 1 173 ? 26.730 15.822  42.643 1.00 16.71 ? 1194 ILE A HG22 1 
ATOM   2760 H HG23 . ILE A 1 173 ? 26.183 15.113  43.936 1.00 16.71 ? 1194 ILE A HG23 1 
ATOM   2761 H HD11 . ILE A 1 173 ? 27.963 11.204  43.721 1.00 22.15 ? 1194 ILE A HD11 1 
ATOM   2762 H HD12 . ILE A 1 173 ? 28.328 11.916  42.367 1.00 22.15 ? 1194 ILE A HD12 1 
ATOM   2763 H HD13 . ILE A 1 173 ? 28.448 12.700  43.725 1.00 22.15 ? 1194 ILE A HD13 1 
ATOM   2764 N N    A GLN A 1 174 ? 23.481 12.255  40.948 0.47 13.80 ? 1195 GLN A N    1 
ATOM   2765 N N    B GLN A 1 174 ? 23.472 12.275  40.939 0.53 14.00 ? 1195 GLN A N    1 
ATOM   2766 C CA   A GLN A 1 174 ? 23.176 11.216  39.982 0.47 17.77 ? 1195 GLN A CA   1 
ATOM   2767 C CA   B GLN A 1 174 ? 23.194 11.191  40.022 0.53 17.98 ? 1195 GLN A CA   1 
ATOM   2768 C C    A GLN A 1 174 ? 23.168 11.765  38.568 0.47 17.25 ? 1195 GLN A C    1 
ATOM   2769 C C    B GLN A 1 174 ? 23.030 11.684  38.575 0.53 16.73 ? 1195 GLN A C    1 
ATOM   2770 O O    A GLN A 1 174 ? 23.792 11.188  37.663 0.47 16.83 ? 1195 GLN A O    1 
ATOM   2771 O O    B GLN A 1 174 ? 23.469 11.001  37.649 0.53 15.32 ? 1195 GLN A O    1 
ATOM   2772 C CB   A GLN A 1 174 ? 21.838 10.557  40.268 0.47 24.60 ? 1195 GLN A CB   1 
ATOM   2773 C CB   B GLN A 1 174 ? 22.013 10.352  40.518 0.53 25.01 ? 1195 GLN A CB   1 
ATOM   2774 C CG   A GLN A 1 174 ? 21.472 9.534   39.202 0.47 28.81 ? 1195 GLN A CG   1 
ATOM   2775 C CG   B GLN A 1 174 ? 20.668 11.018  40.443 0.53 30.34 ? 1195 GLN A CG   1 
ATOM   2776 C CD   A GLN A 1 174 ? 20.628 10.118  38.088 0.47 28.69 ? 1195 GLN A CD   1 
ATOM   2777 C CD   B GLN A 1 174 ? 19.834 10.441  39.331 0.53 30.46 ? 1195 GLN A CD   1 
ATOM   2778 O OE1  A GLN A 1 174 ? 20.980 10.030  36.910 0.47 32.24 ? 1195 GLN A OE1  1 
ATOM   2779 O OE1  B GLN A 1 174 ? 20.364 10.048  38.292 0.53 34.50 ? 1195 GLN A OE1  1 
ATOM   2780 N NE2  A GLN A 1 174 ? 19.508 10.724  38.454 0.47 33.14 ? 1195 GLN A NE2  1 
ATOM   2781 N NE2  B GLN A 1 174 ? 18.523 10.363  39.543 0.53 30.96 ? 1195 GLN A NE2  1 
ATOM   2782 H H    A GLN A 1 174 ? 22.891 12.379  41.561 0.47 16.56 ? 1195 GLN A H    1 
ATOM   2783 H H    B GLN A 1 174 ? 22.860 12.438  41.522 0.53 16.80 ? 1195 GLN A H    1 
ATOM   2784 H HA   A GLN A 1 174 ? 23.868 10.524  40.032 0.47 21.33 ? 1195 GLN A HA   1 
ATOM   2785 H HA   B GLN A 1 174 ? 23.974 10.598  40.024 0.53 21.58 ? 1195 GLN A HA   1 
ATOM   2786 H HB2  A GLN A 1 174 ? 21.883 10.101  41.123 0.47 29.52 ? 1195 GLN A HB2  1 
ATOM   2787 H HB2  B GLN A 1 174 ? 21.966 9.543   39.984 0.53 30.01 ? 1195 GLN A HB2  1 
ATOM   2788 H HB3  A GLN A 1 174 ? 21.145 11.236  40.286 0.47 29.52 ? 1195 GLN A HB3  1 
ATOM   2789 H HB3  B GLN A 1 174 ? 22.171 10.119  41.446 0.53 30.01 ? 1195 GLN A HB3  1 
ATOM   2790 H HG2  A GLN A 1 174 ? 22.287 9.183   38.809 0.47 34.57 ? 1195 GLN A HG2  1 
ATOM   2791 H HG2  B GLN A 1 174 ? 20.196 10.883  41.280 0.53 36.41 ? 1195 GLN A HG2  1 
ATOM   2792 H HG3  A GLN A 1 174 ? 20.968 8.815   39.615 0.47 34.57 ? 1195 GLN A HG3  1 
ATOM   2793 H HG3  B GLN A 1 174 ? 20.788 11.966  40.274 0.53 36.41 ? 1195 GLN A HG3  1 
ATOM   2794 H HE21 A GLN A 1 174 ? 18.993 11.072  37.860 0.47 39.77 ? 1195 GLN A HE21 1 
ATOM   2795 H HE21 B GLN A 1 174 ? 18.007 10.040  38.936 0.53 37.15 ? 1195 GLN A HE21 1 
ATOM   2796 H HE22 A GLN A 1 174 ? 19.296 10.769  39.286 0.47 39.77 ? 1195 GLN A HE22 1 
ATOM   2797 H HE22 B GLN A 1 174 ? 18.191 10.636  40.288 0.53 37.15 ? 1195 GLN A HE22 1 
ATOM   2798 N N    . GLN A 1 175 ? 22.462 12.868  38.353 1.00 17.26 ? 1196 GLN A N    1 
ATOM   2799 C CA   . GLN A 1 175 ? 22.313 13.336  36.992 1.00 17.93 ? 1196 GLN A CA   1 
ATOM   2800 C C    . GLN A 1 175 ? 23.656 13.678  36.354 1.00 16.47 ? 1196 GLN A C    1 
ATOM   2801 O O    . GLN A 1 175 ? 23.875 13.345  35.204 1.00 17.66 ? 1196 GLN A O    1 
ATOM   2802 C CB   . GLN A 1 175 ? 21.334 14.517  36.892 1.00 22.01 ? 1196 GLN A CB   1 
ATOM   2803 C CG   . GLN A 1 175 ? 21.000 14.933  35.455 1.00 30.29 ? 1196 GLN A CG   1 
ATOM   2804 C CD   . GLN A 1 175 ? 20.468 13.779  34.621 1.00 37.23 ? 1196 GLN A CD   1 
ATOM   2805 O OE1  . GLN A 1 175 ? 19.708 12.948  35.120 1.00 38.56 ? 1196 GLN A OE1  1 
ATOM   2806 N NE2  . GLN A 1 175 ? 20.889 13.701  33.358 1.00 41.10 ? 1196 GLN A NE2  1 
ATOM   2807 H HA   . GLN A 1 175 ? 21.928 12.605  36.466 1.00 21.51 ? 1196 GLN A HA   1 
ATOM   2808 H HB2  . GLN A 1 175 ? 20.504 14.272  37.329 1.00 26.42 ? 1196 GLN A HB2  1 
ATOM   2809 H HB3  . GLN A 1 175 ? 21.725 15.285  37.338 1.00 26.42 ? 1196 GLN A HB3  1 
ATOM   2810 H HG2  . GLN A 1 175 ? 20.323 15.627  35.475 1.00 36.35 ? 1196 GLN A HG2  1 
ATOM   2811 H HG3  . GLN A 1 175 ? 21.804 15.266  35.027 1.00 36.35 ? 1196 GLN A HG3  1 
ATOM   2812 H HE21 . GLN A 1 175 ? 21.437 14.287  33.050 1.00 49.32 ? 1196 GLN A HE21 1 
ATOM   2813 H HE22 . GLN A 1 175 ? 20.612 13.063  32.851 1.00 49.32 ? 1196 GLN A HE22 1 
ATOM   2814 N N    A VAL A 1 176 ? 24.567 14.353  37.064 0.76 14.36 ? 1197 VAL A N    1 
ATOM   2815 N N    B VAL A 1 176 ? 24.550 14.314  37.098 0.24 15.51 ? 1197 VAL A N    1 
ATOM   2816 C CA   A VAL A 1 176 ? 25.835 14.697  36.405 0.76 15.01 ? 1197 VAL A CA   1 
ATOM   2817 C CA   B VAL A 1 176 ? 25.815 14.724  36.510 0.24 15.69 ? 1197 VAL A CA   1 
ATOM   2818 C C    A VAL A 1 176 ? 26.675 13.459  36.151 0.76 11.49 ? 1197 VAL A C    1 
ATOM   2819 C C    B VAL A 1 176 ? 26.725 13.520  36.233 0.24 12.54 ? 1197 VAL A C    1 
ATOM   2820 O O    A VAL A 1 176 ? 27.420 13.398  35.172 0.76 12.54 ? 1197 VAL A O    1 
ATOM   2821 O O    B VAL A 1 176 ? 27.569 13.563  35.340 0.24 12.86 ? 1197 VAL A O    1 
ATOM   2822 C CB   A VAL A 1 176 ? 26.675 15.755  37.145 0.76 18.03 ? 1197 VAL A CB   1 
ATOM   2823 C CB   B VAL A 1 176 ? 26.516 15.777  37.382 0.24 17.86 ? 1197 VAL A CB   1 
ATOM   2824 C CG1  A VAL A 1 176 ? 25.984 17.091  37.083 0.76 25.42 ? 1197 VAL A CG1  1 
ATOM   2825 C CG1  B VAL A 1 176 ? 27.189 15.135  38.593 0.24 25.15 ? 1197 VAL A CG1  1 
ATOM   2826 C CG2  A VAL A 1 176 ? 27.006 15.327  38.578 0.76 13.87 ? 1197 VAL A CG2  1 
ATOM   2827 C CG2  B VAL A 1 176 ? 27.505 16.558  36.544 0.24 13.49 ? 1197 VAL A CG2  1 
ATOM   2828 H H    A VAL A 1 176 ? 24.486 14.610  37.880 0.76 17.23 ? 1197 VAL A H    1 
ATOM   2829 H H    B VAL A 1 176 ? 24.453 14.517  37.928 0.24 18.61 ? 1197 VAL A H    1 
ATOM   2830 H HA   A VAL A 1 176 ? 25.619 15.075  35.528 0.76 18.01 ? 1197 VAL A HA   1 
ATOM   2831 H HA   B VAL A 1 176 ? 25.625 15.146  35.646 0.24 18.83 ? 1197 VAL A HA   1 
ATOM   2832 H HB   A VAL A 1 176 ? 27.528 15.851  36.671 0.76 21.63 ? 1197 VAL A HB   1 
ATOM   2833 H HB   B VAL A 1 176 ? 25.844 16.408  37.714 0.24 21.44 ? 1197 VAL A HB   1 
ATOM   2834 H HG11 A VAL A 1 176 ? 25.164 16.995  36.592 0.76 30.51 ? 1197 VAL A HG11 1 
ATOM   2835 H HG11 B VAL A 1 176 ? 27.038 14.188  38.568 0.24 30.18 ? 1197 VAL A HG11 1 
ATOM   2836 H HG12 A VAL A 1 176 ? 25.799 17.389  37.976 0.76 30.51 ? 1197 VAL A HG12 1 
ATOM   2837 H HG12 B VAL A 1 176 ? 28.131 15.318  38.559 0.24 30.18 ? 1197 VAL A HG12 1 
ATOM   2838 H HG13 A VAL A 1 176 ? 26.559 17.719  36.640 0.76 30.51 ? 1197 VAL A HG13 1 
ATOM   2839 H HG13 B VAL A 1 176 ? 26.811 15.507  39.393 0.24 30.18 ? 1197 VAL A HG13 1 
ATOM   2840 H HG21 A VAL A 1 176 ? 26.619 14.464  38.743 0.76 16.64 ? 1197 VAL A HG21 1 
ATOM   2841 H HG21 B VAL A 1 176 ? 27.482 16.226  35.644 0.24 16.19 ? 1197 VAL A HG21 1 
ATOM   2842 H HG22 A VAL A 1 176 ? 27.960 15.283  38.678 0.76 16.64 ? 1197 VAL A HG22 1 
ATOM   2843 H HG22 B VAL A 1 176 ? 27.261 17.486  36.557 0.24 16.19 ? 1197 VAL A HG22 1 
ATOM   2844 H HG23 A VAL A 1 176 ? 26.642 15.972  39.189 0.76 16.64 ? 1197 VAL A HG23 1 
ATOM   2845 H HG23 B VAL A 1 176 ? 28.384 16.445  36.913 0.24 16.19 ? 1197 VAL A HG23 1 
ATOM   2846 N N    . ILE A 1 177 ? 26.550 12.445  36.996 1.00 10.94 ? 1198 ILE A N    1 
ATOM   2847 C CA   . ILE A 1 177 ? 27.258 11.200  36.725 1.00 9.99  ? 1198 ILE A CA   1 
ATOM   2848 C C    . ILE A 1 177 ? 26.659 10.526  35.489 1.00 10.71 ? 1198 ILE A C    1 
ATOM   2849 O O    . ILE A 1 177 ? 27.387 10.054  34.616 1.00 11.58 ? 1198 ILE A O    1 
ATOM   2850 C CB   . ILE A 1 177 ? 27.248 10.268  37.934 1.00 10.76 ? 1198 ILE A CB   1 
ATOM   2851 C CG1  . ILE A 1 177 ? 28.073 10.901  39.065 1.00 10.91 ? 1198 ILE A CG1  1 
ATOM   2852 C CG2  . ILE A 1 177 ? 27.745 8.879   37.560 1.00 10.75 ? 1198 ILE A CG2  1 
ATOM   2853 C CD1  . ILE A 1 177 ? 29.522 11.048  38.768 1.00 11.86 ? 1198 ILE A CD1  1 
ATOM   2854 H H    . ILE A 1 177 ? 26.050 12.432  37.695 0.24 13.12 ? 1198 ILE A H    1 
ATOM   2855 H HA   . ILE A 1 177 ? 28.193 11.411  36.523 1.00 11.99 ? 1198 ILE A HA   1 
ATOM   2856 H HB   . ILE A 1 177 ? 26.331 10.186  38.242 1.00 12.92 ? 1198 ILE A HB   1 
ATOM   2857 H HG12 . ILE A 1 177 ? 27.720 11.786  39.249 1.00 13.09 ? 1198 ILE A HG12 1 
ATOM   2858 H HG13 . ILE A 1 177 ? 27.990 10.347  39.857 1.00 13.09 ? 1198 ILE A HG13 1 
ATOM   2859 H HG21 . ILE A 1 177 ? 27.726 8.320   38.340 1.00 12.90 ? 1198 ILE A HG21 1 
ATOM   2860 H HG22 . ILE A 1 177 ? 27.172 8.515   36.881 1.00 12.90 ? 1198 ILE A HG22 1 
ATOM   2861 H HG23 . ILE A 1 177 ? 28.643 8.948   37.228 1.00 12.90 ? 1198 ILE A HG23 1 
ATOM   2862 H HD11 . ILE A 1 177 ? 29.956 11.449  39.524 1.00 14.23 ? 1198 ILE A HD11 1 
ATOM   2863 H HD12 . ILE A 1 177 ? 29.895 10.180  38.598 1.00 14.23 ? 1198 ILE A HD12 1 
ATOM   2864 H HD13 . ILE A 1 177 ? 29.627 11.607  37.995 1.00 14.23 ? 1198 ILE A HD13 1 
ATOM   2865 N N    . SER A 1 178 ? 25.334 10.528  35.377 1.00 13.26 ? 1199 SER A N    1 
ATOM   2866 C CA   . SER A 1 178 ? 24.695 10.035  34.166 1.00 16.23 ? 1199 SER A CA   1 
ATOM   2867 C C    . SER A 1 178 ? 25.143 10.836  32.935 1.00 15.37 ? 1199 SER A C    1 
ATOM   2868 O O    . SER A 1 178 ? 25.412 10.249  31.873 1.00 17.18 ? 1199 SER A O    1 
ATOM   2869 C CB   . SER A 1 178 ? 23.164 10.065  34.312 1.00 19.37 ? 1199 SER A CB   1 
ATOM   2870 O OG   . SER A 1 178 ? 22.747 9.200   35.354 1.00 20.83 ? 1199 SER A OG   1 
ATOM   2871 H H    . SER A 1 178 ? 24.789 10.806  35.982 1.00 15.91 ? 1199 SER A H    1 
ATOM   2872 H HA   . SER A 1 178 ? 24.962 9.102   34.027 1.00 19.48 ? 1199 SER A HA   1 
ATOM   2873 H HB2  . SER A 1 178 ? 22.883 10.970  34.521 1.00 23.24 ? 1199 SER A HB2  1 
ATOM   2874 H HB3  . SER A 1 178 ? 22.760 9.775   33.479 1.00 23.24 ? 1199 SER A HB3  1 
ATOM   2875 H HG   . SER A 1 178 ? 21.931 9.221   35.426 1.00 25.00 ? 1199 SER A HG   1 
ATOM   2876 N N    . GLU A 1 179 ? 25.192 12.161  33.053 1.00 15.02 ? 1200 GLU A N    1 
ATOM   2877 C CA   . GLU A 1 179 ? 25.653 13.022  31.961 1.00 17.01 ? 1200 GLU A CA   1 
ATOM   2878 C C    . GLU A 1 179 ? 27.105 12.699  31.570 1.00 17.14 ? 1200 GLU A C    1 
ATOM   2879 O O    . GLU A 1 179 ? 27.461 12.710  30.381 1.00 19.52 ? 1200 GLU A O    1 
ATOM   2880 C CB   . GLU A 1 179 ? 25.504 14.509  32.343 1.00 18.65 ? 1200 GLU A CB   1 
ATOM   2881 C CG   . GLU A 1 179 ? 24.039 14.979  32.460 1.00 20.87 ? 1200 GLU A CG   1 
ATOM   2882 C CD   . GLU A 1 179 ? 23.897 16.328  33.150 1.00 22.26 ? 1200 GLU A CD   1 
ATOM   2883 O OE1  . GLU A 1 179 ? 24.816 16.723  33.868 1.00 22.74 ? 1200 GLU A OE1  1 
ATOM   2884 O OE2  . GLU A 1 179 ? 22.855 16.995  32.985 1.00 23.95 ? 1200 GLU A OE2  1 
ATOM   2885 H H    . GLU A 1 179 ? 24.960 12.591  33.760 1.00 18.03 ? 1200 GLU A H    1 
ATOM   2886 H HA   . GLU A 1 179 ? 25.091 12.860  31.175 1.00 20.41 ? 1200 GLU A HA   1 
ATOM   2887 H HB2  . GLU A 1 179 ? 25.931 14.655  33.202 1.00 22.38 ? 1200 GLU A HB2  1 
ATOM   2888 H HB3  . GLU A 1 179 ? 25.936 15.051  31.665 1.00 22.38 ? 1200 GLU A HB3  1 
ATOM   2889 H HG2  . GLU A 1 179 ? 23.662 15.058  31.570 1.00 25.05 ? 1200 GLU A HG2  1 
ATOM   2890 H HG3  . GLU A 1 179 ? 23.538 14.327  32.974 1.00 25.05 ? 1200 GLU A HG3  1 
ATOM   2891 N N    . ARG A 1 180 ? 27.962 12.416  32.546 1.00 15.60 ? 1201 ARG A N    1 
ATOM   2892 C CA   . ARG A 1 180 ? 29.335 12.086  32.232 1.00 14.61 ? 1201 ARG A CA   1 
ATOM   2893 C C    . ARG A 1 180 ? 29.393 10.770  31.469 1.00 14.10 ? 1201 ARG A C    1 
ATOM   2894 O O    . ARG A 1 180 ? 30.127 10.636  30.492 1.00 14.43 ? 1201 ARG A O    1 
ATOM   2895 C CB   . ARG A 1 180 ? 30.151 11.999  33.515 1.00 15.89 ? 1201 ARG A CB   1 
ATOM   2896 C CG   . ARG A 1 180 ? 31.665 11.923  33.343 1.00 19.08 ? 1201 ARG A CG   1 
ATOM   2897 C CD   . ARG A 1 180 ? 32.238 13.199  32.765 1.00 20.10 ? 1201 ARG A CD   1 
ATOM   2898 N NE   . ARG A 1 180 ? 32.408 14.283  33.732 1.00 19.25 ? 1201 ARG A NE   1 
ATOM   2899 C CZ   . ARG A 1 180 ? 32.835 15.505  33.414 1.00 19.74 ? 1201 ARG A CZ   1 
ATOM   2900 N NH1  . ARG A 1 180 ? 33.097 15.812  32.163 1.00 21.69 ? 1201 ARG A NH1  1 
ATOM   2901 N NH2  . ARG A 1 180 ? 33.008 16.427  34.343 1.00 24.52 ? 1201 ARG A NH2  1 
ATOM   2902 H H    . ARG A 1 180 ? 27.771 12.408  33.385 1.00 18.72 ? 1201 ARG A H    1 
ATOM   2903 H HA   . ARG A 1 180 ? 29.719 12.790  31.668 1.00 17.53 ? 1201 ARG A HA   1 
ATOM   2904 H HB2  . ARG A 1 180 ? 29.960 12.784  34.052 1.00 19.07 ? 1201 ARG A HB2  1 
ATOM   2905 H HB3  . ARG A 1 180 ? 29.875 11.204  33.998 1.00 19.07 ? 1201 ARG A HB3  1 
ATOM   2906 H HG2  . ARG A 1 180 ? 32.077 11.773  34.209 1.00 22.90 ? 1201 ARG A HG2  1 
ATOM   2907 H HG3  . ARG A 1 180 ? 31.881 11.195  32.740 1.00 22.90 ? 1201 ARG A HG3  1 
ATOM   2908 H HD2  . ARG A 1 180 ? 33.110 13.004  32.386 1.00 24.12 ? 1201 ARG A HD2  1 
ATOM   2909 H HD3  . ARG A 1 180 ? 31.644 13.517  32.067 1.00 24.12 ? 1201 ARG A HD3  1 
ATOM   2910 H HE   . ARG A 1 180 ? 32.148 14.145  34.540 1.00 23.09 ? 1201 ARG A HE   1 
ATOM   2911 H HH11 . ARG A 1 180 ? 33.002 15.220  31.546 1.00 26.03 ? 1201 ARG A HH11 1 
ATOM   2912 H HH12 . ARG A 1 180 ? 33.367 16.603  31.962 1.00 26.03 ? 1201 ARG A HH12 1 
ATOM   2913 H HH21 . ARG A 1 180 ? 32.832 16.247  35.165 1.00 29.43 ? 1201 ARG A HH21 1 
ATOM   2914 H HH22 . ARG A 1 180 ? 33.266 17.217  34.122 1.00 29.43 ? 1201 ARG A HH22 1 
ATOM   2915 N N    . VAL A 1 181 ? 28.610 9.783   31.898 1.00 12.89 ? 1202 VAL A N    1 
ATOM   2916 C CA   . VAL A 1 181 ? 28.589 8.516   31.180 1.00 15.68 ? 1202 VAL A CA   1 
ATOM   2917 C C    . VAL A 1 181 ? 28.162 8.726   29.714 1.00 18.86 ? 1202 VAL A C    1 
ATOM   2918 O O    . VAL A 1 181 ? 28.739 8.129   28.803 1.00 19.17 ? 1202 VAL A O    1 
ATOM   2919 C CB   . VAL A 1 181 ? 27.703 7.505   31.913 1.00 17.52 ? 1202 VAL A CB   1 
ATOM   2920 C CG1  . VAL A 1 181 ? 27.511 6.258   31.081 1.00 20.98 ? 1202 VAL A CG1  1 
ATOM   2921 C CG2  . VAL A 1 181 ? 28.336 7.154   33.252 1.00 17.93 ? 1202 VAL A CG2  1 
ATOM   2922 H H    . VAL A 1 181 ? 28.094 9.820   32.585 1.00 15.47 ? 1202 VAL A H    1 
ATOM   2923 H HA   . VAL A 1 181 ? 29.499 8.152   31.169 1.00 18.82 ? 1202 VAL A HA   1 
ATOM   2924 H HB   . VAL A 1 181 ? 26.824 7.904   32.081 1.00 21.02 ? 1202 VAL A HB   1 
ATOM   2925 H HG11 . VAL A 1 181 ? 26.953 5.644   31.565 1.00 25.18 ? 1202 VAL A HG11 1 
ATOM   2926 H HG12 . VAL A 1 181 ? 27.092 6.498   30.252 1.00 25.18 ? 1202 VAL A HG12 1 
ATOM   2927 H HG13 . VAL A 1 181 ? 28.368 5.860   30.913 1.00 25.18 ? 1202 VAL A HG13 1 
ATOM   2928 H HG21 . VAL A 1 181 ? 27.775 6.520   33.706 1.00 21.52 ? 1202 VAL A HG21 1 
ATOM   2929 H HG22 . VAL A 1 181 ? 29.203 6.772   33.097 1.00 21.52 ? 1202 VAL A HG22 1 
ATOM   2930 H HG23 . VAL A 1 181 ? 28.419 7.953   33.778 1.00 21.52 ? 1202 VAL A HG23 1 
ATOM   2931 N N    . ILE A 1 182 ? 27.224 9.639   29.481 1.00 20.41 ? 1203 ILE A N    1 
ATOM   2932 C CA   . ILE A 1 182 ? 26.801 9.974   28.120 1.00 22.17 ? 1203 ILE A CA   1 
ATOM   2933 C C    . ILE A 1 182 ? 27.899 10.667  27.299 1.00 23.30 ? 1203 ILE A C    1 
ATOM   2934 O O    . ILE A 1 182 ? 28.109 10.343  26.131 1.00 26.84 ? 1203 ILE A O    1 
ATOM   2935 C CB   . ILE A 1 182 ? 25.558 10.883  28.134 1.00 25.30 ? 1203 ILE A CB   1 
ATOM   2936 C CG1  . ILE A 1 182 ? 24.393 10.179  28.832 1.00 27.46 ? 1203 ILE A CG1  1 
ATOM   2937 C CG2  . ILE A 1 182 ? 25.169 11.273  26.717 1.00 29.14 ? 1203 ILE A CG2  1 
ATOM   2938 C CD1  . ILE A 1 182 ? 23.181 11.061  29.032 1.00 30.30 ? 1203 ILE A CD1  1 
ATOM   2939 H H    . ILE A 1 182 ? 26.815 10.082  30.095 1.00 24.49 ? 1203 ILE A H    1 
ATOM   2940 H HA   . ILE A 1 182 ? 26.559 9.146   27.654 1.00 26.61 ? 1203 ILE A HA   1 
ATOM   2941 H HB   . ILE A 1 182 ? 25.772 11.690  28.629 1.00 30.36 ? 1203 ILE A HB   1 
ATOM   2942 H HG12 . ILE A 1 182 ? 24.122 9.418   28.296 1.00 32.96 ? 1203 ILE A HG12 1 
ATOM   2943 H HG13 . ILE A 1 182 ? 24.688 9.878   29.706 1.00 32.96 ? 1203 ILE A HG13 1 
ATOM   2944 H HG21 . ILE A 1 182 ? 25.910 11.720  26.302 1.00 34.97 ? 1203 ILE A HG21 1 
ATOM   2945 H HG22 . ILE A 1 182 ? 24.948 10.479  26.225 1.00 34.97 ? 1203 ILE A HG22 1 
ATOM   2946 H HG23 . ILE A 1 182 ? 24.410 11.859  26.752 1.00 34.97 ? 1203 ILE A HG23 1 
ATOM   2947 H HD11 . ILE A 1 182 ? 23.373 11.706  29.716 1.00 36.36 ? 1203 ILE A HD11 1 
ATOM   2948 H HD12 . ILE A 1 182 ? 22.981 11.509  28.206 1.00 36.36 ? 1203 ILE A HD12 1 
ATOM   2949 H HD13 . ILE A 1 182 ? 22.437 10.515  29.296 1.00 36.36 ? 1203 ILE A HD13 1 
ATOM   2950 N N    . GLN A 1 183 ? 28.590 11.621  27.919 1.00 20.89 ? 1204 GLN A N    1 
ATOM   2951 C CA   . GLN A 1 183 ? 29.640 12.398  27.264 1.00 21.62 ? 1204 GLN A CA   1 
ATOM   2952 C C    . GLN A 1 183 ? 30.707 11.445  26.791 1.00 20.49 ? 1204 GLN A C    1 
ATOM   2953 O O    . GLN A 1 183 ? 31.294 11.643  25.734 1.00 23.70 ? 1204 GLN A O    1 
ATOM   2954 C CB   . GLN A 1 183 ? 30.273 13.407  28.229 1.00 22.49 ? 1204 GLN A CB   1 
ATOM   2955 C CG   . GLN A 1 183 ? 31.526 14.120  27.705 1.00 23.87 ? 1204 GLN A CG   1 
ATOM   2956 C CD   . GLN A 1 183 ? 32.343 14.748  28.822 1.00 29.10 ? 1204 GLN A CD   1 
ATOM   2957 O OE1  . GLN A 1 183 ? 31.949 14.715  29.993 1.00 28.02 ? 1204 GLN A OE1  1 
ATOM   2958 N NE2  . GLN A 1 183 ? 33.483 15.334  28.466 1.00 34.24 ? 1204 GLN A NE2  1 
ATOM   2959 H H    . GLN A 1 183 ? 28.479 11.822  28.748 1.00 25.07 ? 1204 GLN A H    1 
ATOM   2960 H HA   . GLN A 1 183 ? 29.273 12.877  26.492 1.00 25.94 ? 1204 GLN A HA   1 
ATOM   2961 H HB2  . GLN A 1 183 ? 29.614 14.089  28.435 1.00 26.99 ? 1204 GLN A HB2  1 
ATOM   2962 H HB3  . GLN A 1 183 ? 30.522 12.940  29.042 1.00 26.99 ? 1204 GLN A HB3  1 
ATOM   2963 H HG2  . GLN A 1 183 ? 32.088 13.477  27.245 1.00 28.64 ? 1204 GLN A HG2  1 
ATOM   2964 H HG3  . GLN A 1 183 ? 31.258 14.825  27.095 1.00 28.64 ? 1204 GLN A HG3  1 
ATOM   2965 H HE21 . GLN A 1 183 ? 33.721 15.343  27.639 1.00 41.09 ? 1204 GLN A HE21 1 
ATOM   2966 H HE22 . GLN A 1 183 ? 33.981 15.704  29.061 1.00 41.09 ? 1204 GLN A HE22 1 
ATOM   2967 N N    . LEU A 1 184 ? 30.964 10.406  27.580 1.00 18.98 ? 1205 LEU A N    1 
ATOM   2968 C CA   . LEU A 1 184 ? 32.142 9.603   27.347 1.00 16.94 ? 1205 LEU A CA   1 
ATOM   2969 C C    . LEU A 1 184 ? 31.869 8.462   26.391 1.00 15.76 ? 1205 LEU A C    1 
ATOM   2970 O O    . LEU A 1 184 ? 31.908 7.290   26.746 1.00 18.17 ? 1205 LEU A O    1 
ATOM   2971 C CB   . LEU A 1 184 ? 32.733 9.120   28.661 1.00 15.26 ? 1205 LEU A CB   1 
ATOM   2972 C CG   . LEU A 1 184 ? 33.178 10.250  29.595 1.00 15.69 ? 1205 LEU A CG   1 
ATOM   2973 C CD1  . LEU A 1 184 ? 33.590 9.673   30.926 1.00 14.81 ? 1205 LEU A CD1  1 
ATOM   2974 C CD2  . LEU A 1 184 ? 34.320 11.068  29.004 1.00 18.71 ? 1205 LEU A CD2  1 
ATOM   2975 H H    . LEU A 1 184 ? 30.478 10.154  28.243 1.00 22.77 ? 1205 LEU A H    1 
ATOM   2976 H HA   . LEU A 1 184 ? 32.817 10.174  26.924 1.00 20.33 ? 1205 LEU A HA   1 
ATOM   2977 H HB2  . LEU A 1 184 ? 32.066 8.594   29.130 1.00 18.32 ? 1205 LEU A HB2  1 
ATOM   2978 H HB3  . LEU A 1 184 ? 33.510 8.570   28.471 1.00 18.32 ? 1205 LEU A HB3  1 
ATOM   2979 H HG   . LEU A 1 184 ? 32.428 10.847  29.746 1.00 18.83 ? 1205 LEU A HG   1 
ATOM   2980 H HD11 . LEU A 1 184 ? 33.867 10.388  31.503 1.00 17.77 ? 1205 LEU A HD11 1 
ATOM   2981 H HD12 . LEU A 1 184 ? 32.842 9.211   31.311 1.00 17.77 ? 1205 LEU A HD12 1 
ATOM   2982 H HD13 . LEU A 1 184 ? 34.318 9.062   30.789 1.00 17.77 ? 1205 LEU A HD13 1 
ATOM   2983 H HD21 . LEU A 1 184 ? 34.561 11.760  29.623 1.00 22.45 ? 1205 LEU A HD21 1 
ATOM   2984 H HD22 . LEU A 1 184 ? 35.071 10.490  28.850 1.00 22.45 ? 1205 LEU A HD22 1 
ATOM   2985 H HD23 . LEU A 1 184 ? 34.030 11.456  28.175 1.00 22.45 ? 1205 LEU A HD23 1 
ATOM   2986 N N    . ASN A 1 185 ? 31.605 8.823   25.149 1.00 16.59 ? 1206 ASN A N    1 
ATOM   2987 C CA   . ASN A 1 185 ? 31.541 7.851   24.071 1.00 17.48 ? 1206 ASN A CA   1 
ATOM   2988 C C    . ASN A 1 185 ? 32.899 7.728   23.388 1.00 19.45 ? 1206 ASN A C    1 
ATOM   2989 O O    . ASN A 1 185 ? 33.851 8.407   23.746 1.00 19.56 ? 1206 ASN A O    1 
ATOM   2990 C CB   . ASN A 1 185 ? 30.449 8.220   23.070 1.00 18.89 ? 1206 ASN A CB   1 
ATOM   2991 C CG   . ASN A 1 185 ? 30.658 9.582   22.446 1.00 22.08 ? 1206 ASN A CG   1 
ATOM   2992 O OD1  . ASN A 1 185 ? 31.791 10.030  22.239 1.00 24.91 ? 1206 ASN A OD1  1 
ATOM   2993 N ND2  . ASN A 1 185 ? 29.562 10.255  22.154 1.00 27.67 ? 1206 ASN A ND2  1 
ATOM   2994 H H    . ASN A 1 185 ? 31.456 9.633   24.901 1.00 19.91 ? 1206 ASN A H    1 
ATOM   2995 H HA   . ASN A 1 185 ? 31.316 6.976   24.449 1.00 20.97 ? 1206 ASN A HA   1 
ATOM   2996 H HB2  . ASN A 1 185 ? 30.439 7.562   22.357 1.00 22.67 ? 1206 ASN A HB2  1 
ATOM   2997 H HB3  . ASN A 1 185 ? 29.593 8.227   23.526 1.00 22.67 ? 1206 ASN A HB3  1 
ATOM   2998 H HD21 . ASN A 1 185 ? 28.790 9.913   22.321 1.00 33.20 ? 1206 ASN A HD21 1 
ATOM   2999 H HD22 . ASN A 1 185 ? 29.618 11.035  21.797 1.00 33.20 ? 1206 ASN A HD22 1 
ATOM   3000 N N    . ARG A 1 186 ? 32.994 6.858   22.396 1.00 22.77 ? 1207 ARG A N    1 
ATOM   3001 C CA   . ARG A 1 186 ? 34.275 6.631   21.721 1.00 24.68 ? 1207 ARG A CA   1 
ATOM   3002 C C    . ARG A 1 186 ? 34.857 7.912   21.099 1.00 26.44 ? 1207 ARG A C    1 
ATOM   3003 O O    . ARG A 1 186 ? 36.059 8.159   21.181 1.00 27.50 ? 1207 ARG A O    1 
ATOM   3004 C CB   . ARG A 1 186 ? 34.129 5.564   20.625 1.00 29.18 ? 1207 ARG A CB   1 
ATOM   3005 C CG   . ARG A 1 186 ? 34.346 4.122   21.089 1.00 29.56 ? 1207 ARG A CG   1 
ATOM   3006 C CD   . ARG A 1 186 ? 34.761 3.169   19.926 1.00 32.65 ? 1207 ARG A CD   1 
ATOM   3007 N NE   . ARG A 1 186 ? 33.641 2.716   19.097 1.00 35.39 ? 1207 ARG A NE   1 
ATOM   3008 C CZ   . ARG A 1 186 ? 33.171 1.468   19.041 1.00 35.05 ? 1207 ARG A CZ   1 
ATOM   3009 N NH1  . ARG A 1 186 ? 33.700 0.485   19.771 1.00 31.47 ? 1207 ARG A NH1  1 
ATOM   3010 N NH2  . ARG A 1 186 ? 32.147 1.200   18.242 1.00 35.14 ? 1207 ARG A NH2  1 
ATOM   3011 H H    . ARG A 1 186 ? 32.342 6.386   22.092 1.00 27.33 ? 1207 ARG A H    1 
ATOM   3012 H HA   . ARG A 1 186 ? 34.922 6.298   22.378 1.00 29.62 ? 1207 ARG A HA   1 
ATOM   3013 H HB2  . ARG A 1 186 ? 33.233 5.621   20.257 1.00 35.02 ? 1207 ARG A HB2  1 
ATOM   3014 H HB3  . ARG A 1 186 ? 34.779 5.747   19.928 1.00 35.02 ? 1207 ARG A HB3  1 
ATOM   3015 H HG2  . ARG A 1 186 ? 35.052 4.107   21.755 1.00 35.48 ? 1207 ARG A HG2  1 
ATOM   3016 H HG3  . ARG A 1 186 ? 33.521 3.785   21.473 1.00 35.48 ? 1207 ARG A HG3  1 
ATOM   3017 H HD2  . ARG A 1 186 ? 35.386 3.636   19.349 1.00 39.18 ? 1207 ARG A HD2  1 
ATOM   3018 H HD3  . ARG A 1 186 ? 35.187 2.383   20.303 1.00 39.18 ? 1207 ARG A HD3  1 
ATOM   3019 H HE   . ARG A 1 186 ? 33.254 3.305   18.603 1.00 42.47 ? 1207 ARG A HE   1 
ATOM   3020 H HH11 . ARG A 1 186 ? 34.363 0.646   20.293 1.00 37.76 ? 1207 ARG A HH11 1 
ATOM   3021 H HH12 . ARG A 1 186 ? 33.377 -0.311  19.717 1.00 37.76 ? 1207 ARG A HH12 1 
ATOM   3022 H HH21 . ARG A 1 186 ? 31.797 1.825   17.767 1.00 42.17 ? 1207 ARG A HH21 1 
ATOM   3023 H HH22 . ARG A 1 186 ? 31.834 0.400   18.198 1.00 42.17 ? 1207 ARG A HH22 1 
ATOM   3024 N N    . GLU A 1 187 ? 34.019 8.728   20.469 1.00 26.55 ? 1208 GLU A N    1 
ATOM   3025 C CA   . GLU A 1 187 ? 34.525 9.935   19.815 1.00 28.97 ? 1208 GLU A CA   1 
ATOM   3026 C C    . GLU A 1 187 ? 35.070 10.923  20.840 1.00 27.58 ? 1208 GLU A C    1 
ATOM   3027 O O    . GLU A 1 187 ? 36.153 11.472  20.664 1.00 29.33 ? 1208 GLU A O    1 
ATOM   3028 C CB   . GLU A 1 187 ? 33.441 10.600  18.972 1.00 29.57 ? 1208 GLU A CB   1 
ATOM   3029 C CG   . GLU A 1 187 ? 33.072 9.802   17.723 1.00 32.53 ? 1208 GLU A CG   1 
ATOM   3030 C CD   . GLU A 1 187 ? 32.341 8.505   18.038 1.00 35.88 ? 1208 GLU A CD   1 
ATOM   3031 O OE1  . GLU A 1 187 ? 31.990 8.274   19.217 1.00 35.67 ? 1208 GLU A OE1  1 
ATOM   3032 O OE2  . GLU A 1 187 ? 32.106 7.714   17.094 1.00 37.59 ? 1208 GLU A OE2  1 
ATOM   3033 H H    . GLU A 1 187 ? 33.169 8.612   20.404 1.00 31.86 ? 1208 GLU A H    1 
ATOM   3034 H HA   . GLU A 1 187 ? 35.261 9.686   19.217 1.00 34.76 ? 1208 GLU A HA   1 
ATOM   3035 H HB2  . GLU A 1 187 ? 32.640 10.698  19.511 1.00 35.49 ? 1208 GLU A HB2  1 
ATOM   3036 H HB3  . GLU A 1 187 ? 33.755 11.472  18.687 1.00 35.49 ? 1208 GLU A HB3  1 
ATOM   3037 H HG2  . GLU A 1 187 ? 32.492 10.343  17.164 1.00 39.04 ? 1208 GLU A HG2  1 
ATOM   3038 H HG3  . GLU A 1 187 ? 33.883 9.579   17.241 1.00 39.04 ? 1208 GLU A HG3  1 
ATOM   3039 N N    . GLU A 1 188 ? 34.322 11.150  21.913 1.00 26.42 ? 1209 GLU A N    1 
ATOM   3040 C CA   . GLU A 1 188 ? 34.739 12.132  22.906 1.00 27.76 ? 1209 GLU A CA   1 
ATOM   3041 C C    . GLU A 1 188 ? 36.010 11.663  23.572 1.00 28.81 ? 1209 GLU A C    1 
ATOM   3042 O O    . GLU A 1 188 ? 36.922 12.444  23.814 1.00 29.56 ? 1209 GLU A O    1 
ATOM   3043 C CB   . GLU A 1 188 ? 33.664 12.333  23.975 1.00 30.70 ? 1209 GLU A CB   1 
ATOM   3044 C CG   . GLU A 1 188 ? 34.097 13.248  25.136 1.00 37.81 ? 1209 GLU A CG   1 
ATOM   3045 C CD   . GLU A 1 188 ? 34.315 14.698  24.729 1.00 43.14 ? 1209 GLU A CD   1 
ATOM   3046 O OE1  . GLU A 1 188 ? 34.286 15.000  23.524 1.00 41.43 ? 1209 GLU A OE1  1 
ATOM   3047 O OE2  . GLU A 1 188 ? 34.511 15.544  25.630 1.00 48.66 ? 1209 GLU A OE2  1 
ATOM   3048 H H    . GLU A 1 188 ? 33.579 10.755  22.089 1.00 31.70 ? 1209 GLU A H    1 
ATOM   3049 H HA   . GLU A 1 188 ? 34.912 12.991  22.468 1.00 33.31 ? 1209 GLU A HA   1 
ATOM   3050 H HB2  . GLU A 1 188 ? 32.882 12.731  23.561 1.00 36.84 ? 1209 GLU A HB2  1 
ATOM   3051 H HB3  . GLU A 1 188 ? 33.432 11.469  24.351 1.00 36.84 ? 1209 GLU A HB3  1 
ATOM   3052 H HG2  . GLU A 1 188 ? 33.409 13.232  25.819 1.00 45.37 ? 1209 GLU A HG2  1 
ATOM   3053 H HG3  . GLU A 1 188 ? 34.931 12.914  25.501 1.00 45.37 ? 1209 GLU A HG3  1 
ATOM   3054 N N    . LEU A 1 189 ? 36.052 10.384  23.922 1.00 27.46 ? 1210 LEU A N    1 
ATOM   3055 C CA   . LEU A 1 189 ? 37.248 9.854   24.557 1.00 27.78 ? 1210 LEU A CA   1 
ATOM   3056 C C    . LEU A 1 189 ? 38.474 10.005  23.643 1.00 30.11 ? 1210 LEU A C    1 
ATOM   3057 O O    . LEU A 1 189 ? 39.592 10.176  24.125 1.00 32.19 ? 1210 LEU A O    1 
ATOM   3058 C CB   . LEU A 1 189 ? 37.024 8.404   24.999 1.00 21.78 ? 1210 LEU A CB   1 
ATOM   3059 C CG   . LEU A 1 189 ? 36.309 8.297   26.351 1.00 19.67 ? 1210 LEU A CG   1 
ATOM   3060 C CD1  . LEU A 1 189 ? 35.743 6.920   26.643 1.00 20.44 ? 1210 LEU A CD1  1 
ATOM   3061 C CD2  . LEU A 1 189 ? 37.294 8.692   27.419 1.00 20.28 ? 1210 LEU A CD2  1 
ATOM   3062 H H    . LEU A 1 189 ? 35.417 9.816   23.808 1.00 32.95 ? 1210 LEU A H    1 
ATOM   3063 H HA   . LEU A 1 189 ? 37.424 10.378  25.366 1.00 33.34 ? 1210 LEU A HA   1 
ATOM   3064 H HB2  . LEU A 1 189 ? 36.479 7.953   24.336 1.00 26.13 ? 1210 LEU A HB2  1 
ATOM   3065 H HB3  . LEU A 1 189 ? 37.883 7.962   25.078 1.00 26.13 ? 1210 LEU A HB3  1 
ATOM   3066 H HG   . LEU A 1 189 ? 35.576 8.932   26.371 1.00 23.60 ? 1210 LEU A HG   1 
ATOM   3067 H HD11 . LEU A 1 189 ? 35.314 6.934   27.502 1.00 24.53 ? 1210 LEU A HD11 1 
ATOM   3068 H HD12 . LEU A 1 189 ? 35.105 6.694   25.962 1.00 24.53 ? 1210 LEU A HD12 1 
ATOM   3069 H HD13 . LEU A 1 189 ? 36.460 6.282   26.645 1.00 24.53 ? 1210 LEU A HD13 1 
ATOM   3070 H HD21 . LEU A 1 189 ? 36.865 8.632   28.276 1.00 24.34 ? 1210 LEU A HD21 1 
ATOM   3071 H HD22 . LEU A 1 189 ? 38.046 8.097   27.386 1.00 24.34 ? 1210 LEU A HD22 1 
ATOM   3072 H HD23 . LEU A 1 189 ? 37.582 9.594   27.259 1.00 24.34 ? 1210 LEU A HD23 1 
ATOM   3073 N N    . SER A 1 190 ? 38.258 9.951   22.328 1.00 29.89 ? 1211 SER A N    1 
ATOM   3074 C CA   . SER A 1 190 ? 39.324 10.208  21.350 1.00 30.18 ? 1211 SER A CA   1 
ATOM   3075 C C    . SER A 1 190 ? 40.010 11.560  21.539 1.00 28.17 ? 1211 SER A C    1 
ATOM   3076 O O    . SER A 1 190 ? 41.185 11.710  21.199 1.00 28.95 ? 1211 SER A O    1 
ATOM   3077 C CB   . SER A 1 190 ? 38.765 10.162  19.913 1.00 38.06 ? 1211 SER A CB   1 
ATOM   3078 O OG   . SER A 1 190 ? 38.778 8.858   19.337 1.00 40.49 ? 1211 SER A OG   1 
ATOM   3079 H H    . SER A 1 190 ? 37.497 9.766   21.972 1.00 35.86 ? 1211 SER A H    1 
ATOM   3080 H HA   . SER A 1 190 ? 40.006 9.510   21.432 1.00 36.22 ? 1211 SER A HA   1 
ATOM   3081 H HB2  . SER A 1 190 ? 37.849 10.480  19.929 1.00 45.67 ? 1211 SER A HB2  1 
ATOM   3082 H HB3  . SER A 1 190 ? 39.301 10.748  19.356 1.00 45.67 ? 1211 SER A HB3  1 
ATOM   3083 H HG   . SER A 1 190 ? 38.473 8.883   18.577 1.00 48.59 ? 1211 SER A HG   1 
ATOM   3084 N N    . SER A 1 191 ? 39.278 12.542  22.063 1.00 26.65 ? 1212 SER A N    1 
ATOM   3085 C CA   . SER A 1 191 ? 39.805 13.897  22.232 1.00 30.31 ? 1212 SER A CA   1 
ATOM   3086 C C    . SER A 1 191 ? 40.343 14.169  23.623 1.00 30.78 ? 1212 SER A C    1 
ATOM   3087 O O    . SER A 1 191 ? 40.908 15.242  23.885 1.00 33.04 ? 1212 SER A O    1 
ATOM   3088 C CB   . SER A 1 191 ? 38.713 14.910  21.958 1.00 37.54 ? 1212 SER A CB   1 
ATOM   3089 O OG   . SER A 1 191 ? 38.338 14.859  20.602 1.00 44.94 ? 1212 SER A OG   1 
ATOM   3090 H H    . SER A 1 191 ? 38.466 12.449  22.331 1.00 31.98 ? 1212 SER A H    1 
ATOM   3091 H HA   . SER A 1 191 ? 40.529 14.044  21.588 1.00 36.37 ? 1212 SER A HA   1 
ATOM   3092 H HB2  . SER A 1 191 ? 37.942 14.705  22.510 1.00 45.05 ? 1212 SER A HB2  1 
