data_4IQJ
# 
_entry.id   4IQJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.357 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   4IQJ         pdb_00004iqj 10.2210/pdb4iqj/pdb 
NDB   NA2223       ?            ?                   
RCSB  RCSB077082   ?            ?                   
WWPDB D_1000077082 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2HPI 'The structure of T. aquaticus DNA polymerase III'                           unspecified 
PDB 3E0D 'the structure of a ternary complex of the DNA polymerase III alpha-subunit' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4IQJ 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, B.'    1 
'Lin, J.'    2 
'Steitz, T.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome'                          Structure 
21  658 664 2013 STRUE6 UK 0969-2126 2005 ? 23478062 10.1016/j.str.2013.02.002  
1       'The structure of T. aquaticus DNA polymerase III is distinct from eukaryotic replicative DNA polymerases.'    
'Cell(Cambridge,Mass.)' 126 893 904 2006 CELLB5 US 0092-8674 0998 ? 16959569 10.1016/j.cell.2006.07.027 
2       'Insights into the replisome from the structure of a ternary complex of the DNA polymerase III alpha-subunit.' J.Mol.Biol. 
382 859 869 2008 JMOBAK UK 0022-2836 0070 ? 18691598 10.1016/j.jmb.2008.07.058  
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, B.'      1 ? 
primary 'Lin, J.'      2 ? 
primary 'Steitz, T.A.' 3 ? 
1       'Bailey, S.'   4 ? 
1       'Wing, R.A.'   5 ? 
1       'Steitz, T.A.' 6 ? 
2       'Wing, R.A.'   7 ? 
2       'Bailey, S.'   8 ? 
2       'Steitz, T.A.' 9 ? 
# 
_cell.entry_id           4IQJ 
_cell.length_a           188.530 
_cell.length_b           94.970 
_cell.length_c           204.080 
_cell.angle_alpha        90.00 
_cell.angle_beta         89.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IQJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*A)-3')
;
6137.984   3  ?       ? ?                                  'DNA substrate primer strand'   
2 polymer     syn 
;DNA (5'-D(*TP*TP*TP*TP*TP*TP*TP*GP*TP*GP*GP*CP*AP*CP*TP*GP*GP*CP*CP*GP*TP*CP*GP*TP*TP*TP*CP*G)-3')
;
8591.493   4  ?       ? ?                                  'DNA substrate template strand' 
3 polymer     syn 
;DNA (5'-D(P*CP*GP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*(DOC))-3')
;
6411.167   1  ?       ? ?                                  'DNA substrate primer strand'   
4 polymer     man 'DNA polymerase III subunit alpha'                                                                   137579.422 
4  2.7.7.7 ? 'DNA polymerase III subunit alpha' ?                               
5 polymer     man 'DNA polymerase III subunit gamma/tau'                                                               19600.293  
4  2.7.7.7 ? ?                                  ?                               
6 non-polymer syn 'ZINC ION'                                                                                           65.409     
12 ?       ? ?                                  ?                               
7 non-polymer syn 'MAGNESIUM ION'                                                                                      24.305     
4  ?       ? ?                                  ?                               
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DC)(DG)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)(DA)' 
CGAAACGACGGCCAGTGCCA E,G,K   ? 
2 polydeoxyribonucleotide no no  
;(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DG)(DG)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DC)(DG)
(DT)(DC)(DG)(DT)(DT)(DT)(DC)(DG)
;
TTTTTTTGTGGCACTGGCCGTCGTTTCG F,H,J,L ? 
3 polydeoxyribonucleotide no yes 
;(DC)(DG)(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DG)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DC)(DC)(DA)
(DOC)
;
CGAAACGACGGCCAGTGCCAC I       ? 
4 'polypeptide(L)'        no no  
;MGSKLKFAHLHQHTQFSLLDGAAKLQDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGYEAYVAAESR
FDRKRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEKPRIDREILREHAQGLIALSGCLGAEIPQFILQDRLD
LAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKTTLDDPE
RWRFPCDEFYVKTPEEMRAMLPEAEWGDEPFDNTVEIARMCDVDLPIGDKMVYRIPRFPLPEGRTEAQYLRELTFLGLLR
RYPDRITEAFYREVLRLLGTMPPHGDERALAEALARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSVIERMGFP
GYFLIVQDYINWARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYV
RERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAIQVVPELRAEMEKDERIRQVIE
VAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEARRIVKESKG
VELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLKPRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVSY
AEFPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYSLGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANR
LFDMLEAFANYGFNKSHAAAYSLLSYQTAYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDF
KVVGEEILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNKRALESLVKAGALDAFGDRARLLASLEPL
LRWAAETRERGRSGLVGLFAEVEEPPLVEASPLDEITMLRYEKEALGIYVSGHPVLRYPGLREVASCTIEELSEFVRELP
GKPKVLLSGMVEEVVRKPTRSGGMMARFTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVEKGEELRVLAQAVWT
LEEVLEAPKALEVEVDHALLDEKGVARLKSLLDEHPGSLPVYLRVLGPFGEALFALREVRVGEEALGLLEAEGYRAYLVP
DREVFLQGNGGGPKEEVVPF
;
;MGSKLKFAHLHQHTQFSLLDGAAKLQDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGYEAYVAAESR
FDRKRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEKPRIDREILREHAQGLIALSGCLGAEIPQFILQDRLD
LAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKTTLDDPE
RWRFPCDEFYVKTPEEMRAMLPEAEWGDEPFDNTVEIARMCDVDLPIGDKMVYRIPRFPLPEGRTEAQYLRELTFLGLLR
RYPDRITEAFYREVLRLLGTMPPHGDERALAEALARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSVIERMGFP
GYFLIVQDYINWARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYV
RERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAIQVVPELRAEMEKDERIRQVIE
VAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEARRIVKESKG
VELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLKPRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVSY
AEFPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYSLGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANR
LFDMLEAFANYGFNKSHAAAYSLLSYQTAYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDF
KVVGEEILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNKRALESLVKAGALDAFGDRARLLASLEPL
LRWAAETRERGRSGLVGLFAEVEEPPLVEASPLDEITMLRYEKEALGIYVSGHPVLRYPGLREVASCTIEELSEFVRELP
GKPKVLLSGMVEEVVRKPTRSGGMMARFTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVEKGEELRVLAQAVWT
LEEVLEAPKALEVEVDHALLDEKGVARLKSLLDEHPGSLPVYLRVLGPFGEALFALREVRVGEEALGLLEAEGYRAYLVP
DREVFLQGNGGGPKEEVVPF
;
A,B,C,D ? 
5 'polypeptide(L)'        no no  
;HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHKKAEEQKAHLLPLARAQFGVEEL
AFVLEKKSLSGASPPPPTKPVPPREAPPPVAAPPPEPEPPLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEA
EEPVSEDGIGGNGIMPP
;
;HHHHHHKAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHKKAEEQKAHLLPLARAQFGVEEL
AFVLEKKSLSGASPPPPTKPVPPREAPPPVAAPPPEPEPPLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEA
EEPVSEDGIGGNGIMPP
;
M,N,O,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    DC  n 
1 2    DG  n 
1 3    DA  n 
1 4    DA  n 
1 5    DA  n 
1 6    DC  n 
1 7    DG  n 
1 8    DA  n 
1 9    DC  n 
1 10   DG  n 
1 11   DG  n 
1 12   DC  n 
1 13   DC  n 
1 14   DA  n 
1 15   DG  n 
1 16   DT  n 
1 17   DG  n 
1 18   DC  n 
1 19   DC  n 
1 20   DA  n 
2 1    DT  n 
2 2    DT  n 
2 3    DT  n 
2 4    DT  n 
2 5    DT  n 
2 6    DT  n 
2 7    DT  n 
2 8    DG  n 
2 9    DT  n 
2 10   DG  n 
2 11   DG  n 
2 12   DC  n 
2 13   DA  n 
2 14   DC  n 
2 15   DT  n 
2 16   DG  n 
2 17   DG  n 
2 18   DC  n 
2 19   DC  n 
2 20   DG  n 
2 21   DT  n 
2 22   DC  n 
2 23   DG  n 
2 24   DT  n 
2 25   DT  n 
2 26   DT  n 
2 27   DC  n 
2 28   DG  n 
3 1    DC  n 
3 2    DG  n 
3 3    DA  n 
3 4    DA  n 
3 5    DA  n 
3 6    DC  n 
3 7    DG  n 
3 8    DA  n 
3 9    DC  n 
3 10   DG  n 
3 11   DG  n 
3 12   DC  n 
3 13   DC  n 
3 14   DA  n 
3 15   DG  n 
3 16   DT  n 
3 17   DG  n 
3 18   DC  n 
3 19   DC  n 
3 20   DA  n 
3 21   DOC n 
4 1    MET n 
4 2    GLY n 
4 3    SER n 
4 4    LYS n 
4 5    LEU n 
4 6    LYS n 
4 7    PHE n 
4 8    ALA n 
4 9    HIS n 
4 10   LEU n 
4 11   HIS n 
4 12   GLN n 
4 13   HIS n 
4 14   THR n 
4 15   GLN n 
4 16   PHE n 
4 17   SER n 
4 18   LEU n 
4 19   LEU n 
4 20   ASP n 
4 21   GLY n 
4 22   ALA n 
4 23   ALA n 
4 24   LYS n 
4 25   LEU n 
4 26   GLN n 
4 27   ASP n 
4 28   LEU n 
4 29   LEU n 
4 30   LYS n 
4 31   TRP n 
4 32   VAL n 
4 33   LYS n 
4 34   GLU n 
4 35   THR n 
4 36   THR n 
4 37   PRO n 
4 38   GLU n 
4 39   ASP n 
4 40   PRO n 
4 41   ALA n 
4 42   LEU n 
4 43   ALA n 
4 44   MET n 
4 45   THR n 
4 46   ASP n 
4 47   HIS n 
4 48   GLY n 
4 49   ASN n 
4 50   LEU n 
4 51   PHE n 
4 52   GLY n 
4 53   ALA n 
4 54   VAL n 
4 55   GLU n 
4 56   PHE n 
4 57   TYR n 
4 58   LYS n 
4 59   LYS n 
4 60   ALA n 
4 61   THR n 
4 62   ALA n 
4 63   MET n 
4 64   GLY n 
4 65   VAL n 
4 66   LYS n 
4 67   PRO n 
4 68   ILE n 
4 69   ILE n 
4 70   GLY n 
4 71   TYR n 
4 72   GLU n 
4 73   ALA n 
4 74   TYR n 
4 75   VAL n 
4 76   ALA n 
4 77   ALA n 
4 78   GLU n 
4 79   SER n 
4 80   ARG n 
4 81   PHE n 
4 82   ASP n 
4 83   ARG n 
4 84   LYS n 
4 85   ARG n 
4 86   GLY n 
4 87   LYS n 
4 88   GLY n 
4 89   LEU n 
4 90   ASP n 
4 91   GLY n 
4 92   GLY n 
4 93   TYR n 
4 94   PHE n 
4 95   HIS n 
4 96   LEU n 
4 97   THR n 
4 98   LEU n 
4 99   LEU n 
4 100  ALA n 
4 101  LYS n 
4 102  ASP n 
4 103  PHE n 
4 104  THR n 
4 105  GLY n 
4 106  TYR n 
4 107  GLN n 
4 108  ASN n 
4 109  LEU n 
4 110  VAL n 
4 111  ARG n 
4 112  LEU n 
4 113  ALA n 
4 114  SER n 
4 115  ARG n 
4 116  ALA n 
4 117  TYR n 
4 118  LEU n 
4 119  GLU n 
4 120  GLY n 
4 121  PHE n 
4 122  TYR n 
4 123  GLU n 
4 124  LYS n 
4 125  PRO n 
4 126  ARG n 
4 127  ILE n 
4 128  ASP n 
4 129  ARG n 
4 130  GLU n 
4 131  ILE n 
4 132  LEU n 
4 133  ARG n 
4 134  GLU n 
4 135  HIS n 
4 136  ALA n 
4 137  GLN n 
4 138  GLY n 
4 139  LEU n 
4 140  ILE n 
4 141  ALA n 
4 142  LEU n 
4 143  SER n 
4 144  GLY n 
4 145  CYS n 
4 146  LEU n 
4 147  GLY n 
4 148  ALA n 
4 149  GLU n 
4 150  ILE n 
4 151  PRO n 
4 152  GLN n 
4 153  PHE n 
4 154  ILE n 
4 155  LEU n 
4 156  GLN n 
4 157  ASP n 
4 158  ARG n 
4 159  LEU n 
4 160  ASP n 
4 161  LEU n 
4 162  ALA n 
4 163  GLU n 
4 164  ALA n 
4 165  ARG n 
4 166  LEU n 
4 167  ASN n 
4 168  GLU n 
4 169  ASP n 
4 170  LEU n 
4 171  SER n 
4 172  ILE n 
4 173  PHE n 
4 174  GLY n 
4 175  ASP n 
4 176  ARG n 
4 177  PHE n 
4 178  PHE n 
4 179  ILE n 
4 180  GLU n 
4 181  ILE n 
4 182  GLN n 
4 183  ASN n 
4 184  HIS n 
4 185  GLY n 
4 186  LEU n 
4 187  PRO n 
4 188  GLU n 
4 189  GLN n 
4 190  LYS n 
4 191  LYS n 
4 192  VAL n 
4 193  ASN n 
4 194  GLN n 
4 195  VAL n 
4 196  LEU n 
4 197  LYS n 
4 198  GLU n 
4 199  PHE n 
4 200  ALA n 
4 201  ARG n 
4 202  LYS n 
4 203  TYR n 
4 204  GLY n 
4 205  LEU n 
4 206  GLY n 
4 207  MET n 
4 208  VAL n 
4 209  ALA n 
4 210  THR n 
4 211  ASN n 
4 212  ASP n 
4 213  GLY n 
4 214  HIS n 
4 215  TYR n 
4 216  VAL n 
4 217  ARG n 
4 218  LYS n 
4 219  GLU n 
4 220  ASP n 
4 221  ALA n 
4 222  ARG n 
4 223  ALA n 
4 224  HIS n 
4 225  GLU n 
4 226  VAL n 
4 227  LEU n 
4 228  LEU n 
4 229  ALA n 
4 230  ILE n 
4 231  GLN n 
4 232  SER n 
4 233  LYS n 
4 234  THR n 
4 235  THR n 
4 236  LEU n 
4 237  ASP n 
4 238  ASP n 
4 239  PRO n 
4 240  GLU n 
4 241  ARG n 
4 242  TRP n 
4 243  ARG n 
4 244  PHE n 
4 245  PRO n 
4 246  CYS n 
4 247  ASP n 
4 248  GLU n 
4 249  PHE n 
4 250  TYR n 
4 251  VAL n 
4 252  LYS n 
4 253  THR n 
4 254  PRO n 
4 255  GLU n 
4 256  GLU n 
4 257  MET n 
4 258  ARG n 
4 259  ALA n 
4 260  MET n 
4 261  LEU n 
4 262  PRO n 
4 263  GLU n 
4 264  ALA n 
4 265  GLU n 
4 266  TRP n 
4 267  GLY n 
4 268  ASP n 
4 269  GLU n 
4 270  PRO n 
4 271  PHE n 
4 272  ASP n 
4 273  ASN n 
4 274  THR n 
4 275  VAL n 
4 276  GLU n 
4 277  ILE n 
4 278  ALA n 
4 279  ARG n 
4 280  MET n 
4 281  CYS n 
4 282  ASP n 
4 283  VAL n 
4 284  ASP n 
4 285  LEU n 
4 286  PRO n 
4 287  ILE n 
4 288  GLY n 
4 289  ASP n 
4 290  LYS n 
4 291  MET n 
4 292  VAL n 
4 293  TYR n 
4 294  ARG n 
4 295  ILE n 
4 296  PRO n 
4 297  ARG n 
4 298  PHE n 
4 299  PRO n 
4 300  LEU n 
4 301  PRO n 
4 302  GLU n 
4 303  GLY n 
4 304  ARG n 
4 305  THR n 
4 306  GLU n 
4 307  ALA n 
4 308  GLN n 
4 309  TYR n 
4 310  LEU n 
4 311  ARG n 
4 312  GLU n 
4 313  LEU n 
4 314  THR n 
4 315  PHE n 
4 316  LEU n 
4 317  GLY n 
4 318  LEU n 
4 319  LEU n 
4 320  ARG n 
4 321  ARG n 
4 322  TYR n 
4 323  PRO n 
4 324  ASP n 
4 325  ARG n 
4 326  ILE n 
4 327  THR n 
4 328  GLU n 
4 329  ALA n 
4 330  PHE n 
4 331  TYR n 
4 332  ARG n 
4 333  GLU n 
4 334  VAL n 
4 335  LEU n 
4 336  ARG n 
4 337  LEU n 
4 338  LEU n 
4 339  GLY n 
4 340  THR n 
4 341  MET n 
4 342  PRO n 
4 343  PRO n 
4 344  HIS n 
4 345  GLY n 
4 346  ASP n 
4 347  GLU n 
4 348  ARG n 
4 349  ALA n 
4 350  LEU n 
4 351  ALA n 
4 352  GLU n 
4 353  ALA n 
4 354  LEU n 
4 355  ALA n 
4 356  ARG n 
4 357  VAL n 
4 358  GLU n 
4 359  GLU n 
4 360  LYS n 
4 361  ALA n 
4 362  TRP n 
4 363  GLU n 
4 364  GLU n 
4 365  LEU n 
4 366  ARG n 
4 367  LYS n 
4 368  ARG n 
4 369  LEU n 
4 370  PRO n 
4 371  PRO n 
4 372  LEU n 
4 373  GLU n 
4 374  GLY n 
4 375  VAL n 
4 376  ARG n 
4 377  GLU n 
4 378  TRP n 
4 379  THR n 
4 380  ALA n 
4 381  GLU n 
4 382  ALA n 
4 383  ILE n 
4 384  LEU n 
4 385  HIS n 
4 386  ARG n 
4 387  ALA n 
4 388  LEU n 
4 389  TYR n 
4 390  GLU n 
4 391  LEU n 
4 392  SER n 
4 393  VAL n 
4 394  ILE n 
4 395  GLU n 
4 396  ARG n 
4 397  MET n 
4 398  GLY n 
4 399  PHE n 
4 400  PRO n 
4 401  GLY n 
4 402  TYR n 
4 403  PHE n 
4 404  LEU n 
4 405  ILE n 
4 406  VAL n 
4 407  GLN n 
4 408  ASP n 
4 409  TYR n 
4 410  ILE n 
4 411  ASN n 
4 412  TRP n 
4 413  ALA n 
4 414  ARG n 
4 415  GLY n 
4 416  HIS n 
4 417  GLY n 
4 418  VAL n 
4 419  SER n 
4 420  VAL n 
4 421  GLY n 
4 422  PRO n 
4 423  GLY n 
4 424  ARG n 
4 425  GLY n 
4 426  SER n 
4 427  ALA n 
4 428  ALA n 
4 429  GLY n 
4 430  SER n 
4 431  LEU n 
4 432  VAL n 
4 433  ALA n 
4 434  TYR n 
4 435  ALA n 
4 436  VAL n 
4 437  GLY n 
4 438  ILE n 
4 439  THR n 
4 440  ASN n 
4 441  ILE n 
4 442  ASP n 
4 443  PRO n 
4 444  LEU n 
4 445  ARG n 
4 446  PHE n 
4 447  GLY n 
4 448  LEU n 
4 449  LEU n 
4 450  PHE n 
4 451  GLU n 
4 452  ARG n 
4 453  PHE n 
4 454  LEU n 
4 455  ASN n 
4 456  PRO n 
4 457  GLU n 
4 458  ARG n 
4 459  VAL n 
4 460  SER n 
4 461  MET n 
4 462  PRO n 
4 463  ASP n 
4 464  ILE n 
4 465  ASP n 
4 466  THR n 
4 467  ASP n 
4 468  PHE n 
4 469  SER n 
4 470  ASP n 
4 471  ARG n 
4 472  GLU n 
4 473  ARG n 
4 474  ASP n 
4 475  ARG n 
4 476  VAL n 
4 477  ILE n 
4 478  GLN n 
4 479  TYR n 
4 480  VAL n 
4 481  ARG n 
4 482  GLU n 
4 483  ARG n 
4 484  TYR n 
4 485  GLY n 
4 486  GLU n 
4 487  ASP n 
4 488  LYS n 
4 489  VAL n 
4 490  ALA n 
4 491  GLN n 
4 492  ILE n 
4 493  GLY n 
4 494  THR n 
4 495  PHE n 
4 496  GLY n 
4 497  SER n 
4 498  LEU n 
4 499  ALA n 
4 500  SER n 
4 501  LYS n 
4 502  ALA n 
4 503  ALA n 
4 504  LEU n 
4 505  LYS n 
4 506  ASP n 
4 507  VAL n 
4 508  ALA n 
4 509  ARG n 
4 510  VAL n 
4 511  TYR n 
4 512  GLY n 
4 513  ILE n 
4 514  PRO n 
4 515  HIS n 
4 516  LYS n 
4 517  LYS n 
4 518  ALA n 
4 519  GLU n 
4 520  GLU n 
4 521  LEU n 
4 522  ALA n 
4 523  LYS n 
4 524  LEU n 
4 525  ILE n 
4 526  PRO n 
4 527  VAL n 
4 528  GLN n 
4 529  PHE n 
4 530  GLY n 
4 531  LYS n 
4 532  PRO n 
4 533  LYS n 
4 534  PRO n 
4 535  LEU n 
4 536  GLN n 
4 537  GLU n 
4 538  ALA n 
4 539  ILE n 
4 540  GLN n 
4 541  VAL n 
4 542  VAL n 
4 543  PRO n 
4 544  GLU n 
4 545  LEU n 
4 546  ARG n 
4 547  ALA n 
4 548  GLU n 
4 549  MET n 
4 550  GLU n 
4 551  LYS n 
4 552  ASP n 
4 553  GLU n 
4 554  ARG n 
4 555  ILE n 
4 556  ARG n 
4 557  GLN n 
4 558  VAL n 
4 559  ILE n 
4 560  GLU n 
4 561  VAL n 
4 562  ALA n 
4 563  MET n 
4 564  ARG n 
4 565  LEU n 
4 566  GLU n 
4 567  GLY n 
4 568  LEU n 
4 569  ASN n 
4 570  ARG n 
4 571  HIS n 
4 572  ALA n 
4 573  SER n 
4 574  VAL n 
4 575  HIS n 
4 576  ALA n 
4 577  ALA n 
4 578  GLY n 
4 579  VAL n 
4 580  VAL n 
4 581  ILE n 
4 582  ALA n 
4 583  ALA n 
4 584  GLU n 
4 585  PRO n 
4 586  LEU n 
4 587  THR n 
4 588  ASP n 
4 589  LEU n 
4 590  VAL n 
4 591  PRO n 
4 592  LEU n 
4 593  MET n 
4 594  ARG n 
4 595  ASP n 
4 596  GLN n 
4 597  GLU n 
4 598  GLY n 
4 599  ARG n 
4 600  PRO n 
4 601  VAL n 
4 602  THR n 
4 603  GLN n 
4 604  TYR n 
4 605  ASP n 
4 606  MET n 
4 607  GLY n 
4 608  ALA n 
4 609  VAL n 
4 610  GLU n 
4 611  ALA n 
4 612  LEU n 
4 613  GLY n 
4 614  LEU n 
4 615  LEU n 
4 616  LYS n 
4 617  MET n 
4 618  ASP n 
4 619  PHE n 
4 620  LEU n 
4 621  GLY n 
4 622  LEU n 
4 623  ARG n 
4 624  THR n 
4 625  LEU n 
4 626  THR n 
4 627  PHE n 
4 628  LEU n 
4 629  ASP n 
4 630  GLU n 
4 631  ALA n 
4 632  ARG n 
4 633  ARG n 
4 634  ILE n 
4 635  VAL n 
4 636  LYS n 
4 637  GLU n 
4 638  SER n 
4 639  LYS n 
4 640  GLY n 
4 641  VAL n 
4 642  GLU n 
4 643  LEU n 
4 644  ASP n 
4 645  TYR n 
4 646  ASP n 
4 647  ARG n 
4 648  LEU n 
4 649  PRO n 
4 650  LEU n 
4 651  ASP n 
4 652  ASP n 
4 653  PRO n 
4 654  LYS n 
4 655  THR n 
4 656  PHE n 
4 657  GLU n 
4 658  LEU n 
4 659  LEU n 
4 660  SER n 
4 661  ARG n 
4 662  GLY n 
4 663  GLU n 
4 664  THR n 
4 665  LYS n 
4 666  GLY n 
4 667  VAL n 
4 668  PHE n 
4 669  GLN n 
4 670  LEU n 
4 671  GLU n 
4 672  SER n 
4 673  GLY n 
4 674  GLY n 
4 675  MET n 
4 676  THR n 
4 677  ALA n 
4 678  THR n 
4 679  VAL n 
4 680  ARG n 
4 681  GLY n 
4 682  LEU n 
4 683  LYS n 
4 684  PRO n 
4 685  ARG n 
4 686  ARG n 
4 687  LEU n 
4 688  GLU n 
4 689  ASP n 
4 690  ILE n 
4 691  ILE n 
4 692  ALA n 
4 693  LEU n 
4 694  VAL n 
4 695  SER n 
4 696  LEU n 
4 697  TYR n 
4 698  ARG n 
4 699  PRO n 
4 700  GLY n 
4 701  PRO n 
4 702  MET n 
4 703  GLU n 
4 704  HIS n 
4 705  ILE n 
4 706  PRO n 
4 707  THR n 
4 708  TYR n 
4 709  ILE n 
4 710  ARG n 
4 711  ARG n 
4 712  HIS n 
4 713  HIS n 
4 714  GLY n 
4 715  GLN n 
4 716  GLU n 
4 717  PRO n 
4 718  VAL n 
4 719  SER n 
4 720  TYR n 
4 721  ALA n 
4 722  GLU n 
4 723  PHE n 
4 724  PRO n 
4 725  HIS n 
4 726  ALA n 
4 727  GLU n 
4 728  LYS n 
4 729  TYR n 
4 730  LEU n 
4 731  ARG n 
4 732  PRO n 
4 733  ILE n 
4 734  LEU n 
4 735  ASP n 
4 736  GLU n 
4 737  THR n 
4 738  TYR n 
4 739  GLY n 
4 740  ILE n 
4 741  PRO n 
4 742  VAL n 
4 743  TYR n 
4 744  GLN n 
4 745  GLU n 
4 746  GLN n 
4 747  ILE n 
4 748  MET n 
4 749  GLN n 
4 750  ILE n 
4 751  ALA n 
4 752  SER n 
4 753  GLN n 
4 754  VAL n 
4 755  ALA n 
4 756  GLY n 
4 757  TYR n 
4 758  SER n 
4 759  LEU n 
4 760  GLY n 
4 761  GLU n 
4 762  ALA n 
4 763  ASP n 
4 764  LEU n 
4 765  LEU n 
4 766  ARG n 
4 767  ARG n 
4 768  ALA n 
4 769  MET n 
4 770  GLY n 
4 771  LYS n 
4 772  LYS n 
4 773  ARG n 
4 774  VAL n 
4 775  GLU n 
4 776  GLU n 
4 777  MET n 
4 778  GLN n 
4 779  LYS n 
4 780  HIS n 
4 781  ARG n 
4 782  GLU n 
4 783  ARG n 
4 784  PHE n 
4 785  VAL n 
4 786  ARG n 
4 787  GLY n 
4 788  ALA n 
4 789  LYS n 
4 790  GLU n 
4 791  ARG n 
4 792  GLY n 
4 793  VAL n 
4 794  PRO n 
4 795  GLU n 
4 796  GLU n 
4 797  GLU n 
4 798  ALA n 
4 799  ASN n 
4 800  ARG n 
4 801  LEU n 
4 802  PHE n 
4 803  ASP n 
4 804  MET n 
4 805  LEU n 
4 806  GLU n 
4 807  ALA n 
4 808  PHE n 
4 809  ALA n 
4 810  ASN n 
4 811  TYR n 
4 812  GLY n 
4 813  PHE n 
4 814  ASN n 
4 815  LYS n 
4 816  SER n 
4 817  HIS n 
4 818  ALA n 
4 819  ALA n 
4 820  ALA n 
4 821  TYR n 
4 822  SER n 
4 823  LEU n 
4 824  LEU n 
4 825  SER n 
4 826  TYR n 
4 827  GLN n 
4 828  THR n 
4 829  ALA n 
4 830  TYR n 
4 831  VAL n 
4 832  LYS n 
4 833  ALA n 
4 834  HIS n 
4 835  TYR n 
4 836  PRO n 
4 837  VAL n 
4 838  GLU n 
4 839  PHE n 
4 840  MET n 
4 841  ALA n 
4 842  ALA n 
4 843  LEU n 
4 844  LEU n 
4 845  SER n 
4 846  VAL n 
4 847  GLU n 
4 848  ARG n 
4 849  HIS n 
4 850  ASP n 
4 851  SER n 
4 852  ASP n 
4 853  LYS n 
4 854  VAL n 
4 855  ALA n 
4 856  GLU n 
4 857  TYR n 
4 858  ILE n 
4 859  ARG n 
4 860  ASP n 
4 861  ALA n 
4 862  ARG n 
4 863  ALA n 
4 864  LEU n 
4 865  GLY n 
4 866  ILE n 
4 867  PRO n 
4 868  VAL n 
4 869  LEU n 
4 870  PRO n 
4 871  PRO n 
4 872  ASP n 
4 873  VAL n 
4 874  ASN n 
4 875  ARG n 
4 876  SER n 
4 877  GLY n 
4 878  PHE n 
4 879  ASP n 
4 880  PHE n 
4 881  LYS n 
4 882  VAL n 
4 883  VAL n 
4 884  GLY n 
4 885  GLU n 
4 886  GLU n 
4 887  ILE n 
4 888  LEU n 
4 889  PHE n 
4 890  GLY n 
4 891  LEU n 
4 892  SER n 
4 893  ALA n 
4 894  VAL n 
4 895  LYS n 
4 896  ASN n 
4 897  VAL n 
4 898  GLY n 
4 899  GLU n 
4 900  MET n 
4 901  ALA n 
4 902  ALA n 
4 903  ARG n 
4 904  ALA n 
4 905  ILE n 
4 906  LEU n 
4 907  GLU n 
4 908  GLU n 
4 909  ARG n 
4 910  GLU n 
4 911  ARG n 
4 912  GLY n 
4 913  GLY n 
4 914  PRO n 
4 915  PHE n 
4 916  LYS n 
4 917  SER n 
4 918  LEU n 
4 919  GLY n 
4 920  ASP n 
4 921  PHE n 
4 922  LEU n 
4 923  LYS n 
4 924  ARG n 
4 925  LEU n 
4 926  PRO n 
4 927  GLU n 
4 928  GLN n 
4 929  VAL n 
4 930  VAL n 
4 931  ASN n 
4 932  LYS n 
4 933  ARG n 
4 934  ALA n 
4 935  LEU n 
4 936  GLU n 
4 937  SER n 
4 938  LEU n 
4 939  VAL n 
4 940  LYS n 
4 941  ALA n 
4 942  GLY n 
4 943  ALA n 
4 944  LEU n 
4 945  ASP n 
4 946  ALA n 
4 947  PHE n 
4 948  GLY n 
4 949  ASP n 
4 950  ARG n 
4 951  ALA n 
4 952  ARG n 
4 953  LEU n 
4 954  LEU n 
4 955  ALA n 
4 956  SER n 
4 957  LEU n 
4 958  GLU n 
4 959  PRO n 
4 960  LEU n 
4 961  LEU n 
4 962  ARG n 
4 963  TRP n 
4 964  ALA n 
4 965  ALA n 
4 966  GLU n 
4 967  THR n 
4 968  ARG n 
4 969  GLU n 
4 970  ARG n 
4 971  GLY n 
4 972  ARG n 
4 973  SER n 
4 974  GLY n 
4 975  LEU n 
4 976  VAL n 
4 977  GLY n 
4 978  LEU n 
4 979  PHE n 
4 980  ALA n 
4 981  GLU n 
4 982  VAL n 
4 983  GLU n 
4 984  GLU n 
4 985  PRO n 
4 986  PRO n 
4 987  LEU n 
4 988  VAL n 
4 989  GLU n 
4 990  ALA n 
4 991  SER n 
4 992  PRO n 
4 993  LEU n 
4 994  ASP n 
4 995  GLU n 
4 996  ILE n 
4 997  THR n 
4 998  MET n 
4 999  LEU n 
4 1000 ARG n 
4 1001 TYR n 
4 1002 GLU n 
4 1003 LYS n 
4 1004 GLU n 
4 1005 ALA n 
4 1006 LEU n 
4 1007 GLY n 
4 1008 ILE n 
4 1009 TYR n 
4 1010 VAL n 
4 1011 SER n 
4 1012 GLY n 
4 1013 HIS n 
4 1014 PRO n 
4 1015 VAL n 
4 1016 LEU n 
4 1017 ARG n 
4 1018 TYR n 
4 1019 PRO n 
4 1020 GLY n 
4 1021 LEU n 
4 1022 ARG n 
4 1023 GLU n 
4 1024 VAL n 
4 1025 ALA n 
4 1026 SER n 
4 1027 CYS n 
4 1028 THR n 
4 1029 ILE n 
4 1030 GLU n 
4 1031 GLU n 
4 1032 LEU n 
4 1033 SER n 
4 1034 GLU n 
4 1035 PHE n 
4 1036 VAL n 
4 1037 ARG n 
4 1038 GLU n 
4 1039 LEU n 
4 1040 PRO n 
4 1041 GLY n 
4 1042 LYS n 
4 1043 PRO n 
4 1044 LYS n 
4 1045 VAL n 
4 1046 LEU n 
4 1047 LEU n 
4 1048 SER n 
4 1049 GLY n 
4 1050 MET n 
4 1051 VAL n 
4 1052 GLU n 
4 1053 GLU n 
4 1054 VAL n 
4 1055 VAL n 
4 1056 ARG n 
4 1057 LYS n 
4 1058 PRO n 
4 1059 THR n 
4 1060 ARG n 
4 1061 SER n 
4 1062 GLY n 
4 1063 GLY n 
4 1064 MET n 
4 1065 MET n 
4 1066 ALA n 
4 1067 ARG n 
4 1068 PHE n 
4 1069 THR n 
4 1070 LEU n 
4 1071 SER n 
4 1072 ASP n 
4 1073 GLU n 
4 1074 THR n 
4 1075 GLY n 
4 1076 ALA n 
4 1077 LEU n 
4 1078 GLU n 
4 1079 VAL n 
4 1080 VAL n 
4 1081 VAL n 
4 1082 PHE n 
4 1083 GLY n 
4 1084 ARG n 
4 1085 ALA n 
4 1086 TYR n 
4 1087 GLU n 
4 1088 GLY n 
4 1089 VAL n 
4 1090 SER n 
4 1091 PRO n 
4 1092 LYS n 
4 1093 LEU n 
4 1094 LYS n 
4 1095 GLU n 
4 1096 ASP n 
4 1097 ILE n 
4 1098 PRO n 
4 1099 LEU n 
4 1100 LEU n 
4 1101 VAL n 
4 1102 LEU n 
4 1103 ALA n 
4 1104 GLU n 
4 1105 VAL n 
4 1106 GLU n 
4 1107 LYS n 
4 1108 GLY n 
4 1109 GLU n 
4 1110 GLU n 
4 1111 LEU n 
4 1112 ARG n 
4 1113 VAL n 
4 1114 LEU n 
4 1115 ALA n 
4 1116 GLN n 
4 1117 ALA n 
4 1118 VAL n 
4 1119 TRP n 
4 1120 THR n 
4 1121 LEU n 
4 1122 GLU n 
4 1123 GLU n 
4 1124 VAL n 
4 1125 LEU n 
4 1126 GLU n 
4 1127 ALA n 
4 1128 PRO n 
4 1129 LYS n 
4 1130 ALA n 
4 1131 LEU n 
4 1132 GLU n 
4 1133 VAL n 
4 1134 GLU n 
4 1135 VAL n 
4 1136 ASP n 
4 1137 HIS n 
4 1138 ALA n 
4 1139 LEU n 
4 1140 LEU n 
4 1141 ASP n 
4 1142 GLU n 
4 1143 LYS n 
4 1144 GLY n 
4 1145 VAL n 
4 1146 ALA n 
4 1147 ARG n 
4 1148 LEU n 
4 1149 LYS n 
4 1150 SER n 
4 1151 LEU n 
4 1152 LEU n 
4 1153 ASP n 
4 1154 GLU n 
4 1155 HIS n 
4 1156 PRO n 
4 1157 GLY n 
4 1158 SER n 
4 1159 LEU n 
4 1160 PRO n 
4 1161 VAL n 
4 1162 TYR n 
4 1163 LEU n 
4 1164 ARG n 
4 1165 VAL n 
4 1166 LEU n 
4 1167 GLY n 
4 1168 PRO n 
4 1169 PHE n 
4 1170 GLY n 
4 1171 GLU n 
4 1172 ALA n 
4 1173 LEU n 
4 1174 PHE n 
4 1175 ALA n 
4 1176 LEU n 
4 1177 ARG n 
4 1178 GLU n 
4 1179 VAL n 
4 1180 ARG n 
4 1181 VAL n 
4 1182 GLY n 
4 1183 GLU n 
4 1184 GLU n 
4 1185 ALA n 
4 1186 LEU n 
4 1187 GLY n 
4 1188 LEU n 
4 1189 LEU n 
4 1190 GLU n 
4 1191 ALA n 
4 1192 GLU n 
4 1193 GLY n 
4 1194 TYR n 
4 1195 ARG n 
4 1196 ALA n 
4 1197 TYR n 
4 1198 LEU n 
4 1199 VAL n 
4 1200 PRO n 
4 1201 ASP n 
4 1202 ARG n 
4 1203 GLU n 
4 1204 VAL n 
4 1205 PHE n 
4 1206 LEU n 
4 1207 GLN n 
4 1208 GLY n 
4 1209 ASN n 
4 1210 GLY n 
4 1211 GLY n 
4 1212 GLY n 
4 1213 PRO n 
4 1214 LYS n 
4 1215 GLU n 
4 1216 GLU n 
4 1217 VAL n 
4 1218 VAL n 
4 1219 PRO n 
4 1220 PHE n 
5 1    HIS n 
5 2    HIS n 
5 3    HIS n 
5 4    HIS n 
5 5    HIS n 
5 6    HIS n 
5 7    LYS n 
5 8    ALA n 
5 9    GLY n 
5 10   GLU n 
5 11   ALA n 
5 12   GLN n 
5 13   ASP n 
5 14   LEU n 
5 15   ALA n 
5 16   GLU n 
5 17   GLY n 
5 18   TRP n 
5 19   ARG n 
5 20   ALA n 
5 21   PHE n 
5 22   LEU n 
5 23   GLU n 
5 24   ALA n 
5 25   LEU n 
5 26   LYS n 
5 27   PRO n 
5 28   THR n 
5 29   LEU n 
5 30   ARG n 
5 31   ALA n 
5 32   PHE n 
5 33   VAL n 
5 34   ARG n 
5 35   GLU n 
5 36   ALA n 
5 37   ARG n 
5 38   PRO n 
5 39   HIS n 
5 40   LEU n 
5 41   GLU n 
5 42   GLY n 
5 43   LYS n 
5 44   THR n 
5 45   LEU n 
5 46   VAL n 
5 47   LEU n 
5 48   ARG n 
5 49   PHE n 
5 50   PRO n 
5 51   GLU n 
5 52   SER n 
5 53   LYS n 
5 54   ALA n 
5 55   PHE n 
5 56   HIS n 
5 57   HIS n 
5 58   LYS n 
5 59   LYS n 
5 60   ALA n 
5 61   GLU n 
5 62   GLU n 
5 63   GLN n 
5 64   LYS n 
5 65   ALA n 
5 66   HIS n 
5 67   LEU n 
5 68   LEU n 
5 69   PRO n 
5 70   LEU n 
5 71   ALA n 
5 72   ARG n 
5 73   ALA n 
5 74   GLN n 
5 75   PHE n 
5 76   GLY n 
5 77   VAL n 
5 78   GLU n 
5 79   GLU n 
5 80   LEU n 
5 81   ALA n 
5 82   PHE n 
5 83   VAL n 
5 84   LEU n 
5 85   GLU n 
5 86   LYS n 
5 87   LYS n 
5 88   SER n 
5 89   LEU n 
5 90   SER n 
5 91   GLY n 
5 92   ALA n 
5 93   SER n 
5 94   PRO n 
5 95   PRO n 
5 96   PRO n 
5 97   PRO n 
5 98   THR n 
5 99   LYS n 
5 100  PRO n 
5 101  VAL n 
5 102  PRO n 
5 103  PRO n 
5 104  ARG n 
5 105  GLU n 
5 106  ALA n 
5 107  PRO n 
5 108  PRO n 
5 109  PRO n 
5 110  VAL n 
5 111  ALA n 
5 112  ALA n 
5 113  PRO n 
5 114  PRO n 
5 115  PRO n 
5 116  GLU n 
5 117  PRO n 
5 118  GLU n 
5 119  PRO n 
5 120  PRO n 
5 121  LEU n 
5 122  GLU n 
5 123  ASP n 
5 124  PRO n 
5 125  PRO n 
5 126  TRP n 
5 127  GLU n 
5 128  ALA n 
5 129  GLU n 
5 130  GLU n 
5 131  GLY n 
5 132  GLU n 
5 133  ASP n 
5 134  PRO n 
5 135  SER n 
5 136  GLU n 
5 137  GLU n 
5 138  LEU n 
5 139  ARG n 
5 140  ARG n 
5 141  LEU n 
5 142  ALA n 
5 143  ARG n 
5 144  LEU n 
5 145  LEU n 
5 146  GLY n 
5 147  GLY n 
5 148  ARG n 
5 149  LEU n 
5 150  LEU n 
5 151  TRP n 
5 152  VAL n 
5 153  ARG n 
5 154  LYS n 
5 155  PRO n 
5 156  LYS n 
5 157  ALA n 
5 158  PRO n 
5 159  GLU n 
5 160  ALA n 
5 161  GLU n 
5 162  GLU n 
5 163  PRO n 
5 164  VAL n 
5 165  SER n 
5 166  GLU n 
5 167  ASP n 
5 168  GLY n 
5 169  ILE n 
5 170  GLY n 
5 171  GLY n 
5 172  ASN n 
5 173  GLY n 
5 174  ILE n 
5 175  MET n 
5 176  PRO n 
5 177  PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
4 1 sample 'Biological sequence' 1 1220 ? ? dnaE                            ? ? ? ? ? ? 'Thermus aquaticus' 271 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 177  ? ? 'dnaX_2, dnaX, BVI061214_00485' ? ? ? ? ? ? 'Thermus aquaticus' 271 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 20 'Synthetic construct' ? 32630 ? 
2 1 sample 1 28 'Synthetic construct' ? 32630 ? 
3 1 sample 1 21 'Synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 4IQJ             4IQJ       ? 1 ? 1   
2 PDB 4IQJ             4IQJ       ? 2 ? 1   
3 PDB 4IQJ             4IQJ       ? 3 ? 1   
4 UNP DPO3A_THEAQ      Q9XDH5     ? 4 
;MGSKLKFAHLHQHTQFSLLDGAAKLQDLLKWVKETTPEDPALAMTDHGNLFGAVEFYKKATAMGVKPIIGYEAYVAAESR
FDRKRGKGLDGGYFHLTLLAKDFTGYQNLVRLASRAYLEGFYEKPRIDREILREHAQGLIALSGCLGAEIPQFILQDRLD
LAEARLNEDLSIFGDRFFIEIQNHGLPEQKKVNQVLKEFARKYGLGMVATNDGHYVRKEDARAHEVLLAIQSKTTLDDPE
RWRFPCDEFYVKTPEEMRAMLPEAEWGDEPFDNTVEIARMCDVDLPIGDKMVYRIPRFPLPEGRTEAQYLRELTFLGLLR
RYPDRITEAFYREVLRLLGTMPPHGDERALAEALARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSVIERMGFP
GYFLIVQDYINWARGHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERDRVIQYV
RERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKPLQEAIQVVPELRAEMEKDERIRQVIE
VAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRTLTFLDEARRIVKESKG
VELDYDRLPLDDPKTFELLSRGETKGVFQLESGGMTATVRGLKPRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVSY
AEFPHAEKYLRPILDETYGIPVYQEQIMQIASQVAGYSLGEADLLRRAMGKKRVEEMQKHRERFVRGAKERGVPEEEANR
LFDMLEAFANYGFNKSHAAAYSLLSYQTAYVKAHYPVEFMAALLSVERHDSDKVAEYIRDARALGIPVLPPDVNRSGFDF
KVVGEEILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKRLPEQVVNKRALESLVKAGALDAFGDRARLLASLEPL
LRWAAETRERGRSGLVGLFAEVEEPPLVEASPLDEITMLRYEKEALGIYVSGHPVLRYPGLREVASCTIEELSEFVRELP
GKPKVLLSGMVEEVVRKPTRSGGMMARFTLSDETGALEVVVFGRAYEGVSPKLKEDIPLLVLAEVEKGEELRVLAQAVWT
LEEVLEAPKALEVEVDHALLDEKGVARLKSLLDEHPGSLPVYLRVLGPFGEALFALREVRVGEEALGLLEAEGYRAYLVP
DREVFLQGNGGGPKEEVVPF
;
1   
5 UNP A0A0M9ACL9_THEAQ A0A0M9ACL9 ? 5 
;EAGEAQDLAEGWRAFLEALKPTLRAFVREARPHLEGKTLVLRFPESKAFHHKKAEEQKAHLLPLARAQFGVEELAFVLEK
KSLSGASPPPPTKPVPPREAPPPVAAPPPEPEPPLEDPPWEAEEGEDPSEELRRLARLLGGRLLWVRKPKAPEAEEPVSE
DGIGGNGI
;
373 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4IQJ E 1 ? 20   ? 4IQJ       1   ? 20   ? 1   20   
2  2 4IQJ F 1 ? 28   ? 4IQJ       1   ? 28   ? 1   28   
3  1 4IQJ G 1 ? 20   ? 4IQJ       1   ? 20   ? 1   20   
4  2 4IQJ H 1 ? 28   ? 4IQJ       1   ? 28   ? 1   28   
5  3 4IQJ I 1 ? 21   ? 4IQJ       1   ? 21   ? 1   21   
6  2 4IQJ J 1 ? 28   ? 4IQJ       1   ? 28   ? 1   28   
7  1 4IQJ K 1 ? 20   ? 4IQJ       1   ? 20   ? 1   20   
8  2 4IQJ L 1 ? 28   ? 4IQJ       1   ? 28   ? 1   28   
9  4 4IQJ A 1 ? 1220 ? Q9XDH5     1   ? 1220 ? 1   1220 
10 4 4IQJ B 1 ? 1220 ? Q9XDH5     1   ? 1220 ? 1   1220 
11 4 4IQJ C 1 ? 1220 ? Q9XDH5     1   ? 1220 ? 1   1220 
12 4 4IQJ D 1 ? 1220 ? Q9XDH5     1   ? 1220 ? 1   1220 
13 5 4IQJ M 7 ? 174  ? A0A0M9ACL9 373 ? 540  ? 373 540  
14 5 4IQJ N 7 ? 174  ? A0A0M9ACL9 373 ? 540  ? 373 540  
15 5 4IQJ O 7 ? 174  ? A0A0M9ACL9 373 ? 540  ? 373 540  
16 5 4IQJ P 7 ? 174  ? A0A0M9ACL9 373 ? 540  ? 373 540  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
13 4IQJ HIS M 1   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 367 1  
13 4IQJ HIS M 2   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 368 2  
13 4IQJ HIS M 3   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 369 3  
13 4IQJ HIS M 4   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 370 4  
13 4IQJ HIS M 5   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 371 5  
13 4IQJ HIS M 6   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 372 6  
13 4IQJ LYS M 7   ? UNP A0A0M9ACL9 GLU 373 conflict         373 7  
13 4IQJ MET M 175 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 541 8  
13 4IQJ PRO M 176 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 542 9  
13 4IQJ PRO M 177 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 543 10 
14 4IQJ HIS N 1   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 367 11 
14 4IQJ HIS N 2   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 368 12 
14 4IQJ HIS N 3   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 369 13 
14 4IQJ HIS N 4   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 370 14 
14 4IQJ HIS N 5   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 371 15 
14 4IQJ HIS N 6   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 372 16 
14 4IQJ LYS N 7   ? UNP A0A0M9ACL9 GLU 373 conflict         373 17 
14 4IQJ MET N 175 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 541 18 
14 4IQJ PRO N 176 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 542 19 
14 4IQJ PRO N 177 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 543 20 
15 4IQJ HIS O 1   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 367 21 
15 4IQJ HIS O 2   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 368 22 
15 4IQJ HIS O 3   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 369 23 
15 4IQJ HIS O 4   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 370 24 
15 4IQJ HIS O 5   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 371 25 
15 4IQJ HIS O 6   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 372 26 
15 4IQJ LYS O 7   ? UNP A0A0M9ACL9 GLU 373 conflict         373 27 
15 4IQJ MET O 175 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 541 28 
15 4IQJ PRO O 176 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 542 29 
15 4IQJ PRO O 177 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 543 30 
16 4IQJ HIS P 1   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 367 31 
16 4IQJ HIS P 2   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 368 32 
16 4IQJ HIS P 3   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 369 33 
16 4IQJ HIS P 4   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 370 34 
16 4IQJ HIS P 5   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 371 35 
16 4IQJ HIS P 6   ? UNP A0A0M9ACL9 ?   ?   'expression tag' 372 36 
16 4IQJ LYS P 7   ? UNP A0A0M9ACL9 GLU 373 conflict         373 37 
16 4IQJ MET P 175 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 541 38 
16 4IQJ PRO P 176 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 542 39 
16 4IQJ PRO P 177 ? UNP A0A0M9ACL9 ?   ?   'expression tag' 543 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P' 347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'  291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                               ? 'Zn 2'            65.409  
# 
_exptl.entry_id          4IQJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_percent_sol   53.69 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M TRIS pH 8.8, 18% (w/v) polyethylene glycol 4000, 0.2 M MgCl2, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-09-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'optical system that acts as a narrow-band-pass' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9999 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4IQJ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.198 
_reflns.number_obs                   112427 
_reflns.number_all                   112427 
_reflns.percent_possible_obs         93.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.044 
_reflns.pdbx_netI_over_sigmaI        11.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.198 
_reflns_shell.d_res_low              3.37 
_reflns_shell.percent_possible_all   93.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.539 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4IQJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     108754 
_refine.ls_number_reflns_all                     108754 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    96.03 
_refine.ls_R_factor_obs                          0.26631 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.26434 
_refine.ls_R_factor_R_free                       0.30474 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5710 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.911 
_refine.correlation_coeff_Fo_to_Fc_free          0.875 
_refine.B_iso_mean                               151.765 
_refine.aniso_B[1][1]                            -4.20 
_refine.aniso_B[2][2]                            9.18 
_refine.aniso_B[3][3]                            -4.98 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -1.31 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2HPI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.137 
_refine.overall_SU_ML                            0.495 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             61.343 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        41665 
_refine_hist.pdbx_number_atoms_nucleic_acid   3566 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               45265 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 46545 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.000  0.020  ? 43355 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.272  1.906  ? 63613 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            3.544  3.000  ? 99810 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.369  5.000  ? 5182  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       29.247 22.993 ? 2068  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.564 15.000 ? 7455  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.839 15.000 ? 437   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.067  0.200  ? 6751  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 49723 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.006  0.020  ? 10555 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  5.288  1.500  ? 26008 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 7.969  2.000  ? 41644 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.767  3.000  ? 20557 'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.736  4.500  ? 21995 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 E 2441   0.23 0.05 'interatomic distance' 1  1  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 G 2441   0.23 0.05 'interatomic distance' 1  2  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 E 2532   0.23 0.05 'interatomic distance' 2  3  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 I 2532   0.23 0.05 'interatomic distance' 2  4  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 E 2545   0.23 0.05 'interatomic distance' 3  5  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 K 2545   0.23 0.05 'interatomic distance' 3  6  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 F 2302   0.24 0.05 'interatomic distance' 4  7  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 H 2302   0.24 0.05 'interatomic distance' 4  8  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 F 2186   0.25 0.05 'interatomic distance' 5  9  'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 J 2186   0.25 0.05 'interatomic distance' 5  10 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 F 2351   0.24 0.05 'interatomic distance' 6  11 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 L 2351   0.24 0.05 'interatomic distance' 6  12 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 G 2545   0.24 0.05 'interatomic distance' 7  13 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 I 2545   0.24 0.05 'interatomic distance' 7  14 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 G 2588   0.22 0.05 'interatomic distance' 8  15 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 K 2588   0.22 0.05 'interatomic distance' 8  16 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 H 2570   0.23 0.05 'interatomic distance' 9  17 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 J 2570   0.23 0.05 'interatomic distance' 9  18 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 H 2857   0.21 0.05 'interatomic distance' 10 19 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 L 2857   0.21 0.05 'interatomic distance' 10 20 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 I 2722   0.22 0.05 'interatomic distance' 11 21 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 K 2722   0.22 0.05 'interatomic distance' 11 22 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 J 2655   0.21 0.05 'interatomic distance' 12 23 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 L 2655   0.21 0.05 'interatomic distance' 12 24 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 121401 0.21 0.05 'interatomic distance' 13 25 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 B 121401 0.21 0.05 'interatomic distance' 13 26 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 120083 0.22 0.05 'interatomic distance' 14 27 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 C 120083 0.22 0.05 'interatomic distance' 14 28 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 A 121463 0.22 0.05 'interatomic distance' 15 29 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 D 121463 0.22 0.05 'interatomic distance' 15 30 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 B 118945 0.22 0.05 'interatomic distance' 16 31 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 C 118945 0.22 0.05 'interatomic distance' 16 32 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 B 121358 0.22 0.05 'interatomic distance' 17 33 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 D 121358 0.22 0.05 'interatomic distance' 17 34 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 C 121687 0.22 0.05 'interatomic distance' 18 35 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 D 121687 0.22 0.05 'interatomic distance' 18 36 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 M 11589  0.30 0.05 'interatomic distance' 19 37 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 N 11589  0.30 0.05 'interatomic distance' 19 38 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 M 11484  0.29 0.05 'interatomic distance' 20 39 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 O 11484  0.29 0.05 'interatomic distance' 20 40 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 M 11327  0.30 0.05 'interatomic distance' 21 41 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 P 11327  0.30 0.05 'interatomic distance' 21 42 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 N 11459  0.29 0.05 'interatomic distance' 22 43 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 O 11459  0.29 0.05 'interatomic distance' 22 44 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 N 11107  0.30 0.05 'interatomic distance' 23 45 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 P 11107  0.30 0.05 'interatomic distance' 23 46 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
1 O 11164  0.31 0.05 'interatomic distance' 24 47 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
2 P 11164  0.31 0.05 'interatomic distance' 24 48 'X-RAY DIFFRACTION' ? ? ? ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.200 
_refine_ls_shell.d_res_low                        3.281 
_refine_ls_shell.number_reflns_R_work             6947 
_refine_ls_shell.R_factor_R_work                  0.295 
_refine_ls_shell.percent_reflns_obs               85.36 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             364 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 E 1  
2 G 1  
1 E 2  
2 I 2  
1 E 3  
2 K 3  
1 F 4  
2 H 4  
1 F 5  
2 J 5  
1 F 6  
2 L 6  
1 G 7  
2 I 7  
1 G 8  
2 K 8  
1 H 9  
2 J 9  
1 H 10 
2 L 10 
1 I 11 
2 K 11 
1 J 12 
2 L 12 
1 A 13 
2 B 13 
1 A 14 
2 C 14 
1 A 15 
2 D 15 
1 B 16 
2 C 16 
1 B 17 
2 D 17 
1 C 18 
2 D 18 
1 M 19 
2 N 19 
1 M 20 
2 O 20 
1 M 21 
2 P 21 
1 N 22 
2 O 22 
1 N 23 
2 P 23 
1 O 24 
2 P 24 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 1  ? 
2 G 1   G 20   0 0 ? ? ? ? ? ? ? ? 1  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 2  ? 
2 I 1   I 20   0 0 ? ? ? ? ? ? ? ? 2  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 3  ? 
2 K 1   K 20   0 0 ? ? ? ? ? ? ? ? 3  ? 
1 F 9   F 27   0 0 ? ? ? ? ? ? ? ? 4  ? 
2 H 9   H 27   0 0 ? ? ? ? ? ? ? ? 4  ? 
1 F 9   F 27   0 0 ? ? ? ? ? ? ? ? 5  ? 
2 J 9   J 27   0 0 ? ? ? ? ? ? ? ? 5  ? 
1 F 9   F 27   0 0 ? ? ? ? ? ? ? ? 6  ? 
2 L 9   L 27   0 0 ? ? ? ? ? ? ? ? 6  ? 
1 G 1   G 20   0 0 ? ? ? ? ? ? ? ? 7  ? 
2 I 1   I 20   0 0 ? ? ? ? ? ? ? ? 7  ? 
1 G 1   G 20   0 0 ? ? ? ? ? ? ? ? 8  ? 
2 K 1   K 20   0 0 ? ? ? ? ? ? ? ? 8  ? 
1 H 6   H 27   0 0 ? ? ? ? ? ? ? ? 9  ? 
2 J 6   J 27   0 0 ? ? ? ? ? ? ? ? 9  ? 
1 H 5   H 27   0 0 ? ? ? ? ? ? ? ? 10 ? 
2 L 5   L 27   0 0 ? ? ? ? ? ? ? ? 10 ? 
1 I 1   I 20   0 0 ? ? ? ? ? ? ? ? 11 ? 
2 K 1   K 20   0 0 ? ? ? ? ? ? ? ? 11 ? 
1 J 6   J 27   0 0 ? ? ? ? ? ? ? ? 12 ? 
2 L 6   L 27   0 0 ? ? ? ? ? ? ? ? 12 ? 
1 A 5   A 1220 0 0 ? ? ? ? ? ? ? ? 13 ? 
2 B 5   B 1220 0 0 ? ? ? ? ? ? ? ? 13 ? 
1 A 5   A 1220 0 0 ? ? ? ? ? ? ? ? 14 ? 
2 C 5   C 1220 0 0 ? ? ? ? ? ? ? ? 14 ? 
1 A 5   A 1220 0 0 ? ? ? ? ? ? ? ? 15 ? 
2 D 5   D 1220 0 0 ? ? ? ? ? ? ? ? 15 ? 
1 B 5   B 1220 0 0 ? ? ? ? ? ? ? ? 16 ? 
2 C 5   C 1220 0 0 ? ? ? ? ? ? ? ? 16 ? 
1 B 5   B 1220 0 0 ? ? ? ? ? ? ? ? 17 ? 
2 D 5   D 1220 0 0 ? ? ? ? ? ? ? ? 17 ? 
1 C 5   C 1220 0 0 ? ? ? ? ? ? ? ? 18 ? 
2 D 5   D 1220 0 0 ? ? ? ? ? ? ? ? 18 ? 
1 M 367 M 543  0 0 ? ? ? ? ? ? ? ? 19 ? 
2 N 367 N 543  0 0 ? ? ? ? ? ? ? ? 19 ? 
1 M 367 M 543  0 0 ? ? ? ? ? ? ? ? 20 ? 
2 O 367 O 543  0 0 ? ? ? ? ? ? ? ? 20 ? 
1 M 367 M 543  0 0 ? ? ? ? ? ? ? ? 21 ? 
2 P 367 P 543  0 0 ? ? ? ? ? ? ? ? 21 ? 
1 N 367 N 543  0 0 ? ? ? ? ? ? ? ? 22 ? 
2 O 367 O 543  0 0 ? ? ? ? ? ? ? ? 22 ? 
1 N 367 N 543  0 0 ? ? ? ? ? ? ? ? 23 ? 
2 P 367 P 543  0 0 ? ? ? ? ? ? ? ? 23 ? 
1 O 367 O 543  0 0 ? ? ? ? ? ? ? ? 24 ? 
2 P 367 P 543  0 0 ? ? ? ? ? ? ? ? 24 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
17 ? 
18 ? 
19 ? 
20 ? 
21 ? 
22 ? 
23 ? 
24 ? 
# 
_struct.entry_id                  4IQJ 
_struct.title                     'Structure of PolIIIalpha-Tauc-DNA complex suggests an atomic model of the replisome' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IQJ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;Polymerase, alpha subunit, TauC subunit, DNA replication, DNA-directed DNA Polymerase, Nucleotidyltransferase, TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 6 ? 
R  N N 6 ? 
S  N N 6 ? 
T  N N 7 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 7 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 7 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   LYS I 24   ? THR I 36   ? LYS A 24   THR A 36   1 ? 13 
HELX_P HELX_P2   2   GLY I 52   ? THR I 61   ? GLY A 52   THR A 61   1 ? 10 
HELX_P HELX_P3   3   ASP I 102  ? GLU I 119  ? ASP A 102  GLU A 119  1 ? 18 
HELX_P HELX_P4   4   ASP I 128  ? HIS I 135  ? ASP A 128  HIS A 135  1 ? 8  
HELX_P HELX_P5   5   ALA I 148  ? GLN I 156  ? ALA A 148  GLN A 156  1 ? 9  
HELX_P HELX_P6   6   ARG I 158  ? PHE I 173  ? ARG A 158  PHE A 173  1 ? 16 
HELX_P HELX_P7   7   LEU I 186  ? TYR I 203  ? LEU A 186  TYR A 203  1 ? 18 
HELX_P HELX_P8   8   ARG I 217  ? GLU I 219  ? ARG A 217  GLU A 219  5 ? 3  
HELX_P HELX_P9   9   ASP I 220  ? LYS I 233  ? ASP A 220  LYS A 233  1 ? 14 
HELX_P HELX_P10  10  THR I 253  ? LEU I 261  ? THR A 253  LEU A 261  1 ? 9  
HELX_P HELX_P11  11  ASP I 268  ? MET I 280  ? ASP A 268  MET A 280  1 ? 13 
HELX_P HELX_P12  12  THR I 305  ? TYR I 322  ? THR A 305  TYR A 322  1 ? 18 
HELX_P HELX_P13  13  THR I 327  ? LEU I 338  ? THR A 327  LEU A 338  1 ? 12 
HELX_P HELX_P14  14  GLU I 347  ? VAL I 357  ? GLU A 347  VAL A 357  1 ? 11 
HELX_P HELX_P15  15  GLU I 358  ? LYS I 367  ? GLU A 358  LYS A 367  1 ? 10 
HELX_P HELX_P16  16  THR I 379  ? GLY I 398  ? THR A 379  GLY A 398  1 ? 20 
HELX_P HELX_P17  17  PHE I 399  ? GLY I 415  ? PHE A 399  GLY A 415  1 ? 17 
HELX_P HELX_P18  18  ARG I 424  ? GLY I 429  ? ARG A 424  GLY A 429  5 ? 6  
HELX_P HELX_P19  19  SER I 430  ? GLY I 437  ? SER A 430  GLY A 437  1 ? 8  
HELX_P HELX_P20  20  LEU I 449  ? LEU I 454  ? LEU A 449  LEU A 454  1 ? 6  
HELX_P HELX_P21  21  GLU I 472  ? GLY I 485  ? GLU A 472  GLY A 485  1 ? 14 
HELX_P HELX_P22  22  SER I 500  ? ASP I 506  ? SER A 500  ASP A 506  1 ? 7  
HELX_P HELX_P23  23  HIS I 515  ? LYS I 523  ? HIS A 515  LYS A 523  1 ? 9  
HELX_P HELX_P24  24  ARG I 546  ? ASP I 552  ? ARG A 546  ASP A 552  1 ? 7  
HELX_P HELX_P25  25  GLU I 553  ? LEU I 565  ? GLU A 553  LEU A 565  1 ? 13 
HELX_P HELX_P26  26  PRO I 585  ? VAL I 590  ? PRO A 585  VAL A 590  1 ? 6  
HELX_P HELX_P27  27  ASP I 605  ? LEU I 612  ? ASP A 605  LEU A 612  1 ? 8  
HELX_P HELX_P28  28  ARG I 623  ? GLY I 640  ? ARG A 623  GLY A 640  1 ? 18 
HELX_P HELX_P29  29  ASP I 644  ? LEU I 648  ? ASP A 644  LEU A 648  5 ? 5  
HELX_P HELX_P30  30  ASP I 652  ? ARG I 661  ? ASP A 652  ARG A 661  1 ? 10 
HELX_P HELX_P31  31  SER I 672  ? LYS I 683  ? SER A 672  LYS A 683  1 ? 12 
HELX_P HELX_P32  32  ARG I 686  ? TYR I 697  ? ARG A 686  TYR A 697  1 ? 12 
HELX_P HELX_P33  33  GLY I 700  ? GLU I 703  ? GLY A 700  GLU A 703  5 ? 4  
HELX_P HELX_P34  34  HIS I 704  ? GLY I 714  ? HIS A 704  GLY A 714  1 ? 11 
HELX_P HELX_P35  35  ALA I 726  ? ASP I 735  ? ALA A 726  ASP A 735  1 ? 10 
HELX_P HELX_P36  36  TYR I 743  ? ALA I 755  ? TYR A 743  ALA A 755  1 ? 13 
HELX_P HELX_P37  37  SER I 758  ? LYS I 772  ? SER A 758  LYS A 772  1 ? 15 
HELX_P HELX_P38  38  GLU I 775  ? GLY I 792  ? GLU A 775  GLY A 792  1 ? 18 
HELX_P HELX_P39  39  GLU I 796  ? ALA I 809  ? GLU A 796  ALA A 809  1 ? 14 
HELX_P HELX_P40  40  ASN I 810  ? GLY I 812  ? ASN A 810  GLY A 812  5 ? 3  
HELX_P HELX_P41  41  ASN I 814  ? TYR I 835  ? ASN A 814  TYR A 835  1 ? 22 
HELX_P HELX_P42  42  TYR I 835  ? GLU I 847  ? TYR A 835  GLU A 847  1 ? 13 
HELX_P HELX_P43  43  ASP I 850  ? ALA I 863  ? ASP A 850  ALA A 863  1 ? 14 
HELX_P HELX_P44  44  GLY I 890  ? VAL I 894  ? GLY A 890  VAL A 894  5 ? 5  
HELX_P HELX_P45  45  GLY I 898  ? GLY I 912  ? GLY A 898  GLY A 912  1 ? 15 
HELX_P HELX_P46  46  SER I 917  ? ARG I 924  ? SER A 917  ARG A 924  1 ? 8  
HELX_P HELX_P47  47  ASN I 931  ? ALA I 941  ? ASN A 931  ALA A 941  1 ? 11 
HELX_P HELX_P48  48  LEU I 944  ? GLY I 948  ? LEU A 944  GLY A 948  5 ? 5  
HELX_P HELX_P49  49  ASP I 949  ? SER I 956  ? ASP A 949  SER A 956  1 ? 8  
HELX_P HELX_P50  50  SER I 956  ? SER I 973  ? SER A 956  SER A 973  1 ? 18 
HELX_P HELX_P51  51  ASP I 994  ? GLY I 1007 ? ASP A 994  GLY A 1007 1 ? 14 
HELX_P HELX_P52  52  HIS I 1013 ? ARG I 1017 ? HIS A 1013 ARG A 1017 5 ? 5  
HELX_P HELX_P53  53  TYR I 1018 ? ALA I 1025 ? TYR A 1018 ALA A 1025 1 ? 8  
HELX_P HELX_P54  54  GLU I 1031 ? ARG I 1037 ? GLU A 1031 ARG A 1037 1 ? 7  
HELX_P HELX_P55  55  LEU I 1121 ? LEU I 1125 ? LEU A 1121 LEU A 1125 1 ? 5  
HELX_P HELX_P56  56  VAL I 1145 ? GLU I 1154 ? VAL A 1145 GLU A 1154 1 ? 10 
HELX_P HELX_P57  57  GLU I 1184 ? GLU I 1190 ? GLU A 1184 GLU A 1190 1 ? 7  
HELX_P HELX_P58  58  PRO I 1213 ? VAL I 1218 ? PRO A 1213 VAL A 1218 1 ? 6  
HELX_P HELX_P59  59  LYS J 24   ? THR J 36   ? LYS B 24   THR B 36   1 ? 13 
HELX_P HELX_P60  60  GLY J 52   ? MET J 63   ? GLY B 52   MET B 63   1 ? 12 
HELX_P HELX_P61  61  ASP J 102  ? GLU J 119  ? ASP B 102  GLU B 119  1 ? 18 
HELX_P HELX_P62  62  ASP J 128  ? HIS J 135  ? ASP B 128  HIS B 135  1 ? 8  
HELX_P HELX_P63  63  ALA J 148  ? GLN J 156  ? ALA B 148  GLN B 156  1 ? 9  
HELX_P HELX_P64  64  ARG J 158  ? GLY J 174  ? ARG B 158  GLY B 174  1 ? 17 
HELX_P HELX_P65  65  PRO J 187  ? TYR J 203  ? PRO B 187  TYR B 203  1 ? 17 
HELX_P HELX_P66  66  ARG J 217  ? GLU J 219  ? ARG B 217  GLU B 219  5 ? 3  
HELX_P HELX_P67  67  ASP J 220  ? SER J 232  ? ASP B 220  SER B 232  1 ? 13 
HELX_P HELX_P68  68  THR J 253  ? LEU J 261  ? THR B 253  LEU B 261  1 ? 9  
HELX_P HELX_P69  69  ASP J 268  ? CYS J 281  ? ASP B 268  CYS B 281  1 ? 14 
HELX_P HELX_P70  70  THR J 305  ? TYR J 322  ? THR B 305  TYR B 322  1 ? 18 
HELX_P HELX_P71  71  THR J 327  ? LEU J 337  ? THR B 327  LEU B 337  1 ? 11 
HELX_P HELX_P72  72  GLU J 347  ? ALA J 355  ? GLU B 347  ALA B 355  1 ? 9  
HELX_P HELX_P73  73  GLU J 358  ? LEU J 365  ? GLU B 358  LEU B 365  1 ? 8  
HELX_P HELX_P74  74  THR J 379  ? GLY J 398  ? THR B 379  GLY B 398  1 ? 20 
HELX_P HELX_P75  75  PHE J 399  ? HIS J 416  ? PHE B 399  HIS B 416  1 ? 18 
HELX_P HELX_P76  76  ARG J 424  ? GLY J 429  ? ARG B 424  GLY B 429  5 ? 6  
HELX_P HELX_P77  77  SER J 430  ? GLY J 437  ? SER B 430  GLY B 437  1 ? 8  
HELX_P HELX_P78  78  LEU J 449  ? LEU J 454  ? LEU B 449  LEU B 454  1 ? 6  
HELX_P HELX_P79  79  GLU J 472  ? TYR J 484  ? GLU B 472  TYR B 484  1 ? 13 
HELX_P HELX_P80  80  SER J 500  ? VAL J 510  ? SER B 500  VAL B 510  1 ? 11 
HELX_P HELX_P81  81  LYS J 517  ? LYS J 523  ? LYS B 517  LYS B 523  1 ? 7  
HELX_P HELX_P82  82  LEU J 545  ? MET J 549  ? LEU B 545  MET B 549  5 ? 5  
HELX_P HELX_P83  83  ASP J 552  ? LEU J 565  ? ASP B 552  LEU B 565  1 ? 14 
HELX_P HELX_P84  84  PRO J 585  ? LEU J 589  ? PRO B 585  LEU B 589  5 ? 5  
HELX_P HELX_P85  85  ASP J 605  ? LEU J 612  ? ASP B 605  LEU B 612  1 ? 8  
HELX_P HELX_P86  86  ARG J 623  ? GLY J 640  ? ARG B 623  GLY B 640  1 ? 18 
HELX_P HELX_P87  87  ASP J 644  ? LEU J 648  ? ASP B 644  LEU B 648  5 ? 5  
HELX_P HELX_P88  88  ASP J 652  ? ARG J 661  ? ASP B 652  ARG B 661  1 ? 10 
HELX_P HELX_P89  89  SER J 672  ? LYS J 683  ? SER B 672  LYS B 683  1 ? 12 
HELX_P HELX_P90  90  ARG J 686  ? TYR J 697  ? ARG B 686  TYR B 697  1 ? 12 
HELX_P HELX_P91  91  GLY J 700  ? MET J 702  ? GLY B 700  MET B 702  5 ? 3  
HELX_P HELX_P92  92  GLU J 703  ? GLY J 714  ? GLU B 703  GLY B 714  1 ? 12 
HELX_P HELX_P93  93  ALA J 726  ? ASP J 735  ? ALA B 726  ASP B 735  1 ? 10 
HELX_P HELX_P94  94  GLU J 736  ? TYR J 738  ? GLU B 736  TYR B 738  5 ? 3  
HELX_P HELX_P95  95  TYR J 743  ? ALA J 755  ? TYR B 743  ALA B 755  1 ? 13 
HELX_P HELX_P96  96  SER J 758  ? LYS J 772  ? SER B 758  LYS B 772  1 ? 15 
HELX_P HELX_P97  97  MET J 777  ? GLY J 792  ? MET B 777  GLY B 792  1 ? 16 
HELX_P HELX_P98  98  GLU J 796  ? ASN J 810  ? GLU B 796  ASN B 810  1 ? 15 
HELX_P HELX_P99  99  ASN J 814  ? TYR J 835  ? ASN B 814  TYR B 835  1 ? 22 
HELX_P HELX_P100 100 TYR J 835  ? GLU J 847  ? TYR B 835  GLU B 847  1 ? 13 
HELX_P HELX_P101 101 ASP J 850  ? ALA J 863  ? ASP B 850  ALA B 863  1 ? 14 
HELX_P HELX_P102 102 GLY J 898  ? GLY J 912  ? GLY B 898  GLY B 912  1 ? 15 
HELX_P HELX_P103 103 SER J 917  ? LEU J 925  ? SER B 917  LEU B 925  1 ? 9  
HELX_P HELX_P104 104 ASN J 931  ? GLY J 942  ? ASN B 931  GLY B 942  1 ? 12 
HELX_P HELX_P105 105 ASP J 949  ? SER J 956  ? ASP B 949  SER B 956  1 ? 8  
HELX_P HELX_P106 106 SER J 956  ? ARG J 972  ? SER B 956  ARG B 972  1 ? 17 
HELX_P HELX_P107 107 ASP J 994  ? LEU J 1006 ? ASP B 994  LEU B 1006 1 ? 13 
HELX_P HELX_P108 108 PRO J 1014 ? ARG J 1017 ? PRO B 1014 ARG B 1017 5 ? 4  
HELX_P HELX_P109 109 TYR J 1018 ? ALA J 1025 ? TYR B 1018 ALA B 1025 1 ? 8  
HELX_P HELX_P110 110 GLU J 1030 ? ARG J 1037 ? GLU B 1030 ARG B 1037 1 ? 8  
HELX_P HELX_P111 111 LEU J 1121 ? ALA J 1127 ? LEU B 1121 ALA B 1127 1 ? 7  
HELX_P HELX_P112 112 VAL J 1145 ? GLU J 1154 ? VAL B 1145 GLU B 1154 1 ? 10 
HELX_P HELX_P113 113 GLU J 1184 ? ALA J 1191 ? GLU B 1184 ALA B 1191 1 ? 8  
HELX_P HELX_P114 114 LYS K 24   ? THR K 36   ? LYS C 24   THR C 36   1 ? 13 
HELX_P HELX_P115 115 GLY K 52   ? GLY K 64   ? GLY C 52   GLY C 64   1 ? 13 
HELX_P HELX_P116 116 ASP K 102  ? GLU K 119  ? ASP C 102  GLU C 119  1 ? 18 
HELX_P HELX_P117 117 ASP K 128  ? HIS K 135  ? ASP C 128  HIS C 135  1 ? 8  
HELX_P HELX_P118 118 ALA K 148  ? GLN K 156  ? ALA C 148  GLN C 156  1 ? 9  
HELX_P HELX_P119 119 ARG K 158  ? PHE K 173  ? ARG C 158  PHE C 173  1 ? 16 
HELX_P HELX_P120 120 LEU K 186  ? GLY K 204  ? LEU C 186  GLY C 204  1 ? 19 
HELX_P HELX_P121 121 ARG K 217  ? GLU K 219  ? ARG C 217  GLU C 219  5 ? 3  
HELX_P HELX_P122 122 ASP K 220  ? LYS K 233  ? ASP C 220  LYS C 233  1 ? 14 
HELX_P HELX_P123 123 THR K 253  ? LEU K 261  ? THR C 253  LEU C 261  1 ? 9  
HELX_P HELX_P124 124 PRO K 262  ? GLY K 267  ? PRO C 262  GLY C 267  1 ? 6  
HELX_P HELX_P125 125 ASP K 268  ? CYS K 281  ? ASP C 268  CYS C 281  1 ? 14 
HELX_P HELX_P126 126 THR K 305  ? TYR K 322  ? THR C 305  TYR C 322  1 ? 18 
HELX_P HELX_P127 127 THR K 327  ? LEU K 338  ? THR C 327  LEU C 338  1 ? 12 
HELX_P HELX_P128 128 GLU K 347  ? VAL K 357  ? GLU C 347  VAL C 357  1 ? 11 
HELX_P HELX_P129 129 GLU K 358  ? LYS K 367  ? GLU C 358  LYS C 367  1 ? 10 
HELX_P HELX_P130 130 THR K 379  ? GLY K 398  ? THR C 379  GLY C 398  1 ? 20 
HELX_P HELX_P131 131 PHE K 399  ? HIS K 416  ? PHE C 399  HIS C 416  1 ? 18 
HELX_P HELX_P132 132 ARG K 424  ? GLY K 429  ? ARG C 424  GLY C 429  5 ? 6  
HELX_P HELX_P133 133 SER K 430  ? GLY K 437  ? SER C 430  GLY C 437  1 ? 8  
HELX_P HELX_P134 134 LEU K 449  ? LEU K 454  ? LEU C 449  LEU C 454  1 ? 6  
HELX_P HELX_P135 135 GLU K 472  ? GLY K 485  ? GLU C 472  GLY C 485  1 ? 14 
HELX_P HELX_P136 136 SER K 500  ? GLY K 512  ? SER C 500  GLY C 512  1 ? 13 
HELX_P HELX_P137 137 PRO K 514  ? LEU K 524  ? PRO C 514  LEU C 524  1 ? 11 
HELX_P HELX_P138 138 ASP K 552  ? ARG K 564  ? ASP C 552  ARG C 564  1 ? 13 
HELX_P HELX_P139 139 PRO K 585  ? LEU K 589  ? PRO C 585  LEU C 589  5 ? 5  
HELX_P HELX_P140 140 ASP K 605  ? LEU K 612  ? ASP C 605  LEU C 612  1 ? 8  
HELX_P HELX_P141 141 ARG K 623  ? GLY K 640  ? ARG C 623  GLY C 640  1 ? 18 
HELX_P HELX_P142 142 ASP K 644  ? LEU K 648  ? ASP C 644  LEU C 648  5 ? 5  
HELX_P HELX_P143 143 ASP K 652  ? ARG K 661  ? ASP C 652  ARG C 661  1 ? 10 
HELX_P HELX_P144 144 SER K 672  ? LYS K 683  ? SER C 672  LYS C 683  1 ? 12 
HELX_P HELX_P145 145 ARG K 686  ? TYR K 697  ? ARG C 686  TYR C 697  1 ? 12 
HELX_P HELX_P146 146 GLY K 700  ? GLU K 703  ? GLY C 700  GLU C 703  5 ? 4  
HELX_P HELX_P147 147 HIS K 704  ? GLY K 714  ? HIS C 704  GLY C 714  1 ? 11 
HELX_P HELX_P148 148 ALA K 726  ? ASP K 735  ? ALA C 726  ASP C 735  1 ? 10 
HELX_P HELX_P149 149 TYR K 743  ? ALA K 755  ? TYR C 743  ALA C 755  1 ? 13 
HELX_P HELX_P150 150 SER K 758  ? LYS K 772  ? SER C 758  LYS C 772  1 ? 15 
HELX_P HELX_P151 151 GLU K 776  ? GLU K 790  ? GLU C 776  GLU C 790  1 ? 15 
HELX_P HELX_P152 152 GLU K 795  ? TYR K 811  ? GLU C 795  TYR C 811  1 ? 17 
HELX_P HELX_P153 153 ASN K 814  ? TYR K 835  ? ASN C 814  TYR C 835  1 ? 22 
HELX_P HELX_P154 154 TYR K 835  ? GLU K 847  ? TYR C 835  GLU C 847  1 ? 13 
HELX_P HELX_P155 155 ASP K 850  ? ALA K 863  ? ASP C 850  ALA C 863  1 ? 14 
HELX_P HELX_P156 156 GLY K 890  ? VAL K 894  ? GLY C 890  VAL C 894  5 ? 5  
HELX_P HELX_P157 157 GLY K 898  ? GLY K 912  ? GLY C 898  GLY C 912  1 ? 15 
HELX_P HELX_P158 158 SER K 917  ? LEU K 925  ? SER C 917  LEU C 925  1 ? 9  
HELX_P HELX_P159 159 ASN K 931  ? ALA K 941  ? ASN C 931  ALA C 941  1 ? 11 
HELX_P HELX_P160 160 ASP K 949  ? SER K 956  ? ASP C 949  SER C 956  1 ? 8  
HELX_P HELX_P161 161 SER K 956  ? SER K 973  ? SER C 956  SER C 973  1 ? 18 
HELX_P HELX_P162 162 ASP K 994  ? GLY K 1007 ? ASP C 994  GLY C 1007 1 ? 14 
HELX_P HELX_P163 163 PRO K 1019 ? ALA K 1025 ? PRO C 1019 ALA C 1025 1 ? 7  
HELX_P HELX_P164 164 GLU K 1030 ? ARG K 1037 ? GLU C 1030 ARG C 1037 1 ? 8  
HELX_P HELX_P165 165 PHE K 1082 ? GLU K 1087 ? PHE C 1082 GLU C 1087 5 ? 6  
HELX_P HELX_P166 166 LEU K 1121 ? LEU K 1125 ? LEU C 1121 LEU C 1125 1 ? 5  
HELX_P HELX_P167 167 LEU K 1140 ? GLU K 1154 ? LEU C 1140 GLU C 1154 1 ? 15 
HELX_P HELX_P168 168 GLU K 1184 ? GLU K 1190 ? GLU C 1184 GLU C 1190 1 ? 7  
HELX_P HELX_P169 169 PRO K 1213 ? VAL K 1218 ? PRO C 1213 VAL C 1218 1 ? 6  
HELX_P HELX_P170 170 LYS L 24   ? THR L 36   ? LYS D 24   THR D 36   1 ? 13 
HELX_P HELX_P171 171 GLY L 52   ? GLY L 64   ? GLY D 52   GLY D 64   1 ? 13 
HELX_P HELX_P172 172 ASP L 102  ? GLU L 119  ? ASP D 102  GLU D 119  1 ? 18 
HELX_P HELX_P173 173 ASP L 128  ? HIS L 135  ? ASP D 128  HIS D 135  1 ? 8  
HELX_P HELX_P174 174 ALA L 148  ? GLN L 156  ? ALA D 148  GLN D 156  1 ? 9  
HELX_P HELX_P175 175 ARG L 158  ? GLY L 174  ? ARG D 158  GLY D 174  1 ? 17 
HELX_P HELX_P176 176 LEU L 186  ? GLY L 204  ? LEU D 186  GLY D 204  1 ? 19 
HELX_P HELX_P177 177 ARG L 217  ? GLU L 219  ? ARG D 217  GLU D 219  5 ? 3  
HELX_P HELX_P178 178 ASP L 220  ? LYS L 233  ? ASP D 220  LYS D 233  1 ? 14 
HELX_P HELX_P179 179 THR L 253  ? LEU L 261  ? THR D 253  LEU D 261  1 ? 9  
HELX_P HELX_P180 180 ASP L 268  ? MET L 280  ? ASP D 268  MET D 280  1 ? 13 
HELX_P HELX_P181 181 THR L 305  ? TYR L 322  ? THR D 305  TYR D 322  1 ? 18 
HELX_P HELX_P182 182 THR L 327  ? LEU L 338  ? THR D 327  LEU D 338  1 ? 12 
HELX_P HELX_P183 183 GLU L 347  ? VAL L 357  ? GLU D 347  VAL D 357  1 ? 11 
HELX_P HELX_P184 184 GLU L 358  ? GLU L 363  ? GLU D 358  GLU D 363  1 ? 6  
HELX_P HELX_P185 185 THR L 379  ? GLY L 398  ? THR D 379  GLY D 398  1 ? 20 
HELX_P HELX_P186 186 PHE L 399  ? HIS L 416  ? PHE D 399  HIS D 416  1 ? 18 
HELX_P HELX_P187 187 ARG L 424  ? GLY L 429  ? ARG D 424  GLY D 429  5 ? 6  
HELX_P HELX_P188 188 SER L 430  ? GLY L 437  ? SER D 430  GLY D 437  1 ? 8  
HELX_P HELX_P189 189 GLU L 472  ? GLY L 485  ? GLU D 472  GLY D 485  1 ? 14 
HELX_P HELX_P190 190 ALA L 499  ? GLY L 512  ? ALA D 499  GLY D 512  1 ? 14 
HELX_P HELX_P191 191 PRO L 514  ? LEU L 524  ? PRO D 514  LEU D 524  1 ? 11 
HELX_P HELX_P192 192 PRO L 534  ? VAL L 541  ? PRO D 534  VAL D 541  1 ? 8  
HELX_P HELX_P193 193 ALA L 547  ? ASP L 552  ? ALA D 547  ASP D 552  1 ? 6  
HELX_P HELX_P194 194 ASP L 552  ? ARG L 564  ? ASP D 552  ARG D 564  1 ? 13 
HELX_P HELX_P195 195 PRO L 585  ? VAL L 590  ? PRO D 585  VAL D 590  1 ? 6  
HELX_P HELX_P196 196 ASP L 605  ? ALA L 611  ? ASP D 605  ALA D 611  1 ? 7  
HELX_P HELX_P197 197 ARG L 623  ? GLY L 640  ? ARG D 623  GLY D 640  1 ? 18 
HELX_P HELX_P198 198 ASP L 644  ? LEU L 648  ? ASP D 644  LEU D 648  5 ? 5  
HELX_P HELX_P199 199 ASP L 652  ? ARG L 661  ? ASP D 652  ARG D 661  1 ? 10 
HELX_P HELX_P200 200 SER L 672  ? LYS L 683  ? SER D 672  LYS D 683  1 ? 12 
HELX_P HELX_P201 201 ARG L 686  ? TYR L 697  ? ARG D 686  TYR D 697  1 ? 12 
HELX_P HELX_P202 202 GLY L 700  ? GLU L 703  ? GLY D 700  GLU D 703  5 ? 4  
HELX_P HELX_P203 203 HIS L 704  ? HIS L 713  ? HIS D 704  HIS D 713  1 ? 10 
HELX_P HELX_P204 204 ALA L 726  ? ASP L 735  ? ALA D 726  ASP D 735  1 ? 10 
HELX_P HELX_P205 205 GLU L 736  ? TYR L 738  ? GLU D 736  TYR D 738  5 ? 3  
HELX_P HELX_P206 206 TYR L 743  ? ALA L 755  ? TYR D 743  ALA D 755  1 ? 13 
HELX_P HELX_P207 207 SER L 758  ? LYS L 772  ? SER D 758  LYS D 772  1 ? 15 
HELX_P HELX_P208 208 GLU L 776  ? GLY L 792  ? GLU D 776  GLY D 792  1 ? 17 
HELX_P HELX_P209 209 GLU L 796  ? ASN L 810  ? GLU D 796  ASN D 810  1 ? 15 
HELX_P HELX_P210 210 ASN L 814  ? TYR L 835  ? ASN D 814  TYR D 835  1 ? 22 
HELX_P HELX_P211 211 TYR L 835  ? GLU L 847  ? TYR D 835  GLU D 847  1 ? 13 
HELX_P HELX_P212 212 ASP L 850  ? ALA L 863  ? ASP D 850  ALA D 863  1 ? 14 
HELX_P HELX_P213 213 GLY L 890  ? VAL L 894  ? GLY D 890  VAL D 894  5 ? 5  
HELX_P HELX_P214 214 GLY L 898  ? GLY L 912  ? GLY D 898  GLY D 912  1 ? 15 
HELX_P HELX_P215 215 SER L 917  ? LEU L 925  ? SER D 917  LEU D 925  1 ? 9  
HELX_P HELX_P216 216 ASN L 931  ? ALA L 941  ? ASN D 931  ALA D 941  1 ? 11 
HELX_P HELX_P217 217 ASP L 949  ? SER L 956  ? ASP D 949  SER D 956  1 ? 8  
HELX_P HELX_P218 218 SER L 956  ? ARG L 972  ? SER D 956  ARG D 972  1 ? 17 
HELX_P HELX_P219 219 ASP L 994  ? GLY L 1007 ? ASP D 994  GLY D 1007 1 ? 14 
HELX_P HELX_P220 220 HIS L 1013 ? TYR L 1018 ? HIS D 1013 TYR D 1018 5 ? 6  
HELX_P HELX_P221 221 PRO L 1019 ? ALA L 1025 ? PRO D 1019 ALA D 1025 1 ? 7  
HELX_P HELX_P222 222 GLU L 1030 ? ARG L 1037 ? GLU D 1030 ARG D 1037 1 ? 8  
HELX_P HELX_P223 223 PHE L 1082 ? TYR L 1086 ? PHE D 1082 TYR D 1086 5 ? 5  
HELX_P HELX_P224 224 THR L 1120 ? ALA L 1127 ? THR D 1120 ALA D 1127 1 ? 8  
HELX_P HELX_P225 225 VAL L 1145 ? GLU L 1154 ? VAL D 1145 GLU D 1154 1 ? 10 
HELX_P HELX_P226 226 GLU L 1184 ? GLU L 1190 ? GLU D 1184 GLU D 1190 1 ? 7  
HELX_P HELX_P227 227 GLY L 1212 ? VAL L 1217 ? GLY D 1212 VAL D 1217 1 ? 6  
HELX_P HELX_P228 228 HIS M 2    ? HIS M 6    ? HIS M 368  HIS M 372  1 ? 5  
HELX_P HELX_P229 229 GLY M 9    ? LEU M 14   ? GLY M 375  LEU M 380  1 ? 6  
HELX_P HELX_P230 230 GLU M 35   ? GLY M 42   ? GLU M 401  GLY M 408  1 ? 8  
HELX_P HELX_P231 231 LEU M 47   ? HIS M 57   ? LEU M 413  HIS M 423  1 ? 11 
HELX_P HELX_P232 232 LEU M 68   ? ALA M 73   ? LEU M 434  ALA M 439  1 ? 6  
HELX_P HELX_P233 233 LEU M 144  ? TRP M 151  ? LEU M 510  TRP M 517  1 ? 8  
HELX_P HELX_P234 234 SER M 165  ? MET M 175  ? SER M 531  MET M 541  1 ? 11 
HELX_P HELX_P235 235 HIS N 2    ? LYS N 7    ? HIS N 368  LYS N 373  1 ? 6  
HELX_P HELX_P236 236 GLU N 10   ? ARG N 19   ? GLU N 376  ARG N 385  1 ? 10 
HELX_P HELX_P237 237 GLU N 35   ? GLY N 42   ? GLU N 401  GLY N 408  1 ? 8  
HELX_P HELX_P238 238 PHE N 49   ? HIS N 57   ? PHE N 415  HIS N 423  1 ? 9  
HELX_P HELX_P239 239 LEU N 68   ? ALA N 73   ? LEU N 434  ALA N 439  1 ? 6  
HELX_P HELX_P240 240 LEU N 144  ? LEU N 150  ? LEU N 510  LEU N 516  1 ? 7  
HELX_P HELX_P241 241 SER N 165  ? MET N 175  ? SER N 531  MET N 541  1 ? 11 
HELX_P HELX_P242 242 HIS O 2    ? HIS O 6    ? HIS O 368  HIS O 372  1 ? 5  
HELX_P HELX_P243 243 ALA O 11   ? ALA O 15   ? ALA O 377  ALA O 381  5 ? 5  
HELX_P HELX_P244 244 GLU O 35   ? GLY O 42   ? GLU O 401  GLY O 408  1 ? 8  
HELX_P HELX_P245 245 LEU O 47   ? HIS O 57   ? LEU O 413  HIS O 423  1 ? 11 
HELX_P HELX_P246 246 LEU O 68   ? ALA O 73   ? LEU O 434  ALA O 439  1 ? 6  
HELX_P HELX_P247 247 LEU O 144  ? LEU O 150  ? LEU O 510  LEU O 516  1 ? 7  
HELX_P HELX_P248 248 SER O 165  ? ASN O 172  ? SER O 531  ASN O 538  1 ? 8  
HELX_P HELX_P249 249 HIS P 2    ? HIS P 6    ? HIS P 368  HIS P 372  1 ? 5  
HELX_P HELX_P250 250 GLU P 35   ? GLY P 42   ? GLU P 401  GLY P 408  1 ? 8  
HELX_P HELX_P251 251 LEU P 47   ? HIS P 57   ? LEU P 413  HIS P 423  1 ? 11 
HELX_P HELX_P252 252 LEU P 68   ? ALA P 73   ? LEU P 434  ALA P 439  1 ? 6  
HELX_P HELX_P253 253 LEU P 144  ? VAL P 152  ? LEU P 510  VAL P 518  1 ? 9  
HELX_P HELX_P254 254 SER P 165  ? MET P 175  ? SER P 531  MET P 541  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1   covale both ? E DA  20  "O3'" ? ? ? 1_555 E  DOC 21 P  ? ? I DA  20  I DOC 21   1_555 ? ? ? ? ? ? ?               1.624 
? ? 
metalc1   metalc ?    ? I HIS 11  NE2   ? ? ? 1_555 S  ZN  .  ZN ? ? A HIS 11  A ZN  1303 1_555 ? ? ? ? ? ? ?               2.096 
? ? 
metalc2   metalc ?    ? I HIS 13  NE2   ? ? ? 1_555 S  ZN  .  ZN ? ? A HIS 13  A ZN  1303 1_555 ? ? ? ? ? ? ?               2.173 
? ? 
metalc3   metalc ?    ? I HIS 47  NE2   ? ? ? 1_555 R  ZN  .  ZN ? ? A HIS 47  A ZN  1302 1_555 ? ? ? ? ? ? ?               1.891 
? ? 
metalc4   metalc ?    ? I GLU 72  OE2   ? ? ? 1_555 Q  ZN  .  ZN ? ? A GLU 72  A ZN  1301 1_555 ? ? ? ? ? ? ?               1.866 
? ? 
metalc5   metalc ?    ? I GLU 72  OE1   ? ? ? 1_555 S  ZN  .  ZN ? ? A GLU 72  A ZN  1303 1_555 ? ? ? ? ? ? ?               1.945 
? ? 
metalc6   metalc ?    ? I HIS 95  ND1   ? ? ? 1_555 Q  ZN  .  ZN ? ? A HIS 95  A ZN  1301 1_555 ? ? ? ? ? ? ?               2.412 
? ? 
metalc7   metalc ?    ? I CYS 145 SG    ? ? ? 1_555 Q  ZN  .  ZN ? ? A CYS 145 A ZN  1301 1_555 ? ? ? ? ? ? ?               2.485 
? ? 
metalc8   metalc ?    ? I ASP 212 OD1   ? ? ? 1_555 S  ZN  .  ZN ? ? A ASP 212 A ZN  1303 1_555 ? ? ? ? ? ? ?               1.948 
? ? 
metalc9   metalc ?    ? I HIS 214 NE2   ? ? ? 1_555 R  ZN  .  ZN ? ? A HIS 214 A ZN  1302 1_555 ? ? ? ? ? ? ?               1.904 
? ? 
metalc10  metalc ?    ? I ASP 463 OD1   ? ? ? 1_555 T  MG  .  MG ? ? A ASP 463 A MG  1304 1_555 ? ? ? ? ? ? ?               1.778 
? ? 
metalc11  metalc ?    ? I ASP 463 OD2   ? ? ? 1_555 T  MG  .  MG ? ? A ASP 463 A MG  1304 1_555 ? ? ? ? ? ? ?               2.711 
? ? 
metalc12  metalc ?    ? I ASP 465 OD1   ? ? ? 1_555 T  MG  .  MG ? ? A ASP 465 A MG  1304 1_555 ? ? ? ? ? ? ?               2.354 
? ? 
metalc13  metalc ?    ? I ASP 618 OD2   ? ? ? 1_555 T  MG  .  MG ? ? A ASP 618 A MG  1304 1_555 ? ? ? ? ? ? ?               1.822 
? ? 
metalc14  metalc ?    ? J HIS 11  NE2   ? ? ? 1_555 W  ZN  .  ZN ? ? B HIS 11  B ZN  1303 1_555 ? ? ? ? ? ? ?               2.302 
? ? 
metalc15  metalc ?    ? J HIS 13  NE2   ? ? ? 1_555 W  ZN  .  ZN ? ? B HIS 13  B ZN  1303 1_555 ? ? ? ? ? ? ?               2.113 
? ? 
metalc16  metalc ?    ? J ASP 20  OD2   ? ? ? 1_555 V  ZN  .  ZN ? ? B ASP 20  B ZN  1302 1_555 ? ? ? ? ? ? ?               1.701 
? ? 
metalc17  metalc ?    ? J HIS 47  NE2   ? ? ? 1_555 V  ZN  .  ZN ? ? B HIS 47  B ZN  1302 1_555 ? ? ? ? ? ? ?               2.011 
? ? 
metalc18  metalc ?    ? J GLU 72  OE2   ? ? ? 1_555 U  ZN  .  ZN ? ? B GLU 72  B ZN  1301 1_555 ? ? ? ? ? ? ?               1.903 
? ? 
metalc19  metalc ?    ? J GLU 72  OE1   ? ? ? 1_555 W  ZN  .  ZN ? ? B GLU 72  B ZN  1303 1_555 ? ? ? ? ? ? ?               2.172 
? ? 
metalc20  metalc ?    ? J HIS 95  ND1   ? ? ? 1_555 U  ZN  .  ZN ? ? B HIS 95  B ZN  1301 1_555 ? ? ? ? ? ? ?               2.438 
? ? 
metalc21  metalc ?    ? J CYS 145 SG    ? ? ? 1_555 U  ZN  .  ZN ? ? B CYS 145 B ZN  1301 1_555 ? ? ? ? ? ? ?               2.700 
? ? 
metalc22  metalc ?    ? J ASP 212 OD2   ? ? ? 1_555 W  ZN  .  ZN ? ? B ASP 212 B ZN  1303 1_555 ? ? ? ? ? ? ?               2.632 
? ? 
metalc23  metalc ?    ? J HIS 214 NE2   ? ? ? 1_555 V  ZN  .  ZN ? ? B HIS 214 B ZN  1302 1_555 ? ? ? ? ? ? ?               2.176 
? ? 
metalc24  metalc ?    ? J ASP 463 OD1   ? ? ? 1_555 X  MG  .  MG ? ? B ASP 463 B MG  1304 1_555 ? ? ? ? ? ? ?               2.614 
? ? 
metalc25  metalc ?    ? J ASP 463 OD2   ? ? ? 1_555 X  MG  .  MG ? ? B ASP 463 B MG  1304 1_555 ? ? ? ? ? ? ?               2.646 
? ? 
metalc26  metalc ?    ? J ASP 465 OD1   ? ? ? 1_555 X  MG  .  MG ? ? B ASP 465 B MG  1304 1_555 ? ? ? ? ? ? ?               2.370 
? ? 
metalc27  metalc ?    ? J ASP 618 OD2   ? ? ? 1_555 X  MG  .  MG ? ? B ASP 618 B MG  1304 1_555 ? ? ? ? ? ? ?               2.571 
? ? 
metalc28  metalc ?    ? K HIS 11  NE2   ? ? ? 1_555 AA ZN  .  ZN ? ? C HIS 11  C ZN  1303 1_555 ? ? ? ? ? ? ?               2.371 
? ? 
metalc29  metalc ?    ? K HIS 13  NE2   ? ? ? 1_555 AA ZN  .  ZN ? ? C HIS 13  C ZN  1303 1_555 ? ? ? ? ? ? ?               1.735 
? ? 
metalc30  metalc ?    ? K HIS 47  NE2   ? ? ? 1_555 Z  ZN  .  ZN ? ? C HIS 47  C ZN  1302 1_555 ? ? ? ? ? ? ?               2.122 
? ? 
metalc31  metalc ?    ? K GLU 72  OE2   ? ? ? 1_555 Y  ZN  .  ZN ? ? C GLU 72  C ZN  1301 1_555 ? ? ? ? ? ? ?               2.080 
? ? 
metalc32  metalc ?    ? K GLU 72  OE1   ? ? ? 1_555 AA ZN  .  ZN ? ? C GLU 72  C ZN  1303 1_555 ? ? ? ? ? ? ?               2.031 
? ? 
metalc33  metalc ?    ? K HIS 95  ND1   ? ? ? 1_555 Y  ZN  .  ZN ? ? C HIS 95  C ZN  1301 1_555 ? ? ? ? ? ? ?               2.438 
? ? 
metalc34  metalc ?    ? K CYS 145 SG    ? ? ? 1_555 Y  ZN  .  ZN ? ? C CYS 145 C ZN  1301 1_555 ? ? ? ? ? ? ?               2.148 
? ? 
metalc35  metalc ?    ? K ASP 212 OD1   ? ? ? 1_555 AA ZN  .  ZN ? ? C ASP 212 C ZN  1303 1_555 ? ? ? ? ? ? ?               2.129 
? ? 
metalc36  metalc ?    ? K ASP 463 OD2   ? ? ? 1_555 BA MG  .  MG ? ? C ASP 463 C MG  1304 1_555 ? ? ? ? ? ? ?               2.032 
? ? 
metalc37  metalc ?    ? K ASP 465 OD1   ? ? ? 1_555 BA MG  .  MG ? ? C ASP 465 C MG  1304 1_555 ? ? ? ? ? ? ?               1.817 
? ? 
metalc38  metalc ?    ? K ASP 465 OD2   ? ? ? 1_555 BA MG  .  MG ? ? C ASP 465 C MG  1304 1_555 ? ? ? ? ? ? ?               2.802 
? ? 
metalc39  metalc ?    ? L HIS 11  NE2   ? ? ? 1_555 EA ZN  .  ZN ? ? D HIS 11  D ZN  1303 1_555 ? ? ? ? ? ? ?               2.080 
? ? 
metalc40  metalc ?    ? L ASP 20  OD2   ? ? ? 1_555 DA ZN  .  ZN ? ? D ASP 20  D ZN  1302 1_555 ? ? ? ? ? ? ?               1.962 
? ? 
metalc41  metalc ?    ? L HIS 47  NE2   ? ? ? 1_555 DA ZN  .  ZN ? ? D HIS 47  D ZN  1302 1_555 ? ? ? ? ? ? ?               2.095 
? ? 
metalc42  metalc ?    ? L GLU 72  OE2   ? ? ? 1_555 CA ZN  .  ZN ? ? D GLU 72  D ZN  1301 1_555 ? ? ? ? ? ? ?               2.081 
? ? 
metalc43  metalc ?    ? L GLU 72  OE1   ? ? ? 1_555 EA ZN  .  ZN ? ? D GLU 72  D ZN  1303 1_555 ? ? ? ? ? ? ?               2.135 
? ? 
metalc44  metalc ?    ? L HIS 95  ND1   ? ? ? 1_555 CA ZN  .  ZN ? ? D HIS 95  D ZN  1301 1_555 ? ? ? ? ? ? ?               2.354 
? ? 
metalc45  metalc ?    ? L CYS 145 SG    ? ? ? 1_555 CA ZN  .  ZN ? ? D CYS 145 D ZN  1301 1_555 ? ? ? ? ? ? ?               2.114 
? ? 
metalc46  metalc ?    ? L ASP 212 OD1   ? ? ? 1_555 EA ZN  .  ZN ? ? D ASP 212 D ZN  1303 1_555 ? ? ? ? ? ? ?               2.038 
? ? 
metalc47  metalc ?    ? L HIS 214 NE2   ? ? ? 1_555 DA ZN  .  ZN ? ? D HIS 214 D ZN  1302 1_555 ? ? ? ? ? ? ?               1.884 
? ? 
metalc48  metalc ?    ? L ASP 463 OD1   ? ? ? 1_555 FA MG  .  MG ? ? D ASP 463 D MG  1304 1_555 ? ? ? ? ? ? ?               2.997 
? ? 
metalc49  metalc ?    ? L ASP 465 OD1   ? ? ? 1_555 FA MG  .  MG ? ? D ASP 465 D MG  1304 1_555 ? ? ? ? ? ? ?               2.119 
? ? 
metalc50  metalc ?    ? L ASP 618 OD2   ? ? ? 1_555 FA MG  .  MG ? ? D ASP 618 D MG  1304 1_555 ? ? ? ? ? ? ?               2.950 
? ? 
hydrog1   hydrog ?    ? A DC  1   N4    ? ? ? 1_555 B  DG  28 N3 ? ? E DC  1   F DG  28   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     
? ? 
hydrog2   hydrog ?    ? A DG  2   O6    ? ? ? 1_555 B  DG  28 N2 ? ? E DG  2   F DG  28   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     
? ? 
hydrog3   hydrog ?    ? A DA  5   N1    ? ? ? 1_555 B  DT  24 N3 ? ? E DA  5   F DT  24   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     
? ? 
hydrog4   hydrog ?    ? A DC  6   N3    ? ? ? 1_555 B  DG  23 N1 ? ? E DC  6   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog5   hydrog ?    ? A DC  6   N4    ? ? ? 1_555 B  DG  23 O6 ? ? E DC  6   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog6   hydrog ?    ? A DC  6   O2    ? ? ? 1_555 B  DG  23 N2 ? ? E DC  6   F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog7   hydrog ?    ? A DG  7   N1    ? ? ? 1_555 B  DC  22 N3 ? ? E DG  7   F DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog8   hydrog ?    ? A DG  7   N2    ? ? ? 1_555 B  DC  22 O2 ? ? E DG  7   F DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog9   hydrog ?    ? A DG  7   O6    ? ? ? 1_555 B  DC  22 N4 ? ? E DG  7   F DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog10  hydrog ?    ? A DA  8   N1    ? ? ? 1_555 B  DT  21 N3 ? ? E DA  8   F DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog11  hydrog ?    ? A DA  8   N6    ? ? ? 1_555 B  DT  21 O4 ? ? E DA  8   F DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog12  hydrog ?    ? A DC  9   N3    ? ? ? 1_555 B  DG  20 N1 ? ? E DC  9   F DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog13  hydrog ?    ? A DC  9   N4    ? ? ? 1_555 B  DG  20 O6 ? ? E DC  9   F DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog14  hydrog ?    ? A DC  9   O2    ? ? ? 1_555 B  DG  20 N2 ? ? E DC  9   F DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog15  hydrog ?    ? A DG  10  N1    ? ? ? 1_555 B  DC  19 N3 ? ? E DG  10  F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog16  hydrog ?    ? A DG  10  N2    ? ? ? 1_555 B  DC  19 O2 ? ? E DG  10  F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog17  hydrog ?    ? A DG  10  O6    ? ? ? 1_555 B  DC  19 N4 ? ? E DG  10  F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog18  hydrog ?    ? A DG  11  N2    ? ? ? 1_555 B  DC  18 O2 ? ? E DG  11  F DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     
? ? 
hydrog19  hydrog ?    ? A DC  12  N3    ? ? ? 1_555 B  DG  17 N1 ? ? E DC  12  F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog20  hydrog ?    ? A DC  12  N4    ? ? ? 1_555 B  DG  17 O6 ? ? E DC  12  F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog21  hydrog ?    ? A DC  12  O2    ? ? ? 1_555 B  DG  17 N2 ? ? E DC  12  F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog22  hydrog ?    ? A DC  13  N3    ? ? ? 1_555 B  DG  16 N1 ? ? E DC  13  F DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog23  hydrog ?    ? A DC  13  N4    ? ? ? 1_555 B  DG  16 O6 ? ? E DC  13  F DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog24  hydrog ?    ? A DC  13  O2    ? ? ? 1_555 B  DG  16 N2 ? ? E DC  13  F DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog25  hydrog ?    ? A DA  14  N1    ? ? ? 1_555 B  DT  15 N3 ? ? E DA  14  F DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog26  hydrog ?    ? A DA  14  N6    ? ? ? 1_555 B  DT  15 O4 ? ? E DA  14  F DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog27  hydrog ?    ? A DG  15  N1    ? ? ? 1_555 B  DC  14 N3 ? ? E DG  15  F DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog28  hydrog ?    ? A DG  15  N2    ? ? ? 1_555 B  DC  14 O2 ? ? E DG  15  F DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog29  hydrog ?    ? A DG  15  O6    ? ? ? 1_555 B  DC  14 N4 ? ? E DG  15  F DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog30  hydrog ?    ? A DT  16  N3    ? ? ? 1_555 B  DA  13 N1 ? ? E DT  16  F DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog31  hydrog ?    ? A DT  16  O4    ? ? ? 1_555 B  DA  13 N6 ? ? E DT  16  F DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog32  hydrog ?    ? A DG  17  N1    ? ? ? 1_555 B  DC  12 N3 ? ? E DG  17  F DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog33  hydrog ?    ? A DG  17  N2    ? ? ? 1_555 B  DC  12 O2 ? ? E DG  17  F DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog34  hydrog ?    ? A DG  17  O6    ? ? ? 1_555 B  DC  12 N4 ? ? E DG  17  F DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog35  hydrog ?    ? A DC  18  N3    ? ? ? 1_555 B  DG  11 N1 ? ? E DC  18  F DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog36  hydrog ?    ? A DC  18  N4    ? ? ? 1_555 B  DG  11 O6 ? ? E DC  18  F DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog37  hydrog ?    ? A DC  18  O2    ? ? ? 1_555 B  DG  11 N2 ? ? E DC  18  F DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog38  hydrog ?    ? A DC  19  N3    ? ? ? 1_555 B  DG  10 N1 ? ? E DC  19  F DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog39  hydrog ?    ? A DC  19  N4    ? ? ? 1_555 B  DG  10 O6 ? ? E DC  19  F DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog40  hydrog ?    ? A DC  19  O2    ? ? ? 1_555 B  DG  10 N2 ? ? E DC  19  F DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog41  hydrog ?    ? A DA  20  N1    ? ? ? 1_555 B  DT  9  N3 ? ? E DA  20  F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog42  hydrog ?    ? A DA  20  N6    ? ? ? 1_555 B  DT  9  O4 ? ? E DA  20  F DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog43  hydrog ?    ? C DC  1   N3    ? ? ? 1_555 D  DG  28 N1 ? ? G DC  1   H DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog44  hydrog ?    ? C DC  1   N4    ? ? ? 1_555 D  DG  28 O6 ? ? G DC  1   H DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog45  hydrog ?    ? C DC  1   O2    ? ? ? 1_555 D  DG  28 N2 ? ? G DC  1   H DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog46  hydrog ?    ? C DG  2   N1    ? ? ? 1_555 D  DC  27 N3 ? ? G DG  2   H DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog47  hydrog ?    ? C DG  2   N2    ? ? ? 1_555 D  DC  27 O2 ? ? G DG  2   H DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog48  hydrog ?    ? C DG  2   O6    ? ? ? 1_555 D  DC  27 N4 ? ? G DG  2   H DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog49  hydrog ?    ? C DA  3   N1    ? ? ? 1_555 D  DT  26 N3 ? ? G DA  3   H DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog50  hydrog ?    ? C DA  3   N6    ? ? ? 1_555 D  DT  26 O4 ? ? G DA  3   H DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog51  hydrog ?    ? C DA  4   N1    ? ? ? 1_555 D  DT  25 N3 ? ? G DA  4   H DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog52  hydrog ?    ? C DA  4   N6    ? ? ? 1_555 D  DT  25 O4 ? ? G DA  4   H DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog53  hydrog ?    ? C DA  5   N1    ? ? ? 1_555 D  DT  24 N3 ? ? G DA  5   H DT  24   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     
? ? 