ATOM   3093 H HB3  . SER A 1 191 ? 39.044 15.798  22.164 1.00 45.05 ? 1212 SER A HB3  1 
ATOM   3094 H HG   . SER A 1 191 ? 37.747 15.408  20.454 1.00 53.93 ? 1212 SER A HG   1 
ATOM   3095 N N    . LEU A 1 192 ? 40.145 13.204  24.513 1.00 26.93 ? 1213 LEU A N    1 
ATOM   3096 C CA   . LEU A 1 192 ? 40.464 13.372  25.906 1.00 28.38 ? 1213 LEU A CA   1 
ATOM   3097 C C    . LEU A 1 192 ? 41.708 12.528  26.189 1.00 26.33 ? 1213 LEU A C    1 
ATOM   3098 O O    . LEU A 1 192 ? 41.839 11.412  25.671 1.00 31.70 ? 1213 LEU A O    1 
ATOM   3099 C CB   . LEU A 1 192 ? 39.255 12.916  26.719 1.00 31.53 ? 1213 LEU A CB   1 
ATOM   3100 C CG   . LEU A 1 192 ? 39.214 13.046  28.233 1.00 40.26 ? 1213 LEU A CG   1 
ATOM   3101 C CD1  . LEU A 1 192 ? 39.099 14.475  28.679 1.00 44.16 ? 1213 LEU A CD1  1 
ATOM   3102 C CD2  . LEU A 1 192 ? 38.039 12.227  28.733 1.00 44.05 ? 1213 LEU A CD2  1 
ATOM   3103 H H    . LEU A 1 192 ? 39.819 12.431  24.322 1.00 32.32 ? 1213 LEU A H    1 
ATOM   3104 H HA   . LEU A 1 192 ? 40.655 14.313  26.103 1.00 34.05 ? 1213 LEU A HA   1 
ATOM   3105 H HB2  . LEU A 1 192 ? 38.487 13.408  26.387 1.00 37.84 ? 1213 LEU A HB2  1 
ATOM   3106 H HB3  . LEU A 1 192 ? 39.122 11.975  26.527 1.00 37.84 ? 1213 LEU A HB3  1 
ATOM   3107 H HG   . LEU A 1 192 ? 40.027 12.673  28.609 1.00 48.31 ? 1213 LEU A HG   1 
ATOM   3108 H HD11 . LEU A 1 192 ? 39.859 14.965  28.354 1.00 53.00 ? 1213 LEU A HD11 1 
ATOM   3109 H HD12 . LEU A 1 192 ? 38.291 14.850  28.322 1.00 53.00 ? 1213 LEU A HD12 1 
ATOM   3110 H HD13 . LEU A 1 192 ? 39.077 14.502  29.638 1.00 53.00 ? 1213 LEU A HD13 1 
ATOM   3111 H HD21 . LEU A 1 192 ? 38.165 11.311  28.476 1.00 52.86 ? 1213 LEU A HD21 1 
ATOM   3112 H HD22 . LEU A 1 192 ? 37.995 12.296  29.690 1.00 52.86 ? 1213 LEU A HD22 1 
ATOM   3113 H HD23 . LEU A 1 192 ? 37.231 12.569  28.343 1.00 52.86 ? 1213 LEU A HD23 1 
ATOM   3114 N N    . LYS A 1 193 ? 42.648 13.092  26.939 1.00 22.29 ? 1214 LYS A N    1 
ATOM   3115 C CA   . LYS A 1 193 ? 43.838 12.365  27.379 1.00 21.72 ? 1214 LYS A CA   1 
ATOM   3116 C C    . LYS A 1 193 ? 43.828 12.301  28.898 1.00 17.72 ? 1214 LYS A C    1 
ATOM   3117 O O    . LYS A 1 193 ? 43.452 13.277  29.531 1.00 20.86 ? 1214 LYS A O    1 
ATOM   3118 C CB   . LYS A 1 193 ? 45.098 13.082  26.907 1.00 26.33 ? 1214 LYS A CB   1 
ATOM   3119 C CG   . LYS A 1 193 ? 45.213 13.167  25.391 1.00 31.43 ? 1214 LYS A CG   1 
ATOM   3120 C CD   . LYS A 1 193 ? 45.435 11.789  24.781 1.00 39.78 ? 1214 LYS A CD   1 
ATOM   3121 C CE   . LYS A 1 193 ? 45.335 11.813  23.254 1.00 47.25 ? 1214 LYS A CE   1 
ATOM   3122 N NZ   . LYS A 1 193 ? 43.967 12.172  22.755 1.00 48.99 ? 1214 LYS A NZ   1 
ATOM   3123 H H    . LYS A 1 193 ? 42.621 13.908  27.210 1.00 26.75 ? 1214 LYS A H    1 
ATOM   3124 H HA   . LYS A 1 193 ? 43.831 11.454  27.019 1.00 26.06 ? 1214 LYS A HA   1 
ATOM   3125 H HB2  . LYS A 1 193 ? 45.094 13.987  27.256 1.00 31.60 ? 1214 LYS A HB2  1 
ATOM   3126 H HB3  . LYS A 1 193 ? 45.874 12.604  27.238 1.00 31.60 ? 1214 LYS A HB3  1 
ATOM   3127 H HG2  . LYS A 1 193 ? 44.393 13.534  25.027 1.00 37.72 ? 1214 LYS A HG2  1 
ATOM   3128 H HG3  . LYS A 1 193 ? 45.968 13.729  25.157 1.00 37.72 ? 1214 LYS A HG3  1 
ATOM   3129 H HD2  . LYS A 1 193 ? 46.321 11.474  25.020 1.00 47.74 ? 1214 LYS A HD2  1 
ATOM   3130 H HD3  . LYS A 1 193 ? 44.761 11.179  25.118 1.00 47.74 ? 1214 LYS A HD3  1 
ATOM   3131 H HE2  . LYS A 1 193 ? 45.960 12.470  22.909 1.00 56.70 ? 1214 LYS A HE2  1 
ATOM   3132 H HE3  . LYS A 1 193 ? 45.557 10.934  22.911 1.00 56.70 ? 1214 LYS A HE3  1 
ATOM   3133 H HZ1  . LYS A 1 193 ? 43.739 12.982  23.047 1.00 58.79 ? 1214 LYS A HZ1  1 
ATOM   3134 H HZ2  . LYS A 1 193 ? 43.959 12.174  21.865 1.00 58.79 ? 1214 LYS A HZ2  1 
ATOM   3135 H HZ3  . LYS A 1 193 ? 43.371 11.580  23.049 1.00 58.79 ? 1214 LYS A HZ3  1 
ATOM   3136 N N    . PRO A 1 194 ? 44.251 11.167  29.487 1.00 16.98 ? 1215 PRO A N    1 
ATOM   3137 C CA   . PRO A 1 194 ? 44.281 11.153  30.952 1.00 13.71 ? 1215 PRO A CA   1 
ATOM   3138 C C    . PRO A 1 194 ? 45.429 11.973  31.501 1.00 13.63 ? 1215 PRO A C    1 
ATOM   3139 O O    . PRO A 1 194 ? 46.411 12.263  30.786 1.00 15.55 ? 1215 PRO A O    1 
ATOM   3140 C CB   . PRO A 1 194 ? 44.485 9.677   31.295 1.00 17.34 ? 1215 PRO A CB   1 
ATOM   3141 C CG   . PRO A 1 194 ? 45.239 9.130   30.110 1.00 20.75 ? 1215 PRO A CG   1 
ATOM   3142 C CD   . PRO A 1 194 ? 44.709 9.885   28.920 1.00 18.19 ? 1215 PRO A CD   1 
ATOM   3143 H HA   . PRO A 1 194 ? 43.432 11.470  31.324 1.00 16.45 ? 1215 PRO A HA   1 
ATOM   3144 H HB2  . PRO A 1 194 ? 45.009 9.596   32.107 1.00 20.81 ? 1215 PRO A HB2  1 
ATOM   3145 H HB3  . PRO A 1 194 ? 43.625 9.238   31.392 1.00 20.81 ? 1215 PRO A HB3  1 
ATOM   3146 H HG2  . PRO A 1 194 ? 46.188 9.292   30.223 1.00 24.90 ? 1215 PRO A HG2  1 
ATOM   3147 H HG3  . PRO A 1 194 ? 45.061 8.180   30.020 1.00 24.90 ? 1215 PRO A HG3  1 
ATOM   3148 H HD2  . PRO A 1 194 ? 45.417 10.036  28.274 1.00 21.83 ? 1215 PRO A HD2  1 
ATOM   3149 H HD3  . PRO A 1 194 ? 43.963 9.408   28.523 1.00 21.83 ? 1215 PRO A HD3  1 
ATOM   3150 N N    . ILE A 1 195 ? 45.288 12.368  32.749 1.00 11.14 ? 1216 ILE A N    1 
ATOM   3151 C CA   . ILE A 1 195 ? 46.298 13.129  33.449 1.00 10.97 ? 1216 ILE A CA   1 
ATOM   3152 C C    . ILE A 1 195 ? 47.008 12.214  34.416 1.00 13.56 ? 1216 ILE A C    1 
ATOM   3153 O O    . ILE A 1 195 ? 46.374 11.554  35.208 1.00 14.96 ? 1216 ILE A O    1 
ATOM   3154 C CB   . ILE A 1 195 ? 45.652 14.326  34.104 1.00 12.31 ? 1216 ILE A CB   1 
ATOM   3155 C CG1  . ILE A 1 195 ? 45.442 15.366  32.996 1.00 15.76 ? 1216 ILE A CG1  1 
ATOM   3156 C CG2  . ILE A 1 195 ? 46.554 14.918  35.177 1.00 14.66 ? 1216 ILE A CG2  1 
ATOM   3157 C CD1  . ILE A 1 195 ? 44.735 16.611  33.425 1.00 17.41 ? 1216 ILE A CD1  1 
ATOM   3158 H H    . ILE A 1 195 ? 44.592 12.202  33.227 1.00 13.37 ? 1216 ILE A H    1 
ATOM   3159 H HA   . ILE A 1 195 ? 46.957 13.456  32.802 1.00 13.17 ? 1216 ILE A HA   1 
ATOM   3160 H HB   . ILE A 1 195 ? 44.798 14.074  34.488 1.00 14.77 ? 1216 ILE A HB   1 
ATOM   3161 H HG12 . ILE A 1 195 ? 46.310 15.627  32.649 1.00 18.91 ? 1216 ILE A HG12 1 
ATOM   3162 H HG13 . ILE A 1 195 ? 44.917 14.960  32.288 1.00 18.91 ? 1216 ILE A HG13 1 
ATOM   3163 H HG21 . ILE A 1 195 ? 46.114 15.675  35.571 1.00 17.59 ? 1216 ILE A HG21 1 
ATOM   3164 H HG22 . ILE A 1 195 ? 46.722 14.251  35.846 1.00 17.59 ? 1216 ILE A HG22 1 
ATOM   3165 H HG23 . ILE A 1 195 ? 47.381 15.193  34.773 1.00 17.59 ? 1216 ILE A HG23 1 
ATOM   3166 H HD11 . ILE A 1 195 ? 44.651 17.197  32.670 1.00 20.90 ? 1216 ILE A HD11 1 
ATOM   3167 H HD12 . ILE A 1 195 ? 43.866 16.377  33.758 1.00 20.90 ? 1216 ILE A HD12 1 
ATOM   3168 H HD13 . ILE A 1 195 ? 45.247 17.038  34.116 1.00 20.90 ? 1216 ILE A HD13 1 
ATOM   3169 N N    . LEU A 1 196 ? 48.333 12.141  34.288 1.00 17.40 ? 1217 LEU A N    1 
ATOM   3170 C CA   . LEU A 1 196 ? 49.186 11.287  35.107 1.00 21.77 ? 1217 LEU A CA   1 
ATOM   3171 C C    . LEU A 1 196 ? 50.278 12.159  35.666 1.00 23.52 ? 1217 LEU A C    1 
ATOM   3172 O O    . LEU A 1 196 ? 51.176 12.589  34.943 1.00 28.32 ? 1217 LEU A O    1 
ATOM   3173 C CB   . LEU A 1 196 ? 49.855 10.192  34.274 1.00 25.71 ? 1217 LEU A CB   1 
ATOM   3174 C CG   . LEU A 1 196 ? 49.018 9.009   33.809 1.00 30.42 ? 1217 LEU A CG   1 
ATOM   3175 C CD1  . LEU A 1 196 ? 47.945 9.443   32.848 1.00 32.46 ? 1217 LEU A CD1  1 
ATOM   3176 C CD2  . LEU A 1 196 ? 49.924 7.996   33.159 1.00 35.00 ? 1217 LEU A CD2  1 
ATOM   3177 H H    . LEU A 1 196 ? 48.775 12.598  33.708 1.00 20.88 ? 1217 LEU A H    1 
ATOM   3178 H HA   . LEU A 1 196 ? 48.676 10.884  35.840 1.00 26.12 ? 1217 LEU A HA   1 
ATOM   3179 H HB2  . LEU A 1 196 ? 50.218 10.608  33.476 1.00 30.85 ? 1217 LEU A HB2  1 
ATOM   3180 H HB3  . LEU A 1 196 ? 50.586 9.827   34.797 1.00 30.85 ? 1217 LEU A HB3  1 
ATOM   3181 H HG   . LEU A 1 196 ? 48.593 8.593   34.576 1.00 36.50 ? 1217 LEU A HG   1 
ATOM   3182 H HD11 . LEU A 1 196 ? 47.371 10.076  33.286 1.00 38.95 ? 1217 LEU A HD11 1 
ATOM   3183 H HD12 . LEU A 1 196 ? 48.358 9.850   32.083 1.00 38.95 ? 1217 LEU A HD12 1 
ATOM   3184 H HD13 . LEU A 1 196 ? 47.439 8.674   32.577 1.00 38.95 ? 1217 LEU A HD13 1 
ATOM   3185 H HD21 . LEU A 1 196 ? 50.361 8.405   32.409 1.00 42.01 ? 1217 LEU A HD21 1 
ATOM   3186 H HD22 . LEU A 1 196 ? 50.577 7.705   33.800 1.00 42.01 ? 1217 LEU A HD22 1 
ATOM   3187 H HD23 . LEU A 1 196 ? 49.397 7.249   32.865 1.00 42.01 ? 1217 LEU A HD23 1 
ATOM   3188 N N    . THR A 1 197 ? 50.176 12.435  36.963 1.00 23.66 ? 1218 THR A N    1 
ATOM   3189 C CA   . THR A 1 197 ? 51.151 13.247  37.687 1.00 25.19 ? 1218 THR A CA   1 
ATOM   3190 C C    . THR A 1 197 ? 51.097 12.878  39.168 1.00 28.06 ? 1218 THR A C    1 
ATOM   3191 O O    . THR A 1 197 ? 50.752 13.698  40.019 1.00 29.25 ? 1218 THR A O    1 
ATOM   3192 C CB   . THR A 1 197 ? 50.866 14.751  37.528 1.00 27.38 ? 1218 THR A CB   1 
ATOM   3193 O OG1  . THR A 1 197 ? 51.706 15.497  38.417 1.00 32.88 ? 1218 THR A OG1  1 
ATOM   3194 C CG2  . THR A 1 197 ? 49.407 15.055  37.834 1.00 24.03 ? 1218 THR A CG2  1 
ATOM   3195 H H    . THR A 1 197 ? 49.526 12.156  37.454 1.00 28.39 ? 1218 THR A H    1 
ATOM   3196 H HA   . THR A 1 197 ? 52.052 13.060  37.350 1.00 30.23 ? 1218 THR A HA   1 
ATOM   3197 H HB   . THR A 1 197 ? 51.049 15.017  36.613 1.00 32.85 ? 1218 THR A HB   1 
ATOM   3198 H HG1  . THR A 1 197 ? 52.494 15.326  38.269 1.00 39.46 ? 1218 THR A HG1  1 
ATOM   3199 H HG21 . THR A 1 197 ? 49.210 14.830  38.746 1.00 28.83 ? 1218 THR A HG21 1 
ATOM   3200 H HG22 . THR A 1 197 ? 49.232 15.989  37.698 1.00 28.83 ? 1218 THR A HG22 1 
ATOM   3201 H HG23 . THR A 1 197 ? 48.837 14.542  37.256 1.00 28.83 ? 1218 THR A HG23 1 
ATOM   3202 N N    . PRO A 1 198 ? 51.435 11.626  39.453 1.00 25.46 ? 1219 PRO A N    1 
ATOM   3203 C CA   . PRO A 1 198 ? 51.295 11.034  40.778 1.00 32.76 ? 1219 PRO A CA   1 
ATOM   3204 C C    . PRO A 1 198 ? 51.914 11.868  41.895 1.00 36.05 ? 1219 PRO A C    1 
ATOM   3205 O O    . PRO A 1 198 ? 53.053 12.323  41.765 1.00 37.60 ? 1219 PRO A O    1 
ATOM   3206 C CB   . PRO A 1 198 ? 52.057 9.717   40.623 1.00 31.93 ? 1219 PRO A CB   1 
ATOM   3207 C CG   . PRO A 1 198 ? 51.902 9.359   39.228 1.00 29.05 ? 1219 PRO A CG   1 
ATOM   3208 C CD   . PRO A 1 198 ? 51.940 10.643  38.475 1.00 28.53 ? 1219 PRO A CD   1 
ATOM   3209 H HA   . PRO A 1 198 ? 50.353 10.851  40.981 1.00 39.31 ? 1219 PRO A HA   1 
ATOM   3210 H HB2  . PRO A 1 198 ? 52.993 9.852   40.841 1.00 38.31 ? 1219 PRO A HB2  1 
ATOM   3211 H HB3  . PRO A 1 198 ? 51.664 9.041   41.197 1.00 38.31 ? 1219 PRO A HB3  1 
ATOM   3212 H HG2  . PRO A 1 198 ? 52.634 8.783   38.957 1.00 34.86 ? 1219 PRO A HG2  1 
ATOM   3213 H HG3  . PRO A 1 198 ? 51.051 8.913   39.100 1.00 34.86 ? 1219 PRO A HG3  1 
ATOM   3214 H HD2  . PRO A 1 198 ? 52.850 10.858  38.218 1.00 34.24 ? 1219 PRO A HD2  1 
ATOM   3215 H HD3  . PRO A 1 198 ? 51.353 10.600  37.704 1.00 34.24 ? 1219 PRO A HD3  1 
ATOM   3216 N N    . SER A 1 199 ? 51.169 12.063  42.978 1.00 36.67 ? 1220 SER A N    1 
ATOM   3217 C CA   . SER A 1 199 ? 51.653 12.843  44.110 1.00 39.19 ? 1220 SER A CA   1 
ATOM   3218 C C    . SER A 1 199 ? 52.450 14.051  43.632 1.00 46.31 ? 1220 SER A C    1 
ATOM   3219 O O    . SER A 1 199 ? 53.625 14.204  43.965 1.00 46.29 ? 1220 SER A O    1 
ATOM   3220 C CB   . SER A 1 199 ? 52.520 11.974  45.023 1.00 20.00 ? 1220 SER A CB   1 
ATOM   3221 O OG   . SER A 1 199 ? 53.505 11.278  44.279 1.00 20.00 ? 1220 SER A OG   1 
ATOM   3222 H H    . SER A 1 199 ? 50.374 11.752  43.082 1.00 44.00 ? 1220 SER A H    1 
ATOM   3223 H HA   . SER A 1 199 ? 50.888 13.167  44.630 1.00 47.03 ? 1220 SER A HA   1 
HETATM 3224 O O    . HOH B 2 .   ? 33.102 -8.071  33.846 1.00 7.48  ? 1501 HOH A O    1 
HETATM 3225 O O    . HOH B 2 .   ? 24.457 -5.359  32.066 1.00 8.38  ? 1502 HOH A O    1 
HETATM 3226 O O    . HOH B 2 .   ? 25.978 19.012  33.417 1.00 13.47 ? 1503 HOH A O    1 
HETATM 3227 O O    . HOH B 2 .   ? 43.645 12.539  37.281 1.00 8.64  ? 1504 HOH A O    1 
HETATM 3228 O O    . HOH B 2 .   ? 23.693 -5.574  29.275 1.00 10.00 ? 1505 HOH A O    1 
HETATM 3229 O O    . HOH B 2 .   ? 37.193 -7.423  24.751 1.00 12.83 ? 1506 HOH A O    1 
HETATM 3230 O O    . HOH B 2 .   ? 38.036 2.921   27.646 1.00 12.36 ? 1507 HOH A O    1 
HETATM 3231 O O    . HOH B 2 .   ? 40.525 -4.111  48.015 1.00 10.95 ? 1508 HOH A O    1 
HETATM 3232 O O    . HOH B 2 .   ? 44.048 -9.207  32.360 1.00 12.66 ? 1509 HOH A O    1 
HETATM 3233 O O    . HOH B 2 .   ? 39.243 4.619   49.645 1.00 10.43 ? 1510 HOH A O    1 
HETATM 3234 O O    . HOH B 2 .   ? 37.176 17.699  40.458 1.00 10.12 ? 1511 HOH A O    1 
HETATM 3235 O O    . HOH B 2 .   ? 24.606 -2.058  55.088 1.00 13.44 ? 1512 HOH A O    1 
HETATM 3236 O O    . HOH B 2 .   ? 25.541 -7.843  29.319 1.00 10.59 ? 1513 HOH A O    1 
HETATM 3237 O O    . HOH B 2 .   ? 50.766 -2.885  33.750 1.00 14.41 ? 1514 HOH A O    1 
HETATM 3238 O O    . HOH B 2 .   ? 14.163 -4.652  31.957 1.00 11.33 ? 1515 HOH A O    1 
HETATM 3239 O O    . HOH B 2 .   ? 22.985 4.548   27.651 1.00 12.93 ? 1516 HOH A O    1 
HETATM 3240 O O    . HOH B 2 .   ? 37.787 17.259  43.192 1.00 12.71 ? 1517 HOH A O    1 
HETATM 3241 O O    . HOH B 2 .   ? 16.707 -10.107 33.144 1.00 12.88 ? 1518 HOH A O    1 
HETATM 3242 O O    . HOH B 2 .   ? 39.667 8.366   49.556 1.00 10.11 ? 1519 HOH A O    1 
HETATM 3243 O O    . HOH B 2 .   ? 27.688 -9.644  52.219 1.00 13.54 ? 1520 HOH A O    1 
HETATM 3244 O O    . HOH B 2 .   ? 41.769 20.381  44.207 1.00 11.49 ? 1521 HOH A O    1 
HETATM 3245 O O    . HOH B 2 .   ? 36.346 13.424  46.232 1.00 11.87 ? 1522 HOH A O    1 
HETATM 3246 O O    . HOH B 2 .   ? 38.103 19.401  32.140 1.00 12.81 ? 1523 HOH A O    1 
HETATM 3247 O O    . HOH B 2 .   ? 20.991 17.800  42.235 1.00 15.96 ? 1524 HOH A O    1 
HETATM 3248 O O    . HOH B 2 .   ? 21.163 -13.018 32.715 1.00 12.20 ? 1525 HOH A O    1 
HETATM 3249 O O    . HOH B 2 .   ? 17.259 -2.872  29.372 1.00 12.29 ? 1526 HOH A O    1 
HETATM 3250 O O    . HOH B 2 .   ? 44.926 -6.260  42.939 1.00 12.11 ? 1527 HOH A O    1 
HETATM 3251 O O    . HOH B 2 .   ? 33.884 14.075  50.466 1.00 15.04 ? 1528 HOH A O    1 
HETATM 3252 O O    . HOH B 2 .   ? 25.779 -9.094  47.855 1.00 12.39 ? 1529 HOH A O    1 
HETATM 3253 O O    . HOH B 2 .   ? 45.093 6.991   52.149 1.00 16.39 ? 1530 HOH A O    1 
HETATM 3254 O O    . HOH B 2 .   ? 36.031 13.315  48.944 1.00 15.48 ? 1531 HOH A O    1 
HETATM 3255 O O    . HOH B 2 .   ? 37.964 14.779  44.499 1.00 12.25 ? 1532 HOH A O    1 
HETATM 3256 O O    . HOH B 2 .   ? 15.093 0.979   41.008 1.00 14.43 ? 1533 HOH A O    1 
HETATM 3257 O O    . HOH B 2 .   ? 42.037 -5.185  31.047 1.00 14.18 ? 1534 HOH A O    1 
HETATM 3258 O O    . HOH B 2 .   ? 14.236 -7.225  28.396 1.00 19.20 ? 1535 HOH A O    1 
HETATM 3259 O O    . HOH B 2 .   ? 17.728 -0.110  29.808 1.00 16.71 ? 1536 HOH A O    1 
HETATM 3260 O O    . HOH B 2 .   ? 43.830 -3.423  29.730 1.00 16.12 ? 1537 HOH A O    1 
HETATM 3261 O O    . HOH B 2 .   ? 50.423 -3.300  38.233 1.00 15.55 ? 1538 HOH A O    1 
HETATM 3262 O O    . HOH B 2 .   ? 36.934 -15.601 33.231 1.00 14.72 ? 1539 HOH A O    1 
HETATM 3263 O O    . HOH B 2 .   ? 25.249 -7.407  33.854 1.00 17.35 ? 1540 HOH A O    1 
HETATM 3264 O O    . HOH B 2 .   ? 20.886 14.505  40.125 1.00 15.22 ? 1541 HOH A O    1 
HETATM 3265 O O    . HOH B 2 .   ? 40.205 15.473  51.270 1.00 21.88 ? 1542 HOH A O    1 
HETATM 3266 O O    . HOH B 2 .   ? 29.009 15.628  33.923 1.00 18.43 ? 1543 HOH A O    1 
HETATM 3267 O O    . HOH B 2 .   ? 38.024 1.424   25.340 1.00 18.54 ? 1544 HOH A O    1 
HETATM 3268 O O    . HOH B 2 .   ? 45.305 -7.234  40.359 1.00 16.92 ? 1545 HOH A O    1 
HETATM 3269 O O    . HOH B 2 .   ? 42.606 4.964   29.946 1.00 23.49 ? 1546 HOH A O    1 
HETATM 3270 O O    . HOH B 2 .   ? 47.341 8.974   37.895 1.00 17.31 ? 1547 HOH A O    1 
HETATM 3271 O O    . HOH B 2 .   ? 30.885 -12.944 27.487 1.00 19.75 ? 1548 HOH A O    1 
HETATM 3272 O O    . HOH B 2 .   ? 47.418 -5.070  43.066 1.00 21.30 ? 1549 HOH A O    1 
HETATM 3273 O O    . HOH B 2 .   ? 16.010 -7.812  43.905 1.00 19.21 ? 1550 HOH A O    1 
HETATM 3274 O O    . HOH B 2 .   ? 47.919 -0.938  32.153 1.00 18.14 ? 1551 HOH A O    1 
HETATM 3275 O O    . HOH B 2 .   ? 24.855 18.412  46.852 1.00 22.68 ? 1552 HOH A O    1 
HETATM 3276 O O    . HOH B 2 .   ? 42.946 15.788  49.520 1.00 21.73 ? 1553 HOH A O    1 
HETATM 3277 O O    . HOH B 2 .   ? 19.442 -2.016  51.255 1.00 25.26 ? 1554 HOH A O    1 
HETATM 3278 O O    . HOH B 2 .   ? 24.004 -5.148  53.962 1.00 27.47 ? 1555 HOH A O    1 
HETATM 3279 O O    . HOH B 2 .   ? 12.841 -7.184  32.026 1.00 19.48 ? 1556 HOH A O    1 
HETATM 3280 O O    . HOH B 2 .   ? 34.912 19.460  38.467 1.00 16.75 ? 1557 HOH A O    1 
HETATM 3281 O O    . HOH B 2 .   ? 22.876 -9.537  43.778 1.00 19.36 ? 1558 HOH A O    1 
HETATM 3282 O O    . HOH B 2 .   ? 28.949 2.671   58.758 1.00 24.49 ? 1559 HOH A O    1 
HETATM 3283 O O    . HOH B 2 .   ? 34.644 -17.259 33.050 1.00 31.39 ? 1560 HOH A O    1 
HETATM 3284 O O    . HOH B 2 .   ? 42.888 5.284   37.636 1.00 18.28 ? 1561 HOH A O    1 
HETATM 3285 O O    . HOH B 2 .   ? 47.976 -5.941  39.249 1.00 27.58 ? 1562 HOH A O    1 
HETATM 3286 O O    . HOH B 2 .   ? 46.456 6.361   48.573 1.00 23.73 ? 1563 HOH A O    1 
HETATM 3287 O O    . HOH B 2 .   ? 27.056 -7.549  55.705 1.00 25.69 ? 1564 HOH A O    1 
HETATM 3288 O O    . HOH B 2 .   ? 21.585 10.051  48.725 1.00 20.79 ? 1565 HOH A O    1 
HETATM 3289 O O    . HOH B 2 .   ? 40.645 -10.041 23.779 1.00 36.53 ? 1566 HOH A O    1 
HETATM 3290 O O    . HOH B 2 .   ? 33.752 -9.906  25.928 1.00 19.03 ? 1567 HOH A O    1 
HETATM 3291 O O    . HOH B 2 .   ? 17.828 -1.036  47.126 1.00 25.42 ? 1568 HOH A O    1 
HETATM 3292 O O    . HOH B 2 .   ? 40.434 -10.424 47.267 1.00 28.02 ? 1569 HOH A O    1 
HETATM 3293 O O    . HOH B 2 .   ? 50.537 -0.519  32.392 1.00 16.39 ? 1570 HOH A O    1 
HETATM 3294 O O    . HOH B 2 .   ? 48.219 12.300  41.906 1.00 22.09 ? 1571 HOH A O    1 
HETATM 3295 O O    . HOH B 2 .   ? 33.079 9.190   55.580 1.00 23.60 ? 1572 HOH A O    1 
HETATM 3296 O O    . HOH B 2 .   ? 28.189 4.726   56.354 1.00 21.63 ? 1573 HOH A O    1 
HETATM 3297 O O    . HOH B 2 .   ? 33.837 18.667  32.417 1.00 28.01 ? 1574 HOH A O    1 
HETATM 3298 O O    . HOH B 2 .   ? 15.640 -7.270  46.632 1.00 27.09 ? 1575 HOH A O    1 
HETATM 3299 O O    . HOH B 2 .   ? 14.278 -5.343  39.041 1.00 22.72 ? 1576 HOH A O    1 
HETATM 3300 O O    . HOH B 2 .   ? 47.236 14.729  29.674 1.00 26.88 ? 1577 HOH A O    1 
HETATM 3301 O O    . HOH B 2 .   ? 41.959 -6.456  47.663 1.00 20.71 ? 1578 HOH A O    1 
HETATM 3302 O O    . HOH B 2 .   ? 27.413 10.325  55.247 1.00 23.24 ? 1579 HOH A O    1 
HETATM 3303 O O    . HOH B 2 .   ? 32.785 17.786  43.769 1.00 27.61 ? 1580 HOH A O    1 
HETATM 3304 O O    . HOH B 2 .   ? 49.999 0.583   49.668 1.00 31.19 ? 1581 HOH A O    1 
HETATM 3305 O O    . HOH B 2 .   ? 46.612 9.694   49.968 1.00 28.64 ? 1582 HOH A O    1 
HETATM 3306 O O    . HOH B 2 .   ? 18.378 1.058   48.545 1.00 35.23 ? 1583 HOH A O    1 
HETATM 3307 O O    . HOH B 2 .   ? 25.597 -10.223 27.877 1.00 17.63 ? 1584 HOH A O    1 
HETATM 3308 O O    . HOH B 2 .   ? 15.125 -10.268 35.498 1.00 18.58 ? 1585 HOH A O    1 
HETATM 3309 O O    . HOH B 2 .   ? 33.769 18.776  41.450 1.00 25.56 ? 1586 HOH A O    1 
HETATM 3310 O O    . HOH B 2 .   ? 16.252 -10.907 37.975 1.00 17.42 ? 1587 HOH A O    1 
HETATM 3311 O O    . HOH B 2 .   ? 24.176 3.875   25.178 1.00 26.60 ? 1588 HOH A O    1 
HETATM 3312 O O    . HOH B 2 .   ? 42.759 -7.828  30.038 1.00 16.80 ? 1589 HOH A O    1 
HETATM 3313 O O    . HOH B 2 .   ? 21.201 7.704   47.039 1.00 26.46 ? 1590 HOH A O    1 
HETATM 3314 O O    . HOH B 2 .   ? 21.864 -4.620  52.419 1.00 26.36 ? 1591 HOH A O    1 
HETATM 3315 O O    . HOH B 2 .   ? 13.894 -0.588  29.949 1.00 35.94 ? 1592 HOH A O    1 
HETATM 3316 O O    . HOH B 2 .   ? 39.893 12.676  54.894 1.00 24.72 ? 1593 HOH A O    1 
HETATM 3317 O O    . HOH B 2 .   ? 36.436 19.208  44.589 1.00 26.95 ? 1594 HOH A O    1 
HETATM 3318 O O    . HOH B 2 .   ? 46.771 -3.252  48.985 1.00 26.84 ? 1595 HOH A O    1 
HETATM 3319 O O    . HOH B 2 .   ? 10.718 -7.786  30.579 1.00 24.85 ? 1596 HOH A O    1 
HETATM 3320 O O    . HOH B 2 .   ? 48.556 -0.287  46.173 1.00 31.24 ? 1597 HOH A O    1 
HETATM 3321 O O    . HOH B 2 .   ? 27.428 -11.987 53.350 1.00 33.19 ? 1598 HOH A O    1 
HETATM 3322 O O    . HOH B 2 .   ? 46.145 -7.490  32.592 1.00 22.39 ? 1599 HOH A O    1 
HETATM 3323 O O    . HOH B 2 .   ? 32.909 16.728  50.775 1.00 32.41 ? 1600 HOH A O    1 
HETATM 3324 O O    . HOH B 2 .   ? 36.851 -2.138  16.872 1.00 33.62 ? 1601 HOH A O    1 
HETATM 3325 O O    . HOH B 2 .   ? 38.183 18.239  29.714 1.00 23.35 ? 1602 HOH A O    1 
HETATM 3326 O O    . HOH B 2 .   ? 41.798 -7.897  45.487 1.00 41.34 ? 1603 HOH A O    1 
HETATM 3327 O O    . HOH B 2 .   ? 35.772 1.627   56.493 1.00 26.54 ? 1604 HOH A O    1 
HETATM 3328 O O    . HOH B 2 .   ? 37.897 -11.472 44.404 1.00 25.92 ? 1605 HOH A O    1 
HETATM 3329 O O    . HOH B 2 .   ? 12.578 -7.793  39.603 1.00 24.14 ? 1606 HOH A O    1 
HETATM 3330 O O    . HOH B 2 .   ? 23.779 -10.442 46.466 1.00 31.62 ? 1607 HOH A O    1 
HETATM 3331 O O    . HOH B 2 .   ? 44.020 -8.504  44.090 1.00 27.32 ? 1608 HOH A O    1 
HETATM 3332 O O    . HOH B 2 .   ? 20.395 13.397  47.602 1.00 35.03 ? 1609 HOH A O    1 
HETATM 3333 O O    . HOH B 2 .   ? 30.570 -6.820  20.980 1.00 27.55 ? 1610 HOH A O    1 
HETATM 3334 O O    . HOH B 2 .   ? 36.190 -5.519  59.894 1.00 38.92 ? 1611 HOH A O    1 
HETATM 3335 O O    . HOH B 2 .   ? 15.724 -6.495  26.462 1.00 35.38 ? 1612 HOH A O    1 
HETATM 3336 O O    . HOH B 2 .   ? 36.861 14.539  52.877 1.00 23.99 ? 1613 HOH A O    1 
HETATM 3337 O O    . HOH B 2 .   ? 40.669 5.907   47.492 1.00 24.45 ? 1614 HOH A O    1 
HETATM 3338 O O    . HOH B 2 .   ? 21.970 3.628   23.466 1.00 25.30 ? 1615 HOH A O    1 
HETATM 3339 O O    . HOH B 2 .   ? 47.503 -2.953  51.839 1.00 35.42 ? 1616 HOH A O    1 
HETATM 3340 O O    . HOH B 2 .   ? 27.040 8.536   24.606 1.00 34.33 ? 1617 HOH A O    1 
HETATM 3341 O O    . HOH B 2 .   ? 47.443 15.825  47.462 1.00 40.04 ? 1618 HOH A O    1 
HETATM 3342 O O    . HOH B 2 .   ? 16.709 -3.036  48.170 1.00 36.88 ? 1619 HOH A O    1 
HETATM 3343 O O    . HOH B 2 .   ? 36.309 -3.301  61.626 1.00 39.47 ? 1620 HOH A O    1 
HETATM 3344 O O    . HOH B 2 .   ? 45.860 12.340  49.202 1.00 27.51 ? 1621 HOH A O    1 
HETATM 3345 O O    . HOH B 2 .   ? 26.718 7.455   56.929 1.00 30.94 ? 1622 HOH A O    1 
HETATM 3346 O O    . HOH B 2 .   ? 41.064 4.429   55.828 1.00 34.04 ? 1623 HOH A O    1 
HETATM 3347 O O    . HOH B 2 .   ? 31.320 2.539   21.784 1.00 28.70 ? 1624 HOH A O    1 
HETATM 3348 O O    . HOH B 2 .   ? 32.020 -13.273 43.664 1.00 31.81 ? 1625 HOH A O    1 
HETATM 3349 O O    . HOH B 2 .   ? 17.922 17.807  46.172 1.00 32.17 ? 1626 HOH A O    1 
HETATM 3350 O O    . HOH B 2 .   ? 35.259 -12.157 51.176 1.00 39.90 ? 1627 HOH A O    1 
HETATM 3351 O O    . HOH B 2 .   ? 13.979 -9.537  38.792 1.00 35.91 ? 1628 HOH A O    1 
HETATM 3352 O O    . HOH B 2 .   ? 25.650 -2.154  19.004 1.00 30.12 ? 1629 HOH A O    1 
HETATM 3353 O O    . HOH B 2 .   ? 40.157 -8.882  57.498 1.00 32.23 ? 1630 HOH A O    1 
HETATM 3354 O O    . HOH B 2 .   ? 16.887 0.864   27.098 1.00 42.75 ? 1631 HOH A O    1 
HETATM 3355 O O    . HOH B 2 .   ? 18.611 8.548   30.125 1.00 41.58 ? 1632 HOH A O    1 
HETATM 3356 O O    . HOH B 2 .   ? 46.490 5.834   28.271 1.00 40.76 ? 1633 HOH A O    1 
HETATM 3357 O O    . HOH B 2 .   ? 30.518 -2.005  61.847 1.00 35.11 ? 1634 HOH A O    1 
HETATM 3358 O O    . HOH B 2 .   ? 14.505 -3.392  29.359 1.00 38.11 ? 1635 HOH A O    1 
HETATM 3359 O O    . HOH B 2 .   ? 31.442 19.705  45.012 1.00 31.14 ? 1636 HOH A O    1 
HETATM 3360 O O    . HOH B 2 .   ? 15.661 -4.263  27.323 1.00 40.58 ? 1637 HOH A O    1 
HETATM 3361 O O    . HOH B 2 .   ? 32.172 18.567  49.144 1.00 41.03 ? 1638 HOH A O    1 
HETATM 3362 O O    . HOH B 2 .   ? 28.997 -14.400 52.943 1.00 32.79 ? 1639 HOH A O    1 
HETATM 3363 O O    . HOH B 2 .   ? 19.486 -10.508 32.598 1.00 20.41 ? 1640 HOH A O    1 
HETATM 3364 O O    . HOH B 2 .   ? 13.607 0.708   44.387 1.00 33.92 ? 1641 HOH A O    1 
HETATM 3365 O O    . HOH B 2 .   ? 18.793 18.090  48.559 1.00 38.87 ? 1642 HOH A O    1 
HETATM 3366 O O    . HOH B 2 .   ? 29.670 18.624  46.848 1.00 35.57 ? 1643 HOH A O    1 
HETATM 3367 O O    . HOH B 2 .   ? 38.001 -8.204  19.659 1.00 35.15 ? 1644 HOH A O    1 
HETATM 3368 O O    . HOH B 2 .   ? 30.629 -11.851 55.951 1.00 35.89 ? 1645 HOH A O    1 
HETATM 3369 O O    . HOH B 2 .   ? 47.404 14.355  49.642 1.00 43.31 ? 1646 HOH A O    1 
HETATM 3370 O O    . HOH B 2 .   ? 49.245 15.529  45.447 1.00 39.98 ? 1647 HOH A O    1 
HETATM 3371 O O    . HOH B 2 .   ? 15.958 -11.994 31.372 1.00 37.54 ? 1648 HOH A O    1 
HETATM 3372 O O    . HOH B 2 .   ? 28.730 -3.938  62.909 1.00 39.24 ? 1649 HOH A O    1 
HETATM 3373 O O    . HOH B 2 .   ? 32.183 13.768  36.544 1.00 18.69 ? 1650 HOH A O    1 
HETATM 3374 O O    . HOH B 2 .   ? 32.286 17.317  38.479 1.00 33.27 ? 1651 HOH A O    1 
HETATM 3375 O O    . HOH B 2 .   ? 31.408 -10.425 25.064 1.00 31.23 ? 1652 HOH A O    1 
HETATM 3376 O O    . HOH B 2 .   ? 12.586 -1.677  46.234 1.00 55.19 ? 1653 HOH A O    1 
HETATM 3377 O O    . HOH B 2 .   ? 40.100 -0.216  24.364 1.00 19.33 ? 1654 HOH A O    1 
HETATM 3378 O O    . HOH B 2 .   ? 43.892 -5.757  49.768 1.00 31.80 ? 1655 HOH A O    1 
HETATM 3379 O O    . HOH B 2 .   ? 31.994 -12.765 50.978 1.00 46.27 ? 1656 HOH A O    1 
HETATM 3380 O O    . HOH B 2 .   ? 19.153 10.843  50.219 1.00 39.25 ? 1657 HOH A O    1 
HETATM 3381 O O    . HOH B 2 .   ? 55.251 15.299  46.407 1.00 40.95 ? 1658 HOH A O    1 
HETATM 3382 O O    . HOH B 2 .   ? 28.471 -4.918  21.565 1.00 24.43 ? 1659 HOH A O    1 
HETATM 3383 O O    . HOH B 2 .   ? 18.182 -5.823  26.341 1.00 26.84 ? 1660 HOH A O    1 
HETATM 3384 O O    . HOH B 2 .   ? 29.646 15.674  31.418 1.00 25.86 ? 1661 HOH A O    1 
HETATM 3385 O O    . HOH B 2 .   ? 45.055 -7.949  28.509 1.00 33.73 ? 1662 HOH A O    1 
HETATM 3386 O O    . HOH B 2 .   ? 30.522 -10.731 53.301 1.00 26.86 ? 1663 HOH A O    1 
HETATM 3387 O O    . HOH B 2 .   ? 37.417 -12.974 42.514 1.00 28.97 ? 1664 HOH A O    1 
HETATM 3388 O O    . HOH B 2 .   ? 29.705 4.936   24.142 1.00 32.00 ? 1665 HOH A O    1 
HETATM 3389 O O    . HOH B 2 .   ? 23.997 8.035   31.049 1.00 25.69 ? 1666 HOH A O    1 
HETATM 3390 O O    . HOH B 2 .   ? 28.070 -12.051 46.436 1.00 39.65 ? 1667 HOH A O    1 
HETATM 3391 O O    . HOH B 2 .   ? 40.437 17.420  28.771 1.00 36.34 ? 1668 HOH A O    1 
HETATM 3392 O O    . HOH B 2 .   ? 20.098 -10.582 49.594 1.00 36.90 ? 1669 HOH A O    1 
HETATM 3393 O O    . HOH B 2 .   ? 34.841 17.551  39.798 1.00 7.44  ? 1670 HOH A O    1 
HETATM 3394 O O    . HOH B 2 .   ? 44.952 -1.719  54.805 1.00 39.86 ? 1671 HOH A O    1 
HETATM 3395 O O    . HOH B 2 .   ? 42.490 15.595  28.681 1.00 37.35 ? 1672 HOH A O    1 
HETATM 3396 O O    . HOH B 2 .   ? 31.304 4.950   21.979 1.00 46.19 ? 1673 HOH A O    1 
HETATM 3397 O O    . HOH B 2 .   ? 29.655 -11.495 26.035 1.00 38.58 ? 1674 HOH A O    1 
HETATM 3398 O O    . HOH B 2 .   ? 42.650 -9.795  49.793 1.00 42.95 ? 1675 HOH A O    1 
HETATM 3399 O O    . HOH B 2 .   ? 30.444 9.361   55.606 1.00 36.73 ? 1676 HOH A O    1 
HETATM 3400 O O    . HOH B 2 .   ? 39.677 17.663  52.126 1.00 34.77 ? 1677 HOH A O    1 
HETATM 3401 O O    . HOH B 2 .   ? 28.489 2.415   61.544 1.00 42.06 ? 1678 HOH A O    1 
HETATM 3402 O O    . HOH B 2 .   ? 56.328 15.283  43.158 1.00 40.75 ? 1679 HOH A O    1 
HETATM 3403 O O    . HOH B 2 .   ? 24.800 -9.982  42.054 1.00 25.74 ? 1680 HOH A O    1 
HETATM 3404 O O    . HOH B 2 .   ? 23.044 19.137  48.993 1.00 31.85 ? 1681 HOH A O    1 
HETATM 3405 O O    . HOH B 2 .   ? 56.093 14.348  40.772 1.00 45.02 ? 1682 HOH A O    1 
HETATM 3406 O O    . HOH B 2 .   ? 26.177 -11.622 49.042 1.00 40.93 ? 1683 HOH A O    1 
HETATM 3407 O O    . HOH B 2 .   ? 26.643 18.657  54.210 1.00 29.90 ? 1684 HOH A O    1 
HETATM 3408 O O    . HOH B 2 .   ? 25.773 17.549  56.426 1.00 41.42 ? 1685 HOH A O    1 
HETATM 3409 O O    . HOH B 2 .   ? 52.102 -2.300  36.144 1.00 12.61 ? 1686 HOH A O    1 
HETATM 3410 O O    . HOH B 2 .   ? 14.524 1.972   38.293 1.00 27.72 ? 1687 HOH A O    1 
HETATM 3411 O O    . HOH B 2 .   ? 26.676 -8.421  22.121 1.00 35.93 ? 1688 HOH A O    1 
HETATM 3412 O O    . HOH B 2 .   ? 26.323 -9.456  57.011 1.00 42.06 ? 1689 HOH A O    1 
HETATM 3413 O O    . HOH B 2 .   ? 36.359 -8.402  22.389 1.00 40.69 ? 1690 HOH A O    1 
HETATM 3414 O O    . HOH B 2 .   ? 18.195 1.259   22.225 1.00 25.17 ? 1691 HOH A O    1 
HETATM 3415 O O    . HOH B 2 .   ? 32.586 -15.729 39.922 1.00 40.19 ? 1692 HOH A O    1 
HETATM 3416 O O    . HOH B 2 .   ? 39.349 4.354   25.763 1.00 42.60 ? 1693 HOH A O    1 
HETATM 3417 O O    . HOH B 2 .   ? 20.697 6.285   27.780 1.00 39.00 ? 1694 HOH A O    1 
HETATM 3418 O O    . HOH B 2 .   ? 31.026 20.606  50.524 1.00 45.73 ? 1695 HOH A O    1 
HETATM 3419 O O    . HOH B 2 .   ? 38.558 3.680   56.687 1.00 42.00 ? 1696 HOH A O    1 
HETATM 3420 O O    . HOH B 2 .   ? 35.948 -12.120 48.553 1.00 42.96 ? 1697 HOH A O    1 
HETATM 3421 O O    . HOH B 2 .   ? 35.319 -8.658  18.365 1.00 42.86 ? 1698 HOH A O    1 
HETATM 3422 O O    . HOH B 2 .   ? 14.858 6.709   45.674 1.00 27.79 ? 1699 HOH A O    1 
HETATM 3423 O O    . HOH B 2 .   ? 18.235 11.738  46.802 1.00 44.08 ? 1700 HOH A O    1 
HETATM 3424 O O    . HOH B 2 .   ? 45.095 -4.367  54.216 1.00 47.18 ? 1701 HOH A O    1 
HETATM 3425 O O    . HOH B 2 .   ? 26.910 -5.271  61.260 1.00 23.64 ? 1702 HOH A O    1 
HETATM 3426 O O    . HOH B 2 .   ? 15.517 0.350   46.021 1.00 28.31 ? 1703 HOH A O    1 
HETATM 3427 O O    . HOH B 2 .   ? 32.236 -2.877  19.362 1.00 28.77 ? 1704 HOH A O    1 
HETATM 3428 O O    . HOH B 2 .   ? 34.664 -5.965  16.403 1.00 41.95 ? 1705 HOH A O    1 
HETATM 3429 O O    . HOH B 2 .   ? 17.705 2.063   31.433 1.00 21.96 ? 1706 HOH A O    1 
HETATM 3430 O O    . HOH B 2 .   ? 21.498 -5.468  22.959 1.00 32.44 ? 1707 HOH A O    1 
HETATM 3431 O O    . HOH B 2 .   ? 26.715 3.938   21.177 1.00 40.67 ? 1708 HOH A O    1 
HETATM 3432 O O    . HOH B 2 .   ? 53.623 13.237  39.236 1.00 33.93 ? 1709 HOH A O    1 
HETATM 3433 O O    . HOH B 2 .   ? 20.774 -5.467  20.285 1.00 33.55 ? 1710 HOH A O    1 
HETATM 3434 O O    . HOH B 2 .   ? 14.153 -10.475 30.780 1.00 36.17 ? 1711 HOH A O    1 
HETATM 3435 O O    . HOH B 2 .   ? 30.738 -9.021  22.663 1.00 39.70 ? 1712 HOH A O    1 
HETATM 3436 O O    . HOH B 2 .   ? 46.164 -5.618  49.017 1.00 45.02 ? 1713 HOH A O    1 
HETATM 3437 O O    . HOH B 2 .   ? 33.059 6.141   56.344 1.00 42.20 ? 1714 HOH A O    1 
HETATM 3438 O O    . HOH B 2 .   ? 17.508 8.625   37.138 1.00 46.65 ? 1715 HOH A O    1 
HETATM 3439 O O    . HOH B 2 .   ? 26.828 9.073   22.236 1.00 42.48 ? 1716 HOH A O    1 
HETATM 3440 O O    . HOH B 2 .   ? 53.559 13.604  34.488 1.00 36.31 ? 1717 HOH A O    1 
HETATM 3441 O O    . HOH B 2 .   ? 17.146 11.152  36.128 1.00 45.49 ? 1718 HOH A O    1 
HETATM 3442 O O    . HOH B 2 .   ? 29.964 11.530  55.969 1.00 44.06 ? 1719 HOH A O    1 
HETATM 3443 O O    . HOH B 2 .   ? 36.230 16.782  29.614 1.00 38.34 ? 1720 HOH A O    1 
HETATM 3444 O O    . HOH B 2 .   ? 37.218 -0.628  60.522 1.00 40.49 ? 1721 HOH A O    1 
HETATM 3445 O O    . HOH B 2 .   ? 11.748 -7.235  27.938 1.00 49.03 ? 1722 HOH A O    1 
HETATM 3446 O O    . HOH B 2 .   ? 32.990 -3.933  16.915 1.00 43.26 ? 1723 HOH A O    1 
HETATM 3447 O O    . HOH B 2 .   ? 26.386 -12.757 39.667 1.00 31.37 ? 1724 HOH A O    1 
HETATM 3448 O O    . HOH B 2 .   ? 37.116 3.945   23.675 1.00 27.44 ? 1725 HOH A O    1 
HETATM 3449 O O    . HOH B 2 .   ? 28.192 5.219   19.279 1.00 45.34 ? 1726 HOH A O    1 
HETATM 3450 O O    . HOH B 2 .   ? 49.984 -0.997  51.560 1.00 36.13 ? 1727 HOH A O    1 
HETATM 3451 O O    . HOH B 2 .   ? 29.995 0.366   60.748 1.00 36.52 ? 1728 HOH A O    1 
HETATM 3452 O O    . HOH B 2 .   ? 16.314 2.683   47.468 1.00 39.68 ? 1729 HOH A O    1 
HETATM 3453 O O    . HOH B 2 .   ? 19.658 15.495  49.359 1.00 41.45 ? 1730 HOH A O    1 
HETATM 3454 O O    . HOH B 2 .   ? 33.962 17.881  29.923 1.00 45.18 ? 1731 HOH A O    1 
HETATM 3455 O O    . HOH B 2 .   ? 24.466 -12.890 45.107 1.00 44.49 ? 1732 HOH A O    1 
HETATM 3456 O O    . HOH B 2 .   ? 41.530 6.443   57.789 1.00 47.65 ? 1733 HOH A O    1 
HETATM 3457 O O    . HOH B 2 .   ? 27.772 -9.920  20.803 1.00 46.63 ? 1734 HOH A O    1 
HETATM 3458 O O    . HOH B 2 .   ? 29.971 -14.023 45.664 1.00 46.67 ? 1735 HOH A O    1 
HETATM 3459 O O    . HOH B 2 .   ? 46.586 11.639  45.790 1.00 33.51 ? 1736 HOH A O    1 
HETATM 3460 O O    . HOH B 2 .   ? 40.535 4.924   60.128 1.00 38.68 ? 1737 HOH A O    1 
HETATM 3461 O O    . HOH B 2 .   ? 11.231 -7.530  42.554 1.00 41.16 ? 1738 HOH A O    1 
HETATM 3462 O O    . HOH B 2 .   ? 44.587 -7.376  51.970 1.00 42.24 ? 1739 HOH A O    1 
HETATM 3463 O O    . HOH B 2 .   ? 21.543 -12.215 51.017 1.00 44.62 ? 1740 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 3   ? 0.1771 0.3037 0.1106 -0.0191 -0.0410 0.0464  1024 GLU A N   
2    C CA  . GLU A 3   ? 0.1329 0.3027 0.0916 0.0034  -0.0254 0.0197  1024 GLU A CA  
3    C C   . GLU A 3   ? 0.1161 0.2346 0.1197 0.0255  0.0130  0.0483  1024 GLU A C   
4    O O   . GLU A 3   ? 0.1284 0.2016 0.1132 0.0199  0.0182  0.0546  1024 GLU A O   
5    C CB  . GLU A 3   ? 0.2054 0.3547 0.1359 -0.0475 -0.0031 -0.0129 1024 GLU A CB  
6    C CG  . GLU A 3   ? 0.3464 0.4446 0.1600 -0.0303 -0.0558 -0.0566 1024 GLU A CG  
7    C CD  . GLU A 3   ? 0.5890 0.5614 0.2930 -0.0424 -0.0025 -0.1047 1024 GLU A CD  
8    O OE1 . GLU A 3   ? 0.6720 0.5868 0.3194 -0.0447 0.0605  -0.1139 1024 GLU A OE1 
9    O OE2 . GLU A 3   ? 0.6973 0.6201 0.4189 -0.0431 0.1306  -0.1471 1024 GLU A OE2 
15   N N   . LYS A 4   ? 0.1087 0.1843 0.0869 0.0052  0.0008  0.0433  1025 LYS A N   
16   C CA  . LYS A 4   ? 0.1011 0.1444 0.0867 0.0075  -0.0070 -0.0071 1025 LYS A CA  
17   C C   . LYS A 4   ? 0.0897 0.1079 0.0614 0.0070  -0.0025 0.0020  1025 LYS A C   
18   O O   . LYS A 4   ? 0.0780 0.1272 0.0945 -0.0056 0.0023  0.0035  1025 LYS A O   
19   C CB  . LYS A 4   ? 0.1769 0.1572 0.1323 0.0186  0.0123  0.0067  1025 LYS A CB  
20   C CG  . LYS A 4   ? 0.2614 0.1800 0.1449 0.0768  -0.0612 0.0046  1025 LYS A CG  
21   C CD  . LYS A 4   ? 0.2956 0.1911 0.2566 0.0647  -0.0759 -0.0396 1025 LYS A CD  
22   C CE  . LYS A 4   ? 0.3683 0.2401 0.2551 0.0311  -0.0490 -0.0257 1025 LYS A CE  
23   N NZ  . LYS A 4   ? 0.3791 0.2252 0.2246 -0.0132 -0.0775 0.0034  1025 LYS A NZ  
37   N N   . ASP A 5   ? 0.0848 0.0991 0.0766 -0.0018 0.0128  0.0018  1026 ASP A N   
38   C CA  . ASP A 5   ? 0.0911 0.0864 0.0569 -0.0226 -0.0036 -0.0082 1026 ASP A CA  
39   C C   . ASP A 5   ? 0.0636 0.0911 0.1000 -0.0322 0.0054  -0.0005 1026 ASP A C   
40   O O   . ASP A 5   ? 0.0981 0.1264 0.1084 -0.0435 0.0303  -0.0269 1026 ASP A O   
41   C CB  . ASP A 5   ? 0.0683 0.0903 0.0806 0.0102  0.0049  -0.0047 1026 ASP A CB  
42   C CG  . ASP A 5   ? 0.0818 0.1043 0.0811 -0.0104 0.0005  0.0053  1026 ASP A CG  
43   O OD1 . ASP A 5   ? 0.0805 0.1115 0.0972 0.0132  0.0095  -0.0234 1026 ASP A OD1 
44   O OD2 . ASP A 5   ? 0.0880 0.1081 0.0902 0.0002  0.0066  -0.0174 1026 ASP A OD2 
49   N N   . VAL A 6   ? 0.0749 0.0822 0.0660 -0.0167 0.0029  -0.0055 1027 VAL A N   
50   C CA  . VAL A 6   ? 0.0859 0.0753 0.0652 -0.0208 0.0062  -0.0043 1027 VAL A CA  
51   C C   . VAL A 6   ? 0.0668 0.0657 0.0588 -0.0061 0.0108  0.0003  1027 VAL A C   
52   O O   . VAL A 6   ? 0.0820 0.0831 0.0841 -0.0212 -0.0086 0.0124  1027 VAL A O   
53   C CB  . VAL A 6   ? 0.0934 0.0838 0.0883 -0.0057 0.0006  -0.0102 1027 VAL A CB  
54   C CG1 . VAL A 6   ? 0.1240 0.0893 0.0912 0.0200  0.0129  -0.0006 1027 VAL A CG1 
55   C CG2 . VAL A 6   ? 0.0882 0.0898 0.0869 0.0078  -0.0159 0.0059  1027 VAL A CG2 
65   N N   . VAL A 7   ? 0.0733 0.0724 0.0670 -0.0114 0.0013  0.0060  1028 VAL A N   
66   C CA  . VAL A 7   ? 0.0740 0.0465 0.0821 -0.0020 0.0042  0.0065  1028 VAL A CA  
67   C C   . VAL A 7   ? 0.0707 0.0423 0.0634 0.0002  -0.0069 0.0052  1028 VAL A C   
68   O O   . VAL A 7   ? 0.0838 0.0605 0.0798 -0.0141 0.0121  -0.0039 1028 VAL A O   
69   C CB  . VAL A 7   ? 0.0865 0.0638 0.0945 0.0048  0.0187  -0.0121 1028 VAL A CB  
70   C CG1 . VAL A 7   ? 0.0735 0.0722 0.1255 0.0216  -0.0092 0.0079  1028 VAL A CG1 
71   C CG2 . VAL A 7   ? 0.1136 0.0754 0.1288 -0.0078 0.0484  -0.0197 1028 VAL A CG2 
81   N N   . PHE A 8   ? 0.0537 0.0482 0.0689 -0.0086 -0.0050 0.0102  1029 PHE A N   
82   C CA  . PHE A 8   ? 0.0687 0.0522 0.0704 0.0009  -0.0094 0.0006  1029 PHE A CA  
83   C C   . PHE A 8   ? 0.0676 0.0621 0.0601 0.0052  0.0008  -0.0028 1029 PHE A C   
84   O O   . PHE A 8   ? 0.1030 0.0588 0.0931 -0.0150 -0.0218 0.0081  1029 PHE A O   
85   C CB  . PHE A 8   ? 0.0693 0.0537 0.0710 0.0069  0.0073  0.0074  1029 PHE A CB  
86   C CG  . PHE A 8   ? 0.0525 0.0687 0.0934 -0.0006 0.0241  0.0053  1029 PHE A CG  
87   C CD1 . PHE A 8   ? 0.0550 0.0844 0.0882 -0.0076 0.0078  0.0031  1029 PHE A CD1 
88   C CD2 . PHE A 8   ? 0.0632 0.0740 0.0936 -0.0008 0.0046  0.0077  1029 PHE A CD2 
89   C CE1 . PHE A 8   ? 0.0616 0.1056 0.0998 0.0214  -0.0070 -0.0001 1029 PHE A CE1 
90   C CE2 . PHE A 8   ? 0.0849 0.0713 0.1296 0.0020  0.0012  0.0018  1029 PHE A CE2 
91   C CZ  . PHE A 8   ? 0.0753 0.0818 0.1259 0.0033  0.0111  0.0215  1029 PHE A CZ  
101  N N   . LEU A 9   ? 0.0627 0.0553 0.0713 -0.0051 -0.0131 0.0067  1030 LEU A N   
102  C CA  . LEU A 9   ? 0.0836 0.0629 0.0421 -0.0144 0.0098  -0.0005 1030 LEU A CA  
103  C C   . LEU A 9   ? 0.0829 0.0576 0.0702 -0.0065 0.0020  0.0178  1030 LEU A C   
104  O O   . LEU A 9   ? 0.0882 0.0605 0.0715 -0.0065 0.0008  0.0017  1030 LEU A O   
105  C CB  . LEU A 9   ? 0.0717 0.0876 0.0624 -0.0007 -0.0022 0.0049  1030 LEU A CB  
106  C CG  . LEU A 9   ? 0.0794 0.0755 0.0874 -0.0132 -0.0039 -0.0005 1030 LEU A CG  
107  C CD1 . LEU A 9   ? 0.0528 0.0853 0.0970 0.0037  -0.0116 -0.0010 1030 LEU A CD1 
108  C CD2 . LEU A 9   ? 0.0761 0.0934 0.1045 -0.0021 -0.0059 -0.0002 1030 LEU A CD2 
120  N N   A ILE A 10  ? 0.1052 0.0599 0.0682 -0.0226 0.0410  0.0010  1031 ILE A N   
121  N N   B ILE A 10  ? 0.0863 0.0564 0.0587 0.0304  -0.0253 -0.0157 1031 ILE A N   
122  C CA  A ILE A 10  ? 0.1422 0.1081 0.0813 -0.0283 0.0287  0.0050  1031 ILE A CA  
123  C CA  B ILE A 10  ? 0.1008 0.0854 0.0785 0.0191  0.0099  0.0093  1031 ILE A CA  
124  C C   A ILE A 10  ? 0.0970 0.1036 0.0715 -0.0277 -0.0144 0.0017  1031 ILE A C   
125  C C   B ILE A 10  ? 0.0985 0.0778 0.0391 0.0197  0.0190  0.0187  1031 ILE A C   
126  O O   A ILE A 10  ? 0.0979 0.0965 0.0674 -0.0105 -0.0420 0.0237  1031 ILE A O   
127  O O   B ILE A 10  ? 0.1372 0.0534 0.0826 -0.0070 0.0472  -0.0003 1031 ILE A O   
128  C CB  A ILE A 10  ? 0.1336 0.1871 0.0815 0.0146  -0.0271 -0.0171 1031 ILE A CB  
129  C CB  B ILE A 10  ? 0.1015 0.1472 0.1211 0.0266  0.0469  -0.0172 1031 ILE A CB  
130  C CG1 A ILE A 10  ? 0.1294 0.1471 0.0775 0.0422  0.0081  -0.0341 1031 ILE A CG1 
131  C CG1 B ILE A 10  ? 0.1125 0.1278 0.2013 0.0378  0.0537  -0.0241 1031 ILE A CG1 
132  C CG2 A ILE A 10  ? 0.1236 0.2520 0.1827 0.0076  -0.0532 -0.0181 1031 ILE A CG2 
133  C CG2 B ILE A 10  ? 0.1263 0.1934 0.1156 0.0048  0.0521  -0.0029 1031 ILE A CG2 
134  C CD1 A ILE A 10  ? 0.1637 0.1280 0.0852 0.0237  0.0292  0.0104  1031 ILE A CD1 
135  C CD1 B ILE A 10  ? 0.1203 0.1253 0.1442 0.0197  -0.0247 -0.0283 1031 ILE A CD1 
158  N N   . ASP A 11  ? 0.1228 0.0833 0.0743 -0.0249 0.0035  -0.0019 1032 ASP A N   
159  C CA  . ASP A 11  ? 0.1180 0.0948 0.0730 -0.0272 -0.0039 0.0144  1032 ASP A CA  
160  C C   . ASP A 11  ? 0.1529 0.1025 0.0847 0.0027  0.0019  0.0036  1032 ASP A C   
161  O O   . ASP A 11  ? 0.1730 0.0938 0.0814 -0.0045 0.0413  0.0091  1032 ASP A O   
162  C CB  . ASP A 11  ? 0.1812 0.1017 0.0822 -0.0402 0.0153  0.0040  1032 ASP A CB  
163  C CG  . ASP A 11  ? 0.1654 0.0872 0.1231 -0.0487 -0.0103 0.0121  1032 ASP A CG  
164  O OD1 . ASP A 11  ? 0.1793 0.1009 0.0899 -0.0420 -0.0224 0.0149  1032 ASP A OD1 
165  O OD2 . ASP A 11  ? 0.1782 0.1023 0.0942 -0.0629 0.0064  0.0098  1032 ASP A OD2 
170  N N   . GLY A 12  ? 0.1248 0.0824 0.0741 -0.0183 -0.0157 0.0166  1033 GLY A N   
171  C CA  . GLY A 12  ? 0.1191 0.1077 0.0934 -0.0274 -0.0131 0.0223  1033 GLY A CA  
172  C C   . GLY A 12  ? 0.1147 0.0847 0.1078 -0.0278 -0.0282 0.0165  1033 GLY A C   
173  O O   . GLY A 12  ? 0.1426 0.1003 0.1072 -0.0346 -0.0152 0.0369  1033 GLY A O   
177  N N   . SER A 13  ? 0.1399 0.1222 0.0961 -0.0282 -0.0105 0.0295  1034 SER A N   
178  C CA  . SER A 13  ? 0.1192 0.1336 0.0861 -0.0328 -0.0237 0.0299  1034 SER A CA  
179  C C   . SER A 13  ? 0.1596 0.1770 0.0918 -0.0420 -0.0367 0.0161  1034 SER A C   
180  O O   . SER A 13  ? 0.1496 0.1648 0.0891 -0.0272 -0.0230 0.0097  1034 SER A O   
181  C CB  . SER A 13  ? 0.1391 0.1406 0.1122 -0.0389 -0.0436 0.0288  1034 SER A CB  
182  O OG  . SER A 13  ? 0.1952 0.1353 0.1298 -0.0577 -0.0429 0.0148  1034 SER A OG  
188  N N   . GLU A 14  ? 0.1785 0.2328 0.0753 0.0004  -0.0327 0.0163  1035 GLU A N   
189  C CA  . GLU A 14  ? 0.1735 0.2800 0.0764 -0.0045 -0.0113 -0.0035 1035 GLU A CA  
190  C C   . GLU A 14  ? 0.1740 0.2696 0.0793 -0.0231 -0.0123 -0.0322 1035 GLU A C   
191  O O   . GLU A 14  ? 0.1994 0.3034 0.1053 -0.0195 0.0274  -0.0279 1035 GLU A O   
192  C CB  . GLU A 14  ? 0.1868 0.3246 0.1124 0.0071  -0.0388 0.0000  1035 GLU A CB  
193  C CG  . GLU A 14  ? 0.1673 0.3653 0.1631 0.0306  -0.0425 0.0236  1035 GLU A CG  
194  C CD  . GLU A 14  ? 0.2162 0.3859 0.1519 0.0303  -0.0069 0.0259  1035 GLU A CD  
195  O OE1 . GLU A 14  ? 0.2096 0.3884 0.2004 -0.0364 0.0525  0.0814  1035 GLU A OE1 
196  O OE2 . GLU A 14  ? 0.2601 0.3971 0.1514 0.0066  0.0089  -0.0269 1035 GLU A OE2 
203  N N   . GLY A 15  ? 0.1699 0.2507 0.1848 -0.0423 -0.0405 -0.0304 1036 GLY A N   
204  C CA  . GLY A 15  ? 0.2260 0.2511 0.2148 -0.0420 -0.0422 -0.0214 1036 GLY A CA  
205  C C   . GLY A 15  ? 0.2149 0.1866 0.1926 -0.0511 -0.0195 -0.0514 1036 GLY A C   
206  O O   . GLY A 15  ? 0.2917 0.1622 0.2976 -0.0338 -0.0145 -0.0748 1036 GLY A O   
210  N N   A VAL A 16  ? 0.1574 0.1597 0.1482 -0.0435 0.0038  -0.0189 1037 VAL A N   
211  N N   B VAL A 16  ? 0.2095 0.1804 0.1758 -0.0623 0.0024  -0.0418 1037 VAL A N   
212  C CA  A VAL A 16  ? 0.1561 0.1574 0.1480 -0.0334 0.0132  0.0141  1037 VAL A CA  
213  C CA  B VAL A 16  ? 0.1802 0.1805 0.1660 -0.0592 0.0027  -0.0036 1037 VAL A CA  
214  C C   A VAL A 16  ? 0.1664 0.1595 0.1108 -0.0344 0.0020  0.0260  1037 VAL A C   
215  C C   B VAL A 16  ? 0.1585 0.1674 0.1527 -0.0419 -0.0075 0.0137  1037 VAL A C   
216  O O   A VAL A 16  ? 0.1202 0.1912 0.1162 -0.0359 -0.0034 0.0236  1037 VAL A O   
217  O O   B VAL A 16  ? 0.1540 0.1668 0.1575 -0.0308 -0.0269 0.0265  1037 VAL A O   
218  C CB  A VAL A 16  ? 0.1518 0.1980 0.1401 -0.0557 0.0224  0.0044  1037 VAL A CB  
219  C CB  B VAL A 16  ? 0.1660 0.2030 0.1710 -0.0713 0.0215  0.0171  1037 VAL A CB  
220  C CG1 A VAL A 16  ? 0.2583 0.1936 0.1827 -0.0634 0.1193  -0.0507 1037 VAL A CG1 
221  C CG1 B VAL A 16  ? 0.1342 0.1707 0.1308 -0.0564 0.0406  0.0386  1037 VAL A CG1 
222  C CG2 A VAL A 16  ? 0.1671 0.1837 0.1857 -0.0713 0.0708  -0.0227 1037 VAL A CG2 
223  C CG2 B VAL A 16  ? 0.1893 0.2412 0.2508 -0.0735 0.0799  0.0247  1037 VAL A CG2 
242  N N   . ARG A 17  ? 0.1349 0.1612 0.1227 -0.0330 -0.0109 0.0204  1038 ARG A N   
243  C CA  . ARG A 17  ? 0.1770 0.1710 0.1309 -0.0108 -0.0037 0.0242  1038 ARG A CA  
244  C C   . ARG A 17  ? 0.2205 0.1665 0.0743 -0.0397 0.0286  -0.0005 1038 ARG A C   
245  O O   . ARG A 17  ? 0.1658 0.1945 0.1104 -0.0399 0.0065  0.0121  1038 ARG A O   
246  C CB  . ARG A 17  ? 0.1425 0.1905 0.1636 -0.0085 0.0003  0.0570  1038 ARG A CB  
247  C CG  . ARG A 17  ? 0.1668 0.2594 0.1681 -0.0138 0.0094  0.1005  1038 ARG A CG  
248  C CD  . ARG A 17  ? 0.2174 0.3056 0.2527 0.0106  0.0416  0.0952  1038 ARG A CD  
249  N NE  . ARG A 17  ? 0.1737 0.3227 0.2512 0.0215  -0.0204 0.0177  1038 ARG A NE  
250  C CZ  . ARG A 17  ? 0.1419 0.2816 0.3178 -0.0179 -0.0097 -0.0210 1038 ARG A CZ  
251  N NH1 . ARG A 17  ? 0.1826 0.2265 0.2529 0.0017  0.0862  -0.0102 1038 ARG A NH1 
252  N NH2 . ARG A 17  ? 0.1899 0.3120 0.3030 -0.0294 0.0289  0.0000  1038 ARG A NH2 
266  N N   . SER A 18  ? 0.2155 0.1858 0.0955 -0.0152 0.0301  0.0022  1039 SER A N   
267  C CA  . SER A 18  ? 0.2595 0.2245 0.1181 0.0328  0.0059  -0.0499 1039 SER A CA  
268  C C   . SER A 18  ? 0.2520 0.2193 0.1096 0.0639  0.0387  -0.0283 1039 SER A C   
269  O O   . SER A 18  ? 0.2666 0.2974 0.2106 0.1152  0.0776  0.0115  1039 SER A O   
270  C CB  . SER A 18  ? 0.3408 0.2861 0.2587 0.0547  0.0073  -0.1038 1039 SER A CB  
271  O OG  . SER A 18  ? 0.4284 0.3467 0.2891 0.0328  -0.0463 -0.1804 1039 SER A OG  
277  N N   . GLY A 19  ? 0.1926 0.1858 0.0861 0.0272  0.0021  -0.0316 1040 GLY A N   
278  C CA  . GLY A 19  ? 0.2250 0.1284 0.1129 0.0095  -0.0312 -0.0394 1040 GLY A CA  
279  C C   . GLY A 19  ? 0.1580 0.1168 0.1061 0.0096  0.0098  0.0287  1040 GLY A C   
280  O O   . GLY A 19  ? 0.1585 0.1051 0.1217 -0.0186 -0.0227 0.0164  1040 GLY A O   
284  N N   . PHE A 20  ? 0.1796 0.1121 0.0833 0.0032  -0.0046 0.0032  1041 PHE A N   
285  C CA  . PHE A 20  ? 0.1426 0.1123 0.0935 -0.0189 -0.0101 0.0079  1041 PHE A CA  
286  C C   . PHE A 20  ? 0.1389 0.0991 0.1110 -0.0160 0.0302  -0.0058 1041 PHE A C   
287  O O   . PHE A 20  ? 0.1507 0.1098 0.0989 -0.0225 0.0003  0.0002  1041 PHE A O   
288  C CB  . PHE A 20  ? 0.1730 0.1083 0.1028 0.0074  0.0001  0.0104  1041 PHE A CB  
289  C CG  . PHE A 20  ? 0.2038 0.1030 0.0907 -0.0031 0.0059  0.0012  1041 PHE A CG  
290  C CD1 . PHE A 20  ? 0.1930 0.1503 0.0968 -0.0186 -0.0052 -0.0365 1041 PHE A CD1 
291  C CD2 . PHE A 20  ? 0.1916 0.1053 0.1224 -0.0086 -0.0325 0.0024  1041 PHE A CD2 
292  C CE1 . PHE A 20  ? 0.1891 0.1658 0.1542 -0.0156 0.0403  -0.0172 1041 PHE A CE1 
293  C CE2 . PHE A 20  ? 0.1697 0.1064 0.1401 0.0035  -0.0235 -0.0075 1041 PHE A CE2 
294  C CZ  . PHE A 20  ? 0.1703 0.1325 0.1464 0.0164  -0.0282 -0.0090 1041 PHE A CZ  
304  N N   . PRO A 21  ? 0.1586 0.1204 0.0979 -0.0188 0.0142  0.0259  1042 PRO A N   
305  C CA  . PRO A 21  ? 0.1235 0.1516 0.1340 -0.0208 0.0292  0.0166  1042 PRO A CA  
306  C C   . PRO A 21  ? 0.1399 0.1375 0.1137 -0.0226 0.0221  0.0088  1042 PRO A C   
307  O O   . PRO A 21  ? 0.1197 0.1395 0.1443 -0.0217 -0.0056 0.0071  1042 PRO A O   
308  C CB  . PRO A 21  ? 0.1814 0.2184 0.1764 -0.0285 0.0605  0.0544  1042 PRO A CB  
309  C CG  . PRO A 21  ? 0.2737 0.2425 0.1861 -0.0236 0.1047  0.0527  1042 PRO A CG  
310  C CD  . PRO A 21  ? 0.1998 0.1654 0.1152 -0.0337 0.0166  0.0462  1042 PRO A CD  
318  N N   . LEU A 22  ? 0.1326 0.1148 0.1461 -0.0278 -0.0095 0.0106  1043 LEU A N   
319  C CA  . LEU A 22  ? 0.1409 0.1052 0.1531 -0.0298 0.0083  0.0079  1043 LEU A CA  
320  C C   . LEU A 22  ? 0.1382 0.1017 0.1258 -0.0415 -0.0245 -0.0043 1043 LEU A C   
321  O O   . LEU A 22  ? 0.1691 0.0972 0.1258 -0.0093 -0.0283 0.0020  1043 LEU A O   
322  C CB  . LEU A 22  ? 0.1675 0.1109 0.1319 -0.0182 0.0079  -0.0063 1043 LEU A CB  
323  C CG  . LEU A 22  ? 0.1941 0.1370 0.2879 0.0039  0.0604  -0.0413 1043 LEU A CG  
324  C CD1 . LEU A 22  ? 0.2019 0.1946 0.2384 -0.0099 0.1044  -0.0788 1043 LEU A CD1 
325  C CD2 . LEU A 22  ? 0.2511 0.1636 0.4206 0.0128  0.0482  -0.0611 1043 LEU A CD2 
337  N N   . LEU A 23  ? 0.1182 0.1084 0.1027 -0.0339 0.0010  0.0062  1044 LEU A N   
338  C CA  . LEU A 23  ? 0.1100 0.1248 0.1172 -0.0455 -0.0230 0.0228  1044 LEU A CA  
339  C C   . LEU A 23  ? 0.1027 0.1196 0.1138 -0.0359 -0.0078 0.0317  1044 LEU A C   
340  O O   . LEU A 23  ? 0.1153 0.1284 0.1028 -0.0329 0.0005  0.0269  1044 LEU A O   
341  C CB  . LEU A 23  ? 0.1365 0.2300 0.1634 -0.0567 -0.0558 0.0074  1044 LEU A CB  
342  C CG  . LEU A 23  ? 0.2262 0.3479 0.3634 0.0490  -0.0135 0.0582  1044 LEU A CG  
343  C CD1 . LEU A 23  ? 0.3281 0.3987 0.5196 0.0628  0.0231  0.0413  1044 LEU A CD1 
344  C CD2 . LEU A 23  ? 0.2955 0.4058 0.4789 0.0627  0.0846  0.0844  1044 LEU A CD2 
356  N N   . LYS A 24  ? 0.0943 0.1194 0.0971 -0.0215 -0.0030 -0.0002 1045 LYS A N   
357  C CA  . LYS A 24  ? 0.1049 0.1092 0.0944 -0.0186 -0.0140 0.0045  1045 LYS A CA  
358  C C   . LYS A 24  ? 0.1040 0.0930 0.1166 -0.0019 0.0156  0.0171  1045 LYS A C   
359  O O   . LYS A 24  ? 0.1188 0.1037 0.1140 -0.0186 -0.0140 -0.0085 1045 LYS A O   
360  C CB  . LYS A 24  ? 0.1035 0.1112 0.1048 -0.0280 -0.0125 -0.0029 1045 LYS A CB  
361  C CG  . LYS A 24  ? 0.1385 0.1089 0.1228 -0.0107 -0.0363 0.0075  1045 LYS A CG  
362  C CD  . LYS A 24  ? 0.1452 0.1008 0.1455 -0.0279 -0.0384 0.0152  1045 LYS A CD  
363  C CE  . LYS A 24  ? 0.1501 0.1291 0.1350 0.0093  0.0074  0.0169  1045 LYS A CE  
364  N NZ  . LYS A 24  ? 0.1468 0.1255 0.1061 -0.0192 0.0029  0.0120  1045 LYS A NZ  
378  N N   . ASP A 25  ? 0.0929 0.1114 0.1084 0.0074  0.0084  -0.0016 1046 ASP A N   
379  C CA  . ASP A 25  ? 0.0980 0.1197 0.1312 -0.0292 0.0253  -0.0064 1046 ASP A CA  
380  C C   . ASP A 25  ? 0.0801 0.1082 0.1174 -0.0100 -0.0013 -0.0174 1046 ASP A C   
381  O O   . ASP A 25  ? 0.0917 0.1049 0.0998 -0.0034 0.0014  -0.0103 1046 ASP A O   
382  C CB  . ASP A 25  ? 0.0978 0.1601 0.1272 0.0082  0.0473  0.0174  1046 ASP A CB  
383  C CG  . ASP A 25  ? 0.2251 0.2091 0.2579 -0.0093 0.0837  -0.0052 1046 ASP A CG  
384  O OD1 . ASP A 25  ? 0.2275 0.2096 0.4171 -0.0039 -0.0620 0.0363  1046 ASP A OD1 
385  O OD2 . ASP A 25  ? 0.2611 0.2414 0.2862 0.0164  0.0953  0.0064  1046 ASP A OD2 
390  N N   . PHE A 26  ? 0.1120 0.0970 0.1045 -0.0248 0.0033  0.0034  1047 PHE A N   
391  C CA  . PHE A 26  ? 0.1302 0.0879 0.0998 -0.0070 -0.0209 -0.0066 1047 PHE A CA  
392  C C   . PHE A 26  ? 0.1212 0.0823 0.0964 0.0079  -0.0238 0.0011  1047 PHE A C   
393  O O   . PHE A 26  ? 0.0960 0.0833 0.1067 -0.0073 -0.0080 -0.0007 1047 PHE A O   
394  C CB  . PHE A 26  ? 0.1104 0.0983 0.1101 -0.0292 -0.0265 -0.0154 1047 PHE A CB  
395  C CG  . PHE A 26  ? 0.1094 0.0950 0.1225 -0.0301 -0.0155 -0.0101 1047 PHE A CG  
396  C CD1 . PHE A 26  ? 0.2015 0.0908 0.1715 -0.0282 -0.0105 0.0213  1047 PHE A CD1 
397  C CD2 . PHE A 26  ? 0.1094 0.1326 0.0925 -0.0130 -0.0253 -0.0072 1047 PHE A CD2 
398  C CE1 . PHE A 26  ? 0.2546 0.1130 0.1617 -0.0594 -0.0377 0.0335  1047 PHE A CE1 
399  C CE2 . PHE A 26  ? 0.1314 0.1847 0.1407 -0.0516 -0.0116 0.0093  1047 PHE A CE2 
400  C CZ  . PHE A 26  ? 0.1743 0.1752 0.1484 -0.0664 -0.0297 0.0242  1047 PHE A CZ  
410  N N   . VAL A 27  ? 0.0918 0.0874 0.0896 -0.0153 -0.0118 0.0009  1048 VAL A N   
411  C CA  . VAL A 27  ? 0.0862 0.0904 0.0976 -0.0140 0.0069  0.0118  1048 VAL A CA  
412  C C   . VAL A 27  ? 0.0760 0.0749 0.0914 -0.0039 -0.0057 0.0014  1048 VAL A C   
413  O O   . VAL A 27  ? 0.0819 0.0826 0.0924 -0.0029 -0.0050 -0.0069 1048 VAL A O   
414  C CB  . VAL A 27  ? 0.0593 0.1045 0.1183 0.0046  -0.0090 0.0255  1048 VAL A CB  
415  C CG1 . VAL A 27  ? 0.0705 0.1065 0.1049 0.0161  0.0068  0.0081  1048 VAL A CG1 
416  C CG2 . VAL A 27  ? 0.1052 0.1268 0.1100 -0.0061 0.0022  0.0132  1048 VAL A CG2 
426  N N   . GLN A 28  ? 0.0851 0.0941 0.0798 -0.0026 0.0068  -0.0058 1049 GLN A N   
427  C CA  . GLN A 28  ? 0.0588 0.0905 0.0975 -0.0124 -0.0107 -0.0049 1049 GLN A CA  
428  C C   . GLN A 28  ? 0.0700 0.0968 0.1045 -0.0096 0.0145  -0.0205 1049 GLN A C   
429  O O   . GLN A 28  ? 0.0772 0.1340 0.0894 -0.0046 -0.0082 -0.0197 1049 GLN A O   
430  C CB  . GLN A 28  ? 0.0927 0.0981 0.1080 -0.0210 -0.0019 -0.0245 1049 GLN A CB  
431  C CG  . GLN A 28  ? 0.1039 0.1116 0.1155 -0.0265 0.0032  -0.0146 1049 GLN A CG  
432  C CD  . GLN A 28  ? 0.1255 0.1526 0.1562 -0.0459 -0.0047 -0.0054 1049 GLN A CD  
433  O OE1 . GLN A 28  ? 0.1027 0.1475 0.1625 -0.0281 0.0078  0.0071  1049 GLN A OE1 
434  N NE2 . GLN A 28  ? 0.2032 0.1985 0.1397 -0.0916 -0.0088 -0.0058 1049 GLN A NE2 
443  N N   . ARG A 29  ? 0.0833 0.0973 0.1129 0.0069  -0.0134 -0.0180 1050 ARG A N   
444  C CA  . ARG A 29  ? 0.0951 0.1071 0.1038 0.0219  0.0100  -0.0020 1050 ARG A CA  
445  C C   . ARG A 29  ? 0.0802 0.1244 0.1198 0.0220  -0.0006 0.0027  1050 ARG A C   
446  O O   . ARG A 29  ? 0.0976 0.1851 0.1326 0.0341  -0.0106 0.0268  1050 ARG A O   
447  C CB  . ARG A 29  ? 0.1257 0.1427 0.1142 0.0546  0.0147  -0.0106 1050 ARG A CB  
448  C CG  . ARG A 29  ? 0.1558 0.1700 0.1738 0.0512  0.0060  0.0064  1050 ARG A CG  
449  C CD  . ARG A 29  ? 0.3591 0.3051 0.3495 0.0883  0.1984  0.0529  1050 ARG A CD  
450  N NE  . ARG A 29  ? 0.3972 0.4024 0.4580 0.1333  0.1183  0.0299  1050 ARG A NE  
451  C CZ  . ARG A 29  ? 0.3823 0.4669 0.4166 0.1940  0.0154  -0.0091 1050 ARG A CZ  
452  N NH1 . ARG A 29  ? 0.2931 0.4785 0.4132 0.1437  -0.0633 -0.1351 1050 ARG A NH1 
453  N NH2 . ARG A 29  ? 0.4246 0.4968 0.3210 0.2692  0.0149  -0.0178 1050 ARG A NH2 
467  N N   . VAL A 30  ? 0.0903 0.0819 0.0934 0.0053  -0.0080 0.0135  1051 VAL A N   
468  C CA  . VAL A 30  ? 0.0904 0.0756 0.1206 0.0059  -0.0152 0.0155  1051 VAL A CA  
469  C C   . VAL A 30  ? 0.0964 0.0690 0.1213 0.0049  -0.0135 0.0121  1051 VAL A C   
470  O O   . VAL A 30  ? 0.0937 0.0915 0.1006 0.0098  -0.0086 0.0173  1051 VAL A O   
471  C CB  . VAL A 30  ? 0.0920 0.0772 0.1263 -0.0112 -0.0152 0.0249  1051 VAL A CB  
472  C CG1 . VAL A 30  ? 0.0893 0.0888 0.0934 -0.0190 -0.0113 0.0185  1051 VAL A CG1 
473  C CG2 . VAL A 30  ? 0.0971 0.0961 0.1164 -0.0288 -0.0070 0.0140  1051 VAL A CG2 
483  N N   . VAL A 31  ? 0.0686 0.0782 0.0814 0.0047  0.0002  -0.0033 1052 VAL A N   
484  C CA  . VAL A 31  ? 0.0814 0.0700 0.0956 0.0183  0.0086  0.0030  1052 VAL A CA  
485  C C   . VAL A 31  ? 0.0840 0.0934 0.0978 0.0092  -0.0043 0.0021  1052 VAL A C   
486  O O   . VAL A 31  ? 0.0999 0.0809 0.0856 0.0099  -0.0054 -0.0070 1052 VAL A O   
487  C CB  . VAL A 31  ? 0.0791 0.0748 0.0819 0.0111  -0.0041 -0.0127 1052 VAL A CB  
488  C CG1 . VAL A 31  ? 0.1016 0.0774 0.1114 0.0093  -0.0041 0.0010  1052 VAL A CG1 
489  C CG2 . VAL A 31  ? 0.0842 0.0771 0.1006 0.0120  0.0186  -0.0005 1052 VAL A CG2 
499  N N   . GLU A 32  ? 0.0786 0.1008 0.1102 0.0173  -0.0087 -0.0083 1053 GLU A N   
500  C CA  . GLU A 32  ? 0.0688 0.1526 0.1311 0.0345  -0.0371 -0.0120 1053 GLU A CA  
501  C C   . GLU A 32  ? 0.0809 0.1572 0.1561 0.0268  -0.0479 -0.0124 1053 GLU A C   
502  O O   . GLU A 32  ? 0.1126 0.2261 0.1824 -0.0076 -0.0754 0.0274  1053 GLU A O   
503  C CB  . GLU A 32  ? 0.0795 0.2480 0.1512 0.0409  -0.0201 0.0114  1053 GLU A CB  
504  C CG  . GLU A 32  ? 0.1470 0.3297 0.1654 0.0158  -0.0235 -0.0454 1053 GLU A CG  
505  C CD  . GLU A 32  ? 0.1554 0.3821 0.2022 0.0074  -0.0289 -0.0708 1053 GLU A CD  
506  O OE1 . GLU A 32  ? 0.1494 0.3596 0.1706 0.1037  -0.0304 -0.0747 1053 GLU A OE1 
507  O OE2 . GLU A 32  ? 0.2033 0.4036 0.2361 -0.0041 0.0360  -0.1126 1053 GLU A OE2 
514  N N   A SER A 33  ? 0.1124 0.1152 0.1801 0.0440  -0.0483 -0.0019 1054 SER A N   
515  N N   B SER A 33  ? 0.1091 0.1247 0.1328 0.0303  -0.0661 -0.0088 1054 SER A N   
516  C CA  A SER A 33  ? 0.1449 0.1069 0.1702 0.0338  -0.0374 0.0023  1054 SER A CA  
517  C CA  B SER A 33  ? 0.1541 0.1269 0.1633 0.0445  -0.0668 -0.0102 1054 SER A CA  
518  C C   A SER A 33  ? 0.1504 0.1310 0.1539 -0.0141 -0.0041 0.0026  1054 SER A C   
519  C C   B SER A 33  ? 0.1410 0.1448 0.1563 0.0187  -0.0853 -0.0101 1054 SER A C   
520  O O   A SER A 33  ? 0.2237 0.1695 0.1938 -0.0467 0.0501  0.0509  1054 SER A O   
521  O O   B SER A 33  ? 0.2100 0.1971 0.1745 0.0316  -0.1070 0.0138  1054 SER A O   
522  C CB  A SER A 33  ? 0.1691 0.0932 0.1789 0.0057  -0.0645 0.0114  1054 SER A CB  
523  C CB  B SER A 33  ? 0.2322 0.1304 0.2299 0.0390  0.0269  -0.0237 1054 SER A CB  
524  O OG  A SER A 33  ? 0.1923 0.0740 0.1883 -0.0283 -0.0622 0.0218  1054 SER A OG  
525  O OG  B SER A 33  ? 0.3470 0.1336 0.2939 0.0445  0.1190  -0.0193 1054 SER A OG  
536  N N   . LEU A 34  ? 0.1131 0.1421 0.1195 -0.0275 -0.0212 -0.0046 1055 LEU A N   
537  C CA  . LEU A 34  ? 0.1146 0.1814 0.0884 -0.0183 -0.0072 0.0052  1055 LEU A CA  
538  C C   . LEU A 34  ? 0.1005 0.1529 0.1127 0.0086  -0.0279 0.0093  1055 LEU A C   
539  O O   . LEU A 34  ? 0.1304 0.1573 0.1297 -0.0220 -0.0137 -0.0028 1055 LEU A O   
540  C CB  . LEU A 34  ? 0.1104 0.2672 0.0890 -0.0246 -0.0181 -0.0359 1055 LEU A CB  
541  C CG  . LEU A 34  ? 0.1312 0.3732 0.1336 -0.0435 0.0247  -0.0829 1055 LEU A CG  
542  C CD1 . LEU A 34  ? 0.1186 0.4009 0.1583 0.0130  -0.0214 -0.0825 1055 LEU A CD1 
543  C CD2 . LEU A 34  ? 0.2072 0.4160 0.1905 -0.1427 0.0588  -0.1181 1055 LEU A CD2 
555  N N   . ASP A 35  ? 0.1287 0.1389 0.1128 0.0085  -0.0332 0.0187  1056 ASP A N   
556  C CA  . ASP A 35  ? 0.1313 0.1322 0.1119 0.0026  -0.0427 0.0100  1056 ASP A CA  
557  C C   . ASP A 35  ? 0.0999 0.1360 0.0851 -0.0140 -0.0232 0.0115  1056 ASP A C   
558  O O   . ASP A 35  ? 0.1009 0.1506 0.0977 0.0063  -0.0117 0.0305  1056 ASP A O   
559  C CB  . ASP A 35  ? 0.2152 0.1576 0.1379 0.0265  -0.0748 0.0172  1056 ASP A CB  
560  C CG  . ASP A 35  ? 0.3330 0.2244 0.1922 0.0132  -0.1056 0.0588  1056 ASP A CG  
561  O OD1 . ASP A 35  ? 0.2736 0.1842 0.2591 0.0246  -0.1466 -0.0165 1056 ASP A OD1 
562  O OD2 . ASP A 35  ? 0.4502 0.2790 0.2044 -0.0752 -0.1089 0.0331  1056 ASP A OD2 
567  N N   . VAL A 36  ? 0.0846 0.1285 0.1100 0.0017  -0.0181 0.0097  1057 VAL A N   
568  C CA  . VAL A 36  ? 0.0785 0.1219 0.0955 0.0057  -0.0193 0.0050  1057 VAL A CA  
569  C C   . VAL A 36  ? 0.0756 0.1248 0.1104 -0.0005 -0.0255 -0.0071 1057 VAL A C   
570  O O   . VAL A 36  ? 0.0808 0.1614 0.1204 -0.0110 -0.0238 -0.0096 1057 VAL A O   
571  C CB  . VAL A 36  ? 0.0942 0.1350 0.1070 -0.0053 0.0025  0.0070  1057 VAL A CB  
572  C CG1 . VAL A 36  ? 0.1057 0.1268 0.1001 -0.0184 0.0038  0.0072  1057 VAL A CG1 
573  C CG2 . VAL A 36  ? 0.1271 0.1183 0.1135 0.0207  -0.0342 -0.0129 1057 VAL A CG2 
583  N N   . GLY A 37  ? 0.0821 0.1260 0.0883 0.0096  -0.0191 0.0037  1058 GLY A N   
584  C CA  . GLY A 37  ? 0.1106 0.1226 0.1023 -0.0010 -0.0011 -0.0248 1058 GLY A CA  
585  C C   . GLY A 37  ? 0.1186 0.1439 0.0703 0.0080  -0.0124 0.0009  1058 GLY A C   
586  O O   . GLY A 37  ? 0.0999 0.1437 0.0818 0.0004  -0.0135 -0.0036 1058 GLY A O   
590  N N   . PRO A 38  ? 0.1187 0.1608 0.0925 0.0037  -0.0203 -0.0226 1059 PRO A N   
591  C CA  . PRO A 38  ? 0.1334 0.1663 0.1016 0.0239  -0.0067 -0.0321 1059 PRO A CA  
592  C C   . PRO A 38  ? 0.1216 0.1906 0.0858 0.0443  -0.0265 -0.0302 1059 PRO A C   
593  O O   . PRO A 38  ? 0.1037 0.2350 0.0918 0.0488  -0.0317 -0.0286 1059 PRO A O   
594  C CB  . PRO A 38  ? 0.1793 0.1666 0.1669 0.0258  0.0122  -0.0586 1059 PRO A CB  
595  C CG  . PRO A 38  ? 0.1898 0.1765 0.1381 0.0204  0.0181  -0.0194 1059 PRO A CG  
596  C CD  . PRO A 38  ? 0.1734 0.1661 0.1094 0.0100  0.0004  -0.0322 1059 PRO A CD  
604  N N   . ASP A 39  ? 0.0952 0.2242 0.0930 0.0161  -0.0355 -0.0259 1060 ASP A N   
605  C CA  . ASP A 39  ? 0.1452 0.2624 0.0854 -0.0185 -0.0174 0.0026  1060 ASP A CA  
606  C C   . ASP A 39  ? 0.1467 0.2268 0.0787 -0.0128 -0.0270 0.0053  1060 ASP A C   
607  O O   . ASP A 39  ? 0.2254 0.2550 0.0807 -0.0094 0.0085  0.0025  1060 ASP A O   
608  C CB  . ASP A 39  ? 0.2652 0.3580 0.1176 -0.0117 -0.0694 -0.0038 1060 ASP A CB  
609  C CG  . ASP A 39  ? 0.4692 0.5056 0.2480 0.0119  -0.1438 -0.0432 1060 ASP A CG  