hydrog54  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D  DG  23 N1 ? ? G DC  6   H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog55  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D  DG  23 O6 ? ? G DC  6   H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog56  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D  DG  23 N2 ? ? G DC  6   H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog57  hydrog ?    ? C DG  7   N1    ? ? ? 1_555 D  DC  22 N3 ? ? G DG  7   H DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog58  hydrog ?    ? C DG  7   N2    ? ? ? 1_555 D  DC  22 O2 ? ? G DG  7   H DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog59  hydrog ?    ? C DG  7   O6    ? ? ? 1_555 D  DC  22 N4 ? ? G DG  7   H DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog60  hydrog ?    ? C DA  8   N1    ? ? ? 1_555 D  DT  21 N3 ? ? G DA  8   H DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog61  hydrog ?    ? C DA  8   N6    ? ? ? 1_555 D  DT  21 O4 ? ? G DA  8   H DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog62  hydrog ?    ? C DC  9   N3    ? ? ? 1_555 D  DG  20 N1 ? ? G DC  9   H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog63  hydrog ?    ? C DC  9   N4    ? ? ? 1_555 D  DG  20 O6 ? ? G DC  9   H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog64  hydrog ?    ? C DC  9   O2    ? ? ? 1_555 D  DG  20 N2 ? ? G DC  9   H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog65  hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D  DC  18 N4 ? ? G DG  10  H DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     
? ? 
hydrog66  hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D  DC  19 O2 ? ? G DG  10  H DC  19   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     
? ? 
hydrog67  hydrog ?    ? C DG  11  N1    ? ? ? 1_555 D  DC  18 N3 ? ? G DG  11  H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog68  hydrog ?    ? C DG  11  N2    ? ? ? 1_555 D  DC  18 O2 ? ? G DG  11  H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog69  hydrog ?    ? C DG  11  O6    ? ? ? 1_555 D  DC  18 N4 ? ? G DG  11  H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog70  hydrog ?    ? C DC  12  N3    ? ? ? 1_555 D  DG  17 N1 ? ? G DC  12  H DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog71  hydrog ?    ? C DC  12  N4    ? ? ? 1_555 D  DG  17 O6 ? ? G DC  12  H DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog72  hydrog ?    ? C DC  12  O2    ? ? ? 1_555 D  DG  17 N2 ? ? G DC  12  H DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog73  hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D  DG  16 N1 ? ? G DC  13  H DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog74  hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D  DG  16 O6 ? ? G DC  13  H DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog75  hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D  DG  16 N2 ? ? G DC  13  H DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog76  hydrog ?    ? C DA  14  N1    ? ? ? 1_555 D  DT  15 N3 ? ? G DA  14  H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog77  hydrog ?    ? C DA  14  N6    ? ? ? 1_555 D  DT  15 O4 ? ? G DA  14  H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog78  hydrog ?    ? C DG  15  N1    ? ? ? 1_555 D  DC  14 N3 ? ? G DG  15  H DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog79  hydrog ?    ? C DG  15  N2    ? ? ? 1_555 D  DC  14 O2 ? ? G DG  15  H DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog80  hydrog ?    ? C DG  15  O6    ? ? ? 1_555 D  DC  14 N4 ? ? G DG  15  H DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog81  hydrog ?    ? C DT  16  N3    ? ? ? 1_555 D  DA  13 N1 ? ? G DT  16  H DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog82  hydrog ?    ? C DT  16  O4    ? ? ? 1_555 D  DA  13 N6 ? ? G DT  16  H DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog83  hydrog ?    ? C DG  17  N1    ? ? ? 1_555 D  DC  12 N3 ? ? G DG  17  H DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog84  hydrog ?    ? C DG  17  N2    ? ? ? 1_555 D  DC  12 O2 ? ? G DG  17  H DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog85  hydrog ?    ? C DG  17  O6    ? ? ? 1_555 D  DC  12 N4 ? ? G DG  17  H DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog86  hydrog ?    ? C DC  18  N3    ? ? ? 1_555 D  DG  11 N1 ? ? G DC  18  H DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog87  hydrog ?    ? C DC  18  N4    ? ? ? 1_555 D  DG  11 O6 ? ? G DC  18  H DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog88  hydrog ?    ? C DC  18  O2    ? ? ? 1_555 D  DG  11 N2 ? ? G DC  18  H DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog89  hydrog ?    ? C DC  19  N3    ? ? ? 1_555 D  DG  11 N2 ? ? G DC  19  H DG  11   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     
? ? 
hydrog90  hydrog ?    ? C DA  20  N1    ? ? ? 1_555 D  DT  9  N3 ? ? G DA  20  H DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog91  hydrog ?    ? C DA  20  N6    ? ? ? 1_555 D  DT  9  O4 ? ? G DA  20  H DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog92  hydrog ?    ? E DC  1   N3    ? ? ? 1_555 F  DG  28 N1 ? ? I DC  1   J DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog93  hydrog ?    ? E DC  1   N4    ? ? ? 1_555 F  DG  28 O6 ? ? I DC  1   J DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog94  hydrog ?    ? E DC  1   O2    ? ? ? 1_555 F  DG  28 N2 ? ? I DC  1   J DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog95  hydrog ?    ? E DG  2   N1    ? ? ? 1_555 F  DC  27 N3 ? ? I DG  2   J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog96  hydrog ?    ? E DG  2   N2    ? ? ? 1_555 F  DC  27 O2 ? ? I DG  2   J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog97  hydrog ?    ? E DG  2   O6    ? ? ? 1_555 F  DC  27 N4 ? ? I DG  2   J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog98  hydrog ?    ? E DA  3   N1    ? ? ? 1_555 F  DT  26 N3 ? ? I DA  3   J DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog99  hydrog ?    ? E DA  3   N6    ? ? ? 1_555 F  DT  26 O4 ? ? I DA  3   J DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog100 hydrog ?    ? E DA  4   N1    ? ? ? 1_555 F  DT  25 N3 ? ? I DA  4   J DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog101 hydrog ?    ? E DA  4   N6    ? ? ? 1_555 F  DT  25 O4 ? ? I DA  4   J DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog102 hydrog ?    ? E DA  5   N1    ? ? ? 1_555 F  DT  24 N3 ? ? I DA  5   J DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog103 hydrog ?    ? E DA  5   N6    ? ? ? 1_555 F  DT  24 O4 ? ? I DA  5   J DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog104 hydrog ?    ? E DC  6   N3    ? ? ? 1_555 F  DG  23 N1 ? ? I DC  6   J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog105 hydrog ?    ? E DC  6   N4    ? ? ? 1_555 F  DG  23 O6 ? ? I DC  6   J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog106 hydrog ?    ? E DC  6   O2    ? ? ? 1_555 F  DG  23 N2 ? ? I DC  6   J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog107 hydrog ?    ? E DG  7   N1    ? ? ? 1_555 F  DC  22 N3 ? ? I DG  7   J DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog108 hydrog ?    ? E DG  7   N2    ? ? ? 1_555 F  DC  22 O2 ? ? I DG  7   J DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog109 hydrog ?    ? E DG  7   O6    ? ? ? 1_555 F  DC  22 N4 ? ? I DG  7   J DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog110 hydrog ?    ? E DA  8   N1    ? ? ? 1_555 F  DT  21 N3 ? ? I DA  8   J DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog111 hydrog ?    ? E DA  8   N6    ? ? ? 1_555 F  DT  21 O4 ? ? I DA  8   J DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog112 hydrog ?    ? E DG  10  N2    ? ? ? 1_555 F  DC  19 O2 ? ? I DG  10  J DC  19   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     
? ? 
hydrog113 hydrog ?    ? E DG  11  N1    ? ? ? 1_555 F  DC  18 N3 ? ? I DG  11  J DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog114 hydrog ?    ? E DG  11  N2    ? ? ? 1_555 F  DC  18 O2 ? ? I DG  11  J DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog115 hydrog ?    ? E DG  11  O6    ? ? ? 1_555 F  DC  18 N4 ? ? I DG  11  J DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog116 hydrog ?    ? E DC  12  N3    ? ? ? 1_555 F  DG  17 N1 ? ? I DC  12  J DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog117 hydrog ?    ? E DC  12  N4    ? ? ? 1_555 F  DG  17 O6 ? ? I DC  12  J DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog118 hydrog ?    ? E DC  12  O2    ? ? ? 1_555 F  DG  17 N2 ? ? I DC  12  J DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog119 hydrog ?    ? E DC  13  N3    ? ? ? 1_555 F  DG  16 N1 ? ? I DC  13  J DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog120 hydrog ?    ? E DC  13  N4    ? ? ? 1_555 F  DG  16 O6 ? ? I DC  13  J DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog121 hydrog ?    ? E DC  13  O2    ? ? ? 1_555 F  DG  16 N2 ? ? I DC  13  J DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog122 hydrog ?    ? E DA  14  N6    ? ? ? 1_555 F  DT  15 O2 ? ? I DA  14  J DT  15   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     
? ? 
hydrog123 hydrog ?    ? E DG  15  N1    ? ? ? 1_555 F  DC  14 N3 ? ? I DG  15  J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog124 hydrog ?    ? E DG  15  N2    ? ? ? 1_555 F  DC  14 O2 ? ? I DG  15  J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog125 hydrog ?    ? E DG  15  O6    ? ? ? 1_555 F  DC  14 N4 ? ? I DG  15  J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog126 hydrog ?    ? E DT  16  N3    ? ? ? 1_555 F  DA  13 N1 ? ? I DT  16  J DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog127 hydrog ?    ? E DT  16  O4    ? ? ? 1_555 F  DA  13 N6 ? ? I DT  16  J DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog128 hydrog ?    ? E DG  17  N1    ? ? ? 1_555 F  DC  12 N3 ? ? I DG  17  J DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog129 hydrog ?    ? E DG  17  N2    ? ? ? 1_555 F  DC  12 O2 ? ? I DG  17  J DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog130 hydrog ?    ? E DG  17  O6    ? ? ? 1_555 F  DC  12 N4 ? ? I DG  17  J DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog131 hydrog ?    ? E DC  18  O2    ? ? ? 1_555 F  DG  11 N2 ? ? I DC  18  J DG  11   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     
? ? 
hydrog132 hydrog ?    ? E DC  19  N3    ? ? ? 1_555 F  DG  10 N1 ? ? I DC  19  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog133 hydrog ?    ? E DC  19  N4    ? ? ? 1_555 F  DG  10 O6 ? ? I DC  19  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog134 hydrog ?    ? E DC  19  O2    ? ? ? 1_555 F  DG  10 N2 ? ? I DC  19  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog135 hydrog ?    ? E DA  20  N1    ? ? ? 1_555 F  DT  9  N3 ? ? I DA  20  J DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog136 hydrog ?    ? E DA  20  N6    ? ? ? 1_555 F  DT  9  O4 ? ? I DA  20  J DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog137 hydrog ?    ? E DOC 21  N3    ? ? ? 1_555 F  DG  8  N1 ? ? I DOC 21  J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog138 hydrog ?    ? E DOC 21  N4    ? ? ? 1_555 F  DG  8  O6 ? ? I DOC 21  J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog139 hydrog ?    ? E DOC 21  O2    ? ? ? 1_555 F  DG  8  N2 ? ? I DOC 21  J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog140 hydrog ?    ? G DC  1   N3    ? ? ? 1_555 H  DG  28 N1 ? ? K DC  1   L DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog141 hydrog ?    ? G DC  1   N4    ? ? ? 1_555 H  DG  28 O6 ? ? K DC  1   L DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog142 hydrog ?    ? G DC  1   O2    ? ? ? 1_555 H  DG  28 N2 ? ? K DC  1   L DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog143 hydrog ?    ? G DG  2   N1    ? ? ? 1_555 H  DC  27 N3 ? ? K DG  2   L DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog144 hydrog ?    ? G DG  2   N2    ? ? ? 1_555 H  DC  27 O2 ? ? K DG  2   L DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog145 hydrog ?    ? G DG  2   O6    ? ? ? 1_555 H  DC  27 N4 ? ? K DG  2   L DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog146 hydrog ?    ? G DA  3   N1    ? ? ? 1_555 H  DT  26 N3 ? ? K DA  3   L DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog147 hydrog ?    ? G DA  3   N6    ? ? ? 1_555 H  DT  26 O4 ? ? K DA  3   L DT  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog148 hydrog ?    ? G DA  4   N1    ? ? ? 1_555 H  DT  25 N3 ? ? K DA  4   L DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog149 hydrog ?    ? G DA  4   N6    ? ? ? 1_555 H  DT  25 O4 ? ? K DA  4   L DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog150 hydrog ?    ? G DA  5   N1    ? ? ? 1_555 H  DT  24 N3 ? ? K DA  5   L DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog151 hydrog ?    ? G DA  5   N6    ? ? ? 1_555 H  DT  24 O4 ? ? K DA  5   L DT  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog152 hydrog ?    ? G DC  6   N3    ? ? ? 1_555 H  DG  23 N1 ? ? K DC  6   L DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog153 hydrog ?    ? G DC  6   N4    ? ? ? 1_555 H  DG  23 O6 ? ? K DC  6   L DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog154 hydrog ?    ? G DC  6   O2    ? ? ? 1_555 H  DG  23 N2 ? ? K DC  6   L DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog155 hydrog ?    ? G DG  7   N1    ? ? ? 1_555 H  DC  22 N3 ? ? K DG  7   L DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog156 hydrog ?    ? G DG  7   N2    ? ? ? 1_555 H  DC  22 O2 ? ? K DG  7   L DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog157 hydrog ?    ? G DG  7   O6    ? ? ? 1_555 H  DC  22 N4 ? ? K DG  7   L DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog158 hydrog ?    ? G DA  8   N1    ? ? ? 1_555 H  DT  21 N3 ? ? K DA  8   L DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog159 hydrog ?    ? G DA  8   N6    ? ? ? 1_555 H  DT  21 O4 ? ? K DA  8   L DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog160 hydrog ?    ? G DC  9   N3    ? ? ? 1_555 H  DG  20 N1 ? ? K DC  9   L DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog161 hydrog ?    ? G DC  9   N4    ? ? ? 1_555 H  DG  20 O6 ? ? K DC  9   L DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog162 hydrog ?    ? G DC  9   O2    ? ? ? 1_555 H  DG  20 N2 ? ? K DC  9   L DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog163 hydrog ?    ? G DG  10  N1    ? ? ? 1_555 H  DC  19 N3 ? ? K DG  10  L DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog164 hydrog ?    ? G DG  10  N2    ? ? ? 1_555 H  DC  19 O2 ? ? K DG  10  L DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog165 hydrog ?    ? G DG  10  O6    ? ? ? 1_555 H  DC  19 N4 ? ? K DG  10  L DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog166 hydrog ?    ? G DG  11  N1    ? ? ? 1_555 H  DC  18 N3 ? ? K DG  11  L DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog167 hydrog ?    ? G DG  11  N2    ? ? ? 1_555 H  DC  18 O2 ? ? K DG  11  L DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog168 hydrog ?    ? G DG  11  O6    ? ? ? 1_555 H  DC  18 N4 ? ? K DG  11  L DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog169 hydrog ?    ? G DC  12  N3    ? ? ? 1_555 H  DG  17 N1 ? ? K DC  12  L DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog170 hydrog ?    ? G DC  12  N4    ? ? ? 1_555 H  DG  17 O6 ? ? K DC  12  L DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog171 hydrog ?    ? G DC  12  O2    ? ? ? 1_555 H  DG  17 N2 ? ? K DC  12  L DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog172 hydrog ?    ? G DC  13  N3    ? ? ? 1_555 H  DG  16 N1 ? ? K DC  13  L DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog173 hydrog ?    ? G DC  13  N4    ? ? ? 1_555 H  DG  16 O6 ? ? K DC  13  L DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog174 hydrog ?    ? G DC  13  O2    ? ? ? 1_555 H  DG  16 N2 ? ? K DC  13  L DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog175 hydrog ?    ? G DA  14  N1    ? ? ? 1_555 H  DT  15 N3 ? ? K DA  14  L DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog176 hydrog ?    ? G DA  14  N6    ? ? ? 1_555 H  DT  15 O4 ? ? K DA  14  L DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog177 hydrog ?    ? G DG  15  N1    ? ? ? 1_555 H  DC  14 N3 ? ? K DG  15  L DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog178 hydrog ?    ? G DG  15  N2    ? ? ? 1_555 H  DC  14 O2 ? ? K DG  15  L DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog179 hydrog ?    ? G DG  15  O6    ? ? ? 1_555 H  DC  14 N4 ? ? K DG  15  L DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog180 hydrog ?    ? G DT  16  N3    ? ? ? 1_555 H  DA  13 N1 ? ? K DT  16  L DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog181 hydrog ?    ? G DT  16  O4    ? ? ? 1_555 H  DA  13 N6 ? ? K DT  16  L DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog182 hydrog ?    ? G DG  17  N1    ? ? ? 1_555 H  DC  12 N3 ? ? K DG  17  L DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog183 hydrog ?    ? G DG  17  N2    ? ? ? 1_555 H  DC  12 O2 ? ? K DG  17  L DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog184 hydrog ?    ? G DG  17  O6    ? ? ? 1_555 H  DC  12 N4 ? ? K DG  17  L DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog185 hydrog ?    ? G DC  18  N3    ? ? ? 1_555 H  DG  11 N1 ? ? K DC  18  L DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog186 hydrog ?    ? G DC  18  N4    ? ? ? 1_555 H  DG  11 O6 ? ? K DC  18  L DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog187 hydrog ?    ? G DC  18  O2    ? ? ? 1_555 H  DG  11 N2 ? ? K DC  18  L DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog188 hydrog ?    ? G DC  19  N3    ? ? ? 1_555 H  DG  10 N1 ? ? K DC  19  L DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog189 hydrog ?    ? G DC  19  N4    ? ? ? 1_555 H  DG  10 O6 ? ? K DC  19  L DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog190 hydrog ?    ? G DC  19  O2    ? ? ? 1_555 H  DG  10 N2 ? ? K DC  19  L DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog191 hydrog ?    ? G DA  20  N1    ? ? ? 1_555 H  DT  9  N3 ? ? K DA  20  L DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
hydrog192 hydrog ?    ? G DA  20  N6    ? ? ? 1_555 H  DT  9  O4 ? ? K DA  20  L DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   ASP 238  I . ? ASP 238  A PRO 239  I ? PRO 239  A 1 -8.53  
2   PRO 301  I . ? PRO 301  A GLU 302  I ? GLU 302  A 1 -5.69  
3   PHE 495  I . ? PHE 495  A GLY 496  I ? GLY 496  A 1 1.75   
4   GLY 496  I . ? GLY 496  A SER 497  I ? SER 497  A 1 14.92  
5   LEU 498  I . ? LEU 498  A ALA 499  I ? ALA 499  A 1 -0.98  
6   ASN 569  I . ? ASN 569  A ARG 570  I ? ARG 570  A 1 4.60   
7   ALA 572  I . ? ALA 572  A SER 573  I ? SER 573  A 1 -28.99 
8   VAL 1080 I . ? VAL 1080 A VAL 1081 I ? VAL 1081 A 1 -2.03  
9   TYR 1086 I . ? TYR 1086 A GLU 1087 I ? GLU 1087 A 1 11.46  
10  GLU 1087 I . ? GLU 1087 A GLY 1088 I ? GLY 1088 A 1 -3.08  
11  GLY 1144 I . ? GLY 1144 A VAL 1145 I ? VAL 1145 A 1 -1.67  
12  GLY 1211 I . ? GLY 1211 A GLY 1212 I ? GLY 1212 A 1 1.78   
13  ASP 238  J . ? ASP 238  B PRO 239  J ? PRO 239  B 1 -5.40  
14  VAL 357  J . ? VAL 357  B GLU 358  J ? GLU 358  B 1 -21.43 
15  HIS 515  J . ? HIS 515  B LYS 516  J ? LYS 516  B 1 -9.63  
16  HIS 1013 J . ? HIS 1013 B PRO 1014 J ? PRO 1014 B 1 -6.78  
17  LYS 1057 J . ? LYS 1057 B PRO 1058 J ? PRO 1058 B 1 12.42  
18  VAL 1080 J . ? VAL 1080 B VAL 1081 J ? VAL 1081 B 1 4.78   
19  TYR 1086 J . ? TYR 1086 B GLU 1087 J ? GLU 1087 B 1 -2.64  
20  GLU 1087 J . ? GLU 1087 B GLY 1088 J ? GLY 1088 B 1 -2.72  
21  LYS 1143 J . ? LYS 1143 B GLY 1144 J ? GLY 1144 B 1 5.56   
22  GLY 1211 J . ? GLY 1211 B GLY 1212 J ? GLY 1212 B 1 -3.17  
23  ASP 238  K . ? ASP 238  C PRO 239  K ? PRO 239  C 1 -6.63  
24  PRO 301  K . ? PRO 301  C GLU 302  K ? GLU 302  C 1 -8.02  
25  VAL 541  K . ? VAL 541  C VAL 542  K ? VAL 542  C 1 0.73   
26  TYR 1086 K . ? TYR 1086 C GLU 1087 K ? GLU 1087 C 1 1.33   
27  GLU 1087 K . ? GLU 1087 C GLY 1088 K ? GLY 1088 C 1 -5.38  
28  GLN 1207 K . ? GLN 1207 C GLY 1208 K ? GLY 1208 C 1 23.04  
29  GLY 1211 K . ? GLY 1211 C GLY 1212 K ? GLY 1212 C 1 -2.05  
30  ASP 238  L . ? ASP 238  D PRO 239  L ? PRO 239  D 1 -8.97  
31  LEU 300  L . ? LEU 300  D PRO 301  L ? PRO 301  D 1 -6.99  
32  GLU 302  L . ? GLU 302  D GLY 303  L ? GLY 303  D 1 -4.15  
33  VAL 1080 L . ? VAL 1080 D VAL 1081 L ? VAL 1081 D 1 1.24   
34  TYR 1086 L . ? TYR 1086 D GLU 1087 L ? GLU 1087 D 1 0.71   
35  GLU 1087 L . ? GLU 1087 D GLY 1088 L ? GLY 1088 D 1 -0.63  
36  GLY 1144 L . ? GLY 1144 D VAL 1145 L ? VAL 1145 D 1 3.69   
37  GLY 1211 L . ? GLY 1211 D GLY 1212 L ? GLY 1212 D 1 -28.98 
38  ARG 19   M . ? ARG 385  M ALA 20   M ? ALA 386  M 1 0.92   
39  LYS 26   M . ? LYS 392  M PRO 27   M ? PRO 393  M 1 24.06  
40  LEU 45   M . ? LEU 411  M VAL 46   M ? VAL 412  M 1 -9.42  
41  GLN 74   M . ? GLN 440  M PHE 75   M ? PHE 441  M 1 -15.65 
42  LEU 84   M . ? LEU 450  M GLU 85   M ? GLU 451  M 1 14.33  
43  LEU 89   M . ? LEU 455  M SER 90   M ? SER 456  M 1 3.17   
44  GLU 122  M . ? GLU 488  M ASP 123  M ? ASP 489  M 1 1.54   
45  ALA 128  M . ? ALA 494  M GLU 129  M ? GLU 495  M 1 5.18   
46  GLU 129  M . ? GLU 495  M GLU 130  M ? GLU 496  M 1 17.40  
47  GLU 132  M . ? GLU 498  M ASP 133  M ? ASP 499  M 1 0.68   
48  ASP 133  M . ? ASP 499  M PRO 134  M ? PRO 500  M 1 9.06   
49  ARG 139  M . ? ARG 505  M ARG 140  M ? ARG 506  M 1 5.01   
50  ARG 153  M . ? ARG 519  M LYS 154  M ? LYS 520  M 1 -25.66 
51  ALA 157  M . ? ALA 523  M PRO 158  M ? PRO 524  M 1 -5.73  
52  PRO 158  M . ? PRO 524  M GLU 159  M ? GLU 525  M 1 -13.07 
53  ALA 160  M . ? ALA 526  M GLU 161  M ? GLU 527  M 1 2.96   
54  GLU 161  M . ? GLU 527  M GLU 162  M ? GLU 528  M 1 -1.54  
55  PRO 163  M . ? PRO 529  M VAL 164  M ? VAL 530  M 1 -12.20 
56  LEU 29   N . ? LEU 395  N ARG 30   N ? ARG 396  N 1 -6.89  
57  ALA 31   N . ? ALA 397  N PHE 32   N ? PHE 398  N 1 9.21   
58  LYS 43   N . ? LYS 409  N THR 44   N ? THR 410  N 1 2.42   
59  LEU 45   N . ? LEU 411  N VAL 46   N ? VAL 412  N 1 -16.70 
60  GLN 74   N . ? GLN 440  N PHE 75   N ? PHE 441  N 1 -15.54 
61  LEU 84   N . ? LEU 450  N GLU 85   N ? GLU 451  N 1 20.76  
62  LEU 89   N . ? LEU 455  N SER 90   N ? SER 456  N 1 22.32  
63  GLU 127  N . ? GLU 493  N ALA 128  N ? ALA 494  N 1 -5.06  
64  ALA 128  N . ? ALA 494  N GLU 129  N ? GLU 495  N 1 0.07   
65  GLU 129  N . ? GLU 495  N GLU 130  N ? GLU 496  N 1 8.24   
66  GLU 132  N . ? GLU 498  N ASP 133  N ? ASP 499  N 1 3.89   
67  ASP 133  N . ? ASP 499  N PRO 134  N ? PRO 500  N 1 6.64   
68  ARG 139  N . ? ARG 505  N ARG 140  N ? ARG 506  N 1 -19.53 
69  VAL 152  N . ? VAL 518  N ARG 153  N ? ARG 519  N 1 5.21   
70  ARG 153  N . ? ARG 519  N LYS 154  N ? LYS 520  N 1 -2.69  
71  ALA 157  N . ? ALA 523  N PRO 158  N ? PRO 524  N 1 -7.80  
72  PRO 158  N . ? PRO 524  N GLU 159  N ? GLU 525  N 1 -16.77 
73  GLU 161  N . ? GLU 527  N GLU 162  N ? GLU 528  N 1 -8.56  
74  PRO 163  N . ? PRO 529  N VAL 164  N ? VAL 530  N 1 -14.93 
75  ARG 19   O . ? ARG 385  O ALA 20   O ? ALA 386  O 1 0.37   
76  LYS 26   O . ? LYS 392  O PRO 27   O ? PRO 393  O 1 21.96  
77  LEU 29   O . ? LEU 395  O ARG 30   O ? ARG 396  O 1 -15.04 
78  ARG 30   O . ? ARG 396  O ALA 31   O ? ALA 397  O 1 7.70   
79  ALA 31   O . ? ALA 397  O PHE 32   O ? PHE 398  O 1 23.76  
80  LEU 45   O . ? LEU 411  O VAL 46   O ? VAL 412  O 1 -11.58 
81  GLN 74   O . ? GLN 440  O PHE 75   O ? PHE 441  O 1 -16.55 
82  LEU 84   O . ? LEU 450  O GLU 85   O ? GLU 451  O 1 20.65  
83  LEU 89   O . ? LEU 455  O SER 90   O ? SER 456  O 1 -2.85  
84  GLU 127  O . ? GLU 493  O ALA 128  O ? ALA 494  O 1 -11.20 
85  ALA 128  O . ? ALA 494  O GLU 129  O ? GLU 495  O 1 -11.08 
86  GLU 129  O . ? GLU 495  O GLU 130  O ? GLU 496  O 1 9.76   
87  GLU 132  O . ? GLU 498  O ASP 133  O ? ASP 499  O 1 4.31   
88  ASP 133  O . ? ASP 499  O PRO 134  O ? PRO 500  O 1 14.99  
89  VAL 152  O . ? VAL 518  O ARG 153  O ? ARG 519  O 1 5.03   
90  ARG 153  O . ? ARG 519  O LYS 154  O ? LYS 520  O 1 -15.52 
91  ALA 157  O . ? ALA 523  O PRO 158  O ? PRO 524  O 1 17.23  
92  GLU 161  O . ? GLU 527  O GLU 162  O ? GLU 528  O 1 5.68   
93  PRO 163  O . ? PRO 529  O VAL 164  O ? VAL 530  O 1 -8.84  
94  ARG 19   P . ? ARG 385  P ALA 20   P ? ALA 386  P 1 3.73   
95  ALA 31   P . ? ALA 397  P PHE 32   P ? PHE 398  P 1 24.91  
96  LEU 84   P . ? LEU 450  P GLU 85   P ? GLU 451  P 1 15.92  
97  LEU 89   P . ? LEU 455  P SER 90   P ? SER 456  P 1 -2.66  
98  SER 90   P . ? SER 456  P GLY 91   P ? GLY 457  P 1 8.04   
99  GLU 127  P . ? GLU 493  P ALA 128  P ? ALA 494  P 1 -5.34  
100 ALA 128  P . ? ALA 494  P GLU 129  P ? GLU 495  P 1 3.41   
101 GLU 129  P . ? GLU 495  P GLU 130  P ? GLU 496  P 1 6.28   
102 GLU 132  P . ? GLU 498  P ASP 133  P ? ASP 499  P 1 3.90   
103 ASP 133  P . ? ASP 499  P PRO 134  P ? PRO 500  P 1 5.31   
104 VAL 152  P . ? VAL 518  P ARG 153  P ? ARG 519  P 1 1.65   
105 ARG 153  P . ? ARG 519  P LYS 154  P ? LYS 520  P 1 -0.16  
106 ALA 157  P . ? ALA 523  P PRO 158  P ? PRO 524  P 1 0.31   
107 PRO 158  P . ? PRO 524  P GLU 159  P ? GLU 525  P 1 -24.31 
108 GLU 161  P . ? GLU 527  P GLU 162  P ? GLU 528  P 1 -5.34  
109 PRO 163  P . ? PRO 529  P VAL 164  P ? VAL 530  P 1 7.33   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 6 ? 
C  ? 6 ? 
D  ? 3 ? 
E  ? 6 ? 
F  ? 3 ? 
G  ? 3 ? 
H  ? 6 ? 
I  ? 4 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 6 ? 
M  ? 4 ? 
N  ? 3 ? 
O  ? 6 ? 
P  ? 4 ? 
Q  ? 2 ? 
R  ? 3 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 3 ? 
Z  ? 6 ? 
AA ? 4 ? 
AB ? 2 ? 
AC ? 3 ? 
AD ? 5 ? 
AE ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
B  1 2 ? parallel      
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? parallel      
B  5 6 ? parallel      
C  1 2 ? parallel      
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? parallel      
C  5 6 ? anti-parallel 
D  1 2 ? parallel      
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
E  5 6 ? parallel      
F  1 2 ? parallel      
F  2 3 ? anti-parallel 
G  1 2 ? parallel      
G  2 3 ? parallel      
H  1 2 ? parallel      
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? parallel      
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? parallel      
L  4 5 ? anti-parallel 
L  5 6 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? parallel      
M  3 4 ? anti-parallel 
N  1 2 ? parallel      
N  2 3 ? parallel      
O  1 2 ? parallel      
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? parallel      
O  5 6 ? parallel      
P  1 2 ? parallel      
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? parallel      
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? parallel      
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? parallel      
Z  5 6 ? parallel      
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? parallel      
AE 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ALA I 41   ? MET I 44   ? ALA A 41   MET A 44   
A  2 LYS I 66   ? ALA I 76   ? LYS A 66   ALA A 76   
A  3 ARG I 126  ? ILE I 127  ? ARG A 126  ILE A 127  
B  1 ALA I 41   ? MET I 44   ? ALA A 41   MET A 44   
B  2 LYS I 66   ? ALA I 76   ? LYS A 66   ALA A 76   
B  3 TYR I 93   ? ALA I 100  ? TYR A 93   ALA A 100  
B  4 LEU I 139  ? LEU I 142  ? LEU A 139  LEU A 142  
B  5 PHE I 177  ? ILE I 181  ? PHE A 177  ILE A 181  
B  6 MET I 207  ? ALA I 209  ? MET A 207  ALA A 209  
C  1 ASP I 465  ? SER I 469  ? ASP A 465  SER A 469  
C  2 LEU I 615  ? LEU I 622  ? LEU A 615  LEU A 622  
C  3 VAL I 574  ? ILE I 581  ? VAL A 574  ILE A 581  
C  4 VAL I 489  ? GLY I 493  ? VAL A 489  GLY A 493  
C  5 PRO I 600  ? THR I 602  ? PRO A 600  THR A 602  
C  6 LEU I 592  ? ARG I 594  ? LEU A 592  ARG A 594  
D  1 VAL I 868  ? LEU I 869  ? VAL A 868  LEU A 869  
D  2 GLU I 886  ? LEU I 888  ? GLU A 886  LEU A 888  
D  3 LYS I 881  ? VAL I 883  ? LYS A 881  VAL A 883  
E  1 GLY I 1075 ? ALA I 1076 ? GLY A 1075 ALA A 1076 
E  2 LEU I 1070 ? ASP I 1072 ? LEU A 1070 ASP A 1072 
E  3 LYS I 1044 ? VAL I 1051 ? LYS A 1044 VAL A 1051 
E  4 PRO I 1098 ? GLU I 1104 ? PRO A 1098 GLU A 1104 
E  5 VAL I 1113 ? THR I 1120 ? VAL A 1113 THR A 1120 
E  6 VAL I 1079 ? VAL I 1080 ? VAL A 1079 VAL A 1080 
F  1 VAL I 1133 ? ASP I 1136 ? VAL A 1133 ASP A 1136 
F  2 LEU I 1163 ? LEU I 1166 ? LEU A 1163 LEU A 1166 
F  3 GLU I 1171 ? LEU I 1173 ? GLU A 1171 LEU A 1173 
G  1 ALA J 41   ? MET J 44   ? ALA B 41   MET B 44   
G  2 LYS J 66   ? ALA J 76   ? LYS B 66   ALA B 76   
G  3 ARG J 126  ? ILE J 127  ? ARG B 126  ILE B 127  
H  1 ALA J 41   ? MET J 44   ? ALA B 41   MET B 44   
H  2 LYS J 66   ? ALA J 76   ? LYS B 66   ALA B 76   
H  3 TYR J 93   ? ALA J 100  ? TYR B 93   ALA B 100  
H  4 LEU J 139  ? LEU J 142  ? LEU B 139  LEU B 142  
H  5 PHE J 177  ? ILE J 181  ? PHE B 177  ILE B 181  
H  6 MET J 207  ? ALA J 209  ? MET B 207  ALA B 209  
I  1 ASP J 465  ? SER J 469  ? ASP B 465  SER B 469  
I  2 LEU J 615  ? LEU J 622  ? LEU B 615  LEU B 622  
I  3 SER J 573  ? ILE J 581  ? SER B 573  ILE B 581  
I  4 VAL J 489  ? THR J 494  ? VAL B 489  THR B 494  
J  1 LEU J 592  ? ARG J 594  ? LEU B 592  ARG B 594  
J  2 PRO J 600  ? THR J 602  ? PRO B 600  THR B 602  
K  1 VAL J 868  ? LEU J 869  ? VAL B 868  LEU B 869  
K  2 GLU J 886  ? LEU J 888  ? GLU B 886  LEU B 888  
K  3 LYS J 881  ? VAL J 883  ? LYS B 881  VAL B 883  
L  1 LYS J 1044 ? VAL J 1051 ? LYS B 1044 VAL B 1051 
L  2 PHE J 1068 ? SER J 1071 ? PHE B 1068 SER B 1071 
L  3 ALA J 1076 ? VAL J 1080 ? ALA B 1076 VAL B 1080 
L  4 VAL J 1113 ? THR J 1120 ? VAL B 1113 THR B 1120 
L  5 PRO J 1098 ? GLU J 1104 ? PRO B 1098 GLU B 1104 
L  6 LYS J 1044 ? VAL J 1051 ? LYS B 1044 VAL B 1051 
M  1 PHE J 1174 ? VAL J 1181 ? PHE B 1174 VAL B 1181 
M  2 PRO J 1156 ? LEU J 1163 ? PRO B 1156 LEU B 1163 
M  3 LYS J 1129 ? GLU J 1134 ? LYS B 1129 GLU B 1134 
M  4 ARG J 1195 ? PRO J 1200 ? ARG B 1195 PRO B 1200 
N  1 ALA K 41   ? MET K 44   ? ALA C 41   MET C 44   
N  2 LYS K 66   ? ALA K 76   ? LYS C 66   ALA C 76   
N  3 ARG K 126  ? ILE K 127  ? ARG C 126  ILE C 127  
O  1 ALA K 41   ? MET K 44   ? ALA C 41   MET C 44   
O  2 LYS K 66   ? ALA K 76   ? LYS C 66   ALA C 76   
O  3 TYR K 93   ? ALA K 100  ? TYR C 93   ALA C 100  
O  4 LEU K 139  ? LEU K 142  ? LEU C 139  LEU C 142  
O  5 PHE K 177  ? ILE K 181  ? PHE C 177  ILE C 181  
O  6 MET K 207  ? ALA K 209  ? MET C 207  ALA C 209  
P  1 ASP K 465  ? SER K 469  ? ASP C 465  SER C 469  
P  2 LYS K 616  ? LEU K 622  ? LYS C 616  LEU C 622  
P  3 GLY K 578  ? ILE K 581  ? GLY C 578  ILE C 581  
P  4 VAL K 489  ? ALA K 490  ? VAL C 489  ALA C 490  
Q  1 LEU K 592  ? ARG K 594  ? LEU C 592  ARG C 594  
Q  2 PRO K 600  ? THR K 602  ? PRO C 600  THR C 602  
R  1 VAL K 868  ? LEU K 869  ? VAL C 868  LEU C 869  
R  2 GLU K 886  ? LEU K 888  ? GLU C 886  LEU C 888  
R  3 LYS K 881  ? VAL K 883  ? LYS C 881  VAL C 883  
S  1 LYS K 1044 ? SER K 1048 ? LYS C 1044 SER C 1048 
S  2 LEU K 1099 ? GLU K 1104 ? LEU C 1099 GLU C 1104 
S  3 LEU K 1114 ? THR K 1120 ? LEU C 1114 THR C 1120 
T  1 THR K 1069 ? ASP K 1072 ? THR C 1069 ASP C 1072 
T  2 GLY K 1075 ? GLU K 1078 ? GLY C 1075 GLU C 1078 
U  1 LYS K 1129 ? ALA K 1130 ? LYS C 1129 ALA C 1130 
U  2 VAL K 1199 ? PRO K 1200 ? VAL C 1199 PRO C 1200 
V  1 TYR K 1162 ? LEU K 1163 ? TYR C 1162 LEU C 1163 
V  2 GLU K 1132 ? GLU K 1134 ? GLU C 1132 GLU C 1134 
V  3 ARG K 1195 ? ALA K 1196 ? ARG C 1195 ALA C 1196 
W  1 PRO K 1156 ? PRO K 1160 ? PRO C 1156 PRO C 1160 
W  2 ARG K 1180 ? VAL K 1181 ? ARG C 1180 VAL C 1181 
X  1 LEU K 1166 ? GLY K 1167 ? LEU C 1166 GLY C 1167 
X  2 GLY K 1170 ? GLU K 1171 ? GLY C 1170 GLU C 1171 
Y  1 ALA L 41   ? MET L 44   ? ALA D 41   MET D 44   
Y  2 LYS L 66   ? ALA L 76   ? LYS D 66   ALA D 76   
Y  3 ARG L 126  ? ILE L 127  ? ARG D 126  ILE D 127  
Z  1 ALA L 41   ? MET L 44   ? ALA D 41   MET D 44   
Z  2 LYS L 66   ? ALA L 76   ? LYS D 66   ALA D 76   
Z  3 TYR L 93   ? ALA L 100  ? TYR D 93   ALA D 100  
Z  4 LEU L 139  ? LEU L 142  ? LEU D 139  LEU D 142  
Z  5 PHE L 177  ? ILE L 181  ? PHE D 177  ILE D 181  
Z  6 MET L 207  ? ALA L 209  ? MET D 207  ALA D 209  
AA 1 ASP L 465  ? SER L 469  ? ASP D 465  SER D 469  
AA 2 LYS L 616  ? LEU L 622  ? LYS D 616  LEU D 622  
AA 3 VAL L 574  ? ILE L 581  ? VAL D 574  ILE D 581  
AA 4 VAL L 489  ? GLY L 493  ? VAL D 489  GLY D 493  
AB 1 LEU L 592  ? ARG L 594  ? LEU D 592  ARG D 594  
AB 2 PRO L 600  ? THR L 602  ? PRO D 600  THR D 602  
AC 1 VAL L 868  ? LEU L 869  ? VAL D 868  LEU D 869  
AC 2 GLU L 886  ? LEU L 888  ? GLU D 886  LEU D 888  
AC 3 LYS L 881  ? VAL L 883  ? LYS D 881  VAL D 883  
AD 1 GLY L 1075 ? VAL L 1080 ? GLY D 1075 VAL D 1080 
AD 2 ARG L 1067 ? ASP L 1072 ? ARG D 1067 ASP D 1072 
AD 3 LYS L 1044 ? VAL L 1051 ? LYS D 1044 VAL D 1051 
AD 4 ILE L 1097 ? GLU L 1104 ? ILE D 1097 GLU D 1104 
AD 5 LEU L 1114 ? TRP L 1119 ? LEU D 1114 TRP D 1119 
AE 1 GLU L 1171 ? VAL L 1181 ? GLU D 1171 VAL D 1181 
AE 2 PRO L 1156 ? LEU L 1166 ? PRO D 1156 LEU D 1166 
AE 3 LYS L 1129 ? GLU L 1134 ? LYS D 1129 GLU D 1134 
AE 4 ARG L 1195 ? PRO L 1200 ? ARG D 1195 PRO D 1200 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N MET I 44   ? N MET A 44   O GLY I 70   ? O GLY A 70   
A  2 3 N ALA I 76   ? N ALA A 76   O ILE I 127  ? O ILE A 127  
B  1 2 N MET I 44   ? N MET A 44   O GLY I 70   ? O GLY A 70   
B  2 3 N VAL I 75   ? N VAL A 75   O PHE I 94   ? O PHE A 94   
B  3 4 N LEU I 99   ? N LEU A 99   O ILE I 140  ? O ILE A 140  
B  4 5 N ALA I 141  ? N ALA A 141  O PHE I 178  ? O PHE A 178  
B  5 6 N ILE I 181  ? N ILE A 181  O VAL I 208  ? O VAL A 208  
C  1 2 N PHE I 468  ? N PHE A 468  O LEU I 620  ? O LEU A 620  
C  2 3 O MET I 617  ? O MET A 617  N VAL I 579  ? N VAL A 579  
C  3 4 O HIS I 575  ? O HIS A 575  N ILE I 492  ? N ILE A 492  
C  4 5 N GLN I 491  ? N GLN A 491  O THR I 602  ? O THR A 602  
C  5 6 O VAL I 601  ? O VAL A 601  N MET I 593  ? N MET A 593  
D  1 2 N LEU I 869  ? N LEU A 869  O ILE I 887  ? O ILE A 887  
D  2 3 O LEU I 888  ? O LEU A 888  N LYS I 881  ? N LYS A 881  
E  1 2 O GLY I 1075 ? O GLY A 1075 N ASP I 1072 ? N ASP A 1072 
E  2 3 O SER I 1071 ? O SER A 1071 N MET I 1050 ? N MET A 1050 
E  3 4 N LEU I 1047 ? N LEU A 1047 O VAL I 1101 ? O VAL A 1101 
E  4 5 N GLU I 1104 ? N GLU A 1104 O LEU I 1114 ? O LEU A 1114 
E  5 6 O VAL I 1113 ? O VAL A 1113 N VAL I 1080 ? N VAL A 1080 
F  1 2 N VAL I 1135 ? N VAL A 1135 O ARG I 1164 ? O ARG A 1164 
F  2 3 N VAL I 1165 ? N VAL A 1165 O ALA I 1172 ? O ALA A 1172 
G  1 2 N LEU J 42   ? N LEU B 42   O LYS J 66   ? O LYS B 66   
G  2 3 N ALA J 76   ? N ALA B 76   O ILE J 127  ? O ILE B 127  
H  1 2 N LEU J 42   ? N LEU B 42   O LYS J 66   ? O LYS B 66   
H  2 3 N VAL J 75   ? N VAL B 75   O PHE J 94   ? O PHE B 94   
H  3 4 N LEU J 99   ? N LEU B 99   O ILE J 140  ? O ILE B 140  
H  4 5 N ALA J 141  ? N ALA B 141  O PHE J 178  ? O PHE B 178  
H  5 6 N ILE J 179  ? N ILE B 179  O VAL J 208  ? O VAL B 208  
I  1 2 N PHE J 468  ? N PHE B 468  O LEU J 622  ? O LEU B 622  
I  2 3 O MET J 617  ? O MET B 617  N VAL J 579  ? N VAL B 579  
I  3 4 O VAL J 580  ? O VAL B 580  N ALA J 490  ? N ALA B 490  
J  1 2 N MET J 593  ? N MET B 593  O VAL J 601  ? O VAL B 601  
K  1 2 N LEU J 869  ? N LEU B 869  O ILE J 887  ? O ILE B 887  
K  2 3 O LEU J 888  ? O LEU B 888  N LYS J 881  ? N LYS B 881  
L  1 2 N MET J 1050 ? N MET B 1050 O SER J 1071 ? O SER B 1071 
L  2 3 N LEU J 1070 ? N LEU B 1070 O LEU J 1077 ? O LEU B 1077 
L  3 4 N VAL J 1080 ? N VAL B 1080 O ALA J 1115 ? O ALA B 1115 
L  4 5 O LEU J 1114 ? O LEU B 1114 N GLU J 1104 ? N GLU B 1104 
L  5 6 O VAL J 1101 ? O VAL B 1101 N LEU J 1047 ? N LEU B 1047 
M  1 2 O LEU J 1176 ? O LEU B 1176 N VAL J 1161 ? N VAL B 1161 
M  2 3 O TYR J 1162 ? O TYR B 1162 N VAL J 1133 ? N VAL B 1133 
M  3 4 N ALA J 1130 ? N ALA B 1130 O VAL J 1199 ? O VAL B 1199 
N  1 2 N MET K 44   ? N MET C 44   O ILE K 68   ? O ILE C 68   
N  2 3 N ALA K 76   ? N ALA C 76   O ILE K 127  ? O ILE C 127  
O  1 2 N MET K 44   ? N MET C 44   O ILE K 68   ? O ILE C 68   
O  2 3 N VAL K 75   ? N VAL C 75   O PHE K 94   ? O PHE C 94   
O  3 4 N LEU K 99   ? N LEU C 99   O ILE K 140  ? O ILE C 140  
O  4 5 N ALA K 141  ? N ALA C 141  O PHE K 178  ? O PHE C 178  
O  5 6 N ILE K 179  ? N ILE C 179  O VAL K 208  ? O VAL C 208  
P  1 2 N PHE K 468  ? N PHE C 468  O LEU K 620  ? O LEU C 620  
P  2 3 O MET K 617  ? O MET C 617  N VAL K 579  ? N VAL C 579  
P  3 4 O VAL K 580  ? O VAL C 580  N ALA K 490  ? N ALA C 490  
Q  1 2 N MET K 593  ? N MET C 593  O VAL K 601  ? O VAL C 601  
R  1 2 N LEU K 869  ? N LEU C 869  O ILE K 887  ? O ILE C 887  
R  2 3 O LEU K 888  ? O LEU C 888  N LYS K 881  ? N LYS C 881  
S  1 2 N VAL K 1045 ? N VAL C 1045 O ALA K 1103 ? O ALA C 1103 
S  2 3 N GLU K 1104 ? N GLU C 1104 O LEU K 1114 ? O LEU C 1114 
T  1 2 N ASP K 1072 ? N ASP C 1072 O GLY K 1075 ? O GLY C 1075 
U  1 2 N ALA K 1130 ? N ALA C 1130 O VAL K 1199 ? O VAL C 1199 
V  1 2 O TYR K 1162 ? O TYR C 1162 N VAL K 1133 ? N VAL C 1133 
V  2 3 N GLU K 1134 ? N GLU C 1134 O ARG K 1195 ? O ARG C 1195 
W  1 2 N LEU K 1159 ? N LEU C 1159 O VAL K 1181 ? O VAL C 1181 
X  1 2 N GLY K 1167 ? N GLY C 1167 O GLY K 1170 ? O GLY C 1170 
Y  1 2 N MET L 44   ? N MET D 44   O ILE L 68   ? O ILE D 68   
Y  2 3 N TYR L 74   ? N TYR D 74   O ILE L 127  ? O ILE D 127  
Z  1 2 N MET L 44   ? N MET D 44   O ILE L 68   ? O ILE D 68   
Z  2 3 N VAL L 75   ? N VAL D 75   O PHE L 94   ? O PHE D 94   
Z  3 4 N LEU L 99   ? N LEU D 99   O ILE L 140  ? O ILE D 140  
Z  4 5 N ALA L 141  ? N ALA D 141  O PHE L 178  ? O PHE D 178  
Z  5 6 N ILE L 181  ? N ILE D 181  O VAL L 208  ? O VAL D 208  
AA 1 2 N PHE L 468  ? N PHE D 468  O LEU L 622  ? O LEU D 622  
AA 2 3 O MET L 617  ? O MET D 617  N VAL L 579  ? N VAL D 579  
AA 3 4 O HIS L 575  ? O HIS D 575  N ILE L 492  ? N ILE D 492  
AB 1 2 N MET L 593  ? N MET D 593  O VAL L 601  ? O VAL D 601  
AC 1 2 N LEU L 869  ? N LEU D 869  O ILE L 887  ? O ILE D 887  
AC 2 3 O LEU L 888  ? O LEU D 888  N LYS L 881  ? N LYS D 881  
AD 1 2 O GLY L 1075 ? O GLY D 1075 N ASP L 1072 ? N ASP D 1072 
AD 2 3 O SER L 1071 ? O SER D 1071 N MET L 1050 ? N MET D 1050 
AD 3 4 N VAL L 1045 ? N VAL D 1045 O ALA L 1103 ? O ALA D 1103 
AD 4 5 N LEU L 1100 ? N LEU D 1100 O TRP L 1119 ? O TRP D 1119 
AE 1 2 O ALA L 1172 ? O ALA D 1172 N VAL L 1165 ? N VAL D 1165 
AE 2 3 O TYR L 1162 ? O TYR D 1162 N VAL L 1133 ? N VAL D 1133 
AE 3 4 N ALA L 1130 ? N ALA D 1130 O VAL L 1199 ? O VAL D 1199 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1301 ? 4 'BINDING SITE FOR RESIDUE ZN A 1301' 
AC2 Software A ZN 1302 ? 3 'BINDING SITE FOR RESIDUE ZN A 1302' 
AC3 Software A ZN 1303 ? 5 'BINDING SITE FOR RESIDUE ZN A 1303' 
AC4 Software A MG 1304 ? 4 'BINDING SITE FOR RESIDUE MG A 1304' 
AC5 Software B ZN 1301 ? 5 'BINDING SITE FOR RESIDUE ZN B 1301' 
AC6 Software B ZN 1302 ? 3 'BINDING SITE FOR RESIDUE ZN B 1302' 
AC7 Software B ZN 1303 ? 5 'BINDING SITE FOR RESIDUE ZN B 1303' 
AC8 Software B MG 1304 ? 5 'BINDING SITE FOR RESIDUE MG B 1304' 
AC9 Software C ZN 1301 ? 4 'BINDING SITE FOR RESIDUE ZN C 1301' 
BC1 Software C ZN 1302 ? 3 'BINDING SITE FOR RESIDUE ZN C 1302' 
BC2 Software C ZN 1303 ? 5 'BINDING SITE FOR RESIDUE ZN C 1303' 
BC3 Software C MG 1304 ? 4 'BINDING SITE FOR RESIDUE MG C 1304' 
BC4 Software D ZN 1301 ? 5 'BINDING SITE FOR RESIDUE ZN D 1301' 
BC5 Software D ZN 1302 ? 3 'BINDING SITE FOR RESIDUE ZN D 1302' 
BC6 Software D ZN 1303 ? 5 'BINDING SITE FOR RESIDUE ZN D 1303' 
BC7 Software D MG 1304 ? 6 'BINDING SITE FOR RESIDUE MG D 1304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 GLU I  72  ? GLU A 72   . ? 1_555 ? 
2  AC1 4 HIS I  95  ? HIS A 95   . ? 1_555 ? 
3  AC1 4 CYS I  145 ? CYS A 145  . ? 1_555 ? 
4  AC1 4 ZN  S  .   ? ZN  A 1303 . ? 1_555 ? 
5  AC2 3 ASP I  20  ? ASP A 20   . ? 1_555 ? 
6  AC2 3 HIS I  47  ? HIS A 47   . ? 1_555 ? 
7  AC2 3 HIS I  214 ? HIS A 214  . ? 1_555 ? 
8  AC3 5 HIS I  11  ? HIS A 11   . ? 1_555 ? 
9  AC3 5 HIS I  13  ? HIS A 13   . ? 1_555 ? 
10 AC3 5 GLU I  72  ? GLU A 72   . ? 1_555 ? 
11 AC3 5 ASP I  212 ? ASP A 212  . ? 1_555 ? 
12 AC3 5 ZN  Q  .   ? ZN  A 1301 . ? 1_555 ? 
13 AC4 4 ASP I  463 ? ASP A 463  . ? 1_555 ? 
14 AC4 4 ASP I  465 ? ASP A 465  . ? 1_555 ? 
15 AC4 4 LYS I  616 ? LYS A 616  . ? 1_555 ? 
16 AC4 4 ASP I  618 ? ASP A 618  . ? 1_555 ? 
17 AC5 5 GLU J  72  ? GLU B 72   . ? 1_555 ? 
18 AC5 5 HIS J  95  ? HIS B 95   . ? 1_555 ? 
19 AC5 5 CYS J  145 ? CYS B 145  . ? 1_555 ? 
20 AC5 5 ASP J  212 ? ASP B 212  . ? 1_555 ? 
21 AC5 5 ZN  W  .   ? ZN  B 1303 . ? 1_555 ? 
22 AC6 3 ASP J  20  ? ASP B 20   . ? 1_555 ? 
23 AC6 3 HIS J  47  ? HIS B 47   . ? 1_555 ? 
24 AC6 3 HIS J  214 ? HIS B 214  . ? 1_555 ? 
25 AC7 5 HIS J  11  ? HIS B 11   . ? 1_555 ? 
26 AC7 5 HIS J  13  ? HIS B 13   . ? 1_555 ? 
27 AC7 5 GLU J  72  ? GLU B 72   . ? 1_555 ? 
28 AC7 5 ASP J  212 ? ASP B 212  . ? 1_555 ? 
29 AC7 5 ZN  U  .   ? ZN  B 1301 . ? 1_555 ? 
30 AC8 5 ASP J  463 ? ASP B 463  . ? 1_555 ? 
31 AC8 5 ILE J  464 ? ILE B 464  . ? 1_555 ? 
32 AC8 5 ASP J  465 ? ASP B 465  . ? 1_555 ? 
33 AC8 5 LYS J  616 ? LYS B 616  . ? 1_555 ? 
34 AC8 5 ASP J  618 ? ASP B 618  . ? 1_555 ? 
35 AC9 4 GLU K  72  ? GLU C 72   . ? 1_555 ? 
36 AC9 4 HIS K  95  ? HIS C 95   . ? 1_555 ? 
37 AC9 4 CYS K  145 ? CYS C 145  . ? 1_555 ? 
38 AC9 4 ZN  AA .   ? ZN  C 1303 . ? 1_555 ? 
39 BC1 3 ASP K  20  ? ASP C 20   . ? 1_555 ? 
40 BC1 3 HIS K  47  ? HIS C 47   . ? 1_555 ? 
41 BC1 3 HIS K  214 ? HIS C 214  . ? 1_555 ? 
42 BC2 5 HIS K  11  ? HIS C 11   . ? 1_555 ? 
43 BC2 5 HIS K  13  ? HIS C 13   . ? 1_555 ? 
44 BC2 5 GLU K  72  ? GLU C 72   . ? 1_555 ? 
45 BC2 5 ASP K  212 ? ASP C 212  . ? 1_555 ? 
46 BC2 5 ZN  Y  .   ? ZN  C 1301 . ? 1_555 ? 
47 BC3 4 ASP K  463 ? ASP C 463  . ? 1_555 ? 
48 BC3 4 ASP K  465 ? ASP C 465  . ? 1_555 ? 
49 BC3 4 LYS K  616 ? LYS C 616  . ? 1_555 ? 
50 BC3 4 ASP K  618 ? ASP C 618  . ? 1_555 ? 
51 BC4 5 GLU L  72  ? GLU D 72   . ? 1_555 ? 
52 BC4 5 HIS L  95  ? HIS D 95   . ? 1_555 ? 
53 BC4 5 CYS L  145 ? CYS D 145  . ? 1_555 ? 
54 BC4 5 ASP L  212 ? ASP D 212  . ? 1_555 ? 
55 BC4 5 ZN  EA .   ? ZN  D 1303 . ? 1_555 ? 
56 BC5 3 ASP L  20  ? ASP D 20   . ? 1_555 ? 
57 BC5 3 HIS L  47  ? HIS D 47   . ? 1_555 ? 
58 BC5 3 HIS L  214 ? HIS D 214  . ? 1_555 ? 
59 BC6 5 HIS L  11  ? HIS D 11   . ? 1_555 ? 
60 BC6 5 HIS L  13  ? HIS D 13   . ? 1_555 ? 
61 BC6 5 GLU L  72  ? GLU D 72   . ? 1_555 ? 
62 BC6 5 ASP L  212 ? ASP D 212  . ? 1_555 ? 
63 BC6 5 ZN  CA .   ? ZN  D 1301 . ? 1_555 ? 
64 BC7 6 ASP L  463 ? ASP D 463  . ? 1_555 ? 
65 BC7 6 ILE L  464 ? ILE D 464  . ? 1_555 ? 
66 BC7 6 ASP L  465 ? ASP D 465  . ? 1_555 ? 
67 BC7 6 LYS L  616 ? LYS D 616  . ? 1_555 ? 
68 BC7 6 MET L  617 ? MET D 617  . ? 1_555 ? 
69 BC7 6 ASP L  618 ? ASP D 618  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4IQJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4IQJ 
_atom_sites.fract_transf_matrix[1][1]   0.005304 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000003 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010530 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004900 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     P  P     . DC  A  1 1    ? -6.876  -56.382  -17.343 1.00 194.21 ? 1    DC  E P     1 
ATOM   2     O  OP1   . DC  A  1 1    ? -8.344  -56.620  -17.375 1.00 180.52 ? 1    DC  E OP1   1 
ATOM   3     O  OP2   . DC  A  1 1    ? -6.280  -55.303  -18.179 1.00 187.40 ? 1    DC  E OP2   1 
ATOM   4     O  "O5'" . DC  A  1 1    ? -6.466  -56.115  -15.825 1.00 189.69 ? 1    DC  E "O5'" 1 
ATOM   5     C  "C5'" . DC  A  1 1    ? -6.997  -56.932  -14.766 1.00 181.93 ? 1    DC  E "C5'" 1 
ATOM   6     C  "C4'" . DC  A  1 1    ? -6.303  -56.627  -13.457 1.00 179.09 ? 1    DC  E "C4'" 1 
ATOM   7     O  "O4'" . DC  A  1 1    ? -4.926  -57.067  -13.511 1.00 180.56 ? 1    DC  E "O4'" 1 
ATOM   8     C  "C3'" . DC  A  1 1    ? -6.263  -55.149  -13.070 1.00 180.33 ? 1    DC  E "C3'" 1 
ATOM   9     O  "O3'" . DC  A  1 1    ? -6.623  -54.993  -11.689 1.00 192.04 ? 1    DC  E "O3'" 1 
ATOM   10    C  "C2'" . DC  A  1 1    ? -4.826  -54.740  -13.348 1.00 175.99 ? 1    DC  E "C2'" 1 
ATOM   11    C  "C1'" . DC  A  1 1    ? -4.065  -56.026  -13.089 1.00 175.83 ? 1    DC  E "C1'" 1 
ATOM   12    N  N1    . DC  A  1 1    ? -2.789  -56.177  -13.812 1.00 181.87 ? 1    DC  E N1    1 
ATOM   13    C  C2    . DC  A  1 1    ? -1.687  -56.715  -13.133 1.00 182.16 ? 1    DC  E C2    1 
ATOM   14    O  O2    . DC  A  1 1    ? -1.812  -57.029  -11.941 1.00 171.91 ? 1    DC  E O2    1 
ATOM   15    N  N3    . DC  A  1 1    ? -0.513  -56.863  -13.790 1.00 188.14 ? 1    DC  E N3    1 
ATOM   16    C  C4    . DC  A  1 1    ? -0.417  -56.508  -15.074 1.00 186.50 ? 1    DC  E C4    1 
ATOM   17    N  N4    . DC  A  1 1    ? 0.757   -56.676  -15.684 1.00 183.44 ? 1    DC  E N4    1 
ATOM   18    C  C5    . DC  A  1 1    ? -1.527  -55.973  -15.793 1.00 187.91 ? 1    DC  E C5    1 
ATOM   19    C  C6    . DC  A  1 1    ? -2.683  -55.829  -15.131 1.00 184.09 ? 1    DC  E C6    1 
ATOM   20    P  P     . DG  A  1 2    ? -7.108  -53.580  -11.077 1.00 191.79 ? 2    DG  E P     1 
ATOM   21    O  OP1   . DG  A  1 2    ? -8.528  -53.667  -10.648 1.00 189.69 ? 2    DG  E OP1   1 
ATOM   22    O  OP2   . DG  A  1 2    ? -6.686  -52.503  -12.019 1.00 187.68 ? 2    DG  E OP2   1 
ATOM   23    O  "O5'" . DG  A  1 2    ? -6.252  -53.431  -9.742  1.00 177.22 ? 2    DG  E "O5'" 1 
ATOM   24    C  "C5'" . DG  A  1 2    ? -6.010  -54.549  -8.874  1.00 172.20 ? 2    DG  E "C5'" 1 
ATOM   25    C  "C4'" . DG  A  1 2    ? -4.707  -54.352  -8.135  1.00 175.98 ? 2    DG  E "C4'" 1 
ATOM   26    O  "O4'" . DG  A  1 2    ? -3.587  -54.690  -8.992  1.00 176.83 ? 2    DG  E "O4'" 1 
ATOM   27    C  "C3'" . DG  A  1 2    ? -4.461  -52.924  -7.643  1.00 174.80 ? 2    DG  E "C3'" 1 
ATOM   28    O  "O3'" . DG  A  1 2    ? -4.030  -52.940  -6.285  1.00 182.15 ? 2    DG  E "O3'" 1 
ATOM   29    C  "C2'" . DG  A  1 2    ? -3.350  -52.415  -8.541  1.00 180.81 ? 2    DG  E "C2'" 1 
ATOM   30    C  "C1'" . DG  A  1 2    ? -2.597  -53.684  -8.892  1.00 178.64 ? 2    DG  E "C1'" 1 
ATOM   31    N  N9    . DG  A  1 2    ? -1.877  -53.638  -10.160 1.00 173.78 ? 2    DG  E N9    1 
ATOM   32    C  C8    . DG  A  1 2    ? -2.291  -53.053  -11.332 1.00 173.06 ? 2    DG  E C8    1 
ATOM   33    N  N7    . DG  A  1 2    ? -1.426  -53.178  -12.302 1.00 185.26 ? 2    DG  E N7    1 
ATOM   34    C  C5    . DG  A  1 2    ? -0.375  -53.888  -11.736 1.00 183.32 ? 2    DG  E C5    1 
ATOM   35    C  C6    . DG  A  1 2    ? 0.847   -54.329  -12.307 1.00 170.73 ? 2    DG  E C6    1 
ATOM   36    O  O6    . DG  A  1 2    ? 1.260   -54.170  -13.461 1.00 157.74 ? 2    DG  E O6    1 
ATOM   37    N  N1    . DG  A  1 2    ? 1.624   -55.021  -11.382 1.00 169.97 ? 2    DG  E N1    1 
ATOM   38    C  C2    . DG  A  1 2    ? 1.271   -55.258  -10.075 1.00 178.79 ? 2    DG  E C2    1 
ATOM   39    N  N2    . DG  A  1 2    ? 2.160   -55.941  -9.339  1.00 178.51 ? 2    DG  E N2    1 
ATOM   40    N  N3    . DG  A  1 2    ? 0.132   -54.852  -9.530  1.00 184.09 ? 2    DG  E N3    1 
ATOM   41    C  C4    . DG  A  1 2    ? -0.638  -54.178  -10.413 1.00 181.36 ? 2    DG  E C4    1 
ATOM   42    P  P     . DA  A  1 3    ? -4.058  -51.604  -5.425  1.00 193.86 ? 3    DA  E P     1 
ATOM   43    O  OP1   . DA  A  1 3    ? -5.077  -51.810  -4.363  1.00 189.64 ? 3    DA  E OP1   1 
ATOM   44    O  OP2   . DA  A  1 3    ? -4.158  -50.430  -6.329  1.00 186.98 ? 3    DA  E OP2   1 
ATOM   45    O  "O5'" . DA  A  1 3    ? -2.611  -51.544  -4.763  1.00 198.70 ? 3    DA  E "O5'" 1 
ATOM   46    C  "C5'" . DA  A  1 3    ? -1.850  -52.738  -4.493  1.00 195.13 ? 3    DA  E "C5'" 1 
ATOM   47    C  "C4'" . DA  A  1 3    ? -0.380  -52.452  -4.685  1.00 190.54 ? 3    DA  E "C4'" 1 
ATOM   48    O  "O4'" . DA  A  1 3    ? -0.080  -52.458  -6.104  1.00 184.38 ? 3    DA  E "O4'" 1 
ATOM   49    C  "C3'" . DA  A  1 3    ? 0.081   -51.086  -4.159  1.00 185.87 ? 3    DA  E "C3'" 1 
ATOM   50    O  "O3'" . DA  A  1 3    ? 1.356   -51.163  -3.508  1.00 175.44 ? 3    DA  E "O3'" 1 
ATOM   51    C  "C2'" . DA  A  1 3    ? 0.219   -50.258  -5.421  1.00 188.91 ? 3    DA  E "C2'" 1 
ATOM   52    C  "C1'" . DA  A  1 3    ? 0.698   -51.313  -6.398  1.00 187.95 ? 3    DA  E "C1'" 1 
ATOM   53    N  N9    . DA  A  1 3    ? 0.522   -50.991  -7.815  1.00 188.94 ? 3    DA  E N9    1 
ATOM   54    C  C8    . DA  A  1 3    ? -0.509  -50.301  -8.407  1.00 187.05 ? 3    DA  E C8    1 
ATOM   55    N  N7    . DA  A  1 3    ? -0.377  -50.167  -9.705  1.00 180.92 ? 3    DA  E N7    1 
ATOM   56    C  C5    . DA  A  1 3    ? 0.831   -50.790  -9.984  1.00 180.01 ? 3    DA  E C5    1 
ATOM   57    C  C6    . DA  A  1 3    ? 1.546   -50.976  -11.181 1.00 171.98 ? 3    DA  E C6    1 
ATOM   58    N  N6    . DA  A  1 3    ? 1.124   -50.542  -12.373 1.00 161.42 ? 3    DA  E N6    1 
ATOM   59    N  N1    . DA  A  1 3    ? 2.723   -51.637  -11.113 1.00 175.22 ? 3    DA  E N1    1 
ATOM   60    C  C2    . DA  A  1 3    ? 3.146   -52.073  -9.919  1.00 173.02 ? 3    DA  E C2    1 
ATOM   61    N  N3    . DA  A  1 3    ? 2.564   -51.960  -8.726  1.00 180.68 ? 3    DA  E N3    1 
ATOM   62    C  C4    . DA  A  1 3    ? 1.398   -51.299  -8.828  1.00 184.05 ? 3    DA  E C4    1 
ATOM   63    P  P     . DA  A  1 4    ? 1.520   -50.849  -1.951  1.00 174.13 ? 4    DA  E P     1 
ATOM   64    O  OP1   . DA  A  1 4    ? 0.380   -51.511  -1.251  1.00 181.36 ? 4    DA  E OP1   1 
ATOM   65    O  OP2   . DA  A  1 4    ? 1.757   -49.388  -1.775  1.00 161.11 ? 4    DA  E OP2   1 
ATOM   66    O  "O5'" . DA  A  1 4    ? 2.868   -51.584  -1.530  1.00 168.85 ? 4    DA  E "O5'" 1 
ATOM   67    C  "C5'" . DA  A  1 4    ? 3.653   -52.334  -2.476  1.00 172.47 ? 4    DA  E "C5'" 1 
ATOM   68    C  "C4'" . DA  A  1 4    ? 4.792   -51.503  -3.026  1.00 172.69 ? 4    DA  E "C4'" 1 
ATOM   69    O  "O4'" . DA  A  1 4    ? 4.474   -51.069  -4.364  1.00 171.47 ? 4    DA  E "O4'" 1 
ATOM   70    C  "C3'" . DA  A  1 4    ? 5.141   -50.231  -2.245  1.00 171.99 ? 4    DA  E "C3'" 1 
ATOM   71    O  "O3'" . DA  A  1 4    ? 6.332   -50.432  -1.482  1.00 172.21 ? 4    DA  E "O3'" 1 
ATOM   72    C  "C2'" . DA  A  1 4    ? 5.375   -49.172  -3.313  1.00 167.11 ? 4    DA  E "C2'" 1 
ATOM   73    C  "C1'" . DA  A  1 4    ? 5.232   -49.909  -4.637  1.00 165.96 ? 4    DA  E "C1'" 1 
ATOM   74    N  N9    . DA  A  1 4    ? 4.545   -49.158  -5.687  1.00 160.80 ? 4    DA  E N9    1 
ATOM   75    C  C8    . DA  A  1 4    ? 3.409   -48.393  -5.592  1.00 160.59 ? 4    DA  E C8    1 
ATOM   76    N  N7    . DA  A  1 4    ? 3.045   -47.845  -6.726  1.00 159.74 ? 4    DA  E N7    1 
ATOM   77    C  C5    . DA  A  1 4    ? 4.009   -48.273  -7.628  1.00 167.41 ? 4    DA  E C5    1 
ATOM   78    C  C6    . DA  A  1 4    ? 4.194   -48.036  -9.003  1.00 170.77 ? 4    DA  E C6    1 
ATOM   79    N  N6    . DA  A  1 4    ? 3.380   -47.276  -9.740  1.00 167.06 ? 4    DA  E N6    1 
ATOM   80    N  N1    . DA  A  1 4    ? 5.257   -48.617  -9.604  1.00 171.85 ? 4    DA  E N1    1 
ATOM   81    C  C2    . DA  A  1 4    ? 6.075   -49.377  -8.864  1.00 171.41 ? 4    DA  E C2    1 
ATOM   82    N  N3    . DA  A  1 4    ? 6.009   -49.669  -7.565  1.00 168.50 ? 4    DA  E N3    1 
ATOM   83    C  C4    . DA  A  1 4    ? 4.939   -49.083  -7.000  1.00 166.20 ? 4    DA  E C4    1 
ATOM   84    P  P     . DA  A  1 5    ? 6.162   -50.943  0.008   1.00 195.68 ? 5    DA  E P     1 
ATOM   85    O  OP1   . DA  A  1 5    ? 5.640   -52.334  0.006   1.00 199.26 ? 5    DA  E OP1   1 
ATOM   86    O  OP2   . DA  A  1 5    ? 5.442   -49.884  0.759   1.00 211.30 ? 5    DA  E OP2   1 
ATOM   87    O  "O5'" . DA  A  1 5    ? 7.669   -50.968  0.510   1.00 187.92 ? 5    DA  E "O5'" 1 
ATOM   88    C  "C5'" . DA  A  1 5    ? 8.223   -52.153  1.107   1.00 193.98 ? 5    DA  E "C5'" 1 
ATOM   89    C  "C4'" . DA  A  1 5    ? 9.731   -52.072  1.084   1.00 193.01 ? 5    DA  E "C4'" 1 
ATOM   90    O  "O4'" . DA  A  1 5    ? 10.143  -51.287  -0.057  1.00 183.44 ? 5    DA  E "O4'" 1 
ATOM   91    C  "C3'" . DA  A  1 5    ? 10.365  -51.384  2.289   1.00 190.17 ? 5    DA  E "C3'" 1 
ATOM   92    O  "O3'" . DA  A  1 5    ? 11.694  -51.868  2.486   1.00 187.15 ? 5    DA  E "O3'" 1 
ATOM   93    C  "C2'" . DA  A  1 5    ? 10.402  -49.932  1.860   1.00 181.79 ? 5    DA  E "C2'" 1 
ATOM   94    C  "C1'" . DA  A  1 5    ? 10.699  -50.052  0.376   1.00 179.48 ? 5    DA  E "C1'" 1 
ATOM   95    N  N9    . DA  A  1 5    ? 10.123  -48.996  -0.449  1.00 181.31 ? 5    DA  E N9    1 
ATOM   96    C  C8    . DA  A  1 5    ? 8.948   -48.307  -0.266  1.00 179.71 ? 5    DA  E C8    1 
ATOM   97    N  N7    . DA  A  1 5    ? 8.707   -47.418  -1.199  1.00 179.68 ? 5    DA  E N7    1 
ATOM   98    C  C5    . DA  A  1 5    ? 9.791   -47.534  -2.059  1.00 181.92 ? 5    DA  E C5    1 
ATOM   99    C  C6    . DA  A  1 5    ? 10.133  -46.863  -3.246  1.00 181.27 ? 5    DA  E C6    1 
ATOM   100   N  N6    . DA  A  1 5    ? 9.384   -45.906  -3.797  1.00 190.43 ? 5    DA  E N6    1 
ATOM   101   N  N1    . DA  A  1 5    ? 11.288  -47.213  -3.856  1.00 176.71 ? 5    DA  E N1    1 
ATOM   102   C  C2    . DA  A  1 5    ? 12.041  -48.173  -3.301  1.00 178.40 ? 5    DA  E C2    1 
ATOM   103   N  N3    . DA  A  1 5    ? 11.826  -48.874  -2.188  1.00 171.82 ? 5    DA  E N3    1 
ATOM   104   C  C4    . DA  A  1 5    ? 10.669  -48.504  -1.610  1.00 183.32 ? 5    DA  E C4    1 
ATOM   105   P  P     . DC  A  1 6    ? 12.486  -51.744  3.875   1.00 187.58 ? 6    DC  E P     1 
ATOM   106   O  OP1   . DC  A  1 6    ? 12.471  -53.046  4.600   1.00 183.60 ? 6    DC  E OP1   1 
ATOM   107   O  OP2   . DC  A  1 6    ? 12.073  -50.501  4.581   1.00 192.20 ? 6    DC  E OP2   1 
ATOM   108   O  "O5'" . DC  A  1 6    ? 13.967  -51.520  3.339   1.00 180.98 ? 6    DC  E "O5'" 1 
ATOM   109   C  "C5'" . DC  A  1 6    ? 14.384  -52.032  2.061   1.00 179.88 ? 6    DC  E "C5'" 1 
ATOM   110   C  "C4'" . DC  A  1 6    ? 15.316  -51.049  1.397   1.00 180.39 ? 6    DC  E "C4'" 1 
ATOM   111   O  "O4'" . DC  A  1 6    ? 14.541  -50.025  0.726   1.00 182.04 ? 6    DC  E "O4'" 1 
ATOM   112   C  "C3'" . DC  A  1 6    ? 16.248  -50.307  2.358   1.00 179.32 ? 6    DC  E "C3'" 1 
ATOM   113   O  "O3'" . DC  A  1 6    ? 17.537  -50.153  1.761   1.00 175.50 ? 6    DC  E "O3'" 1 
ATOM   114   C  "C2'" . DC  A  1 6    ? 15.571  -48.961  2.526   1.00 178.31 ? 6    DC  E "C2'" 1 
ATOM   115   C  "C1'" . DC  A  1 6    ? 15.019  -48.752  1.128   1.00 178.44 ? 6    DC  E "C1'" 1 
ATOM   116   N  N1    . DC  A  1 6    ? 13.918  -47.780  0.974   1.00 179.72 ? 6    DC  E N1    1 
ATOM   117   C  C2    . DC  A  1 6    ? 13.783  -47.121  -0.254  1.00 181.38 ? 6    DC  E C2    1 
ATOM   118   O  O2    . DC  A  1 6    ? 14.582  -47.379  -1.168  1.00 179.05 ? 6    DC  E O2    1 
ATOM   119   N  N3    . DC  A  1 6    ? 12.789  -46.218  -0.413  1.00 183.93 ? 6    DC  E N3    1 
ATOM   120   C  C4    . DC  A  1 6    ? 11.943  -45.973  0.590   1.00 178.75 ? 6    DC  E C4    1 
ATOM   121   N  N4    . DC  A  1 6    ? 10.974  -45.078  0.384   1.00 175.98 ? 6    DC  E N4    1 
ATOM   122   C  C5    . DC  A  1 6    ? 12.055  -46.631  1.850   1.00 175.91 ? 6    DC  E C5    1 
ATOM   123   C  C6    . DC  A  1 6    ? 13.050  -47.516  1.998   1.00 174.17 ? 6    DC  E C6    1 
ATOM   124   P  P     . DG  A  1 7    ? 18.837  -49.971  2.674   1.00 173.09 ? 7    DG  E P     1 
ATOM   125   O  OP1   . DG  A  1 7    ? 19.553  -51.269  2.764   1.00 175.26 ? 7    DG  E OP1   1 
ATOM   126   O  OP2   . DG  A  1 7    ? 18.442  -49.244  3.912   1.00 185.67 ? 7    DG  E OP2   1 
ATOM   127   O  "O5'" . DG  A  1 7    ? 19.755  -48.997  1.815   1.00 177.51 ? 7    DG  E "O5'" 1 
ATOM   128   C  "C5'" . DG  A  1 7    ? 19.788  -49.078  0.374   1.00 179.60 ? 7    DG  E "C5'" 1 
ATOM   129   C  "C4'" . DG  A  1 7    ? 19.794  -47.692  -0.230  1.00 176.06 ? 7    DG  E "C4'" 1 
ATOM   130   O  "O4'" . DG  A  1 7    ? 18.462  -47.122  -0.229  1.00 172.43 ? 7    DG  E "O4'" 1 
ATOM   131   C  "C3'" . DG  A  1 7    ? 20.696  -46.684  0.492   1.00 174.50 ? 7    DG  E "C3'" 1 
ATOM   132   O  "O3'" . DG  A  1 7    ? 21.652  -46.152  -0.422  1.00 175.96 ? 7    DG  E "O3'" 1 
ATOM   133   C  "C2'" . DG  A  1 7    ? 19.747  -45.605  0.990   1.00 169.49 ? 7    DG  E "C2'" 1 
ATOM   134   C  "C1'" . DG  A  1 7    ? 18.557  -45.739  0.063   1.00 168.62 ? 7    DG  E "C1'" 1 
ATOM   135   N  N9    . DG  A  1 7    ? 17.286  -45.306  0.637   1.00 167.57 ? 7    DG  E N9    1 
ATOM   136   C  C8    . DG  A  1 7    ? 16.693  -45.755  1.794   1.00 166.73 ? 7    DG  E C8    1 
ATOM   137   N  N7    . DG  A  1 7    ? 15.555  -45.168  2.047   1.00 165.57 ? 7    DG  E N7    1 
ATOM   138   C  C5    . DG  A  1 7    ? 15.387  -44.276  0.997   1.00 169.01 ? 7    DG  E C5    1 
ATOM   139   C  C6    . DG  A  1 7    ? 14.337  -43.355  0.726   1.00 174.64 ? 7    DG  E C6    1 
ATOM   140   O  O6    . DG  A  1 7    ? 13.308  -43.142  1.381   1.00 170.32 ? 7    DG  E O6    1 
ATOM   141   N  N1    . DG  A  1 7    ? 14.572  -42.641  -0.445  1.00 173.36 ? 7    DG  E N1    1 
ATOM   142   C  C2    . DG  A  1 7    ? 15.676  -42.785  -1.248  1.00 167.56 ? 7    DG  E C2    1 
ATOM   143   N  N2    . DG  A  1 7    ? 15.722  -42.003  -2.337  1.00 171.61 ? 7    DG  E N2    1 
ATOM   144   N  N3    . DG  A  1 7    ? 16.659  -43.638  -1.010  1.00 162.50 ? 7    DG  E N3    1 
ATOM   145   C  C4    . DG  A  1 7    ? 16.450  -44.346  0.121   1.00 164.73 ? 7    DG  E C4    1 
ATOM   146   P  P     . DA  A  1 8    ? 22.997  -45.480  0.103   1.00 178.68 ? 8    DA  E P     1 
ATOM   147   O  OP1   . DA  A  1 8    ? 24.124  -46.391  -0.220  1.00 189.24 ? 8    DA  E OP1   1 
ATOM   148   O  OP2   . DA  A  1 8    ? 22.797  -45.015  1.502   1.00 183.00 ? 8    DA  E OP2   1 
ATOM   149   O  "O5'" . DA  A  1 8    ? 23.107  -44.196  -0.833  1.00 175.40 ? 8    DA  E "O5'" 1 
ATOM   150   C  "C5'" . DA  A  1 8    ? 22.502  -44.169  -2.140  1.00 171.43 ? 8    DA  E "C5'" 1 
ATOM   151   C  "C4'" . DA  A  1 8    ? 21.849  -42.826  -2.381  1.00 164.82 ? 8    DA  E "C4'" 1 
ATOM   152   O  "O4'" . DA  A  1 8    ? 20.712  -42.662  -1.502  1.00 160.55 ? 8    DA  E "O4'" 1 
ATOM   153   C  "C3'" . DA  A  1 8    ? 22.764  -41.622  -2.134  1.00 158.93 ? 8    DA  E "C3'" 1 
ATOM   154   O  "O3'" . DA  A  1 8    ? 22.805  -40.796  -3.300  1.00 158.69 ? 8    DA  E "O3'" 1 
ATOM   155   C  "C2'" . DA  A  1 8    ? 22.134  -40.906  -0.951  1.00 153.47 ? 8    DA  E "C2'" 1 
ATOM   156   C  "C1'" . DA  A  1 8    ? 20.685  -41.331  -1.028  1.00 152.22 ? 8    DA  E "C1'" 1 
ATOM   157   N  N9    . DA  A  1 8    ? 19.974  -41.321  0.248   1.00 155.70 ? 8    DA  E N9    1 
ATOM   158   C  C8    . DA  A  1 8    ? 20.399  -41.785  1.471   1.00 157.98 ? 8    DA  E C8    1 
ATOM   159   N  N7    . DA  A  1 8    ? 19.516  -41.634  2.429   1.00 151.93 ? 8    DA  E N7    1 
ATOM   160   C  C5    . DA  A  1 8    ? 18.433  -41.041  1.794   1.00 155.34 ? 8    DA  E C5    1 
ATOM   161   C  C6    . DA  A  1 8    ? 17.176  -40.617  2.262   1.00 158.30 ? 8    DA  E C6    1 
ATOM   162   N  N6    . DA  A  1 8    ? 16.777  -40.740  3.530   1.00 165.43 ? 8    DA  E N6    1 
ATOM   163   N  N1    . DA  A  1 8    ? 16.327  -40.061  1.368   1.00 158.96 ? 8    DA  E N1    1 
ATOM   164   C  C2    . DA  A  1 8    ? 16.727  -39.938  0.094   1.00 155.29 ? 8    DA  E C2    1 
ATOM   165   N  N3    . DA  A  1 8    ? 17.883  -40.295  -0.465  1.00 151.68 ? 8    DA  E N3    1 
ATOM   166   C  C4    . DA  A  1 8    ? 18.701  -40.846  0.449   1.00 155.59 ? 8    DA  E C4    1 
ATOM   167   P  P     . DC  A  1 9    ? 23.964  -39.717  -3.527  1.00 157.91 ? 9    DC  E P     1 
ATOM   168   O  OP1   . DC  A  1 9    ? 24.576  -39.960  -4.857  1.00 166.15 ? 9    DC  E OP1   1 
ATOM   169   O  OP2   . DC  A  1 9    ? 24.830  -39.685  -2.324  1.00 157.34 ? 9    DC  E OP2   1 
ATOM   170   O  "O5'" . DC  A  1 9    ? 23.145  -38.353  -3.604  1.00 164.92 ? 9    DC  E "O5'" 1 
ATOM   171   C  "C5'" . DC  A  1 9    ? 21.886  -38.274  -4.308  1.00 169.70 ? 9    DC  E "C5'" 1 
ATOM   172   C  "C4'" . DC  A  1 9    ? 21.081  -37.089  -3.826  1.00 168.67 ? 9    DC  E "C4'" 1 
ATOM   173   O  "O4'" . DC  A  1 9    ? 20.419  -37.412  -2.579  1.00 169.51 ? 9    DC  E "O4'" 1 
ATOM   174   C  "C3'" . DC  A  1 9    ? 21.902  -35.828  -3.545  1.00 177.89 ? 9    DC  E "C3'" 1 
ATOM   175   O  "O3'" . DC  A  1 9    ? 21.183  -34.652  -3.930  1.00 182.81 ? 9    DC  E "O3'" 1 
ATOM   176   C  "C2'" . DC  A  1 9    ? 22.060  -35.848  -2.037  1.00 176.95 ? 9    DC  E "C2'" 1 
ATOM   177   C  "C1'" . DC  A  1 9    ? 20.715  -36.410  -1.614  1.00 175.43 ? 9    DC  E "C1'" 1 
ATOM   178   N  N1    . DC  A  1 9    ? 20.649  -37.026  -0.271  1.00 176.50 ? 9    DC  E N1    1 
ATOM   179   C  C2    . DC  A  1 9    ? 19.434  -36.995  0.427   1.00 170.66 ? 9    DC  E C2    1 
ATOM   180   O  O2    . DC  A  1 9    ? 18.455  -36.434  -0.091  1.00 161.73 ? 9    DC  E O2    1 
ATOM   181   N  N3    . DC  A  1 9    ? 19.363  -37.560  1.654   1.00 175.05 ? 9    DC  E N3    1 
ATOM   182   C  C4    . DC  A  1 9    ? 20.442  -38.143  2.185   1.00 177.82 ? 9    DC  E C4    1 
ATOM   183   N  N4    . DC  A  1 9    ? 20.326  -38.690  3.398   1.00 177.64 ? 9    DC  E N4    1 
ATOM   184   C  C5    . DC  A  1 9    ? 21.690  -38.187  1.498   1.00 177.62 ? 9    DC  E C5    1 
ATOM   185   C  C6    . DC  A  1 9    ? 21.748  -37.624  0.284   1.00 177.98 ? 9    DC  E C6    1 
ATOM   186   P  P     . DG  A  1 10   ? 21.915  -33.293  -4.362  1.00 164.86 ? 10   DG  E P     1 
ATOM   187   O  OP1   . DG  A  1 10   ? 22.249  -33.445  -5.803  1.00 175.81 ? 10   DG  E OP1   1 
ATOM   188   O  OP2   . DG  A  1 10   ? 22.992  -32.963  -3.392  1.00 164.99 ? 10   DG  E OP2   1 
ATOM   189   O  "O5'" . DG  A  1 10   ? 20.760  -32.211  -4.178  1.00 163.17 ? 10   DG  E "O5'" 1 
ATOM   190   C  "C5'" . DG  A  1 10   ? 19.375  -32.598  -3.996  1.00 166.38 ? 10   DG  E "C5'" 1 
ATOM   191   C  "C4'" . DG  A  1 10   ? 18.747  -31.832  -2.853  1.00 166.19 ? 10   DG  E "C4'" 1 
ATOM   192   O  "O4'" . DG  A  1 10   ? 18.867  -32.595  -1.626  1.00 162.34 ? 10   DG  E "O4'" 1 
ATOM   193   C  "C3'" . DG  A  1 10   ? 19.377  -30.465  -2.558  1.00 170.15 ? 10   DG  E "C3'" 1 
ATOM   194   O  "O3'" . DG  A  1 10   ? 18.368  -29.501  -2.239  1.00 165.82 ? 10   DG  E "O3'" 1 
ATOM   195   C  "C2'" . DG  A  1 10   ? 20.256  -30.744  -1.353  1.00 168.99 ? 10   DG  E "C2'" 1 
ATOM   196   C  "C1'" . DG  A  1 10   ? 19.403  -31.755  -0.615  1.00 164.35 ? 10   DG  E "C1'" 1 
ATOM   197   N  N9    . DG  A  1 10   ? 20.110  -32.597  0.340   1.00 163.81 ? 10   DG  E N9    1 
ATOM   198   C  C8    . DG  A  1 10   ? 21.350  -33.171  0.193   1.00 167.43 ? 10   DG  E C8    1 
ATOM   199   N  N7    . DG  A  1 10   ? 21.711  -33.884  1.225   1.00 162.72 ? 10   DG  E N7    1 
ATOM   200   C  C5    . DG  A  1 10   ? 20.646  -33.772  2.107   1.00 170.87 ? 10   DG  E C5    1 
ATOM   201   C  C6    . DG  A  1 10   ? 20.459  -34.329  3.402   1.00 172.78 ? 10   DG  E C6    1 
ATOM   202   O  O6    . DG  A  1 10   ? 21.225  -35.056  4.048   1.00 173.63 ? 10   DG  E O6    1 
ATOM   203   N  N1    . DG  A  1 10   ? 19.230  -33.966  3.943   1.00 166.98 ? 10   DG  E N1    1 
ATOM   204   C  C2    . DG  A  1 10   ? 18.299  -33.170  3.321   1.00 167.04 ? 10   DG  E C2    1 
ATOM   205   N  N2    . DG  A  1 10   ? 17.172  -32.930  4.009   1.00 164.20 ? 10   DG  E N2    1 
ATOM   206   N  N3    . DG  A  1 10   ? 18.459  -32.648  2.115   1.00 166.79 ? 10   DG  E N3    1 
ATOM   207   C  C4    . DG  A  1 10   ? 19.648  -32.984  1.574   1.00 165.16 ? 10   DG  E C4    1 
ATOM   208   P  P     . DG  A  1 11   ? 18.613  -27.916  -2.346  1.00 171.91 ? 11   DG  E P     1 
ATOM   209   O  OP1   . DG  A  1 11   ? 18.071  -27.459  -3.665  1.00 177.40 ? 11   DG  E OP1   1 
ATOM   210   O  OP2   . DG  A  1 11   ? 20.020  -27.602  -1.960  1.00 157.50 ? 11   DG  E OP2   1 
ATOM   211   O  "O5'" . DG  A  1 11   ? 17.692  -27.295  -1.201  1.00 172.95 ? 11   DG  E "O5'" 1 
ATOM   212   C  "C5'" . DG  A  1 11   ? 16.379  -27.822  -0.902  1.00 164.72 ? 11   DG  E "C5'" 1 
ATOM   213   C  "C4'" . DG  A  1 11   ? 16.114  -27.743  0.585   1.00 160.00 ? 11   DG  E "C4'" 1 
ATOM   214   O  "O4'" . DG  A  1 11   ? 16.921  -28.724  1.283   1.00 150.44 ? 11   DG  E "O4'" 1 
ATOM   215   C  "C3'" . DG  A  1 11   ? 16.447  -26.387  1.217   1.00 164.38 ? 11   DG  E "C3'" 1 
ATOM   216   O  "O3'" . DG  A  1 11   ? 15.426  -25.955  2.127   1.00 163.24 ? 11   DG  E "O3'" 1 
ATOM   217   C  "C2'" . DG  A  1 11   ? 17.773  -26.635  1.915   1.00 163.66 ? 11   DG  E "C2'" 1 
ATOM   218   C  "C1'" . DG  A  1 11   ? 17.671  -28.097  2.312   1.00 159.81 ? 11   DG  E "C1'" 1 
ATOM   219   N  N9    . DG  A  1 11   ? 18.949  -28.797  2.435   1.00 162.58 ? 11   DG  E N9    1 
ATOM   220   C  C8    . DG  A  1 11   ? 19.995  -28.779  1.544   1.00 166.16 ? 11   DG  E C8    1 
ATOM   221   N  N7    . DG  A  1 11   ? 21.006  -29.513  1.926   1.00 166.61 ? 11   DG  E N7    1 
ATOM   222   C  C5    . DG  A  1 11   ? 20.607  -30.041  3.145   1.00 169.56 ? 11   DG  E C5    1 
ATOM   223   C  C6    . DG  A  1 11   ? 21.289  -30.911  4.037   1.00 169.92 ? 11   DG  E C6    1 
ATOM   224   O  O6    . DG  A  1 11   ? 22.422  -31.395  3.924   1.00 169.83 ? 11   DG  E O6    1 
ATOM   225   N  N1    . DG  A  1 11   ? 20.516  -31.204  5.158   1.00 162.29 ? 11   DG  E N1    1 
ATOM   226   C  C2    . DG  A  1 11   ? 19.253  -30.716  5.395   1.00 159.03 ? 11   DG  E C2    1 
ATOM   227   N  N2    . DG  A  1 11   ? 18.673  -31.106  6.535   1.00 160.81 ? 11   DG  E N2    1 
ATOM   228   N  N3    . DG  A  1 11   ? 18.605  -29.907  4.570   1.00 161.39 ? 11   DG  E N3    1 
ATOM   229   C  C4    . DG  A  1 11   ? 19.339  -29.610  3.474   1.00 170.41 ? 11   DG  E C4    1 
ATOM   230   P  P     . DC  A  1 12   ? 15.189  -24.409  2.523   1.00 170.15 ? 12   DC  E P     1 
ATOM   231   O  OP1   . DC  A  1 12   ? 13.747  -24.083  2.339   1.00 179.00 ? 12   DC  E OP1   1 
ATOM   232   O  OP2   . DC  A  1 12   ? 16.220  -23.533  1.910   1.00 164.84 ? 12   DC  E OP2   1 
ATOM   233   O  "O5'" . DC  A  1 12   ? 15.434  -24.405  4.097   1.00 169.12 ? 12   DC  E "O5'" 1 
ATOM   234   C  "C5'" . DC  A  1 12   ? 14.688  -25.287  4.966   1.00 169.22 ? 12   DC  E "C5'" 1 
ATOM   235   C  "C4'" . DC  A  1 12   ? 15.445  -25.538  6.252   1.00 166.77 ? 12   DC  E "C4'" 1 
ATOM   236   O  "O4'" . DC  A  1 12   ? 16.617  -26.346  5.995   1.00 163.22 ? 12   DC  E "O4'" 1 
ATOM   237   C  "C3'" . DC  A  1 12   ? 15.935  -24.271  6.960   1.00 164.91 ? 12   DC  E "C3'" 1 
ATOM   238   O  "O3'" . DC  A  1 12   ? 15.231  -24.078  8.191   1.00 170.90 ? 12   DC  E "O3'" 1 
ATOM   239   C  "C2'" . DC  A  1 12   ? 17.420  -24.502  7.197   1.00 163.19 ? 12   DC  E "C2'" 1 
ATOM   240   C  "C1'" . DC  A  1 12   ? 17.643  -25.975  6.893   1.00 159.16 ? 12   DC  E "C1'" 1 
ATOM   241   N  N1    . DC  A  1 12   ? 18.939  -26.277  6.252   1.00 153.40 ? 12   DC  E N1    1 
ATOM   242   C  C2    . DC  A  1 12   ? 19.798  -27.193  6.867   1.00 152.97 ? 12   DC  E C2    1 
ATOM   243   O  O2    . DC  A  1 12   ? 19.447  -27.724  7.933   1.00 154.63 ? 12   DC  E O2    1 
ATOM   244   N  N3    . DC  A  1 12   ? 20.990  -27.473  6.288   1.00 145.44 ? 12   DC  E N3    1 
ATOM   245   C  C4    . DC  A  1 12   ? 21.327  -26.885  5.138   1.00 140.66 ? 12   DC  E C4    1 
ATOM   246   N  N4    . DC  A  1 12   ? 22.510  -27.192  4.603   1.00 144.02 ? 12   DC  E N4    1 
ATOM   247   C  C5    . DC  A  1 12   ? 20.469  -25.951  4.490   1.00 143.71 ? 12   DC  E C5    1 
ATOM   248   C  C6    . DC  A  1 12   ? 19.298  -25.675  5.078   1.00 146.00 ? 12   DC  E C6    1 
ATOM   249   P  P     . DC  A  1 13   ? 15.312  -22.702  9.011   1.00 167.50 ? 13   DC  E P     1 
ATOM   250   O  OP1   . DC  A  1 13   ? 14.026  -22.495  9.721   1.00 170.22 ? 13   DC  E OP1   1 
ATOM   251   O  OP2   . DC  A  1 13   ? 15.861  -21.626  8.154   1.00 168.69 ? 13   DC  E OP2   1 
ATOM   252   O  "O5'" . DC  A  1 13   ? 16.429  -23.060  10.083  1.00 170.15 ? 13   DC  E "O5'" 1 
ATOM   253   C  "C5'" . DC  A  1 13   ? 16.420  -24.328  10.773  1.00 176.98 ? 13   DC  E "C5'" 1 
ATOM   254   C  "C4'" . DC  A  1 13   ? 17.727  -24.538  11.503  1.00 177.25 ? 13   DC  E "C4'" 1 
ATOM   255   O  "O4'" . DC  A  1 13   ? 18.740  -24.985  10.573  1.00 178.60 ? 13   DC  E "O4'" 1 
ATOM   256   C  "C3'" . DC  A  1 13   ? 18.290  -23.292  12.197  1.00 178.00 ? 13   DC  E "C3'" 1 
ATOM   257   O  "O3'" . DC  A  1 13   ? 18.527  -23.549  13.583  1.00 175.93 ? 13   DC  E "O3'" 1 
ATOM   258   C  "C2'" . DC  A  1 13   ? 19.580  -22.988  11.454  1.00 174.25 ? 13   DC  E "C2'" 1 
ATOM   259   C  "C1'" . DC  A  1 13   ? 19.961  -24.325  10.847  1.00 176.00 ? 13   DC  E "C1'" 1 
ATOM   260   N  N1    . DC  A  1 13   ? 20.735  -24.259  9.589   1.00 175.48 ? 13   DC  E N1    1 
ATOM   261   C  C2    . DC  A  1 13   ? 21.868  -25.069  9.464   1.00 168.35 ? 13   DC  E C2    1 
ATOM   262   O  O2    . DC  A  1 13   ? 22.181  -25.811  10.408  1.00 163.52 ? 13   DC  E O2    1 
ATOM   263   N  N3    . DC  A  1 13   ? 22.591  -25.023  8.321   1.00 164.60 ? 13   DC  E N3    1 
ATOM   264   C  C4    . DC  A  1 13   ? 22.213  -24.220  7.324   1.00 159.22 ? 13   DC  E C4    1 
ATOM   265   N  N4    . DC  A  1 13   ? 22.957  -24.210  6.213   1.00 152.64 ? 13   DC  E N4    1 
ATOM   266   C  C5    . DC  A  1 13   ? 21.060  -23.387  7.423   1.00 162.70 ? 13   DC  E C5    1 
ATOM   267   C  C6    . DC  A  1 13   ? 20.356  -23.439  8.562   1.00 165.77 ? 13   DC  E C6    1 
ATOM   268   P  P     . DA  A  1 14   ? 18.782  -22.347  14.611  1.00 175.83 ? 14   DA  E P     1 
ATOM   269   O  OP1   . DA  A  1 14   ? 17.796  -22.452  15.713  1.00 174.07 ? 14   DA  E OP1   1 
ATOM   270   O  OP2   . DA  A  1 14   ? 18.931  -21.064  13.874  1.00 171.74 ? 14   DA  E OP2   1 
ATOM   271   O  "O5'" . DA  A  1 14   ? 20.199  -22.779  15.190  1.00 179.58 ? 14   DA  E "O5'" 1 
ATOM   272   C  "C5'" . DA  A  1 14   ? 20.511  -24.173  15.389  1.00 188.45 ? 14   DA  E "C5'" 1 
ATOM   273   C  "C4'" . DA  A  1 14   ? 22.005  -24.392  15.350  1.00 187.87 ? 14   DA  E "C4'" 1 
ATOM   274   O  "O4'" . DA  A  1 14   ? 22.479  -24.340  13.982  1.00 177.92 ? 14   DA  E "O4'" 1 
ATOM   275   C  "C3'" . DA  A  1 14   ? 22.822  -23.359  16.130  1.00 185.95 ? 14   DA  E "C3'" 1 
ATOM   276   O  "O3'" . DA  A  1 14   ? 23.737  -24.054  16.982  1.00 188.53 ? 14   DA  E "O3'" 1 
ATOM   277   C  "C2'" . DA  A  1 14   ? 23.515  -22.550  15.045  1.00 180.67 ? 14   DA  E "C2'" 1 
ATOM   278   C  "C1'" . DA  A  1 14   ? 23.672  -23.578  13.944  1.00 177.08 ? 14   DA  E "C1'" 1 
ATOM   279   N  N9    . DA  A  1 14   ? 23.818  -23.044  12.591  1.00 173.96 ? 14   DA  E N9    1 
ATOM   280   C  C8    . DA  A  1 14   ? 23.064  -22.075  11.976  1.00 174.68 ? 14   DA  E C8    1 
ATOM   281   N  N7    . DA  A  1 14   ? 23.432  -21.823  10.743  1.00 174.97 ? 14   DA  E N7    1 
ATOM   282   C  C5    . DA  A  1 14   ? 24.495  -22.688  10.528  1.00 166.24 ? 14   DA  E C5    1 
ATOM   283   C  C6    . DA  A  1 14   ? 25.323  -22.911  9.416   1.00 164.27 ? 14   DA  E C6    1 
ATOM   284   N  N6    . DA  A  1 14   ? 25.207  -22.249  8.262   1.00 169.29 ? 14   DA  E N6    1 
ATOM   285   N  N1    . DA  A  1 14   ? 26.291  -23.846  9.531   1.00 160.71 ? 14   DA  E N1    1 
ATOM   286   C  C2    . DA  A  1 14   ? 26.414  -24.503  10.691  1.00 158.39 ? 14   DA  E C2    1 
ATOM   287   N  N3    . DA  A  1 14   ? 25.699  -24.380  11.806  1.00 159.69 ? 14   DA  E N3    1 
ATOM   288   C  C4    . DA  A  1 14   ? 24.743  -23.448  11.657  1.00 167.87 ? 14   DA  E C4    1 
ATOM   289   P  P     . DG  A  1 15   ? 24.561  -23.327  18.140  1.00 198.82 ? 15   DG  E P     1 
ATOM   290   O  OP1   . DG  A  1 15   ? 24.321  -24.034  19.426  1.00 205.60 ? 15   DG  E OP1   1 
ATOM   291   O  OP2   . DG  A  1 15   ? 24.356  -21.860  18.049  1.00 217.12 ? 15   DG  E OP2   1 
ATOM   292   O  "O5'" . DG  A  1 15   ? 26.049  -23.644  17.681  1.00 180.70 ? 15   DG  E "O5'" 1 
ATOM   293   C  "C5'" . DG  A  1 15   ? 26.422  -24.985  17.337  1.00 175.15 ? 15   DG  E "C5'" 1 
ATOM   294   C  "C4'" . DG  A  1 15   ? 27.727  -24.965  16.582  1.00 170.58 ? 15   DG  E "C4'" 1 
ATOM   295   O  "O4'" . DG  A  1 15   ? 27.510  -24.458  15.245  1.00 174.27 ? 15   DG  E "O4'" 1 
ATOM   296   C  "C3'" . DG  A  1 15   ? 28.800  -24.075  17.209  1.00 172.94 ? 15   DG  E "C3'" 1 
ATOM   297   O  "O3'" . DG  A  1 15   ? 30.027  -24.802  17.230  1.00 174.88 ? 15   DG  E "O3'" 1 
ATOM   298   C  "C2'" . DG  A  1 15   ? 28.863  -22.868  16.290  1.00 175.60 ? 15   DG  E "C2'" 1 
ATOM   299   C  "C1'" . DG  A  1 15   ? 28.474  -23.460  14.952  1.00 172.90 ? 15   DG  E "C1'" 1 
ATOM   300   N  N9    . DG  A  1 15   ? 27.874  -22.515  14.017  1.00 167.94 ? 15   DG  E N9    1 
ATOM   301   C  C8    . DG  A  1 15   ? 26.861  -21.622  14.270  1.00 173.02 ? 15   DG  E C8    1 
ATOM   302   N  N7    . DG  A  1 15   ? 26.531  -20.912  13.225  1.00 176.85 ? 15   DG  E N7    1 
ATOM   303   C  C5    . DG  A  1 15   ? 27.380  -21.362  12.223  1.00 173.53 ? 15   DG  E C5    1 
ATOM   304   C  C6    . DG  A  1 15   ? 27.495  -20.962  10.867  1.00 171.96 ? 15   DG  E C6    1 
ATOM   305   O  O6    . DG  A  1 15   ? 26.842  -20.105  10.258  1.00 161.88 ? 15   DG  E O6    1 
ATOM   306   N  N1    . DG  A  1 15   ? 28.492  -21.676  10.206  1.00 175.23 ? 15   DG  E N1    1 
ATOM   307   C  C2    . DG  A  1 15   ? 29.272  -22.653  10.775  1.00 167.45 ? 15   DG  E C2    1 
ATOM   308   N  N2    . DG  A  1 15   ? 30.177  -23.233  9.972   1.00 164.94 ? 15   DG  E N2    1 
ATOM   309   N  N3    . DG  A  1 15   ? 29.172  -23.036  12.036  1.00 166.95 ? 15   DG  E N3    1 
ATOM   310   C  C4    . DG  A  1 15   ? 28.214  -22.353  12.697  1.00 168.09 ? 15   DG  E C4    1 
ATOM   311   P  P     . DT  A  1 16   ? 31.261  -24.249  18.057  1.00 173.66 ? 16   DT  E P     1 
ATOM   312   O  OP1   . DT  A  1 16   ? 31.782  -25.310  18.967  1.00 184.10 ? 16   DT  E OP1   1 
ATOM   313   O  OP2   . DT  A  1 16   ? 30.851  -22.928  18.597  1.00 177.10 ? 16   DT  E OP2   1 
ATOM   314   O  "O5'" . DT  A  1 16   ? 32.338  -24.016  16.916  1.00 168.14 ? 16   DT  E "O5'" 1 
ATOM   315   C  "C5'" . DT  A  1 16   ? 32.309  -24.797  15.714  1.00 176.89 ? 16   DT  E "C5'" 1 
ATOM   316   C  "C4'" . DT  A  1 16   ? 33.169  -24.136  14.664  1.00 181.93 ? 16   DT  E "C4'" 1 
ATOM   317   O  "O4'" . DT  A  1 16   ? 32.355  -23.210  13.902  1.00 180.55 ? 16   DT  E "O4'" 1 
ATOM   318   C  "C3'" . DT  A  1 16   ? 34.331  -23.312  15.227  1.00 185.28 ? 16   DT  E "C3'" 1 
ATOM   319   O  "O3'" . DT  A  1 16   ? 35.507  -23.499  14.429  1.00 182.17 ? 16   DT  E "O3'" 1 
ATOM   320   C  "C2'" . DT  A  1 16   ? 33.793  -21.892  15.180  1.00 188.82 ? 16   DT  E "C2'" 1 
ATOM   321   C  "C1'" . DT  A  1 16   ? 32.976  -21.936  13.898  1.00 186.76 ? 16   DT  E "C1'" 1 
ATOM   322   N  N1    . DT  A  1 16   ? 31.919  -20.906  13.715  1.00 188.85 ? 16   DT  E N1    1 
ATOM   323   C  C2    . DT  A  1 16   ? 31.568  -20.584  12.421  1.00 187.12 ? 16   DT  E C2    1 
ATOM   324   O  O2    . DT  A  1 16   ? 32.077  -21.106  11.442  1.00 181.84 ? 16   DT  E O2    1 
ATOM   325   N  N3    . DT  A  1 16   ? 30.589  -19.627  12.314  1.00 182.96 ? 16   DT  E N3    1 
ATOM   326   C  C4    . DT  A  1 16   ? 29.944  -18.972  13.347  1.00 178.28 ? 16   DT  E C4    1 
ATOM   327   O  O4    . DT  A  1 16   ? 29.089  -18.128  13.096  1.00 174.63 ? 16   DT  E O4    1 
ATOM   328   C  C5    . DT  A  1 16   ? 30.361  -19.357  14.676  1.00 179.22 ? 16   DT  E C5    1 
ATOM   329   C  C7    . DT  A  1 16   ? 29.719  -18.696  15.855  1.00 177.30 ? 16   DT  E C7    1 