610  O OD1 . ASP A 39  ? 0.6111 0.5454 0.2796 0.0840  -0.0704 -0.0689 1060 ASP A OD1 
611  O OD2 . ASP A 39  ? 0.5870 0.5604 0.3820 -0.0398 -0.0426 -0.1003 1060 ASP A OD2 
616  N N   A ARG A 40  ? 0.1279 0.2095 0.0736 -0.0027 -0.0156 -0.0089 1061 ARG A N   
617  N N   B ARG A 40  ? 0.1353 0.1970 0.0624 -0.0057 -0.0236 0.0026  1061 ARG A N   
618  C CA  A ARG A 40  ? 0.1089 0.2039 0.0921 0.0070  -0.0445 0.0226  1061 ARG A CA  
619  C CA  B ARG A 40  ? 0.1337 0.1937 0.0704 -0.0065 -0.0085 0.0387  1061 ARG A CA  
620  C C   A ARG A 40  ? 0.0938 0.1674 0.1070 0.0050  -0.0576 0.0056  1061 ARG A C   
621  C C   B ARG A 40  ? 0.1251 0.1770 0.1293 -0.0068 0.0244  0.0140  1061 ARG A C   
622  O O   A ARG A 40  ? 0.0942 0.1855 0.0963 -0.0146 -0.0306 -0.0232 1061 ARG A O   
623  O O   B ARG A 40  ? 0.1186 0.2105 0.1338 0.0151  0.0503  0.0421  1061 ARG A O   
642  N N   . VAL A 41  ? 0.0939 0.1502 0.0984 0.0104  -0.0315 0.0251  1062 VAL A N   
643  C CA  . VAL A 41  ? 0.0693 0.1297 0.0836 0.0033  -0.0184 0.0139  1062 VAL A CA  
644  C C   . VAL A 41  ? 0.0634 0.1154 0.0556 -0.0085 -0.0101 0.0091  1062 VAL A C   
645  O O   . VAL A 41  ? 0.0637 0.1370 0.0894 0.0027  -0.0160 0.0291  1062 VAL A O   
646  C CB  . VAL A 41  ? 0.0861 0.1024 0.0974 -0.0047 -0.0179 0.0107  1062 VAL A CB  
647  C CG1 . VAL A 41  ? 0.0889 0.1199 0.1208 0.0144  -0.0120 0.0006  1062 VAL A CG1 
648  C CG2 . VAL A 41  ? 0.1032 0.1400 0.1509 -0.0128 -0.0034 0.0088  1062 VAL A CG2 
658  N N   . ARG A 42  ? 0.0598 0.0993 0.0685 -0.0009 -0.0057 0.0121  1063 ARG A N   
659  C CA  . ARG A 42  ? 0.0785 0.0942 0.0722 -0.0039 -0.0059 -0.0097 1063 ARG A CA  
660  C C   . ARG A 42  ? 0.0565 0.0859 0.0928 -0.0059 -0.0147 -0.0062 1063 ARG A C   
661  O O   . ARG A 42  ? 0.0729 0.1027 0.0772 -0.0138 -0.0062 -0.0036 1063 ARG A O   
662  C CB  . ARG A 42  ? 0.0666 0.0883 0.0854 -0.0002 -0.0151 -0.0096 1063 ARG A CB  
663  C CG  . ARG A 42  ? 0.0812 0.1069 0.0828 0.0034  -0.0205 -0.0157 1063 ARG A CG  
664  C CD  . ARG A 42  ? 0.0874 0.1035 0.0774 0.0121  -0.0144 -0.0125 1063 ARG A CD  
665  N NE  . ARG A 42  ? 0.0896 0.1185 0.1079 0.0193  -0.0203 -0.0240 1063 ARG A NE  
666  C CZ  . ARG A 42  ? 0.1142 0.1501 0.1480 0.0350  -0.0527 -0.0438 1063 ARG A CZ  
667  N NH1 . ARG A 42  ? 0.1580 0.1635 0.1932 0.0558  -0.0850 -0.0871 1063 ARG A NH1 
668  N NH2 . ARG A 42  ? 0.1425 0.1700 0.1234 0.0357  -0.0516 -0.0719 1063 ARG A NH2 
682  N N   . VAL A 43  ? 0.0700 0.0792 0.0728 -0.0059 -0.0051 -0.0034 1064 VAL A N   
683  C CA  . VAL A 43  ? 0.0708 0.0702 0.0761 -0.0119 -0.0117 -0.0134 1064 VAL A CA  
684  C C   . VAL A 43  ? 0.0660 0.0598 0.0780 -0.0041 0.0103  -0.0105 1064 VAL A C   
685  O O   . VAL A 43  ? 0.0978 0.0671 0.0977 -0.0029 -0.0164 -0.0001 1064 VAL A O   
686  C CB  . VAL A 43  ? 0.0613 0.0782 0.0815 -0.0010 -0.0038 -0.0157 1064 VAL A CB  
687  C CG1 . VAL A 43  ? 0.0674 0.0696 0.1004 0.0013  0.0036  0.0010  1064 VAL A CG1 
688  C CG2 . VAL A 43  ? 0.0704 0.1076 0.0972 0.0204  0.0091  0.0111  1064 VAL A CG2 
698  N N   . ALA A 44  ? 0.0822 0.0582 0.0681 -0.0071 -0.0182 -0.0081 1065 ALA A N   
699  C CA  . ALA A 44  ? 0.0635 0.0592 0.0622 -0.0016 -0.0046 0.0098  1065 ALA A CA  
700  C C   . ALA A 44  ? 0.0734 0.0507 0.0724 0.0046  0.0050  -0.0065 1065 ALA A C   
701  O O   . ALA A 44  ? 0.0773 0.0544 0.0746 0.0073  0.0010  -0.0007 1065 ALA A O   
702  C CB  . ALA A 44  ? 0.0875 0.0605 0.0711 -0.0093 0.0023  -0.0095 1065 ALA A CB  
708  N N   . LEU A 45  ? 0.0884 0.0533 0.0721 -0.0115 -0.0039 0.0001  1066 LEU A N   
709  C CA  . LEU A 45  ? 0.0852 0.0583 0.0681 0.0046  -0.0038 -0.0016 1066 LEU A CA  
710  C C   . LEU A 45  ? 0.0641 0.0524 0.0710 -0.0035 -0.0063 -0.0035 1066 LEU A C   
711  O O   . LEU A 45  ? 0.0848 0.0552 0.1020 -0.0054 -0.0111 0.0072  1066 LEU A O   
712  C CB  . LEU A 45  ? 0.0710 0.0767 0.0790 0.0007  0.0018  0.0129  1066 LEU A CB  
713  C CG  . LEU A 45  ? 0.0773 0.0697 0.0741 0.0095  0.0001  0.0002  1066 LEU A CG  
714  C CD1 . LEU A 45  ? 0.1261 0.1110 0.0787 0.0407  0.0021  0.0094  1066 LEU A CD1 
715  C CD2 . LEU A 45  ? 0.0956 0.0944 0.0730 0.0094  0.0077  0.0339  1066 LEU A CD2 
727  N N   . VAL A 46  ? 0.0694 0.0508 0.0700 -0.0012 0.0002  0.0095  1067 VAL A N   
728  C CA  . VAL A 46  ? 0.0811 0.0672 0.0662 0.0022  0.0149  0.0113  1067 VAL A CA  
729  C C   . VAL A 46  ? 0.0805 0.0613 0.0699 -0.0007 -0.0024 0.0128  1067 VAL A C   
730  O O   . VAL A 46  ? 0.1037 0.0624 0.0681 -0.0022 0.0121  0.0114  1067 VAL A O   
731  C CB  . VAL A 46  ? 0.0719 0.0772 0.0767 0.0026  -0.0031 0.0189  1067 VAL A CB  
732  C CG1 . VAL A 46  ? 0.0939 0.0960 0.0995 0.0093  0.0142  0.0059  1067 VAL A CG1 
733  C CG2 . VAL A 46  ? 0.0989 0.0827 0.0837 0.0165  0.0131  0.0006  1067 VAL A CG2 
743  N N   . GLN A 47  ? 0.0937 0.0482 0.0691 -0.0138 -0.0070 0.0045  1068 GLN A N   
744  C CA  . GLN A 47  ? 0.1173 0.0676 0.0861 -0.0196 0.0078  0.0131  1068 GLN A CA  
745  C C   . GLN A 47  ? 0.1105 0.0745 0.0518 -0.0170 -0.0263 0.0058  1068 GLN A C   
746  O O   . GLN A 47  ? 0.1185 0.0854 0.0954 -0.0102 -0.0276 0.0094  1068 GLN A O   
747  C CB  . GLN A 47  ? 0.1290 0.0775 0.0846 -0.0150 0.0079  0.0159  1068 GLN A CB  
748  C CG  . GLN A 47  ? 0.1279 0.1033 0.0820 -0.0061 -0.0083 0.0232  1068 GLN A CG  
749  C CD  . GLN A 47  ? 0.1118 0.1089 0.1092 -0.0027 0.0144  0.0223  1068 GLN A CD  
750  O OE1 . GLN A 47  ? 0.1211 0.1093 0.1103 -0.0015 0.0048  0.0299  1068 GLN A OE1 
751  N NE2 . GLN A 47  ? 0.1336 0.1193 0.1122 0.0032  0.0462  0.0285  1068 GLN A NE2 
760  N N   . TYR A 48  ? 0.0994 0.0974 0.0754 -0.0146 0.0034  0.0243  1069 TYR A N   
761  C CA  . TYR A 48  ? 0.0979 0.0999 0.0873 -0.0111 -0.0254 0.0136  1069 TYR A CA  
762  C C   . TYR A 48  ? 0.1154 0.1003 0.0966 -0.0193 -0.0158 0.0375  1069 TYR A C   
763  O O   . TYR A 48  ? 0.1120 0.1338 0.1030 -0.0148 -0.0188 0.0246  1069 TYR A O   
764  C CB  . TYR A 48  ? 0.1085 0.1011 0.1003 -0.0227 -0.0132 0.0124  1069 TYR A CB  
765  C CG  . TYR A 48  ? 0.0979 0.1006 0.0766 -0.0229 -0.0101 0.0211  1069 TYR A CG  
766  C CD1 . TYR A 48  ? 0.0947 0.0993 0.0817 -0.0147 -0.0038 0.0111  1069 TYR A CD1 
767  C CD2 . TYR A 48  ? 0.1064 0.1146 0.0876 -0.0292 -0.0112 -0.0161 1069 TYR A CD2 
768  C CE1 . TYR A 48  ? 0.0916 0.1061 0.0713 -0.0193 -0.0038 0.0051  1069 TYR A CE1 
769  C CE2 . TYR A 48  ? 0.1034 0.1163 0.0856 -0.0267 0.0002  0.0006  1069 TYR A CE2 
770  C CZ  . TYR A 48  ? 0.1047 0.1185 0.0869 -0.0187 0.0176  0.0090  1069 TYR A CZ  
771  O OH  . TYR A 48  ? 0.1168 0.0965 0.1215 -0.0287 0.0126  -0.0057 1069 TYR A OH  
781  N N   A SER A 49  ? 0.1365 0.0881 0.0963 -0.0063 -0.0375 0.0085  1070 SER A N   
782  N N   B SER A 49  ? 0.1355 0.1334 0.0733 -0.0120 -0.0170 0.0130  1070 SER A N   
783  C CA  A SER A 49  ? 0.1448 0.1023 0.0684 -0.0343 -0.0423 0.0152  1070 SER A CA  
784  C CA  B SER A 49  ? 0.1621 0.1687 0.0940 -0.0171 -0.0281 0.0057  1070 SER A CA  
785  C C   A SER A 49  ? 0.1530 0.1284 0.1030 -0.0346 -0.0613 0.0330  1070 SER A C   
786  C C   B SER A 49  ? 0.1441 0.1777 0.0956 -0.0218 -0.0260 0.0166  1070 SER A C   
787  O O   A SER A 49  ? 0.1332 0.1550 0.1444 -0.0477 -0.0514 -0.0039 1070 SER A O   
788  O O   B SER A 49  ? 0.1294 0.1811 0.1070 -0.0183 0.0622  0.0157  1070 SER A O   
789  C CB  A SER A 49  ? 0.1176 0.1082 0.0794 -0.0217 -0.0175 0.0138  1070 SER A CB  
790  C CB  B SER A 49  ? 0.2160 0.2035 0.1178 -0.0180 -0.0414 -0.0163 1070 SER A CB  
791  O OG  A SER A 49  ? 0.1172 0.1095 0.0893 -0.0116 -0.0103 0.0395  1070 SER A OG  
792  O OG  B SER A 49  ? 0.3067 0.2373 0.1249 -0.0380 -0.0254 -0.0205 1070 SER A OG  
803  N N   . ASP A 50  ? 0.1489 0.1955 0.1183 -0.0235 -0.0383 0.0155  1071 ASP A N   
804  C CA  . ASP A 50  ? 0.1451 0.2476 0.1676 0.0180  -0.0644 0.0208  1071 ASP A CA  
805  C C   . ASP A 50  ? 0.1486 0.2441 0.1668 0.0396  -0.0550 0.0425  1071 ASP A C   
806  O O   . ASP A 50  ? 0.1476 0.3175 0.2464 0.0468  -0.0672 0.0121  1071 ASP A O   
807  C CB  . ASP A 50  ? 0.2078 0.3151 0.1929 0.0427  -0.0873 0.0367  1071 ASP A CB  
808  C CG  . ASP A 50  ? 0.2608 0.3754 0.1925 0.0577  -0.0908 0.0674  1071 ASP A CG  
809  O OD1 . ASP A 50  ? 0.2881 0.3392 0.1889 0.0414  -0.0442 0.1218  1071 ASP A OD1 
810  O OD2 . ASP A 50  ? 0.3621 0.4405 0.2107 0.0670  -0.0854 0.1055  1071 ASP A OD2 
815  N N   . ARG A 51  ? 0.1489 0.1930 0.1397 -0.0092 -0.0511 0.0410  1072 ARG A N   
816  C CA  . ARG A 51  ? 0.1652 0.1824 0.1376 0.0354  -0.0699 0.0376  1072 ARG A CA  
817  C C   . ARG A 51  ? 0.1371 0.1156 0.1647 -0.0026 -0.0149 0.0023  1072 ARG A C   
818  O O   . ARG A 51  ? 0.1536 0.1150 0.1194 0.0088  -0.0410 0.0066  1072 ARG A O   
819  C CB  . ARG A 51  ? 0.2357 0.2198 0.1521 0.0632  -0.0294 0.0754  1072 ARG A CB  
820  C CG  . ARG A 51  ? 0.2642 0.2548 0.2230 0.0057  0.0412  0.1345  1072 ARG A CG  
821  C CD  . ARG A 51  ? 0.3551 0.2910 0.3628 0.0284  0.1651  0.1358  1072 ARG A CD  
822  N NE  . ARG A 51  ? 0.2765 0.2846 0.3057 0.0438  0.0476  0.1228  1072 ARG A NE  
823  C CZ  . ARG A 51  ? 0.2671 0.2712 0.3706 -0.0134 0.0520  0.1049  1072 ARG A CZ  
824  N NH1 . ARG A 51  ? 0.2814 0.2409 0.3499 0.0085  0.0990  0.0859  1072 ARG A NH1 
825  N NH2 . ARG A 51  ? 0.3172 0.2805 0.3838 -0.0310 -0.0013 0.1564  1072 ARG A NH2 
839  N N   . THR A 52  ? 0.1372 0.1355 0.1619 0.0434  -0.0307 0.0081  1073 THR A N   
840  C CA  . THR A 52  ? 0.1329 0.1436 0.1506 0.0254  -0.0541 0.0219  1073 THR A CA  
841  C C   . THR A 52  ? 0.1632 0.1035 0.1621 0.0295  -0.0280 0.0146  1073 THR A C   
842  O O   . THR A 52  ? 0.1821 0.1331 0.2010 0.0189  -0.0246 0.0373  1073 THR A O   
843  C CB  . THR A 52  ? 0.1687 0.1609 0.1279 0.0272  0.0139  0.0382  1073 THR A CB  
844  O OG1 . THR A 52  ? 0.2081 0.2037 0.1796 0.0600  0.0346  0.0314  1073 THR A OG1 
845  C CG2 . THR A 52  ? 0.1841 0.1879 0.1693 -0.0157 0.0455  0.0227  1073 THR A CG2 
853  N N   . ARG A 53  ? 0.1370 0.1155 0.1395 0.0073  -0.0534 0.0413  1074 ARG A N   
854  C CA  . ARG A 53  ? 0.1241 0.1025 0.1540 0.0085  -0.0284 0.0251  1074 ARG A CA  
855  C C   . ARG A 53  ? 0.0944 0.0830 0.1464 0.0212  -0.0128 0.0167  1074 ARG A C   
856  O O   . ARG A 53  ? 0.1120 0.0787 0.1015 0.0035  -0.0107 0.0067  1074 ARG A O   
857  C CB  . ARG A 53  ? 0.1555 0.1148 0.1213 -0.0044 -0.0094 0.0288  1074 ARG A CB  
858  C CG  . ARG A 53  ? 0.1886 0.1314 0.1725 -0.0191 0.0178  0.0214  1074 ARG A CG  
859  C CD  . ARG A 53  ? 0.1682 0.1312 0.2082 -0.0214 -0.0040 0.0488  1074 ARG A CD  
860  N NE  . ARG A 53  ? 0.1613 0.1575 0.1720 -0.0270 -0.0140 0.0599  1074 ARG A NE  
861  C CZ  . ARG A 53  ? 0.1646 0.1621 0.1455 -0.0381 0.0042  0.0296  1074 ARG A CZ  
862  N NH1 . ARG A 53  ? 0.2080 0.1614 0.1719 -0.0558 -0.0116 0.0598  1074 ARG A NH1 
863  N NH2 . ARG A 53  ? 0.1794 0.1553 0.1584 0.0102  0.0173  0.0232  1074 ARG A NH2 
877  N N   . PRO A 54  ? 0.1244 0.0859 0.1170 0.0170  0.0066  0.0131  1075 PRO A N   
878  C CA  . PRO A 54  ? 0.0915 0.0811 0.1284 0.0132  -0.0061 0.0062  1075 PRO A CA  
879  C C   . PRO A 54  ? 0.1081 0.0609 0.1184 0.0129  -0.0100 0.0142  1075 PRO A C   
880  O O   . PRO A 54  ? 0.1510 0.0698 0.1789 0.0181  -0.0036 0.0415  1075 PRO A O   
881  C CB  . PRO A 54  ? 0.1386 0.1045 0.1407 0.0313  0.0370  0.0105  1075 PRO A CB  
882  C CG  . PRO A 54  ? 0.1164 0.1506 0.1914 0.0401  0.0165  -0.0178 1075 PRO A CG  
883  C CD  . PRO A 54  ? 0.1449 0.1022 0.1501 0.0433  0.0210  0.0109  1075 PRO A CD  
891  N N   . GLU A 55  ? 0.1038 0.0622 0.0989 0.0059  -0.0065 0.0104  1076 GLU A N   
892  C CA  . GLU A 55  ? 0.0919 0.0788 0.1051 -0.0022 0.0074  0.0081  1076 GLU A CA  
893  C C   . GLU A 55  ? 0.1041 0.0792 0.1022 -0.0171 -0.0156 0.0140  1076 GLU A C   
894  O O   . GLU A 55  ? 0.1735 0.1297 0.1080 -0.0495 -0.0125 0.0158  1076 GLU A O   
895  C CB  . GLU A 55  ? 0.1096 0.0866 0.0889 -0.0040 0.0025  0.0159  1076 GLU A CB  
896  C CG  . GLU A 55  ? 0.1378 0.0964 0.0824 0.0201  -0.0050 0.0215  1076 GLU A CG  
897  C CD  . GLU A 55  ? 0.2213 0.1012 0.1155 0.0445  -0.0091 0.0151  1076 GLU A CD  
898  O OE1 . GLU A 55  ? 0.3311 0.1444 0.1422 -0.0082 0.0345  0.0435  1076 GLU A OE1 
899  O OE2 . GLU A 55  ? 0.3000 0.1255 0.1098 0.0041  -0.0088 -0.0050 1076 GLU A OE2 
906  N N   . PHE A 56  ? 0.0853 0.0753 0.0812 -0.0264 -0.0042 -0.0087 1077 PHE A N   
907  C CA  . PHE A 56  ? 0.0668 0.0665 0.1146 -0.0158 0.0013  0.0149  1077 PHE A CA  
908  C C   . PHE A 56  ? 0.0739 0.0544 0.1085 -0.0015 -0.0271 -0.0037 1077 PHE A C   
909  O O   . PHE A 56  ? 0.0841 0.0638 0.0892 -0.0021 -0.0048 -0.0039 1077 PHE A O   
910  C CB  . PHE A 56  ? 0.0688 0.0754 0.1295 -0.0155 -0.0124 0.0036  1077 PHE A CB  
911  C CG  . PHE A 56  ? 0.0645 0.0834 0.1186 -0.0041 -0.0178 0.0105  1077 PHE A CG  
912  C CD1 . PHE A 56  ? 0.0721 0.0847 0.1135 -0.0020 -0.0072 0.0198  1077 PHE A CD1 
913  C CD2 . PHE A 56  ? 0.0664 0.0900 0.0998 0.0126  0.0098  -0.0052 1077 PHE A CD2 
914  C CE1 . PHE A 56  ? 0.0682 0.0977 0.1046 0.0045  0.0033  0.0102  1077 PHE A CE1 
915  C CE2 . PHE A 56  ? 0.0674 0.1025 0.1092 -0.0123 -0.0024 0.0016  1077 PHE A CE2 
916  C CZ  . PHE A 56  ? 0.0533 0.0909 0.1180 -0.0104 0.0012  0.0125  1077 PHE A CZ  
926  N N   . TYR A 57  ? 0.0727 0.0611 0.0941 -0.0079 -0.0087 -0.0099 1078 TYR A N   
927  C CA  . TYR A 57  ? 0.0728 0.0636 0.1148 -0.0070 0.0019  -0.0023 1078 TYR A CA  
928  C C   . TYR A 57  ? 0.0685 0.0671 0.1005 -0.0100 -0.0121 -0.0259 1078 TYR A C   
929  O O   . TYR A 57  ? 0.0793 0.0775 0.0953 -0.0051 0.0016  -0.0083 1078 TYR A O   
930  C CB  . TYR A 57  ? 0.0814 0.0627 0.1295 0.0046  0.0094  -0.0088 1078 TYR A CB  
931  C CG  . TYR A 57  ? 0.1043 0.0799 0.1200 0.0230  0.0047  0.0039  1078 TYR A CG  
932  C CD1 . TYR A 57  ? 0.0846 0.0943 0.1248 0.0216  -0.0106 -0.0142 1078 TYR A CD1 
933  C CD2 . TYR A 57  ? 0.1224 0.0956 0.1247 0.0100  -0.0027 0.0068  1078 TYR A CD2 
934  C CE1 . TYR A 57  ? 0.0975 0.1090 0.1451 0.0282  -0.0033 -0.0190 1078 TYR A CE1 
935  C CE2 . TYR A 57  ? 0.1657 0.1253 0.1529 0.0172  0.0308  0.0470  1078 TYR A CE2 
936  C CZ  . TYR A 57  ? 0.1075 0.1245 0.1566 0.0285  -0.0015 0.0012  1078 TYR A CZ  
937  O OH  . TYR A 57  ? 0.1771 0.1498 0.1476 0.0565  -0.0261 0.0107  1078 TYR A OH  
947  N N   . LEU A 58  ? 0.0575 0.0853 0.0821 -0.0009 0.0072  -0.0163 1079 LEU A N   
948  C CA  . LEU A 58  ? 0.0724 0.0761 0.0794 0.0082  -0.0004 -0.0040 1079 LEU A CA  
949  C C   . LEU A 58  ? 0.0887 0.0963 0.0872 -0.0032 -0.0165 -0.0276 1079 LEU A C   
950  O O   . LEU A 58  ? 0.0848 0.1148 0.1136 0.0001  -0.0318 -0.0064 1079 LEU A O   
951  C CB  . LEU A 58  ? 0.0762 0.0784 0.0989 0.0065  -0.0022 0.0034  1079 LEU A CB  
952  C CG  . LEU A 58  ? 0.0732 0.0731 0.0685 -0.0153 0.0053  -0.0043 1079 LEU A CG  
953  C CD1 . LEU A 58  ? 0.0940 0.0794 0.0880 -0.0026 -0.0073 0.0060  1079 LEU A CD1 
954  C CD2 . LEU A 58  ? 0.0798 0.0573 0.0866 -0.0077 0.0016  -0.0015 1079 LEU A CD2 
966  N N   . ASN A 59  ? 0.1068 0.0750 0.1029 -0.0086 0.0009  -0.0321 1080 ASN A N   
967  C CA  . ASN A 59  ? 0.0991 0.0967 0.1279 -0.0236 0.0009  -0.0374 1080 ASN A CA  
968  C C   . ASN A 59  ? 0.1011 0.0907 0.1164 -0.0119 -0.0028 -0.0277 1080 ASN A C   
969  O O   . ASN A 59  ? 0.1265 0.1006 0.1396 -0.0468 -0.0046 -0.0296 1080 ASN A O   
970  C CB  . ASN A 59  ? 0.1099 0.1087 0.1306 -0.0245 0.0022  -0.0416 1080 ASN A CB  
971  C CG  . ASN A 59  ? 0.1294 0.1312 0.1371 -0.0066 0.0076  -0.0316 1080 ASN A CG  
972  O OD1 . ASN A 59  ? 0.1384 0.1287 0.1601 0.0006  -0.0007 -0.0184 1080 ASN A OD1 
973  N ND2 . ASN A 59  ? 0.1662 0.1498 0.2009 0.0260  0.0145  -0.0358 1080 ASN A ND2 
980  N N   . SER A 60  ? 0.1163 0.0885 0.1157 -0.0135 -0.0001 -0.0188 1081 SER A N   
981  C CA  . SER A 60  ? 0.1104 0.0810 0.1296 -0.0282 0.0111  -0.0091 1081 SER A CA  
982  C C   . SER A 60  ? 0.1000 0.0650 0.1198 -0.0076 -0.0123 0.0030  1081 SER A C   
983  O O   . SER A 60  ? 0.0922 0.0710 0.1692 -0.0124 -0.0119 0.0064  1081 SER A O   
984  C CB  . SER A 60  ? 0.0951 0.0940 0.1182 -0.0251 -0.0174 -0.0201 1081 SER A CB  
985  O OG  . SER A 60  ? 0.1167 0.0996 0.1053 -0.0379 0.0021  -0.0140 1081 SER A OG  
991  N N   . HIS A 61  ? 0.1183 0.0701 0.1215 -0.0344 0.0200  -0.0056 1082 HIS A N   
992  C CA  . HIS A 61  ? 0.0912 0.0909 0.1484 0.0099  0.0268  0.0157  1082 HIS A CA  
993  C C   . HIS A 61  ? 0.1190 0.0973 0.1401 -0.0142 0.0171  0.0068  1082 HIS A C   
994  O O   . HIS A 61  ? 0.1232 0.1522 0.1558 -0.0258 0.0282  0.0279  1082 HIS A O   
995  C CB  . HIS A 61  ? 0.1483 0.1004 0.1415 0.0264  0.0289  0.0201  1082 HIS A CB  
996  C CG  . HIS A 61  ? 0.0888 0.0888 0.1814 0.0118  0.0130  -0.0143 1082 HIS A CG  
997  N ND1 . HIS A 61  ? 0.2001 0.1367 0.1454 0.0219  0.0438  -0.0103 1082 HIS A ND1 
998  C CD2 . HIS A 61  ? 0.0764 0.1608 0.1679 0.0070  -0.0079 -0.0619 1082 HIS A CD2 
999  C CE1 . HIS A 61  ? 0.2105 0.1236 0.1720 0.0214  0.1026  0.0175  1082 HIS A CE1 
1000 N NE2 . HIS A 61  ? 0.2311 0.2284 0.1342 0.1113  0.0177  0.0111  1082 HIS A NE2 
1009 N N   . MET A 62  ? 0.0874 0.1110 0.1658 -0.0070 0.0015  0.0129  1083 MET A N   
1010 C CA  . MET A 62  ? 0.1192 0.1253 0.1254 0.0171  -0.0119 -0.0013 1083 MET A CA  
1011 C C   . MET A 62  ? 0.1385 0.1051 0.1224 0.0131  -0.0118 -0.0117 1083 MET A C   
1012 O O   . MET A 62  ? 0.1188 0.1382 0.1091 -0.0010 -0.0289 -0.0003 1083 MET A O   
1013 C CB  . MET A 62  ? 0.1495 0.1398 0.1852 0.0146  0.0062  -0.0269 1083 MET A CB  
1014 C CG  . MET A 62  ? 0.1256 0.1483 0.2801 -0.0319 -0.0016 -0.0495 1083 MET A CG  
1015 S SD  . MET A 62  ? 0.1474 0.1893 0.3303 -0.0322 -0.0028 -0.1076 1083 MET A SD  
1016 C CE  . MET A 62  ? 0.2296 0.2567 0.3380 -0.0176 -0.0178 -0.1143 1083 MET A CE  
1026 N N   . ASP A 63  ? 0.0996 0.1069 0.1455 0.0103  -0.0174 -0.0052 1084 ASP A N   
1027 C CA  . ASP A 63  ? 0.1149 0.1068 0.1105 -0.0243 -0.0090 -0.0296 1084 ASP A CA  
1028 C C   . ASP A 63  ? 0.0718 0.0904 0.1536 -0.0078 -0.0261 -0.0067 1084 ASP A C   
1029 O O   . ASP A 63  ? 0.0836 0.0919 0.1229 -0.0050 -0.0315 0.0013  1084 ASP A O   
1030 C CB  . ASP A 63  ? 0.0965 0.1146 0.1369 0.0003  -0.0236 -0.0226 1084 ASP A CB  
1031 C CG  . ASP A 63  ? 0.0903 0.1163 0.1424 -0.0022 -0.0433 -0.0545 1084 ASP A CG  
1032 O OD1 . ASP A 63  ? 0.0958 0.1146 0.1407 -0.0034 -0.0220 -0.0194 1084 ASP A OD1 
1033 O OD2 . ASP A 63  ? 0.1060 0.1556 0.1656 -0.0097 -0.0353 -0.0375 1084 ASP A OD2 
1038 N N   A GLN A 64  ? 0.1066 0.0853 0.1260 -0.0063 -0.0303 -0.0054 1085 GLN A N   
1039 N N   B GLN A 64  ? 0.1248 0.1014 0.1023 0.0068  -0.0380 -0.0125 1085 GLN A N   
1040 C CA  A GLN A 64  ? 0.1151 0.0616 0.1271 0.0015  -0.0268 0.0054  1085 GLN A CA  
1041 C CA  B GLN A 64  ? 0.1251 0.1046 0.1584 0.0057  -0.0421 -0.0161 1085 GLN A CA  
1042 C C   A GLN A 64  ? 0.0884 0.0760 0.1318 0.0072  -0.0070 -0.0362 1085 GLN A C   
1043 C C   B GLN A 64  ? 0.1026 0.0695 0.1588 0.0124  -0.0388 -0.0376 1085 GLN A C   
1044 O O   A GLN A 64  ? 0.0538 0.0856 0.0729 0.0237  -0.0193 -0.0440 1085 GLN A O   
1045 O O   B GLN A 64  ? 0.1360 0.0701 0.1448 -0.0136 -0.0402 -0.0014 1085 GLN A O   
1046 C CB  A GLN A 64  ? 0.1566 0.0468 0.0692 0.0003  -0.0448 0.0037  1085 GLN A CB  
1047 C CB  B GLN A 64  ? 0.1937 0.1775 0.1689 -0.0131 -0.0555 -0.0451 1085 GLN A CB  
1048 C CG  A GLN A 64  ? 0.1405 0.0501 0.0691 -0.0070 0.0023  -0.0185 1085 GLN A CG  
1049 C CG  B GLN A 64  ? 0.2110 0.2039 0.2185 0.0055  -0.0121 -0.0255 1085 GLN A CG  
1050 C CD  A GLN A 64  ? 0.1463 0.0584 0.1227 0.0125  -0.0435 -0.0188 1085 GLN A CD  
1051 C CD  B GLN A 64  ? 0.0781 0.1611 0.2627 0.0012  -0.0201 -0.0030 1085 GLN A CD  
1052 O OE1 A GLN A 64  ? 0.1680 0.0528 0.1194 0.0100  -0.0429 -0.0110 1085 GLN A OE1 
1053 O OE1 B GLN A 64  ? 0.1399 0.1856 0.2586 0.0059  -0.0198 0.0559  1085 GLN A OE1 
1054 N NE2 A GLN A 64  ? 0.0838 0.0803 0.2934 0.0054  -0.0371 -0.0304 1085 GLN A NE2 
1055 N NE2 B GLN A 64  ? 0.1085 0.1639 0.2023 0.0134  -0.0216 -0.1056 1085 GLN A NE2 
1072 N N   . GLN A 65  ? 0.0858 0.0834 0.1365 0.0106  -0.0183 -0.0357 1086 GLN A N   
1073 C CA  . GLN A 65  ? 0.0690 0.1193 0.1343 0.0017  -0.0005 -0.0375 1086 GLN A CA  
1074 C C   . GLN A 65  ? 0.0600 0.0843 0.1376 -0.0141 -0.0078 -0.0378 1086 GLN A C   
1075 O O   . GLN A 65  ? 0.0959 0.0983 0.1159 -0.0242 -0.0111 -0.0152 1086 GLN A O   
1076 C CB  . GLN A 65  ? 0.0726 0.1440 0.1469 -0.0032 0.0002  -0.0461 1086 GLN A CB  
1077 C CG  . GLN A 65  ? 0.0732 0.1873 0.1577 -0.0296 0.0060  -0.0422 1086 GLN A CG  
1078 C CD  . GLN A 65  ? 0.0927 0.2212 0.1733 -0.0380 0.0083  -0.0559 1086 GLN A CD  
1079 O OE1 . GLN A 65  ? 0.1556 0.2268 0.1794 -0.0769 -0.0171 -0.0528 1086 GLN A OE1 
1080 N NE2 . GLN A 65  ? 0.1263 0.2684 0.1655 -0.0822 0.0101  -0.0449 1086 GLN A NE2 
1089 N N   . GLY A 66  ? 0.0711 0.0808 0.1209 -0.0046 -0.0278 -0.0125 1087 GLY A N   
1090 C CA  . GLY A 66  ? 0.0823 0.0683 0.1327 -0.0136 -0.0078 -0.0115 1087 GLY A CA  
1091 C C   . GLY A 66  ? 0.0763 0.0759 0.1128 -0.0028 -0.0106 -0.0027 1087 GLY A C   
1092 O O   . GLY A 66  ? 0.0934 0.0684 0.1039 -0.0099 0.0010  -0.0021 1087 GLY A O   
1096 N N   . VAL A 67  ? 0.0700 0.0686 0.1004 -0.0126 -0.0020 0.0007  1088 VAL A N   
1097 C CA  . VAL A 67  ? 0.0565 0.0630 0.1070 -0.0050 0.0036  0.0084  1088 VAL A CA  
1098 C C   . VAL A 67  ? 0.0530 0.0711 0.0976 -0.0007 -0.0220 0.0108  1088 VAL A C   
1099 O O   . VAL A 67  ? 0.0646 0.0858 0.1032 -0.0098 -0.0104 0.0036  1088 VAL A O   
1100 C CB  . VAL A 67  ? 0.0589 0.0796 0.0964 -0.0117 -0.0226 0.0005  1088 VAL A CB  
1101 C CG1 . VAL A 67  ? 0.0680 0.0601 0.1058 0.0005  0.0029  0.0113  1088 VAL A CG1 
1102 C CG2 . VAL A 67  ? 0.0781 0.1032 0.1057 -0.0192 -0.0052 -0.0113 1088 VAL A CG2 
1112 N N   . ILE A 68  ? 0.0633 0.0644 0.0938 -0.0002 -0.0098 -0.0037 1089 ILE A N   
1113 C CA  . ILE A 68  ? 0.0682 0.0603 0.1081 -0.0180 0.0025  -0.0118 1089 ILE A CA  
1114 C C   . ILE A 68  ? 0.0758 0.0627 0.0966 -0.0055 -0.0072 -0.0070 1089 ILE A C   
1115 O O   . ILE A 68  ? 0.0837 0.0925 0.0961 -0.0049 -0.0087 -0.0080 1089 ILE A O   
1116 C CB  . ILE A 68  ? 0.0809 0.0726 0.1021 0.0026  -0.0044 -0.0018 1089 ILE A CB  
1117 C CG1 . ILE A 68  ? 0.0953 0.0817 0.1159 -0.0046 0.0052  -0.0206 1089 ILE A CG1 
1118 C CG2 . ILE A 68  ? 0.0929 0.0913 0.1105 -0.0051 0.0215  -0.0151 1089 ILE A CG2 
1119 C CD1 . ILE A 68  ? 0.1173 0.1056 0.1256 -0.0058 -0.0132 0.0074  1089 ILE A CD1 
1131 N N   A SER A 69  ? 0.0767 0.0978 0.0756 -0.0194 -0.0303 0.0108  1090 SER A N   
1132 N N   B SER A 69  ? 0.0855 0.0695 0.1589 0.0065  0.0309  -0.0131 1090 SER A N   
1133 C CA  A SER A 69  ? 0.0959 0.0975 0.1126 -0.0200 0.0316  0.0108  1090 SER A CA  
1134 C CA  B SER A 69  ? 0.0680 0.0789 0.1271 -0.0192 -0.0235 -0.0213 1090 SER A CA  
1135 C C   A SER A 69  ? 0.0883 0.0908 0.1000 -0.0369 0.0016  0.0180  1090 SER A C   
1136 C C   B SER A 69  ? 0.0728 0.0814 0.1323 -0.0060 -0.0448 -0.0061 1090 SER A C   
1137 O O   A SER A 69  ? 0.1094 0.1058 0.1010 -0.0338 0.0316  0.0283  1090 SER A O   
1138 O O   B SER A 69  ? 0.1334 0.0913 0.1338 0.0159  -0.0489 -0.0098 1090 SER A O   
1139 C CB  A SER A 69  ? 0.0696 0.1093 0.2075 -0.0052 0.0152  0.0140  1090 SER A CB  
1140 C CB  B SER A 69  ? 0.1290 0.1227 0.0526 -0.0221 -0.0219 0.0290  1090 SER A CB  
1141 O OG  A SER A 69  ? 0.0897 0.1053 0.2296 -0.0155 -0.0605 0.0114  1090 SER A OG  
1142 O OG  B SER A 69  ? 0.1883 0.1540 0.1025 -0.0649 -0.0316 0.0302  1090 SER A OG  
1153 N N   . ALA A 70  ? 0.0837 0.0825 0.1065 -0.0040 -0.0083 0.0033  1091 ALA A N   
1154 C CA  . ALA A 70  ? 0.0883 0.0772 0.1232 0.0049  -0.0066 0.0151  1091 ALA A CA  
1155 C C   . ALA A 70  ? 0.0873 0.0864 0.1069 -0.0060 -0.0183 0.0096  1091 ALA A C   
1156 O O   . ALA A 70  ? 0.1505 0.0899 0.1270 -0.0131 -0.0474 0.0159  1091 ALA A O   
1157 C CB  . ALA A 70  ? 0.0857 0.1031 0.1396 -0.0003 -0.0147 -0.0038 1091 ALA A CB  
1163 N N   . ILE A 71  ? 0.0701 0.0842 0.1142 -0.0135 -0.0160 0.0049  1092 ILE A N   
1164 C CA  . ILE A 71  ? 0.0606 0.0855 0.1027 -0.0158 -0.0120 -0.0020 1092 ILE A CA  
1165 C C   . ILE A 71  ? 0.0542 0.0990 0.1150 -0.0142 -0.0125 0.0138  1092 ILE A C   
1166 O O   . ILE A 71  ? 0.0709 0.1225 0.0974 -0.0177 -0.0104 0.0026  1092 ILE A O   
1167 C CB  . ILE A 71  ? 0.0621 0.0939 0.0960 -0.0121 -0.0099 -0.0046 1092 ILE A CB  
1168 C CG1 . ILE A 71  ? 0.0834 0.0823 0.1052 -0.0232 -0.0104 -0.0072 1092 ILE A CG1 
1169 C CG2 . ILE A 71  ? 0.0767 0.1192 0.0903 -0.0074 -0.0025 0.0086  1092 ILE A CG2 
1170 C CD1 . ILE A 71  ? 0.1033 0.0888 0.1168 -0.0302 -0.0124 -0.0032 1092 ILE A CD1 
1182 N N   . ARG A 72  ? 0.0766 0.1005 0.0938 -0.0135 -0.0099 0.0028  1093 ARG A N   
1183 C CA  . ARG A 72  ? 0.0789 0.1163 0.0950 -0.0197 0.0226  0.0102  1093 ARG A CA  
1184 C C   . ARG A 72  ? 0.0894 0.1342 0.1031 -0.0232 0.0100  0.0022  1093 ARG A C   
1185 O O   . ARG A 72  ? 0.1226 0.1729 0.0966 -0.0353 0.0118  0.0059  1093 ARG A O   
1186 C CB  . ARG A 72  ? 0.0765 0.1258 0.0961 -0.0107 -0.0036 -0.0131 1093 ARG A CB  
1187 C CG  . ARG A 72  ? 0.0799 0.1274 0.0953 0.0123  -0.0027 -0.0028 1093 ARG A CG  
1188 C CD  . ARG A 72  ? 0.0898 0.1441 0.1472 0.0080  -0.0191 0.0038  1093 ARG A CD  
1189 N NE  . ARG A 72  ? 0.0879 0.1303 0.1689 0.0021  0.0205  0.0018  1093 ARG A NE  
1190 C CZ  . ARG A 72  ? 0.0848 0.1427 0.1782 0.0115  -0.0263 0.0154  1093 ARG A CZ  
1191 N NH1 . ARG A 72  ? 0.1080 0.1406 0.2458 -0.0182 -0.0483 0.0503  1093 ARG A NH1 
1192 N NH2 . ARG A 72  ? 0.0811 0.1493 0.1994 0.0079  -0.0170 0.0190  1093 ARG A NH2 
1206 N N   . ARG A 73  ? 0.1046 0.1101 0.1162 -0.0293 -0.0119 0.0183  1094 ARG A N   
1207 C CA  . ARG A 73  ? 0.1487 0.1213 0.1442 -0.0130 -0.0248 0.0214  1094 ARG A CA  
1208 C C   . ARG A 73  ? 0.1293 0.1116 0.1081 -0.0120 -0.0078 0.0227  1094 ARG A C   
1209 O O   . ARG A 73  ? 0.1560 0.1237 0.1250 -0.0316 -0.0232 0.0400  1094 ARG A O   
1219 N N   . LEU A 74  ? 0.0963 0.1058 0.0895 -0.0045 -0.0065 0.0172  1095 LEU A N   
1220 C CA  . LEU A 74  ? 0.0922 0.0976 0.0998 -0.0062 -0.0009 0.0044  1095 LEU A CA  
1221 C C   . LEU A 74  ? 0.0942 0.1088 0.0835 -0.0049 0.0020  -0.0036 1095 LEU A C   
1222 O O   . LEU A 74  ? 0.1031 0.1233 0.0881 -0.0102 0.0058  0.0176  1095 LEU A O   
1223 C CB  . LEU A 74  ? 0.0790 0.1306 0.1077 -0.0102 -0.0076 0.0142  1095 LEU A CB  
1224 C CG  . LEU A 74  ? 0.1151 0.1637 0.0900 0.0035  -0.0013 0.0208  1095 LEU A CG  
1225 C CD1 . LEU A 74  ? 0.1226 0.1734 0.1029 -0.0519 -0.0075 0.0402  1095 LEU A CD1 
1226 C CD2 . LEU A 74  ? 0.1531 0.2026 0.1223 0.0292  0.0073  0.0092  1095 LEU A CD2 
1238 N N   . THR A 75  ? 0.1005 0.1118 0.0962 -0.0074 -0.0035 0.0190  1096 THR A N   
1239 C CA  . THR A 75  ? 0.1072 0.1370 0.0842 -0.0126 -0.0146 0.0176  1096 THR A CA  
1240 C C   . THR A 75  ? 0.1093 0.1258 0.0680 -0.0160 0.0099  0.0183  1096 THR A C   
1241 O O   . THR A 75  ? 0.1029 0.1239 0.0828 -0.0230 0.0157  0.0120  1096 THR A O   
1242 C CB  . THR A 75  ? 0.1381 0.1686 0.1413 -0.0478 0.0102  0.0290  1096 THR A CB  
1243 O OG1 . THR A 75  ? 0.1718 0.1569 0.1551 -0.0238 -0.0074 0.0488  1096 THR A OG1 
1244 C CG2 . THR A 75  ? 0.1778 0.2138 0.1740 -0.0834 -0.0062 0.0639  1096 THR A CG2 
1252 N N   . LEU A 76  ? 0.1113 0.1487 0.0809 0.0040  0.0023  -0.0036 1097 LEU A N   
1253 C CA  . LEU A 76  ? 0.1187 0.1377 0.0971 0.0048  -0.0397 -0.0130 1097 LEU A CA  
1254 C C   . LEU A 76  ? 0.1137 0.1159 0.0952 -0.0172 -0.0031 0.0034  1097 LEU A C   
1255 O O   . LEU A 76  ? 0.1359 0.1169 0.0973 -0.0299 -0.0128 0.0366  1097 LEU A O   
1256 C CB  . LEU A 76  ? 0.1841 0.1553 0.1097 0.0251  -0.0432 -0.0237 1097 LEU A CB  
1257 C CG  . LEU A 76  ? 0.2296 0.1684 0.1940 0.0050  -0.0906 -0.0717 1097 LEU A CG  
1258 C CD1 . LEU A 76  ? 0.1672 0.1901 0.2355 -0.0177 0.0027  -0.0711 1097 LEU A CD1 
1259 C CD2 . LEU A 76  ? 0.3131 0.1931 0.2772 -0.0064 -0.1362 -0.0377 1097 LEU A CD2 
1271 N N   . LEU A 77  ? 0.1028 0.0910 0.0928 -0.0193 -0.0144 0.0150  1098 LEU A N   
1272 C CA  . LEU A 77  ? 0.0967 0.1020 0.1201 0.0012  -0.0153 0.0305  1098 LEU A CA  
1273 C C   . LEU A 77  ? 0.1152 0.0974 0.1199 -0.0196 0.0042  0.0449  1098 LEU A C   
1274 O O   . LEU A 77  ? 0.1605 0.1087 0.1357 -0.0324 -0.0082 0.0519  1098 LEU A O   
1275 C CB  . LEU A 77  ? 0.1141 0.1060 0.1222 -0.0142 -0.0277 0.0191  1098 LEU A CB  
1276 C CG  . LEU A 77  ? 0.1278 0.1221 0.1348 -0.0141 -0.0134 0.0333  1098 LEU A CG  
1277 C CD1 . LEU A 77  ? 0.1438 0.1306 0.1589 -0.0170 0.0112  0.0100  1098 LEU A CD1 
1278 C CD2 . LEU A 77  ? 0.1230 0.1306 0.1364 -0.0063 -0.0314 0.0323  1098 LEU A CD2 
1290 N N   . GLY A 78  ? 0.1166 0.1213 0.0932 -0.0227 -0.0295 0.0414  1099 GLY A N   
1291 C CA  . GLY A 78  ? 0.1206 0.1590 0.1004 -0.0335 -0.0323 0.0538  1099 GLY A CA  
1292 C C   . GLY A 78  ? 0.1223 0.1702 0.1161 -0.0404 -0.0157 0.0591  1099 GLY A C   
1293 O O   . GLY A 78  ? 0.1199 0.1922 0.1311 -0.0304 -0.0320 0.0469  1099 GLY A O   
1297 N N   . GLY A 79  ? 0.1485 0.2125 0.1144 -0.0583 -0.0443 0.0245  1100 GLY A N   
1298 C CA  . GLY A 79  ? 0.1556 0.1838 0.1416 -0.0550 -0.0449 0.0310  1100 GLY A CA  
1299 C C   . GLY A 79  ? 0.1718 0.1681 0.1434 -0.0400 -0.0333 0.0284  1100 GLY A C   
1300 O O   . GLY A 79  ? 0.1653 0.1874 0.1590 -0.0305 -0.0154 0.0579  1100 GLY A O   
1304 N N   . PRO A 80  ? 0.1782 0.1993 0.1597 -0.0451 -0.0943 0.0201  1101 PRO A N   
1305 C CA  . PRO A 80  ? 0.2379 0.2573 0.1791 -0.0948 -0.0883 -0.0016 1101 PRO A CA  
1306 C C   . PRO A 80  ? 0.2607 0.2893 0.2034 -0.1385 -0.0323 -0.0482 1101 PRO A C   
1307 O O   . PRO A 80  ? 0.4533 0.3405 0.2686 -0.1738 0.1651  -0.0805 1101 PRO A O   
1308 C CB  . PRO A 80  ? 0.2397 0.3042 0.2357 -0.0379 -0.1364 -0.0154 1101 PRO A CB  
1309 C CG  . PRO A 80  ? 0.1994 0.3112 0.2830 -0.0163 -0.1306 -0.0162 1101 PRO A CG  
1310 C CD  . PRO A 80  ? 0.1975 0.2639 0.2297 -0.0098 -0.1063 -0.0010 1101 PRO A CD  
1318 N N   . THR A 81  ? 0.1905 0.2673 0.1687 -0.0961 0.0555  -0.0132 1102 THR A N   