ATOM   330   C  C6    . DT  A  1 16   ? 31.315  -20.291  14.793  1.00 186.79 ? 16   DT  E C6    1 
ATOM   331   P  P     . DG  A  1 17   ? 37.002  -23.262  14.993  1.00 187.97 ? 17   DG  E P     1 
ATOM   332   O  OP1   . DG  A  1 17   ? 37.661  -24.577  15.223  1.00 198.71 ? 17   DG  E OP1   1 
ATOM   333   O  OP2   . DG  A  1 17   ? 36.971  -22.254  16.085  1.00 177.46 ? 17   DG  E OP2   1 
ATOM   334   O  "O5'" . DG  A  1 17   ? 37.775  -22.622  13.757  1.00 185.71 ? 17   DG  E "O5'" 1 
ATOM   335   C  "C5'" . DG  A  1 17   ? 37.548  -23.096  12.416  1.00 181.30 ? 17   DG  E "C5'" 1 
ATOM   336   C  "C4'" . DG  A  1 17   ? 37.513  -21.932  11.454  1.00 178.61 ? 17   DG  E "C4'" 1 
ATOM   337   O  "O4'" . DG  A  1 17   ? 36.304  -21.154  11.639  1.00 168.60 ? 17   DG  E "O4'" 1 
ATOM   338   C  "C3'" . DG  A  1 17   ? 38.678  -20.952  11.616  1.00 185.35 ? 17   DG  E "C3'" 1 
ATOM   339   O  "O3'" . DG  A  1 17   ? 39.237  -20.661  10.332  1.00 192.65 ? 17   DG  E "O3'" 1 
ATOM   340   C  "C2'" . DG  A  1 17   ? 38.035  -19.726  12.242  1.00 183.89 ? 17   DG  E "C2'" 1 
ATOM   341   C  "C1'" . DG  A  1 17   ? 36.645  -19.778  11.647  1.00 177.27 ? 17   DG  E "C1'" 1 
ATOM   342   N  N9    . DG  A  1 17   ? 35.613  -19.059  12.389  1.00 174.37 ? 17   DG  E N9    1 
ATOM   343   C  C8    . DG  A  1 17   ? 35.308  -19.182  13.722  1.00 167.67 ? 17   DG  E C8    1 
ATOM   344   N  N7    . DG  A  1 17   ? 34.324  -18.410  14.096  1.00 170.51 ? 17   DG  E N7    1 
ATOM   345   C  C5    . DG  A  1 17   ? 33.957  -17.735  12.940  1.00 174.48 ? 17   DG  E C5    1 
ATOM   346   C  C6    . DG  A  1 17   ? 32.948  -16.754  12.723  1.00 179.76 ? 17   DG  E C6    1 
ATOM   347   O  O6    . DG  A  1 17   ? 32.150  -16.271  13.537  1.00 180.94 ? 17   DG  E O6    1 
ATOM   348   N  N1    . DG  A  1 17   ? 32.921  -16.332  11.399  1.00 178.19 ? 17   DG  E N1    1 
ATOM   349   C  C2    . DG  A  1 17   ? 33.755  -16.789  10.409  1.00 176.93 ? 17   DG  E C2    1 
ATOM   350   N  N2    . DG  A  1 17   ? 33.569  -16.261  9.191   1.00 183.58 ? 17   DG  E N2    1 
ATOM   351   N  N3    . DG  A  1 17   ? 34.699  -17.697  10.597  1.00 176.85 ? 17   DG  E N3    1 
ATOM   352   C  C4    . DG  A  1 17   ? 34.744  -18.122  11.878  1.00 175.19 ? 17   DG  E C4    1 
ATOM   353   P  P     . DC  A  1 18   ? 40.729  -20.119  10.173  1.00 193.00 ? 18   DC  E P     1 
ATOM   354   O  OP1   . DC  A  1 18   ? 41.511  -21.112  9.387   1.00 191.52 ? 18   DC  E OP1   1 
ATOM   355   O  OP2   . DC  A  1 18   ? 41.219  -19.680  11.510  1.00 192.23 ? 18   DC  E OP2   1 
ATOM   356   O  "O5'" . DC  A  1 18   ? 40.511  -18.818  9.282   1.00 194.38 ? 18   DC  E "O5'" 1 
ATOM   357   C  "C5'" . DC  A  1 18   ? 39.809  -18.876  8.028   1.00 196.65 ? 18   DC  E "C5'" 1 
ATOM   358   C  "C4'" . DC  A  1 18   ? 39.258  -17.511  7.686   1.00 203.04 ? 18   DC  E "C4'" 1 
ATOM   359   O  "O4'" . DC  A  1 18   ? 38.243  -17.145  8.655   1.00 206.20 ? 18   DC  E "O4'" 1 
ATOM   360   C  "C3'" . DC  A  1 18   ? 40.287  -16.374  7.704   1.00 208.27 ? 18   DC  E "C3'" 1 
ATOM   361   O  "O3'" . DC  A  1 18   ? 40.125  -15.499  6.574   1.00 210.61 ? 18   DC  E "O3'" 1 
ATOM   362   C  "C2'" . DC  A  1 18   ? 40.001  -15.663  9.016   1.00 205.26 ? 18   DC  E "C2'" 1 
ATOM   363   C  "C1'" . DC  A  1 18   ? 38.499  -15.835  9.130   1.00 201.61 ? 18   DC  E "C1'" 1 
ATOM   364   N  N1    . DC  A  1 18   ? 37.919  -15.720  10.483  1.00 206.08 ? 18   DC  E N1    1 
ATOM   365   C  C2    . DC  A  1 18   ? 36.677  -15.089  10.628  1.00 213.72 ? 18   DC  E C2    1 
ATOM   366   O  O2    . DC  A  1 18   ? 36.117  -14.625  9.621   1.00 210.70 ? 18   DC  E O2    1 
ATOM   367   N  N3    . DC  A  1 18   ? 36.126  -14.988  11.862  1.00 214.06 ? 18   DC  E N3    1 
ATOM   368   C  C4    . DC  A  1 18   ? 36.764  -15.494  12.921  1.00 206.51 ? 18   DC  E C4    1 
ATOM   369   N  N4    . DC  A  1 18   ? 36.186  -15.370  14.118  1.00 197.24 ? 18   DC  E N4    1 
ATOM   370   C  C5    . DC  A  1 18   ? 38.025  -16.149  12.800  1.00 205.81 ? 18   DC  E C5    1 
ATOM   371   C  C6    . DC  A  1 18   ? 38.560  -16.241  11.574  1.00 204.09 ? 18   DC  E C6    1 
ATOM   372   P  P     . DC  A  1 19   ? 41.274  -14.503  6.003   1.00 201.12 ? 19   DC  E P     1 
ATOM   373   O  OP1   . DC  A  1 19   ? 41.848  -15.115  4.781   1.00 198.34 ? 19   DC  E OP1   1 
ATOM   374   O  OP2   . DC  A  1 19   ? 42.193  -14.044  7.073   1.00 202.45 ? 19   DC  E OP2   1 
ATOM   375   O  "O5'" . DC  A  1 19   ? 40.410  -13.230  5.587   1.00 205.70 ? 19   DC  E "O5'" 1 
ATOM   376   C  "C5'" . DC  A  1 19   ? 39.247  -13.355  4.742   1.00 206.18 ? 19   DC  E "C5'" 1 
ATOM   377   C  "C4'" . DC  A  1 19   ? 38.235  -12.287  5.085   1.00 204.18 ? 19   DC  E "C4'" 1 
ATOM   378   O  "O4'" . DC  A  1 19   ? 37.750  -12.485  6.435   1.00 199.77 ? 19   DC  E "O4'" 1 
ATOM   379   C  "C3'" . DC  A  1 19   ? 38.770  -10.853  5.036   1.00 203.21 ? 19   DC  E "C3'" 1 
ATOM   380   O  "O3'" . DC  A  1 19   ? 37.805  -10.002  4.409   1.00 205.56 ? 19   DC  E "O3'" 1 
ATOM   381   C  "C2'" . DC  A  1 19   ? 38.959  -10.495  6.498   1.00 197.74 ? 19   DC  E "C2'" 1 
ATOM   382   C  "C1'" . DC  A  1 19   ? 37.813  -11.255  7.137   1.00 198.40 ? 19   DC  E "C1'" 1 
ATOM   383   N  N1    . DC  A  1 19   ? 37.970  -11.558  8.570   1.00 199.80 ? 19   DC  E N1    1 
ATOM   384   C  C2    . DC  A  1 19   ? 36.946  -11.205  9.456   1.00 193.63 ? 19   DC  E C2    1 
ATOM   385   O  O2    . DC  A  1 19   ? 35.937  -10.639  9.011   1.00 193.43 ? 19   DC  E O2    1 
ATOM   386   N  N3    . DC  A  1 19   ? 37.083  -11.486  10.772  1.00 191.51 ? 19   DC  E N3    1 
ATOM   387   C  C4    . DC  A  1 19   ? 38.185  -12.098  11.211  1.00 196.94 ? 19   DC  E C4    1 
ATOM   388   N  N4    . DC  A  1 19   ? 38.280  -12.356  12.517  1.00 198.77 ? 19   DC  E N4    1 
ATOM   389   C  C5    . DC  A  1 19   ? 39.238  -12.479  10.329  1.00 204.21 ? 19   DC  E C5    1 
ATOM   390   C  C6    . DC  A  1 19   ? 39.091  -12.191  9.029   1.00 206.55 ? 19   DC  E C6    1 
ATOM   391   P  P     . DA  A  1 20   ? 38.177  -8.551   3.868   1.00 210.50 ? 20   DA  E P     1 
ATOM   392   O  OP1   . DA  A  1 20   ? 37.758  -8.454   2.444   1.00 211.62 ? 20   DA  E OP1   1 
ATOM   393   O  OP2   . DA  A  1 20   ? 39.597  -8.319   4.234   1.00 203.79 ? 20   DA  E OP2   1 
ATOM   394   O  "O5'" . DA  A  1 20   ? 37.242  -7.605   4.751   1.00 212.06 ? 20   DA  E "O5'" 1 
ATOM   395   C  "C5'" . DA  A  1 20   ? 35.847  -7.394   4.426   1.00 210.59 ? 20   DA  E "C5'" 1 
ATOM   396   C  "C4'" . DA  A  1 20   ? 35.118  -6.779   5.600   1.00 208.21 ? 20   DA  E "C4'" 1 
ATOM   397   O  "O4'" . DA  A  1 20   ? 35.442  -7.523   6.790   1.00 201.41 ? 20   DA  E "O4'" 1 
ATOM   398   C  "C3'" . DA  A  1 20   ? 35.481  -5.320   5.898   1.00 211.64 ? 20   DA  E "C3'" 1 
ATOM   399   O  "O3'" . DA  A  1 20   ? 34.427  -4.418   5.537   1.00 213.72 ? 20   DA  E "O3'" 1 
ATOM   400   C  "C2'" . DA  A  1 20   ? 35.721  -5.275   7.401   1.00 210.19 ? 20   DA  E "C2'" 1 
ATOM   401   C  "C1'" . DA  A  1 20   ? 35.368  -6.663   7.907   1.00 205.30 ? 20   DA  E "C1'" 1 
ATOM   402   N  N9    . DA  A  1 20   ? 36.282  -7.179   8.922   1.00 204.04 ? 20   DA  E N9    1 
ATOM   403   C  C8    . DA  A  1 20   ? 37.446  -7.875   8.714   1.00 209.76 ? 20   DA  E C8    1 
ATOM   404   N  N7    . DA  A  1 20   ? 38.061  -8.219   9.819   1.00 214.49 ? 20   DA  E N7    1 
ATOM   405   C  C5    . DA  A  1 20   ? 37.241  -7.725   10.824  1.00 207.92 ? 20   DA  E C5    1 
ATOM   406   C  C6    . DA  A  1 20   ? 37.336  -7.763   12.226  1.00 206.71 ? 20   DA  E C6    1 
ATOM   407   N  N6    . DA  A  1 20   ? 38.338  -8.349   12.885  1.00 200.01 ? 20   DA  E N6    1 
ATOM   408   N  N1    . DA  A  1 20   ? 36.352  -7.170   12.937  1.00 216.28 ? 20   DA  E N1    1 
ATOM   409   C  C2    . DA  A  1 20   ? 35.346  -6.583   12.275  1.00 216.95 ? 20   DA  E C2    1 
ATOM   410   N  N3    . DA  A  1 20   ? 35.146  -6.484   10.962  1.00 214.71 ? 20   DA  E N3    1 
ATOM   411   C  C4    . DA  A  1 20   ? 36.145  -7.077   10.285  1.00 207.22 ? 20   DA  E C4    1 
ATOM   412   P  P     . DT  B  2 9    ? 34.827  -7.645   22.779  1.00 187.56 ? 9    DT  F P     1 
ATOM   413   O  OP1   . DT  B  2 9    ? 33.916  -7.619   23.953  1.00 183.69 ? 9    DT  F OP1   1 
ATOM   414   O  OP2   . DT  B  2 9    ? 35.700  -8.821   22.536  1.00 173.58 ? 9    DT  F OP2   1 
ATOM   415   O  "O5'" . DT  B  2 9    ? 33.952  -7.370   21.477  1.00 190.03 ? 9    DT  F "O5'" 1 
ATOM   416   C  "C5'" . DT  B  2 9    ? 33.132  -6.189   21.376  1.00 197.46 ? 9    DT  F "C5'" 1 
ATOM   417   C  "C4'" . DT  B  2 9    ? 32.377  -6.191   20.066  1.00 198.82 ? 9    DT  F "C4'" 1 
ATOM   418   O  "O4'" . DT  B  2 9    ? 33.311  -6.055   18.969  1.00 193.85 ? 9    DT  F "O4'" 1 
ATOM   419   C  "C3'" . DT  B  2 9    ? 31.574  -7.467   19.791  1.00 202.39 ? 9    DT  F "C3'" 1 
ATOM   420   O  "O3'" . DT  B  2 9    ? 30.264  -7.158   19.310  1.00 216.56 ? 9    DT  F "O3'" 1 
ATOM   421   C  "C2'" . DT  B  2 9    ? 32.396  -8.197   18.745  1.00 197.12 ? 9    DT  F "C2'" 1 
ATOM   422   C  "C1'" . DT  B  2 9    ? 33.059  -7.059   17.998  1.00 195.75 ? 9    DT  F "C1'" 1 
ATOM   423   N  N1    . DT  B  2 9    ? 34.345  -7.403   17.351  1.00 199.59 ? 9    DT  F N1    1 
ATOM   424   C  C2    . DT  B  2 9    ? 34.576  -6.935   16.076  1.00 198.74 ? 9    DT  F C2    1 
ATOM   425   O  O2    . DT  B  2 9    ? 33.770  -6.260   15.455  1.00 202.60 ? 9    DT  F O2    1 
ATOM   426   N  N3    . DT  B  2 9    ? 35.792  -7.291   15.548  1.00 194.95 ? 9    DT  F N3    1 
ATOM   427   C  C4    . DT  B  2 9    ? 36.775  -8.052   16.152  1.00 194.27 ? 9    DT  F C4    1 
ATOM   428   O  O4    . DT  B  2 9    ? 37.812  -8.300   15.548  1.00 193.78 ? 9    DT  F O4    1 
ATOM   429   C  C5    . DT  B  2 9    ? 36.467  -8.509   17.489  1.00 191.72 ? 9    DT  F C5    1 
ATOM   430   C  C7    . DT  B  2 9    ? 37.472  -9.340   18.222  1.00 186.54 ? 9    DT  F C7    1 
ATOM   431   C  C6    . DT  B  2 9    ? 35.284  -8.167   18.014  1.00 196.50 ? 9    DT  F C6    1 
ATOM   432   P  P     . DG  B  2 10   ? 29.244  -8.327   18.897  1.00 218.46 ? 10   DG  F P     1 
ATOM   433   O  OP1   . DG  B  2 10   ? 27.853  -7.882   19.204  1.00 227.02 ? 10   DG  F OP1   1 
ATOM   434   O  OP2   . DG  B  2 10   ? 29.737  -9.641   19.388  1.00 210.11 ? 10   DG  F OP2   1 
ATOM   435   O  "O5'" . DG  B  2 10   ? 29.408  -8.322   17.316  1.00 195.07 ? 10   DG  F "O5'" 1 
ATOM   436   C  "C5'" . DG  B  2 10   ? 29.091  -7.136   16.571  1.00 196.64 ? 10   DG  F "C5'" 1 
ATOM   437   C  "C4'" . DG  B  2 10   ? 29.113  -7.442   15.094  1.00 193.10 ? 10   DG  F "C4'" 1 
ATOM   438   O  "O4'" . DG  B  2 10   ? 30.466  -7.776   14.702  1.00 186.43 ? 10   DG  F "O4'" 1 
ATOM   439   C  "C3'" . DG  B  2 10   ? 28.253  -8.637   14.678  1.00 189.64 ? 10   DG  F "C3'" 1 
ATOM   440   O  "O3'" . DG  B  2 10   ? 27.702  -8.409   13.376  1.00 193.83 ? 10   DG  F "O3'" 1 
ATOM   441   C  "C2'" . DG  B  2 10   ? 29.254  -9.773   14.636  1.00 184.90 ? 10   DG  F "C2'" 1 
ATOM   442   C  "C1'" . DG  B  2 10   ? 30.470  -9.056   14.088  1.00 183.07 ? 10   DG  F "C1'" 1 
ATOM   443   N  N9    . DG  B  2 10   ? 31.763  -9.676   14.355  1.00 182.05 ? 10   DG  F N9    1 
ATOM   444   C  C8    . DG  B  2 10   ? 32.205  -10.235  15.530  1.00 182.86 ? 10   DG  F C8    1 
ATOM   445   N  N7    . DG  B  2 10   ? 33.424  -10.696  15.450  1.00 176.44 ? 10   DG  F N7    1 
ATOM   446   C  C5    . DG  B  2 10   ? 33.813  -10.412  14.149  1.00 176.57 ? 10   DG  F C5    1 
ATOM   447   C  C6    . DG  B  2 10   ? 35.038  -10.668  13.478  1.00 178.13 ? 10   DG  F C6    1 
ATOM   448   O  O6    . DG  B  2 10   ? 36.058  -11.212  13.916  1.00 177.05 ? 10   DG  F O6    1 
ATOM   449   N  N1    . DG  B  2 10   ? 35.005  -10.214  12.162  1.00 180.29 ? 10   DG  F N1    1 
ATOM   450   C  C2    . DG  B  2 10   ? 33.931  -9.600   11.566  1.00 182.90 ? 10   DG  F C2    1 
ATOM   451   N  N2    . DG  B  2 10   ? 34.088  -9.242   10.284  1.00 183.07 ? 10   DG  F N2    1 
ATOM   452   N  N3    . DG  B  2 10   ? 32.787  -9.353   12.181  1.00 184.83 ? 10   DG  F N3    1 
ATOM   453   C  C4    . DG  B  2 10   ? 32.799  -9.781   13.461  1.00 179.30 ? 10   DG  F C4    1 
ATOM   454   P  P     . DG  B  2 11   ? 26.298  -8.985   12.856  1.00 192.89 ? 11   DG  F P     1 
ATOM   455   O  OP1   . DG  B  2 11   ? 25.188  -8.094   13.302  1.00 196.08 ? 11   DG  F OP1   1 
ATOM   456   O  OP2   . DG  B  2 11   ? 26.275  -10.421  13.224  1.00 191.86 ? 11   DG  F OP2   1 
ATOM   457   O  "O5'" . DG  B  2 11   ? 26.405  -8.892   11.267  1.00 195.02 ? 11   DG  F "O5'" 1 
ATOM   458   C  "C5'" . DG  B  2 11   ? 27.548  -8.307   10.591  1.00 200.49 ? 11   DG  F "C5'" 1 
ATOM   459   C  "C4'" . DG  B  2 11   ? 28.032  -9.211   9.479   1.00 200.21 ? 11   DG  F "C4'" 1 
ATOM   460   O  "O4'" . DG  B  2 11   ? 29.270  -9.854   9.882   1.00 203.16 ? 11   DG  F "O4'" 1 
ATOM   461   C  "C3'" . DG  B  2 11   ? 27.081  -10.356  9.124   1.00 202.88 ? 11   DG  F "C3'" 1 
ATOM   462   O  "O3'" . DG  B  2 11   ? 27.200  -10.763  7.755   1.00 199.05 ? 11   DG  F "O3'" 1 
ATOM   463   C  "C2'" . DG  B  2 11   ? 27.590  -11.480  10.001  1.00 203.51 ? 11   DG  F "C2'" 1 
ATOM   464   C  "C1'" . DG  B  2 11   ? 29.088  -11.267  9.866   1.00 204.84 ? 11   DG  F "C1'" 1 
ATOM   465   N  N9    . DG  B  2 11   ? 29.925  -11.852  10.913  1.00 215.95 ? 11   DG  F N9    1 
ATOM   466   C  C8    . DG  B  2 11   ? 29.561  -12.163  12.202  1.00 219.65 ? 11   DG  F C8    1 
ATOM   467   N  N7    . DG  B  2 11   ? 30.534  -12.691  12.896  1.00 217.06 ? 11   DG  F N7    1 
ATOM   468   C  C5    . DG  B  2 11   ? 31.601  -12.742  12.010  1.00 210.97 ? 11   DG  F C5    1 
ATOM   469   C  C6    . DG  B  2 11   ? 32.926  -13.220  12.191  1.00 200.96 ? 11   DG  F C6    1 
ATOM   470   O  O6    . DG  B  2 11   ? 33.437  -13.714  13.204  1.00 196.94 ? 11   DG  F O6    1 
ATOM   471   N  N1    . DG  B  2 11   ? 33.680  -13.090  11.029  1.00 197.29 ? 11   DG  F N1    1 
ATOM   472   C  C2    . DG  B  2 11   ? 33.222  -12.565  9.845   1.00 198.43 ? 11   DG  F C2    1 
ATOM   473   N  N2    . DG  B  2 11   ? 34.103  -12.525  8.834   1.00 196.19 ? 11   DG  F N2    1 
ATOM   474   N  N3    . DG  B  2 11   ? 31.992  -12.111  9.664   1.00 202.77 ? 11   DG  F N3    1 
ATOM   475   C  C4    . DG  B  2 11   ? 31.241  -12.230  10.780  1.00 212.33 ? 11   DG  F C4    1 
ATOM   476   P  P     . DC  B  2 12   ? 26.416  -10.011  6.582   1.00 208.64 ? 12   DC  F P     1 
ATOM   477   O  OP1   . DC  B  2 12   ? 26.286  -8.565   6.923   1.00 210.34 ? 12   DC  F OP1   1 
ATOM   478   O  OP2   . DC  B  2 12   ? 25.208  -10.815  6.257   1.00 209.45 ? 12   DC  F OP2   1 
ATOM   479   O  "O5'" . DC  B  2 12   ? 27.391  -10.105  5.328   1.00 199.13 ? 12   DC  F "O5'" 1 
ATOM   480   C  "C5'" . DC  B  2 12   ? 28.808  -10.254  5.508   1.00 202.22 ? 12   DC  F "C5'" 1 
ATOM   481   C  "C4'" . DC  B  2 12   ? 29.203  -11.700  5.319   1.00 199.20 ? 12   DC  F "C4'" 1 
ATOM   482   O  "O4'" . DC  B  2 12   ? 29.717  -12.240  6.551   1.00 198.40 ? 12   DC  F "O4'" 1 
ATOM   483   C  "C3'" . DC  B  2 12   ? 28.069  -12.649  4.927   1.00 195.88 ? 12   DC  F "C3'" 1 
ATOM   484   O  "O3'" . DC  B  2 12   ? 27.834  -12.700  3.510   1.00 201.31 ? 12   DC  F "O3'" 1 
ATOM   485   C  "C2'" . DC  B  2 12   ? 28.505  -13.986  5.506   1.00 193.78 ? 12   DC  F "C2'" 1 
ATOM   486   C  "C1'" . DC  B  2 12   ? 29.659  -13.654  6.459   1.00 198.90 ? 12   DC  F "C1'" 1 
ATOM   487   N  N1    . DC  B  2 12   ? 29.544  -14.196  7.828   1.00 203.80 ? 12   DC  F N1    1 
ATOM   488   C  C2    . DC  B  2 12   ? 30.705  -14.634  8.478   1.00 200.80 ? 12   DC  F C2    1 
ATOM   489   O  O2    . DC  B  2 12   ? 31.789  -14.558  7.884   1.00 198.40 ? 12   DC  F O2    1 
ATOM   490   N  N3    . DC  B  2 12   ? 30.612  -15.131  9.735   1.00 201.01 ? 12   DC  F N3    1 
ATOM   491   C  C4    . DC  B  2 12   ? 29.425  -15.187  10.345  1.00 198.16 ? 12   DC  F C4    1 
ATOM   492   N  N4    . DC  B  2 12   ? 29.381  -15.685  11.584  1.00 188.36 ? 12   DC  F N4    1 
ATOM   493   C  C5    . DC  B  2 12   ? 28.228  -14.754  9.705   1.00 199.04 ? 12   DC  F C5    1 
ATOM   494   C  C6    . DC  B  2 12   ? 28.333  -14.265  8.460   1.00 203.08 ? 12   DC  F C6    1 
ATOM   495   P  P     . DA  B  2 13   ? 28.897  -12.938  2.312   1.00 203.20 ? 13   DA  F P     1 
ATOM   496   O  OP1   . DA  B  2 13   ? 29.843  -11.795  2.169   1.00 197.69 ? 13   DA  F OP1   1 
ATOM   497   O  OP2   . DA  B  2 13   ? 28.097  -13.371  1.135   1.00 195.54 ? 13   DA  F OP2   1 
ATOM   498   O  "O5'" . DA  B  2 13   ? 29.715  -14.213  2.802   1.00 199.01 ? 13   DA  F "O5'" 1 
ATOM   499   C  "C5'" . DA  B  2 13   ? 31.133  -14.160  3.056   1.00 186.58 ? 13   DA  F "C5'" 1 
ATOM   500   C  "C4'" . DA  B  2 13   ? 31.642  -15.540  3.408   1.00 177.81 ? 13   DA  F "C4'" 1 
ATOM   501   O  "O4'" . DA  B  2 13   ? 31.296  -15.845  4.777   1.00 175.63 ? 13   DA  F "O4'" 1 
ATOM   502   C  "C3'" . DA  B  2 13   ? 31.069  -16.670  2.546   1.00 174.47 ? 13   DA  F "C3'" 1 
ATOM   503   O  "O3'" . DA  B  2 13   ? 32.135  -17.359  1.897   1.00 173.32 ? 13   DA  F "O3'" 1 
ATOM   504   C  "C2'" . DA  B  2 13   ? 30.315  -17.563  3.519   1.00 174.72 ? 13   DA  F "C2'" 1 
ATOM   505   C  "C1'" . DA  B  2 13   ? 30.887  -17.196  4.878   1.00 177.37 ? 13   DA  F "C1'" 1 
ATOM   506   N  N9    . DA  B  2 13   ? 29.944  -17.295  5.992   1.00 173.46 ? 13   DA  F N9    1 
ATOM   507   C  C8    . DA  B  2 13   ? 28.602  -17.004  6.002   1.00 172.58 ? 13   DA  F C8    1 
ATOM   508   N  N7    . DA  B  2 13   ? 28.029  -17.190  7.166   1.00 175.17 ? 13   DA  F N7    1 
ATOM   509   C  C5    . DA  B  2 13   ? 29.063  -17.634  7.977   1.00 176.27 ? 13   DA  F C5    1 
ATOM   510   C  C6    . DA  B  2 13   ? 29.106  -18.015  9.330   1.00 182.15 ? 13   DA  F C6    1 
ATOM   511   N  N6    . DA  B  2 13   ? 28.044  -17.996  10.139  1.00 181.31 ? 13   DA  F N6    1 
ATOM   512   N  N1    . DA  B  2 13   ? 30.296  -18.404  9.834   1.00 183.84 ? 13   DA  F N1    1 
ATOM   513   C  C2    . DA  B  2 13   ? 31.362  -18.419  9.023   1.00 172.62 ? 13   DA  F C2    1 
ATOM   514   N  N3    . DA  B  2 13   ? 31.448  -18.082  7.738   1.00 166.60 ? 13   DA  F N3    1 
ATOM   515   C  C4    . DA  B  2 13   ? 30.248  -17.701  7.268   1.00 171.01 ? 13   DA  F C4    1 
ATOM   516   P  P     . DC  B  2 14   ? 31.839  -18.445  0.777   1.00 169.84 ? 14   DC  F P     1 
ATOM   517   O  OP1   . DC  B  2 14   ? 32.826  -18.224  -0.309  1.00 186.79 ? 14   DC  F OP1   1 
ATOM   518   O  OP2   . DC  B  2 14   ? 30.389  -18.444  0.471   1.00 163.30 ? 14   DC  F OP2   1 
ATOM   519   O  "O5'" . DC  B  2 14   ? 32.226  -19.793  1.530   1.00 172.98 ? 14   DC  F "O5'" 1 
ATOM   520   C  "C5'" . DC  B  2 14   ? 33.429  -19.898  2.320   1.00 166.36 ? 14   DC  F "C5'" 1 
ATOM   521   C  "C4'" . DC  B  2 14   ? 33.223  -20.899  3.432   1.00 165.51 ? 14   DC  F "C4'" 1 
ATOM   522   O  "O4'" . DC  B  2 14   ? 32.187  -20.422  4.316   1.00 161.81 ? 14   DC  F "O4'" 1 
ATOM   523   C  "C3'" . DC  B  2 14   ? 32.776  -22.291  2.969   1.00 167.68 ? 14   DC  F "C3'" 1 
ATOM   524   O  "O3'" . DC  B  2 14   ? 33.819  -23.248  3.180   1.00 167.97 ? 14   DC  F "O3'" 1 
ATOM   525   C  "C2'" . DC  B  2 14   ? 31.541  -22.602  3.805   1.00 165.02 ? 14   DC  F "C2'" 1 
ATOM   526   C  "C1'" . DC  B  2 14   ? 31.558  -21.545  4.894   1.00 163.63 ? 14   DC  F "C1'" 1 
ATOM   527   N  N1    . DC  B  2 14   ? 30.238  -21.119  5.388   1.00 163.91 ? 14   DC  F N1    1 
ATOM   528   C  C2    . DC  B  2 14   ? 29.989  -21.155  6.766   1.00 162.60 ? 14   DC  F C2    1 
ATOM   529   O  O2    . DC  B  2 14   ? 30.883  -21.559  7.528   1.00 155.72 ? 14   DC  F O2    1 
ATOM   530   N  N3    . DC  B  2 14   ? 28.782  -20.755  7.231   1.00 163.64 ? 14   DC  F N3    1 
ATOM   531   C  C4    . DC  B  2 14   ? 27.846  -20.329  6.379   1.00 162.67 ? 14   DC  F C4    1 
ATOM   532   N  N4    . DC  B  2 14   ? 26.670  -19.945  6.882   1.00 161.38 ? 14   DC  F N4    1 
ATOM   533   C  C5    . DC  B  2 14   ? 28.075  -20.276  4.972   1.00 162.89 ? 14   DC  F C5    1 
ATOM   534   C  C6    . DC  B  2 14   ? 29.274  -20.674  4.525   1.00 160.19 ? 14   DC  F C6    1 
ATOM   535   P  P     . DT  B  2 15   ? 33.807  -24.636  2.386   1.00 170.97 ? 15   DT  F P     1 
ATOM   536   O  OP1   . DT  B  2 15   ? 35.053  -24.769  1.585   1.00 172.41 ? 15   DT  F OP1   1 
ATOM   537   O  OP2   . DT  B  2 15   ? 32.491  -24.783  1.712   1.00 169.57 ? 15   DT  F OP2   1 
ATOM   538   O  "O5'" . DT  B  2 15   ? 33.858  -25.719  3.553   1.00 172.38 ? 15   DT  F "O5'" 1 
ATOM   539   C  "C5'" . DT  B  2 15   ? 34.422  -25.440  4.849   1.00 163.92 ? 15   DT  F "C5'" 1 
ATOM   540   C  "C4'" . DT  B  2 15   ? 33.556  -26.067  5.916   1.00 165.38 ? 15   DT  F "C4'" 1 
ATOM   541   O  "O4'" . DT  B  2 15   ? 32.319  -25.329  6.033   1.00 170.63 ? 15   DT  F "O4'" 1 
ATOM   542   C  "C3'" . DT  B  2 15   ? 33.160  -27.523  5.647   1.00 165.72 ? 15   DT  F "C3'" 1 
ATOM   543   O  "O3'" . DT  B  2 15   ? 33.734  -28.352  6.656   1.00 164.36 ? 15   DT  F "O3'" 1 
ATOM   544   C  "C2'" . DT  B  2 15   ? 31.636  -27.527  5.672   1.00 165.51 ? 15   DT  F "C2'" 1 
ATOM   545   C  "C1'" . DT  B  2 15   ? 31.289  -26.231  6.386   1.00 167.71 ? 15   DT  F "C1'" 1 
ATOM   546   N  N1    . DT  B  2 15   ? 29.993  -25.607  6.026   1.00 162.23 ? 15   DT  F N1    1 
ATOM   547   C  C2    . DT  B  2 15   ? 29.122  -25.285  7.044   1.00 160.96 ? 15   DT  F C2    1 
ATOM   548   O  O2    . DT  B  2 15   ? 29.361  -25.504  8.221   1.00 163.04 ? 15   DT  F O2    1 
ATOM   549   N  N3    . DT  B  2 15   ? 27.951  -24.699  6.631   1.00 160.89 ? 15   DT  F N3    1 
ATOM   550   C  C4    . DT  B  2 15   ? 27.578  -24.402  5.333   1.00 161.50 ? 15   DT  F C4    1 
ATOM   551   O  O4    . DT  B  2 15   ? 26.493  -23.871  5.115   1.00 174.52 ? 15   DT  F O4    1 
ATOM   552   C  C5    . DT  B  2 15   ? 28.540  -24.760  4.317   1.00 155.71 ? 15   DT  F C5    1 
ATOM   553   C  C7    . DT  B  2 15   ? 28.216  -24.486  2.882   1.00 142.37 ? 15   DT  F C7    1 
ATOM   554   C  C6    . DT  B  2 15   ? 29.685  -25.336  4.709   1.00 160.86 ? 15   DT  F C6    1 
ATOM   555   P  P     . DG  B  2 16   ? 33.665  -29.934  6.526   1.00 170.00 ? 16   DG  F P     1 
ATOM   556   O  OP1   . DG  B  2 16   ? 34.972  -30.471  6.985   1.00 166.15 ? 16   DG  F OP1   1 
ATOM   557   O  OP2   . DG  B  2 16   ? 33.140  -30.297  5.186   1.00 179.36 ? 16   DG  F OP2   1 
ATOM   558   O  "O5'" . DG  B  2 16   ? 32.541  -30.313  7.587   1.00 184.32 ? 16   DG  F "O5'" 1 
ATOM   559   C  "C5'" . DG  B  2 16   ? 32.620  -29.855  8.951   1.00 182.70 ? 16   DG  F "C5'" 1 
ATOM   560   C  "C4'" . DG  B  2 16   ? 31.296  -30.066  9.648   1.00 177.16 ? 16   DG  F "C4'" 1 
ATOM   561   O  "O4'" . DG  B  2 16   ? 30.315  -29.157  9.098   1.00 171.12 ? 16   DG  F "O4'" 1 
ATOM   562   C  "C3'" . DG  B  2 16   ? 30.702  -31.473  9.506   1.00 173.47 ? 16   DG  F "C3'" 1 
ATOM   563   O  "O3'" . DG  B  2 16   ? 30.252  -31.936  10.783  1.00 174.63 ? 16   DG  F "O3'" 1 
ATOM   564   C  "C2'" . DG  B  2 16   ? 29.540  -31.278  8.550   1.00 168.80 ? 16   DG  F "C2'" 1 
ATOM   565   C  "C1'" . DG  B  2 16   ? 29.108  -29.867  8.896   1.00 168.65 ? 16   DG  F "C1'" 1 
ATOM   566   N  N9    . DG  B  2 16   ? 28.334  -29.159  7.881   1.00 162.90 ? 16   DG  F N9    1 
ATOM   567   C  C8    . DG  B  2 16   ? 28.592  -29.092  6.534   1.00 159.90 ? 16   DG  F C8    1 
ATOM   568   N  N7    . DG  B  2 16   ? 27.721  -28.372  5.881   1.00 157.85 ? 16   DG  F N7    1 
ATOM   569   C  C5    . DG  B  2 16   ? 26.839  -27.931  6.857   1.00 154.49 ? 16   DG  F C5    1 
ATOM   570   C  C6    . DG  B  2 16   ? 25.688  -27.109  6.751   1.00 156.71 ? 16   DG  F C6    1 
ATOM   571   O  O6    . DG  B  2 16   ? 25.199  -26.592  5.738   1.00 162.66 ? 16   DG  F O6    1 
ATOM   572   N  N1    . DG  B  2 16   ? 25.085  -26.913  7.988   1.00 154.90 ? 16   DG  F N1    1 
ATOM   573   C  C2    . DG  B  2 16   ? 25.530  -27.439  9.175   1.00 155.40 ? 16   DG  F C2    1 
ATOM   574   N  N2    . DG  B  2 16   ? 24.812  -27.134  10.265  1.00 163.25 ? 16   DG  F N2    1 
ATOM   575   N  N3    . DG  B  2 16   ? 26.600  -28.206  9.288   1.00 155.52 ? 16   DG  F N3    1 
ATOM   576   C  C4    . DG  B  2 16   ? 27.203  -28.407  8.097   1.00 158.16 ? 16   DG  F C4    1 
ATOM   577   P  P     . DG  B  2 17   ? 30.038  -33.483  11.098  1.00 172.55 ? 17   DG  F P     1 
ATOM   578   O  OP1   . DG  B  2 17   ? 31.059  -33.934  12.079  1.00 171.98 ? 17   DG  F OP1   1 
ATOM   579   O  OP2   . DG  B  2 17   ? 29.909  -34.173  9.791   1.00 177.70 ? 17   DG  F OP2   1 
ATOM   580   O  "O5'" . DG  B  2 17   ? 28.627  -33.493  11.831  1.00 165.65 ? 17   DG  F "O5'" 1 
ATOM   581   C  "C5'" . DG  B  2 17   ? 28.287  -32.472  12.789  1.00 169.11 ? 17   DG  F "C5'" 1 
ATOM   582   C  "C4'" . DG  B  2 17   ? 26.786  -32.354  12.923  1.00 166.90 ? 17   DG  F "C4'" 1 
ATOM   583   O  "O4'" . DG  B  2 17   ? 26.259  -31.546  11.843  1.00 156.94 ? 17   DG  F "O4'" 1 
ATOM   584   C  "C3'" . DG  B  2 17   ? 26.045  -33.692  12.859  1.00 174.04 ? 17   DG  F "C3'" 1 
ATOM   585   O  "O3'" . DG  B  2 17   ? 25.020  -33.763  13.856  1.00 179.51 ? 17   DG  F "O3'" 1 
ATOM   586   C  "C2'" . DG  B  2 17   ? 25.475  -33.711  11.454  1.00 170.55 ? 17   DG  F "C2'" 1 
ATOM   587   C  "C1'" . DG  B  2 17   ? 25.196  -32.240  11.217  1.00 164.21 ? 17   DG  F "C1'" 1 
ATOM   588   N  N9    . DG  B  2 17   ? 25.151  -31.834  9.816   1.00 161.46 ? 17   DG  F N9    1 
ATOM   589   C  C8    . DG  B  2 17   ? 25.938  -32.286  8.785   1.00 156.98 ? 17   DG  F C8    1 
ATOM   590   N  N7    . DG  B  2 17   ? 25.643  -31.739  7.638   1.00 156.01 ? 17   DG  F N7    1 
ATOM   591   C  C5    . DG  B  2 17   ? 24.596  -30.877  7.928   1.00 166.91 ? 17   DG  F C5    1 
ATOM   592   C  C6    . DG  B  2 17   ? 23.857  -30.007  7.082   1.00 178.20 ? 17   DG  F C6    1 
ATOM   593   O  O6    . DG  B  2 17   ? 23.990  -29.816  5.865   1.00 181.00 ? 17   DG  F O6    1 
ATOM   594   N  N1    . DG  B  2 17   ? 22.876  -29.314  7.789   1.00 176.37 ? 17   DG  F N1    1 
ATOM   595   C  C2    . DG  B  2 17   ? 22.634  -29.444  9.136   1.00 172.38 ? 17   DG  F C2    1 
ATOM   596   N  N2    . DG  B  2 17   ? 21.642  -28.692  9.638   1.00 169.38 ? 17   DG  F N2    1 
ATOM   597   N  N3    . DG  B  2 17   ? 23.318  -30.248  9.935   1.00 170.86 ? 17   DG  F N3    1 
ATOM   598   C  C4    . DG  B  2 17   ? 24.275  -30.930  9.268   1.00 166.48 ? 17   DG  F C4    1 
ATOM   599   P  P     . DC  B  2 18   ? 24.231  -35.135  14.132  1.00 183.37 ? 18   DC  F P     1 
ATOM   600   O  OP1   . DC  B  2 18   ? 24.198  -35.348  15.602  1.00 194.36 ? 18   DC  F OP1   1 
ATOM   601   O  OP2   . DC  B  2 18   ? 24.743  -36.219  13.247  1.00 184.03 ? 18   DC  F OP2   1 
ATOM   602   O  "O5'" . DC  B  2 18   ? 22.757  -34.783  13.634  1.00 188.46 ? 18   DC  F "O5'" 1 
ATOM   603   C  "C5'" . DC  B  2 18   ? 22.029  -33.637  14.134  1.00 182.23 ? 18   DC  F "C5'" 1 
ATOM   604   C  "C4'" . DC  B  2 18   ? 20.822  -33.372  13.263  1.00 179.35 ? 18   DC  F "C4'" 1 
ATOM   605   O  "O4'" . DC  B  2 18   ? 21.253  -32.937  11.951  1.00 179.72 ? 18   DC  F "O4'" 1 
ATOM   606   C  "C3'" . DC  B  2 18   ? 19.918  -34.587  13.031  1.00 184.03 ? 18   DC  F "C3'" 1 
ATOM   607   O  "O3'" . DC  B  2 18   ? 18.538  -34.248  13.167  1.00 187.31 ? 18   DC  F "O3'" 1 
ATOM   608   C  "C2'" . DC  B  2 18   ? 20.205  -34.992  11.596  1.00 185.32 ? 18   DC  F "C2'" 1 
ATOM   609   C  "C1'" . DC  B  2 18   ? 20.567  -33.670  10.950  1.00 181.27 ? 18   DC  F "C1'" 1 
ATOM   610   N  N1    . DC  B  2 18   ? 21.447  -33.764  9.769   1.00 181.89 ? 18   DC  F N1    1 
ATOM   611   C  C2    . DC  B  2 18   ? 21.156  -32.982  8.643   1.00 188.55 ? 18   DC  F C2    1 
ATOM   612   O  O2    . DC  B  2 18   ? 20.161  -32.242  8.668   1.00 199.05 ? 18   DC  F O2    1 
ATOM   613   N  N3    . DC  B  2 18   ? 21.966  -33.054  7.559   1.00 179.30 ? 18   DC  F N3    1 
ATOM   614   C  C4    . DC  B  2 18   ? 23.028  -33.864  7.573   1.00 180.26 ? 18   DC  F C4    1 
ATOM   615   N  N4    . DC  B  2 18   ? 23.799  -33.905  6.483   1.00 175.86 ? 18   DC  F N4    1 
ATOM   616   C  C5    . DC  B  2 18   ? 23.348  -34.668  8.707   1.00 185.90 ? 18   DC  F C5    1 
ATOM   617   C  C6    . DC  B  2 18   ? 22.540  -34.586  9.773   1.00 183.06 ? 18   DC  F C6    1 
ATOM   618   P  P     . DC  B  2 19   ? 17.416  -35.366  13.430  1.00 188.75 ? 19   DC  F P     1 
ATOM   619   O  OP1   . DC  B  2 19   ? 16.922  -35.235  14.828  1.00 203.61 ? 19   DC  F OP1   1 
ATOM   620   O  OP2   . DC  B  2 19   ? 17.871  -36.689  12.939  1.00 190.70 ? 19   DC  F OP2   1 
ATOM   621   O  "O5'" . DC  B  2 19   ? 16.260  -34.889  12.447  1.00 177.99 ? 19   DC  F "O5'" 1 
ATOM   622   C  "C5'" . DC  B  2 19   ? 15.960  -33.492  12.268  1.00 178.45 ? 19   DC  F "C5'" 1 
ATOM   623   C  "C4'" . DC  B  2 19   ? 15.396  -33.276  10.885  1.00 172.58 ? 19   DC  F "C4'" 1 
ATOM   624   O  "O4'" . DC  B  2 19   ? 16.459  -33.407  9.913   1.00 171.60 ? 19   DC  F "O4'" 1 
ATOM   625   C  "C3'" . DC  B  2 19   ? 14.333  -34.301  10.488  1.00 174.19 ? 19   DC  F "C3'" 1 
ATOM   626   O  "O3'" . DC  B  2 19   ? 13.300  -33.676  9.732   1.00 174.54 ? 19   DC  F "O3'" 1 
ATOM   627   C  "C2'" . DC  B  2 19   ? 15.100  -35.291  9.636   1.00 174.86 ? 19   DC  F "C2'" 1 
ATOM   628   C  "C1'" . DC  B  2 19   ? 16.092  -34.376  8.942   1.00 175.30 ? 19   DC  F "C1'" 1 
ATOM   629   N  N1    . DC  B  2 19   ? 17.327  -35.008  8.425   1.00 175.26 ? 19   DC  F N1    1 
ATOM   630   C  C2    . DC  B  2 19   ? 17.888  -34.497  7.251   1.00 167.19 ? 19   DC  F C2    1 
ATOM   631   O  O2    . DC  B  2 19   ? 17.336  -33.538  6.692   1.00 161.13 ? 19   DC  F O2    1 
ATOM   632   N  N3    . DC  B  2 19   ? 19.010  -35.065  6.751   1.00 165.61 ? 19   DC  F N3    1 
ATOM   633   C  C4    . DC  B  2 19   ? 19.571  -36.099  7.381   1.00 164.25 ? 19   DC  F C4    1 
ATOM   634   N  N4    . DC  B  2 19   ? 20.679  -36.626  6.852   1.00 165.25 ? 19   DC  F N4    1 
ATOM   635   C  C5    . DC  B  2 19   ? 19.020  -36.640  8.579   1.00 162.92 ? 19   DC  F C5    1 
ATOM   636   C  C6    . DC  B  2 19   ? 17.906  -36.074  9.059   1.00 168.60 ? 19   DC  F C6    1 
ATOM   637   P  P     . DG  B  2 20   ? 11.803  -34.237  9.781   1.00 183.82 ? 20   DG  F P     1 
ATOM   638   O  OP1   . DG  B  2 20   ? 11.032  -33.410  10.748  1.00 197.17 ? 20   DG  F OP1   1 
ATOM   639   O  OP2   . DG  B  2 20   ? 11.826  -35.713  9.939   1.00 179.82 ? 20   DG  F OP2   1 
ATOM   640   O  "O5'" . DG  B  2 20   ? 11.299  -33.904  8.307   1.00 183.71 ? 20   DG  F "O5'" 1 
ATOM   641   C  "C5'" . DG  B  2 20   ? 11.531  -32.606  7.712   1.00 186.53 ? 20   DG  F "C5'" 1 
ATOM   642   C  "C4'" . DG  B  2 20   ? 11.746  -32.727  6.220   1.00 184.92 ? 20   DG  F "C4'" 1 
ATOM   643   O  "O4'" . DG  B  2 20   ? 13.034  -33.332  5.946   1.00 174.76 ? 20   DG  F "O4'" 1 
ATOM   644   C  "C3'" . DG  B  2 20   ? 10.705  -33.581  5.488   1.00 187.86 ? 20   DG  F "C3'" 1 
ATOM   645   O  "O3'" . DG  B  2 20   ? 10.217  -32.900  4.326   1.00 184.26 ? 20   DG  F "O3'" 1 
ATOM   646   C  "C2'" . DG  B  2 20   ? 11.461  -34.850  5.134   1.00 183.24 ? 20   DG  F "C2'" 1 
ATOM   647   C  "C1'" . DG  B  2 20   ? 12.879  -34.341  4.964   1.00 177.69 ? 20   DG  F "C1'" 1 
ATOM   648   N  N9    . DG  B  2 20   ? 13.920  -35.341  5.178   1.00 176.51 ? 20   DG  F N9    1 
ATOM   649   C  C8    . DG  B  2 20   ? 14.065  -36.169  6.266   1.00 176.27 ? 20   DG  F C8    1 
ATOM   650   N  N7    . DG  B  2 20   ? 15.097  -36.962  6.172   1.00 177.33 ? 20   DG  F N7    1 
ATOM   651   C  C5    . DG  B  2 20   ? 15.665  -36.644  4.945   1.00 179.76 ? 20   DG  F C5    1 
ATOM   652   C  C6    . DG  B  2 20   ? 16.813  -37.177  4.294   1.00 175.25 ? 20   DG  F C6    1 
ATOM   653   O  O6    . DG  B  2 20   ? 17.578  -38.069  4.683   1.00 171.56 ? 20   DG  F O6    1 
ATOM   654   N  N1    . DG  B  2 20   ? 17.035  -36.564  3.064   1.00 173.99 ? 20   DG  F N1    1 
ATOM   655   C  C2    . DG  B  2 20   ? 16.254  -35.570  2.525   1.00 178.71 ? 20   DG  F C2    1 
ATOM   656   N  N2    . DG  B  2 20   ? 16.635  -35.104  1.323   1.00 172.29 ? 20   DG  F N2    1 
ATOM   657   N  N3    . DG  B  2 20   ? 15.183  -35.066  3.121   1.00 182.41 ? 20   DG  F N3    1 
ATOM   658   C  C4    . DG  B  2 20   ? 14.949  -35.646  4.319   1.00 179.13 ? 20   DG  F C4    1 
ATOM   659   P  P     . DT  B  2 21   ? 8.919   -33.418  3.552   1.00 183.37 ? 21   DT  F P     1 
ATOM   660   O  OP1   . DT  B  2 21   ? 8.015   -32.262  3.335   1.00 192.21 ? 21   DT  F OP1   1 
ATOM   661   O  OP2   . DT  B  2 21   ? 8.403   -34.640  4.230   1.00 184.27 ? 21   DT  F OP2   1 
ATOM   662   O  "O5'" . DT  B  2 21   ? 9.512   -33.786  2.121   1.00 183.40 ? 21   DT  F "O5'" 1 
ATOM   663   C  "C5'" . DT  B  2 21   ? 10.315  -32.840  1.392   1.00 182.59 ? 21   DT  F "C5'" 1 
ATOM   664   C  "C4'" . DT  B  2 21   ? 11.118  -33.552  0.329   1.00 180.20 ? 21   DT  F "C4'" 1 
ATOM   665   O  "O4'" . DT  B  2 21   ? 12.083  -34.439  0.942   1.00 174.39 ? 21   DT  F "O4'" 1 
ATOM   666   C  "C3'" . DT  B  2 21   ? 10.286  -34.413  -0.622  1.00 181.29 ? 21   DT  F "C3'" 1 
ATOM   667   O  "O3'" . DT  B  2 21   ? 10.600  -34.065  -1.972  1.00 188.71 ? 21   DT  F "O3'" 1 
ATOM   668   C  "C2'" . DT  B  2 21   ? 10.690  -35.840  -0.286  1.00 177.05 ? 21   DT  F "C2'" 1 
ATOM   669   C  "C1'" . DT  B  2 21   ? 12.101  -35.667  0.236   1.00 173.78 ? 21   DT  F "C1'" 1 
ATOM   670   N  N1    . DT  B  2 21   ? 12.580  -36.720  1.161   1.00 172.29 ? 21   DT  F N1    1 
ATOM   671   C  C2    . DT  B  2 21   ? 13.813  -37.286  0.916   1.00 170.40 ? 21   DT  F C2    1 
ATOM   672   O  O2    . DT  B  2 21   ? 14.513  -36.978  -0.036  1.00 163.48 ? 21   DT  F O2    1 
ATOM   673   N  N3    . DT  B  2 21   ? 14.194  -38.241  1.828   1.00 168.76 ? 21   DT  F N3    1 
ATOM   674   C  C4    . DT  B  2 21   ? 13.484  -38.672  2.934   1.00 167.40 ? 21   DT  F C4    1 
ATOM   675   O  O4    . DT  B  2 21   ? 13.955  -39.540  3.661   1.00 176.21 ? 21   DT  F O4    1 
ATOM   676   C  C5    . DT  B  2 21   ? 12.204  -38.031  3.133   1.00 167.88 ? 21   DT  F C5    1 
ATOM   677   C  C7    . DT  B  2 21   ? 11.367  -38.430  4.308   1.00 157.02 ? 21   DT  F C7    1 
ATOM   678   C  C6    . DT  B  2 21   ? 11.821  -37.100  2.248   1.00 173.44 ? 21   DT  F C6    1 
ATOM   679   P  P     . DC  B  2 22   ? 9.567   -34.419  -3.134  1.00 197.61 ? 22   DC  F P     1 
ATOM   680   O  OP1   . DC  B  2 22   ? 8.947   -33.169  -3.651  1.00 196.35 ? 22   DC  F OP1   1 
ATOM   681   O  OP2   . DC  B  2 22   ? 8.697   -35.504  -2.613  1.00 196.28 ? 22   DC  F OP2   1 
ATOM   682   O  "O5'" . DC  B  2 22   ? 10.477  -35.043  -4.284  1.00 200.69 ? 22   DC  F "O5'" 1 
ATOM   683   C  "C5'" . DC  B  2 22   ? 11.882  -34.737  -4.411  1.00 191.47 ? 22   DC  F "C5'" 1 
ATOM   684   C  "C4'" . DC  B  2 22   ? 12.640  -35.965  -4.863  1.00 191.49 ? 22   DC  F "C4'" 1 
ATOM   685   O  "O4'" . DC  B  2 22   ? 12.925  -36.822  -3.729  1.00 192.31 ? 22   DC  F "O4'" 1 
ATOM   686   C  "C3'" . DC  B  2 22   ? 11.906  -36.848  -5.875  1.00 190.48 ? 22   DC  F "C3'" 1 
ATOM   687   O  "O3'" . DC  B  2 22   ? 12.850  -37.352  -6.818  1.00 192.69 ? 22   DC  F "O3'" 1 
ATOM   688   C  "C2'" . DC  B  2 22   ? 11.366  -37.981  -5.023  1.00 187.82 ? 22   DC  F "C2'" 1 
ATOM   689   C  "C1'" . DC  B  2 22   ? 12.502  -38.147  -4.029  1.00 186.80 ? 22   DC  F "C1'" 1 
ATOM   690   N  N1    . DC  B  2 22   ? 12.189  -38.828  -2.755  1.00 181.05 ? 22   DC  F N1    1 
ATOM   691   C  C2    . DC  B  2 22   ? 13.218  -39.504  -2.090  1.00 174.31 ? 22   DC  F C2    1 
ATOM   692   O  O2    . DC  B  2 22   ? 14.349  -39.520  -2.595  1.00 176.50 ? 22   DC  F O2    1 
ATOM   693   N  N3    . DC  B  2 22   ? 12.952  -40.130  -0.921  1.00 178.49 ? 22   DC  F N3    1 
ATOM   694   C  C4    . DC  B  2 22   ? 11.719  -40.092  -0.410  1.00 178.34 ? 22   DC  F C4    1 