1319 C CA  . THR A 81  ? 0.1821 0.3594 0.1813 -0.1010 -0.0166 -0.0012 1102 THR A CA  
1320 C C   . THR A 81  ? 0.2162 0.2889 0.1134 -0.0866 -0.0208 -0.0299 1102 THR A C   
1321 O O   . THR A 81  ? 0.2865 0.2698 0.1252 -0.0743 -0.0466 -0.0141 1102 THR A O   
1322 C CB  . THR A 81  ? 0.3178 0.5042 0.2549 -0.1018 -0.0401 0.0384  1102 THR A CB  
1323 O OG1 . THR A 81  ? 0.4121 0.5854 0.4630 -0.0772 0.0247  0.0414  1102 THR A OG1 
1324 C CG2 . THR A 81  ? 0.3336 0.5489 0.2288 -0.0493 -0.0284 0.0419  1102 THR A CG2 
1332 N N   . PRO A 82  ? 0.2655 0.2195 0.1976 -0.1094 0.0663  -0.0236 1103 PRO A N   
1333 C CA  . PRO A 82  ? 0.2568 0.1597 0.1578 -0.0799 0.0663  -0.0390 1103 PRO A CA  
1334 C C   . PRO A 82  ? 0.1882 0.1463 0.1363 -0.0910 0.0277  -0.0363 1103 PRO A C   
1335 O O   . PRO A 82  ? 0.2041 0.1606 0.1549 -0.0786 0.0418  -0.0377 1103 PRO A O   
1336 C CB  . PRO A 82  ? 0.2573 0.1710 0.2022 -0.0627 0.0494  -0.0536 1103 PRO A CB  
1337 C CG  . PRO A 82  ? 0.2988 0.2173 0.2268 -0.0411 0.0905  -0.0244 1103 PRO A CG  
1338 C CD  . PRO A 82  ? 0.3350 0.2231 0.1986 -0.0621 0.0857  -0.0319 1103 PRO A CD  
1346 N N   . ASN A 83  ? 0.2034 0.1704 0.1061 -0.0625 0.0316  -0.0201 1104 ASN A N   
1347 C CA  . ASN A 83  ? 0.1543 0.1670 0.0796 -0.0233 -0.0156 0.0267  1104 ASN A CA  
1348 C C   . ASN A 83  ? 0.1173 0.1261 0.1083 -0.0159 -0.0046 0.0015  1104 ASN A C   
1349 O O   . ASN A 83  ? 0.1087 0.1188 0.0939 -0.0131 -0.0137 0.0172  1104 ASN A O   
1350 C CB  . ASN A 83  ? 0.1678 0.1957 0.1218 -0.0307 -0.0580 0.0678  1104 ASN A CB  
1351 C CG  . ASN A 83  ? 0.2539 0.2062 0.1777 -0.0392 -0.0891 0.0518  1104 ASN A CG  
1352 O OD1 . ASN A 83  ? 0.3957 0.2221 0.1836 -0.0601 -0.0989 0.0523  1104 ASN A OD1 
1353 N ND2 . ASN A 83  ? 0.2169 0.2387 0.1967 -0.0136 -0.1039 0.0744  1104 ASN A ND2 
1360 N N   . THR A 84  ? 0.1083 0.1168 0.0952 -0.0249 -0.0201 -0.0042 1105 THR A N   
1361 C CA  . THR A 84  ? 0.0971 0.1026 0.1014 -0.0165 -0.0231 -0.0107 1105 THR A CA  
1362 C C   . THR A 84  ? 0.0781 0.1075 0.0973 -0.0202 -0.0382 0.0054  1105 THR A C   
1363 O O   . THR A 84  ? 0.0824 0.1089 0.1034 -0.0020 -0.0288 -0.0005 1105 THR A O   
1364 C CB  . THR A 84  ? 0.0963 0.1208 0.1153 -0.0196 0.0124  -0.0165 1105 THR A CB  
1365 O OG1 . THR A 84  ? 0.0980 0.1240 0.1188 -0.0134 0.0022  -0.0345 1105 THR A OG1 
1366 C CG2 . THR A 84  ? 0.1256 0.1424 0.1179 0.0098  -0.0114 0.0016  1105 THR A CG2 
1374 N N   . GLY A 85  ? 0.1016 0.1137 0.0828 -0.0037 -0.0249 -0.0063 1106 GLY A N   
1375 C CA  . GLY A 85  ? 0.0830 0.1167 0.1040 -0.0036 -0.0299 0.0043  1106 GLY A CA  
1376 C C   . GLY A 85  ? 0.0795 0.0974 0.1270 -0.0303 -0.0174 0.0052  1106 GLY A C   
1377 O O   . GLY A 85  ? 0.0955 0.1096 0.1150 -0.0022 -0.0274 0.0089  1106 GLY A O   
1381 N N   . ALA A 86  ? 0.0900 0.1071 0.0995 -0.0132 -0.0203 0.0235  1107 ALA A N   
1382 C CA  . ALA A 86  ? 0.0965 0.0832 0.1292 -0.0005 -0.0323 0.0066  1107 ALA A CA  
1383 C C   . ALA A 86  ? 0.0895 0.0862 0.1147 -0.0024 -0.0170 0.0083  1107 ALA A C   
1384 O O   . ALA A 86  ? 0.0931 0.0854 0.1207 -0.0008 -0.0175 0.0127  1107 ALA A O   
1385 C CB  . ALA A 86  ? 0.1421 0.1038 0.1230 -0.0021 -0.0305 0.0169  1107 ALA A CB  
1391 N N   . ALA A 87  ? 0.0908 0.0939 0.0752 -0.0009 -0.0122 0.0166  1108 ALA A N   
1392 C CA  . ALA A 87  ? 0.0947 0.0999 0.0830 -0.0026 -0.0208 0.0104  1108 ALA A CA  
1393 C C   . ALA A 87  ? 0.0720 0.0957 0.0890 -0.0049 -0.0107 0.0052  1108 ALA A C   
1394 O O   . ALA A 87  ? 0.0726 0.0887 0.0788 0.0026  -0.0031 -0.0053 1108 ALA A O   
1395 C CB  . ALA A 87  ? 0.0936 0.1292 0.0643 0.0113  -0.0155 0.0095  1108 ALA A CB  
1401 N N   . LEU A 88  ? 0.0826 0.0913 0.0656 -0.0024 -0.0161 0.0019  1109 LEU A N   
1402 C CA  . LEU A 88  ? 0.0881 0.0708 0.0980 0.0073  -0.0001 0.0089  1109 LEU A CA  
1403 C C   . LEU A 88  ? 0.0634 0.0791 0.0736 -0.0018 -0.0163 0.0039  1109 LEU A C   
1404 O O   . LEU A 88  ? 0.0789 0.0697 0.0860 0.0003  0.0077  0.0061  1109 LEU A O   
1405 C CB  . LEU A 88  ? 0.0906 0.0833 0.1023 0.0001  -0.0022 0.0121  1109 LEU A CB  
1406 C CG  . LEU A 88  ? 0.1058 0.0688 0.1099 0.0079  0.0082  -0.0045 1109 LEU A CG  
1407 C CD1 . LEU A 88  ? 0.1741 0.0690 0.1389 0.0079  -0.0151 -0.0163 1109 LEU A CD1 
1408 C CD2 . LEU A 88  ? 0.0927 0.0741 0.1791 0.0204  0.0067  0.0048  1109 LEU A CD2 
1420 N N   . GLU A 89  ? 0.0662 0.0970 0.0875 -0.0029 -0.0055 0.0023  1110 GLU A N   
1421 C CA  . GLU A 89  ? 0.0634 0.0924 0.1153 0.0022  0.0088  -0.0046 1110 GLU A CA  
1422 C C   . GLU A 89  ? 0.0655 0.0718 0.1309 0.0126  0.0086  0.0197  1110 GLU A C   
1423 O O   . GLU A 89  ? 0.0971 0.0813 0.1245 0.0083  0.0256  -0.0077 1110 GLU A O   
1424 C CB  . GLU A 89  ? 0.0907 0.1152 0.1234 -0.0134 -0.0001 -0.0011 1110 GLU A CB  
1425 C CG  . GLU A 89  ? 0.0656 0.1189 0.2010 0.0010  -0.0152 0.0012  1110 GLU A CG  
1426 C CD  . GLU A 89  ? 0.1068 0.1323 0.2205 -0.0092 -0.0229 0.0223  1110 GLU A CD  
1427 O OE1 . GLU A 89  ? 0.1132 0.1614 0.2943 -0.0097 -0.0631 0.0490  1110 GLU A OE1 
1428 O OE2 . GLU A 89  ? 0.1049 0.1356 0.2566 0.0036  -0.0139 0.0302  1110 GLU A OE2 
1435 N N   . PHE A 90  ? 0.0732 0.0643 0.1061 0.0093  -0.0015 0.0031  1111 PHE A N   
1436 C CA  . PHE A 90  ? 0.0904 0.0652 0.0899 0.0114  0.0102  0.0170  1111 PHE A CA  
1437 C C   . PHE A 90  ? 0.0730 0.0643 0.0935 0.0164  0.0111  0.0067  1111 PHE A C   
1438 O O   . PHE A 90  ? 0.0933 0.0652 0.0901 0.0031  0.0116  0.0021  1111 PHE A O   
1439 C CB  . PHE A 90  ? 0.0970 0.0769 0.1095 -0.0163 -0.0150 0.0119  1111 PHE A CB  
1440 C CG  . PHE A 90  ? 0.1509 0.1054 0.0984 -0.0197 0.0050  0.0192  1111 PHE A CG  
1441 C CD1 . PHE A 90  ? 0.1437 0.0996 0.1221 0.0010  0.0184  0.0009  1111 PHE A CD1 
1442 C CD2 . PHE A 90  ? 0.1116 0.1293 0.1295 -0.0358 -0.0067 0.0297  1111 PHE A CD2 
1443 C CE1 . PHE A 90  ? 0.1286 0.1211 0.1626 -0.0315 0.0003  -0.0074 1111 PHE A CE1 
1444 C CE2 . PHE A 90  ? 0.1143 0.1435 0.1361 -0.0215 0.0034  0.0027  1111 PHE A CE2 
1445 C CZ  . PHE A 90  ? 0.1623 0.1258 0.1652 -0.0306 -0.0040 -0.0050 1111 PHE A CZ  
1455 N N   . VAL A 91  ? 0.0709 0.0670 0.0840 -0.0013 0.0016  -0.0064 1112 VAL A N   
1456 C CA  . VAL A 91  ? 0.0622 0.0640 0.0834 0.0081  0.0097  -0.0021 1112 VAL A CA  
1457 C C   . VAL A 91  ? 0.0740 0.0671 0.0921 0.0192  0.0018  -0.0009 1112 VAL A C   
1458 O O   . VAL A 91  ? 0.0988 0.0705 0.0780 0.0142  -0.0008 0.0021  1112 VAL A O   
1459 C CB  . VAL A 91  ? 0.0827 0.0706 0.0920 0.0090  0.0045  -0.0245 1112 VAL A CB  
1460 C CG1 . VAL A 91  ? 0.1112 0.0791 0.1040 0.0247  -0.0050 -0.0089 1112 VAL A CG1 
1461 C CG2 . VAL A 91  ? 0.0677 0.0844 0.1044 0.0069  0.0034  -0.0184 1112 VAL A CG2 
1471 N N   . LEU A 92  ? 0.0844 0.0612 0.0988 0.0130  0.0033  0.0028  1113 LEU A N   
1472 C CA  . LEU A 92  ? 0.0931 0.0668 0.1065 -0.0038 0.0269  -0.0035 1113 LEU A CA  
1473 C C   . LEU A 92  ? 0.1051 0.0922 0.0974 0.0053  0.0031  -0.0027 1113 LEU A C   
1474 O O   . LEU A 92  ? 0.1430 0.0895 0.0997 0.0020  0.0199  -0.0016 1113 LEU A O   
1475 C CB  . LEU A 92  ? 0.1188 0.0769 0.1272 -0.0069 0.0272  0.0074  1113 LEU A CB  
1476 C CG  . LEU A 92  ? 0.1631 0.1218 0.1603 -0.0148 0.0827  0.0241  1113 LEU A CG  
1477 C CD1 . LEU A 92  ? 0.2165 0.1458 0.1492 -0.0470 0.0742  0.0269  1113 LEU A CD1 
1478 C CD2 . LEU A 92  ? 0.1661 0.1399 0.2284 -0.0129 0.1114  0.0066  1113 LEU A CD2 
1490 N N   . ARG A 93  ? 0.0966 0.0856 0.0931 0.0148  0.0254  -0.0082 1114 ARG A N   
1491 C CA  . ARG A 93  ? 0.0834 0.0751 0.1402 0.0143  0.0082  -0.0114 1114 ARG A CA  
1492 C C   . ARG A 93  ? 0.0848 0.0718 0.0927 0.0295  0.0150  -0.0048 1114 ARG A C   
1493 O O   . ARG A 93  ? 0.0951 0.0831 0.1057 0.0173  0.0091  -0.0177 1114 ARG A O   
1494 C CB  . ARG A 93  ? 0.0849 0.0934 0.2325 0.0108  0.0248  -0.0483 1114 ARG A CB  
1495 C CG  . ARG A 93  ? 0.1121 0.1461 0.3406 -0.0183 0.0137  -0.0663 1114 ARG A CG  
1496 C CD  . ARG A 93  ? 0.1768 0.2090 0.3123 -0.0855 0.0462  -0.0983 1114 ARG A CD  
1497 N NE  . ARG A 93  ? 0.1634 0.2134 0.2596 -0.0502 0.0490  -0.1046 1114 ARG A NE  
1498 C CZ  . ARG A 93  ? 0.2054 0.1768 0.2416 0.0008  0.0428  -0.0863 1114 ARG A CZ  
1499 N NH1 . ARG A 93  ? 0.1472 0.2387 0.2798 -0.0242 0.0497  -0.0827 1114 ARG A NH1 
1500 N NH2 . ARG A 93  ? 0.1148 0.1515 0.3564 -0.0057 0.0528  -0.0649 1114 ARG A NH2 
1514 N N   . ASN A 94  ? 0.0935 0.0598 0.1138 0.0193  0.0175  -0.0120 1115 ASN A N   
1515 C CA  . ASN A 94  ? 0.0958 0.0567 0.1137 0.0292  0.0166  -0.0136 1115 ASN A CA  
1516 C C   . ASN A 94  ? 0.0839 0.0782 0.1176 0.0223  0.0016  -0.0210 1115 ASN A C   
1517 O O   . ASN A 94  ? 0.1056 0.0920 0.2220 0.0212  -0.0131 -0.0614 1115 ASN A O   
1518 C CB  . ASN A 94  ? 0.0876 0.0718 0.1087 0.0149  0.0087  0.0085  1115 ASN A CB  
1519 C CG  . ASN A 94  ? 0.0949 0.0727 0.1176 0.0225  0.0179  0.0084  1115 ASN A CG  
1520 O OD1 . ASN A 94  ? 0.0994 0.0759 0.1039 0.0216  -0.0015 -0.0109 1115 ASN A OD1 
1521 N ND2 . ASN A 94  ? 0.1104 0.0904 0.1657 0.0200  -0.0130 -0.0377 1115 ASN A ND2 
1528 N N   . ILE A 95  ? 0.0953 0.0606 0.0851 0.0229  0.0145  -0.0041 1116 ILE A N   
1529 C CA  . ILE A 95  ? 0.0807 0.0748 0.0967 0.0123  0.0103  -0.0034 1116 ILE A CA  
1530 C C   . ILE A 95  ? 0.0839 0.0796 0.1075 0.0101  0.0186  0.0089  1116 ILE A C   
1531 O O   . ILE A 95  ? 0.0865 0.1129 0.0934 -0.0020 0.0040  -0.0005 1116 ILE A O   
1532 C CB  . ILE A 95  ? 0.0782 0.0778 0.0941 0.0255  0.0089  -0.0002 1116 ILE A CB  
1533 C CG1 . ILE A 95  ? 0.1020 0.0979 0.1114 -0.0125 0.0212  -0.0128 1116 ILE A CG1 
1534 C CG2 . ILE A 95  ? 0.0905 0.1054 0.1040 0.0213  0.0319  -0.0040 1116 ILE A CG2 
1535 C CD1 . ILE A 95  ? 0.1289 0.1258 0.1187 -0.0090 0.0001  -0.0013 1116 ILE A CD1 
1547 N N   . LEU A 96  ? 0.0746 0.0773 0.0820 0.0088  0.0066  0.0039  1117 LEU A N   
1548 C CA  . LEU A 96  ? 0.0964 0.0850 0.0794 0.0152  0.0009  0.0075  1117 LEU A CA  
1549 C C   . LEU A 96  ? 0.0696 0.0925 0.0652 0.0105  0.0140  0.0069  1117 LEU A C   
1550 O O   . LEU A 96  ? 0.0984 0.1008 0.0929 0.0007  0.0224  -0.0084 1117 LEU A O   
1551 C CB  . LEU A 96  ? 0.1090 0.0760 0.0899 0.0093  0.0089  0.0046  1117 LEU A CB  
1552 C CG  . LEU A 96  ? 0.1160 0.0704 0.1015 0.0123  0.0130  0.0043  1117 LEU A CG  
1553 C CD1 . LEU A 96  ? 0.1376 0.0597 0.1481 0.0199  0.0178  0.0051  1117 LEU A CD1 
1554 C CD2 . LEU A 96  ? 0.1489 0.0970 0.1294 0.0183  0.0463  -0.0058 1117 LEU A CD2 
1566 N N   . THR A 97  ? 0.0855 0.0823 0.1045 -0.0005 0.0100  -0.0088 1118 THR A N   
1567 C CA  . THR A 97  ? 0.0710 0.0964 0.1273 0.0222  -0.0211 -0.0027 1118 THR A CA  
1568 C C   . THR A 97  ? 0.0848 0.0862 0.0971 0.0184  0.0163  0.0095  1118 THR A C   
1569 O O   . THR A 97  ? 0.0928 0.0760 0.1248 0.0267  0.0058  -0.0209 1118 THR A O   
1570 C CB  . THR A 97  ? 0.1366 0.1310 0.2028 -0.0025 -0.0534 0.0170  1118 THR A CB  
1571 O OG1 . THR A 97  ? 0.2024 0.2287 0.2966 -0.0934 -0.1192 0.1371  1118 THR A OG1 
1572 C CG2 . THR A 97  ? 0.1088 0.1130 0.1316 0.0198  -0.0090 -0.0079 1118 THR A CG2 
1580 N N   A SER A 98  ? 0.0948 0.0978 0.1060 0.0324  0.0219  0.0015  1119 SER A N   
1581 N N   B SER A 98  ? 0.1025 0.0861 0.1163 0.0164  0.0263  0.0042  1119 SER A N   
1582 C CA  A SER A 98  ? 0.0984 0.1198 0.0958 0.0157  -0.0237 -0.0084 1119 SER A CA  
1583 C CA  B SER A 98  ? 0.1109 0.0891 0.1078 0.0124  0.0287  -0.0201 1119 SER A CA  
1584 C C   A SER A 98  ? 0.1009 0.1013 0.1104 0.0253  0.0092  -0.0330 1119 SER A C   
1585 C C   B SER A 98  ? 0.1171 0.1009 0.0695 0.0233  0.0231  -0.0129 1119 SER A C   
1586 O O   A SER A 98  ? 0.0969 0.1116 0.1406 0.0114  -0.0228 -0.0313 1119 SER A O   
1587 O O   B SER A 98  ? 0.1082 0.1068 0.0639 0.0258  0.0298  -0.0209 1119 SER A O   
1588 C CB  A SER A 98  ? 0.1682 0.1609 0.0957 -0.0074 0.0197  0.0006  1119 SER A CB  
1589 C CB  B SER A 98  ? 0.0884 0.0757 0.0956 0.0098  0.0128  -0.0467 1119 SER A CB  
1590 O OG  A SER A 98  ? 0.1896 0.2053 0.1662 0.0513  0.0425  -0.0073 1119 SER A OG  
1591 O OG  B SER A 98  ? 0.0535 0.0653 0.0689 0.0164  -0.0069 -0.0375 1119 SER A OG  
1602 N N   A SER A 99  ? 0.0748 0.0864 0.1127 0.0092  -0.0022 -0.0366 1120 SER A N   
1603 N N   B SER A 99  ? 0.1068 0.1013 0.0596 0.0299  -0.0038 0.0052  1120 SER A N   
1604 C CA  A SER A 99  ? 0.0905 0.0827 0.1245 -0.0056 0.0269  -0.0246 1120 SER A CA  
1605 C CA  B SER A 99  ? 0.1088 0.0971 0.1062 0.0219  0.0281  -0.0131 1120 SER A CA  
1606 C C   A SER A 99  ? 0.1099 0.0793 0.1210 0.0039  -0.0062 -0.0047 1120 SER A C   
1607 C C   B SER A 99  ? 0.1045 0.0846 0.1267 0.0109  0.0384  -0.0097 1120 SER A C   
1608 O O   A SER A 99  ? 0.1150 0.0841 0.1708 0.0017  0.0332  -0.0234 1120 SER A O   
1609 O O   B SER A 99  ? 0.1051 0.0779 0.1451 -0.0105 0.0717  -0.0162 1120 SER A O   
1610 C CB  A SER A 99  ? 0.0984 0.0811 0.1550 0.0112  0.0192  -0.0071 1120 SER A CB  
1611 C CB  B SER A 99  ? 0.0916 0.0959 0.0873 0.0203  -0.0168 -0.0325 1120 SER A CB  
1612 O OG  A SER A 99  ? 0.1147 0.0906 0.1541 0.0342  0.0091  -0.0151 1120 SER A OG  
1613 O OG  B SER A 99  ? 0.0759 0.0810 0.1314 0.0454  0.0028  -0.0007 1120 SER A OG  
1624 N N   . THR A 100 ? 0.0882 0.0818 0.1197 0.0129  0.0025  -0.0124 1121 THR A N   
1625 C CA  . THR A 100 ? 0.0939 0.0866 0.1080 0.0180  -0.0027 -0.0103 1121 THR A CA  
1626 C C   . THR A 100 ? 0.0955 0.0914 0.1234 0.0416  0.0276  0.0040  1121 THR A C   
1627 O O   . THR A 100 ? 0.1410 0.1110 0.1061 0.0579  0.0097  -0.0069 1121 THR A O   
1628 C CB  . THR A 100 ? 0.1369 0.1022 0.1214 0.0096  -0.0175 0.0167  1121 THR A CB  
1629 O OG1 . THR A 100 ? 0.3216 0.0981 0.1160 -0.0360 0.0076  -0.0080 1121 THR A OG1 
1630 C CG2 . THR A 100 ? 0.1187 0.1179 0.1228 -0.0057 0.0082  -0.0015 1121 THR A CG2 
1638 N N   . GLY A 101 ? 0.0929 0.0769 0.0947 0.0099  0.0176  -0.0131 1122 GLY A N   
1639 C CA  . GLY A 101 ? 0.0997 0.0899 0.0872 0.0102  0.0027  -0.0081 1122 GLY A CA  
1640 C C   . GLY A 101 ? 0.0725 0.0871 0.0949 0.0069  -0.0092 -0.0173 1122 GLY A C   
1641 O O   . GLY A 101 ? 0.1013 0.1016 0.0919 0.0183  -0.0151 -0.0151 1122 GLY A O   
1645 N N   . SER A 102 ? 0.0940 0.0839 0.0816 0.0064  -0.0043 -0.0027 1123 SER A N   
1646 C CA  . SER A 102 ? 0.0993 0.0882 0.0712 -0.0088 -0.0005 0.0017  1123 SER A CA  
1647 C C   . SER A 102 ? 0.0957 0.0909 0.0952 0.0276  0.0089  -0.0217 1123 SER A C   
1648 O O   . SER A 102 ? 0.1362 0.1061 0.0801 0.0294  0.0107  -0.0095 1123 SER A O   
1649 C CB  . SER A 102 ? 0.1211 0.0838 0.0826 -0.0016 -0.0183 0.0041  1123 SER A CB  
1650 O OG  . SER A 102 ? 0.1056 0.0865 0.0748 -0.0022 0.0025  0.0065  1123 SER A OG  
1656 N N   . ARG A 103 ? 0.0943 0.0835 0.0887 0.0267  0.0070  0.0069  1124 ARG A N   
1657 C CA  . ARG A 103 ? 0.1302 0.0878 0.0717 0.0249  0.0105  0.0063  1124 ARG A CA  
1658 C C   . ARG A 103 ? 0.0838 0.0968 0.0774 0.0108  0.0085  -0.0006 1124 ARG A C   
1659 O O   . ARG A 103 ? 0.1201 0.1258 0.0797 0.0050  0.0231  -0.0010 1124 ARG A O   
1660 C CB  . ARG A 103 ? 0.1190 0.1128 0.0676 0.0306  -0.0187 -0.0088 1124 ARG A CB  
1661 C CG  . ARG A 103 ? 0.1356 0.1104 0.0899 -0.0023 -0.0138 -0.0220 1124 ARG A CG  
1662 C CD  . ARG A 103 ? 0.1330 0.1374 0.1060 0.0052  -0.0118 0.0030  1124 ARG A CD  
1663 N NE  . ARG A 103 ? 0.1211 0.1364 0.0863 -0.0146 -0.0021 -0.0038 1124 ARG A NE  
1664 C CZ  . ARG A 103 ? 0.1053 0.1743 0.1023 -0.0188 -0.0037 -0.0096 1124 ARG A CZ  
1665 N NH1 . ARG A 103 ? 0.1047 0.2019 0.1259 0.0041  0.0059  -0.0270 1124 ARG A NH1 
1666 N NH2 . ARG A 103 ? 0.0761 0.1794 0.1023 -0.0073 0.0097  -0.0095 1124 ARG A NH2 
1680 N N   . ILE A 104 ? 0.0886 0.1153 0.0914 0.0106  0.0187  -0.0050 1125 ILE A N   
1681 C CA  . ILE A 104 ? 0.1099 0.1418 0.0753 0.0353  0.0181  0.0200  1125 ILE A CA  
1682 C C   . ILE A 104 ? 0.1114 0.1623 0.0808 0.0016  0.0103  -0.0089 1125 ILE A C   
1683 O O   . ILE A 104 ? 0.1014 0.1824 0.0893 -0.0049 0.0171  0.0003  1125 ILE A O   
1684 C CB  . ILE A 104 ? 0.0888 0.1375 0.0787 0.0158  0.0150  0.0118  1125 ILE A CB  
1685 C CG1 . ILE A 104 ? 0.0917 0.1594 0.1085 0.0120  0.0220  0.0004  1125 ILE A CG1 
1686 C CG2 . ILE A 104 ? 0.1008 0.1616 0.0883 0.0180  0.0137  0.0068  1125 ILE A CG2 
1687 C CD1 . ILE A 104 ? 0.0912 0.1880 0.1043 -0.0145 -0.0159 0.0105  1125 ILE A CD1 
1699 N N   . ALA A 105 ? 0.1317 0.1541 0.0841 0.0106  0.0216  -0.0183 1126 ALA A N   
1700 C CA  . ALA A 105 ? 0.1365 0.1780 0.1213 0.0381  0.0173  -0.0329 1126 ALA A CA  
1701 C C   . ALA A 105 ? 0.1315 0.1503 0.1086 0.0211  0.0438  -0.0358 1126 ALA A C   
1702 O O   . ALA A 105 ? 0.1464 0.1426 0.1616 0.0179  0.0743  -0.0125 1126 ALA A O   
1703 C CB  . ALA A 105 ? 0.1943 0.2228 0.0967 0.0652  0.0223  -0.0317 1126 ALA A CB  
1709 N N   . GLU A 106 ? 0.1297 0.1744 0.0777 0.0039  0.0197  -0.0217 1127 GLU A N   
1710 C CA  . GLU A 106 ? 0.1473 0.2122 0.0864 -0.0150 0.0001  0.0107  1127 GLU A CA  
1711 C C   . GLU A 106 ? 0.1395 0.2053 0.0795 -0.0069 0.0304  0.0073  1127 GLU A C   
1712 O O   . GLU A 106 ? 0.2069 0.2380 0.1044 0.0131  -0.0191 0.0462  1127 GLU A O   
1713 C CB  . GLU A 106 ? 0.1948 0.2335 0.1448 0.0027  -0.0531 -0.0007 1127 GLU A CB  
1714 C CG  . GLU A 106 ? 0.2344 0.2725 0.3191 -0.0294 -0.0355 -0.0496 1127 GLU A CG  
1715 C CD  . GLU A 106 ? 0.3436 0.3207 0.4912 -0.0507 0.0456  -0.1043 1127 GLU A CD  
1716 O OE1 . GLU A 106 ? 0.4127 0.3613 0.2613 -0.0516 0.0276  -0.1030 1127 GLU A OE1 
1717 O OE2 . GLU A 106 ? 0.4037 0.3459 0.7527 -0.0786 0.1163  -0.0938 1127 GLU A OE2 
1724 N N   . GLY A 107 ? 0.1320 0.1827 0.0938 0.0084  0.0437  0.0081  1128 GLY A N   
1725 C CA  . GLY A 107 ? 0.1373 0.1882 0.1190 0.0098  0.0484  0.0367  1128 GLY A CA  
1726 C C   . GLY A 107 ? 0.1413 0.1514 0.1168 -0.0048 0.0410  0.0203  1128 GLY A C   
1727 O O   . GLY A 107 ? 0.1638 0.1635 0.2560 0.0008  0.0797  0.0428  1128 GLY A O   
1731 N N   . VAL A 108 ? 0.1212 0.1431 0.0948 -0.0114 0.0288  0.0056  1129 VAL A N   
1732 C CA  . VAL A 108 ? 0.0959 0.1253 0.1158 0.0074  0.0201  0.0136  1129 VAL A CA  
1733 C C   . VAL A 108 ? 0.0935 0.1106 0.1015 0.0037  0.0295  -0.0081 1129 VAL A C   
1734 O O   . VAL A 108 ? 0.0956 0.1106 0.1086 0.0054  0.0010  0.0100  1129 VAL A O   
1735 C CB  . VAL A 108 ? 0.0775 0.1238 0.1066 -0.0001 0.0062  0.0062  1129 VAL A CB  
1736 C CG1 . VAL A 108 ? 0.1020 0.1132 0.1049 -0.0169 0.0050  0.0209  1129 VAL A CG1 
1737 C CG2 . VAL A 108 ? 0.0952 0.1466 0.1288 -0.0032 -0.0037 -0.0064 1129 VAL A CG2 
1747 N N   . PRO A 109 ? 0.1080 0.0987 0.1046 0.0025  0.0092  0.0116  1130 PRO A N   
1748 C CA  . PRO A 109 ? 0.1005 0.0889 0.1066 -0.0110 0.0252  0.0193  1130 PRO A CA  
1749 C C   . PRO A 109 ? 0.0831 0.0855 0.1127 0.0080  0.0207  0.0134  1130 PRO A C   
1750 O O   . PRO A 109 ? 0.0981 0.0927 0.1248 -0.0070 0.0332  0.0091  1130 PRO A O   
1751 C CB  . PRO A 109 ? 0.1502 0.0863 0.1374 0.0199  0.0276  0.0209  1130 PRO A CB  
1752 C CG  . PRO A 109 ? 0.1468 0.1152 0.1619 0.0206  0.0099  0.0341  1130 PRO A CG  
1753 C CD  . PRO A 109 ? 0.1229 0.1176 0.1191 0.0054  0.0125  0.0180  1130 PRO A CD  
1761 N N   . GLN A 110 ? 0.0971 0.0912 0.1002 -0.0031 0.0305  0.0008  1131 GLN A N   
1762 C CA  . GLN A 110 ? 0.0857 0.0841 0.1024 -0.0003 0.0252  0.0145  1131 GLN A CA  
1763 C C   . GLN A 110 ? 0.1030 0.0867 0.0775 -0.0092 0.0144  0.0022  1131 GLN A C   
1764 O O   . GLN A 110 ? 0.0992 0.1267 0.1364 -0.0320 0.0125  -0.0257 1131 GLN A O   
1765 C CB  . GLN A 110 ? 0.1295 0.0867 0.0920 -0.0017 0.0185  -0.0102 1131 GLN A CB  
1766 C CG  . GLN A 110 ? 0.1268 0.0933 0.1159 0.0073  0.0226  -0.0061 1131 GLN A CG  
1767 C CD  . GLN A 110 ? 0.1258 0.0841 0.0938 0.0046  0.0320  -0.0185 1131 GLN A CD  
1768 O OE1 . GLN A 110 ? 0.1476 0.0888 0.0988 -0.0129 0.0069  -0.0031 1131 GLN A OE1 
1769 N NE2 . GLN A 110 ? 0.1127 0.0840 0.0871 0.0015  0.0261  -0.0071 1131 GLN A NE2 
1778 N N   . LEU A 111 ? 0.0818 0.0823 0.0679 -0.0132 0.0039  -0.0007 1132 LEU A N   
1779 C CA  . LEU A 111 ? 0.1162 0.0762 0.0681 -0.0217 0.0154  -0.0072 1132 LEU A CA  
1780 C C   . LEU A 111 ? 0.0950 0.0784 0.0803 -0.0369 0.0044  -0.0012 1132 LEU A C   
1781 O O   . LEU A 111 ? 0.1533 0.1522 0.0823 -0.0900 -0.0205 0.0243  1132 LEU A O   
1782 C CB  . LEU A 111 ? 0.1106 0.0935 0.0886 -0.0033 -0.0102 0.0178  1132 LEU A CB  
1783 C CG  . LEU A 111 ? 0.1088 0.1423 0.1729 -0.0158 0.0000  0.0384  1132 LEU A CG  
1784 C CD1 . LEU A 111 ? 0.1171 0.1657 0.1793 -0.0132 0.0096  0.0701  1132 LEU A CD1 
1785 C CD2 . LEU A 111 ? 0.1507 0.1465 0.1080 0.0137  0.0200  0.0308  1132 LEU A CD2 
1797 N N   . LEU A 112 ? 0.0797 0.0659 0.0731 -0.0210 0.0124  -0.0024 1133 LEU A N   
1798 C CA  . LEU A 112 ? 0.0863 0.0684 0.0574 -0.0054 0.0016  0.0131  1133 LEU A CA  
1799 C C   . LEU A 112 ? 0.0955 0.0576 0.0755 -0.0048 0.0222  -0.0006 1133 LEU A C   
1800 O O   . LEU A 112 ? 0.1183 0.0661 0.1202 -0.0299 0.0419  -0.0365 1133 LEU A O   
1801 C CB  . LEU A 112 ? 0.0888 0.0818 0.1059 -0.0174 0.0078  0.0027  1133 LEU A CB  
1802 C CG  . LEU A 112 ? 0.1060 0.1004 0.1020 -0.0050 -0.0046 0.0185  1133 LEU A CG  
1803 C CD1 . LEU A 112 ? 0.0926 0.0942 0.1297 -0.0179 -0.0082 0.0350  1133 LEU A CD1 
1804 C CD2 . LEU A 112 ? 0.0677 0.1362 0.1672 -0.0160 -0.0164 0.0495  1133 LEU A CD2 
1816 N N   . ILE A 113 ? 0.0812 0.0499 0.0698 0.0041  0.0049  -0.0042 1134 ILE A N   
1817 C CA  . ILE A 113 ? 0.0867 0.0535 0.0756 -0.0111 0.0022  0.0020  1134 ILE A CA  
1818 C C   . ILE A 113 ? 0.0738 0.0509 0.0854 -0.0099 -0.0009 -0.0005 1134 ILE A C   
1819 O O   . ILE A 113 ? 0.1001 0.0480 0.0803 -0.0136 -0.0110 0.0070  1134 ILE A O   
1820 C CB  . ILE A 113 ? 0.0705 0.0581 0.1038 -0.0005 0.0042  0.0048  1134 ILE A CB  
1821 C CG1 . ILE A 113 ? 0.0809 0.1104 0.1445 0.0321  -0.0076 0.0197  1134 ILE A CG1 
1822 C CG2 . ILE A 113 ? 0.1234 0.0511 0.1349 0.0013  0.0134  -0.0042 1134 ILE A CG2 
1823 C CD1 . ILE A 113 ? 0.1103 0.1160 0.1385 0.0373  -0.0035 0.0012  1134 ILE A CD1 
1835 N N   . VAL A 114 ? 0.0789 0.0579 0.0605 -0.0101 0.0049  0.0011  1135 VAL A N   
1836 C CA  . VAL A 114 ? 0.0774 0.0643 0.0683 -0.0173 -0.0051 0.0009  1135 VAL A CA  
1837 C C   . VAL A 114 ? 0.0968 0.0670 0.0678 -0.0133 0.0132  -0.0260 1135 VAL A C   
1838 O O   . VAL A 114 ? 0.1388 0.0539 0.0889 -0.0110 0.0271  -0.0073 1135 VAL A O   
1839 C CB  . VAL A 114 ? 0.0805 0.0819 0.0899 -0.0142 -0.0046 0.0037  1135 VAL A CB  
1840 C CG1 . VAL A 114 ? 0.0809 0.1124 0.1111 -0.0175 -0.0092 0.0083  1135 VAL A CG1 
1841 C CG2 . VAL A 114 ? 0.0592 0.0851 0.1253 -0.0095 0.0197  -0.0033 1135 VAL A CG2 
1851 N N   . LEU A 115 ? 0.1070 0.0724 0.0596 0.0031  0.0099  0.0069  1136 LEU A N   
1852 C CA  . LEU A 115 ? 0.1146 0.0706 0.0907 -0.0007 0.0098  -0.0031 1136 LEU A CA  
1853 C C   . LEU A 115 ? 0.1224 0.0647 0.0729 -0.0001 0.0238  -0.0057 1136 LEU A C   
1854 O O   . LEU A 115 ? 0.1345 0.0688 0.0742 -0.0018 0.0013  0.0003  1136 LEU A O   
1855 C CB  . LEU A 115 ? 0.1170 0.1141 0.0961 -0.0086 0.0361  0.0073  1136 LEU A CB  
1856 C CG  . LEU A 115 ? 0.1040 0.1186 0.1227 0.0001  -0.0072 -0.0026 1136 LEU A CG  
1857 C CD1 . LEU A 115 ? 0.2488 0.1698 0.1501 0.0198  -0.0526 -0.0042 1136 LEU A CD1 
1858 C CD2 . LEU A 115 ? 0.1766 0.1174 0.1265 -0.0058 0.0041  -0.0109 1136 LEU A CD2 
1870 N N   . THR A 116 ? 0.1300 0.0697 0.0806 -0.0069 0.0208  -0.0019 1137 THR A N   
1871 C CA  . THR A 116 ? 0.1290 0.0785 0.0790 -0.0091 0.0111  0.0043  1137 THR A CA  
1872 C C   . THR A 116 ? 0.1331 0.0888 0.0782 -0.0065 0.0107  0.0102  1137 THR A C   
1873 O O   . THR A 116 ? 0.1461 0.0914 0.0749 -0.0146 0.0170  -0.0006 1137 THR A O   
1874 C CB  . THR A 116 ? 0.1158 0.0813 0.1231 -0.0271 0.0023  0.0049  1137 THR A CB  
1875 O OG1 . THR A 116 ? 0.1245 0.0986 0.1262 -0.0217 -0.0038 0.0080  1137 THR A OG1 
1876 C CG2 . THR A 116 ? 0.1304 0.1046 0.1357 -0.0238 0.0272  0.0190  1137 THR A CG2 
1884 N N   . ALA A 117 ? 0.1428 0.0995 0.0884 -0.0199 0.0107  0.0109  1138 ALA A N   
1885 C CA  . ALA A 117 ? 0.1552 0.1163 0.1011 -0.0371 0.0385  -0.0121 1138 ALA A CA  
1886 C C   . ALA A 117 ? 0.1673 0.1335 0.0972 -0.0332 0.0311  -0.0176 1138 ALA A C   
1887 O O   . ALA A 117 ? 0.2209 0.1615 0.0864 -0.0126 0.0374  -0.0235 1138 ALA A O   
1888 C CB  . ALA A 117 ? 0.1953 0.1561 0.1037 -0.0408 0.0280  -0.0295 1138 ALA A CB  
1894 N N   . GLU A 118 ? 0.1979 0.1512 0.0716 -0.0411 0.0330  0.0156  1139 GLU A N   
1895 C CA  . GLU A 118 ? 0.1965 0.1852 0.0690 -0.0404 -0.0138 0.0079  1139 GLU A CA  
1896 C C   . GLU A 118 ? 0.1979 0.1395 0.0722 -0.0402 -0.0001 0.0038  1139 GLU A C   
1897 O O   . GLU A 118 ? 0.1810 0.1312 0.0760 -0.0337 0.0044  0.0005  1139 GLU A O   
1898 C CB  . GLU A 118 ? 0.2228 0.2913 0.1370 -0.0871 0.0119  0.0688  1139 GLU A CB  
1899 C CG  . GLU A 118 ? 0.4202 0.3931 0.2891 -0.0086 -0.0100 0.1233  1139 GLU A CG  
1900 C CD  . GLU A 118 ? 0.5942 0.4895 0.4425 0.0105  0.0850  0.0946  1139 GLU A CD  
1901 O OE1 . GLU A 118 ? 0.6941 0.4896 0.2922 0.0484  0.0727  0.0953  1139 GLU A OE1 
1902 O OE2 . GLU A 118 ? 0.5639 0.5631 0.5554 -0.0291 0.0836  0.0290  1139 GLU A OE2 
1909 N N   . PRO A 119 ? 0.1931 0.1527 0.0959 -0.0260 -0.0211 -0.0085 1140 PRO A N   
1910 C CA  . PRO A 119 ? 0.1732 0.1494 0.0767 -0.0410 -0.0178 -0.0070 1140 PRO A CA  
1911 C C   . PRO A 119 ? 0.2009 0.1229 0.1033 -0.0516 -0.0086 -0.0333 1140 PRO A C   
1912 O O   . PRO A 119 ? 0.2283 0.1401 0.1171 -0.0336 -0.0019 0.0218  1140 PRO A O   
1913 C CB  . PRO A 119 ? 0.2107 0.1943 0.1122 -0.0488 -0.0286 -0.0337 1140 PRO A CB  
1914 C CG  . PRO A 119 ? 0.2475 0.2220 0.1053 -0.0640 -0.0202 -0.0433 1140 PRO A CG  
1915 C CD  . PRO A 119 ? 0.2475 0.2061 0.0952 -0.0536 -0.0234 -0.0429 1140 PRO A CD  
1923 N N   . SER A 120 ? 0.1570 0.1215 0.0948 -0.0203 -0.0189 0.0049  1141 SER A N   
1924 C CA  . SER A 120 ? 0.1119 0.1223 0.0994 -0.0423 -0.0198 0.0151  1141 SER A CA  
1925 C C   . SER A 120 ? 0.1651 0.1201 0.0877 -0.0416 -0.0318 -0.0196 1141 SER A C   
1926 O O   . SER A 120 ? 0.2065 0.1269 0.1027 -0.0207 -0.0478 0.0176  1141 SER A O   
1927 C CB  . SER A 120 ? 0.1174 0.1294 0.0929 -0.0303 -0.0115 0.0221  1141 SER A CB  
1928 O OG  . SER A 120 ? 0.1346 0.1300 0.0850 -0.0314 -0.0124 0.0052  1141 SER A OG  
1934 N N   . GLY A 121 ? 0.1790 0.1359 0.1076 -0.0144 -0.0221 0.0093  1142 GLY A N   
1935 C CA  . GLY A 121 ? 0.1941 0.1688 0.0683 -0.0034 -0.0368 0.0292  1142 GLY A CA  
1936 C C   . GLY A 121 ? 0.2213 0.1742 0.1308 -0.0059 -0.0651 0.0409  1142 GLY A C   
1937 O O   . GLY A 121 ? 0.2768 0.2594 0.1271 0.0363  -0.0546 0.0558  1142 GLY A O   
1941 N N   . ASP A 122 ? 0.1803 0.1481 0.1275 -0.0304 -0.0597 0.0455  1143 ASP A N   
1942 C CA  . ASP A 122 ? 0.1635 0.1586 0.1361 -0.0346 -0.0683 0.0503  1143 ASP A CA  
1943 C C   . ASP A 122 ? 0.1378 0.1616 0.1639 -0.0384 -0.0686 0.0599  1143 ASP A C   
1944 O O   . ASP A 122 ? 0.1666 0.1335 0.1570 -0.0406 -0.0303 0.0572  1143 ASP A O   
1945 C CB  . ASP A 122 ? 0.1607 0.1775 0.1027 -0.0243 -0.0639 0.0380  1143 ASP A CB  
1946 C CG  . ASP A 122 ? 0.1350 0.1767 0.1037 -0.0148 -0.0250 0.0174  1143 ASP A CG  
1947 O OD1 . ASP A 122 ? 0.1111 0.1900 0.1169 -0.0024 -0.0367 0.0135  1143 ASP A OD1 
1948 O OD2 . ASP A 122 ? 0.1858 0.1774 0.0955 -0.0106 -0.0434 0.0225  1143 ASP A OD2 
1953 N N   . ASP A 123 ? 0.1042 0.2308 0.1791 -0.0389 -0.0534 0.0727  1144 ASP A N   
1954 C CA  . ASP A 123 ? 0.0950 0.2339 0.2252 -0.0218 -0.0292 0.0921  1144 ASP A CA  
1955 C C   . ASP A 123 ? 0.1240 0.1707 0.1621 0.0015  -0.0176 0.0647  1144 ASP A C   
1956 O O   . ASP A 123 ? 0.2031 0.1828 0.1772 0.0419  0.0195  0.0639  1144 ASP A O   
1957 C CB  . ASP A 123 ? 0.1198 0.2885 0.3066 0.0007  0.0015  0.1263  1144 ASP A CB  
1958 C CG  . ASP A 123 ? 0.2236 0.3061 0.2835 -0.0449 0.0576  0.0847  1144 ASP A CG  
1959 O OD1 . ASP A 123 ? 0.1848 0.2506 0.3532 -0.0931 -0.0881 0.1034  1144 ASP A OD1 
1960 O OD2 . ASP A 123 ? 0.2373 0.3367 0.2088 -0.0384 -0.0520 0.0920  1144 ASP A OD2 
1965 N N   . VAL A 124 ? 0.0959 0.1339 0.1623 -0.0099 -0.0057 0.0238  1145 VAL A N   
1966 C CA  . VAL A 124 ? 0.0873 0.1392 0.1259 -0.0104 -0.0169 0.0044  1145 VAL A CA  
1967 C C   . VAL A 124 ? 0.1031 0.1152 0.1541 -0.0033 0.0147  0.0113  1145 VAL A C   
1968 O O   . VAL A 124 ? 0.1195 0.1298 0.1321 0.0097  0.0119  -0.0019 1145 VAL A O   
1969 C CB  . VAL A 124 ? 0.1171 0.1364 0.1031 0.0015  0.0125  0.0204  1145 VAL A CB  
1970 C CG1 . VAL A 124 ? 0.1003 0.1488 0.1257 -0.0043 -0.0155 0.0315  1145 VAL A CG1 
1971 C CG2 . VAL A 124 ? 0.1361 0.1275 0.1223 0.0044  0.0194  -0.0016 1145 VAL A CG2 
1981 N N   . ARG A 125 ? 0.1138 0.1572 0.1354 -0.0315 0.0255  -0.0012 1146 ARG A N   
1982 C CA  . ARG A 125 ? 0.1217 0.1757 0.1741 -0.0190 0.0530  -0.0010 1146 ARG A CA  
1983 C C   . ARG A 125 ? 0.0809 0.1548 0.1526 0.0046  0.0129  0.0106  1146 ARG A C   
1984 O O   . ARG A 125 ? 0.1033 0.1421 0.1276 0.0082  0.0042  0.0095  1146 ARG A O   
1985 C CB  . ARG A 125 ? 0.1435 0.2240 0.2079 -0.0728 0.0640  -0.0402 1146 ARG A CB  
1986 C CG  . ARG A 125 ? 0.2663 0.3391 0.2929 -0.0619 0.0976  -0.0313 1146 ARG A CG  
1987 C CD  . ARG A 125 ? 0.3356 0.4139 0.3580 -0.1122 0.1105  -0.0013 1146 ARG A CD  
1988 N NE  . ARG A 125 ? 0.4439 0.4526 0.4303 -0.1329 0.1654  -0.0728 1146 ARG A NE  
1989 C CZ  . ARG A 125 ? 0.3682 0.4361 0.3983 -0.1014 0.1364  -0.0993 1146 ARG A CZ  
1990 N NH1 . ARG A 125 ? 0.4769 0.4471 0.4297 -0.1621 0.1768  -0.1518 1146 ARG A NH1 
1991 N NH2 . ARG A 125 ? 0.1776 0.4088 0.4422 0.0753  0.0972  0.0576  1146 ARG A NH2 
2005 N N   . GLY A 126 ? 0.1013 0.1478 0.1451 -0.0051 -0.0003 0.0097  1147 GLY A N   
2006 C CA  . GLY A 126 ? 0.0942 0.1376 0.1520 0.0152  0.0186  0.0125  1147 GLY A CA  
2007 C C   . GLY A 126 ? 0.0866 0.1100 0.1522 0.0043  0.0111  0.0091  1147 GLY A C   
2008 O O   . GLY A 126 ? 0.0939 0.1372 0.1469 0.0222  0.0122  0.0082  1147 GLY A O   
2012 N N   . PRO A 127 ? 0.0888 0.1038 0.1625 0.0055  0.0084  0.0023  1148 PRO A N   
2013 C CA  . PRO A 127 ? 0.0971 0.0989 0.1563 0.0166  0.0317  0.0096  1148 PRO A CA  