ATOM   695   N  N4    . DC  B  2 22   ? 11.504  -40.723  0.747   1.00 177.78 ? 22   DC  F N4    1 
ATOM   696   C  C5    . DC  B  2 22   ? 10.652  -39.411  -1.066  1.00 175.81 ? 22   DC  F C5    1 
ATOM   697   C  C6    . DC  B  2 22   ? 10.928  -38.801  -2.226  1.00 178.18 ? 22   DC  F C6    1 
ATOM   698   P  P     . DG  B  2 23   ? 12.376  -37.708  -8.292  1.00 194.80 ? 23   DG  F P     1 
ATOM   699   O  OP1   . DG  B  2 23   ? 12.570  -36.506  -9.144  1.00 203.01 ? 23   DG  F OP1   1 
ATOM   700   O  OP2   . DG  B  2 23   ? 11.019  -38.296  -8.164  1.00 199.10 ? 23   DG  F OP2   1 
ATOM   701   O  "O5'" . DG  B  2 23   ? 13.439  -38.832  -8.679  1.00 183.65 ? 23   DG  F "O5'" 1 
ATOM   702   C  "C5'" . DG  B  2 23   ? 14.857  -38.595  -8.581  1.00 182.54 ? 23   DG  F "C5'" 1 
ATOM   703   C  "C4'" . DG  B  2 23   ? 15.546  -39.830  -8.050  1.00 184.48 ? 23   DG  F "C4'" 1 
ATOM   704   O  "O4'" . DG  B  2 23   ? 14.969  -40.186  -6.771  1.00 181.62 ? 23   DG  F "O4'" 1 
ATOM   705   C  "C3'" . DG  B  2 23   ? 15.413  -41.066  -8.949  1.00 183.91 ? 23   DG  F "C3'" 1 
ATOM   706   O  "O3'" . DG  B  2 23   ? 16.693  -41.543  -9.391  1.00 186.35 ? 23   DG  F "O3'" 1 
ATOM   707   C  "C2'" . DG  B  2 23   ? 14.691  -42.086  -8.083  1.00 183.95 ? 23   DG  F "C2'" 1 
ATOM   708   C  "C1'" . DG  B  2 23   ? 14.925  -41.594  -6.668  1.00 185.22 ? 23   DG  F "C1'" 1 
ATOM   709   N  N9    . DG  B  2 23   ? 13.867  -41.944  -5.724  1.00 182.65 ? 23   DG  F N9    1 
ATOM   710   C  C8    . DG  B  2 23   ? 12.631  -41.355  -5.618  1.00 184.48 ? 23   DG  F C8    1 
ATOM   711   N  N7    . DG  B  2 23   ? 11.891  -41.883  -4.681  1.00 188.38 ? 23   DG  F N7    1 
ATOM   712   C  C5    . DG  B  2 23   ? 12.685  -42.882  -4.136  1.00 184.85 ? 23   DG  F C5    1 
ATOM   713   C  C6    . DG  B  2 23   ? 12.421  -43.799  -3.079  1.00 186.28 ? 23   DG  F C6    1 
ATOM   714   O  O6    . DG  B  2 23   ? 11.401  -43.910  -2.387  1.00 173.57 ? 23   DG  F O6    1 
ATOM   715   N  N1    . DG  B  2 23   ? 13.503  -44.643  -2.850  1.00 190.31 ? 23   DG  F N1    1 
ATOM   716   C  C2    . DG  B  2 23   ? 14.686  -44.616  -3.547  1.00 190.31 ? 23   DG  F C2    1 
ATOM   717   N  N2    . DG  B  2 23   ? 15.613  -45.510  -3.170  1.00 185.78 ? 23   DG  F N2    1 
ATOM   718   N  N3    . DG  B  2 23   ? 14.948  -43.761  -4.528  1.00 188.72 ? 23   DG  F N3    1 
ATOM   719   C  C4    . DG  B  2 23   ? 13.908  -42.935  -4.770  1.00 182.46 ? 23   DG  F C4    1 
ATOM   720   P  P     . DT  B  2 24   ? 17.038  -41.959  -10.916 1.00 185.74 ? 24   DT  F P     1 
ATOM   721   O  OP1   . DT  B  2 24   ? 18.301  -41.305  -11.361 1.00 180.45 ? 24   DT  F OP1   1 
ATOM   722   O  OP2   . DT  B  2 24   ? 15.819  -41.793  -11.736 1.00 182.53 ? 24   DT  F OP2   1 
ATOM   723   O  "O5'" . DT  B  2 24   ? 17.314  -43.526  -10.808 1.00 182.22 ? 24   DT  F "O5'" 1 
ATOM   724   C  "C5'" . DT  B  2 24   ? 18.295  -44.066  -9.889  1.00 188.22 ? 24   DT  F "C5'" 1 
ATOM   725   C  "C4'" . DT  B  2 24   ? 17.867  -45.427  -9.384  1.00 189.20 ? 24   DT  F "C4'" 1 
ATOM   726   O  "O4'" . DT  B  2 24   ? 16.711  -45.294  -8.514  1.00 189.41 ? 24   DT  F "O4'" 1 
ATOM   727   C  "C3'" . DT  B  2 24   ? 17.456  -46.408  -10.490 1.00 191.41 ? 24   DT  F "C3'" 1 
ATOM   728   O  "O3'" . DT  B  2 24   ? 18.016  -47.727  -10.377 1.00 192.43 ? 24   DT  F "O3'" 1 
ATOM   729   C  "C2'" . DT  B  2 24   ? 15.940  -46.412  -10.409 1.00 196.71 ? 24   DT  F "C2'" 1 
ATOM   730   C  "C1'" . DT  B  2 24   ? 15.726  -46.233  -8.918  1.00 191.46 ? 24   DT  F "C1'" 1 
ATOM   731   N  N1    . DT  B  2 24   ? 14.393  -45.746  -8.483  1.00 187.52 ? 24   DT  F N1    1 
ATOM   732   C  C2    . DT  B  2 24   ? 13.947  -46.169  -7.253  1.00 184.97 ? 24   DT  F C2    1 
ATOM   733   O  O2    . DT  B  2 24   ? 14.604  -46.887  -6.519  1.00 197.37 ? 24   DT  F O2    1 
ATOM   734   N  N3    . DT  B  2 24   ? 12.701  -45.710  -6.905  1.00 187.94 ? 24   DT  F N3    1 
ATOM   735   C  C4    . DT  B  2 24   ? 11.873  -44.897  -7.653  1.00 185.91 ? 24   DT  F C4    1 
ATOM   736   O  O4    . DT  B  2 24   ? 10.781  -44.563  -7.206  1.00 188.54 ? 24   DT  F O4    1 
ATOM   737   C  C5    . DT  B  2 24   ? 12.396  -44.503  -8.940  1.00 184.19 ? 24   DT  F C5    1 
ATOM   738   C  C7    . DT  B  2 24   ? 11.569  -43.618  -9.820  1.00 185.60 ? 24   DT  F C7    1 
ATOM   739   C  C6    . DT  B  2 24   ? 13.608  -44.950  -9.292  1.00 188.32 ? 24   DT  F C6    1 
ATOM   740   P  P     . DT  B  2 25   ? 18.226  -48.688  -9.109  1.00 191.61 ? 25   DT  F P     1 
ATOM   741   O  OP1   . DT  B  2 25   ? 17.804  -48.003  -7.861  1.00 184.18 ? 25   DT  F OP1   1 
ATOM   742   O  OP2   . DT  B  2 25   ? 19.612  -49.216  -9.238  1.00 194.98 ? 25   DT  F OP2   1 
ATOM   743   O  "O5'" . DT  B  2 25   ? 17.252  -49.927  -9.343  1.00 188.47 ? 25   DT  F "O5'" 1 
ATOM   744   C  "C5'" . DT  B  2 25   ? 15.827  -49.741  -9.462  1.00 188.49 ? 25   DT  F "C5'" 1 
ATOM   745   C  "C4'" . DT  B  2 25   ? 15.094  -50.569  -8.433  1.00 185.95 ? 25   DT  F "C4'" 1 
ATOM   746   O  "O4'" . DT  B  2 25   ? 14.010  -49.799  -7.858  1.00 184.06 ? 25   DT  F "O4'" 1 
ATOM   747   C  "C3'" . DT  B  2 25   ? 14.460  -51.842  -8.985  1.00 187.28 ? 25   DT  F "C3'" 1 
ATOM   748   O  "O3'" . DT  B  2 25   ? 14.657  -52.906  -8.051  1.00 186.00 ? 25   DT  F "O3'" 1 
ATOM   749   C  "C2'" . DT  B  2 25   ? 13.003  -51.461  -9.177  1.00 188.86 ? 25   DT  F "C2'" 1 
ATOM   750   C  "C1'" . DT  B  2 25   ? 12.765  -50.444  -8.074  1.00 187.66 ? 25   DT  F "C1'" 1 
ATOM   751   N  N1    . DT  B  2 25   ? 11.766  -49.402  -8.393  1.00 192.65 ? 25   DT  F N1    1 
ATOM   752   C  C2    . DT  B  2 25   ? 10.681  -49.252  -7.558  1.00 195.72 ? 25   DT  F C2    1 
ATOM   753   O  O2    . DT  B  2 25   ? 10.500  -49.944  -6.570  1.00 198.47 ? 25   DT  F O2    1 
ATOM   754   N  N3    . DT  B  2 25   ? 9.809   -48.256  -7.924  1.00 201.03 ? 25   DT  F N3    1 
ATOM   755   C  C4    . DT  B  2 25   ? 9.914   -47.414  -9.015  1.00 205.47 ? 25   DT  F C4    1 
ATOM   756   O  O4    . DT  B  2 25   ? 9.053   -46.560  -9.211  1.00 204.37 ? 25   DT  F O4    1 
ATOM   757   C  C5    . DT  B  2 25   ? 11.080  -47.625  -9.848  1.00 205.85 ? 25   DT  F C5    1 
ATOM   758   C  C7    . DT  B  2 25   ? 11.280  -46.761  -11.054 1.00 199.71 ? 25   DT  F C7    1 
ATOM   759   C  C6    . DT  B  2 25   ? 11.936  -48.594  -9.497  1.00 201.77 ? 25   DT  F C6    1 
ATOM   760   P  P     . DT  B  2 26   ? 15.154  -54.354  -8.524  1.00 192.56 ? 26   DT  F P     1 
ATOM   761   O  OP1   . DT  B  2 26   ? 16.555  -54.534  -8.047  1.00 186.09 ? 26   DT  F OP1   1 
ATOM   762   O  OP2   . DT  B  2 26   ? 14.840  -54.512  -9.967  1.00 191.31 ? 26   DT  F OP2   1 
ATOM   763   O  "O5'" . DT  B  2 26   ? 14.233  -55.375  -7.712  1.00 197.23 ? 26   DT  F "O5'" 1 
ATOM   764   C  "C5'" . DT  B  2 26   ? 13.092  -54.933  -6.939  1.00 195.36 ? 26   DT  F "C5'" 1 
ATOM   765   C  "C4'" . DT  B  2 26   ? 11.804  -55.500  -7.489  1.00 194.13 ? 26   DT  F "C4'" 1 
ATOM   766   O  "O4'" . DT  B  2 26   ? 11.055  -54.472  -8.184  1.00 193.92 ? 26   DT  F "O4'" 1 
ATOM   767   C  "C3'" . DT  B  2 26   ? 11.956  -56.657  -8.483  1.00 196.54 ? 26   DT  F "C3'" 1 
ATOM   768   O  "O3'" . DT  B  2 26   ? 11.112  -57.735  -8.068  1.00 200.18 ? 26   DT  F "O3'" 1 
ATOM   769   C  "C2'" . DT  B  2 26   ? 11.494  -56.068  -9.805  1.00 194.64 ? 26   DT  F "C2'" 1 
ATOM   770   C  "C1'" . DT  B  2 26   ? 10.473  -55.053  -9.335  1.00 192.32 ? 26   DT  F "C1'" 1 
ATOM   771   N  N1    . DT  B  2 26   ? 10.116  -53.967  -10.273 1.00 189.09 ? 26   DT  F N1    1 
ATOM   772   C  C2    . DT  B  2 26   ? 8.859   -53.413  -10.154 1.00 190.37 ? 26   DT  F C2    1 
ATOM   773   O  O2    . DT  B  2 26   ? 8.045   -53.781  -9.322  1.00 187.77 ? 26   DT  F O2    1 
ATOM   774   N  N3    . DT  B  2 26   ? 8.589   -52.407  -11.049 1.00 190.06 ? 26   DT  F N3    1 
ATOM   775   C  C4    . DT  B  2 26   ? 9.432   -51.909  -12.025 1.00 187.55 ? 26   DT  F C4    1 
ATOM   776   O  O4    . DT  B  2 26   ? 9.049   -50.999  -12.756 1.00 185.83 ? 26   DT  F O4    1 
ATOM   777   C  C5    . DT  B  2 26   ? 10.737  -52.533  -12.090 1.00 188.76 ? 26   DT  F C5    1 
ATOM   778   C  C7    . DT  B  2 26   ? 11.718  -52.060  -13.115 1.00 190.62 ? 26   DT  F C7    1 
ATOM   779   C  C6    . DT  B  2 26   ? 11.009  -53.517  -11.223 1.00 185.61 ? 26   DT  F C6    1 
ATOM   780   P  P     . DC  B  2 27   ? 11.423  -59.245  -8.475  1.00 210.23 ? 27   DC  F P     1 
ATOM   781   O  OP1   . DC  B  2 27   ? 10.744  -60.081  -7.450  1.00 212.70 ? 27   DC  F OP1   1 
ATOM   782   O  OP2   . DC  B  2 27   ? 12.889  -59.391  -8.686  1.00 219.89 ? 27   DC  F OP2   1 
ATOM   783   O  "O5'" . DC  B  2 27   ? 10.686  -59.392  -9.883  1.00 216.99 ? 27   DC  F "O5'" 1 
ATOM   784   C  "C5'" . DC  B  2 27   ? 9.525   -60.239  -10.047 1.00 227.33 ? 27   DC  F "C5'" 1 
ATOM   785   C  "C4'" . DC  B  2 27   ? 8.281   -59.538  -9.549  1.00 227.05 ? 27   DC  F "C4'" 1 
ATOM   786   O  "O4'" . DC  B  2 27   ? 8.477   -58.105  -9.595  1.00 227.76 ? 27   DC  F "O4'" 1 
ATOM   787   C  "C3'" . DC  B  2 27   ? 7.019   -59.810  -10.367 1.00 221.55 ? 27   DC  F "C3'" 1 
ATOM   788   O  "O3'" . DC  B  2 27   ? 6.309   -60.941  -9.841  1.00 222.09 ? 27   DC  F "O3'" 1 
ATOM   789   C  "C2'" . DC  B  2 27   ? 6.226   -58.523  -10.220 1.00 220.06 ? 27   DC  F "C2'" 1 
ATOM   790   C  "C1'" . DC  B  2 27   ? 7.296   -57.450  -10.043 1.00 221.44 ? 27   DC  F "C1'" 1 
ATOM   791   N  N1    . DC  B  2 27   ? 7.626   -56.691  -11.264 1.00 216.96 ? 27   DC  F N1    1 
ATOM   792   C  C2    . DC  B  2 27   ? 6.767   -55.660  -11.655 1.00 215.58 ? 27   DC  F C2    1 
ATOM   793   O  O2    . DC  B  2 27   ? 5.753   -55.435  -10.975 1.00 211.21 ? 27   DC  F O2    1 
ATOM   794   N  N3    . DC  B  2 27   ? 7.056   -54.943  -12.768 1.00 216.24 ? 27   DC  F N3    1 
ATOM   795   C  C4    . DC  B  2 27   ? 8.149   -55.227  -13.480 1.00 207.82 ? 27   DC  F C4    1 
ATOM   796   N  N4    . DC  B  2 27   ? 8.392   -54.496  -14.571 1.00 199.54 ? 27   DC  F N4    1 
ATOM   797   C  C5    . DC  B  2 27   ? 9.042   -56.273  -13.104 1.00 211.34 ? 27   DC  F C5    1 
ATOM   798   C  C6    . DC  B  2 27   ? 8.745   -56.973  -12.000 1.00 215.84 ? 27   DC  F C6    1 
ATOM   799   P  P     . DG  B  2 28   ? 5.798   -62.188  -10.731 1.00 226.44 ? 28   DG  F P     1 
ATOM   800   O  OP1   . DG  B  2 28   ? 5.375   -63.275  -9.809  1.00 223.04 ? 28   DG  F OP1   1 
ATOM   801   O  OP2   . DG  B  2 28   ? 6.804   -62.481  -11.787 1.00 223.47 ? 28   DG  F OP2   1 
ATOM   802   O  "O5'" . DG  B  2 28   ? 4.472   -61.638  -11.424 1.00 219.80 ? 28   DG  F "O5'" 1 
ATOM   803   C  "C5'" . DG  B  2 28   ? 3.400   -61.075  -10.635 1.00 216.05 ? 28   DG  F "C5'" 1 
ATOM   804   C  "C4'" . DG  B  2 28   ? 2.513   -60.198  -11.490 1.00 213.63 ? 28   DG  F "C4'" 1 
ATOM   805   O  "O4'" . DG  B  2 28   ? 3.313   -59.196  -12.170 1.00 211.89 ? 28   DG  F "O4'" 1 
ATOM   806   C  "C3'" . DG  B  2 28   ? 1.749   -60.949  -12.584 1.00 215.64 ? 28   DG  F "C3'" 1 
ATOM   807   O  "O3'" . DG  B  2 28   ? 0.396   -60.499  -12.698 1.00 213.00 ? 28   DG  F "O3'" 1 
ATOM   808   C  "C2'" . DG  B  2 28   ? 2.539   -60.643  -13.843 1.00 214.55 ? 28   DG  F "C2'" 1 
ATOM   809   C  "C1'" . DG  B  2 28   ? 3.051   -59.240  -13.565 1.00 209.63 ? 28   DG  F "C1'" 1 
ATOM   810   N  N9    . DG  B  2 28   ? 4.282   -58.896  -14.274 1.00 205.80 ? 28   DG  F N9    1 
ATOM   811   C  C8    . DG  B  2 28   ? 5.445   -59.627  -14.319 1.00 204.29 ? 28   DG  F C8    1 
ATOM   812   N  N7    . DG  B  2 28   ? 6.372   -59.072  -15.051 1.00 200.03 ? 28   DG  F N7    1 
ATOM   813   C  C5    . DG  B  2 28   ? 5.784   -57.907  -15.525 1.00 200.89 ? 28   DG  F C5    1 
ATOM   814   C  C6    . DG  B  2 28   ? 6.303   -56.893  -16.377 1.00 195.74 ? 28   DG  F C6    1 
ATOM   815   O  O6    . DG  B  2 28   ? 7.420   -56.823  -16.901 1.00 190.71 ? 28   DG  F O6    1 
ATOM   816   N  N1    . DG  B  2 28   ? 5.370   -55.891  -16.607 1.00 197.31 ? 28   DG  F N1    1 
ATOM   817   C  C2    . DG  B  2 28   ? 4.098   -55.863  -16.089 1.00 196.25 ? 28   DG  F C2    1 
ATOM   818   N  N2    . DG  B  2 28   ? 3.345   -54.807  -16.429 1.00 195.19 ? 28   DG  F N2    1 
ATOM   819   N  N3    . DG  B  2 28   ? 3.601   -56.801  -15.296 1.00 196.96 ? 28   DG  F N3    1 
ATOM   820   C  C4    . DG  B  2 28   ? 4.492   -57.785  -15.058 1.00 202.58 ? 28   DG  F C4    1 
ATOM   821   P  P     . DC  C  1 1    ? 53.736  43.415   122.340 1.00 192.59 ? 1    DC  G P     1 
ATOM   822   O  OP1   . DC  C  1 1    ? 52.758  43.387   123.460 1.00 193.66 ? 1    DC  G OP1   1 
ATOM   823   O  OP2   . DC  C  1 1    ? 54.765  42.343   122.251 1.00 190.90 ? 1    DC  G OP2   1 
ATOM   824   O  "O5'" . DC  C  1 1    ? 52.892  43.351   120.989 1.00 186.76 ? 1    DC  G "O5'" 1 
ATOM   825   C  "C5'" . DC  C  1 1    ? 51.990  44.412   120.608 1.00 188.80 ? 1    DC  G "C5'" 1 
ATOM   826   C  "C4'" . DC  C  1 1    ? 51.515  44.221   119.184 1.00 185.92 ? 1    DC  G "C4'" 1 
ATOM   827   O  "O4'" . DC  C  1 1    ? 52.367  44.981   118.299 1.00 175.96 ? 1    DC  G "O4'" 1 
ATOM   828   C  "C3'" . DC  C  1 1    ? 51.544  42.778   118.660 1.00 190.79 ? 1    DC  G "C3'" 1 
ATOM   829   O  "O3'" . DC  C  1 1    ? 50.442  42.511   117.777 1.00 190.02 ? 1    DC  G "O3'" 1 
ATOM   830   C  "C2'" . DC  C  1 1    ? 52.883  42.698   117.948 1.00 187.20 ? 1    DC  G "C2'" 1 
ATOM   831   C  "C1'" . DC  C  1 1    ? 53.041  44.111   117.398 1.00 182.04 ? 1    DC  G "C1'" 1 
ATOM   832   N  N1    . DC  C  1 1    ? 54.420  44.595   117.256 1.00 177.10 ? 1    DC  G N1    1 
ATOM   833   C  C2    . DC  C  1 1    ? 54.710  45.447   116.190 1.00 179.91 ? 1    DC  G C2    1 
ATOM   834   O  O2    . DC  C  1 1    ? 53.804  45.736   115.392 1.00 175.40 ? 1    DC  G O2    1 
ATOM   835   N  N3    . DC  C  1 1    ? 55.969  45.921   116.045 1.00 182.07 ? 1    DC  G N3    1 
ATOM   836   C  C4    . DC  C  1 1    ? 56.913  45.587   116.928 1.00 179.83 ? 1    DC  G C4    1 
ATOM   837   N  N4    . DC  C  1 1    ? 58.140  46.082   116.750 1.00 179.79 ? 1    DC  G N4    1 
ATOM   838   C  C5    . DC  C  1 1    ? 56.640  44.731   118.034 1.00 180.18 ? 1    DC  G C5    1 
ATOM   839   C  C6    . DC  C  1 1    ? 55.390  44.268   118.162 1.00 181.24 ? 1    DC  G C6    1 
ATOM   840   P  P     . DG  C  1 2    ? 50.026  41.028   117.302 1.00 191.93 ? 2    DG  G P     1 
ATOM   841   O  OP1   . DG  C  1 2    ? 48.657  40.722   117.799 1.00 194.66 ? 2    DG  G OP1   1 
ATOM   842   O  OP2   . DG  C  1 2    ? 51.146  40.109   117.636 1.00 186.40 ? 2    DG  G OP2   1 
ATOM   843   O  "O5'" . DG  C  1 2    ? 49.963  41.152   115.711 1.00 200.60 ? 2    DG  G "O5'" 1 
ATOM   844   C  "C5'" . DG  C  1 2    ? 49.245  42.228   115.052 1.00 197.16 ? 2    DG  G "C5'" 1 
ATOM   845   C  "C4'" . DG  C  1 2    ? 49.806  42.511   113.673 1.00 189.90 ? 2    DG  G "C4'" 1 
ATOM   846   O  "O4'" . DG  C  1 2    ? 51.162  43.008   113.764 1.00 184.09 ? 2    DG  G "O4'" 1 
ATOM   847   C  "C3'" . DG  C  1 2    ? 49.855  41.323   112.704 1.00 185.62 ? 2    DG  G "C3'" 1 
ATOM   848   O  "O3'" . DG  C  1 2    ? 49.175  41.674   111.492 1.00 179.81 ? 2    DG  G "O3'" 1 
ATOM   849   C  "C2'" . DG  C  1 2    ? 51.342  41.084   112.479 1.00 172.67 ? 2    DG  G "C2'" 1 
ATOM   850   C  "C1'" . DG  C  1 2    ? 51.925  42.461   112.706 1.00 172.39 ? 2    DG  G "C1'" 1 
ATOM   851   N  N9    . DG  C  1 2    ? 53.322  42.497   113.111 1.00 169.66 ? 2    DG  G N9    1 
ATOM   852   C  C8    . DG  C  1 2    ? 53.900  41.795   114.142 1.00 171.54 ? 2    DG  G C8    1 
ATOM   853   N  N7    . DG  C  1 2    ? 55.170  42.055   114.289 1.00 174.66 ? 2    DG  G N7    1 
ATOM   854   C  C5    . DG  C  1 2    ? 55.444  42.999   113.310 1.00 168.47 ? 2    DG  G C5    1 
ATOM   855   C  C6    . DG  C  1 2    ? 56.654  43.670   112.995 1.00 156.95 ? 2    DG  G C6    1 
ATOM   856   O  O6    . DG  C  1 2    ? 57.758  43.556   113.537 1.00 145.16 ? 2    DG  G O6    1 
ATOM   857   N  N1    . DG  C  1 2    ? 56.485  44.563   111.939 1.00 160.39 ? 2    DG  G N1    1 
ATOM   858   C  C2    . DG  C  1 2    ? 55.305  44.779   111.269 1.00 162.22 ? 2    DG  G C2    1 
ATOM   859   N  N2    . DG  C  1 2    ? 55.345  45.679   110.273 1.00 161.44 ? 2    DG  G N2    1 
ATOM   860   N  N3    . DG  C  1 2    ? 54.167  44.166   111.559 1.00 161.62 ? 2    DG  G N3    1 
ATOM   861   C  C4    . DG  C  1 2    ? 54.310  43.294   112.583 1.00 169.29 ? 2    DG  G C4    1 
ATOM   862   P  P     . DA  C  1 3    ? 48.808  40.589   110.385 1.00 180.66 ? 3    DA  G P     1 
ATOM   863   O  OP1   . DA  C  1 3    ? 47.386  40.747   109.996 1.00 182.20 ? 3    DA  G OP1   1 
ATOM   864   O  OP2   . DA  C  1 3    ? 49.322  39.258   110.817 1.00 193.01 ? 3    DA  G OP2   1 
ATOM   865   O  "O5'" . DA  C  1 3    ? 49.663  41.088   109.142 1.00 176.76 ? 3    DA  G "O5'" 1 
ATOM   866   C  "C5'" . DA  C  1 3    ? 49.568  42.447   108.696 1.00 175.91 ? 3    DA  G "C5'" 1 
ATOM   867   C  "C4'" . DA  C  1 3    ? 50.785  42.807   107.877 1.00 171.26 ? 3    DA  G "C4'" 1 
ATOM   868   O  "O4'" . DA  C  1 3    ? 51.970  42.743   108.703 1.00 166.97 ? 3    DA  G "O4'" 1 
ATOM   869   C  "C3'" . DA  C  1 3    ? 51.046  41.893   106.677 1.00 166.16 ? 3    DA  G "C3'" 1 
ATOM   870   O  "O3'" . DA  C  1 3    ? 51.094  42.678   105.485 1.00 170.46 ? 3    DA  G "O3'" 1 
ATOM   871   C  "C2'" . DA  C  1 3    ? 52.380  41.234   106.986 1.00 160.48 ? 3    DA  G "C2'" 1 
ATOM   872   C  "C1'" . DA  C  1 3    ? 53.031  42.198   107.954 1.00 160.11 ? 3    DA  G "C1'" 1 
ATOM   873   N  N9    . DA  C  1 3    ? 53.960  41.579   108.894 1.00 163.56 ? 3    DA  G N9    1 
ATOM   874   C  C8    . DA  C  1 3    ? 53.722  40.509   109.721 1.00 166.22 ? 3    DA  G C8    1 
ATOM   875   N  N7    . DA  C  1 3    ? 54.749  40.178   110.465 1.00 165.34 ? 3    DA  G N7    1 
ATOM   876   C  C5    . DA  C  1 3    ? 55.728  41.093   110.109 1.00 161.50 ? 3    DA  G C5    1 
ATOM   877   C  C6    . DA  C  1 3    ? 57.054  41.276   110.540 1.00 159.86 ? 3    DA  G C6    1 
ATOM   878   N  N6    . DA  C  1 3    ? 57.641  40.515   111.466 1.00 164.77 ? 3    DA  G N6    1 
ATOM   879   N  N1    . DA  C  1 3    ? 57.766  42.277   109.977 1.00 156.07 ? 3    DA  G N1    1 
ATOM   880   C  C2    . DA  C  1 3    ? 57.173  43.046   109.053 1.00 155.68 ? 3    DA  G C2    1 
ATOM   881   N  N3    . DA  C  1 3    ? 55.934  42.975   108.569 1.00 157.85 ? 3    DA  G N3    1 
ATOM   882   C  C4    . DA  C  1 3    ? 55.256  41.965   109.144 1.00 164.57 ? 3    DA  G C4    1 
ATOM   883   P  P     . DA  C  1 4    ? 51.088  42.043   104.023 1.00 171.00 ? 4    DA  G P     1 
ATOM   884   O  OP1   . DA  C  1 4    ? 50.216  42.861   103.135 1.00 179.02 ? 4    DA  G OP1   1 
ATOM   885   O  OP2   . DA  C  1 4    ? 50.924  40.569   104.065 1.00 177.19 ? 4    DA  G OP2   1 
ATOM   886   O  "O5'" . DA  C  1 4    ? 52.604  42.313   103.639 1.00 166.70 ? 4    DA  G "O5'" 1 
ATOM   887   C  "C5'" . DA  C  1 4    ? 53.221  43.572   103.927 1.00 166.51 ? 4    DA  G "C5'" 1 
ATOM   888   C  "C4'" . DA  C  1 4    ? 54.674  43.524   103.521 1.00 168.71 ? 4    DA  G "C4'" 1 
ATOM   889   O  "O4'" . DA  C  1 4    ? 55.441  42.887   104.569 1.00 163.14 ? 4    DA  G "O4'" 1 
ATOM   890   C  "C3'" . DA  C  1 4    ? 54.961  42.738   102.239 1.00 168.28 ? 4    DA  G "C3'" 1 
ATOM   891   O  "O3'" . DA  C  1 4    ? 55.880  43.465   101.431 1.00 170.09 ? 4    DA  G "O3'" 1 
ATOM   892   C  "C2'" . DA  C  1 4    ? 55.566  41.439   102.737 1.00 168.22 ? 4    DA  G "C2'" 1 
ATOM   893   C  "C1'" . DA  C  1 4    ? 56.259  41.876   104.014 1.00 164.60 ? 4    DA  G "C1'" 1 
ATOM   894   N  N9    . DA  C  1 4    ? 56.420  40.831   105.021 1.00 160.64 ? 4    DA  G N9    1 
ATOM   895   C  C8    . DA  C  1 4    ? 55.556  39.811   105.334 1.00 158.93 ? 4    DA  G C8    1 
ATOM   896   N  N7    . DA  C  1 4    ? 55.981  39.034   106.300 1.00 161.81 ? 4    DA  G N7    1 
ATOM   897   C  C5    . DA  C  1 4    ? 57.207  39.582   106.652 1.00 160.03 ? 4    DA  G C5    1 
ATOM   898   C  C6    . DA  C  1 4    ? 58.168  39.215   107.612 1.00 157.19 ? 4    DA  G C6    1 
ATOM   899   N  N6    . DA  C  1 4    ? 58.037  38.167   108.427 1.00 158.01 ? 4    DA  G N6    1 
ATOM   900   N  N1    . DA  C  1 4    ? 59.286  39.971   107.704 1.00 157.53 ? 4    DA  G N1    1 
ATOM   901   C  C2    . DA  C  1 4    ? 59.420  41.022   106.882 1.00 150.46 ? 4    DA  G C2    1 
ATOM   902   N  N3    . DA  C  1 4    ? 58.589  41.465   105.940 1.00 154.55 ? 4    DA  G N3    1 
ATOM   903   C  C4    . DA  C  1 4    ? 57.490  40.690   105.873 1.00 162.77 ? 4    DA  G C4    1 
ATOM   904   P  P     . DA  C  1 5    ? 56.163  42.965   99.960  1.00 182.22 ? 5    DA  G P     1 
ATOM   905   O  OP1   . DA  C  1 5    ? 55.979  44.122   99.038  1.00 194.85 ? 5    DA  G OP1   1 
ATOM   906   O  OP2   . DA  C  1 5    ? 55.412  41.702   99.735  1.00 180.58 ? 5    DA  G OP2   1 
ATOM   907   O  "O5'" . DA  C  1 5    ? 57.707  42.607   100.080 1.00 173.06 ? 5    DA  G "O5'" 1 
ATOM   908   C  "C5'" . DA  C  1 5    ? 58.630  43.507   100.716 1.00 170.21 ? 5    DA  G "C5'" 1 
ATOM   909   C  "C4'" . DA  C  1 5    ? 59.907  42.765   101.025 1.00 168.04 ? 5    DA  G "C4'" 1 
ATOM   910   O  "O4'" . DA  C  1 5    ? 59.660  41.841   102.110 1.00 166.05 ? 5    DA  G "O4'" 1 
ATOM   911   C  "C3'" . DA  C  1 5    ? 60.451  41.924   99.867  1.00 172.60 ? 5    DA  G "C3'" 1 
ATOM   912   O  "O3'" . DA  C  1 5    ? 61.852  42.154   99.712  1.00 168.59 ? 5    DA  G "O3'" 1 
ATOM   913   C  "C2'" . DA  C  1 5    ? 60.160  40.493   100.286 1.00 172.24 ? 5    DA  G "C2'" 1 
ATOM   914   C  "C1'" . DA  C  1 5    ? 60.235  40.589   101.796 1.00 165.26 ? 5    DA  G "C1'" 1 
ATOM   915   N  N9    . DA  C  1 5    ? 59.501  39.560   102.532 1.00 162.70 ? 5    DA  G N9    1 
ATOM   916   C  C8    . DA  C  1 5    ? 58.248  39.064   102.272 1.00 160.93 ? 5    DA  G C8    1 
ATOM   917   N  N7    . DA  C  1 5    ? 57.860  38.140   103.117 1.00 159.92 ? 5    DA  G N7    1 
ATOM   918   C  C5    . DA  C  1 5    ? 58.929  38.016   103.991 1.00 163.09 ? 5    DA  G C5    1 
ATOM   919   C  C6    . DA  C  1 5    ? 59.144  37.199   105.117 1.00 162.38 ? 5    DA  G C6    1 
ATOM   920   N  N6    . DA  C  1 5    ? 58.252  36.315   105.571 1.00 160.77 ? 5    DA  G N6    1 
ATOM   921   N  N1    . DA  C  1 5    ? 60.321  37.325   105.771 1.00 156.98 ? 5    DA  G N1    1 
ATOM   922   C  C2    . DA  C  1 5    ? 61.216  38.210   105.314 1.00 155.07 ? 5    DA  G C2    1 
ATOM   923   N  N3    . DA  C  1 5    ? 61.127  39.037   104.272 1.00 160.72 ? 5    DA  G N3    1 
ATOM   924   C  C4    . DA  C  1 5    ? 59.946  38.889   103.646 1.00 163.74 ? 5    DA  G C4    1 
ATOM   925   P  P     . DC  C  1 6    ? 62.517  42.059   98.271  1.00 165.25 ? 6    DC  G P     1 
ATOM   926   O  OP1   . DC  C  1 6    ? 62.687  43.440   97.768  1.00 166.54 ? 6    DC  G OP1   1 
ATOM   927   O  OP2   . DC  C  1 6    ? 61.744  41.065   97.478  1.00 168.89 ? 6    DC  G OP2   1 
ATOM   928   O  "O5'" . DC  C  1 6    ? 63.964  41.485   98.614  1.00 175.49 ? 6    DC  G "O5'" 1 
ATOM   929   C  "C5'" . DC  C  1 6    ? 64.710  41.990   99.740  1.00 176.97 ? 6    DC  G "C5'" 1 
ATOM   930   C  "C4'" . DC  C  1 6    ? 65.155  40.855   100.633 1.00 171.89 ? 6    DC  G "C4'" 1 
ATOM   931   O  "O4'" . DC  C  1 6    ? 64.014  40.091   101.077 1.00 168.24 ? 6    DC  G "O4'" 1 
ATOM   932   C  "C3'" . DC  C  1 6    ? 66.101  39.847   99.975  1.00 170.18 ? 6    DC  G "C3'" 1 
ATOM   933   O  "O3'" . DC  C  1 6    ? 67.433  40.052   100.456 1.00 166.86 ? 6    DC  G "O3'" 1 
ATOM   934   C  "C2'" . DC  C  1 6    ? 65.549  38.485   100.379 1.00 167.02 ? 6    DC  G "C2'" 1 
ATOM   935   C  "C1'" . DC  C  1 6    ? 64.487  38.805   101.415 1.00 168.03 ? 6    DC  G "C1'" 1 
ATOM   936   N  N1    . DC  C  1 6    ? 63.335  37.890   101.428 1.00 170.15 ? 6    DC  G N1    1 
ATOM   937   C  C2    . DC  C  1 6    ? 63.071  37.147   102.585 1.00 168.82 ? 6    DC  G C2    1 
ATOM   938   O  O2    . DC  C  1 6    ? 63.819  37.276   103.567 1.00 161.93 ? 6    DC  G O2    1 
ATOM   939   N  N3    . DC  C  1 6    ? 62.006  36.313   102.605 1.00 170.09 ? 6    DC  G N3    1 
ATOM   940   C  C4    . DC  C  1 6    ? 61.223  36.205   101.528 1.00 167.89 ? 6    DC  G C4    1 
ATOM   941   N  N4    . DC  C  1 6    ? 60.190  35.366   101.591 1.00 173.49 ? 6    DC  G N4    1 
ATOM   942   C  C5    . DC  C  1 6    ? 61.471  36.950   100.339 1.00 169.06 ? 6    DC  G C5    1 
ATOM   943   C  C6    . DC  C  1 6    ? 62.525  37.774   100.333 1.00 171.08 ? 6    DC  G C6    1 
ATOM   944   P  P     . DG  C  1 7    ? 68.703  39.348   99.792  1.00 165.60 ? 7    DG  G P     1 
ATOM   945   O  OP1   . DG  C  1 7    ? 69.896  40.204   100.026 1.00 163.27 ? 7    DG  G OP1   1 
ATOM   946   O  OP2   . DG  C  1 7    ? 68.369  38.892   98.415  1.00 171.11 ? 7    DG  G OP2   1 
ATOM   947   O  "O5'" . DG  C  1 7    ? 68.875  38.058   100.703 1.00 157.98 ? 7    DG  G "O5'" 1 
ATOM   948   C  "C5'" . DG  C  1 7    ? 68.770  38.148   102.132 1.00 160.26 ? 7    DG  G "C5'" 1 
ATOM   949   C  "C4'" . DG  C  1 7    ? 68.812  36.766   102.741 1.00 161.36 ? 7    DG  G "C4'" 1 
ATOM   950   O  "O4'" . DG  C  1 7    ? 67.485  36.182   102.753 1.00 157.24 ? 7    DG  G "O4'" 1 
ATOM   951   C  "C3'" . DG  C  1 7    ? 69.708  35.773   101.997 1.00 165.30 ? 7    DG  G "C3'" 1 
ATOM   952   O  "O3'" . DG  C  1 7    ? 70.459  35.003   102.934 1.00 165.96 ? 7    DG  G "O3'" 1 
ATOM   953   C  "C2'" . DG  C  1 7    ? 68.724  34.914   101.222 1.00 162.94 ? 7    DG  G "C2'" 1 
ATOM   954   C  "C1'" . DG  C  1 7    ? 67.526  34.894   102.149 1.00 158.58 ? 7    DG  G "C1'" 1 
ATOM   955   N  N9    . DG  C  1 7    ? 66.234  34.649   101.511 1.00 161.77 ? 7    DG  G N9    1 
ATOM   956   C  C8    . DG  C  1 7    ? 65.799  35.102   100.287 1.00 164.33 ? 7    DG  G C8    1 
ATOM   957   N  N7    . DG  C  1 7    ? 64.584  34.717   100.001 1.00 158.62 ? 7    DG  G N7    1 
ATOM   958   C  C5    . DG  C  1 7    ? 64.196  33.962   101.099 1.00 158.52 ? 7    DG  G C5    1 
ATOM   959   C  C6    . DG  C  1 7    ? 62.976  33.286   101.366 1.00 157.63 ? 7    DG  G C6    1 
ATOM   960   O  O6    . DG  C  1 7    ? 61.960  33.220   100.663 1.00 153.49 ? 7    DG  G O6    1 
ATOM   961   N  N1    . DG  C  1 7    ? 63.003  32.649   102.603 1.00 153.99 ? 7    DG  G N1    1 
ATOM   962   C  C2    . DG  C  1 7    ? 64.066  32.660   103.473 1.00 154.49 ? 7    DG  G C2    1 
ATOM   963   N  N2    . DG  C  1 7    ? 63.900  31.984   104.621 1.00 150.16 ? 7    DG  G N2    1 
ATOM   964   N  N3    . DG  C  1 7    ? 65.206  33.289   103.238 1.00 163.89 ? 7    DG  G N3    1 
ATOM   965   C  C4    . DG  C  1 7    ? 65.203  33.911   102.039 1.00 160.96 ? 7    DG  G C4    1 
ATOM   966   P  P     . DA  C  1 8    ? 71.761  34.188   102.507 1.00 168.60 ? 8    DA  G P     1 
ATOM   967   O  OP1   . DA  C  1 8    ? 72.859  34.746   103.335 1.00 183.00 ? 8    DA  G OP1   1 
ATOM   968   O  OP2   . DA  C  1 8    ? 71.901  34.147   101.028 1.00 172.40 ? 8    DA  G OP2   1 
ATOM   969   O  "O5'" . DA  C  1 8    ? 71.426  32.717   103.020 1.00 167.69 ? 8    DA  G "O5'" 1 
ATOM   970   C  "C5'" . DA  C  1 8    ? 70.900  32.483   104.347 1.00 169.28 ? 8    DA  G "C5'" 1 
ATOM   971   C  "C4'" . DA  C  1 8    ? 70.100  31.200   104.396 1.00 163.74 ? 8    DA  G "C4'" 1 
ATOM   972   O  "O4'" . DA  C  1 8    ? 68.849  31.339   103.676 1.00 156.91 ? 8    DA  G "O4'" 1 
ATOM   973   C  "C3'" . DA  C  1 8    ? 70.806  29.978   103.798 1.00 162.56 ? 8    DA  G "C3'" 1 
ATOM   974   O  "O3'" . DA  C  1 8    ? 70.740  28.902   104.730 1.00 165.26 ? 8    DA  G "O3'" 1 
ATOM   975   C  "C2'" . DA  C  1 8    ? 70.039  29.702   102.516 1.00 158.06 ? 8    DA  G "C2'" 1 
ATOM   976   C  "C1'" . DA  C  1 8    ? 68.652  30.188   102.872 1.00 158.56 ? 8    DA  G "C1'" 1 
ATOM   977   N  N9    . DA  C  1 8    ? 67.822  30.562   101.726 1.00 159.66 ? 8    DA  G N9    1 
ATOM   978   C  C8    . DA  C  1 8    ? 68.154  31.327   100.633 1.00 163.38 ? 8    DA  G C8    1 
ATOM   979   N  N7    . DA  C  1 8    ? 67.174  31.469   99.773  1.00 161.60 ? 8    DA  G N7    1 
ATOM   980   C  C5    . DA  C  1 8    ? 66.134  30.737   100.328 1.00 154.65 ? 8    DA  G C5    1 
ATOM   981   C  C6    . DA  C  1 8    ? 64.820  30.485   99.898  1.00 158.15 ? 8    DA  G C6    1 
ATOM   982   N  N6    . DA  C  1 8    ? 64.309  30.965   98.762  1.00 162.64 ? 8    DA  G N6    1 
ATOM   983   N  N1    . DA  C  1 8    ? 64.038  29.713   100.686 1.00 157.05 ? 8    DA  G N1    1 
ATOM   984   C  C2    . DA  C  1 8    ? 64.551  29.235   101.828 1.00 151.90 ? 8    DA  G C2    1 
ATOM   985   N  N3    . DA  C  1 8    ? 65.770  29.401   102.337 1.00 147.00 ? 8    DA  G N3    1 
ATOM   986   C  C4    . DA  C  1 8    ? 66.520  30.171   101.530 1.00 153.86 ? 8    DA  G C4    1 
ATOM   987   P  P     . DC  C  1 9    ? 71.255  27.455   104.314 1.00 178.74 ? 9    DC  G P     1 
ATOM   988   O  OP1   . DC  C  1 9    ? 71.720  26.752   105.541 1.00 190.79 ? 9    DC  G OP1   1 
ATOM   989   O  OP2   . DC  C  1 9    ? 72.162  27.591   103.145 1.00 178.05 ? 9    DC  G OP2   1 
ATOM   990   O  "O5'" . DC  C  1 9    ? 69.890  26.767   103.866 1.00 174.77 ? 9    DC  G "O5'" 1 
ATOM   991   C  "C5'" . DC  C  1 9    ? 68.721  26.844   104.709 1.00 166.05 ? 9    DC  G "C5'" 1 
ATOM   992   C  "C4'" . DC  C  1 9    ? 67.574  26.068   104.104 1.00 161.77 ? 9    DC  G "C4'" 1 
ATOM   993   O  "O4'" . DC  C  1 9    ? 67.070  26.731   102.916 1.00 159.16 ? 9    DC  G "O4'" 1 
ATOM   994   C  "C3'" . DC  C  1 9    ? 67.920  24.638   103.676 1.00 163.48 ? 9    DC  G "C3'" 1 
ATOM   995   O  "O3'" . DC  C  1 9    ? 66.873  23.744   104.047 1.00 160.25 ? 9    DC  G "O3'" 1 
ATOM   996   C  "C2'" . DC  C  1 9    ? 67.938  24.714   102.162 1.00 167.42 ? 9    DC  G "C2'" 1 
ATOM   997   C  "C1'" . DC  C  1 9    ? 66.851  25.739   101.928 1.00 165.78 ? 9    DC  G "C1'" 1 
ATOM   998   N  N1    . DC  C  1 9    ? 66.851  26.388   100.605 1.00 175.31 ? 9    DC  G N1    1 
ATOM   999   C  C2    . DC  C  1 9    ? 65.660  26.400   99.875  1.00 175.79 ? 9    DC  G C2    1 
ATOM   1000  O  O2    . DC  C  1 9    ? 64.648  25.884   100.371 1.00 169.02 ? 9    DC  G O2    1 
ATOM   1001  N  N3    . DC  C  1 9    ? 65.634  26.988   98.658  1.00 180.04 ? 9    DC  G N3    1 
ATOM   1002  C  C4    . DC  C  1 9    ? 66.742  27.541   98.161  1.00 189.02 ? 9    DC  G C4    1 
ATOM   1003  N  N4    . DC  C  1 9    ? 66.670  28.109   96.955  1.00 196.32 ? 9    DC  G N4    1 
ATOM   1004  C  C5    . DC  C  1 9    ? 67.973  27.540   98.881  1.00 187.32 ? 9    DC  G C5    1 
ATOM   1005  C  C6    . DC  C  1 9    ? 67.983  26.957   100.088 1.00 183.96 ? 9    DC  G C6    1 
ATOM   1006  P  P     . DG  C  1 10   ? 67.143  22.476   104.960 1.00 166.61 ? 10   DG  G P     1 
ATOM   1007  O  OP1   . DG  C  1 10   ? 66.916  22.844   106.384 1.00 176.68 ? 10   DG  G OP1   1 
ATOM   1008  O  OP2   . DG  C  1 10   ? 68.441  21.878   104.540 1.00 175.91 ? 10   DG  G OP2   1 
ATOM   1009  O  "O5'" . DG  C  1 10   ? 65.920  21.553   104.534 1.00 156.75 ? 10   DG  G "O5'" 1 
ATOM   1010  C  "C5'" . DG  C  1 10   ? 64.594  22.095   104.448 1.00 155.41 ? 10   DG  G "C5'" 1 
ATOM   1011  C  "C4'" . DG  C  1 10   ? 63.909  21.593   103.199 1.00 157.71 ? 10   DG  G "C4'" 1 
ATOM   1012  O  "O4'" . DG  C  1 10   ? 64.377  22.309   102.033 1.00 166.02 ? 10   DG  G "O4'" 1 
ATOM   1013  C  "C3'" . DG  C  1 10   ? 64.126  20.105   102.901 1.00 161.60 ? 10   DG  G "C3'" 1 
ATOM   1014  O  "O3'" . DG  C  1 10   ? 62.859  19.442   102.935 1.00 166.82 ? 10   DG  G "O3'" 1 
ATOM   1015  C  "C2'" . DG  C  1 10   ? 64.748  20.073   101.511 1.00 161.86 ? 10   DG  G "C2'" 1 
ATOM   1016  C  "C1'" . DG  C  1 10   ? 64.368  21.420   100.928 1.00 165.54 ? 10   DG  G "C1'" 1 
ATOM   1017  N  N9    . DG  C  1 10   ? 65.272  21.949   99.904  1.00 167.67 ? 10   DG  G N9    1 
ATOM   1018  C  C8    . DG  C  1 10   ? 66.635  22.114   99.996  1.00 167.14 ? 10   DG  G C8    1 
ATOM   1019  N  N7    . DG  C  1 10   ? 67.163  22.630   98.918  1.00 159.73 ? 10   DG  G N7    1 
ATOM   1020  C  C5    . DG  C  1 10   ? 66.086  22.813   98.061  1.00 164.63 ? 10   DG  G C5    1 
ATOM   1021  C  C6    . DG  C  1 10   ? 66.040  23.338   96.742  1.00 169.46 ? 10   DG  G C6    1 
ATOM   1022  O  O6    . DG  C  1 10   ? 66.972  23.758   96.045  1.00 183.20 ? 10   DG  G O6    1 
ATOM   1023  N  N1    . DG  C  1 10   ? 64.743  23.342   96.240  1.00 162.55 ? 10   DG  G N1    1 
ATOM   1024  C  C2    . DG  C  1 10   ? 63.633  22.901   96.918  1.00 161.64 ? 10   DG  G C2    1 
ATOM   1025  N  N2    . DG  C  1 10   ? 62.466  22.991   96.266  1.00 169.98 ? 10   DG  G N2    1 
ATOM   1026  N  N3    . DG  C  1 10   ? 63.662  22.415   98.148  1.00 160.77 ? 10   DG  G N3    1 
ATOM   1027  C  C4    . DG  C  1 10   ? 64.912  22.397   98.654  1.00 164.02 ? 10   DG  G C4    1 
ATOM   1028  P  P     . DG  C  1 11   ? 62.744  17.850   102.972 1.00 174.20 ? 11   DG  G P     1 
ATOM   1029  O  OP1   . DG  C  1 11   ? 61.779  17.441   104.039 1.00 178.47 ? 11   DG  G OP1   1 
ATOM   1030  O  OP2   . DG  C  1 11   ? 64.123  17.270   102.935 1.00 167.84 ? 11   DG  G OP2   1 
ATOM   1031  O  "O5'" . DG  C  1 11   ? 62.008  17.538   101.600 1.00 162.93 ? 11   DG  G "O5'" 1 
ATOM   1032  C  "C5'" . DG  C  1 11   ? 61.302  18.562   100.885 1.00 164.35 ? 11   DG  G "C5'" 1 
ATOM   1033  C  "C4'" . DG  C  1 11   ? 60.932  18.059   99.509  1.00 168.76 ? 11   DG  G "C4'" 1 
ATOM   1034  O  "O4'" . DG  C  1 11   ? 61.799  18.657   98.516  1.00 160.77 ? 11   DG  G "O4'" 1 
ATOM   1035  C  "C3'" . DG  C  1 11   ? 61.068  16.548   99.318  1.00 170.32 ? 11   DG  G "C3'" 1 
ATOM   1036  O  "O3'" . DG  C  1 11   ? 60.040  16.115   98.423  1.00 171.80 ? 11   DG  G "O3'" 1 
ATOM   1037  C  "C2'" . DG  C  1 11   ? 62.465  16.409   98.741  1.00 168.06 ? 11   DG  G "C2'" 1 
ATOM   1038  C  "C1'" . DG  C  1 11   ? 62.551  17.645   97.857  1.00 165.08 ? 11   DG  G "C1'" 1 
ATOM   1039  N  N9    . DG  C  1 11   ? 63.888  18.176   97.613  1.00 161.23 ? 11   DG  G N9    1 
ATOM   1040  C  C8    . DG  C  1 11   ? 64.979  18.135   98.447  1.00 154.15 ? 11   DG  G C8    1 
ATOM   1041  N  N7    . DG  C  1 11   ? 66.026  18.731   97.946  1.00 157.83 ? 11   DG  G N7    1 
ATOM   1042  C  C5    . DG  C  1 11   ? 65.600  19.200   96.711  1.00 162.96 ? 11   DG  G C5    1 
ATOM   1043  C  C6    . DG  C  1 11   ? 66.296  19.928   95.710  1.00 162.09 ? 11   DG  G C6    1 
ATOM   1044  O  O6    . DG  C  1 11   ? 67.465  20.328   95.722  1.00 154.32 ? 11   DG  G O6    1 
ATOM   1045  N  N1    . DG  C  1 11   ? 65.481  20.198   94.614  1.00 168.23 ? 11   DG  G N1    1 
ATOM   1046  C  C2    . DG  C  1 11   ? 64.164  19.822   94.497  1.00 166.81 ? 11   DG  G C2    1 
ATOM   1047  N  N2    . DG  C  1 11   ? 63.543  20.178   93.362  1.00 170.33 ? 11   DG  G N2    1 
ATOM   1048  N  N3    . DG  C  1 11   ? 63.504  19.146   95.423  1.00 167.39 ? 11   DG  G N3    1 
ATOM   1049  C  C4    . DG  C  1 11   ? 64.278  18.872   96.495  1.00 166.44 ? 11   DG  G C4    1 
ATOM   1050  P  P     . DC  C  1 12   ? 59.649  14.583   98.176  1.00 182.70 ? 12   DC  G P     1 
ATOM   1051  O  OP1   . DC  C  1 12   ? 58.330  14.362   98.808  1.00 193.27 ? 12   DC  G OP1   1 
ATOM   1052  O  OP2   . DC  C  1 12   ? 60.784  13.680   98.505  1.00 184.02 ? 12   DC  G OP2   1 
ATOM   1053  O  "O5'" . DC  C  1 12   ? 59.421  14.528   96.599  1.00 186.80 ? 12   DC  G "O5'" 1 
ATOM   1054  C  "C5'" . DC  C  1 12   ? 59.007  15.693   95.845  1.00 175.93 ? 12   DC  G "C5'" 1 
ATOM   1055  C  "C4'" . DC  C  1 12   ? 59.735  15.762   94.521  1.00 174.49 ? 12   DC  G "C4'" 1 
ATOM   1056  O  "O4'" . DC  C  1 12   ? 61.073  16.290   94.705  1.00 164.91 ? 12   DC  G "O4'" 1 
ATOM   1057  C  "C3'" . DC  C  1 12   ? 59.899  14.420   93.795  1.00 179.69 ? 12   DC  G "C3'" 1 
ATOM   1058  O  "O3'" . DC  C  1 12   ? 59.514  14.509   92.420  1.00 178.07 ? 12   DC  G "O3'" 1 
ATOM   1059  C  "C2'" . DC  C  1 12   ? 61.384  14.125   93.906  1.00 177.17 ? 12   DC  G "C2'" 1 
ATOM   1060  C  "C1'" . DC  C  1 12   ? 61.982  15.518   93.939  1.00 170.63 ? 12   DC  G "C1'" 1 
ATOM   1061  N  N1    . DC  C  1 12   ? 63.318  15.624   94.561  1.00 170.57 ? 12   DC  G N1    1 
ATOM   1062  C  C2    . DC  C  1 12   ? 64.308  16.372   93.909  1.00 167.82 ? 12   DC  G C2    1 
ATOM   1063  O  O2    . DC  C  1 12   ? 64.033  16.925   92.832  1.00 165.62 ? 12   DC  G O2    1 
ATOM   1064  N  N3    . DC  C  1 12   ? 65.535  16.477   94.470  1.00 159.12 ? 12   DC  G N3    1 
ATOM   1065  C  C4    . DC  C  1 12   ? 65.792  15.871   95.632  1.00 159.00 ? 12   DC  G C4    1 
ATOM   1066  N  N4    . DC  C  1 12   ? 67.015  16.001   96.148  1.00 149.36 ? 12   DC  G N4    1 
ATOM   1067  C  C5    . DC  C  1 12   ? 64.805  15.101   96.315  1.00 169.08 ? 12   DC  G C5    1 
ATOM   1068  C  C6    . DC  C  1 12   ? 63.594  15.001   95.747  1.00 168.68 ? 12   DC  G C6    1 
ATOM   1069  P  P     . DC  C  1 13   ? 58.912  13.204   91.715  1.00 186.79 ? 13   DC  G P     1 
ATOM   1070  O  OP1   . DC  C  1 13   ? 57.454  13.242   91.971  1.00 190.08 ? 13   DC  G OP1   1 
ATOM   1071  O  OP2   . DC  C  1 13   ? 59.679  12.009   92.155  1.00 184.34 ? 13   DC  G OP2   1 
ATOM   1072  O  "O5'" . DC  C  1 13   ? 59.196  13.459   90.166  1.00 185.51 ? 13   DC  G "O5'" 1 
ATOM   1073  C  "C5'" . DC  C  1 13   ? 59.515  14.771   89.658  1.00 183.42 ? 13   DC  G "C5'" 1 
ATOM   1074  C  "C4'" . DC  C  1 13   ? 60.902  14.774   89.060  1.00 183.89 ? 13   DC  G "C4'" 1 
ATOM   1075  O  "O4'" . DC  C  1 13   ? 61.889  14.733   90.114  1.00 180.62 ? 13   DC  G "O4'" 1 
ATOM   1076  C  "C3'" . DC  C  1 13   ? 61.215  13.589   88.132  1.00 191.49 ? 13   DC  G "C3'" 1 
ATOM   1077  O  "O3'" . DC  C  1 13   ? 61.425  14.037   86.789  1.00 195.99 ? 13   DC  G "O3'" 1 
ATOM   1078  C  "C2'" . DC  C  1 13   ? 62.472  12.961   88.718  1.00 188.52 ? 13   DC  G "C2'" 1 
ATOM   1079  C  "C1'" . DC  C  1 13   ? 63.025  14.055   89.614  1.00 184.09 ? 13   DC  G "C1'" 1 
ATOM   1080  N  N1    . DC  C  1 13   ? 63.835  13.598   90.762  1.00 175.80 ? 13   DC  G N1    1 
ATOM   1081  C  C2    . DC  C  1 13   ? 65.056  14.227   91.006  1.00 169.55 ? 13   DC  G C2    1 
ATOM   1082  O  O2    . DC  C  1 13   ? 65.418  15.144   90.253  1.00 171.97 ? 13   DC  G O2    1 
ATOM   1083  N  N3    . DC  C  1 13   ? 65.815  13.818   92.049  1.00 168.28 ? 13   DC  G N3    1 
ATOM   1084  C  C4    . DC  C  1 13   ? 65.390  12.824   92.834  1.00 167.00 ? 13   DC  G C4    1 
ATOM   1085  N  N4    . DC  C  1 13   ? 66.168  12.455   93.853  1.00 169.44 ? 13   DC  G N4    1 
ATOM   1086  C  C5    . DC  C  1 13   ? 64.151  12.161   92.604  1.00 168.16 ? 13   DC  G C5    1 
ATOM   1087  C  C6    . DC  C  1 13   ? 63.416  12.571   91.562  1.00 174.95 ? 13   DC  G C6    1 
ATOM   1088  P  P     . DA  C  1 14   ? 61.768  12.999   85.621  1.00 193.99 ? 14   DA  G P     1 
ATOM   1089  O  OP1   . DA  C  1 14   ? 61.259  13.538   84.336  1.00 200.95 ? 14   DA  G OP1   1 
ATOM   1090  O  OP2   . DA  C  1 14   ? 61.398  11.631   86.054  1.00 200.44 ? 14   DA  G OP2   1 
ATOM   1091  O  "O5'" . DA  C  1 14   ? 63.353  13.080   85.583  1.00 187.05 ? 14   DA  G "O5'" 1 
ATOM   1092  C  "C5'" . DA  C  1 14   ? 63.994  14.351   85.409  1.00 192.81 ? 14   DA  G "C5'" 1 
ATOM   1093  C  "C4'" . DA  C  1 14   ? 65.441  14.146   85.037  1.00 191.58 ? 14   DA  G "C4'" 1 
ATOM   1094  O  "O4'" . DA  C  1 14   ? 66.189  13.821   86.231  1.00 186.72 ? 14   DA  G "O4'" 1 
ATOM   1095  C  "C3'" . DA  C  1 14   ? 65.692  12.995   84.064  1.00 194.81 ? 14   DA  G "C3'" 1 
ATOM   1096  O  "O3'" . DA  C  1 14   ? 66.801  13.296   83.208  1.00 197.62 ? 14   DA  G "O3'" 1 
ATOM   1097  C  "C2'" . DA  C  1 14   ? 66.001  11.831   84.984  1.00 189.79 ? 14   DA  G "C2'" 1 
ATOM   1098  C  "C1'" . DA  C  1 14   ? 66.733  12.513   86.130  1.00 181.97 ? 14   DA  G "C1'" 1 
ATOM   1099  N  N9    . DA  C  1 14   ? 66.584  11.870   87.433  1.00 175.86 ? 14   DA  G N9    1 
ATOM   1100  C  C8    . DA  C  1 14   ? 65.535  11.121   87.908  1.00 170.66 ? 14   DA  G C8    1 
ATOM   1101  N  N7    . DA  C  1 14   ? 65.709  10.688   89.133  1.00 164.43 ? 14   DA  G N7    1 
ATOM   1102  C  C5    . DA  C  1 14   ? 66.947  11.200   89.496  1.00 168.08 ? 14   DA  G C5    1 
ATOM   1103  C  C6    . DA  C  1 14   ? 67.698  11.109   90.680  1.00 164.50 ? 14   DA  G C6    1 
ATOM   1104  N  N6    . DA  C  1 14   ? 67.296  10.438   91.761  1.00 162.76 ? 14   DA  G N6    1 
ATOM   1105  N  N1    . DA  C  1 14   ? 68.897  11.732   90.713  1.00 165.72 ? 14   DA  G N1    1 
ATOM   1106  C  C2    . DA  C  1 14   ? 69.302  12.403   89.626  1.00 166.01 ? 14   DA  G C2    1 
ATOM   1107  N  N3    . DA  C  1 14   ? 68.682  12.567   88.459  1.00 171.54 ? 14   DA  G N3    1 
ATOM   1108  C  C4    . DA  C  1 14   ? 67.496  11.932   88.459  1.00 174.68 ? 14   DA  G C4    1 
ATOM   1109  P  P     . DG  C  1 15   ? 67.010  12.551   81.804  1.00 196.16 ? 15   DG  G P     1 
ATOM   1110  O  OP1   . DG  C  1 15   ? 66.676  13.451   80.670  1.00 199.99 ? 15   DG  G OP1   1 
ATOM   1111  O  OP2   . DG  C  1 15   ? 66.344  11.228   81.919  1.00 202.33 ? 15   DG  G OP2   1 
ATOM   1112  O  "O5'" . DG  C  1 15   ? 68.586  12.338   81.767  1.00 196.76 ? 15   DG  G "O5'" 1 
ATOM   1113  C  "C5'" . DG  C  1 15   ? 69.476  13.367   82.235  1.00 199.27 ? 15   DG  G "C5'" 1 
ATOM   1114  C  "C4'" . DG  C  1 15   ? 70.528  12.771   83.141  1.00 195.70 ? 15   DG  G "C4'" 1 
ATOM   1115  O  "O4'" . DG  C  1 15   ? 69.925  12.196   84.321  1.00 189.81 ? 15   DG  G "O4'" 1 
ATOM   1116  C  "C3'" . DG  C  1 15   ? 71.361  11.653   82.506  1.00 191.25 ? 15   DG  G "C3'" 1 
ATOM   1117  O  "O3'" . DG  C  1 15   ? 72.689  12.134   82.301  1.00 191.57 ? 15   DG  G "O3'" 1 
ATOM   1118  C  "C2'" . DG  C  1 15   ? 71.319  10.517   83.517  1.00 185.98 ? 15   DG  G "C2'" 1 
ATOM   1119  C  "C1'" . DG  C  1 15   ? 70.785  11.171   84.777  1.00 185.09 ? 15   DG  G "C1'" 1 
ATOM   1120  N  N9    . DG  C  1 15   ? 70.018  10.289   85.654  1.00 181.04 ? 15   DG  G N9    1 
ATOM   1121  C  C8    . DG  C  1 15   ? 68.878  9.590    85.339  1.00 177.49 ? 15   DG  G C8    1 
ATOM   1122  N  N7    . DG  C  1 15   ? 68.418  8.884    86.335  1.00 168.57 ? 15   DG  G N7    1 
ATOM   1123  C  C5    . DG  C  1 15   ? 69.309  9.129    87.371  1.00 170.47 ? 15   DG  G C5    1 
ATOM   1124  C  C6    . DG  C  1 15   ? 69.330  8.636    88.701  1.00 167.39 ? 15   DG  G C6    1 
ATOM   1125  O  O6    . DG  C  1 15   ? 68.536  7.862    89.248  1.00 169.00 ? 15   DG  G O6    1 
ATOM   1126  N  N1    . DG  C  1 15   ? 70.417  9.133    89.415  1.00 165.61 ? 15   DG  G N1    1 
ATOM   1127  C  C2    . DG  C  1 15   ? 71.361  9.999    88.915  1.00 170.77 ? 15   DG  G C2    1 
ATOM   1128  N  N2    . DG  C  1 15   ? 72.333  10.372   89.760  1.00 169.57 ? 15   DG  G N2    1 
ATOM   1129  N  N3    . DG  C  1 15   ? 71.352  10.466   87.677  1.00 179.12 ? 15   DG  G N3    1 
ATOM   1130  C  C4    . DG  C  1 15   ? 70.305  9.992    86.965  1.00 178.72 ? 15   DG  G C4    1 
ATOM   1131  P  P     . DT  C  1 16   ? 73.729  11.340   81.395  1.00 201.85 ? 16   DT  G P     1 
ATOM   1132  O  OP1   . DT  C  1 16   ? 74.098  12.161   80.211  1.00 203.32 ? 16   DT  G OP1   1 
ATOM   1133  O  OP2   . DT  C  1 16   ? 73.178  9.977    81.195  1.00 201.41 ? 16   DT  G OP2   1 
ATOM   1134  O  "O5'" . DT  C  1 16   ? 75.012  11.241   82.337  1.00 206.08 ? 16   DT  G "O5'" 1 
ATOM   1135  C  "C5'" . DT  C  1 16   ? 74.944  11.522   83.754  1.00 200.12 ? 16   DT  G "C5'" 1 
ATOM   1136  C  "C4'" . DT  C  1 16   ? 75.578  10.413   84.564  1.00 195.32 ? 16   DT  G "C4'" 1 
ATOM   1137  O  "O4'" . DT  C  1 16   ? 74.561  9.716    85.329  1.00 193.52 ? 16   DT  G "O4'" 1 
ATOM   1138  C  "C3'" . DT  C  1 16   ? 76.306  9.331    83.763  1.00 200.97 ? 16   DT  G "C3'" 1 
ATOM   1139  O  "O3'" . DT  C  1 16   ? 77.465  8.900    84.480  1.00 196.69 ? 16   DT  G "O3'" 1 
ATOM   1140  C  "C2'" . DT  C  1 16   ? 75.284  8.211    83.704  1.00 202.16 ? 16   DT  G "C2'" 1 
ATOM   1141  C  "C1'" . DT  C  1 16   ? 74.691  8.319    85.097  1.00 198.35 ? 16   DT  G "C1'" 1 
ATOM   1142  N  N1    . DT  C  1 16   ? 73.370  7.678    85.335  1.00 198.55 ? 16   DT  G N1    1 
ATOM   1143  C  C2    . DT  C  1 16   ? 73.083  7.282    86.624  1.00 189.78 ? 16   DT  G C2    1 
ATOM   1144  O  O2    . DT  C  1 16   ? 73.851  7.439    87.559  1.00 181.90 ? 16   DT  G O2    1 
ATOM   1145  N  N3    . DT  C  1 16   ? 71.854  6.689    86.780  1.00 187.40 ? 16   DT  G N3    1 
ATOM   1146  C  C4    . DT  C  1 16   ? 70.907  6.460    85.801  1.00 190.35 ? 16   DT  G C4    1 
ATOM   1147  O  O4    . DT  C  1 16   ? 69.846  5.915    86.094  1.00 188.52 ? 16   DT  G O4    1 
ATOM   1148  C  C5    . DT  C  1 16   ? 71.274  6.896    84.472  1.00 195.20 ? 16   DT  G C5    1 
ATOM   1149  C  C7    . DT  C  1 16   ? 70.311  6.685    83.347  1.00 199.55 ? 16   DT  G C7    1 
ATOM   1150  C  C6    . DT  C  1 16   ? 72.474  7.471    84.307  1.00 196.56 ? 16   DT  G C6    1 
ATOM   1151  P  P     . DG  C  1 17   ? 78.760  8.361    83.722  1.00 198.48 ? 17   DG  G P     1 
ATOM   1152  O  OP1   . DG  C  1 17   ? 79.619  9.518    83.362  1.00 201.33 ? 17   DG  G OP1   1 
ATOM   1153  O  OP2   . DG  C  1 17   ? 78.298  7.431    82.661  1.00 203.82 ? 17   DG  G OP2   1 
ATOM   1154  O  "O5'" . DG  C  1 17   ? 79.488  7.511    84.855  1.00 192.68 ? 17   DG  G "O5'" 1 
ATOM   1155  C  "C5'" . DG  C  1 17   ? 79.618  8.005    86.202  1.00 187.84 ? 17   DG  G "C5'" 1 
ATOM   1156  C  "C4'" . DG  C  1 17   ? 79.312  6.914    87.203  1.00 185.78 ? 17   DG  G "C4'" 1 
ATOM   1157  O  "O4'" . DG  C  1 17   ? 77.897  6.603    87.195  1.00 181.79 ? 17   DG  G "O4'" 1 
ATOM   1158  C  "C3'" . DG  C  1 17   ? 80.040  5.587    86.970  1.00 186.87 ? 17   DG  G "C3'" 1 
ATOM   1159  O  "O3'" . DG  C  1 17   ? 80.531  5.077    88.207  1.00 188.76 ? 17   DG  G "O3'" 1 
ATOM   1160  C  "C2'" . DG  C  1 17   ? 78.956  4.666    86.442  1.00 183.53 ? 17   DG  G "C2'" 1 
ATOM   1161  C  "C1'" . DG  C  1 17   ? 77.733  5.196    87.158  1.00 180.10 ? 17   DG  G "C1'" 1 
ATOM   1162  N  N9    . DG  C  1 17   ? 76.467  4.905    86.496  1.00 183.28 ? 17   DG  G N9    1 
ATOM   1163  C  C8    . DG  C  1 17   ? 76.078  5.265    85.228  1.00 188.44 ? 17   DG  G C8    1 
ATOM   1164  N  N7    . DG  C  1 17   ? 74.876  4.853    84.925  1.00 185.14 ? 17   DG  G N7    1 
ATOM   1165  C  C5    . DG  C  1 17   ? 74.452  4.173    86.058  1.00 178.50 ? 17   DG  G C5    1 
ATOM   1166  C  C6    . DG  C  1 17   ? 73.230  3.502    86.325  1.00 179.58 ? 17   DG  G C6    1 
ATOM   1167  O  O6    . DG  C  1 17   ? 72.242  3.376    85.592  1.00 183.93 ? 17   DG  G O6    1 
ATOM   1168  N  N1    . DG  C  1 17   ? 73.218  2.951    87.602  1.00 179.31 ? 17   DG  G N1    1 
ATOM   1169  C  C2    . DG  C  1 17   ? 74.250  3.029    88.506  1.00 175.28 ? 17   DG  G C2    1 
ATOM   1170  N  N2    . DG  C  1 17   ? 74.052  2.433    89.690  1.00 169.11 ? 17   DG  G N2    1 
ATOM   1171  N  N3    . DG  C  1 17   ? 75.391  3.651    88.269  1.00 180.12 ? 17   DG  G N3    1 
ATOM   1172  C  C4    . DG  C  1 17   ? 75.424  4.196    87.035  1.00 179.38 ? 17   DG  G C4    1 
ATOM   1173  P  P     . DC  C  1 18   ? 81.493  3.808    88.225  1.00 205.48 ? 18   DC  G P     1 
ATOM   1174  O  OP1   . DC  C  1 18   ? 82.632  4.138    89.126  1.00 210.64 ? 18   DC  G OP1   1 
ATOM   1175  O  OP2   . DC  C  1 18   ? 81.754  3.339    86.836  1.00 203.65 ? 18   DC  G OP2   1 
ATOM   1176  O  "O5'" . DC  C  1 18   ? 80.598  2.699    88.934  1.00 200.71 ? 18   DC  G "O5'" 1 
ATOM   1177  C  "C5'" . DC  C  1 18   ? 81.163  1.424    89.289  1.00 201.97 ? 18   DC  G "C5'" 1 
ATOM   1178  C  "C4'" . DC  C  1 18   ? 80.072  0.390    89.435  1.00 202.03 ? 18   DC  G "C4'" 1 
ATOM   1179  O  "O4'" . DC  C  1 18   ? 78.918  0.790    88.655  1.00 200.72 ? 18   DC  G "O4'" 1 
ATOM   1180  C  "C3'" . DC  C  1 18   ? 80.447  -1.004   88.922  1.00 208.87 ? 18   DC  G "C3'" 1 
ATOM   1181  O  "O3'" . DC  C  1 18   ? 79.846  -2.087   89.654  1.00 224.13 ? 18   DC  G "O3'" 1 
ATOM   1182  C  "C2'" . DC  C  1 18   ? 79.880  -1.001   87.517  1.00 205.20 ? 18   DC  G "C2'" 1 
ATOM   1183  C  "C1'" . DC  C  1 18   ? 78.578  -0.265   87.768  1.00 199.63 ? 18   DC  G "C1'" 1 
ATOM   1184  N  N1    . DC  C  1 18   ? 77.888  0.316    86.604  1.00 200.18 ? 18   DC  G N1    1 
ATOM   1185  C  C2    . DC  C  1 18   ? 76.588  0.798    86.779  1.00 197.59 ? 18   DC  G C2    1 
ATOM   1186  O  O2    . DC  C  1 18   ? 76.063  0.716    87.900  1.00 190.60 ? 18   DC  G O2    1 
ATOM   1187  N  N3    . DC  C  1 18   ? 75.930  1.328    85.722  1.00 199.80 ? 18   DC  G N3    1 
ATOM   1188  C  C4    . DC  C  1 18   ? 76.530  1.400    84.532  1.00 204.86 ? 18   DC  G C4    1 
ATOM   1189  N  N4    . DC  C  1 18   ? 75.847  1.940    83.520  1.00 212.22 ? 18   DC  G N4    1 
ATOM   1190  C  C5    . DC  C  1 18   ? 77.857  0.921    84.326  1.00 206.82 ? 18   DC  G C5    1 
ATOM   1191  C  C6    . DC  C  1 18   ? 78.494  0.389    85.379  1.00 204.58 ? 18   DC  G C6    1 
ATOM   1192  P  P     . DC  C  1 19   ? 78.943  -2.031   90.989  1.00 230.88 ? 19   DC  G P     1 
ATOM   1193  O  OP1   . DC  C  1 19   ? 77.710  -1.239   90.735  1.00 217.13 ? 19   DC  G OP1   1 
ATOM   1194  O  OP2   . DC  C  1 19   ? 79.824  -1.680   92.136  1.00 235.77 ? 19   DC  G OP2   1 
ATOM   1195  O  "O5'" . DC  C  1 19   ? 78.503  -3.550   91.188  1.00 228.45 ? 19   DC  G "O5'" 1 
ATOM   1196  C  "C5'" . DC  C  1 19   ? 77.842  -3.984   92.394  1.00 219.85 ? 19   DC  G "C5'" 1 
ATOM   1197  C  "C4'" . DC  C  1 19   ? 76.653  -4.853   92.055  1.00 215.10 ? 19   DC  G "C4'" 1 
ATOM   1198  O  "O4'" . DC  C  1 19   ? 75.846  -4.205   91.042  1.00 211.78 ? 19   DC  G "O4'" 1 
ATOM   1199  C  "C3'" . DC  C  1 19   ? 77.004  -6.230   91.491  1.00 210.00 ? 19   DC  G "C3'" 1 
ATOM   1200  O  "O3'" . DC  C  1 19   ? 76.082  -7.218   91.955  1.00 201.65 ? 19   DC  G "O3'" 1 
ATOM   1201  C  "C2'" . DC  C  1 19   ? 76.867  -6.043   89.992  1.00 211.44 ? 19   DC  G "C2'" 1 
ATOM   1202  C  "C1'" . DC  C  1 19   ? 75.726  -5.041   89.900  1.00 212.59 ? 19   DC  G "C1'" 1 
ATOM   1203  N  N1    . DC  C  1 19   ? 75.719  -4.175   88.706  1.00 212.05 ? 19   DC  G N1    1 
ATOM   1204  C  C2    . DC  C  1 19   ? 74.493  -3.730   88.207  1.00 212.17 ? 19   DC  G C2    1 
ATOM   1205  O  O2    . DC  C  1 19   ? 73.449  -4.090   88.771  1.00 214.11 ? 19   DC  G O2    1 
ATOM   1206  N  N3    . DC  C  1 19   ? 74.474  -2.925   87.120  1.00 214.62 ? 19   DC  G N3    1 
ATOM   1207  C  C4    . DC  C  1 19   ? 75.620  -2.550   86.548  1.00 214.33 ? 19   DC  G C4    1 
ATOM   1208  N  N4    . DC  C  1 19   ? 75.554  -1.758   85.476  1.00 217.40 ? 19   DC  G N4    1 
ATOM   1209  C  C5    . DC  C  1 19   ? 76.884  -2.990   87.035  1.00 212.09 ? 19   DC  G C5    1 
ATOM   1210  C  C6    . DC  C  1 19   ? 76.888  -3.784   88.112  1.00 211.86 ? 19   DC  G C6    1 
ATOM   1211  P  P     . DA  C  1 20   ? 76.458  -8.772   91.882  1.00 205.92 ? 20   DA  G P     1 
ATOM   1212  O  OP1   . DA  C  1 20   ? 76.172  -9.368   93.214  1.00 217.91 ? 20   DA  G OP1   1 
ATOM   1213  O  OP2   . DA  C  1 20   ? 77.818  -8.918   91.294  1.00 201.38 ? 20   DA  G OP2   1 
ATOM   1214  O  "O5'" . DA  C  1 20   ? 75.381  -9.329   90.848  1.00 196.82 ? 20   DA  G "O5'" 1 
ATOM   1215  C  "C5'" . DA  C  1 20   ? 74.003  -9.511   91.231  1.00 191.83 ? 20   DA  G "C5'" 1 
ATOM   1216  C  "C4'" . DA  C  1 20   ? 73.237  -10.190  90.120  1.00 187.78 ? 20   DA  G "C4'" 1 
ATOM   1217  O  "O4'" . DA  C  1 20   ? 73.646  -9.633   88.849  1.00 179.10 ? 20   DA  G "O4'" 1 
ATOM   1218  C  "C3'" . DA  C  1 20   ? 73.458  -11.700  90.012  1.00 187.85 ? 20   DA  G "C3'" 1 
ATOM   1219  O  "O3'" . DA  C  1 20   ? 72.249  -12.386  89.664  1.00 188.60 ? 20   DA  G "O3'" 1 
ATOM   1220  C  "C2'" . DA  C  1 20   ? 74.507  -11.828  88.922  1.00 187.19 ? 20   DA  G "C2'" 1 
ATOM   1221  C  "C1'" . DA  C  1 20   ? 74.196  -10.647  88.015  1.00 187.61 ? 20   DA  G "C1'" 1 
ATOM   1222  N  N9    . DA  C  1 20   ? 75.354  -10.077  87.324  1.00 191.96 ? 20   DA  G N9    1 
ATOM   1223  C  C8    . DA  C  1 20   ? 76.628  -9.909   87.805  1.00 191.04 ? 20   DA  G C8    1 
ATOM   1224  N  N7    . DA  C  1 20   ? 77.448  -9.354   86.944  1.00 189.61 ? 20   DA  G N7    1 
ATOM   1225  C  C5    . DA  C  1 20   ? 76.660  -9.135   85.824  1.00 194.78 ? 20   DA  G C5    1 
ATOM   1226  C  C6    . DA  C  1 20   ? 76.935  -8.567   84.568  1.00 195.94 ? 20   DA  G C6    1 
ATOM   1227  N  N6    . DA  C  1 20   ? 78.135  -8.101   84.213  1.00 196.93 ? 20   DA  G N6    1 
ATOM   1228  N  N1    . DA  C  1 20   ? 75.923  -8.493   83.676  1.00 197.90 ? 20   DA  G N1    1 
ATOM   1229  C  C2    . DA  C  1 20   ? 74.718  -8.962   84.032  1.00 199.11 ? 20   DA  G C2    1 
ATOM   1230  N  N3    . DA  C  1 20   ? 74.336  -9.516   85.181  1.00 195.56 ? 20   DA  G N3    1 
ATOM   1231  C  C4    . DA  C  1 20   ? 75.366  -9.576   86.045  1.00 195.76 ? 20   DA  G C4    1 
ATOM   1232  P  P     . DT  D  2 2    ? 68.012  -25.803  80.488  1.00 220.30 ? 2    DT  H P     1 
ATOM   1233  O  OP1   . DT  D  2 2    ? 66.991  -26.629  81.191  1.00 208.87 ? 2    DT  H OP1   1 
ATOM   1234  O  OP2   . DT  D  2 2    ? 67.800  -24.335  80.323  1.00 215.36 ? 2    DT  H OP2   1 
ATOM   1235  O  "O5'" . DT  D  2 2    ? 69.388  -25.984  81.266  1.00 197.28 ? 2    DT  H "O5'" 1 
ATOM   1236  C  "C5'" . DT  D  2 2    ? 70.216  -27.140  81.053  1.00 194.67 ? 2    DT  H "C5'" 1 
ATOM   1237  C  "C4'" . DT  D  2 2    ? 71.616  -26.715  80.676  1.00 185.78 ? 2    DT  H "C4'" 1 
ATOM   1238  O  "O4'" . DT  D  2 2    ? 71.595  -26.064  79.391  1.00 182.44 ? 2    DT  H "O4'" 1 
ATOM   1239  C  "C3'" . DT  D  2 2    ? 72.265  -25.707  81.627  1.00 187.33 ? 2    DT  H "C3'" 1 
ATOM   1240  O  "O3'" . DT  D  2 2    ? 73.067  -26.372  82.618  1.00 194.62 ? 2    DT  H "O3'" 1 
ATOM   1241  C  "C2'" . DT  D  2 2    ? 73.086  -24.808  80.709  1.00 182.23 ? 2    DT  H "C2'" 1 
ATOM   1242  C  "C1'" . DT  D  2 2    ? 72.762  -25.267  79.290  1.00 178.95 ? 2    DT  H "C1'" 1 
ATOM   1243  N  N1    . DT  D  2 2    ? 72.483  -24.170  78.342  1.00 171.37 ? 2    DT  H N1    1 
ATOM   1244  C  C2    . DT  D  2 2    ? 73.472  -23.820  77.433  1.00 164.55 ? 2    DT  H C2    1 
ATOM   1245  O  O2    . DT  D  2 2    ? 74.565  -24.384  77.361  1.00 167.08 ? 2    DT  H O2    1 
ATOM   1246  N  N3    . DT  D  2 2    ? 73.132  -22.780  76.602  1.00 162.58 ? 2    DT  H N3    1 
ATOM   1247  C  C4    . DT  D  2 2    ? 71.959  -22.070  76.581  1.00 164.22 ? 2    DT  H C4    1 
ATOM   1248  O  O4    . DT  D  2 2    ? 71.810  -21.167  75.758  1.00 174.08 ? 2    DT  H O4    1 
ATOM   1249  C  C5    . DT  D  2 2    ? 70.976  -22.472  77.567  1.00 169.93 ? 2    DT  H C5    1 
ATOM   1250  C  C7    . DT  D  2 2    ? 69.667  -21.754  77.621  1.00 174.81 ? 2    DT  H C7    1 
ATOM   1251  C  C6    . DT  D  2 2    ? 71.288  -23.487  78.392  1.00 171.53 ? 2    DT  H C6    1 
ATOM   1252  P  P     . DT  D  2 3    ? 73.831  -25.605  83.825  1.00 186.78 ? 3    DT  H P     1 
ATOM   1253  O  OP1   . DT  D  2 3    ? 74.004  -26.564  84.946  1.00 182.52 ? 3    DT  H OP1   1 
ATOM   1254  O  OP2   . DT  D  2 3    ? 73.191  -24.286  84.070  1.00 172.63 ? 3    DT  H OP2   1 
ATOM   1255  O  "O5'" . DT  D  2 3    ? 75.286  -25.304  83.247  1.00 190.54 ? 3    DT  H "O5'" 1 
ATOM   1256  C  "C5'" . DT  D  2 3    ? 76.041  -26.312  82.536  1.00 190.36 ? 3    DT  H "C5'" 1 
ATOM   1257  C  "C4'" . DT  D  2 3    ? 77.236  -25.688  81.852  1.00 187.15 ? 3    DT  H "C4'" 1 
ATOM   1258  O  "O4'" . DT  D  2 3    ? 76.799  -24.842  80.758  1.00 179.74 ? 3    DT  H "O4'" 1 
ATOM   1259  C  "C3'" . DT  D  2 3    ? 78.103  -24.808  82.757  1.00 180.72 ? 3    DT  H "C3'" 1 
ATOM   1260  O  "O3'" . DT  D  2 3    ? 79.497  -25.063  82.558  1.00 186.83 ? 3    DT  H "O3'" 1 
ATOM   1261  C  "C2'" . DT  D  2 3    ? 77.755  -23.396  82.331  1.00 176.47 ? 3    DT  H "C2'" 1 
ATOM   1262  C  "C1'" . DT  D  2 3    ? 77.410  -23.569  80.864  1.00 177.25 ? 3    DT  H "C1'" 1 
ATOM   1263  N  N1    . DT  D  2 3    ? 76.463  -22.577  80.331  1.00 185.52 ? 3    DT  H N1    1 
ATOM   1264  C  C2    . DT  D  2 3    ? 76.807  -21.929  79.152  1.00 190.16 ? 3    DT  H C2    1 
ATOM   1265  O  O2    . DT  D  2 3    ? 77.847  -22.150  78.529  1.00 191.66 ? 3    DT  H O2    1 
ATOM   1266  N  N3    . DT  D  2 3    ? 75.881  -21.009  78.723  1.00 193.66 ? 3    DT  H N3    1 
ATOM   1267  C  C4    . DT  D  2 3    ? 74.695  -20.668  79.320  1.00 194.15 ? 3    DT  H C4    1 
ATOM   1268  O  O4    . DT  D  2 3    ? 73.970  -19.825  78.795  1.00 193.33 ? 3    DT  H O4    1 
ATOM   1269  C  C5    . DT  D  2 3    ? 74.404  -21.366  80.557  1.00 189.60 ? 3    DT  H C5    1 
ATOM   1270  C  C7    . DT  D  2 3    ? 73.133  -21.060  81.281  1.00 188.20 ? 3    DT  H C7    1 
ATOM   1271  C  C6    . DT  D  2 3    ? 75.297  -22.270  80.997  1.00 185.04 ? 3    DT  H C6    1 
ATOM   1272  P  P     . DT  D  2 4    ? 80.601  -24.569  83.613  1.00 193.12 ? 4    DT  H P     1 
ATOM   1273  O  OP1   . DT  D  2 4    ? 81.358  -25.750  84.104  1.00 207.75 ? 4    DT  H OP1   1 
ATOM   1274  O  OP2   . DT  D  2 4    ? 79.944  -23.663  84.595  1.00 186.94 ? 4    DT  H OP2   1 
ATOM   1275  O  "O5'" . DT  D  2 4    ? 81.596  -23.705  82.717  1.00 189.10 ? 4    DT  H "O5'" 1 
ATOM   1276  C  "C5'" . DT  D  2 4    ? 82.234  -24.254  81.542  1.00 181.98 ? 4    DT  H "C5'" 1 
ATOM   1277  C  "C4'" . DT  D  2 4    ? 82.572  -23.147  80.569  1.00 175.89 ? 4    DT  H "C4'" 1 
ATOM   1278  O  "O4'" . DT  D  2 4    ? 81.357  -22.472  80.163  1.00 179.76 ? 4    DT  H "O4'" 1 
ATOM   1279  C  "C3'" . DT  D  2 4    ? 83.504  -22.063  81.128  1.00 173.52 ? 4    DT  H "C3'" 1 
ATOM   1280  O  "O3'" . DT  D  2 4    ? 84.627  -21.844  80.265  1.00 171.58 ? 4    DT  H "O3'" 1 
ATOM   1281  C  "C2'" . DT  D  2 4    ? 82.627  -20.826  81.229  1.00 172.09 ? 4    DT  H "C2'" 1 
ATOM   1282  C  "C1'" . DT  D  2 4    ? 81.570  -21.071  80.166  1.00 179.07 ? 4    DT  H "C1'" 1 
ATOM   1283  N  N1    . DT  D  2 4    ? 80.262  -20.417  80.394  1.00 183.39 ? 4    DT  H N1    1 
ATOM   1284  C  C2    . DT  D  2 4    ? 79.685  -19.712  79.346  1.00 185.77 ? 4    DT  H C2    1 
ATOM   1285  O  O2    . DT  D  2 4    ? 80.198  -19.605  78.231  1.00 188.18 ? 4    DT  H O2    1 
ATOM   1286  N  N3    . DT  D  2 4    ? 78.476  -19.136  79.652  1.00 182.05 ? 4    DT  H N3    1 
ATOM   1287  C  C4    . DT  D  2 4    ? 77.803  -19.176  80.846  1.00 184.28 ? 4    DT  H C4    1 
ATOM   1288  O  O4    . DT  D  2 4    ? 76.716  -18.610  80.950  1.00 198.21 ? 4    DT  H O4    1 
ATOM   1289  C  C5    . DT  D  2 4    ? 78.467  -19.911  81.904  1.00 180.09 ? 4    DT  H C5    1 
ATOM   1290  C  C7    . DT  D  2 4    ? 77.810  -20.008  83.242  1.00 183.46 ? 4    DT  H C7    1 
ATOM   1291  C  C6    . DT  D  2 4    ? 79.653  -20.482  81.628  1.00 180.39 ? 4    DT  H C6    1 
ATOM   1292  P  P     . DT  D  2 5    ? 85.951  -21.038  80.705  1.00 165.06 ? 5    DT  H P     1 
ATOM   1293  O  OP1   . DT  D  2 5    ? 87.124  -21.896  80.382  1.00 167.34 ? 5    DT  H OP1   1 
ATOM   1294  O  OP2   . DT  D  2 5    ? 85.797  -20.504  82.081  1.00 159.42 ? 5    DT  H OP2   1 
ATOM   1295  O  "O5'" . DT  D  2 5    ? 85.950  -19.792  79.709  1.00 165.96 ? 5    DT  H "O5'" 1 
ATOM   1296  C  "C5'" . DT  D  2 5    ? 85.887  -19.974  78.280  1.00 163.29 ? 5    DT  H "C5'" 1 
ATOM   1297  C  "C4'" . DT  D  2 5    ? 85.346  -18.727  77.624  1.00 162.77 ? 5    DT  H "C4'" 1 
ATOM   1298  O  "O4'" . DT  D  2 5    ? 83.980  -18.513  78.057  1.00 162.08 ? 5    DT  H "O4'" 1 
ATOM   1299  C  "C3'" . DT  D  2 5    ? 86.116  -17.449  77.973  1.00 166.33 ? 5    DT  H "C3'" 1 
ATOM   1300  O  "O3'" . DT  D  2 5    ? 86.373  -16.647  76.818  1.00 180.06 ? 5    DT  H "O3'" 1 
ATOM   1301  C  "C2'" . DT  D  2 5    ? 85.181  -16.701  78.904  1.00 168.08 ? 5    DT  H "C2'" 1 
ATOM   1302  C  "C1'" . DT  D  2 5    ? 83.819  -17.148  78.402  1.00 172.09 ? 5    DT  H "C1'" 1 
ATOM   1303  N  N1    . DT  D  2 5    ? 82.705  -17.044  79.374  1.00 175.58 ? 5    DT  H N1    1 
ATOM   1304  C  C2    . DT  D  2 5    ? 81.451  -16.692  78.894  1.00 181.61 ? 5    DT  H C2    1 
ATOM   1305  O  O2    . DT  D  2 5    ? 81.208  -16.484  77.704  1.00 174.80 ? 5    DT  H O2    1 
ATOM   1306  N  N3    . DT  D  2 5    ? 80.483  -16.593  79.864  1.00 187.57 ? 5    DT  H N3    1 
ATOM   1307  C  C4    . DT  D  2 5    ? 80.621  -16.793  81.214  1.00 178.10 ? 5    DT  H C4    1 
ATOM   1308  O  O4    . DT  D  2 5    ? 79.641  -16.674  81.949  1.00 171.20 ? 5    DT  H O4    1 
ATOM   1309  C  C5    . DT  D  2 5    ? 81.958  -17.140  81.653  1.00 165.61 ? 5    DT  H C5    1 
ATOM   1310  C  C7    . DT  D  2 5    ? 82.204  -17.375  83.107  1.00 161.16 ? 5    DT  H C7    1 
ATOM   1311  C  C6    . DT  D  2 5    ? 82.922  -17.239  80.721  1.00 166.34 ? 5    DT  H C6    1 
ATOM   1312  P  P     . DT  D  2 6    ? 87.821  -15.998  76.579  1.00 188.17 ? 6    DT  H P     1 
ATOM   1313  O  OP1   . DT  D  2 6    ? 88.531  -16.935  75.675  1.00 203.57 ? 6    DT  H OP1   1 
ATOM   1314  O  OP2   . DT  D  2 6    ? 88.427  -15.644  77.887  1.00 178.83 ? 6    DT  H OP2   1 
ATOM   1315  O  "O5'" . DT  D  2 6    ? 87.579  -14.615  75.819  1.00 185.85 ? 6    DT  H "O5'" 1 
ATOM   1316  C  "C5'" . DT  D  2 6    ? 86.547  -14.434  74.819  1.00 181.32 ? 6    DT  H "C5'" 1 
ATOM   1317  C  "C4'" . DT  D  2 6    ? 85.841  -13.111  75.021  1.00 181.09 ? 6    DT  H "C4'" 1 
ATOM   1318  O  "O4'" . DT  D  2 6    ? 84.824  -13.255  76.044  1.00 173.55 ? 6    DT  H "O4'" 1 
ATOM   1319  C  "C3'" . DT  D  2 6    ? 86.740  -11.954  75.471  1.00 181.80 ? 6    DT  H "C3'" 1 
ATOM   1320  O  "O3'" . DT  D  2 6    ? 86.513  -10.793  74.657  1.00 186.57 ? 6    DT  H "O3'" 1 
ATOM   1321  C  "C2'" . DT  D  2 6    ? 86.430  -11.823  76.953  1.00 174.27 ? 6    DT  H "C2'" 1 
ATOM   1322  C  "C1'" . DT  D  2 6    ? 84.976  -12.251  77.033  1.00 167.41 ? 6    DT  H "C1'" 1 
ATOM   1323  N  N1    . DT  D  2 6    ? 84.539  -12.822  78.325  1.00 161.77 ? 6    DT  H N1    1 
ATOM   1324  C  C2    . DT  D  2 6    ? 83.242  -13.310  78.406  1.00 155.91 ? 6    DT  H C2    1 
ATOM   1325  O  O2    . DT  D  2 6    ? 82.449  -13.303  77.463  1.00 150.62 ? 6    DT  H O2    1 
ATOM   1326  N  N3    . DT  D  2 6    ? 82.905  -13.813  79.640  1.00 156.38 ? 6    DT  H N3    1 
ATOM   1327  C  C4    . DT  D  2 6    ? 83.686  -13.876  80.765  1.00 159.44 ? 6    DT  H C4    1 
ATOM   1328  O  O4    . DT  D  2 6    ? 83.229  -14.372  81.794  1.00 155.39 ? 6    DT  H O4    1 
ATOM   1329  C  C5    . DT  D  2 6    ? 85.021  -13.334  80.619  1.00 161.60 ? 6    DT  H C5    1 
ATOM   1330  C  C7    . DT  D  2 6    ? 85.945  -13.357  81.793  1.00 161.60 ? 6    DT  H C7    1 
ATOM   1331  C  C6    . DT  D  2 6    ? 85.374  -12.834  79.422  1.00 161.56 ? 6    DT  H C6    1 
ATOM   1332  P  P     . DT  D  2 7    ? 86.257  -9.279   75.133  1.00 200.83 ? 7    DT  H P     1 
ATOM   1333  O  OP1   . DT  D  2 7    ? 86.508  -8.397   73.967  1.00 209.63 ? 7    DT  H OP1   1 
ATOM   1334  O  OP2   . DT  D  2 7    ? 86.927  -8.973   76.423  1.00 201.54 ? 7    DT  H OP2   1 
ATOM   1335  O  "O5'" . DT  D  2 7    ? 84.683  -9.324   75.362  1.00 196.94 ? 7    DT  H "O5'" 1 
ATOM   1336  C  "C5'" . DT  D  2 7    ? 83.811  -9.817   74.326  1.00 193.85 ? 7    DT  H "C5'" 1 
ATOM   1337  C  "C4'" . DT  D  2 7    ? 82.369  -9.560   74.690  1.00 188.55 ? 7    DT  H "C4'" 1 
ATOM   1338  O  "O4'" . DT  D  2 7    ? 82.003  -10.417  75.791  1.00 173.47 ? 7    DT  H "O4'" 1 
ATOM   1339  C  "C3'" . DT  D  2 7    ? 82.062  -8.126   75.143  1.00 190.16 ? 7    DT  H "C3'" 1 
ATOM   1340  O  "O3'" . DT  D  2 7    ? 81.159  -7.481   74.233  1.00 198.69 ? 7    DT  H "O3'" 1 
ATOM   1341  C  "C2'" . DT  D  2 7    ? 81.443  -8.285   76.524  1.00 175.31 ? 7    DT  H "C2'" 1 
ATOM   1342  C  "C1'" . DT  D  2 7    ? 81.031  -9.744   76.556  1.00 169.77 ? 7    DT  H "C1'" 1 
ATOM   1343  N  N1    . DT  D  2 7    ? 81.000  -10.382  77.879  1.00 166.48 ? 7    DT  H N1    1 
ATOM   1344  C  C2    . DT  D  2 7    ? 79.904  -11.169  78.202  1.00 165.35 ? 7    DT  H C2    1 
ATOM   1345  O  O2    . DT  D  2 7    ? 78.955  -11.365  77.440  1.00 166.65 ? 7    DT  H O2    1 
ATOM   1346  N  N3    . DT  D  2 7    ? 79.958  -11.725  79.457  1.00 158.07 ? 7    DT  H N3    1 
ATOM   1347  C  C4    . DT  D  2 7    ? 80.947  -11.585  80.397  1.00 156.77 ? 7    DT  H C4    1 
ATOM   1348  O  O4    . DT  D  2 7    ? 80.845  -12.165  81.477  1.00 160.74 ? 7    DT  H O4    1 
ATOM   1349  C  C5    . DT  D  2 7    ? 82.055  -10.736  80.005  1.00 161.27 ? 7    DT  H C5    1 
ATOM   1350  C  C7    . DT  D  2 7    ? 83.179  -10.522  80.965  1.00 160.86 ? 7    DT  H C7    1 
ATOM   1351  C  C6    . DT  D  2 7    ? 82.021  -10.179  78.782  1.00 165.08 ? 7    DT  H C6    1 
ATOM   1352  P  P     . DG  D  2 8    ? 81.020  -5.884   74.094  1.00 183.63 ? 8    DG  H P     1 
ATOM   1353  O  OP1   . DG  D  2 8    ? 81.160  -5.561   72.651  1.00 194.04 ? 8    DG  H OP1   1 
ATOM   1354  O  OP2   . DG  D  2 8    ? 81.904  -5.213   75.086  1.00 193.47 ? 8    DG  H OP2   1 
ATOM   1355  O  "O5'" . DG  D  2 8    ? 79.502  -5.649   74.515  1.00 175.07 ? 8    DG  H "O5'" 1 
ATOM   1356  C  "C5'" . DG  D  2 8    ? 78.438  -6.328   73.824  1.00 175.91 ? 8    DG  H "C5'" 1 
ATOM   1357  C  "C4'" . DG  D  2 8    ? 77.263  -6.530   74.751  1.00 172.60 ? 8    DG  H "C4'" 1 
ATOM   1358  O  "O4'" . DG  D  2 8    ? 77.678  -7.331   75.879  1.00 170.55 ? 8    DG  H "O4'" 1 
ATOM   1359  C  "C3'" . DG  D  2 8    ? 76.675  -5.236   75.331  1.00 175.55 ? 8    DG  H "C3'" 1 
ATOM   1360  O  "O3'" . DG  D  2 8    ? 75.344  -5.014   74.836  1.00 176.24 ? 8    DG  H "O3'" 1 
ATOM   1361  C  "C2'" . DG  D  2 8    ? 76.725  -5.431   76.841  1.00 170.80 ? 8    DG  H "C2'" 1 
ATOM   1362  C  "C1'" . DG  D  2 8    ? 76.932  -6.928   77.011  1.00 174.00 ? 8    DG  H "C1'" 1 
ATOM   1363  N  N9    . DG  D  2 8    ? 77.667  -7.337   78.206  1.00 170.00 ? 8    DG  H N9    1 
ATOM   1364  C  C8    . DG  D  2 8    ? 78.826  -6.782   78.695  1.00 168.15 ? 8    DG  H C8    1 
ATOM   1365  N  N7    . DG  D  2 8    ? 79.256  -7.368   79.780  1.00 159.92 ? 8    DG  H N7    1 
ATOM   1366  C  C5    . DG  D  2 8    ? 78.330  -8.372   80.020  1.00 154.52 ? 8    DG  H C5    1 
ATOM   1367  C  C6    . DG  D  2 8    ? 78.272  -9.337   81.057  1.00 156.21 ? 8    DG  H C6    1 
ATOM   1368  O  O6    . DG  D  2 8    ? 79.055  -9.502   81.999  1.00 155.14 ? 8    DG  H O6    1 
ATOM   1369  N  N1    . DG  D  2 8    ? 77.165  -10.170  80.921  1.00 167.05 ? 8    DG  H N1    1 
ATOM   1370  C  C2    . DG  D  2 8    ? 76.233  -10.087  79.915  1.00 173.22 ? 8    DG  H C2    1 
ATOM   1371  N  N2    . DG  D  2 8    ? 75.235  -10.986  79.954  1.00 169.08 ? 8    DG  H N2    1 
ATOM   1372  N  N3    . DG  D  2 8    ? 76.276  -9.190   78.941  1.00 179.33 ? 8    DG  H N3    1 
ATOM   1373  C  C4    . DG  D  2 8    ? 77.343  -8.369   79.057  1.00 167.22 ? 8    DG  H C4    1 
ATOM   1374  P  P     . DT  D  2 9    ? 74.523  -3.644   75.038  1.00 173.98 ? 9    DT  H P     1 
ATOM   1375  O  OP1   . DT  D  2 9    ? 73.885  -3.179   73.772  1.00 171.12 ? 9    DT  H OP1   1 
ATOM   1376  O  OP2   . DT  D  2 9    ? 75.361  -2.700   75.824  1.00 173.60 ? 9    DT  H OP2   1 
ATOM   1377  O  "O5'" . DT  D  2 9    ? 73.352  -4.104   76.009  1.00 164.62 ? 9    DT  H "O5'" 1 
ATOM   1378  C  "C5'" . DT  D  2 9    ? 72.899  -5.468   76.076  1.00 160.75 ? 9    DT  H "C5'" 1 
ATOM   1379  C  "C4'" . DT  D  2 9    ? 72.208  -5.705   77.398  1.00 162.48 ? 9    DT  H "C4'" 1 
ATOM   1380  O  "O4'" . DT  D  2 9    ? 73.179  -6.157   78.374  1.00 159.30 ? 9    DT  H "O4'" 1 
ATOM   1381  C  "C3'" . DT  D  2 9    ? 71.540  -4.469   78.008  1.00 161.76 ? 9    DT  H "C3'" 1 
ATOM   1382  O  "O3'" . DT  D  2 9    ? 70.289  -4.833   78.591  1.00 163.92 ? 9    DT  H "O3'" 1 
ATOM   1383  C  "C2'" . DT  D  2 9    ? 72.542  -4.007   79.051  1.00 158.74 ? 9    DT  H "C2'" 1 
ATOM   1384  C  "C1'" . DT  D  2 9    ? 73.118  -5.331   79.530  1.00 160.44 ? 9    DT  H "C1'" 1 
ATOM   1385  N  N1    . DT  D  2 9    ? 74.471  -5.302   80.146  1.00 162.96 ? 9    DT  H N1    1 
ATOM   1386  C  C2    . DT  D  2 9    ? 74.773  -6.294   81.054  1.00 163.63 ? 9    DT  H C2    1 
ATOM   1387  O  O2    . DT  D  2 9    ? 73.982  -7.167   81.377  1.00 158.20 ? 9    DT  H O2    1 
ATOM   1388  N  N3    . DT  D  2 9    ? 76.041  -6.220   81.582  1.00 165.06 ? 9    DT  H N3    1 
ATOM   1389  C  C4    . DT  D  2 9    ? 77.016  -5.283   81.288  1.00 153.26 ? 9    DT  H C4    1 
ATOM   1390  O  O4    . DT  D  2 9    ? 78.110  -5.344   81.845  1.00 145.19 ? 9    DT  H O4    1 
ATOM   1391  C  C5    . DT  D  2 9    ? 76.631  -4.274   80.327  1.00 149.69 ? 9    DT  H C5    1 
ATOM   1392  C  C7    . DT  D  2 9    ? 77.621  -3.220   79.945  1.00 144.54 ? 9    DT  H C7    1 
ATOM   1393  C  C6    . DT  D  2 9    ? 75.395  -4.332   79.813  1.00 162.44 ? 9    DT  H C6    1 
ATOM   1394  P  P     . DG  D  2 10   ? 69.165  -3.758   78.966  1.00 173.10 ? 10   DG  H P     1 
ATOM   1395  O  OP1   . DG  D  2 10   ? 67.986  -4.032   78.106  1.00 179.73 ? 10   DG  H OP1   1 
ATOM   1396  O  OP2   . DG  D  2 10   ? 69.761  -2.394   78.987  1.00 169.27 ? 10   DG  H OP2   1 
ATOM   1397  O  "O5'" . DG  D  2 10   ? 68.774  -4.182   80.454  1.00 178.85 ? 10   DG  H "O5'" 1 
ATOM   1398  C  "C5'" . DG  D  2 10   ? 68.499  -5.560   80.800  1.00 179.06 ? 10   DG  H "C5'" 1 
ATOM   1399  C  "C4'" . DG  D  2 10   ? 68.782  -5.806   82.265  1.00 172.33 ? 10   DG  H "C4'" 1 
ATOM   1400  O  "O4'" . DG  D  2 10   ? 70.211  -5.793   82.502  1.00 163.14 ? 10   DG  H "O4'" 1 
ATOM   1401  C  "C3'" . DG  D  2 10   ? 68.173  -4.767   83.211  1.00 171.15 ? 10   DG  H "C3'" 1 
ATOM   1402  O  "O3'" . DG  D  2 10   ? 67.439  -5.394   84.270  1.00 176.45 ? 10   DG  H "O3'" 1 
ATOM   1403  C  "C2'" . DG  D  2 10   ? 69.370  -3.985   83.727  1.00 165.39 ? 10   DG  H "C2'" 1 
ATOM   1404  C  "C1'" . DG  D  2 10   ? 70.521  -4.964   83.611  1.00 163.74 ? 10   DG  H "C1'" 1 
ATOM   1405  N  N9    . DG  D  2 10   ? 71.825  -4.351   83.364  1.00 165.47 ? 10   DG  H N9    1 
ATOM   1406  C  C8    . DG  D  2 10   ? 72.109  -3.360   82.456  1.00 168.70 ? 10   DG  H C8    1 
ATOM   1407  N  N7    . DG  D  2 10   ? 73.371  -3.026   82.440  1.00 163.89 ? 10   DG  H N7    1 
ATOM   1408  C  C5    . DG  D  2 10   ? 73.956  -3.844   83.396  1.00 163.80 ? 10   DG  H C5    1 
ATOM   1409  C  C6    . DG  D  2 10   ? 75.308  -3.942   83.822  1.00 164.56 ? 10   DG  H C6    1 
ATOM   1410  O  O6    . DG  D  2 10   ? 76.286  -3.288   83.440  1.00 161.20 ? 10   DG  H O6    1 
ATOM   1411  N  N1    . DG  D  2 10   ? 75.463  -4.897   84.821  1.00 166.41 ? 10   DG  H N1    1 
ATOM   1412  C  C2    . DG  D  2 10   ? 74.453  -5.670   85.337  1.00 167.38 ? 10   DG  H C2    1 
ATOM   1413  N  N2    . DG  D  2 10   ? 74.806  -6.536   86.298  1.00 157.39 ? 10   DG  H N2    1 
ATOM   1414  N  N3    . DG  D  2 10   ? 73.190  -5.597   84.942  1.00 175.06 ? 10   DG  H N3    1 
ATOM   1415  C  C4    . DG  D  2 10   ? 73.015  -4.669   83.976  1.00 165.83 ? 10   DG  H C4    1 
ATOM   1416  P  P     . DG  D  2 11   ? 66.093  -4.758   84.892  1.00 174.79 ? 11   DG  H P     1 
ATOM   1417  O  OP1   . DG  D  2 11   ? 64.923  -5.582   84.474  1.00 171.28 ? 11   DG  H OP1   1 
ATOM   1418  O  OP2   . DG  D  2 11   ? 66.071  -3.281   84.695  1.00 173.89 ? 11   DG  H OP2   1 
ATOM   1419  O  "O5'" . DG  D  2 11   ? 66.272  -5.008   86.454  1.00 181.02 ? 11   DG  H "O5'" 1 
ATOM   1420  C  "C5'" . DG  D  2 11   ? 67.493  -5.539   87.016  1.00 179.76 ? 11   DG  H "C5'" 1 
ATOM   1421  C  "C4'" . DG  D  2 11   ? 68.044  -4.600   88.065  1.00 175.21 ? 11   DG  H "C4'" 1 
ATOM   1422  O  "O4'" . DG  D  2 11   ? 69.145  -3.835   87.519  1.00 174.63 ? 11   DG  H "O4'" 1 
ATOM   1423  C  "C3'" . DG  D  2 11   ? 67.055  -3.569   88.614  1.00 172.46 ? 11   DG  H "C3'" 1 
ATOM   1424  O  "O3'" . DG  D  2 11   ? 67.289  -3.451   90.016  1.00 170.77 ? 11   DG  H "O3'" 1 