2014 C C   . PRO A 127 ? 0.0805 0.1126 0.1342 0.0008  0.0132  -0.0186 1148 PRO A C   
2015 O O   . PRO A 127 ? 0.1013 0.1216 0.1400 -0.0072 0.0115  -0.0291 1148 PRO A O   
2016 C CB  . PRO A 127 ? 0.1034 0.1135 0.1480 0.0143  0.0002  -0.0034 1148 PRO A CB  
2017 C CG  . PRO A 127 ? 0.1212 0.1092 0.2010 0.0065  0.0492  0.0087  1148 PRO A CG  
2018 C CD  . PRO A 127 ? 0.1267 0.1178 0.1499 0.0094  0.0195  0.0274  1148 PRO A CD  
2026 N N   A SER A 128 ? 0.0864 0.1049 0.1064 0.0075  -0.0031 -0.0204 1149 SER A N   
2027 N N   B SER A 128 ? 0.1055 0.1161 0.1331 -0.0038 0.0182  -0.0275 1149 SER A N   
2028 C CA  A SER A 128 ? 0.0657 0.1004 0.1303 0.0198  -0.0215 -0.0007 1149 SER A CA  
2029 C CA  B SER A 128 ? 0.0858 0.1274 0.1427 0.0280  0.0115  0.0025  1149 SER A CA  
2030 C C   A SER A 128 ? 0.0797 0.1103 0.1661 0.0147  -0.0175 0.0102  1149 SER A C   
2031 C C   B SER A 128 ? 0.0741 0.1274 0.1441 0.0209  -0.0001 0.0182  1149 SER A C   
2032 O O   A SER A 128 ? 0.0859 0.1050 0.1643 0.0082  0.0003  -0.0190 1149 SER A O   
2033 O O   B SER A 128 ? 0.0687 0.1254 0.0876 0.0297  -0.0055 0.0395  1149 SER A O   
2034 C CB  A SER A 128 ? 0.1376 0.0976 0.1377 0.0555  -0.0077 0.0041  1149 SER A CB  
2035 C CB  B SER A 128 ? 0.1273 0.1429 0.1899 0.0651  0.0452  0.0242  1149 SER A CB  
2036 O OG  A SER A 128 ? 0.1162 0.0901 0.1715 0.0233  -0.0148 -0.0139 1149 SER A OG  
2037 O OG  B SER A 128 ? 0.1657 0.1593 0.2439 0.0710  0.0812  0.0580  1149 SER A OG  
2048 N N   . VAL A 129 ? 0.0692 0.1120 0.1787 0.0051  -0.0128 0.0081  1150 VAL A N   
2049 C CA  . VAL A 129 ? 0.0740 0.1211 0.1716 -0.0079 -0.0016 0.0203  1150 VAL A CA  
2050 C C   . VAL A 129 ? 0.0617 0.1383 0.1627 0.0133  0.0036  0.0375  1150 VAL A C   
2051 O O   . VAL A 129 ? 0.0840 0.1738 0.1380 -0.0053 0.0042  0.0347  1150 VAL A O   
2052 C CB  . VAL A 129 ? 0.0714 0.1423 0.1826 -0.0125 -0.0030 0.0420  1150 VAL A CB  
2053 C CG1 . VAL A 129 ? 0.0674 0.1800 0.2285 -0.0008 -0.0033 0.0446  1150 VAL A CG1 
2054 C CG2 . VAL A 129 ? 0.1097 0.1430 0.2560 -0.0036 0.0147  0.0625  1150 VAL A CG2 
2064 N N   . VAL A 130 ? 0.1025 0.1376 0.1309 0.0340  0.0222  0.0238  1151 VAL A N   
2065 C CA  . VAL A 130 ? 0.1357 0.1294 0.1475 0.0377  0.0352  0.0126  1151 VAL A CA  
2066 C C   . VAL A 130 ? 0.1306 0.1015 0.1222 0.0100  0.0289  -0.0152 1151 VAL A C   
2067 O O   . VAL A 130 ? 0.1387 0.1165 0.1341 0.0276  0.0360  -0.0190 1151 VAL A O   
2068 C CB  . VAL A 130 ? 0.1643 0.1391 0.1939 0.0685  0.0107  0.0031  1151 VAL A CB  
2069 C CG1 . VAL A 130 ? 0.2636 0.1452 0.2165 0.0463  0.0759  -0.0111 1151 VAL A CG1 
2070 C CG2 . VAL A 130 ? 0.1955 0.1758 0.2332 0.0857  0.0437  0.0042  1151 VAL A CG2 
2080 N N   A LEU A 131 ? 0.1016 0.1118 0.1142 -0.0101 0.0373  -0.0304 1152 LEU A N   
2081 N N   B LEU A 131 ? 0.1391 0.0946 0.1210 0.0306  0.0226  -0.0179 1152 LEU A N   
2082 C CA  A LEU A 131 ? 0.0796 0.1198 0.1160 -0.0181 0.0224  -0.0500 1152 LEU A CA  
2083 C CA  B LEU A 131 ? 0.1427 0.0685 0.1670 0.0160  0.0290  -0.0240 1152 LEU A CA  
2084 C C   A LEU A 131 ? 0.1028 0.1297 0.1431 0.0130  0.0593  -0.0165 1152 LEU A C   
2085 C C   B LEU A 131 ? 0.1093 0.0924 0.1700 0.0096  0.0110  -0.0312 1152 LEU A C   
2086 O O   A LEU A 131 ? 0.1147 0.1649 0.1567 0.0148  0.0773  0.0003  1152 LEU A O   
2087 O O   B LEU A 131 ? 0.1098 0.1079 0.1623 0.0056  -0.0563 -0.0561 1152 LEU A O   
2088 C CB  A LEU A 131 ? 0.0870 0.1441 0.1321 -0.0185 0.0140  -0.0040 1152 LEU A CB  
2089 C CB  B LEU A 131 ? 0.1652 0.0498 0.1550 0.0157  0.0139  -0.0160 1152 LEU A CB  
2090 C CG  A LEU A 131 ? 0.0886 0.1601 0.1140 -0.0297 0.0128  0.0024  1152 LEU A CG  
2091 C CG  B LEU A 131 ? 0.1991 0.0607 0.1473 0.0037  0.0285  0.0028  1152 LEU A CG  
2092 C CD1 A LEU A 131 ? 0.0836 0.1351 0.0730 -0.0027 0.0434  0.0075  1152 LEU A CD1 
2093 C CD1 B LEU A 131 ? 0.1347 0.0649 0.1230 0.0094  0.0096  0.0065  1152 LEU A CD1 
2094 C CD2 A LEU A 131 ? 0.0645 0.1714 0.1404 0.0009  0.0170  0.0593  1152 LEU A CD2 
2095 C CD2 B LEU A 131 ? 0.2280 0.0606 0.1770 0.0093  0.0130  0.0163  1152 LEU A CD2 
2118 N N   . LYS A 132 ? 0.0859 0.1081 0.1407 0.0012  0.0304  -0.0356 1153 LYS A N   
2119 C CA  . LYS A 132 ? 0.1261 0.1151 0.1259 0.0155  0.0135  0.0007  1153 LYS A CA  
2120 C C   . LYS A 132 ? 0.1164 0.1435 0.1494 0.0092  0.0097  0.0314  1153 LYS A C   
2121 O O   . LYS A 132 ? 0.1249 0.2084 0.1494 0.0483  0.0382  0.0238  1153 LYS A O   
2122 C CB  . LYS A 132 ? 0.1726 0.1339 0.1571 0.0354  -0.0135 0.0022  1153 LYS A CB  
2123 C CG  . LYS A 132 ? 0.2214 0.1587 0.1489 0.0787  -0.0352 -0.0254 1153 LYS A CG  
2124 C CD  . LYS A 132 ? 0.2215 0.1791 0.1390 0.0359  0.0397  -0.0055 1153 LYS A CD  
2125 C CE  . LYS A 132 ? 0.1411 0.2264 0.1636 0.0489  -0.0100 -0.0148 1153 LYS A CE  
2126 N NZ  . LYS A 132 ? 0.2011 0.2014 0.1517 0.0114  0.0406  -0.0411 1153 LYS A NZ  
2140 N N   . GLN A 133 ? 0.1089 0.1330 0.1390 0.0042  0.0124  0.0239  1154 GLN A N   
2141 C CA  . GLN A 133 ? 0.1138 0.1692 0.1301 0.0262  0.0353  0.0123  1154 GLN A CA  
2142 C C   . GLN A 133 ? 0.1512 0.1818 0.1275 0.0265  0.0520  -0.0024 1154 GLN A C   
2143 O O   . GLN A 133 ? 0.2163 0.2081 0.1600 0.0035  0.0872  -0.0111 1154 GLN A O   
2144 C CB  . GLN A 133 ? 0.0996 0.2241 0.1663 0.0198  0.0327  -0.0002 1154 GLN A CB  
2145 C CG  . GLN A 133 ? 0.1061 0.3027 0.1962 0.0150  0.0424  -0.0184 1154 GLN A CG  
2146 C CD  . GLN A 133 ? 0.1890 0.4373 0.3219 -0.0523 0.0966  -0.0739 1154 GLN A CD  
2147 O OE1 . GLN A 133 ? 0.1911 0.4726 0.3700 -0.0504 0.0727  -0.2038 1154 GLN A OE1 
2148 N NE2 . GLN A 133 ? 0.3047 0.5011 0.2000 -0.1727 0.0698  -0.0314 1154 GLN A NE2 
2157 N N   . GLY A 134 ? 0.1518 0.1350 0.1512 0.0384  0.0637  -0.0207 1155 GLY A N   
2158 C CA  . GLY A 134 ? 0.1648 0.1322 0.1809 0.0414  0.0565  -0.0203 1155 GLY A CA  
2159 C C   . GLY A 134 ? 0.1547 0.1591 0.1270 0.0150  0.0565  -0.0295 1155 GLY A C   
2160 O O   . GLY A 134 ? 0.1904 0.1870 0.1628 -0.0315 0.0363  -0.0336 1155 GLY A O   
2164 N N   . GLY A 135 ? 0.1426 0.2014 0.1070 0.0274  0.0430  -0.0411 1156 GLY A N   
2165 C CA  . GLY A 135 ? 0.1516 0.2444 0.1296 0.0362  0.0440  -0.0366 1156 GLY A CA  
2166 C C   . GLY A 135 ? 0.1588 0.2568 0.1611 0.0452  0.0165  -0.0163 1156 GLY A C   
2167 O O   . GLY A 135 ? 0.1723 0.3211 0.1366 0.0299  0.0070  -0.0192 1156 GLY A O   
2171 N N   . ALA A 136 ? 0.1214 0.1686 0.1249 0.0076  0.0207  -0.0386 1157 ALA A N   
2172 C CA  . ALA A 136 ? 0.1048 0.1201 0.1228 -0.0084 0.0219  -0.0454 1157 ALA A CA  
2173 C C   . ALA A 136 ? 0.0959 0.1229 0.0846 -0.0323 0.0189  -0.0182 1157 ALA A C   
2174 O O   . ALA A 136 ? 0.0953 0.1302 0.1030 -0.0190 0.0338  -0.0030 1157 ALA A O   
2175 C CB  . ALA A 136 ? 0.1555 0.1058 0.1193 -0.0157 0.0303  -0.0031 1157 ALA A CB  
2181 N N   . VAL A 137 ? 0.0972 0.0972 0.0809 -0.0143 0.0173  -0.0090 1158 VAL A N   
2182 C CA  . VAL A 137 ? 0.0947 0.0996 0.0800 -0.0115 0.0085  -0.0041 1158 VAL A CA  
2183 C C   . VAL A 137 ? 0.0622 0.0697 0.0917 -0.0064 0.0054  0.0192  1158 VAL A C   
2184 O O   . VAL A 137 ? 0.0786 0.0784 0.0835 -0.0073 -0.0001 0.0021  1158 VAL A O   
2185 C CB  . VAL A 137 ? 0.1057 0.1330 0.0775 -0.0121 0.0037  -0.0123 1158 VAL A CB  
2186 C CG1 . VAL A 137 ? 0.1140 0.1031 0.0945 -0.0118 -0.0015 0.0100  1158 VAL A CG1 
2187 C CG2 . VAL A 137 ? 0.1458 0.1922 0.0959 -0.0047 0.0101  0.0009  1158 VAL A CG2 
2197 N N   . PRO A 138 ? 0.0559 0.0842 0.0782 -0.0238 0.0094  -0.0072 1159 PRO A N   
2198 C CA  . PRO A 138 ? 0.0586 0.0668 0.0757 -0.0147 0.0103  -0.0025 1159 PRO A CA  
2199 C C   . PRO A 138 ? 0.0471 0.0662 0.0950 -0.0260 -0.0002 -0.0055 1159 PRO A C   
2200 O O   . PRO A 138 ? 0.0741 0.0710 0.0860 -0.0258 0.0076  0.0047  1159 PRO A O   
2201 C CB  . PRO A 138 ? 0.0839 0.0691 0.0731 -0.0112 -0.0073 0.0005  1159 PRO A CB  
2202 C CG  . PRO A 138 ? 0.0941 0.0708 0.0982 -0.0086 0.0094  -0.0204 1159 PRO A CG  
2203 C CD  . PRO A 138 ? 0.0806 0.0710 0.0835 -0.0197 0.0082  -0.0016 1159 PRO A CD  
2211 N N   . ILE A 139 ? 0.0686 0.0553 0.0768 -0.0060 0.0177  -0.0005 1160 ILE A N   
2212 C CA  . ILE A 139 ? 0.0614 0.0550 0.0904 -0.0132 0.0194  0.0100  1160 ILE A CA  
2213 C C   . ILE A 139 ? 0.0623 0.0544 0.0856 -0.0115 0.0202  0.0068  1160 ILE A C   
2214 O O   . ILE A 139 ? 0.0950 0.0645 0.0661 -0.0197 0.0190  0.0043  1160 ILE A O   
2215 C CB  . ILE A 139 ? 0.0875 0.0736 0.0861 -0.0127 -0.0122 0.0243  1160 ILE A CB  
2216 C CG1 . ILE A 139 ? 0.0843 0.1190 0.1480 -0.0099 -0.0321 0.0328  1160 ILE A CG1 
2217 C CG2 . ILE A 139 ? 0.0846 0.0939 0.1462 0.0275  0.0178  0.0181  1160 ILE A CG2 
2218 C CD1 . ILE A 139 ? 0.1286 0.1771 0.1626 -0.0125 -0.0334 0.0471  1160 ILE A CD1 
2230 N N   . GLY A 140 ? 0.0774 0.0506 0.0901 -0.0064 0.0084  0.0074  1161 GLY A N   
2231 C CA  . GLY A 140 ? 0.0831 0.0569 0.0830 0.0000  0.0328  -0.0050 1161 GLY A CA  
2232 C C   . GLY A 140 ? 0.0803 0.0599 0.0826 -0.0097 0.0035  -0.0050 1161 GLY A C   
2233 O O   . GLY A 140 ? 0.1041 0.0568 0.1156 -0.0076 0.0375  0.0111  1161 GLY A O   
2237 N N   . ILE A 141 ? 0.0838 0.0620 0.0802 0.0050  0.0405  0.0059  1162 ILE A N   
2238 C CA  . ILE A 141 ? 0.0983 0.0579 0.1021 -0.0051 0.0163  0.0100  1162 ILE A CA  
2239 C C   . ILE A 141 ? 0.0957 0.0637 0.0839 0.0000  0.0129  0.0020  1162 ILE A C   
2240 O O   . ILE A 141 ? 0.1170 0.0801 0.0871 -0.0105 0.0134  -0.0052 1162 ILE A O   
2241 C CB  . ILE A 141 ? 0.0832 0.0669 0.0972 0.0018  0.0086  0.0031  1162 ILE A CB  
2242 C CG1 . ILE A 141 ? 0.0982 0.0742 0.1342 -0.0089 0.0065  0.0129  1162 ILE A CG1 
2243 C CG2 . ILE A 141 ? 0.0978 0.0799 0.1167 0.0038  0.0302  -0.0005 1162 ILE A CG2 
2244 C CD1 . ILE A 141 ? 0.1076 0.0815 0.1190 0.0067  0.0142  -0.0010 1162 ILE A CD1 
2256 N N   . GLY A 142 ? 0.0941 0.0741 0.0865 -0.0205 0.0279  -0.0086 1163 GLY A N   
2257 C CA  . GLY A 142 ? 0.1119 0.1138 0.0909 -0.0348 0.0354  -0.0199 1163 GLY A CA  
2258 C C   . GLY A 142 ? 0.1334 0.0961 0.1166 -0.0266 0.0348  -0.0334 1163 GLY A C   
2259 O O   . GLY A 142 ? 0.1643 0.0838 0.1363 -0.0051 0.0448  -0.0077 1163 GLY A O   
2263 N N   . ILE A 143 ? 0.1336 0.0989 0.1226 -0.0252 0.0598  -0.0152 1164 ILE A N   
2264 C CA  . ILE A 143 ? 0.1482 0.1114 0.1194 -0.0064 0.0469  0.0058  1164 ILE A CA  
2265 C C   . ILE A 143 ? 0.1540 0.1302 0.1132 -0.0119 0.0623  -0.0200 1164 ILE A C   
2266 O O   . ILE A 143 ? 0.1726 0.1395 0.1142 -0.0336 0.0383  -0.0074 1164 ILE A O   
2267 C CB  . ILE A 143 ? 0.1428 0.1201 0.1275 -0.0225 0.0447  0.0084  1164 ILE A CB  
2268 C CG1 . ILE A 143 ? 0.1764 0.1376 0.1381 -0.0314 0.0353  -0.0109 1164 ILE A CG1 
2269 C CG2 . ILE A 143 ? 0.1160 0.1501 0.1728 -0.0078 0.0400  0.0295  1164 ILE A CG2 
2270 C CD1 . ILE A 143 ? 0.2503 0.1930 0.1811 0.0040  -0.0026 -0.0248 1164 ILE A CD1 
2282 N N   . GLY A 144 ? 0.2106 0.1672 0.1387 -0.0066 0.0857  -0.0265 1165 GLY A N   
2283 C CA  . GLY A 144 ? 0.2469 0.2204 0.1269 -0.0040 0.0598  -0.0287 1165 GLY A CA  
2284 C C   . GLY A 144 ? 0.2297 0.2247 0.1728 -0.0031 0.0356  -0.0782 1165 GLY A C   
2285 O O   . GLY A 144 ? 0.2593 0.2089 0.2175 -0.0239 0.0505  -0.0946 1165 GLY A O   
2289 N N   . ASN A 145 ? 0.2524 0.2525 0.1118 -0.0126 0.0468  -0.0686 1166 ASN A N   
2290 C CA  . ASN A 145 ? 0.2729 0.2741 0.1431 -0.0184 0.0399  -0.0486 1166 ASN A CA  
2291 C C   . ASN A 145 ? 0.2105 0.2061 0.1371 -0.0341 -0.0021 -0.0420 1166 ASN A C   
2292 O O   . ASN A 145 ? 0.2456 0.1954 0.1159 -0.0126 -0.0082 -0.0347 1166 ASN A O   
2293 C CB  . ASN A 145 ? 0.3639 0.3566 0.1113 0.0084  0.0126  -0.0148 1166 ASN A CB  
2294 C CG  . ASN A 145 ? 0.4820 0.4265 0.2136 0.0676  0.0536  0.0195  1166 ASN A CG  
2295 O OD1 . ASN A 145 ? 0.5031 0.4245 0.2044 0.1063  0.0455  -0.0548 1166 ASN A OD1 
2296 N ND2 . ASN A 145 ? 0.5563 0.4826 0.2271 0.1166  0.1032  0.0717  1166 ASN A ND2 
2303 N N   . ALA A 146 ? 0.1859 0.1562 0.1151 -0.0367 0.0151  -0.0250 1167 ALA A N   
2304 C CA  . ALA A 146 ? 0.1851 0.1360 0.1014 -0.0438 0.0306  -0.0124 1167 ALA A CA  
2305 C C   . ALA A 146 ? 0.1597 0.1235 0.0968 -0.0325 0.0019  -0.0095 1167 ALA A C   
2306 O O   . ALA A 146 ? 0.1906 0.1124 0.1402 -0.0182 0.0156  -0.0116 1167 ALA A O   
2307 C CB  . ALA A 146 ? 0.1367 0.1301 0.0990 -0.0458 0.0349  -0.0362 1167 ALA A CB  
2313 N N   . ASP A 147 ? 0.1487 0.1305 0.0941 -0.0337 0.0132  -0.0035 1168 ASP A N   
2314 C CA  . ASP A 147 ? 0.1620 0.1200 0.1029 -0.0309 -0.0088 -0.0092 1168 ASP A CA  
2315 C C   . ASP A 147 ? 0.1578 0.0979 0.1179 -0.0392 0.0129  -0.0255 1168 ASP A C   
2316 O O   . ASP A 147 ? 0.1532 0.1094 0.0957 -0.0459 0.0049  -0.0142 1168 ASP A O   
2317 C CB  . ASP A 147 ? 0.1875 0.1589 0.0996 -0.0478 -0.0198 0.0120  1168 ASP A CB  
2318 C CG  . ASP A 147 ? 0.2360 0.1866 0.0962 -0.0525 -0.0267 -0.0133 1168 ASP A CG  
2319 O OD1 . ASP A 147 ? 0.2062 0.1641 0.1047 -0.0524 -0.0177 -0.0010 1168 ASP A OD1 
2320 O OD2 . ASP A 147 ? 0.2393 0.2940 0.1253 -0.1067 -0.0122 -0.0384 1168 ASP A OD2 
2325 N N   . ILE A 148 ? 0.1753 0.0978 0.1076 -0.0243 0.0149  -0.0195 1169 ILE A N   
2326 C CA  . ILE A 148 ? 0.1837 0.0951 0.1072 -0.0292 0.0281  -0.0091 1169 ILE A CA  
2327 C C   . ILE A 148 ? 0.1454 0.0933 0.1012 -0.0269 -0.0076 0.0014  1169 ILE A C   
2328 O O   . ILE A 148 ? 0.1395 0.0970 0.0911 -0.0242 -0.0068 0.0046  1169 ILE A O   
2329 C CB  . ILE A 148 ? 0.2650 0.1310 0.1138 0.0143  0.0461  -0.0143 1169 ILE A CB  
2330 C CG1 . ILE A 148 ? 0.3302 0.1701 0.1910 0.0293  0.0775  -0.0530 1169 ILE A CG1 
2331 C CG2 . ILE A 148 ? 0.3375 0.1021 0.1564 0.0082  0.0330  -0.0110 1169 ILE A CG2 
2332 C CD1 . ILE A 148 ? 0.3420 0.1847 0.2465 0.0440  0.0427  -0.0365 1169 ILE A CD1 
2344 N N   A SER A 149 ? 0.1736 0.1047 0.0733 -0.0466 -0.0170 -0.0222 1170 SER A N   
2345 N N   B SER A 149 ? 0.1663 0.1139 0.0984 -0.0389 0.0150  0.0302  1170 SER A N   
2346 C CA  A SER A 149 ? 0.1504 0.1111 0.0623 -0.0633 -0.0042 -0.0112 1170 SER A CA  
2347 C CA  B SER A 149 ? 0.1487 0.1299 0.1162 -0.0247 -0.0541 0.0176  1170 SER A CA  
2348 C C   A SER A 149 ? 0.1296 0.1040 0.0723 -0.0627 -0.0001 0.0178  1170 SER A C   
2349 C C   B SER A 149 ? 0.1287 0.1153 0.1102 -0.0309 -0.0578 0.0032  1170 SER A C   
2350 O O   A SER A 149 ? 0.1127 0.1091 0.0523 -0.0651 0.0101  -0.0053 1170 SER A O   
2351 O O   B SER A 149 ? 0.1139 0.1080 0.1205 0.0150  -0.0510 0.0385  1170 SER A O   
2352 C CB  A SER A 149 ? 0.1351 0.1221 0.1568 -0.0755 0.0029  -0.0157 1170 SER A CB  
2353 C CB  B SER A 149 ? 0.1731 0.1637 0.0937 -0.0058 -0.0645 0.0262  1170 SER A CB  
2354 O OG  A SER A 149 ? 0.1497 0.1924 0.1180 -0.0876 -0.0485 0.0311  1170 SER A OG  
2355 O OG  B SER A 149 ? 0.2155 0.1888 0.1689 0.0140  -0.0434 0.0175  1170 SER A OG  
2366 N N   . GLU A 150 ? 0.1220 0.1084 0.0885 -0.0327 -0.0090 0.0114  1171 GLU A N   
2367 C CA  . GLU A 150 ? 0.1017 0.0928 0.0884 -0.0346 -0.0242 0.0130  1171 GLU A CA  
2368 C C   . GLU A 150 ? 0.1052 0.0692 0.0888 -0.0185 0.0133  0.0172  1171 GLU A C   
2369 O O   . GLU A 150 ? 0.1012 0.0835 0.0820 -0.0120 0.0027  0.0002  1171 GLU A O   
2370 C CB  . GLU A 150 ? 0.1293 0.0897 0.1072 -0.0289 -0.0014 0.0151  1171 GLU A CB  
2371 C CG  . GLU A 150 ? 0.1625 0.1236 0.1041 -0.0472 -0.0274 0.0128  1171 GLU A CG  
2372 C CD  . GLU A 150 ? 0.1752 0.1779 0.1456 -0.0402 -0.0491 0.0389  1171 GLU A CD  
2373 O OE1 . GLU A 150 ? 0.1798 0.1379 0.1164 -0.0272 -0.0297 0.0370  1171 GLU A OE1 
2374 O OE2 . GLU A 150 ? 0.1913 0.2328 0.2110 -0.0651 -0.0728 0.1005  1171 GLU A OE2 
2381 N N   . MET A 151 ? 0.1061 0.0864 0.0541 -0.0272 0.0001  -0.0052 1172 MET A N   
2382 C CA  . MET A 151 ? 0.1104 0.0672 0.0678 -0.0236 0.0242  0.0045  1172 MET A CA  
2383 C C   . MET A 151 ? 0.0820 0.0675 0.0929 -0.0318 -0.0163 -0.0046 1172 MET A C   
2384 O O   . MET A 151 ? 0.0713 0.0795 0.0938 -0.0186 -0.0010 0.0045  1172 MET A O   
2385 C CB  . MET A 151 ? 0.1072 0.0996 0.0821 -0.0339 0.0408  -0.0129 1172 MET A CB  
2386 C CG  . MET A 151 ? 0.1283 0.1194 0.1110 -0.0518 0.0446  -0.0264 1172 MET A CG  
2387 S SD  . MET A 151 ? 0.1344 0.1403 0.1391 -0.0403 0.0138  0.0307  1172 MET A SD  
2388 C CE  . MET A 151 ? 0.1385 0.1361 0.0638 -0.0797 -0.0051 0.0122  1172 MET A CE  
2398 N N   . GLN A 152 ? 0.0891 0.0830 0.0784 -0.0224 0.0135  0.0035  1173 GLN A N   
2399 C CA  . GLN A 152 ? 0.0646 0.0951 0.0739 -0.0175 0.0058  -0.0099 1173 GLN A CA  
2400 C C   . GLN A 152 ? 0.0795 0.0853 0.0839 -0.0272 -0.0067 0.0126  1173 GLN A C   
2401 O O   . GLN A 152 ? 0.1095 0.1151 0.0739 -0.0014 0.0073  -0.0034 1173 GLN A O   
2402 C CB  . GLN A 152 ? 0.0691 0.0849 0.1040 -0.0200 0.0143  0.0017  1173 GLN A CB  
2403 C CG  . GLN A 152 ? 0.0790 0.0871 0.1001 -0.0139 0.0118  0.0029  1173 GLN A CG  
2404 C CD  . GLN A 152 ? 0.0933 0.0851 0.1545 -0.0146 0.0149  -0.0072 1173 GLN A CD  
2405 O OE1 . GLN A 152 ? 0.1170 0.0852 0.2602 -0.0175 -0.0270 -0.0002 1173 GLN A OE1 
2406 N NE2 . GLN A 152 ? 0.1137 0.1044 0.1411 -0.0176 0.0127  -0.0171 1173 GLN A NE2 
2415 N N   . THR A 153 ? 0.0841 0.0696 0.0800 -0.0083 -0.0016 0.0048  1174 THR A N   
2416 C CA  . THR A 153 ? 0.0690 0.0925 0.1073 -0.0235 0.0055  -0.0022 1174 THR A CA  
2417 C C   . THR A 153 ? 0.0621 0.0842 0.1116 -0.0144 -0.0009 0.0237  1174 THR A C   
2418 O O   . THR A 153 ? 0.0755 0.1041 0.0958 -0.0034 0.0073  0.0013  1174 THR A O   
2419 C CB  . THR A 153 ? 0.0742 0.1069 0.1252 -0.0155 -0.0193 -0.0065 1174 THR A CB  
2420 O OG1 . THR A 153 ? 0.0971 0.1090 0.1561 -0.0215 -0.0393 -0.0087 1174 THR A OG1 
2421 C CG2 . THR A 153 ? 0.0738 0.1398 0.1362 0.0150  -0.0153 0.0128  1174 THR A CG2 
2429 N N   A ILE A 154 ? 0.0780 0.0728 0.0625 -0.0205 0.0153  -0.0087 1175 ILE A N   
2430 N N   B ILE A 154 ? 0.0513 0.0776 0.1047 0.0257  -0.0120 0.0218  1175 ILE A N   
2431 C CA  A ILE A 154 ? 0.0698 0.0835 0.0768 -0.0056 0.0026  -0.0190 1175 ILE A CA  
2432 C CA  B ILE A 154 ? 0.0714 0.0776 0.1034 0.0199  -0.0067 0.0148  1175 ILE A CA  
2433 C C   A ILE A 154 ? 0.0601 0.0774 0.1055 -0.0212 -0.0007 -0.0177 1175 ILE A C   
2434 C C   B ILE A 154 ? 0.0744 0.0556 0.1022 0.0015  0.0274  0.0192  1175 ILE A C   
2435 O O   A ILE A 154 ? 0.1113 0.1068 0.1314 0.0056  -0.0137 -0.0481 1175 ILE A O   
2436 O O   B ILE A 154 ? 0.0587 0.0460 0.0669 -0.0018 -0.0050 -0.0018 1175 ILE A O   
2437 C CB  A ILE A 154 ? 0.1011 0.0832 0.1134 -0.0101 0.0198  0.0047  1175 ILE A CB  
2438 C CB  B ILE A 154 ? 0.0644 0.0669 0.0821 -0.0232 -0.0328 -0.0043 1175 ILE A CB  
2439 C CG1 A ILE A 154 ? 0.1046 0.0978 0.1337 0.0145  -0.0262 0.0429  1175 ILE A CG1 
2440 C CG1 B ILE A 154 ? 0.0633 0.0556 0.0657 -0.0252 -0.0176 -0.0158 1175 ILE A CG1 
2441 C CG2 A ILE A 154 ? 0.1330 0.1160 0.0683 -0.0185 0.0044  0.0341  1175 ILE A CG2 
2442 C CG2 B ILE A 154 ? 0.1075 0.0581 0.1021 -0.0402 -0.0127 -0.0084 1175 ILE A CG2 
2443 C CD1 A ILE A 154 ? 0.1170 0.1150 0.1006 -0.0005 -0.0145 0.0274  1175 ILE A CD1 
2444 C CD1 B ILE A 154 ? 0.0888 0.0851 0.0548 0.0205  -0.0128 -0.0261 1175 ILE A CD1 
2467 N N   . SER A 155 ? 0.0750 0.0606 0.0739 0.0015  0.0046  -0.0009 1176 SER A N   
2468 C CA  . SER A 155 ? 0.0528 0.0749 0.0890 -0.0177 0.0068  -0.0002 1176 SER A CA  
2469 C C   . SER A 155 ? 0.0663 0.0663 0.0702 -0.0072 -0.0084 0.0060  1176 SER A C   
2470 O O   . SER A 155 ? 0.0791 0.0811 0.0839 -0.0102 -0.0009 0.0148  1176 SER A O   
2471 C CB  . SER A 155 ? 0.0591 0.0634 0.0830 -0.0064 0.0019  0.0016  1176 SER A CB  
2472 O OG  . SER A 155 ? 0.0631 0.0660 0.0997 -0.0181 0.0177  0.0046  1176 SER A OG  
2478 N N   . PHE A 156 ? 0.0575 0.0713 0.0893 -0.0086 -0.0025 0.0123  1177 PHE A N   
2479 C CA  . PHE A 156 ? 0.0802 0.0769 0.0724 -0.0169 0.0220  0.0114  1177 PHE A CA  
2480 C C   . PHE A 156 ? 0.0612 0.0753 0.0840 -0.0106 0.0045  -0.0053 1177 PHE A C   
2481 O O   . PHE A 156 ? 0.0844 0.0936 0.0838 -0.0114 0.0151  0.0094  1177 PHE A O   
2482 C CB  . PHE A 156 ? 0.1073 0.1099 0.0741 -0.0334 -0.0091 0.0047  1177 PHE A CB  
2483 C CG  . PHE A 156 ? 0.1405 0.1799 0.0814 -0.0788 0.0118  0.0026  1177 PHE A CG  
2484 C CD1 . PHE A 156 ? 0.1810 0.2481 0.1301 -0.0841 0.0541  -0.0803 1177 PHE A CD1 
2485 C CD2 . PHE A 156 ? 0.2246 0.2596 0.1142 -0.1088 -0.0105 0.0518  1177 PHE A CD2 
2486 C CE1 . PHE A 156 ? 0.2478 0.3434 0.1967 -0.1400 0.0889  -0.1162 1177 PHE A CE1 
2487 C CE2 . PHE A 156 ? 0.2785 0.3512 0.1411 -0.1473 0.0174  0.0315  1177 PHE A CE2 
2488 C CZ  . PHE A 156 ? 0.2558 0.3769 0.1459 -0.1539 0.0524  -0.0594 1177 PHE A CZ  
2498 N N   . ILE A 157 ? 0.0686 0.0780 0.0880 -0.0042 -0.0023 0.0066  1178 ILE A N   
2499 C CA  . ILE A 157 ? 0.0851 0.0680 0.0877 -0.0156 0.0007  0.0030  1178 ILE A CA  
2500 C C   . ILE A 157 ? 0.0673 0.0640 0.1101 -0.0266 0.0054  0.0102  1178 ILE A C   
2501 O O   . ILE A 157 ? 0.0788 0.0715 0.0887 -0.0169 -0.0062 0.0224  1178 ILE A O   
2502 C CB  . ILE A 157 ? 0.1014 0.0777 0.0990 -0.0185 0.0035  0.0253  1178 ILE A CB  
2503 C CG1 . ILE A 157 ? 0.1100 0.1003 0.1140 0.0046  -0.0147 0.0263  1178 ILE A CG1 
2504 C CG2 . ILE A 157 ? 0.1327 0.1113 0.1209 -0.0013 0.0022  0.0391  1178 ILE A CG2 
2505 C CD1 . ILE A 157 ? 0.1763 0.0985 0.1127 -0.0008 -0.0118 0.0517  1178 ILE A CD1 
2517 N N   . PRO A 158 ? 0.0584 0.0645 0.1131 -0.0090 0.0025  0.0223  1179 PRO A N   
2518 C CA  . PRO A 158 ? 0.0969 0.0638 0.0992 -0.0226 0.0169  0.0131  1179 PRO A CA  
2519 C C   . PRO A 158 ? 0.0712 0.0556 0.0885 -0.0077 -0.0143 0.0059  1179 PRO A C   
2520 O O   . PRO A 158 ? 0.0840 0.0741 0.0999 -0.0059 0.0098  0.0099  1179 PRO A O   
2521 C CB  . PRO A 158 ? 0.0801 0.0694 0.0911 -0.0066 -0.0026 0.0090  1179 PRO A CB  
2522 C CG  . PRO A 158 ? 0.0973 0.0881 0.1090 -0.0227 -0.0075 0.0116  1179 PRO A CG  
2523 C CD  . PRO A 158 ? 0.0889 0.0794 0.0920 -0.0186 -0.0045 0.0151  1179 PRO A CD  
2531 N N   . ASP A 159 ? 0.0945 0.0621 0.0923 -0.0122 0.0109  0.0135  1180 ASP A N   
2532 C CA  . ASP A 159 ? 0.0760 0.0772 0.1145 0.0039  0.0112  0.0241  1180 ASP A CA  
2533 C C   . ASP A 159 ? 0.0782 0.0732 0.1059 -0.0079 0.0043  0.0319  1180 ASP A C   
2534 O O   . ASP A 159 ? 0.0887 0.0925 0.1522 -0.0075 0.0219  0.0191  1180 ASP A O   
2535 C CB  . ASP A 159 ? 0.0967 0.0805 0.1330 -0.0166 -0.0100 0.0262  1180 ASP A CB  
2536 C CG  . ASP A 159 ? 0.1093 0.1145 0.1007 -0.0165 -0.0100 0.0177  1180 ASP A CG  
2537 O OD1 . ASP A 159 ? 0.1059 0.1475 0.1539 0.0315  -0.0003 0.0401  1180 ASP A OD1 
2538 O OD2 . ASP A 159 ? 0.1534 0.1582 0.1543 0.0060  -0.0153 0.0117  1180 ASP A OD2 
2543 N N   . PHE A 160 ? 0.0751 0.0636 0.1039 -0.0106 0.0032  0.0169  1181 PHE A N   
2544 C CA  . PHE A 160 ? 0.0995 0.0716 0.1153 -0.0086 -0.0164 0.0256  1181 PHE A CA  
2545 C C   . PHE A 160 ? 0.0833 0.0718 0.1193 -0.0234 0.0063  0.0018  1181 PHE A C   
2546 O O   . PHE A 160 ? 0.0838 0.1072 0.1313 -0.0376 -0.0037 0.0217  1181 PHE A O   
2547 C CB  . PHE A 160 ? 0.0918 0.0825 0.1278 -0.0267 -0.0337 0.0055  1181 PHE A CB  
2548 C CG  . PHE A 160 ? 0.0990 0.1197 0.0944 -0.0240 -0.0299 -0.0014 1181 PHE A CG  
2549 C CD1 . PHE A 160 ? 0.1322 0.1272 0.1133 -0.0233 -0.0468 0.0497  1181 PHE A CD1 
2550 C CD2 . PHE A 160 ? 0.1186 0.1417 0.1207 -0.0135 -0.0382 0.0020  1181 PHE A CD2 
2551 C CE1 . PHE A 160 ? 0.1670 0.1654 0.1365 -0.0283 -0.0273 0.0304  1181 PHE A CE1 
2552 C CE2 . PHE A 160 ? 0.1583 0.1794 0.0948 -0.0134 -0.0195 -0.0096 1181 PHE A CE2 
2553 C CZ  . PHE A 160 ? 0.1698 0.1848 0.1086 -0.0313 -0.0396 0.0201  1181 PHE A CZ  
2563 N N   . ALA A 161 ? 0.0637 0.0781 0.1107 -0.0158 0.0135  0.0004  1182 ALA A N   
2564 C CA  . ALA A 161 ? 0.0811 0.0694 0.0883 -0.0235 0.0170  -0.0005 1182 ALA A CA  
2565 C C   . ALA A 161 ? 0.0941 0.0662 0.1093 -0.0006 0.0295  0.0197  1182 ALA A C   
2566 O O   . ALA A 161 ? 0.0984 0.0721 0.1593 0.0070  0.0467  0.0176  1182 ALA A O   
2567 C CB  . ALA A 161 ? 0.0897 0.0756 0.0972 -0.0057 0.0223  0.0043  1182 ALA A CB  
2573 N N   . VAL A 162 ? 0.0992 0.0727 0.1199 -0.0004 0.0320  0.0019  1183 VAL A N   
2574 C CA  . VAL A 162 ? 0.1266 0.1051 0.1340 0.0195  0.0399  0.0216  1183 VAL A CA  
2575 C C   . VAL A 162 ? 0.1336 0.0587 0.1277 -0.0048 0.0550  -0.0062 1183 VAL A C   
2576 O O   . VAL A 162 ? 0.1518 0.0624 0.1451 0.0011  0.0533  0.0013  1183 VAL A O   
2577 C CB  . VAL A 162 ? 0.1331 0.2347 0.1909 0.0408  0.0418  -0.0062 1183 VAL A CB  
2578 C CG1 . VAL A 162 ? 0.1894 0.3428 0.2760 0.0576  0.0815  -0.0629 1183 VAL A CG1 
2579 C CG2 . VAL A 162 ? 0.1289 0.2377 0.2158 0.0246  -0.0117 -0.0239 1183 VAL A CG2 
2589 N N   . ALA A 163 ? 0.1645 0.0666 0.1534 -0.0072 0.0808  0.0004  1184 ALA A N   
2590 C CA  . ALA A 163 ? 0.1864 0.1012 0.1697 -0.0110 0.0775  -0.0104 1184 ALA A CA  
2591 C C   . ALA A 163 ? 0.2170 0.0925 0.1534 0.0071  0.0916  -0.0076 1184 ALA A C   
2592 O O   . ALA A 163 ? 0.2531 0.1226 0.2443 0.0383  0.1305  0.0081  1184 ALA A O   
2593 C CB  . ALA A 163 ? 0.2038 0.1174 0.2128 -0.0187 0.0238  -0.0230 1184 ALA A CB  
2599 N N   . ILE A 164 ? 0.1647 0.1031 0.1322 0.0028  0.0565  -0.0134 1185 ILE A N   
2600 C CA  . ILE A 164 ? 0.1743 0.1637 0.1687 -0.0065 0.0750  -0.0052 1185 ILE A CA  
2601 C C   . ILE A 164 ? 0.1782 0.1463 0.1325 0.0079  0.0641  0.0103  1185 ILE A C   
2602 O O   . ILE A 164 ? 0.2256 0.1559 0.1591 0.0434  0.0778  -0.0030 1185 ILE A O   
2603 C CB  . ILE A 164 ? 0.2410 0.2191 0.1887 -0.0186 0.0817  -0.0140 1185 ILE A CB  
2604 C CG1 . ILE A 164 ? 0.2305 0.1896 0.2379 -0.0196 0.0543  -0.0576 1185 ILE A CG1 
2605 C CG2 . ILE A 164 ? 0.2690 0.2967 0.2719 -0.0314 0.1261  0.0249  1185 ILE A CG2 
2606 C CD1 . ILE A 164 ? 0.2563 0.2140 0.2946 -0.0340 0.1070  -0.0908 1185 ILE A CD1 
2618 N N   . PRO A 165 ? 0.2086 0.1250 0.1738 0.0132  0.0757  -0.0057 1186 PRO A N   
2619 C CA  . PRO A 165 ? 0.2430 0.1477 0.1239 -0.0028 0.0448  -0.0195 1186 PRO A CA  
2620 C C   . PRO A 165 ? 0.2254 0.1498 0.1451 0.0210  0.0968  -0.0153 1186 PRO A C   
2621 O O   . PRO A 165 ? 0.3049 0.1764 0.1594 0.0038  0.0719  -0.0057 1186 PRO A O   
2622 C CB  . PRO A 165 ? 0.2968 0.1460 0.1626 -0.0441 0.0746  -0.0609 1186 PRO A CB  
2623 C CG  . PRO A 165 ? 0.4067 0.1751 0.2280 0.0194  0.0869  -0.0309 1186 PRO A CG  
2624 C CD  . PRO A 165 ? 0.2590 0.1297 0.1911 0.0403  0.0959  -0.0249 1186 PRO A CD  
2632 N N   . THR A 166 ? 0.2406 0.1678 0.1930 -0.0022 0.1253  -0.0213 1187 THR A N   
2633 C CA  . THR A 166 ? 0.2600 0.1927 0.2004 -0.0075 0.1342  -0.0152 1187 THR A CA  
2634 C C   . THR A 166 ? 0.2402 0.1770 0.1957 0.0222  0.1279  0.0108  1187 THR A C   
2635 O O   . THR A 166 ? 0.2486 0.1405 0.2091 0.0112  0.0944  0.0161  1187 THR A O   
2636 C CB  . THR A 166 ? 0.2999 0.2225 0.2549 0.0088  0.0972  -0.0277 1187 THR A CB  
2637 O OG1 . THR A 166 ? 0.2844 0.2596 0.3455 0.0107  0.1681  -0.0667 1187 THR A OG1 
2638 C CG2 . THR A 166 ? 0.3142 0.2107 0.2971 -0.0021 0.1460  -0.0842 1187 THR A CG2 
2646 N N   . PHE A 167 ? 0.2692 0.1540 0.1922 0.0080  0.1321  0.0143  1188 PHE A N   
2647 C CA  . PHE A 167 ? 0.2636 0.1299 0.2213 0.0359  0.1074  0.0503  1188 PHE A CA  
2648 C C   . PHE A 167 ? 0.2408 0.1541 0.2569 0.0643  0.0853  0.0936  1188 PHE A C   
2649 O O   . PHE A 167 ? 0.1916 0.1922 0.3436 0.0347  0.0955  0.0790  1188 PHE A O   
2650 C CB  . PHE A 167 ? 0.2232 0.1163 0.2157 0.0034  0.0507  0.0448  1188 PHE A CB  
2651 C CG  . PHE A 167 ? 0.1854 0.1441 0.1787 -0.0158 0.0074  0.0655  1188 PHE A CG  
2652 C CD1 . PHE A 167 ? 0.2663 0.1661 0.1955 0.0095  0.0616  0.0104  1188 PHE A CD1 
2653 C CD2 . PHE A 167 ? 0.2868 0.1427 0.2001 -0.0316 -0.0506 0.0746  1188 PHE A CD2 
2654 C CE1 . PHE A 167 ? 0.3137 0.1691 0.3195 -0.0034 0.0839  0.0092  1188 PHE A CE1 
2655 C CE2 . PHE A 167 ? 0.2938 0.1695 0.3069 -0.0582 -0.0265 0.0554  1188 PHE A CE2 
2656 C CZ  . PHE A 167 ? 0.2576 0.1836 0.2952 -0.0351 0.0280  0.0555  1188 PHE A CZ  
2666 N N   . ARG A 168 ? 0.2997 0.2016 0.2935 0.0919  0.1477  0.0840  1189 ARG A N   
2667 C CA  . ARG A 168 ? 0.3563 0.2278 0.2979 0.1196  0.1456  0.0924  1189 ARG A CA  
2668 C C   . ARG A 168 ? 0.3263 0.2123 0.2664 0.0946  0.1411  0.0853  1189 ARG A C   
2669 O O   . ARG A 168 ? 0.3203 0.2213 0.3302 0.0563  0.0338  0.0564  1189 ARG A O   
2670 C CB  . ARG A 168 ? 0.3736 0.2881 0.3114 0.1229  0.1448  0.1189  1189 ARG A CB  
2671 C CG  . ARG A 168 ? 0.4459 0.3596 0.3994 0.0553  0.1265  0.0441  1189 ARG A CG  
2672 C CD  . ARG A 168 ? 0.5393 0.4185 0.3737 0.0258  0.1434  -0.0069 1189 ARG A CD  
2673 N NE  . ARG A 168 ? 0.6117 0.5246 0.5231 0.0100  0.1300  -0.0428 1189 ARG A NE  
2674 C CZ  . ARG A 168 ? 0.6692 0.6289 0.6987 0.0100  0.1066  -0.0490 1189 ARG A CZ  
2675 N NH1 . ARG A 168 ? 0.6412 0.6972 0.7118 0.0280  0.1475  -0.0016 1189 ARG A NH1 
2676 N NH2 . ARG A 168 ? 0.7180 0.6345 0.7642 -0.0095 0.0312  -0.0999 1189 ARG A NH2 
2690 N N   . GLU A 169 ? 0.3122 0.1614 0.2899 0.0694  0.1358  0.0763  1190 GLU A N   
2691 C CA  . GLU A 169 ? 0.2943 0.1441 0.2382 0.0441  0.0413  0.0703  1190 GLU A CA  
2692 C C   . GLU A 169 ? 0.2400 0.1353 0.2903 0.0519  0.0289  0.0655  1190 GLU A C   
2693 O O   . GLU A 169 ? 0.2103 0.1401 0.2539 0.0110  0.0144  0.0529  1190 GLU A O   
2694 C CB  . GLU A 169 ? 0.3327 0.1707 0.3216 0.0044  -0.0340 0.0447  1190 GLU A CB  
2695 C CG  . GLU A 169 ? 0.4479 0.2789 0.3477 0.0245  -0.0048 0.0260  1190 GLU A CG  
2696 C CD  . GLU A 169 ? 0.5073 0.4591 0.4981 0.0432  0.0827  -0.0368 1190 GLU A CD  
2697 O OE1 . GLU A 169 ? 0.4586 0.5623 0.4258 0.1034  0.0925  -0.0369 1190 GLU A OE1 
2698 O OE2 . GLU A 169 ? 0.5414 0.4877 0.5993 -0.0197 0.0753  -0.0823 1190 GLU A OE2 
2705 N N   . LEU A 170 ? 0.2541 0.1533 0.3034 0.0439  0.1306  0.0681  1191 LEU A N   
2706 C CA  . LEU A 170 ? 0.2872 0.1506 0.3455 0.0381  0.1471  0.0770  1191 LEU A CA  
2707 C C   . LEU A 170 ? 0.2444 0.1207 0.2890 0.0378  0.1464  0.0279  1191 LEU A C   
2708 O O   . LEU A 170 ? 0.3230 0.1266 0.2809 0.0314  0.1680  0.0173  1191 LEU A O   
2709 C CB  . LEU A 170 ? 0.3347 0.1832 0.4079 0.0479  0.1804  0.0935  1191 LEU A CB  
2710 C CG  . LEU A 170 ? 0.1797 0.1590 0.3358 0.0266  -0.0006 0.0236  1191 LEU A CG  
2711 C CD1 . LEU A 170 ? 0.1435 0.1916 0.1977 0.0544  0.0003  -0.0423 1191 LEU A CD1 
2712 C CD2 . LEU A 170 ? 0.2315 0.1154 0.3523 -0.0017 -0.1003 0.0166  1191 LEU A CD2 
2724 N N   . GLY A 171 ? 0.2477 0.1281 0.3577 0.0201  0.1709  0.0312  1192 GLY A N   
2725 C CA  . GLY A 171 ? 0.2515 0.1379 0.3405 -0.0508 0.1403  -0.0468 1192 GLY A CA  
2726 C C   . GLY A 171 ? 0.1833 0.1680 0.3688 -0.0426 0.1184  -0.0704 1192 GLY A C   
2727 O O   . GLY A 171 ? 0.1704 0.2119 0.3820 -0.0614 0.0782  -0.0879 1192 GLY A O   
2731 N N   . THR A 172 ? 0.1373 0.1328 0.3049 -0.0118 0.1020  -0.0152 1193 THR A N   
2732 C CA  . THR A 172 ? 0.1373 0.1193 0.2332 0.0181  0.0663  -0.0008 1193 THR A CA  
2733 C C   . THR A 172 ? 0.1034 0.1062 0.1810 0.0266  0.0189  -0.0088 1193 THR A C   
2734 O O   . THR A 172 ? 0.1110 0.1350 0.1893 0.0314  0.0123  -0.0011 1193 THR A O   
2735 C CB  . THR A 172 ? 0.1337 0.1058 0.2056 0.0216  0.0424  0.0289  1193 THR A CB  
2736 O OG1 . THR A 172 ? 0.1732 0.0930 0.1710 0.0281  0.0343  0.0263  1193 THR A OG1 
2737 C CG2 . THR A 172 ? 0.1835 0.1484 0.2448 0.0567  0.1025  0.0568  1193 THR A CG2 
2745 N N   . ILE A 173 ? 0.1114 0.1016 0.1920 0.0282  0.0528  0.0064  1194 ILE A N   
2746 C CA  . ILE A 173 ? 0.0941 0.1153 0.1684 0.0338  0.0066  0.0016  1194 ILE A CA  
2747 C C   . ILE A 173 ? 0.0996 0.1277 0.2312 0.0198  -0.0072 -0.0202 1194 ILE A C   
2748 O O   . ILE A 173 ? 0.1263 0.1503 0.2008 0.0303  0.0022  -0.0107 1194 ILE A O   
2749 C CB  . ILE A 173 ? 0.1124 0.1263 0.2030 0.0413  0.0284  0.0123  1194 ILE A CB  
2750 C CG1 . ILE A 173 ? 0.1520 0.1594 0.2399 0.0566  0.0248  0.0414  1194 ILE A CG1 
2751 C CG2 . ILE A 173 ? 0.1153 0.1542 0.2597 0.0250  0.0268  -0.0009 1194 ILE A CG2 
2752 C CD1 . ILE A 173 ? 0.1827 0.1823 0.3362 0.0763  0.0110  0.0278  1194 ILE A CD1 
2764 N N   A GLN A 174 ? 0.1384 0.1295 0.2564 0.0249  0.0309  -0.0639 1195 GLN A N   
2765 N N   B GLN A 174 ? 0.1357 0.1364 0.2598 0.0202  0.0338  -0.0660 1195 GLN A N   
2766 C CA  A GLN A 174 ? 0.1829 0.1507 0.3417 0.0069  -0.0188 -0.0866 1195 GLN A CA  
2767 C CA  B GLN A 174 ? 0.1774 0.1617 0.3441 0.0031  -0.0155 -0.1009 1195 GLN A CA  
2768 C C   A GLN A 174 ? 0.1622 0.1455 0.3477 0.0341  -0.0700 -0.0924 1195 GLN A C   
2769 C C   B GLN A 174 ? 0.1401 0.1577 0.3380 0.0311  -0.0756 -0.1030 1195 GLN A C   
2770 O O   A GLN A 174 ? 0.1708 0.1479 0.3206 0.0238  -0.0626 -0.1052 1195 GLN A O   
2771 O O   B GLN A 174 ? 0.1296 0.1635 0.2888 0.0336  -0.0564 -0.1164 1195 GLN A O   
2772 C CB  A GLN A 174 ? 0.3402 0.2030 0.3915 -0.0506 0.0602  -0.1286 1195 GLN A CB  
2773 C CB  B GLN A 174 ? 0.3462 0.2088 0.3953 -0.0240 0.0657  -0.1424 1195 GLN A CB  
2774 C CG  A GLN A 174 ? 0.3812 0.2306 0.4829 -0.1035 0.1418  -0.1209 1195 GLN A CG  
2775 C CG  B GLN A 174 ? 0.4135 0.2440 0.4952 -0.0489 0.1164  -0.1457 1195 GLN A CG  
2776 C CD  A GLN A 174 ? 0.3228 0.2602 0.5070 -0.1121 0.0295  -0.1076 1195 GLN A CD  
2777 C CD  B GLN A 174 ? 0.3759 0.2697 0.5117 -0.0900 0.0087  -0.1007 1195 GLN A CD  
2778 O OE1 A GLN A 174 ? 0.3658 0.2535 0.6058 -0.0730 0.0538  -0.1145 1195 GLN A OE1 
2779 O OE1 B GLN A 174 ? 0.4273 0.2858 0.5979 -0.0871 0.0787  -0.0637 1195 GLN A OE1 
2780 N NE2 A GLN A 174 ? 0.3556 0.2987 0.6050 -0.0991 0.1164  -0.0700 1195 GLN A NE2 
2781 N NE2 B GLN A 174 ? 0.3223 0.2718 0.5823 -0.0980 0.0192  -0.0812 1195 GLN A NE2 
2798 N N   . GLN A 175 ? 0.1548 0.1697 0.3314 0.0526  -0.0708 -0.1106 1196 GLN A N   
2799 C CA  . GLN A 175 ? 0.1916 0.1984 0.2912 0.0858  -0.1001 -0.1106 1196 GLN A CA  
2800 C C   . GLN A 175 ? 0.2291 0.1534 0.2434 0.0838  -0.1085 -0.0527 1196 GLN A C   
2801 O O   . GLN A 175 ? 0.2656 0.1802 0.2253 0.1105  -0.0998 -0.0560 1196 GLN A O   
2802 C CB  . GLN A 175 ? 0.2794 0.2737 0.2833 0.1439  -0.1064 -0.1179 1196 GLN A CB  
2803 C CG  . GLN A 175 ? 0.3564 0.3760 0.4184 0.1846  -0.0980 -0.0820 1196 GLN A CG  
2804 C CD  . GLN A 175 ? 0.3808 0.4605 0.5732 0.1193  -0.1061 -0.0971 1196 GLN A CD  
2805 O OE1 . GLN A 175 ? 0.3724 0.4733 0.6196 0.1055  -0.1402 -0.1291 1196 GLN A OE1 
2806 N NE2 . GLN A 175 ? 0.4437 0.4989 0.6189 0.0577  -0.0410 -0.1213 1196 GLN A NE2 
2814 N N   A VAL A 176 ? 0.2051 0.1190 0.2216 0.0697  -0.0771 -0.0394 1197 VAL A N   
2815 N N   B VAL A 176 ? 0.2210 0.1319 0.2364 0.0736  -0.0952 -0.0363 1197 VAL A N   
2816 C CA  A VAL A 176 ? 0.2558 0.1005 0.2139 0.0559  -0.0558 -0.0389 1197 VAL A CA  
2817 C CA  B VAL A 176 ? 0.2528 0.1210 0.2225 0.0448  -0.0598 -0.0296 1197 VAL A CA  
2818 C C   A VAL A 176 ? 0.1751 0.0736 0.1881 0.0306  -0.0654 -0.0275 1197 VAL A C   
2819 C C   B VAL A 176 ? 0.1785 0.1005 0.1976 0.0291  -0.0413 -0.0304 1197 VAL A C   
2820 O O   A VAL A 176 ? 0.2086 0.0992 0.1685 0.0106  -0.0657 -0.0043 1197 VAL A O   
2821 O O   B VAL A 176 ? 0.1602 0.1317 0.1967 0.0318  -0.0231 -0.0197 1197 VAL A O   
2822 C CB  A VAL A 176 ? 0.3038 0.1207 0.2605 0.0166  -0.1223 -0.0123 1197 VAL A CB  
2823 C CB  B VAL A 176 ? 0.3032 0.1309 0.2446 -0.0016 -0.1092 -0.0121 1197 VAL A CB  
2824 C CG1 A VAL A 176 ? 0.4468 0.1876 0.3315 -0.0132 -0.1742 0.0115  1197 VAL A CG1 
2825 C CG1 B VAL A 176 ? 0.4398 0.1812 0.3347 -0.0310 -0.1517 -0.0170 1197 VAL A CG1 
2826 C CG2 A VAL A 176 ? 0.1890 0.1005 0.2374 -0.0013 -0.0607 -0.0145 1197 VAL A CG2 
2827 C CG2 B VAL A 176 ? 0.2104 0.0992 0.2031 -0.0340 -0.0453 0.0067  1197 VAL A CG2 
2846 N N   . ILE A 177 ? 0.1346 0.0647 0.2162 0.0117  -0.0319 -0.0102 1198 ILE A N   
2847 C CA  . ILE A 177 ? 0.1007 0.0961 0.1829 -0.0127 -0.0394 0.0005  1198 ILE A CA  
2848 C C   . ILE A 177 ? 0.0973 0.0878 0.2218 0.0209  -0.0456 -0.0085 1198 ILE A C   
2849 O O   . ILE A 177 ? 0.1267 0.1136 0.1997 0.0377  -0.0331 -0.0266 1198 ILE A O   
2850 C CB  . ILE A 177 ? 0.0968 0.1078 0.2044 0.0049  -0.0022 0.0431  1198 ILE A CB  
2851 C CG1 . ILE A 177 ? 0.0838 0.1547 0.1759 -0.0125 -0.0191 0.0460  1198 ILE A CG1 
2852 C CG2 . ILE A 177 ? 0.1097 0.0967 0.2023 0.0279  0.0337  0.0534  1198 ILE A CG2 
2853 C CD1 . ILE A 177 ? 0.0959 0.1739 0.1807 -0.0179 -0.0180 0.0448  1198 ILE A CD1 
2865 N N   . SER A 178 ? 0.1152 0.1189 0.2695 0.0286  -0.0783 -0.0407 1199 SER A N   
2866 C CA  . SER A 178 ? 0.1568 0.1530 0.3069 0.0458  -0.1082 -0.0741 1199 SER A CA  
2867 C C   . SER A 178 ? 0.1788 0.1894 0.2157 0.0392  -0.1014 -0.0808 1199 SER A C   
2868 O O   . SER A 178 ? 0.1648 0.2258 0.2621 0.0630  -0.0932 -0.1080 1199 SER A O   
2869 C CB  . SER A 178 ? 0.1888 0.1587 0.3885 0.0353  -0.1370 -0.0664 1199 SER A CB  
2870 O OG  . SER A 178 ? 0.1775 0.1485 0.4655 0.0274  -0.1232 -0.0743 1199 SER A OG  
2876 N N   . GLU A 179 ? 0.1782 0.2008 0.1919 0.0821  -0.0837 -0.0466 1200 GLU A N   
2877 C CA  . GLU A 179 ? 0.2266 0.2162 0.2035 0.0927  -0.1075 -0.0428 1200 GLU A CA  
2878 C C   . GLU A 179 ? 0.2503 0.2057 0.1952 0.1001  -0.0884 -0.0012 1200 GLU A C   
2879 O O   . GLU A 179 ? 0.3351 0.2460 0.1605 0.1010  -0.0831 -0.0001 1200 GLU A O   
2880 C CB  . GLU A 179 ? 0.2574 0.1974 0.2538 0.1167  -0.0855 -0.0394 1200 GLU A CB  
2881 C CG  . GLU A 179 ? 0.2748 0.2101 0.3083 0.1078  -0.1186 -0.0238 1200 GLU A CG  
2882 C CD  . GLU A 179 ? 0.3012 0.1960 0.3487 0.0810  -0.1342 0.0011  1200 GLU A CD  
2883 O OE1 . GLU A 179 ? 0.2937 0.1334 0.4369 -0.0065 -0.1202 0.0266  1200 GLU A OE1 
2884 O OE2 . GLU A 179 ? 0.3242 0.2573 0.3284 0.1185  -0.0466 -0.0502 1200 GLU A OE2 
2891 N N   . ARG A 180 ? 0.2430 0.1540 0.1958 0.0617  -0.1114 -0.0088 1201 ARG A N   
2892 C CA  . ARG A 180 ? 0.2335 0.1594 0.1621 0.0545  -0.0889 0.0132  1201 ARG A CA  
2893 C C   . ARG A 180 ? 0.2366 0.1457 0.1535 0.0451  -0.0536 0.0124  1201 ARG A C   
2894 O O   . ARG A 180 ? 0.2360 0.1603 0.1520 0.0229  -0.0557 0.0162  1201 ARG A O   
2895 C CB  . ARG A 180 ? 0.2357 0.1963 0.1720 0.0370  -0.0602 0.0067  1201 ARG A CB  
2896 C CG  . ARG A 180 ? 0.2794 0.2157 0.2299 0.0544  -0.0747 0.0084  1201 ARG A CG  
2897 C CD  . ARG A 180 ? 0.2599 0.2314 0.2725 -0.0336 -0.1269 0.0349  1201 ARG A CD  
2898 N NE  . ARG A 180 ? 0.2127 0.2300 0.2885 0.0025  -0.1067 0.0751  1201 ARG A NE  
2899 C CZ  . ARG A 180 ? 0.2260 0.2199 0.3044 0.0452  -0.0859 0.0887  1201 ARG A CZ  
2900 N NH1 . ARG A 180 ? 0.3009 0.2115 0.3117 0.0154  -0.0598 0.0820  1201 ARG A NH1 
2901 N NH2 . ARG A 180 ? 0.2698 0.2328 0.4292 0.0518  0.0788  0.1068  1201 ARG A NH2 
2915 N N   . VAL A 181 ? 0.1612 0.1354 0.1932 0.0458  -0.0553 -0.0199 1202 VAL A N   
2916 C CA  . VAL A 181 ? 0.1478 0.1829 0.2653 0.0519  -0.0446 -0.0596 1202 VAL A CA  
2917 C C   . VAL A 181 ? 0.1708 0.2349 0.3108 0.0413  -0.0877 -0.0937 1202 VAL A C   
2918 O O   . VAL A 181 ? 0.2064 0.2204 0.3016 0.0358  -0.0612 -0.0926 1202 VAL A O   
2919 C CB  . VAL A 181 ? 0.1731 0.1755 0.3170 0.0116  0.0257  -0.0858 1202 VAL A CB  
2920 C CG1 . VAL A 181 ? 0.1983 0.2097 0.3894 -0.0046 0.0700  -0.1253 1202 VAL A CG1 
2921 C CG2 . VAL A 181 ? 0.1886 0.1484 0.3444 -0.0025 0.1095  -0.0401 1202 VAL A CG2 
2931 N N   . ILE A 182 ? 0.2114 0.3102 0.2538 0.0593  -0.1181 -0.0945 1203 ILE A N   
2932 C CA  . ILE A 182 ? 0.2303 0.3502 0.2620 0.0723  -0.1300 -0.0148 1203 ILE A CA  
2933 C C   . ILE A 182 ? 0.2823 0.3419 0.2613 0.0662  -0.1528 -0.0325 1203 ILE A C   
2934 O O   . ILE A 182 ? 0.3863 0.3991 0.2342 0.0761  -0.1575 -0.0475 1203 ILE A O   
2935 C CB  . ILE A 182 ? 0.2738 0.4227 0.2648 0.0101  -0.1332 0.0110  1203 ILE A CB  
2936 C CG1 . ILE A 182 ? 0.2701 0.4145 0.3589 -0.0222 -0.0808 -0.0445 1203 ILE A CG1 
2937 C CG2 . ILE A 182 ? 0.3502 0.4921 0.2650 -0.0115 -0.1344 0.0424  1203 ILE A CG2 
2938 C CD1 . ILE A 182 ? 0.3312 0.4236 0.3966 0.0152  -0.0600 -0.0019 1203 ILE A CD1 
2950 N N   . GLN A 183 ? 0.2918 0.2775 0.2247 0.0712  -0.0997 0.0176  1204 GLN A N   
2951 C CA  . GLN A 183 ? 0.4073 0.2457 0.1683 0.0498  -0.0326 0.0099  1204 GLN A CA  
2952 C C   . GLN A 183 ? 0.4482 0.1991 0.1312 0.0926  -0.0506 -0.0045 1204 GLN A C   
2953 O O   . GLN A 183 ? 0.5329 0.2231 0.1446 0.0573  -0.0316 0.0167  1204 GLN A O   
2954 C CB  . GLN A 183 ? 0.4235 0.2492 0.1818 0.0039  0.0328  0.0367  1204 GLN A CB  
2955 C CG  . GLN A 183 ? 0.4386 0.3024 0.1659 -0.0435 -0.0158 -0.0019 1204 GLN A CG  
2956 C CD  . GLN A 183 ? 0.4358 0.3662 0.3035 -0.0827 0.0364  -0.0969 1204 GLN A CD  
2957 O OE1 . GLN A 183 ? 0.4088 0.3523 0.3033 -0.0099 -0.0098 -0.0981 1204 GLN A OE1 
2958 N NE2 . GLN A 183 ? 0.5196 0.4320 0.3495 -0.1686 0.0718  -0.1370 1204 GLN A NE2 
2967 N N   . LEU A 184 ? 0.3900 0.1818 0.1493 0.0608  -0.0679 0.0163  1205 LEU A N   
2968 C CA  . LEU A 184 ? 0.3193 0.1698 0.1546 -0.0103 -0.0331 -0.0145 1205 LEU A CA  
2969 C C   . LEU A 184 ? 0.2926 0.1718 0.1343 -0.0094 -0.0375 -0.0130 1205 LEU A C   
2970 O O   . LEU A 184 ? 0.3546 0.1853 0.1505 -0.0310 -0.0306 -0.0288 1205 LEU A O   
2971 C CB  . LEU A 184 ? 0.2979 0.1723 0.1097 0.0114  -0.0109 0.0005  1205 LEU A CB  
2972 C CG  . LEU A 184 ? 0.2824 0.1990 0.1147 -0.0123 0.0071  -0.0225 1205 LEU A CG  
2973 C CD1 . LEU A 184 ? 0.2298 0.2070 0.1260 0.0122  -0.0175 -0.0185 1205 LEU A CD1 
2974 C CD2 . LEU A 184 ? 0.3410 0.2542 0.1157 -0.0421 0.0483  -0.0256 1205 LEU A CD2 
2986 N N   . ASN A 185 ? 0.2924 0.1954 0.1426 0.0040  -0.0355 -0.0052 1206 ASN A N   
2987 C CA  . ASN A 185 ? 0.3111 0.2428 0.1101 -0.0347 -0.0416 -0.0186 1206 ASN A CA  
2988 C C   . ASN A 185 ? 0.3630 0.2812 0.0947 0.0057  -0.0230 -0.0166 1206 ASN A C   
2989 O O   . ASN A 185 ? 0.3550 0.2848 0.1034 -0.0037 -0.0090 0.0255  1206 ASN A O   
2990 C CB  . ASN A 185 ? 0.2891 0.2593 0.1693 -0.0194 -0.0596 0.0029  1206 ASN A CB  
2991 C CG  . ASN A 185 ? 0.3602 0.2724 0.2061 -0.0207 -0.0773 0.0346  1206 ASN A CG  
2992 O OD1 . ASN A 185 ? 0.4695 0.3023 0.1748 -0.0375 -0.0548 0.0568  1206 ASN A OD1 
2993 N ND2 . ASN A 185 ? 0.4197 0.2638 0.3678 0.0303  -0.0715 0.0520  1206 ASN A ND2 
3000 N N   . ARG A 186 ? 0.4115 0.3230 0.1308 0.0247  0.0321  -0.0628 1207 ARG A N   
3001 C CA  . ARG A 186 ? 0.4037 0.3485 0.1856 0.0127  -0.0342 -0.0567 1207 ARG A CA  
3002 C C   . ARG A 186 ? 0.4414 0.3998 0.1633 0.0053  0.0286  -0.0069 1207 ARG A C   
3003 O O   . ARG A 186 ? 0.4607 0.4189 0.1654 0.0052  0.0576  0.0719  1207 ARG A O   
3004 C CB  . ARG A 186 ? 0.4758 0.3455 0.2875 -0.0394 -0.0206 -0.0626 1207 ARG A CB  
3005 C CG  . ARG A 186 ? 0.5053 0.3935 0.2244 -0.1009 -0.0492 -0.0332 1207 ARG A CG  
3006 C CD  . ARG A 186 ? 0.4945 0.4578 0.2884 -0.1225 -0.0108 -0.0844 1207 ARG A CD  
3007 N NE  . ARG A 186 ? 0.4267 0.5090 0.4088 -0.1254 0.1218  -0.1286 1207 ARG A NE  
3008 C CZ  . ARG A 186 ? 0.3428 0.5827 0.4060 -0.0605 0.0892  -0.0258 1207 ARG A CZ  
3009 N NH1 . ARG A 186 ? 0.2543 0.6316 0.3097 -0.0563 -0.0116 0.1082  1207 ARG A NH1 
3010 N NH2 . ARG A 186 ? 0.3132 0.5932 0.4289 -0.0212 0.0409  -0.0280 1207 ARG A NH2 
3024 N N   . GLU A 187 ? 0.4657 0.4125 0.1307 -0.0318 0.0460  -0.0108 1208 GLU A N   
3025 C CA  . GLU A 187 ? 0.4981 0.4269 0.1757 -0.0362 0.0107  -0.0081 1208 GLU A CA  
3026 C C   . GLU A 187 ? 0.4956 0.3937 0.1587 -0.0643 -0.0329 0.0370  1208 GLU A C   
3027 O O   . GLU A 187 ? 0.5446 0.4093 0.1606 -0.0426 0.0126  0.0660  1208 GLU A O   
3028 C CB  . GLU A 187 ? 0.4858 0.4498 0.1880 -0.0073 -0.0719 -0.0030 1208 GLU A CB  
3029 C CG  . GLU A 187 ? 0.4787 0.4709 0.2866 0.0217  -0.0868 -0.0377 1208 GLU A CG  
3030 C CD  . GLU A 187 ? 0.5325 0.4984 0.3322 0.0690  -0.0888 -0.0576 1208 GLU A CD  
3031 O OE1 . GLU A 187 ? 0.6253 0.4629 0.2672 0.1382  -0.1076 -0.0122 1208 GLU A OE1 
3032 O OE2 . GLU A 187 ? 0.4898 0.5528 0.3858 0.0615  -0.0344 -0.0914 1208 GLU A OE2 
3039 N N   . GLU A 188 ? 0.4958 0.3397 0.1683 -0.0864 0.0416  0.0314  1209 GLU A N   
3040 C CA  . GLU A 188 ? 0.5101 0.3284 0.2164 -0.1299 0.0431  0.0765  1209 GLU A CA  
3041 C C   . GLU A 188 ? 0.5023 0.3273 0.2651 -0.1114 0.0627  0.0999  1209 GLU A C   
3042 O O   . GLU A 188 ? 0.5311 0.3585 0.2335 -0.1014 0.0790  0.0951  1209 GLU A O   
3043 C CB  . GLU A 188 ? 0.5525 0.3687 0.2451 -0.1732 -0.0526 0.0454  1209 GLU A CB  
3044 C CG  . GLU A 188 ? 0.6418 0.4205 0.3742 -0.1621 -0.0006 0.0391  1209 GLU A CG  
3045 C CD  . GLU A 188 ? 0.6671 0.4578 0.5142 -0.1498 -0.0700 -0.0303 1209 GLU A CD  
3046 O OE1 . GLU A 188 ? 0.7350 0.4544 0.3849 -0.1250 0.0268  -0.0261 1209 GLU A OE1 
3047 O OE2 . GLU A 188 ? 0.6465 0.4961 0.7063 -0.1382 -0.1622 -0.0735 1209 GLU A OE2 
3054 N N   . LEU A 189 ? 0.4923 0.3271 0.2238 -0.0932 0.0641  0.0952  1210 LEU A N   
3055 C CA  . LEU A 189 ? 0.4560 0.3500 0.2495 -0.0811 0.0334  0.0959  1210 LEU A CA  
3056 C C   . LEU A 189 ? 0.4884 0.4035 0.2523 -0.1091 0.0348  0.0760  1210 LEU A C   
3057 O O   . LEU A 189 ? 0.5577 0.3960 0.2693 -0.1328 0.0251  0.1065  1210 LEU A O   
3058 C CB  . LEU A 189 ? 0.3762 0.2981 0.1531 -0.0739 -0.0667 0.0269  1210 LEU A CB  
3059 C CG  . LEU A 189 ? 0.3377 0.2669 0.1427 -0.1087 -0.0192 0.0147  1210 LEU A CG  
3060 C CD1 . LEU A 189 ? 0.3509 0.2674 0.1583 -0.0758 0.0374  -0.0452 1210 LEU A CD1 
3061 C CD2 . LEU A 189 ? 0.3818 0.2449 0.1438 -0.0993 -0.0653 0.0599  1210 LEU A CD2 
3073 N N   . SER A 190 ? 0.4967 0.4451 0.1938 -0.0661 0.0238  0.0564  1211 SER A N   
3074 C CA  . SER A 190 ? 0.5167 0.4561 0.1739 -0.0632 0.0045  -0.0370 1211 SER A CA  
3075 C C   . SER A 190 ? 0.5065 0.3800 0.1839 -0.0337 -0.0090 0.0387  1211 SER A C   
3076 O O   . SER A 190 ? 0.4876 0.3598 0.2525 -0.0340 -0.0753 0.0095  1211 SER A O   
3077 C CB  . SER A 190 ? 0.5547 0.5544 0.3368 -0.0907 0.0192  -0.1444 1211 SER A CB  
3078 O OG  . SER A 190 ? 0.5272 0.6331 0.3782 -0.1204 0.0129  -0.1476 1211 SER A OG  
3084 N N   . SER A 191 ? 0.4706 0.3370 0.2050 -0.0278 0.0120  0.1030  1212 SER A N   
3085 C CA  . SER A 191 ? 0.4869 0.3753 0.2893 -0.0431 -0.0377 0.1296  1212 SER A CA  
3086 C C   . SER A 191 ? 0.4732 0.3320 0.3642 -0.0864 -0.0194 0.1244  1212 SER A C   
3087 O O   . SER A 191 ? 0.5675 0.2890 0.3989 -0.1124 -0.0207 0.0956  1212 SER A O   
3088 C CB  . SER A 191 ? 0.5945 0.4724 0.3594 0.0055  -0.0761 0.1683  1212 SER A CB  
3089 O OG  . SER A 191 ? 0.7076 0.5431 0.4567 0.0454  -0.0713 0.1783  1212 SER A OG  
3095 N N   . LEU A 192 ? 0.3428 0.3645 0.3160 -0.0596 -0.0870 0.1299  1213 LEU A N   
3096 C CA  . LEU A 192 ? 0.3398 0.4311 0.3073 -0.0649 -0.1029 0.0963  1213 LEU A CA  
3097 C C   . LEU A 192 ? 0.3334 0.4505 0.2166 -0.1119 -0.0811 -0.0025 1213 LEU A C   
3098 O O   . LEU A 192 ? 0.4141 0.4484 0.3422 -0.1634 0.0372  -0.1330 1213 LEU A O   
3099 C CB  . LEU A 192 ? 0.4007 0.4659 0.3315 -0.0813 -0.0815 0.0748  1213 LEU A CB  
3100 C CG  . LEU A 192 ? 0.5263 0.4902 0.5131 -0.0928 -0.0026 0.0168  1213 LEU A CG  
3101 C CD1 . LEU A 192 ? 0.6110 0.4833 0.5838 -0.0568 0.0839  0.0160  1213 LEU A CD1 
3102 C CD2 . LEU A 192 ? 0.5695 0.5028 0.6013 -0.1431 0.0651  -0.0137 1213 LEU A CD2 
3114 N N   . LYS A 193 ? 0.2467 0.4375 0.1626 -0.0975 -0.0370 0.0843  1214 LYS A N   
3115 C CA  . LYS A 193 ? 0.2274 0.4287 0.1692 -0.0837 -0.0092 0.0611  1214 LYS A CA  
3116 C C   . LYS A 193 ? 0.1961 0.3707 0.1065 -0.0567 -0.0009 0.0279  1214 LYS A C   
3117 O O   . LYS A 193 ? 0.2375 0.3672 0.1878 -0.0045 0.0469  0.0798  1214 LYS A O   
3118 C CB  . LYS A 193 ? 0.3395 0.4671 0.1940 -0.0898 0.0940  0.0421  1214 LYS A CB  
3119 C CG  . LYS A 193 ? 0.3961 0.4991 0.2990 -0.0934 0.1220  0.0035  1214 LYS A CG  
3120 C CD  . LYS A 193 ? 0.5188 0.5557 0.4371 -0.0161 0.0855  -0.0019 1214 LYS A CD  
3121 C CE  . LYS A 193 ? 0.6148 0.5988 0.5816 0.0443  0.0351  0.0031  1214 LYS A CE  
3122 N NZ  . LYS A 193 ? 0.6806 0.6172 0.5637 0.0601  -0.0304 -0.0082 1214 LYS A NZ  
3136 N N   . PRO A 194 ? 0.2083 0.3279 0.1088 -0.0573 0.0251  -0.0342 1215 PRO A N   
3137 C CA  . PRO A 194 ? 0.1694 0.2667 0.0849 -0.0429 0.0111  -0.0359 1215 PRO A CA  
3138 C C   . PRO A 194 ? 0.1669 0.2318 0.1193 -0.0188 0.0247  0.0052  1215 PRO A C   
3139 O O   . PRO A 194 ? 0.1614 0.2784 0.1509 -0.0490 0.0425  0.0081  1215 PRO A O   
3140 C CB  . PRO A 194 ? 0.2244 0.2700 0.1646 -0.0703 0.0726  -0.0589 1215 PRO A CB  
3141 C CG  . PRO A 194 ? 0.2524 0.3068 0.2292 -0.0535 0.1013  -0.0583 1215 PRO A CG  
3142 C CD  . PRO A 194 ? 0.2389 0.3258 0.1265 -0.0636 0.0635  -0.0521 1215 PRO A CD  
3150 N N   . ILE A 195 ? 0.1459 0.1733 0.1041 -0.0354 0.0247  0.0115  1216 ILE A N   
3151 C CA  . ILE A 195 ? 0.1306 0.1748 0.1115 -0.0569 -0.0123 0.0168  1216 ILE A CA  
3152 C C   . ILE A 195 ? 0.1359 0.2304 0.1490 -0.0231 -0.0161 0.0570  1216 ILE A C   
3153 O O   . ILE A 195 ? 0.1714 0.1843 0.2127 -0.0204 -0.0287 0.0763  1216 ILE A O   
3154 C CB  . ILE A 195 ? 0.1639 0.1502 0.1535 -0.0416 -0.0207 0.0263  1216 ILE A CB  
3155 C CG1 . ILE A 195 ? 0.2053 0.1719 0.2216 0.0031  0.0207  0.0522  1216 ILE A CG1 
3156 C CG2 . ILE A 195 ? 0.2405 0.1586 0.1579 -0.0479 -0.0388 0.0187  1216 ILE A CG2 
3157 C CD1 . ILE A 195 ? 0.2603 0.1576 0.2438 0.0136  0.0189  0.0249  1216 ILE A CD1 
3169 N N   . LEU A 196 ? 0.1535 0.2792 0.2285 -0.0124 -0.0445 0.0512  1217 LEU A N   
3170 C CA  . LEU A 196 ? 0.2350 0.3335 0.2586 0.0043  -0.0447 -0.0068 1217 LEU A CA  
3171 C C   . LEU A 196 ? 0.2215 0.3852 0.2868 -0.0371 -0.0415 -0.0282 1217 LEU A C   
3172 O O   . LEU A 196 ? 0.2036 0.4862 0.3864 -0.0766 0.0081  -0.0103 1217 LEU A O   
3173 C CB  . LEU A 196 ? 0.3093 0.3509 0.3165 0.0802  -0.0312 0.0155  1217 LEU A CB  
3174 C CG  . LEU A 196 ? 0.3653 0.3654 0.4250 0.1136  -0.0220 -0.0377 1217 LEU A CG  
3175 C CD1 . LEU A 196 ? 0.4214 0.3906 0.4213 0.0732  -0.0221 -0.1114 1217 LEU A CD1 
3176 C CD2 . LEU A 196 ? 0.3895 0.3719 0.5686 0.1226  0.0503  -0.0104 1217 LEU A CD2 
3188 N N   . THR A 197 ? 0.2323 0.3346 0.3320 0.0162  -0.0369 0.0124  1218 THR A N   
3189 C CA  . THR A 197 ? 0.3015 0.3670 0.2887 0.0333  -0.0611 0.0593  1218 THR A CA  
3190 C C   . THR A 197 ? 0.3935 0.4426 0.2302 0.0341  0.0388  -0.0050 1218 THR A C   
3191 O O   . THR A 197 ? 0.3168 0.5367 0.2580 -0.0885 0.0267  -0.1351 1218 THR A O   
3192 C CB  . THR A 197 ? 0.3098 0.3503 0.3801 -0.0577 -0.0963 0.0466  1218 THR A CB  
3193 O OG1 . THR A 197 ? 0.3580 0.3892 0.5021 -0.1384 -0.0882 0.0323  1218 THR A OG1 
3194 C CG2 . THR A 197 ? 0.3023 0.2830 0.3276 -0.0921 0.1049  -0.0104 1218 THR A CG2 
3202 N N   . PRO A 198 ? 0.3669 0.4045 0.1961 0.1198  -0.0286 -0.0174 1219 PRO A N   
3203 C CA  . PRO A 198 ? 0.4940 0.4485 0.3021 0.1190  0.0200  0.0173  1219 PRO A CA  
3204 C C   . PRO A 198 ? 0.5712 0.5373 0.2613 0.0719  0.0136  0.0243  1219 PRO A C   
3205 O O   . PRO A 198 ? 0.5434 0.5921 0.2932 0.0531  -0.0932 0.0682  1219 PRO A O   
3206 C CB  . PRO A 198 ? 0.4845 0.4151 0.3136 0.0751  -0.0377 0.0040  1219 PRO A CB  
3207 C CG  . PRO A 198 ? 0.3781 0.3811 0.3446 0.0091  -0.0379 -0.1068 1219 PRO A CG  
3208 C CD  . PRO A 198 ? 0.3676 0.3941 0.3225 0.0676  -0.0335 -0.0514 1219 PRO A CD  
3216 N N   . SER A 199 ? 0.6130 0.5534 0.2268 0.0129  -0.0026 -0.0166 1220 SER A N   
3217 C CA  . SER A 199 ? 0.5630 0.5652 0.3609 -0.0698 -0.0675 -0.0947 1220 SER A CA  
3218 C C   . SER A 199 ? 0.5445 0.6269 0.5883 -0.0887 -0.0722 -0.1427 1220 SER A C   
3219 O O   . SER A 199 ? 0.5090 0.6726 0.5775 -0.0575 -0.2156 -0.1423 1220 SER A O   
3224 O O   . HOH B .   ? 0.0856 0.0942 0.1043 0.0128  0.0036  -0.0076 1501 HOH A O   
3225 O O   . HOH B .   ? 0.1103 0.1040 0.1041 -0.0168 -0.0075 -0.0060 1502 HOH A O   
3226 O O   . HOH B .   ? 0.1877 0.1231 0.2009 0.0353  0.0314  0.0012  1503 HOH A O   
3227 O O   . HOH B .   ? 0.1068 0.1105 0.1108 -0.0181 0.0087  -0.0002 1504 HOH A O   
3228 O O   . HOH B .   ? 0.1219 0.1466 0.1114 -0.0104 -0.0259 0.0036  1505 HOH A O   
3229 O O   . HOH B .   ? 0.1933 0.1392 0.1551 0.0414  0.0516  0.0043  1506 HOH A O   
3230 O O   . HOH B .   ? 0.1279 0.1802 0.1615 -0.0368 0.0357  -0.0125 1507 HOH A O   
3231 O O   . HOH B .   ? 0.1481 0.1398 0.1281 -0.0115 -0.0305 0.0322  1508 HOH A O   
3232 O O   . HOH B .   ? 0.1691 0.1203 0.1917 0.0070  0.0836  -0.0294 1509 HOH A O   
3233 O O   . HOH B .   ? 0.1400 0.1217 0.1344 -0.0223 -0.0016 -0.0234 1510 HOH A O   
3234 O O   . HOH B .   ? 0.1420 0.1019 0.1406 -0.0121 0.0411  0.0086  1511 HOH A O   
3235 O O   . HOH B .   ? 0.2230 0.2010 0.0867 -0.0547 0.0242  0.0049  1512 HOH A O   
3236 O O   . HOH B .   ? 0.1252 0.1357 0.1414 -0.0226 -0.0101 0.0021  1513 HOH A O   
3237 O O   . HOH B .   ? 0.1553 0.1654 0.2270 0.0084  -0.0444 -0.0481 1514 HOH A O   
3238 O O   . HOH B .   ? 0.1269 0.1521 0.1514 0.0214  -0.0502 -0.0313 1515 HOH A O   
3239 O O   . HOH B .   ? 0.1682 0.1472 0.1760 -0.0126 0.0078  0.0417  1516 HOH A O   
3240 O O   . HOH B .   ? 0.1344 0.1617 0.1870 -0.0282 0.0350  -0.0326 1517 HOH A O   
3241 O O   . HOH B .   ? 0.1383 0.1181 0.2329 -0.0053 -0.0092 0.0019  1518 HOH A O   
3242 O O   . HOH B .   ? 0.1764 0.1116 0.0962 -0.0177 -0.0072 -0.0056 1519 HOH A O   
3243 O O   . HOH B .   ? 0.2071 0.1450 0.1622 -0.0049 0.0031  0.0210  1520 HOH A O   
3244 O O   . HOH B .   ? 0.1271 0.1128 0.1969 -0.0298 0.0199  -0.0328 1521 HOH A O   
3245 O O   . HOH B .   ? 0.1351 0.1339 0.1820 -0.0349 0.0228  -0.0195 1522 HOH A O   
3246 O O   . HOH B .   ? 0.1347 0.1670 0.1849 -0.0088 -0.0283 0.0519  1523 HOH A O   
3247 O O   . HOH B .   ? 0.2204 0.2139 0.1719 0.0854  -0.0522 -0.0159 1524 HOH A O   
3248 O O   . HOH B .   ? 0.1200 0.1533 0.1902 -0.0390 -0.0187 0.0099  1525 HOH A O   
3249 O O   . HOH B .   ? 0.1416 0.1630 0.1625 0.0118  -0.0089 0.0351  1526 HOH A O   
3250 O O   . HOH B .   ? 0.1390 0.1380 0.1833 0.0297  -0.0078 0.0191  1527 HOH A O   
3251 O O   . HOH B .   ? 0.1866 0.1662 0.2187 -0.0232 0.0193  -0.0200 1528 HOH A O   
3252 O O   . HOH B .   ? 0.1541 0.1801 0.1365 0.0160  0.0136  0.0369  1529 HOH A O   
3253 O O   . HOH B .   ? 0.2325 0.1920 0.1983 -0.0947 -0.0985 0.0669  1530 HOH A O   
3254 O O   . HOH B .   ? 0.2092 0.1871 0.1920 -0.0099 0.0177  -0.0208 1531 HOH A O   
3255 O O   . HOH B .   ? 0.1870 0.1371 0.1413 -0.0165 0.0014  0.0043  1532 HOH A O   
3256 O O   . HOH B .   ? 0.1399 0.1422 0.2662 0.0086  0.0388  -0.0218 1533 HOH A O   
3257 O O   . HOH B .   ? 0.1553 0.2326 0.1508 0.0175  0.0120  0.0194  1534 HOH A O   
3258 O O   . HOH B .   ? 0.2112 0.3247 0.1936 -0.0403 -0.0669 0.0120  1535 HOH A O   
3259 O O   . HOH B .   ? 0.1628 0.2114 0.2609 -0.0265 0.0715  -0.0085 1536 HOH A O   
3260 O O   . HOH B .   ? 0.1740 0.2265 0.2121 0.0261  0.0242  -0.0195 1537 HOH A O   
3261 O O   . HOH B .   ? 0.1652 0.1474 0.2783 0.0093  0.0316  0.0055  1538 HOH A O   
3262 O O   . HOH B .   ? 0.1887 0.1488 0.2220 0.0012  -0.0472 0.0089  1539 HOH A O   
3263 O O   . HOH B .   ? 0.2407 0.1127 0.3058 -0.0200 -0.1525 0.0286  1540 HOH A O   
3264 O O   . HOH B .   ? 0.1402 0.1250 0.3131 0.0260  0.0373  -0.0196 1541 HOH A O   
3265 O O   . HOH B .   ? 0.4270 0.2349 0.1695 -0.0960 0.0169  -0.0713 1542 HOH A O   
3266 O O   . HOH B .   ? 0.2253 0.1648 0.3100 0.0128  0.0107  -0.0136 1543 HOH A O   
3267 O O   . HOH B .   ? 0.2262 0.2462 0.2322 -0.0187 0.0429  -0.0406 1544 HOH A O   
3268 O O   . HOH B .   ? 0.2489 0.1526 0.2414 0.0577  -0.0471 -0.0179 1545 HOH A O   
3269 O O   . HOH B .   ? 0.1710 0.5577 0.1641 -0.0175 0.0191  0.0537  1546 HOH A O   
3270 O O   . HOH B .   ? 0.2225 0.2184 0.2166 0.0225  -0.0181 0.0494  1547 HOH A O   
3271 O O   . HOH B .   ? 0.3720 0.2042 0.1742 0.0469  0.0439  -0.0547 1548 HOH A O   
3272 O O   . HOH B .   ? 0.1809 0.3367 0.2915 -0.0062 -0.0345 0.1212  1549 HOH A O   
3273 O O   . HOH B .   ? 0.2667 0.1974 0.2656 -0.0976 0.1050  -0.0092 1550 HOH A O   
3274 O O   . HOH B .   ? 0.1748 0.2664 0.2481 0.0590  0.0202  -0.0980 1551 HOH A O   
3275 O O   . HOH B .   ? 0.3411 0.1821 0.3386 -0.0258 0.0042  -0.0431 1552 HOH A O   
3276 O O   . HOH B .   ? 0.3447 0.3124 0.1685 -0.1098 -0.0197 -0.0817 1553 HOH A O   
3277 O O   . HOH B .   ? 0.4000 0.3379 0.2220 -0.0835 0.1120  -0.1191 1554 HOH A O   
3278 O O   . HOH B .   ? 0.1998 0.6000 0.2440 -0.0033 0.0136  -0.1754 1555 HOH A O   
3279 O O   . HOH B .   ? 0.2228 0.2551 0.2624 -0.0419 -0.0504 -0.0303 1556 HOH A O   
3280 O O   . HOH B .   ? 0.2859 0.1670 0.1836 0.1105  0.0639  0.0567  1557 HOH A O   
3281 O O   . HOH B .   ? 0.2243 0.1699 0.3413 -0.0203 -0.0601 0.0930  1558 HOH A O   
3282 O O   . HOH B .   ? 0.3736 0.3302 0.2266 0.0080  -0.0735 -0.0504 1559 HOH A O   
3283 O O   . HOH B .   ? 0.3377 0.4281 0.4271 -0.1799 0.0959  -0.1969 1560 HOH A O   
3284 O O   . HOH B .   ? 0.1405 0.1685 0.3856 0.0229  -0.0311 -0.0477 1561 HOH A O   
3285 O O   . HOH B .   ? 0.2274 0.2328 0.5878 0.0435  -0.1446 -0.1451 1562 HOH A O   
3286 O O   . HOH B .   ? 0.3163 0.2665 0.3190 0.0312  -0.1800 -0.0745 1563 HOH A O   
3287 O O   . HOH B .   ? 0.4599 0.2658 0.2505 -0.0936 0.1720  -0.0201 1564 HOH A O   
3288 O O   . HOH B .   ? 0.2682 0.1481 0.3736 -0.0060 0.1783  -0.0083 1565 HOH A O   
3289 O O   . HOH B .   ? 0.4643 0.4267 0.4970 0.2097  0.2392  0.1714  1566 HOH A O   
3290 O O   . HOH B .   ? 0.2479 0.1879 0.2874 -0.0188 -0.0557 -0.0236 1567 HOH A O   
3291 O O   . HOH B .   ? 0.3264 0.4138 0.2257 -0.1279 0.0046  -0.0815 1568 HOH A O   
3292 O O   . HOH B .   ? 0.4412 0.2673 0.3564 0.1748  -0.0705 0.0312  1569 HOH A O   
3293 O O   . HOH B .   ? 0.1609 0.2271 0.2347 0.0193  -0.0038 -0.0246 1570 HOH A O   
3294 O O   . HOH B .   ? 0.1966 0.2307 0.4120 -0.0558 0.0191  0.0727  1571 HOH A O   
3295 O O   . HOH B .   ? 0.4173 0.2598 0.2194 0.0022  0.1017  -0.0529 1572 HOH A O   
3296 O O   . HOH B .   ? 0.3084 0.2258 0.2875 -0.0065 -0.0318 -0.0758 1573 HOH A O   
3297 O O   . HOH B .   ? 0.3442 0.1970 0.5231 -0.0416 -0.2185 0.0860  1574 HOH A O   
3298 O O   . HOH B .   ? 0.3886 0.3598 0.2807 -0.1020 0.0830  0.0222  1575 HOH A O   
3299 O O   . HOH B .   ? 0.2627 0.2132 0.3874 0.0372  -0.0942 -0.0021 1576 HOH A O   
3300 O O   . HOH B .   ? 0.3846 0.3757 0.2610 -0.0753 0.0637  -0.0398 1577 HOH A O   
3301 O O   . HOH B .   ? 0.2048 0.1887 0.3935 -0.0124 0.0646  0.0198  1578 HOH A O   
3302 O O   . HOH B .   ? 0.4459 0.2848 0.1524 -0.0544 -0.0340 -0.0212 1579 HOH A O   
3303 O O   . HOH B .   ? 0.5152 0.2037 0.3302 0.0988  0.2297  0.0663  1580 HOH A O   
3304 O O   . HOH B .   ? 0.2524 0.3266 0.6060 0.0322  -0.1134 0.1500  1581 HOH A O   
3305 O O   . HOH B .   ? 0.3521 0.3241 0.4119 -0.1276 -0.1147 0.0439  1582 HOH A O   
3306 O O   . HOH B .   ? 0.2318 0.4637 0.6430 -0.0870 0.0701  -0.2203 1583 HOH A O   
3307 O O   . HOH B .   ? 0.3125 0.1881 0.1691 -0.0535 0.0593  0.0051  1584 HOH A O   
3308 O O   . HOH B .   ? 0.1879 0.1799 0.3381 0.0099  0.0606  -0.0080 1585 HOH A O   
3309 O O   . HOH B .   ? 0.4532 0.1660 0.3519 0.0349  0.2342  0.0287  1586 HOH A O   
3310 O O   . HOH B .   ? 0.2317 0.1809 0.2492 -0.0390 0.0137  -0.0557 1587 HOH A O   
3311 O O   . HOH B .   ? 0.3744 0.4262 0.2101 0.2016  0.0811  0.1126  1588 HOH A O   
3312 O O   . HOH B .   ? 0.2051 0.2134 0.2198 0.0092  0.0000  0.0045  1589 HOH A O   
3313 O O   . HOH B .   ? 0.3778 0.1677 0.4598 0.0562  -0.1406 -0.0099 1590 HOH A O   
3314 O O   . HOH B .   ? 0.3523 0.3730 0.2762 -0.0269 0.0384  -0.0802 1591 HOH A O   
3315 O O   . HOH B .   ? 0.2857 0.7727 0.3071 -0.0161 0.0336  -0.0466 1592 HOH A O   
3316 O O   . HOH B .   ? 0.3984 0.3192 0.2215 -0.0023 -0.0416 -0.0410 1593 HOH A O   
3317 O O   . HOH B .   ? 0.3551 0.2985 0.3704 0.0913  0.0087  -0.1301 1594 HOH A O   
3318 O O   . HOH B .   ? 0.4149 0.2782 0.3269 0.1523  -0.1880 -0.0878 1595 HOH A O   
3319 O O   . HOH B .   ? 0.3888 0.1972 0.3581 -0.0079 -0.1703 -0.0084 1596 HOH A O   
3320 O O   . HOH B .   ? 0.4939 0.3201 0.3730 0.1220  -0.1448 0.0836  1597 HOH A O   
3321 O O   . HOH B .   ? 0.4475 0.2935 0.5200 0.0234  0.0162  0.2150  1598 HOH A O   
3322 O O   . HOH B .   ? 0.2512 0.3011 0.2985 -0.0190 -0.0187 -0.0614 1599 HOH A O   
3323 O O   . HOH B .   ? 0.4468 0.2825 0.5021 0.0062  0.1032  -0.1695 1600 HOH A O   
3324 O O   . HOH B .   ? 0.6773 0.3783 0.2219 -0.1826 0.0680  -0.0488 1601 HOH A O   
3325 O O   . HOH B .   ? 0.4423 0.2862 0.1588 0.0492  0.0020  0.0454  1602 HOH A O   
3326 O O   . HOH B .   ? 0.3741 0.7650 0.4315 0.2490  0.0485  0.1949  1603 HOH A O   
3327 O O   . HOH B .   ? 0.3145 0.3733 0.3207 -0.1095 -0.0096 -0.1360 1604 HOH A O   
3328 O O   . HOH B .   ? 0.4378 0.3126 0.2345 0.0356  -0.0229 0.0215  1605 HOH A O   
3329 O O   . HOH B .   ? 0.2929 0.3273 0.2970 -0.0984 0.0693  -0.0046 1606 HOH A O   
3330 O O   . HOH B .   ? 0.5832 0.3066 0.3117 0.0632  -0.2240 -0.0596 1607 HOH A O   
3331 O O   . HOH B .   ? 0.3850 0.2495 0.4037 0.0481  0.1154  0.0706  1608 HOH A O   
3332 O O   . HOH B .   ? 0.4443 0.3270 0.5598 0.0567  0.2419  -0.0810 1609 HOH A O   
3333 O O   . HOH B .   ? 0.2752 0.4985 0.2730 0.0278  0.0196  -0.1640 1610 HOH A O   
3334 O O   . HOH B .   ? 0.5278 0.6700 0.2811 -0.2337 0.0691  0.0146  1611 HOH A O   
3335 O O   . HOH B .   ? 0.2842 0.6498 0.4101 -0.0930 -0.0287 -0.0222 1612 HOH A O   
3336 O O   . HOH B .   ? 0.3096 0.2610 0.3411 -0.0016 -0.0142 -0.1550 1613 HOH A O   
3337 O O   . HOH B .   ? 0.3541 0.3300 0.2448 0.0442  -0.0124 -0.0005 1614 HOH A O   
3338 O O   . HOH B .   ? 0.2356 0.4822 0.2436 0.0331  0.0161  0.0525  1615 HOH A O   
3339 O O   . HOH B .   ? 0.5131 0.4364 0.3962 0.1469  -0.1343 0.0816  1616 HOH A O   
3340 O O   . HOH B .   ? 0.4045 0.3208 0.5791 -0.0207 -0.0650 0.1595  1617 HOH A O   
3341 O O   . HOH B .   ? 0.3848 0.4040 0.7327 -0.1254 -0.2488 0.1040  1618 HOH A O   
3342 O O   . HOH B .   ? 0.6535 0.3058 0.4421 0.0179  0.2272  -0.0593 1619 HOH A O   
3343 O O   . HOH B .   ? 0.2741 0.8048 0.4205 -0.0106 -0.0375 0.1652  1620 HOH A O   
3344 O O   . HOH B .   ? 0.3242 0.3501 0.3709 -0.0809 -0.0170 0.1832  1621 HOH A O   
3345 O O   . HOH B .   ? 0.4037 0.4986 0.2734 -0.0293 0.1103  0.0386  1622 HOH A O   
3346 O O   . HOH B .   ? 0.5273 0.5570 0.2091 0.0283  -0.0369 0.1430  1623 HOH A O   
3347 O O   . HOH B .   ? 0.4014 0.4801 0.2088 -0.1561 -0.0387 0.0130  1624 HOH A O   
3348 O O   . HOH B .   ? 0.6358 0.2254 0.3476 0.0942  0.0741  0.0918  1625 HOH A O   
3349 O O   . HOH B .   ? 0.3328 0.3801 0.5093 0.1617  0.1470  0.1989  1626 HOH A O   
3350 O O   . HOH B .   ? 0.6818 0.3688 0.4654 -0.0149 0.1081  0.0800  1627 HOH A O   
3351 O O   . HOH B .   ? 0.5285 0.3992 0.4367 -0.1302 -0.2377 -0.0273 1628 HOH A O   
3352 O O   . HOH B .   ? 0.4205 0.4958 0.2282 -0.1128 -0.0150 -0.0222 1629 HOH A O   
3353 O O   . HOH B .   ? 0.4025 0.3790 0.4433 0.1258  0.0439  0.0156  1630 HOH A O   
3354 O O   . HOH B .   ? 0.3985 0.4915 0.7343 0.1003  -0.0665 0.0708  1631 HOH A O   
3355 O O   . HOH B .   ? 0.5947 0.4589 0.5261 0.1856  -0.1372 0.1447  1632 HOH A O   
3356 O O   . HOH B .   ? 0.5601 0.6128 0.3756 0.2801  0.1933  0.1123  1633 HOH A O   
3357 O O   . HOH B .   ? 0.2765 0.5108 0.5466 0.0797  0.1654  0.1983  1634 HOH A O   
3358 O O   . HOH B .   ? 0.5701 0.5340 0.3439 -0.0859 -0.1428 0.0265  1635 HOH A O   
3359 O O   . HOH B .   ? 0.3989 0.3951 0.3892 0.0568  -0.0917 0.0101  1636 HOH A O   
3360 O O   . HOH B .   ? 0.4838 0.6095 0.4487 -0.0988 -0.2648 0.0497  1637 HOH A O   
3361 O O   . HOH B .   ? 0.6009 0.4744 0.4837 0.0799  -0.0329 -0.2528 1638 HOH A O   
3362 O O   . HOH B .   ? 0.5276 0.3985 0.3197 0.1245  -0.0273 0.1440  1639 HOH A O   
3363 O O   . HOH B .   ? 0.1359 0.2469 0.3926 0.0128  0.0720  0.1026  1640 HOH A O   
3364 O O   . HOH B .   ? 0.6475 0.2676 0.3736 0.1193  -0.1380 -0.0710 1641 HOH A O   
3365 O O   . HOH B .   ? 0.6670 0.5161 0.2938 0.0274  0.2007  0.0853  1642 HOH A O   
3366 O O   . HOH B .   ? 0.2658 0.3190 0.7665 0.0469  0.0050  0.1931  1643 HOH A O   
3367 O O   . HOH B .   ? 0.3971 0.5814 0.3569 0.0906  -0.0449 -0.1184 1644 HOH A O   
3368 O O   . HOH B .   ? 0.7677 0.3419 0.2542 0.0916  -0.0018 0.0862  1645 HOH A O   
3369 O O   . HOH B .   ? 0.6079 0.5819 0.4557 -0.1625 -0.1924 0.1863  1646 HOH A O   
3370 O O   . HOH B .   ? 0.5602 0.4044 0.5546 0.1135  -0.0953 0.1007  1647 HOH A O   
3371 O O   . HOH B .   ? 0.7036 0.2485 0.4741 -0.1242 -0.1482 -0.0305 1648 HOH A O   
3372 O O   . HOH B .   ? 0.4916 0.6146 0.3848 0.0540  0.0192  -0.1485 1649 HOH A O   
3373 O O   . HOH B .   ? 0.1436 0.3021 0.2646 -0.0598 -0.0669 0.1071  1650 HOH A O   
3374 O O   . HOH B .   ? 0.2519 0.3389 0.6732 0.0878  0.1024  0.1865  1651 HOH A O   
3375 O O   . HOH B .   ? 0.3004 0.3659 0.5203 0.0813  -0.0785 -0.2451 1652 HOH A O   
3376 O O   . HOH B .   ? 0.6777 0.7263 0.6931 0.2186  -0.1214 0.1406  1653 HOH A O   
3377 O O   . HOH B .   ? 0.2556 0.2312 0.2477 0.0533  0.1218  0.0140  1654 HOH A O   
3378 O O   . HOH B .   ? 0.4072 0.3925 0.4083 0.1403  -0.1159 0.0491  1655 HOH A O   
3379 O O   . HOH B .   ? 0.6938 0.3867 0.6777 0.1803  0.0145  0.2215  1656 HOH A O   
3380 O O   . HOH B .   ? 0.3182 0.4629 0.7101 0.0549  0.1922  0.2319  1657 HOH A O   
3381 O O   . HOH B .   ? 0.5348 0.3736 0.6474 -0.1216 0.1337  -0.2490 1658 HOH A O   
3382 O O   . HOH B .   ? 0.2022 0.5346 0.1916 0.0871  -0.0366 -0.1242 1659 HOH A O   
3383 O O   . HOH B .   ? 0.2598 0.4792 0.2808 -0.0883 -0.1055 0.1614  1660 HOH A O   
3384 O O   . HOH B .   ? 0.3912 0.1946 0.3968 0.0807  0.0136  -0.0040 1661 HOH A O   
3385 O O   . HOH B .   ? 0.3908 0.5276 0.3632 0.0127  0.2243  -0.0231 1662 HOH A O   
3386 O O   . HOH B .   ? 0.5598 0.2268 0.2337 -0.1424 0.0581  0.0192  1663 HOH A O   
3387 O O   . HOH B .   ? 0.4940 0.2604 0.3464 0.0754  -0.1040 0.0309  1664 HOH A O   
3388 O O   . HOH B .   ? 0.6435 0.2071 0.3653 -0.0818 -0.0210 0.0177  1665 HOH A O   
3389 O O   . HOH B .   ? 0.3706 0.2364 0.3691 -0.0506 -0.1327 0.0000  1666 HOH A O   
3390 O O   . HOH B .   ? 0.5336 0.2801 0.6927 -0.0948 -0.2111 0.1592  1667 HOH A O   
3391 O O   . HOH B .   ? 0.5698 0.3138 0.4971 -0.1802 0.0432  -0.0125 1668 HOH A O   
3392 O O   . HOH B .   ? 0.4662 0.5363 0.3995 -0.2434 -0.0283 0.1736  1669 HOH A O   
3393 O O   . HOH B .   ? 0.0859 0.0505 0.1461 0.0034  0.0375  0.0266  1670 HOH A O   
3394 O O   . HOH B .   ? 0.4763 0.3121 0.7260 -0.0829 -0.3239 0.1442  1671 HOH A O   
3395 O O   . HOH B .   ? 0.4896 0.4582 0.4713 -0.2257 0.1567  0.0331  1672 HOH A O   
3396 O O   . HOH B .   ? 0.7189 0.4737 0.5625 -0.1219 0.0858  -0.2833 1673 HOH A O   
3397 O O   . HOH B .   ? 0.4418 0.2926 0.7315 0.0076  0.2562  -0.0652 1674 HOH A O   
3398 O O   . HOH B .   ? 0.3517 0.8005 0.4797 0.2132  0.0717  0.2359  1675 HOH A O   
3399 O O   . HOH B .   ? 0.4503 0.4655 0.4797 -0.1357 -0.0734 0.0314  1676 HOH A O   
3400 O O   . HOH B .   ? 0.6767 0.3707 0.2735 -0.1870 0.0161  0.0657  1677 HOH A O   
3401 O O   . HOH B .   ? 0.5311 0.7269 0.3402 -0.0039 0.0504  -0.1212 1678 HOH A O   
3402 O O   . HOH B .   ? 0.3294 0.5086 0.7102 0.0841  -0.2255 0.0040  1679 HOH A O   
3403 O O   . HOH B .   ? 0.3411 0.2588 0.3781 -0.0033 0.1211  -0.0186 1680 HOH A O   
3404 O O   . HOH B .   ? 0.5707 0.3583 0.2811 0.1716  0.0264  0.0762  1681 HOH A O   
3405 O O   . HOH B .   ? 0.4469 0.7341 0.5295 0.1936  -0.0227 0.2689  1682 HOH A O   
3406 O O   . HOH B .   ? 0.8506 0.3095 0.3949 -0.1797 -0.0804 0.0866  1683 HOH A O   
3407 O O   . HOH B .   ? 0.4366 0.3900 0.3093 0.1115  0.0604  -0.0028 1684 HOH A O   
3408 O O   . HOH B .   ? 0.5958 0.4870 0.4909 -0.1942 0.1201  -0.2526 1685 HOH A O   
3409 O O   . HOH B .   ? 0.1092 0.1375 0.2324 0.0139  -0.0067 -0.0470 1686 HOH A O   
3410 O O   . HOH B .   ? 0.2262 0.5296 0.2972 0.0549  -0.0277 -0.1310 1687 HOH A O   
3411 O O   . HOH B .   ? 0.5043 0.5437 0.3172 0.1172  -0.1360 -0.1940 1688 HOH A O   
3412 O O   . HOH B .   ? 0.8392 0.3374 0.4214 0.1012  0.2856  0.0940  1689 HOH A O   
3413 O O   . HOH B .   ? 0.4707 0.7762 0.2992 -0.2198 -0.0830 -0.0583 1690 HOH A O   
3414 O O   . HOH B .   ? 0.4017 0.2894 0.2653 -0.0792 -0.1425 0.0467  1691 HOH A O   
3415 O O   . HOH B .   ? 0.3996 0.6583 0.4690 0.1728  0.1181  0.3079  1692 HOH A O   
3416 O O   . HOH B .   ? 0.6077 0.6600 0.3509 -0.1396 -0.1481 0.1971  1693 HOH A O   
3417 O O   . HOH B .   ? 0.3042 0.3815 0.7963 0.1107  0.0319  0.1652  1694 HOH A O   
3418 O O   . HOH B .   ? 0.8376 0.2251 0.6747 0.0291  0.0759  -0.0518 1695 HOH A O   
3419 O O   . HOH B .   ? 0.6314 0.5677 0.3968 -0.0939 0.2710  -0.0939 1696 HOH A O   
3420 O O   . HOH B .   ? 0.8495 0.4134 0.3696 -0.0645 -0.0035 0.1724  1697 HOH A O   
3421 O O   . HOH B .   ? 0.5231 0.7516 0.3536 -0.1077 0.1970  -0.1169 1698 HOH A O   
3422 O O   . HOH B .   ? 0.2271 0.2990 0.5298 -0.0110 -0.0472 0.1774  1699 HOH A O   
3423 O O   . HOH B .   ? 0.4419 0.7687 0.4641 -0.0709 0.1082  -0.3168 1700 HOH A O   
3424 O O   . HOH B .   ? 0.6614 0.7333 0.3980 0.0273  -0.2244 0.1804  1701 HOH A O   
3425 O O   . HOH B .   ? 0.2494 0.4164 0.2324 0.0627  0.1060  0.0920  1702 HOH A O   
3426 O O   . HOH B .   ? 0.3125 0.3936 0.3696 0.0060  0.0627  0.0596  1703 HOH A O   
3427 O O   . HOH B .   ? 0.3285 0.5234 0.2413 -0.0367 0.0414  -0.0425 1704 HOH A O   
3428 O O   . HOH B .   ? 0.6517 0.6228 0.3192 -0.1803 0.0220  -0.1158 1705 HOH A O   
3429 O O   . HOH B .   ? 0.2527 0.2728 0.3089 -0.0608 0.0025  0.0333  1706 HOH A O   
3430 O O   . HOH B .   ? 0.2520 0.6446 0.3359 0.0165  -0.1249 0.0110  1707 HOH A O   
3431 O O   . HOH B .   ? 0.4655 0.5064 0.5735 0.2001  -0.2389 -0.0548 1708 HOH A O   
3432 O O   . HOH B .   ? 0.2910 0.4629 0.5354 -0.1373 0.1565  -0.2805 1709 HOH A O   
3433 O O   . HOH B .   ? 0.3910 0.6222 0.2617 0.0137  -0.1301 0.0998  1710 HOH A O   
3434 O O   . HOH B .   ? 0.3721 0.2392 0.7629 -0.0767 -0.0558 -0.0590 1711 HOH A O   
3435 O O   . HOH B .   ? 0.6682 0.3657 0.4747 0.1003  0.1960  -0.0738 1712 HOH A O   
3436 O O   . HOH B .   ? 0.8354 0.3819 0.4934 0.2015  -0.0916 0.1156  1713 HOH A O   
3437 O O   . HOH B .   ? 0.6580 0.4446 0.5010 -0.2936 -0.0582 0.1155  1714 HOH A O   
3438 O O   . HOH B .   ? 0.3891 0.9105 0.4730 0.1903  0.0865  -0.1441 1715 HOH A O   
3439 O O   . HOH B .   ? 0.5449 0.3960 0.6733 -0.0430 0.0653  0.1160  1716 HOH A O   
3440 O O   . HOH B .   ? 0.4604 0.4815 0.4376 -0.0685 -0.0264 -0.1514 1717 HOH A O   
3441 O O   . HOH B .   ? 0.5259 0.5019 0.7006 -0.2333 -0.1433 0.1921  1718 HOH A O   
3442 O O   . HOH B .   ? 0.5728 0.7233 0.3782 0.1440  0.1733  0.2223  1719 HOH A O   
3443 O O   . HOH B .   ? 0.4993 0.5097 0.4476 -0.1222 -0.2521 0.1002  1720 HOH A O   
3444 O O   . HOH B .   ? 0.7008 0.5826 0.2550 0.1283  0.0756  0.0121  1721 HOH A O   
3445 O O   . HOH B .   ? 0.7628 0.4676 0.6325 -0.1575 0.0285  0.1594  1722 HOH A O   
3446 O O   . HOH B .   ? 0.5447 0.6285 0.4707 -0.0288 0.1849  -0.1143 1723 HOH A O   
3447 O O   . HOH B .   ? 0.6830 0.2188 0.2902 -0.1179 -0.0752 -0.0144 1724 HOH A O   
3448 O O   . HOH B .   ? 0.2993 0.3430 0.4004 -0.1200 -0.0980 0.0700  1725 HOH A O   
3449 O O   . HOH B .   ? 0.5422 0.8863 0.2942 0.1390  0.1189  -0.0109 1726 HOH A O   
3450 O O   . HOH B .   ? 0.4287 0.5327 0.4114 0.0157  -0.0796 -0.0399 1727 HOH A O   
3451 O O   . HOH B .   ? 0.3713 0.6760 0.3403 0.0301  -0.0856 -0.0811 1728 HOH A O   
3452 O O   . HOH B .   ? 0.6024 0.4026 0.5027 -0.1465 -0.1220 0.1989  1729 HOH A O   
3453 O O   . HOH B .   ? 0.6539 0.3908 0.5302 0.1470  0.1291  0.1730  1730 HOH A O   
3454 O O   . HOH B .   ? 0.7369 0.5092 0.4707 -0.2125 -0.1547 0.1297  1731 HOH A O   
3455 O O   . HOH B .   ? 0.5117 0.4460 0.7327 -0.0214 -0.1640 0.1325  1732 HOH A O   
3456 O O   . HOH B .   ? 0.7893 0.7426 0.2785 0.1412  -0.1379 0.0499  1733 HOH A O   
3457 O O   . HOH B .   ? 0.4793 0.6079 0.6848 0.1002  -0.1885 -0.0087 1734 HOH A O   
3458 O O   . HOH B .   ? 0.5794 0.4187 0.7751 0.1325  -0.2135 0.0578  1735 HOH A O   
3459 O O   . HOH B .   ? 0.3195 0.3595 0.5940 -0.0329 -0.0654 -0.0115 1736 HOH A O   
3460 O O   . HOH B .   ? 0.5609 0.4726 0.4364 0.0017  -0.0924 -0.1369 1737 HOH A O   
3461 O O   . HOH B .   ? 0.4544 0.5168 0.5927 0.0681  0.0181  0.0455  1738 HOH A O   
3462 O O   . HOH B .   ? 0.5386 0.5227 0.5436 0.0790  -0.1447 0.0584  1739 HOH A O   
3463 O O   . HOH B .   ? 0.6657 0.4200 0.6096 -0.1856 0.0166  0.0807  1740 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1022 ?    ?   ?   A . n 
A 1 2   GLY 2   1023 ?    ?   ?   A . n 
A 1 3   GLU 3   1024 1024 GLU GLU A . n 
A 1 4   LYS 4   1025 1025 LYS LYS A . n 
A 1 5   ASP 5   1026 1026 ASP ASP A . n 
A 1 6   VAL 6   1027 1027 VAL VAL A . n 
A 1 7   VAL 7   1028 1028 VAL VAL A . n 
A 1 8   PHE 8   1029 1029 PHE PHE A . n 
A 1 9   LEU 9   1030 1030 LEU LEU A . n 
A 1 10  ILE 10  1031 1031 ILE ILE A . n 
A 1 11  ASP 11  1032 1032 ASP ASP A . n 
A 1 12  GLY 12  1033 1033 GLY GLY A . n 
A 1 13  SER 13  1034 1034 SER SER A . n 
A 1 14  GLU 14  1035 1035 GLU GLU A . n 
A 1 15  GLY 15  1036 1036 GLY GLY A . n 
A 1 16  VAL 16  1037 1037 VAL VAL A . n 
A 1 17  ARG 17  1038 1038 ARG ARG A . n 
A 1 18  SER 18  1039 1039 SER SER A . n 
A 1 19  GLY 19  1040 1040 GLY GLY A . n 
A 1 20  PHE 20  1041 1041 PHE PHE A . n 
A 1 21  PRO 21  1042 1042 PRO PRO A . n 
A 1 22  LEU 22  1043 1043 LEU LEU A . n 
A 1 23  LEU 23  1044 1044 LEU LEU A . n 
A 1 24  LYS 24  1045 1045 LYS LYS A . n 
A 1 25  ASP 25  1046 1046 ASP ASP A . n 
A 1 26  PHE 26  1047 1047 PHE PHE A . n 
A 1 27  VAL 27  1048 1048 VAL VAL A . n 
A 1 28  GLN 28  1049 1049 GLN GLN A . n 
A 1 29  ARG 29  1050 1050 ARG ARG A . n 
A 1 30  VAL 30  1051 1051 VAL VAL A . n 
A 1 31  VAL 31  1052 1052 VAL VAL A . n 
A 1 32  GLU 32  1053 1053 GLU GLU A . n 
A 1 33  SER 33  1054 1054 SER SER A . n 
A 1 34  LEU 34  1055 1055 LEU LEU A . n 
A 1 35  ASP 35  1056 1056 ASP ASP A . n 
A 1 36  VAL 36  1057 1057 VAL VAL A . n 
A 1 37  GLY 37  1058 1058 GLY GLY A . n 
A 1 38  PRO 38  1059 1059 PRO PRO A . n 
A 1 39  ASP 39  1060 1060 ASP ASP A . n 
A 1 40  ARG 40  1061 1061 ARG ARG A . n 
A 1 41  VAL 41  1062 1062 VAL VAL A . n 
A 1 42  ARG 42  1063 1063 ARG ARG A . n 
A 1 43  VAL 43  1064 1064 VAL VAL A . n 
A 1 44  ALA 44  1065 1065 ALA ALA A . n 
A 1 45  LEU 45  1066 1066 LEU LEU A . n 
A 1 46  VAL 46  1067 1067 VAL VAL A . n 
A 1 47  GLN 47  1068 1068 GLN GLN A . n 
A 1 48  TYR 48  1069 1069 TYR TYR A . n 
A 1 49  SER 49  1070 1070 SER SER A . n 
A 1 50  ASP 50  1071 1071 ASP ASP A . n 
A 1 51  ARG 51  1072 1072 ARG ARG A . n 
A 1 52  THR 52  1073 1073 THR THR A . n 
A 1 53  ARG 53  1074 1074 ARG ARG A . n 
A 1 54  PRO 54  1075 1075 PRO PRO A . n 
A 1 55  GLU 55  1076 1076 GLU GLU A . n 
A 1 56  PHE 56  1077 1077 PHE PHE A . n 
A 1 57  TYR 57  1078 1078 TYR TYR A . n 
A 1 58  LEU 58  1079 1079 LEU LEU A . n 
A 1 59  ASN 59  1080 1080 ASN ASN A . n 
A 1 60  SER 60  1081 1081 SER SER A . n 
A 1 61  HIS 61  1082 1082 HIS HIS A . n 
A 1 62  MET 62  1083 1083 MET MET A . n 
A 1 63  ASP 63  1084 1084 ASP ASP A . n 
A 1 64  GLN 64  1085 1085 GLN GLN A . n 
A 1 65  GLN 65  1086 1086 GLN GLN A . n 
A 1 66  GLY 66  1087 1087 GLY GLY A . n 
A 1 67  VAL 67  1088 1088 VAL VAL A . n 
A 1 68  ILE 68  1089 1089 ILE ILE A . n 
A 1 69  SER 69  1090 1090 SER SER A . n 
A 1 70  ALA 70  1091 1091 ALA ALA A . n 
A 1 71  ILE 71  1092 1092 ILE ILE A . n 
A 1 72  ARG 72  1093 1093 ARG ARG A . n 
A 1 73  ARG 73  1094 1094 ARG ARG A . n 
A 1 74  LEU 74  1095 1095 LEU LEU A . n 
A 1 75  THR 75  1096 1096 THR THR A . n 
A 1 76  LEU 76  1097 1097 LEU LEU A . n 
A 1 77  LEU 77  1098 1098 LEU LEU A . n 
A 1 78  GLY 78  1099 1099 GLY GLY A . n 
A 1 79  GLY 79  1100 1100 GLY GLY A . n 
A 1 80  PRO 80  1101 1101 PRO PRO A . n 
A 1 81  THR 81  1102 1102 THR THR A . n 
A 1 82  PRO 82  1103 1103 PRO PRO A . n 
A 1 83  ASN 83  1104 1104 ASN ASN A . n 
A 1 84  THR 84  1105 1105 THR THR A . n 
A 1 85  GLY 85  1106 1106 GLY GLY A . n 
A 1 86  ALA 86  1107 1107 ALA ALA A . n 
A 1 87  ALA 87  1108 1108 ALA ALA A . n 
A 1 88  LEU 88  1109 1109 LEU LEU A . n 
A 1 89  GLU 89  1110 1110 GLU GLU A . n 
A 1 90  PHE 90  1111 1111 PHE PHE A . n 
A 1 91  VAL 91  1112 1112 VAL VAL A . n 
A 1 92  LEU 92  1113 1113 LEU LEU A . n 
A 1 93  ARG 93  1114 1114 ARG ARG A . n 
A 1 94  ASN 94  1115 1115 ASN ASN A . n 
A 1 95  ILE 95  1116 1116 ILE ILE A . n 
A 1 96  LEU 96  1117 1117 LEU LEU A . n 
A 1 97  THR 97  1118 1118 THR THR A . n 
A 1 98  SER 98  1119 1119 SER SER A . n 
A 1 99  SER 99  1120 1120 SER SER A . n 
A 1 100 THR 100 1121 1121 THR THR A . n 
A 1 101 GLY 101 1122 1122 GLY GLY A . n 
A 1 102 SER 102 1123 1123 SER SER A . n 
A 1 103 ARG 103 1124 1124 ARG ARG A . n 
A 1 104 ILE 104 1125 1125 ILE ILE A . n 
A 1 105 ALA 105 1126 1126 ALA ALA A . n 
A 1 106 GLU 106 1127 1127 GLU GLU A . n 
A 1 107 GLY 107 1128 1128 GLY GLY A . n 
A 1 108 VAL 108 1129 1129 VAL VAL A . n 
A 1 109 PRO 109 1130 1130 PRO PRO A . n 
A 1 110 GLN 110 1131 1131 GLN GLN A . n 
A 1 111 LEU 111 1132 1132 LEU LEU A . n 
A 1 112 LEU 112 1133 1133 LEU LEU A . n 
A 1 113 ILE 113 1134 1134 ILE ILE A . n 
A 1 114 VAL 114 1135 1135 VAL VAL A . n 
A 1 115 LEU 115 1136 1136 LEU LEU A . n 
A 1 116 THR 116 1137 1137 THR THR A . n 
A 1 117 ALA 117 1138 1138 ALA ALA A . n 
A 1 118 GLU 118 1139 1139 GLU GLU A . n 
A 1 119 PRO 119 1140 1140 PRO PRO A . n 
A 1 120 SER 120 1141 1141 SER SER A . n 
A 1 121 GLY 121 1142 1142 GLY GLY A . n 
A 1 122 ASP 122 1143 1143 ASP ASP A . n 
A 1 123 ASP 123 1144 1144 ASP ASP A . n 
A 1 124 VAL 124 1145 1145 VAL VAL A . n 
A 1 125 ARG 125 1146 1146 ARG ARG A . n 
A 1 126 GLY 126 1147 1147 GLY GLY A . n 
A 1 127 PRO 127 1148 1148 PRO PRO A . n 
A 1 128 SER 128 1149 1149 SER SER A . n 
A 1 129 VAL 129 1150 1150 VAL VAL A . n 
A 1 130 VAL 130 1151 1151 VAL VAL A . n 
A 1 131 LEU 131 1152 1152 LEU LEU A . n 
A 1 132 LYS 132 1153 1153 LYS LYS A . n 
A 1 133 GLN 133 1154 1154 GLN GLN A . n 
A 1 134 GLY 134 1155 1155 GLY GLY A . n 
A 1 135 GLY 135 1156 1156 GLY GLY A . n 
A 1 136 ALA 136 1157 1157 ALA ALA A . n 
A 1 137 VAL 137 1158 1158 VAL VAL A . n 
A 1 138 PRO 138 1159 1159 PRO PRO A . n 
A 1 139 ILE 139 1160 1160 ILE ILE A . n 
A 1 140 GLY 140 1161 1161 GLY GLY A . n 
A 1 141 ILE 141 1162 1162 ILE ILE A . n 
A 1 142 GLY 142 1163 1163 GLY GLY A . n 
A 1 143 ILE 143 1164 1164 ILE ILE A . n 
A 1 144 GLY 144 1165 1165 GLY GLY A . n 
A 1 145 ASN 145 1166 1166 ASN ASN A . n 
A 1 146 ALA 146 1167 1167 ALA ALA A . n 
A 1 147 ASP 147 1168 1168 ASP ASP A . n 
A 1 148 ILE 148 1169 1169 ILE ILE A . n 
A 1 149 SER 149 1170 1170 SER SER A . n 
A 1 150 GLU 150 1171 1171 GLU GLU A . n 
A 1 151 MET 151 1172 1172 MET MET A . n 
A 1 152 GLN 152 1173 1173 GLN GLN A . n 
A 1 153 THR 153 1174 1174 THR THR A . n 
A 1 154 ILE 154 1175 1175 ILE ILE A . n 
A 1 155 SER 155 1176 1176 SER SER A . n 
A 1 156 PHE 156 1177 1177 PHE PHE A . n 
A 1 157 ILE 157 1178 1178 ILE ILE A . n 
A 1 158 PRO 158 1179 1179 PRO PRO A . n 
A 1 159 ASP 159 1180 1180 ASP ASP A . n 
A 1 160 PHE 160 1181 1181 PHE PHE A . n 
A 1 161 ALA 161 1182 1182 ALA ALA A . n 
A 1 162 VAL 162 1183 1183 VAL VAL A . n 
A 1 163 ALA 163 1184 1184 ALA ALA A . n 
A 1 164 ILE 164 1185 1185 ILE ILE A . n 
A 1 165 PRO 165 1186 1186 PRO PRO A . n 
A 1 166 THR 166 1187 1187 THR THR A . n 
A 1 167 PHE 167 1188 1188 PHE PHE A . n 
A 1 168 ARG 168 1189 1189 ARG ARG A . n 
A 1 169 GLU 169 1190 1190 GLU GLU A . n 
A 1 170 LEU 170 1191 1191 LEU LEU A . n 
A 1 171 GLY 171 1192 1192 GLY GLY A . n 
A 1 172 THR 172 1193 1193 THR THR A . n 
A 1 173 ILE 173 1194 1194 ILE ILE A . n 
A 1 174 GLN 174 1195 1195 GLN GLN A . n 
A 1 175 GLN 175 1196 1196 GLN GLN A . n 
A 1 176 VAL 176 1197 1197 VAL VAL A . n 
A 1 177 ILE 177 1198 1198 ILE ILE A . n 
A 1 178 SER 178 1199 1199 SER SER A . n 
A 1 179 GLU 179 1200 1200 GLU GLU A . n 
A 1 180 ARG 180 1201 1201 ARG ARG A . n 
A 1 181 VAL 181 1202 1202 VAL VAL A . n 
A 1 182 ILE 182 1203 1203 ILE ILE A . n 
A 1 183 GLN 183 1204 1204 GLN GLN A . n 
A 1 184 LEU 184 1205 1205 LEU LEU A . n 
A 1 185 ASN 185 1206 1206 ASN ASN A . n 
A 1 186 ARG 186 1207 1207 ARG ARG A . n 
A 1 187 GLU 187 1208 1208 GLU GLU A . n 
A 1 188 GLU 188 1209 1209 GLU GLU A . n 
A 1 189 LEU 189 1210 1210 LEU LEU A . n 
A 1 190 SER 190 1211 1211 SER SER A . n 
A 1 191 SER 191 1212 1212 SER SER A . n 
A 1 192 LEU 192 1213 1213 LEU LEU A . n 
A 1 193 LYS 193 1214 1214 LYS LYS A . n 
A 1 194 PRO 194 1215 1215 PRO PRO A . n 
A 1 195 ILE 195 1216 1216 ILE ILE A . n 
A 1 196 LEU 196 1217 1217 LEU LEU A . n 
A 1 197 THR 197 1218 1218 THR THR A . n 
A 1 198 PRO 198 1219 1219 PRO PRO A . n 
A 1 199 SER 199 1220 1220 SER SER A . n 
A 1 200 THR 200 1221 ?    ?   ?   A . n 
A 1 201 GLY 201 1222 ?    ?   ?   A . n 
A 1 202 ALA 202 1223 ?    ?   ?   A . n 
A 1 203 GLY 203 1224 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1501 1501 HOH HOH A . 
B 2 HOH 2   1502 1502 HOH HOH A . 
B 2 HOH 3   1503 1503 HOH HOH A . 
B 2 HOH 4   1504 1504 HOH HOH A . 
B 2 HOH 5   1505 1505 HOH HOH A . 
B 2 HOH 6   1506 1506 HOH HOH A . 
B 2 HOH 7   1507 1507 HOH HOH A . 
B 2 HOH 8   1508 1508 HOH HOH A . 
B 2 HOH 9   1509 1509 HOH HOH A . 
B 2 HOH 10  1510 1510 HOH HOH A . 
B 2 HOH 11  1511 1511 HOH HOH A . 
B 2 HOH 12  1512 1512 HOH HOH A . 
B 2 HOH 13  1513 1513 HOH HOH A . 
B 2 HOH 14  1514 1514 HOH HOH A . 
B 2 HOH 15  1515 1515 HOH HOH A . 
B 2 HOH 16  1516 1516 HOH HOH A . 
B 2 HOH 17  1517 1517 HOH HOH A . 
B 2 HOH 18  1518 1518 HOH HOH A . 
B 2 HOH 19  1519 1519 HOH HOH A . 
B 2 HOH 20  1520 1520 HOH HOH A . 
B 2 HOH 21  1521 1521 HOH HOH A . 
B 2 HOH 22  1522 1522 HOH HOH A . 
B 2 HOH 23  1523 1523 HOH HOH A . 
B 2 HOH 24  1524 1524 HOH HOH A . 
B 2 HOH 25  1525 1525 HOH HOH A . 
B 2 HOH 26  1526 1526 HOH HOH A . 
B 2 HOH 27  1527 1527 HOH HOH A . 
B 2 HOH 28  1528 1528 HOH HOH A . 
B 2 HOH 29  1529 1529 HOH HOH A . 
B 2 HOH 30  1530 1530 HOH HOH A . 
B 2 HOH 31  1531 1531 HOH HOH A . 
B 2 HOH 32  1532 1532 HOH HOH A . 
B 2 HOH 33  1533 1533 HOH HOH A . 
B 2 HOH 34  1534 1534 HOH HOH A . 
B 2 HOH 35  1535 1535 HOH HOH A . 
B 2 HOH 36  1536 1536 HOH HOH A . 
B 2 HOH 37  1537 1537 HOH HOH A . 
B 2 HOH 38  1538 1538 HOH HOH A . 
B 2 HOH 39  1539 1539 HOH HOH A . 
B 2 HOH 40  1540 1540 HOH HOH A . 
B 2 HOH 41  1541 1541 HOH HOH A . 
B 2 HOH 42  1542 1542 HOH HOH A . 
B 2 HOH 43  1543 1543 HOH HOH A . 
B 2 HOH 44  1544 1544 HOH HOH A . 
B 2 HOH 45  1545 1545 HOH HOH A . 
B 2 HOH 46  1546 1546 HOH HOH A . 
B 2 HOH 47  1547 1547 HOH HOH A . 
B 2 HOH 48  1548 1548 HOH HOH A . 
B 2 HOH 49  1549 1549 HOH HOH A . 
B 2 HOH 50  1550 1550 HOH HOH A . 
B 2 HOH 51  1551 1551 HOH HOH A . 
B 2 HOH 52  1552 1552 HOH HOH A . 
B 2 HOH 53  1553 1553 HOH HOH A . 
B 2 HOH 54  1554 1554 HOH HOH A . 
B 2 HOH 55  1555 1555 HOH HOH A . 
B 2 HOH 56  1556 1556 HOH HOH A . 
B 2 HOH 57  1557 1557 HOH HOH A . 
B 2 HOH 58  1558 1558 HOH HOH A . 
B 2 HOH 59  1559 1559 HOH HOH A . 
B 2 HOH 60  1560 1560 HOH HOH A . 
B 2 HOH 61  1561 1561 HOH HOH A . 
B 2 HOH 62  1562 1562 HOH HOH A . 
B 2 HOH 63  1563 1563 HOH HOH A . 
B 2 HOH 64  1564 1564 HOH HOH A . 
B 2 HOH 65  1565 1565 HOH HOH A . 
B 2 HOH 66  1566 1566 HOH HOH A . 
B 2 HOH 67  1567 1567 HOH HOH A . 
B 2 HOH 68  1568 1568 HOH HOH A . 
B 2 HOH 69  1569 1569 HOH HOH A . 
B 2 HOH 70  1570 1570 HOH HOH A . 
B 2 HOH 71  1571 1571 HOH HOH A . 
B 2 HOH 72  1572 1572 HOH HOH A . 
B 2 HOH 73  1573 1573 HOH HOH A . 
B 2 HOH 74  1574 1574 HOH HOH A . 
B 2 HOH 75  1575 1575 HOH HOH A . 
B 2 HOH 76  1576 1576 HOH HOH A . 
B 2 HOH 77  1577 1577 HOH HOH A . 
B 2 HOH 78  1578 1578 HOH HOH A . 
B 2 HOH 79  1579 1579 HOH HOH A . 
B 2 HOH 80  1580 1580 HOH HOH A . 
B 2 HOH 81  1581 1581 HOH HOH A . 
B 2 HOH 82  1582 1582 HOH HOH A . 
B 2 HOH 83  1583 1583 HOH HOH A . 
B 2 HOH 84  1584 1584 HOH HOH A . 
B 2 HOH 85  1585 1585 HOH HOH A . 
B 2 HOH 86  1586 1586 HOH HOH A . 
B 2 HOH 87  1587 1587 HOH HOH A . 
B 2 HOH 88  1588 1588 HOH HOH A . 
B 2 HOH 89  1589 1589 HOH HOH A . 
B 2 HOH 90  1590 1590 HOH HOH A . 
B 2 HOH 91  1591 1591 HOH HOH A . 
B 2 HOH 92  1592 1592 HOH HOH A . 
B 2 HOH 93  1593 1593 HOH HOH A . 
B 2 HOH 94  1594 1594 HOH HOH A . 
B 2 HOH 95  1595 1595 HOH HOH A . 
B 2 HOH 96  1596 1596 HOH HOH A . 
B 2 HOH 97  1597 1597 HOH HOH A . 
B 2 HOH 98  1598 1598 HOH HOH A . 
B 2 HOH 99  1599 1599 HOH HOH A . 
B 2 HOH 100 1600 1600 HOH HOH A . 
B 2 HOH 101 1601 1601 HOH HOH A . 
B 2 HOH 102 1602 1602 HOH HOH A . 
B 2 HOH 103 1603 1603 HOH HOH A . 
B 2 HOH 104 1604 1604 HOH HOH A . 
B 2 HOH 105 1605 1605 HOH HOH A . 
B 2 HOH 106 1606 1606 HOH HOH A . 
B 2 HOH 107 1607 1607 HOH HOH A . 
B 2 HOH 108 1608 1608 HOH HOH A . 
B 2 HOH 109 1609 1609 HOH HOH A . 
B 2 HOH 110 1610 1610 HOH HOH A . 
B 2 HOH 111 1611 1611 HOH HOH A . 
B 2 HOH 112 1612 1612 HOH HOH A . 
B 2 HOH 113 1613 1613 HOH HOH A . 
B 2 HOH 114 1614 1614 HOH HOH A . 
B 2 HOH 115 1615 1615 HOH HOH A . 
B 2 HOH 116 1616 1616 HOH HOH A . 
B 2 HOH 117 1617 1617 HOH HOH A . 
B 2 HOH 118 1618 1618 HOH HOH A . 
B 2 HOH 119 1619 1619 HOH HOH A . 
B 2 HOH 120 1620 1620 HOH HOH A . 
B 2 HOH 121 1621 1621 HOH HOH A . 
B 2 HOH 122 1622 1622 HOH HOH A . 
B 2 HOH 123 1623 1623 HOH HOH A . 
B 2 HOH 124 1624 1624 HOH HOH A . 
B 2 HOH 125 1625 1625 HOH HOH A . 
B 2 HOH 126 1626 1626 HOH HOH A . 
B 2 HOH 127 1627 1627 HOH HOH A . 
B 2 HOH 128 1628 1628 HOH HOH A . 
B 2 HOH 129 1629 1629 HOH HOH A . 
B 2 HOH 130 1630 1630 HOH HOH A . 
B 2 HOH 131 1631 1631 HOH HOH A . 
B 2 HOH 132 1632 1632 HOH HOH A . 
B 2 HOH 133 1633 1633 HOH HOH A . 
B 2 HOH 134 1634 1634 HOH HOH A . 
B 2 HOH 135 1635 1635 HOH HOH A . 
B 2 HOH 136 1636 1636 HOH HOH A . 
B 2 HOH 137 1637 1637 HOH HOH A . 
B 2 HOH 138 1638 1638 HOH HOH A . 
B 2 HOH 139 1639 1639 HOH HOH A . 
B 2 HOH 140 1640 1640 HOH HOH A . 
B 2 HOH 141 1641 1641 HOH HOH A . 
B 2 HOH 142 1642 1642 HOH HOH A . 
B 2 HOH 143 1643 1643 HOH HOH A . 
B 2 HOH 144 1644 1644 HOH HOH A . 
B 2 HOH 145 1645 1645 HOH HOH A . 
B 2 HOH 146 1646 1646 HOH HOH A . 
B 2 HOH 147 1647 1647 HOH HOH A . 
B 2 HOH 148 1648 1648 HOH HOH A . 
B 2 HOH 149 1649 1649 HOH HOH A . 
B 2 HOH 150 1650 1650 HOH HOH A . 
B 2 HOH 151 1651 1651 HOH HOH A . 
B 2 HOH 152 1652 1652 HOH HOH A . 
B 2 HOH 153 1653 1653 HOH HOH A . 
B 2 HOH 154 1654 1654 HOH HOH A . 
B 2 HOH 155 1655 1655 HOH HOH A . 
B 2 HOH 156 1656 1656 HOH HOH A . 
B 2 HOH 157 1657 1657 HOH HOH A . 
B 2 HOH 158 1658 1658 HOH HOH A . 
B 2 HOH 159 1659 1659 HOH HOH A . 
B 2 HOH 160 1660 1660 HOH HOH A . 
B 2 HOH 161 1661 1661 HOH HOH A . 
B 2 HOH 162 1662 1662 HOH HOH A . 
B 2 HOH 163 1663 1663 HOH HOH A . 
B 2 HOH 164 1664 1664 HOH HOH A . 
B 2 HOH 165 1665 1665 HOH HOH A . 
B 2 HOH 166 1666 1666 HOH HOH A . 
B 2 HOH 167 1667 1667 HOH HOH A . 
B 2 HOH 168 1668 1668 HOH HOH A . 
B 2 HOH 169 1669 1669 HOH HOH A . 
B 2 HOH 170 1670 1670 HOH HOH A . 
B 2 HOH 171 1671 1671 HOH HOH A . 
B 2 HOH 172 1672 1672 HOH HOH A . 
B 2 HOH 173 1673 1673 HOH HOH A . 
B 2 HOH 174 1674 1674 HOH HOH A . 
B 2 HOH 175 1675 1675 HOH HOH A . 
B 2 HOH 176 1676 1676 HOH HOH A . 
B 2 HOH 177 1677 1677 HOH HOH A . 
B 2 HOH 178 1678 1678 HOH HOH A . 
B 2 HOH 179 1679 1679 HOH HOH A . 
B 2 HOH 180 1680 1680 HOH HOH A . 
B 2 HOH 181 1681 1681 HOH HOH A . 
B 2 HOH 182 1682 1682 HOH HOH A . 
B 2 HOH 183 1683 1683 HOH HOH A . 
B 2 HOH 184 1684 1684 HOH HOH A . 
B 2 HOH 185 1685 1685 HOH HOH A . 
B 2 HOH 186 1686 1686 HOH HOH A . 
B 2 HOH 187 1687 1687 HOH HOH A . 
B 2 HOH 188 1688 1688 HOH HOH A . 
B 2 HOH 189 1689 1689 HOH HOH A . 
B 2 HOH 190 1690 1690 HOH HOH A . 
B 2 HOH 191 1691 1691 HOH HOH A . 
B 2 HOH 192 1692 1692 HOH HOH A . 
B 2 HOH 193 1693 1693 HOH HOH A . 
B 2 HOH 194 1694 1694 HOH HOH A . 
B 2 HOH 195 1695 1695 HOH HOH A . 
B 2 HOH 196 1696 1696 HOH HOH A . 
B 2 HOH 197 1697 1697 HOH HOH A . 
B 2 HOH 198 1698 1698 HOH HOH A . 
B 2 HOH 199 1699 1699 HOH HOH A . 
B 2 HOH 200 1700 1700 HOH HOH A . 
B 2 HOH 201 1701 1701 HOH HOH A . 
B 2 HOH 202 1702 1702 HOH HOH A . 
B 2 HOH 203 1703 1703 HOH HOH A . 
B 2 HOH 204 1704 1704 HOH HOH A . 
B 2 HOH 205 1705 1705 HOH HOH A . 
B 2 HOH 206 1706 1706 HOH HOH A . 
B 2 HOH 207 1707 1707 HOH HOH A . 
B 2 HOH 208 1708 1708 HOH HOH A . 
B 2 HOH 209 1709 1709 HOH HOH A . 
B 2 HOH 210 1710 1710 HOH HOH A . 
B 2 HOH 211 1711 1711 HOH HOH A . 
B 2 HOH 212 1712 1713 HOH HOH A . 
B 2 HOH 213 1713 1714 HOH HOH A . 
B 2 HOH 214 1714 1715 HOH HOH A . 
B 2 HOH 215 1715 1716 HOH HOH A . 
B 2 HOH 216 1716 1717 HOH HOH A . 
B 2 HOH 217 1717 1718 HOH HOH A . 
B 2 HOH 218 1718 1719 HOH HOH A . 
B 2 HOH 219 1719 1720 HOH HOH A . 
B 2 HOH 220 1720 1721 HOH HOH A . 
B 2 HOH 221 1721 1722 HOH HOH A . 
B 2 HOH 222 1722 1723 HOH HOH A . 
B 2 HOH 223 1723 1724 HOH HOH A . 
B 2 HOH 224 1724 1725 HOH HOH A . 
B 2 HOH 225 1725 1726 HOH HOH A . 
B 2 HOH 226 1726 1727 HOH HOH A . 
B 2 HOH 227 1727 1728 HOH HOH A . 
B 2 HOH 228 1728 1729 HOH HOH A . 
B 2 HOH 229 1729 1730 HOH HOH A . 
B 2 HOH 230 1730 1731 HOH HOH A . 
B 2 HOH 231 1731 1732 HOH HOH A . 
B 2 HOH 232 1732 1733 HOH HOH A . 
B 2 HOH 233 1733 1734 HOH HOH A . 
B 2 HOH 234 1734 1735 HOH HOH A . 
B 2 HOH 235 1735 1736 HOH HOH A . 
B 2 HOH 236 1736 1737 HOH HOH A . 
B 2 HOH 237 1737 1738 HOH HOH A . 
B 2 HOH 238 1738 1739 HOH HOH A . 
B 2 HOH 239 1739 1740 HOH HOH A . 
B 2 HOH 240 1740 1741 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-12-18 
2 'Structure model' 1 1 2018-12-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
13 2 'Structure model' '_citation_author.name'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                 ? 1 
PHASER   phasing           .                 ? 2 
PHENIX   refinement        '(phenix.refine)' ? 3 
MOSFLM   'data reduction'  .                 ? 4 
SCALA    'data scaling'    .                 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 1061 ? A -123.10 -112.94 
2 1 ARG A 1061 ? B -121.92 -113.82 
3 1 SER A 1070 ? A -139.88 -105.55 
4 1 SER A 1070 ? B -138.13 -106.07 
5 1 THR A 1218 ? ? -155.65 63.22   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1022 ? A SER 1   
2 1 Y 1 A GLY 1023 ? A GLY 2   
3 1 Y 1 A THR 1221 ? A THR 200 
4 1 Y 1 A GLY 1222 ? A GLY 201 
5 1 Y 1 A ALA 1223 ? A ALA 202 
6 1 Y 1 A GLY 1224 ? A GLY 203 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#