ATOM   1425  C  "C2'" . DG  D  2 11   ? 67.432  -2.297   87.879  1.00 167.35 ? 11   DG  H "C2'" 1 
ATOM   1426  C  "C1'" . DG  D  2 11   ? 68.937  -2.460   87.797  1.00 166.03 ? 11   DG  H "C1'" 1 
ATOM   1427  N  N9    . DG  D  2 11   ? 69.623  -1.682   86.769  1.00 156.57 ? 11   DG  H N9    1 
ATOM   1428  C  C8    . DG  D  2 11   ? 69.158  -1.343   85.522  1.00 157.16 ? 11   DG  H C8    1 
ATOM   1429  N  N7    . DG  D  2 11   ? 70.014  -0.642   84.830  1.00 160.17 ? 11   DG  H N7    1 
ATOM   1430  C  C5    . DG  D  2 11   ? 71.106  -0.502   85.675  1.00 163.10 ? 11   DG  H C5    1 
ATOM   1431  C  C6    . DG  D  2 11   ? 72.344  0.169    85.478  1.00 168.02 ? 11   DG  H C6    1 
ATOM   1432  O  O6    . DG  D  2 11   ? 72.737  0.788    84.480  1.00 159.17 ? 11   DG  H O6    1 
ATOM   1433  N  N1    . DG  D  2 11   ? 73.166  0.063    86.596  1.00 165.53 ? 11   DG  H N1    1 
ATOM   1434  C  C2    . DG  D  2 11   ? 72.841  -0.597   87.756  1.00 160.63 ? 11   DG  H C2    1 
ATOM   1435  N  N2    . DG  D  2 11   ? 73.769  -0.593   88.723  1.00 156.54 ? 11   DG  H N2    1 
ATOM   1436  N  N3    . DG  D  2 11   ? 71.692  -1.224   87.952  1.00 162.58 ? 11   DG  H N3    1 
ATOM   1437  C  C4    . DG  D  2 11   ? 70.880  -1.139   86.876  1.00 158.10 ? 11   DG  H C4    1 
ATOM   1438  P  P     . DC  D  2 12   ? 66.136  -2.993   91.013  1.00 186.81 ? 12   DC  H P     1 
ATOM   1439  O  OP1   . DC  D  2 12   ? 65.561  -4.211   91.651  1.00 188.80 ? 12   DC  H OP1   1 
ATOM   1440  O  OP2   . DC  D  2 12   ? 65.245  -2.048   90.280  1.00 185.86 ? 12   DC  H OP2   1 
ATOM   1441  O  "O5'" . DC  D  2 12   ? 66.986  -2.211   92.113  1.00 171.92 ? 12   DC  H "O5'" 1 
ATOM   1442  C  "C5'" . DC  D  2 12   ? 68.243  -2.732   92.588  1.00 165.53 ? 12   DC  H "C5'" 1 
ATOM   1443  C  "C4'" . DC  D  2 12   ? 69.244  -1.616   92.788  1.00 164.41 ? 12   DC  H "C4'" 1 
ATOM   1444  O  "O4'" . DC  D  2 12   ? 69.692  -1.099   91.509  1.00 151.80 ? 12   DC  H "O4'" 1 
ATOM   1445  C  "C3'" . DC  D  2 12   ? 68.718  -0.410   93.577  1.00 167.41 ? 12   DC  H "C3'" 1 
ATOM   1446  O  "O3'" . DC  D  2 12   ? 69.666  0.018    94.564  1.00 169.79 ? 12   DC  H "O3'" 1 
ATOM   1447  C  "C2'" . DC  D  2 12   ? 68.552  0.660    92.516  1.00 159.48 ? 12   DC  H "C2'" 1 
ATOM   1448  C  "C1'" . DC  D  2 12   ? 69.696  0.315    91.585  1.00 158.68 ? 12   DC  H "C1'" 1 
ATOM   1449  N  N1    . DC  D  2 12   ? 69.601  0.855    90.215  1.00 164.00 ? 12   DC  H N1    1 
ATOM   1450  C  C2    . DC  D  2 12   ? 70.706  1.530    89.687  1.00 162.63 ? 12   DC  H C2    1 
ATOM   1451  O  O2    . DC  D  2 12   ? 71.731  1.637    90.377  1.00 164.86 ? 12   DC  H O2    1 
ATOM   1452  N  N3    . DC  D  2 12   ? 70.636  2.041    88.436  1.00 160.46 ? 12   DC  H N3    1 
ATOM   1453  C  C4    . DC  D  2 12   ? 69.517  1.902    87.721  1.00 164.51 ? 12   DC  H C4    1 
ATOM   1454  N  N4    . DC  D  2 12   ? 69.494  2.422    86.490  1.00 160.77 ? 12   DC  H N4    1 
ATOM   1455  C  C5    . DC  D  2 12   ? 68.371  1.225    88.238  1.00 161.09 ? 12   DC  H C5    1 
ATOM   1456  C  C6    . DC  D  2 12   ? 68.455  0.727    89.479  1.00 160.80 ? 12   DC  H C6    1 
ATOM   1457  P  P     . DA  D  2 13   ? 69.328  0.180    96.137  1.00 173.81 ? 13   DA  H P     1 
ATOM   1458  O  OP1   . DA  D  2 13   ? 69.411  -1.150   96.800  1.00 171.58 ? 13   DA  H OP1   1 
ATOM   1459  O  OP2   . DA  D  2 13   ? 68.078  0.982    96.272  1.00 169.25 ? 13   DA  H OP2   1 
ATOM   1460  O  "O5'" . DA  D  2 13   ? 70.573  1.053    96.622  1.00 160.64 ? 13   DA  H "O5'" 1 
ATOM   1461  C  "C5'" . DA  D  2 13   ? 71.907  0.815    96.114  1.00 155.06 ? 13   DA  H "C5'" 1 
ATOM   1462  C  "C4'" . DA  D  2 13   ? 72.574  2.108    95.695  1.00 148.24 ? 13   DA  H "C4'" 1 
ATOM   1463  O  "O4'" . DA  D  2 13   ? 72.227  2.471    94.331  1.00 146.47 ? 13   DA  H "O4'" 1 
ATOM   1464  C  "C3'" . DA  D  2 13   ? 72.233  3.323    96.561  1.00 140.83 ? 13   DA  H "C3'" 1 
ATOM   1465  O  "O3'" . DA  D  2 13   ? 73.428  4.009    96.933  1.00 148.37 ? 13   DA  H "O3'" 1 
ATOM   1466  C  "C2'" . DA  D  2 13   ? 71.390  4.195    95.651  1.00 140.55 ? 13   DA  H "C2'" 1 
ATOM   1467  C  "C1'" . DA  D  2 13   ? 71.955  3.863    94.285  1.00 141.40 ? 13   DA  H "C1'" 1 
ATOM   1468  N  N9    . DA  D  2 13   ? 71.056  4.123    93.158  1.00 137.26 ? 13   DA  H N9    1 
ATOM   1469  C  C8    . DA  D  2 13   ? 69.690  4.013    93.123  1.00 141.72 ? 13   DA  H C8    1 
ATOM   1470  N  N7    . DA  D  2 13   ? 69.164  4.326    91.964  1.00 145.35 ? 13   DA  H N7    1 
ATOM   1471  C  C5    . DA  D  2 13   ? 70.257  4.669    91.183  1.00 140.59 ? 13   DA  H C5    1 
ATOM   1472  C  C6    . DA  D  2 13   ? 70.369  5.100    89.851  1.00 145.22 ? 13   DA  H C6    1 
ATOM   1473  N  N6    . DA  D  2 13   ? 69.326  5.255    89.033  1.00 149.19 ? 13   DA  H N6    1 
ATOM   1474  N  N1    . DA  D  2 13   ? 71.606  5.373    89.380  1.00 149.71 ? 13   DA  H N1    1 
ATOM   1475  C  C2    . DA  D  2 13   ? 72.653  5.217    90.201  1.00 148.15 ? 13   DA  H C2    1 
ATOM   1476  N  N3    . DA  D  2 13   ? 72.673  4.817    91.472  1.00 150.89 ? 13   DA  H N3    1 
ATOM   1477  C  C4    . DA  D  2 13   ? 71.429  4.558    91.909  1.00 141.86 ? 13   DA  H C4    1 
ATOM   1478  P  P     . DC  D  2 14   ? 73.550  4.804    98.320  1.00 168.63 ? 14   DC  H P     1 
ATOM   1479  O  OP1   . DC  D  2 14   ? 74.288  3.947    99.288  1.00 173.39 ? 14   DC  H OP1   1 
ATOM   1480  O  OP2   . DC  D  2 14   ? 72.233  5.383    98.714  1.00 172.33 ? 14   DC  H OP2   1 
ATOM   1481  O  "O5'" . DC  D  2 14   ? 74.475  6.035    97.919  1.00 153.29 ? 14   DC  H "O5'" 1 
ATOM   1482  C  "C5'" . DC  D  2 14   ? 75.494  5.929    96.912  1.00 144.30 ? 14   DC  H "C5'" 1 
ATOM   1483  C  "C4'" . DC  D  2 14   ? 75.462  7.150    96.024  1.00 145.79 ? 14   DC  H "C4'" 1 
ATOM   1484  O  "O4'" . DC  D  2 14   ? 74.390  7.025    95.059  1.00 145.61 ? 14   DC  H "O4'" 1 
ATOM   1485  C  "C3'" . DC  D  2 14   ? 75.225  8.482    96.751  1.00 149.97 ? 14   DC  H "C3'" 1 
ATOM   1486  O  "O3'" . DC  D  2 14   ? 76.225  9.445    96.401  1.00 151.59 ? 14   DC  H "O3'" 1 
ATOM   1487  C  "C2'" . DC  D  2 14   ? 73.859  8.934    96.262  1.00 146.02 ? 14   DC  H "C2'" 1 
ATOM   1488  C  "C1'" . DC  D  2 14   ? 73.801  8.300    94.886  1.00 145.91 ? 14   DC  H "C1'" 1 
ATOM   1489  N  N1    . DC  D  2 14   ? 72.459  8.113    94.299  1.00 139.80 ? 14   DC  H N1    1 
ATOM   1490  C  C2    . DC  D  2 14   ? 72.283  8.330    92.926  1.00 133.12 ? 14   DC  H C2    1 
ATOM   1491  O  O2    . DC  D  2 14   ? 73.257  8.685    92.242  1.00 128.06 ? 14   DC  H O2    1 
ATOM   1492  N  N3    . DC  D  2 14   ? 71.057  8.152    92.382  1.00 132.47 ? 14   DC  H N3    1 
ATOM   1493  C  C4    . DC  D  2 14   ? 70.036  7.767    93.152  1.00 128.72 ? 14   DC  H C4    1 
ATOM   1494  N  N4    . DC  D  2 14   ? 68.845  7.595    92.575  1.00 128.71 ? 14   DC  H N4    1 
ATOM   1495  C  C5    . DC  D  2 14   ? 70.187  7.534    94.548  1.00 135.10 ? 14   DC  H C5    1 
ATOM   1496  C  C6    . DC  D  2 14   ? 71.404  7.721    95.076  1.00 141.23 ? 14   DC  H C6    1 
ATOM   1497  P  P     . DT  D  2 15   ? 76.596  10.685   97.348  1.00 155.34 ? 15   DT  H P     1 
ATOM   1498  O  OP1   . DT  D  2 15   ? 77.905  10.391   97.990  1.00 147.66 ? 15   DT  H OP1   1 
ATOM   1499  O  OP2   . DT  D  2 15   ? 75.412  11.056   98.167  1.00 155.04 ? 15   DT  H OP2   1 
ATOM   1500  O  "O5'" . DT  D  2 15   ? 76.827  11.864   96.305  1.00 152.29 ? 15   DT  H "O5'" 1 
ATOM   1501  C  "C5'" . DT  D  2 15   ? 77.441  11.594   95.030  1.00 149.20 ? 15   DT  H "C5'" 1 
ATOM   1502  C  "C4'" . DT  D  2 15   ? 76.783  12.396   93.930  1.00 141.71 ? 15   DT  H "C4'" 1 
ATOM   1503  O  "O4'" . DT  D  2 15   ? 75.475  11.866   93.608  1.00 138.21 ? 15   DT  H "O4'" 1 
ATOM   1504  C  "C3'" . DT  D  2 15   ? 76.581  13.878   94.256  1.00 144.44 ? 15   DT  H "C3'" 1 
ATOM   1505  O  "O3'" . DT  D  2 15   ? 77.169  14.677   93.230  1.00 147.81 ? 15   DT  H "O3'" 1 
ATOM   1506  C  "C2'" . DT  D  2 15   ? 75.073  14.046   94.317  1.00 142.81 ? 15   DT  H "C2'" 1 
ATOM   1507  C  "C1'" . DT  D  2 15   ? 74.579  12.944   93.408  1.00 140.87 ? 15   DT  H "C1'" 1 
ATOM   1508  N  N1    . DT  D  2 15   ? 73.204  12.466   93.690  1.00 147.72 ? 15   DT  H N1    1 
ATOM   1509  C  C2    . DT  D  2 15   ? 72.332  12.409   92.629  1.00 148.18 ? 15   DT  H C2    1 
ATOM   1510  O  O2    . DT  D  2 15   ? 72.646  12.720   91.493  1.00 146.78 ? 15   DT  H O2    1 
ATOM   1511  N  N3    . DT  D  2 15   ? 71.073  11.959   92.945  1.00 158.00 ? 15   DT  H N3    1 
ATOM   1512  C  C4    . DT  D  2 15   ? 70.612  11.571   94.191  1.00 152.51 ? 15   DT  H C4    1 
ATOM   1513  O  O4    . DT  D  2 15   ? 69.452  11.190   94.323  1.00 154.08 ? 15   DT  H O4    1 
ATOM   1514  C  C5    . DT  D  2 15   ? 71.577  11.662   95.260  1.00 151.82 ? 15   DT  H C5    1 
ATOM   1515  C  C7    . DT  D  2 15   ? 71.165  11.267   96.644  1.00 149.31 ? 15   DT  H C7    1 
ATOM   1516  C  C6    . DT  D  2 15   ? 72.809  12.101   94.961  1.00 154.86 ? 15   DT  H C6    1 
ATOM   1517  P  P     . DG  D  2 16   ? 77.486  16.233   93.443  1.00 155.50 ? 16   DG  H P     1 
ATOM   1518  O  OP1   . DG  D  2 16   ? 78.958  16.431   93.398  1.00 148.79 ? 16   DG  H OP1   1 
ATOM   1519  O  OP2   . DG  D  2 16   ? 76.742  16.695   94.639  1.00 158.18 ? 16   DG  H OP2   1 
ATOM   1520  O  "O5'" . DG  D  2 16   ? 76.814  16.836   92.126  1.00 142.03 ? 16   DG  H "O5'" 1 
ATOM   1521  C  "C5'" . DG  D  2 16   ? 75.833  16.083   91.389  1.00 135.67 ? 16   DG  H "C5'" 1 
ATOM   1522  C  "C4'" . DG  D  2 16   ? 74.998  16.993   90.521  1.00 140.43 ? 16   DG  H "C4'" 1 
ATOM   1523  O  "O4'" . DG  D  2 16   ? 73.619  16.580   90.639  1.00 143.07 ? 16   DG  H "O4'" 1 
ATOM   1524  C  "C3'" . DG  D  2 16   ? 74.990  18.455   90.943  1.00 145.28 ? 16   DG  H "C3'" 1 
ATOM   1525  O  "O3'" . DG  D  2 16   ? 74.436  19.235   89.886  1.00 146.90 ? 16   DG  H "O3'" 1 
ATOM   1526  C  "C2'" . DG  D  2 16   ? 73.984  18.431   92.069  1.00 150.64 ? 16   DG  H "C2'" 1 
ATOM   1527  C  "C1'" . DG  D  2 16   ? 72.926  17.501   91.480  1.00 148.66 ? 16   DG  H "C1'" 1 
ATOM   1528  N  N9    . DG  D  2 16   ? 72.155  16.729   92.446  1.00 147.59 ? 16   DG  H N9    1 
ATOM   1529  C  C8    . DG  D  2 16   ? 72.475  16.459   93.755  1.00 148.35 ? 16   DG  H C8    1 
ATOM   1530  N  N7    . DG  D  2 16   ? 71.580  15.728   94.360  1.00 152.81 ? 16   DG  H N7    1 
ATOM   1531  C  C5    . DG  D  2 16   ? 70.610  15.502   93.392  1.00 155.30 ? 16   DG  H C5    1 
ATOM   1532  C  C6    . DG  D  2 16   ? 69.390  14.776   93.463  1.00 156.61 ? 16   DG  H C6    1 
ATOM   1533  O  O6    . DG  D  2 16   ? 68.907  14.163   94.425  1.00 156.08 ? 16   DG  H O6    1 
ATOM   1534  N  N1    . DG  D  2 16   ? 68.704  14.815   92.252  1.00 152.09 ? 16   DG  H N1    1 
ATOM   1535  C  C2    . DG  D  2 16   ? 69.136  15.461   91.120  1.00 151.41 ? 16   DG  H C2    1 
ATOM   1536  N  N2    . DG  D  2 16   ? 68.335  15.374   90.046  1.00 157.23 ? 16   DG  H N2    1 
ATOM   1537  N  N3    . DG  D  2 16   ? 70.271  16.136   91.042  1.00 146.73 ? 16   DG  H N3    1 
ATOM   1538  C  C4    . DG  D  2 16   ? 70.953  16.115   92.206  1.00 147.28 ? 16   DG  H C4    1 
ATOM   1539  P  P     . DG  D  2 17   ? 74.759  20.774   89.772  1.00 162.09 ? 17   DG  H P     1 
ATOM   1540  O  OP1   . DG  D  2 17   ? 76.103  20.870   89.143  1.00 176.17 ? 17   DG  H OP1   1 
ATOM   1541  O  OP2   . DG  D  2 17   ? 74.513  21.402   91.094  1.00 158.88 ? 17   DG  H OP2   1 
ATOM   1542  O  "O5'" . DG  D  2 17   ? 73.673  21.287   88.729  1.00 158.69 ? 17   DG  H "O5'" 1 
ATOM   1543  C  "C5'" . DG  D  2 17   ? 73.151  20.434   87.692  1.00 152.28 ? 17   DG  H "C5'" 1 
ATOM   1544  C  "C4'" . DG  D  2 17   ? 71.656  20.618   87.583  1.00 155.73 ? 17   DG  H "C4'" 1 
ATOM   1545  O  "O4'" . DG  D  2 17   ? 70.993  19.866   88.628  1.00 155.29 ? 17   DG  H "O4'" 1 
ATOM   1546  C  "C3'" . DG  D  2 17   ? 71.165  22.059   87.737  1.00 165.20 ? 17   DG  H "C3'" 1 
ATOM   1547  O  "O3'" . DG  D  2 17   ? 70.055  22.289   86.867  1.00 170.05 ? 17   DG  H "O3'" 1 
ATOM   1548  C  "C2'" . DG  D  2 17   ? 70.721  22.123   89.187  1.00 168.11 ? 17   DG  H "C2'" 1 
ATOM   1549  C  "C1'" . DG  D  2 17   ? 70.158  20.729   89.390  1.00 164.15 ? 17   DG  H "C1'" 1 
ATOM   1550  N  N9    . DG  D  2 17   ? 70.152  20.246   90.769  1.00 163.49 ? 17   DG  H N9    1 
ATOM   1551  C  C8    . DG  D  2 17   ? 71.144  20.395   91.709  1.00 163.85 ? 17   DG  H C8    1 
ATOM   1552  N  N7    . DG  D  2 17   ? 70.850  19.840   92.854  1.00 170.24 ? 17   DG  H N7    1 
ATOM   1553  C  C5    . DG  D  2 17   ? 69.590  19.293   92.660  1.00 169.18 ? 17   DG  H C5    1 
ATOM   1554  C  C6    . DG  D  2 17   ? 68.755  18.564   93.551  1.00 165.25 ? 17   DG  H C6    1 
ATOM   1555  O  O6    . DG  D  2 17   ? 68.972  18.244   94.726  1.00 163.74 ? 17   DG  H O6    1 
ATOM   1556  N  N1    . DG  D  2 17   ? 67.556  18.200   92.945  1.00 161.74 ? 17   DG  H N1    1 
ATOM   1557  C  C2    . DG  D  2 17   ? 67.204  18.495   91.651  1.00 165.21 ? 17   DG  H C2    1 
ATOM   1558  N  N2    . DG  D  2 17   ? 66.001  18.055   91.250  1.00 165.71 ? 17   DG  H N2    1 
ATOM   1559  N  N3    . DG  D  2 17   ? 67.973  19.172   90.811  1.00 168.81 ? 17   DG  H N3    1 
ATOM   1560  C  C4    . DG  D  2 17   ? 69.144  19.536   91.379  1.00 166.61 ? 17   DG  H C4    1 
ATOM   1561  P  P     . DC  D  2 18   ? 69.490  23.756   86.582  1.00 185.92 ? 18   DC  H P     1 
ATOM   1562  O  OP1   . DC  D  2 18   ? 69.361  23.939   85.117  1.00 185.33 ? 18   DC  H OP1   1 
ATOM   1563  O  OP2   . DC  D  2 18   ? 70.239  24.756   87.385  1.00 207.82 ? 18   DC  H OP2   1 
ATOM   1564  O  "O5'" . DC  D  2 18   ? 68.022  23.651   87.187  1.00 190.42 ? 18   DC  H "O5'" 1 
ATOM   1565  C  "C5'" . DC  D  2 18   ? 67.028  22.840   86.540  1.00 188.46 ? 18   DC  H "C5'" 1 
ATOM   1566  C  "C4'" . DC  D  2 18   ? 65.833  22.663   87.448  1.00 183.31 ? 18   DC  H "C4'" 1 
ATOM   1567  O  "O4'" . DC  D  2 18   ? 66.282  22.194   88.741  1.00 170.96 ? 18   DC  H "O4'" 1 
ATOM   1568  C  "C3'" . DC  D  2 18   ? 65.030  23.943   87.713  1.00 187.99 ? 18   DC  H "C3'" 1 
ATOM   1569  O  "O3'" . DC  D  2 18   ? 63.621  23.688   87.655  1.00 190.13 ? 18   DC  H "O3'" 1 
ATOM   1570  C  "C2'" . DC  D  2 18   ? 65.440  24.335   89.121  1.00 177.96 ? 18   DC  H "C2'" 1 
ATOM   1571  C  "C1'" . DC  D  2 18   ? 65.667  22.975   89.750  1.00 175.58 ? 18   DC  H "C1'" 1 
ATOM   1572  N  N1    . DC  D  2 18   ? 66.551  22.981   90.924  1.00 172.47 ? 18   DC  H N1    1 
ATOM   1573  C  C2    . DC  D  2 18   ? 66.047  22.540   92.154  1.00 161.41 ? 18   DC  H C2    1 
ATOM   1574  O  O2    . DC  D  2 18   ? 64.870  22.145   92.215  1.00 144.82 ? 18   DC  H O2    1 
ATOM   1575  N  N3    . DC  D  2 18   ? 66.855  22.552   93.240  1.00 152.69 ? 18   DC  H N3    1 
ATOM   1576  C  C4    . DC  D  2 18   ? 68.112  22.986   93.133  1.00 156.69 ? 18   DC  H C4    1 
ATOM   1577  N  N4    . DC  D  2 18   ? 68.872  22.979   94.231  1.00 155.45 ? 18   DC  H N4    1 
ATOM   1578  C  C5    . DC  D  2 18   ? 68.648  23.445   91.894  1.00 168.10 ? 18   DC  H C5    1 
ATOM   1579  C  C6    . DC  D  2 18   ? 67.838  23.430   90.826  1.00 170.85 ? 18   DC  H C6    1 
ATOM   1580  P  P     . DC  D  2 19   ? 62.542  24.878   87.659  1.00 193.93 ? 19   DC  H P     1 
ATOM   1581  O  OP1   . DC  D  2 19   ? 61.675  24.732   86.459  1.00 202.39 ? 19   DC  H OP1   1 
ATOM   1582  O  OP2   . DC  D  2 19   ? 63.210  26.183   87.931  1.00 197.17 ? 19   DC  H OP2   1 
ATOM   1583  O  "O5'" . DC  D  2 19   ? 61.695  24.490   88.951  1.00 179.91 ? 19   DC  H "O5'" 1 
ATOM   1584  C  "C5'" . DC  D  2 19   ? 60.253  24.535   88.930  1.00 184.64 ? 19   DC  H "C5'" 1 
ATOM   1585  C  "C4'" . DC  D  2 19   ? 59.702  24.632   90.336  1.00 176.02 ? 19   DC  H "C4'" 1 
ATOM   1586  O  "O4'" . DC  D  2 19   ? 60.790  24.547   91.286  1.00 175.76 ? 19   DC  H "O4'" 1 
ATOM   1587  C  "C3'" . DC  D  2 19   ? 58.958  25.930   90.668  1.00 178.83 ? 19   DC  H "C3'" 1 
ATOM   1588  O  "O3'" . DC  D  2 19   ? 57.809  25.679   91.482  1.00 184.93 ? 19   DC  H "O3'" 1 
ATOM   1589  C  "C2'" . DC  D  2 19   ? 59.978  26.738   91.448  1.00 173.18 ? 19   DC  H "C2'" 1 
ATOM   1590  C  "C1'" . DC  D  2 19   ? 60.741  25.650   92.179  1.00 169.21 ? 19   DC  H "C1'" 1 
ATOM   1591  N  N1    . DC  D  2 19   ? 62.125  25.986   92.568  1.00 161.82 ? 19   DC  H N1    1 
ATOM   1592  C  C2    . DC  D  2 19   ? 62.562  25.633   93.849  1.00 154.74 ? 19   DC  H C2    1 
ATOM   1593  O  O2    . DC  D  2 19   ? 61.774  25.056   94.614  1.00 154.70 ? 19   DC  H O2    1 
ATOM   1594  N  N3    . DC  D  2 19   ? 63.827  25.933   94.223  1.00 156.79 ? 19   DC  H N3    1 
ATOM   1595  C  C4    . DC  D  2 19   ? 64.643  26.560   93.372  1.00 159.57 ? 19   DC  H C4    1 
ATOM   1596  N  N4    . DC  D  2 19   ? 65.883  26.836   93.785  1.00 157.91 ? 19   DC  H N4    1 
ATOM   1597  C  C5    . DC  D  2 19   ? 64.224  26.929   92.060  1.00 161.35 ? 19   DC  H C5    1 
ATOM   1598  C  C6    . DC  D  2 19   ? 62.971  26.620   91.700  1.00 159.40 ? 19   DC  H C6    1 
ATOM   1599  P  P     . DG  D  2 20   ? 56.630  26.766   91.568  1.00 192.52 ? 20   DG  H P     1 
ATOM   1600  O  OP1   . DG  D  2 20   ? 55.444  26.236   90.846  1.00 187.66 ? 20   DG  H OP1   1 
ATOM   1601  O  OP2   . DG  D  2 20   ? 57.160  28.113   91.216  1.00 182.99 ? 20   DG  H OP2   1 
ATOM   1602  O  "O5'" . DG  D  2 20   ? 56.310  26.726   93.127  1.00 180.41 ? 20   DG  H "O5'" 1 
ATOM   1603  C  "C5'" . DG  D  2 20   ? 55.737  25.553   93.722  1.00 172.33 ? 20   DG  H "C5'" 1 
ATOM   1604  C  "C4'" . DG  D  2 20   ? 56.308  25.339   95.102  1.00 170.37 ? 20   DG  H "C4'" 1 
ATOM   1605  O  "O4'" . DG  D  2 20   ? 57.733  25.588   95.079  1.00 171.22 ? 20   DG  H "O4'" 1 
ATOM   1606  C  "C3'" . DG  D  2 20   ? 55.728  26.248   96.194  1.00 168.27 ? 20   DG  H "C3'" 1 
ATOM   1607  O  "O3'" . DG  D  2 20   ? 55.336  25.481   97.341  1.00 167.41 ? 20   DG  H "O3'" 1 
ATOM   1608  C  "C2'" . DG  D  2 20   ? 56.872  27.190   96.522  1.00 168.44 ? 20   DG  H "C2'" 1 
ATOM   1609  C  "C1'" . DG  D  2 20   ? 58.075  26.316   96.243  1.00 173.70 ? 20   DG  H "C1'" 1 
ATOM   1610  N  N9    . DG  D  2 20   ? 59.310  27.042   95.976  1.00 176.09 ? 20   DG  H N9    1 
ATOM   1611  C  C8    . DG  D  2 20   ? 59.568  27.880   94.917  1.00 169.39 ? 20   DG  H C8    1 
ATOM   1612  N  N7    . DG  D  2 20   ? 60.768  28.392   94.950  1.00 169.31 ? 20   DG  H N7    1 
ATOM   1613  C  C5    . DG  D  2 20   ? 61.339  27.858   96.098  1.00 174.74 ? 20   DG  H C5    1 
ATOM   1614  C  C6    . DG  D  2 20   ? 62.633  28.044   96.656  1.00 174.13 ? 20   DG  H C6    1 
ATOM   1615  O  O6    . DG  D  2 20   ? 63.564  28.743   96.232  1.00 164.61 ? 20   DG  H O6    1 
ATOM   1616  N  N1    . DG  D  2 20   ? 62.796  27.310   97.828  1.00 176.41 ? 20   DG  H N1    1 
ATOM   1617  C  C2    . DG  D  2 20   ? 61.838  26.500   98.392  1.00 178.29 ? 20   DG  H C2    1 
ATOM   1618  N  N2    . DG  D  2 20   ? 62.182  25.874   99.527  1.00 177.52 ? 20   DG  H N2    1 
ATOM   1619  N  N3    . DG  D  2 20   ? 60.630  26.318   97.881  1.00 173.84 ? 20   DG  H N3    1 
ATOM   1620  C  C4    . DG  D  2 20   ? 60.451  27.022   96.742  1.00 175.59 ? 20   DG  H C4    1 
ATOM   1621  P  P     . DT  D  2 21   ? 54.653  26.117   98.655  1.00 174.30 ? 21   DT  H P     1 
ATOM   1622  O  OP1   . DT  D  2 21   ? 53.596  25.194   99.157  1.00 173.94 ? 21   DT  H OP1   1 
ATOM   1623  O  OP2   . DT  D  2 21   ? 54.333  27.552   98.457  1.00 178.08 ? 21   DT  H OP2   1 
ATOM   1624  O  "O5'" . DT  D  2 21   ? 55.871  26.087   99.676  1.00 161.27 ? 21   DT  H "O5'" 1 
ATOM   1625  C  "C5'" . DT  D  2 21   ? 56.463  24.832   100.057 1.00 173.40 ? 21   DT  H "C5'" 1 
ATOM   1626  C  "C4'" . DT  D  2 21   ? 57.385  25.028   101.238 1.00 172.92 ? 21   DT  H "C4'" 1 
ATOM   1627  O  "O4'" . DT  D  2 21   ? 58.573  25.741   100.810 1.00 164.54 ? 21   DT  H "O4'" 1 
ATOM   1628  C  "C3'" . DT  D  2 21   ? 56.778  25.837   102.390 1.00 176.53 ? 21   DT  H "C3'" 1 
ATOM   1629  O  "O3'" . DT  D  2 21   ? 57.022  25.225   103.663 1.00 178.68 ? 21   DT  H "O3'" 1 
ATOM   1630  C  "C2'" . DT  D  2 21   ? 57.476  27.181   102.298 1.00 176.05 ? 21   DT  H "C2'" 1 
ATOM   1631  C  "C1'" . DT  D  2 21   ? 58.820  26.828   101.681 1.00 170.48 ? 21   DT  H "C1'" 1 
ATOM   1632  N  N1    . DT  D  2 21   ? 59.437  27.912   100.891 1.00 166.78 ? 21   DT  H N1    1 
ATOM   1633  C  C2    . DT  D  2 21   ? 60.727  28.285   101.193 1.00 164.88 ? 21   DT  H C2    1 
ATOM   1634  O  O2    . DT  D  2 21   ? 61.387  27.752   102.068 1.00 168.30 ? 21   DT  H O2    1 
ATOM   1635  N  N3    . DT  D  2 21   ? 61.223  29.306   100.422 1.00 160.38 ? 21   DT  H N3    1 
ATOM   1636  C  C4    . DT  D  2 21   ? 60.568  29.982   99.411  1.00 162.43 ? 21   DT  H C4    1 
ATOM   1637  O  O4    . DT  D  2 21   ? 61.147  30.876   98.801  1.00 161.73 ? 21   DT  H O4    1 
ATOM   1638  C  C5    . DT  D  2 21   ? 59.211  29.546   99.155  1.00 162.50 ? 21   DT  H C5    1 
ATOM   1639  C  C7    . DT  D  2 21   ? 58.420  30.221   98.079  1.00 153.89 ? 21   DT  H C7    1 
ATOM   1640  C  C6    . DT  D  2 21   ? 58.722  28.546   99.897  1.00 167.34 ? 21   DT  H C6    1 
ATOM   1641  P  P     . DC  D  2 22   ? 56.236  25.628   105.006 1.00 164.88 ? 22   DC  H P     1 
ATOM   1642  O  OP1   . DC  D  2 22   ? 55.713  24.403   105.663 1.00 162.48 ? 22   DC  H OP1   1 
ATOM   1643  O  OP2   . DC  D  2 22   ? 55.306  26.735   104.665 1.00 166.46 ? 22   DC  H OP2   1 
ATOM   1644  O  "O5'" . DC  D  2 22   ? 57.395  26.196   105.936 1.00 164.37 ? 22   DC  H "O5'" 1 
ATOM   1645  C  "C5'" . DC  D  2 22   ? 58.525  25.383   106.306 1.00 168.06 ? 22   DC  H "C5'" 1 
ATOM   1646  C  "C4'" . DC  D  2 22   ? 59.622  26.247   106.882 1.00 169.38 ? 22   DC  H "C4'" 1 
ATOM   1647  O  "O4'" . DC  D  2 22   ? 60.080  27.186   105.878 1.00 174.26 ? 22   DC  H "O4'" 1 
ATOM   1648  C  "C3'" . DC  D  2 22   ? 59.206  27.092   108.089 1.00 172.01 ? 22   DC  H "C3'" 1 
ATOM   1649  O  "O3'" . DC  D  2 22   ? 60.215  27.088   109.102 1.00 172.81 ? 22   DC  H "O3'" 1 
ATOM   1650  C  "C2'" . DC  D  2 22   ? 59.045  28.489   107.514 1.00 170.58 ? 22   DC  H "C2'" 1 
ATOM   1651  C  "C1'" . DC  D  2 22   ? 60.084  28.500   106.414 1.00 166.91 ? 22   DC  H "C1'" 1 
ATOM   1652  N  N1    . DC  D  2 22   ? 59.834  29.437   105.306 1.00 164.93 ? 22   DC  H N1    1 
ATOM   1653  C  C2    . DC  D  2 22   ? 60.910  30.164   104.787 1.00 162.32 ? 22   DC  H C2    1 
ATOM   1654  O  O2    . DC  D  2 22   ? 62.031  30.022   105.296 1.00 165.33 ? 22   DC  H O2    1 
ATOM   1655  N  N3    . DC  D  2 22   ? 60.699  31.016   103.759 1.00 164.56 ? 22   DC  H N3    1 
ATOM   1656  C  C4    . DC  D  2 22   ? 59.476  31.143   103.239 1.00 169.78 ? 22   DC  H C4    1 
ATOM   1657  N  N4    . DC  D  2 22   ? 59.317  31.993   102.224 1.00 173.04 ? 22   DC  H N4    1 
ATOM   1658  C  C5    . DC  D  2 22   ? 58.364  30.405   103.739 1.00 175.53 ? 22   DC  H C5    1 
ATOM   1659  C  C6    . DC  D  2 22   ? 58.587  29.569   104.762 1.00 171.02 ? 22   DC  H C6    1 
ATOM   1660  P  P     . DG  D  2 23   ? 59.913  27.585   110.609 1.00 180.23 ? 23   DG  H P     1 
ATOM   1661  O  OP1   . DG  D  2 23   ? 60.336  26.523   111.564 1.00 182.04 ? 23   DG  H OP1   1 
ATOM   1662  O  OP2   . DG  D  2 23   ? 58.576  28.225   110.751 1.00 168.21 ? 23   DG  H OP2   1 
ATOM   1663  O  "O5'" . DG  D  2 23   ? 60.991  28.745   110.722 1.00 175.43 ? 23   DG  H "O5'" 1 
ATOM   1664  C  "C5'" . DG  D  2 23   ? 62.364  28.502   110.372 1.00 174.76 ? 23   DG  H "C5'" 1 
ATOM   1665  C  "C4'" . DG  D  2 23   ? 63.129  29.804   110.397 1.00 172.85 ? 23   DG  H "C4'" 1 
ATOM   1666  O  "O4'" . DG  D  2 23   ? 62.871  30.544   109.179 1.00 174.09 ? 23   DG  H "O4'" 1 
ATOM   1667  C  "C3'" . DG  D  2 23   ? 62.755  30.746   111.539 1.00 173.32 ? 23   DG  H "C3'" 1 
ATOM   1668  O  "O3'" . DG  D  2 23   ? 63.940  31.392   112.004 1.00 171.18 ? 23   DG  H "O3'" 1 
ATOM   1669  C  "C2'" . DG  D  2 23   ? 61.807  31.735   110.884 1.00 168.90 ? 23   DG  H "C2'" 1 
ATOM   1670  C  "C1'" . DG  D  2 23   ? 62.399  31.845   109.494 1.00 160.69 ? 23   DG  H "C1'" 1 
ATOM   1671  N  N9    . DG  D  2 23   ? 61.476  32.252   108.440 1.00 157.19 ? 23   DG  H N9    1 
ATOM   1672  C  C8    . DG  D  2 23   ? 60.167  31.865   108.278 1.00 160.34 ? 23   DG  H C8    1 
ATOM   1673  N  N7    . DG  D  2 23   ? 59.607  32.385   107.220 1.00 167.19 ? 23   DG  H N7    1 
ATOM   1674  C  C5    . DG  D  2 23   ? 60.610  33.152   106.642 1.00 164.81 ? 23   DG  H C5    1 
ATOM   1675  C  C6    . DG  D  2 23   ? 60.598  33.950   105.467 1.00 160.77 ? 23   DG  H C6    1 
ATOM   1676  O  O6    . DG  D  2 23   ? 59.666  34.146   104.678 1.00 154.40 ? 23   DG  H O6    1 
ATOM   1677  N  N1    . DG  D  2 23   ? 61.832  34.555   105.247 1.00 162.05 ? 23   DG  H N1    1 
ATOM   1678  C  C2    . DG  D  2 23   ? 62.937  34.410   106.051 1.00 155.24 ? 23   DG  H C2    1 
ATOM   1679  N  N2    . DG  D  2 23   ? 64.042  35.069   105.669 1.00 147.23 ? 23   DG  H N2    1 
ATOM   1680  N  N3    . DG  D  2 23   ? 62.961  33.669   107.146 1.00 157.94 ? 23   DG  H N3    1 
ATOM   1681  C  C4    . DG  D  2 23   ? 61.771  33.077   107.382 1.00 159.25 ? 23   DG  H C4    1 
ATOM   1682  P  P     . DT  D  2 24   ? 64.083  31.750   113.546 1.00 185.88 ? 24   DT  H P     1 
ATOM   1683  O  OP1   . DT  D  2 24   ? 64.795  30.607   114.171 1.00 186.76 ? 24   DT  H OP1   1 
ATOM   1684  O  OP2   . DT  D  2 24   ? 62.748  32.162   114.056 1.00 191.38 ? 24   DT  H OP2   1 
ATOM   1685  O  "O5'" . DT  D  2 24   ? 65.036  33.025   113.564 1.00 173.91 ? 24   DT  H "O5'" 1 
ATOM   1686  C  "C5'" . DT  D  2 24   ? 66.087  33.170   112.595 1.00 168.40 ? 24   DT  H "C5'" 1 
ATOM   1687  C  "C4'" . DT  D  2 24   ? 65.882  34.432   111.790 1.00 162.98 ? 24   DT  H "C4'" 1 
ATOM   1688  O  "O4'" . DT  D  2 24   ? 64.633  34.390   111.072 1.00 159.50 ? 24   DT  H "O4'" 1 
ATOM   1689  C  "C3'" . DT  D  2 24   ? 65.834  35.717   112.616 1.00 158.69 ? 24   DT  H "C3'" 1 
ATOM   1690  O  "O3'" . DT  D  2 24   ? 67.069  36.404   112.455 1.00 154.29 ? 24   DT  H "O3'" 1 
ATOM   1691  C  "C2'" . DT  D  2 24   ? 64.675  36.511   112.030 1.00 158.08 ? 24   DT  H "C2'" 1 
ATOM   1692  C  "C1'" . DT  D  2 24   ? 64.285  35.731   110.787 1.00 160.41 ? 24   DT  H "C1'" 1 
ATOM   1693  N  N1    . DT  D  2 24   ? 62.847  35.770   110.434 1.00 163.08 ? 24   DT  H N1    1 
ATOM   1694  C  C2    . DT  D  2 24   ? 62.479  36.250   109.194 1.00 160.66 ? 24   DT  H C2    1 
ATOM   1695  O  O2    . DT  D  2 24   ? 63.281  36.666   108.374 1.00 151.28 ? 24   DT  H O2    1 
ATOM   1696  N  N3    . DT  D  2 24   ? 61.125  36.232   108.953 1.00 166.89 ? 24   DT  H N3    1 
ATOM   1697  C  C4    . DT  D  2 24   ? 60.130  35.793   109.808 1.00 163.38 ? 24   DT  H C4    1 
ATOM   1698  O  O4    . DT  D  2 24   ? 58.955  35.842   109.456 1.00 163.43 ? 24   DT  H O4    1 
ATOM   1699  C  C5    . DT  D  2 24   ? 60.589  35.306   111.090 1.00 156.32 ? 24   DT  H C5    1 
ATOM   1700  C  C7    . DT  D  2 24   ? 59.585  34.805   112.078 1.00 148.31 ? 24   DT  H C7    1 
ATOM   1701  C  C6    . DT  D  2 24   ? 61.905  35.317   111.334 1.00 161.78 ? 24   DT  H C6    1 
ATOM   1702  P  P     . DT  D  2 25   ? 67.369  37.608   113.427 1.00 164.99 ? 25   DT  H P     1 
ATOM   1703  O  OP1   . DT  D  2 25   ? 68.825  37.613   113.705 1.00 162.72 ? 25   DT  H OP1   1 
ATOM   1704  O  OP2   . DT  D  2 25   ? 66.399  37.550   114.556 1.00 166.63 ? 25   DT  H OP2   1 
ATOM   1705  O  "O5'" . DT  D  2 25   ? 66.985  38.867   112.532 1.00 166.03 ? 25   DT  H "O5'" 1 
ATOM   1706  C  "C5'" . DT  D  2 25   ? 67.360  38.951   111.147 1.00 168.96 ? 25   DT  H "C5'" 1 
ATOM   1707  C  "C4'" . DT  D  2 25   ? 66.702  40.144   110.491 1.00 175.26 ? 25   DT  H "C4'" 1 
ATOM   1708  O  "O4'" . DT  D  2 25   ? 65.333  39.827   110.138 1.00 179.21 ? 25   DT  H "O4'" 1 
ATOM   1709  C  "C3'" . DT  D  2 25   ? 66.628  41.408   111.351 1.00 181.87 ? 25   DT  H "C3'" 1 
ATOM   1710  O  "O3'" . DT  D  2 25   ? 66.934  42.553   110.547 1.00 191.94 ? 25   DT  H "O3'" 1 
ATOM   1711  C  "C2'" . DT  D  2 25   ? 65.186  41.434   111.828 1.00 172.27 ? 25   DT  H "C2'" 1 
ATOM   1712  C  "C1'" . DT  D  2 25   ? 64.458  40.823   110.647 1.00 169.79 ? 25   DT  H "C1'" 1 
ATOM   1713  N  N1    . DT  D  2 25   ? 63.160  40.176   110.934 1.00 166.18 ? 25   DT  H N1    1 
ATOM   1714  C  C2    . DT  D  2 25   ? 62.149  40.322   110.008 1.00 163.20 ? 25   DT  H C2    1 
ATOM   1715  O  O2    . DT  D  2 25   ? 62.266  40.988   108.989 1.00 149.73 ? 25   DT  H O2    1 
ATOM   1716  N  N3    . DT  D  2 25   ? 60.980  39.674   110.332 1.00 165.09 ? 25   DT  H N3    1 
ATOM   1717  C  C4    . DT  D  2 25   ? 60.735  38.901   111.454 1.00 171.31 ? 25   DT  H C4    1 
ATOM   1718  O  O4    . DT  D  2 25   ? 59.636  38.374   111.607 1.00 178.57 ? 25   DT  H O4    1 
ATOM   1719  C  C5    . DT  D  2 25   ? 61.844  38.783   112.376 1.00 170.90 ? 25   DT  H C5    1 
ATOM   1720  C  C7    . DT  D  2 25   ? 61.671  37.968   113.619 1.00 163.31 ? 25   DT  H C7    1 
ATOM   1721  C  C6    . DT  D  2 25   ? 62.987  39.410   112.069 1.00 168.03 ? 25   DT  H C6    1 
ATOM   1722  P  P     . DT  D  2 26   ? 67.468  43.922   111.184 1.00 195.85 ? 26   DT  H P     1 
ATOM   1723  O  OP1   . DT  D  2 26   ? 68.918  44.022   110.864 1.00 196.34 ? 26   DT  H OP1   1 
ATOM   1724  O  OP2   . DT  D  2 26   ? 67.016  43.990   112.602 1.00 196.01 ? 26   DT  H OP2   1 
ATOM   1725  O  "O5'" . DT  D  2 26   ? 66.679  45.045   110.368 1.00 185.50 ? 26   DT  H "O5'" 1 
ATOM   1726  C  "C5'" . DT  D  2 26   ? 66.309  44.862   108.984 1.00 176.28 ? 26   DT  H "C5'" 1 
ATOM   1727  C  "C4'" . DT  D  2 26   ? 64.958  45.483   108.717 1.00 173.38 ? 26   DT  H "C4'" 1 
ATOM   1728  O  "O4'" . DT  D  2 26   ? 63.901  44.594   109.159 1.00 171.91 ? 26   DT  H "O4'" 1 
ATOM   1729  C  "C3'" . DT  D  2 26   ? 64.712  46.817   109.429 1.00 172.62 ? 26   DT  H "C3'" 1 
ATOM   1730  O  "O3'" . DT  D  2 26   ? 64.094  47.744   108.539 1.00 169.65 ? 26   DT  H "O3'" 1 
ATOM   1731  C  "C2'" . DT  D  2 26   ? 63.737  46.460   110.535 1.00 172.40 ? 26   DT  H "C2'" 1 
ATOM   1732  C  "C1'" . DT  D  2 26   ? 62.940  45.350   109.879 1.00 166.97 ? 26   DT  H "C1'" 1 
ATOM   1733  N  N1    . DT  D  2 26   ? 62.215  44.427   110.783 1.00 161.10 ? 26   DT  H N1    1 
ATOM   1734  C  C2    . DT  D  2 26   ? 60.976  43.975   110.384 1.00 157.54 ? 26   DT  H C2    1 
ATOM   1735  O  O2    . DT  D  2 26   ? 60.448  44.313   109.337 1.00 158.30 ? 26   DT  H O2    1 
ATOM   1736  N  N3    . DT  D  2 26   ? 60.369  43.115   111.265 1.00 156.43 ? 26   DT  H N3    1 
ATOM   1737  C  C4    . DT  D  2 26   ? 60.864  42.676   112.479 1.00 157.15 ? 26   DT  H C4    1 
ATOM   1738  O  O4    . DT  D  2 26   ? 60.205  41.901   113.164 1.00 153.11 ? 26   DT  H O4    1 
ATOM   1739  C  C5    . DT  D  2 26   ? 62.164  43.192   112.837 1.00 162.72 ? 26   DT  H C5    1 
ATOM   1740  C  C7    . DT  D  2 26   ? 62.779  42.770   114.134 1.00 161.37 ? 26   DT  H C7    1 
ATOM   1741  C  C6    . DT  D  2 26   ? 62.769  44.026   111.981 1.00 165.22 ? 26   DT  H C6    1 
ATOM   1742  P  P     . DC  D  2 27   ? 64.317  49.304   108.743 1.00 164.35 ? 27   DC  H P     1 
ATOM   1743  O  OP1   . DC  D  2 27   ? 65.439  49.733   107.873 1.00 176.31 ? 27   DC  H OP1   1 
ATOM   1744  O  OP2   . DC  D  2 27   ? 64.384  49.554   110.204 1.00 174.19 ? 27   DC  H OP2   1 
ATOM   1745  O  "O5'" . DC  D  2 27   ? 62.967  49.913   108.162 1.00 160.13 ? 27   DC  H "O5'" 1 
ATOM   1746  C  "C5'" . DC  D  2 27   ? 62.303  49.312   107.038 1.00 160.67 ? 27   DC  H "C5'" 1 
ATOM   1747  C  "C4'" . DC  D  2 27   ? 60.811  49.305   107.268 1.00 159.76 ? 27   DC  H "C4'" 1 
ATOM   1748  O  "O4'" . DC  D  2 27   ? 60.474  48.284   108.237 1.00 162.93 ? 27   DC  H "O4'" 1 
ATOM   1749  C  "C3'" . DC  D  2 27   ? 60.255  50.609   107.833 1.00 164.75 ? 27   DC  H "C3'" 1 
ATOM   1750  O  "O3'" . DC  D  2 27   ? 59.000  50.903   107.214 1.00 166.27 ? 27   DC  H "O3'" 1 
ATOM   1751  C  "C2'" . DC  D  2 27   ? 60.079  50.298   109.307 1.00 166.92 ? 27   DC  H "C2'" 1 
ATOM   1752  C  "C1'" . DC  D  2 27   ? 59.624  48.856   109.217 1.00 169.79 ? 27   DC  H "C1'" 1 
ATOM   1753  N  N1    . DC  D  2 27   ? 59.720  48.036   110.444 1.00 175.17 ? 27   DC  H N1    1 
ATOM   1754  C  C2    . DC  D  2 27   ? 58.726  47.078   110.704 1.00 164.26 ? 27   DC  H C2    1 
ATOM   1755  O  O2    . DC  D  2 27   ? 57.773  46.968   109.918 1.00 157.16 ? 27   DC  H O2    1 
ATOM   1756  N  N3    . DC  D  2 27   ? 58.821  46.312   111.815 1.00 160.96 ? 27   DC  H N3    1 
ATOM   1757  C  C4    . DC  D  2 27   ? 59.850  46.473   112.652 1.00 168.40 ? 27   DC  H C4    1 
ATOM   1758  N  N4    . DC  D  2 27   ? 59.900  45.700   113.737 1.00 169.33 ? 27   DC  H N4    1 
ATOM   1759  C  C5    . DC  D  2 27   ? 60.877  47.432   112.409 1.00 178.56 ? 27   DC  H C5    1 
ATOM   1760  C  C6    . DC  D  2 27   ? 60.774  48.186   111.304 1.00 180.34 ? 27   DC  H C6    1 
ATOM   1761  P  P     . DG  D  2 28   ? 58.558  52.436   107.014 1.00 185.00 ? 28   DG  H P     1 
ATOM   1762  O  OP1   . DG  D  2 28   ? 58.840  52.810   105.602 1.00 194.79 ? 28   DG  H OP1   1 
ATOM   1763  O  OP2   . DG  D  2 28   ? 59.081  53.291   108.111 1.00 187.79 ? 28   DG  H OP2   1 
ATOM   1764  O  "O5'" . DG  D  2 28   ? 56.982  52.349   107.218 1.00 180.42 ? 28   DG  H "O5'" 1 
ATOM   1765  C  "C5'" . DG  D  2 28   ? 56.187  51.418   106.462 1.00 182.70 ? 28   DG  H "C5'" 1 
ATOM   1766  C  "C4'" . DG  D  2 28   ? 55.042  50.895   107.298 1.00 185.12 ? 28   DG  H "C4'" 1 
ATOM   1767  O  "O4'" . DG  D  2 28   ? 55.560  50.065   108.367 1.00 186.55 ? 28   DG  H "O4'" 1 
ATOM   1768  C  "C3'" . DG  D  2 28   ? 54.180  51.967   107.973 1.00 192.33 ? 28   DG  H "C3'" 1 
ATOM   1769  O  "O3'" . DG  D  2 28   ? 52.789  51.628   107.914 1.00 190.47 ? 28   DG  H "O3'" 1 
ATOM   1770  C  "C2'" . DG  D  2 28   ? 54.648  51.941   109.416 1.00 190.52 ? 28   DG  H "C2'" 1 
ATOM   1771  C  "C1'" . DG  D  2 28   ? 54.969  50.470   109.590 1.00 189.14 ? 28   DG  H "C1'" 1 
ATOM   1772  N  N9    . DG  D  2 28   ? 55.899  50.160   110.672 1.00 186.20 ? 28   DG  H N9    1 
ATOM   1773  C  C8    . DG  D  2 28   ? 57.108  50.759   110.931 1.00 183.41 ? 28   DG  H C8    1 
ATOM   1774  N  N7    . DG  D  2 28   ? 57.708  50.268   111.981 1.00 183.19 ? 28   DG  H N7    1 
ATOM   1775  C  C5    . DG  D  2 28   ? 56.834  49.300   112.456 1.00 180.95 ? 28   DG  H C5    1 
ATOM   1776  C  C6    . DG  D  2 28   ? 56.938  48.435   113.579 1.00 180.02 ? 28   DG  H C6    1 
ATOM   1777  O  O6    . DG  D  2 28   ? 57.856  48.349   114.405 1.00 170.72 ? 28   DG  H O6    1 
ATOM   1778  N  N1    . DG  D  2 28   ? 55.824  47.609   113.691 1.00 177.95 ? 28   DG  H N1    1 
ATOM   1779  C  C2    . DG  D  2 28   ? 54.749  47.611   112.835 1.00 179.39 ? 28   DG  H C2    1 
ATOM   1780  N  N2    . DG  D  2 28   ? 53.773  46.733   113.105 1.00 179.76 ? 28   DG  H N2    1 
ATOM   1781  N  N3    . DG  D  2 28   ? 54.643  48.408   111.785 1.00 178.35 ? 28   DG  H N3    1 
ATOM   1782  C  C4    . DG  D  2 28   ? 55.712  49.222   111.659 1.00 181.42 ? 28   DG  H C4    1 
ATOM   1783  P  P     . DC  E  3 1    ? 40.996  92.222   76.636  1.00 272.50 ? 1    DC  I P     1 
ATOM   1784  O  OP1   . DC  E  3 1    ? 40.832  91.715   75.253  1.00 274.38 ? 1    DC  I OP1   1 
ATOM   1785  O  OP2   . DC  E  3 1    ? 39.871  92.069   77.600  1.00 270.04 ? 1    DC  I OP2   1 
ATOM   1786  O  "O5'" . DC  E  3 1    ? 42.270  91.486   77.253  1.00 263.68 ? 1    DC  I "O5'" 1 
ATOM   1787  C  "C5'" . DC  E  3 1    ? 43.614  91.871   76.905  1.00 252.86 ? 1    DC  I "C5'" 1 
ATOM   1788  C  "C4'" . DC  E  3 1    ? 44.564  91.633   78.059  1.00 239.55 ? 1    DC  I "C4'" 1 
ATOM   1789  O  "O4'" . DC  E  3 1    ? 44.494  92.744   78.981  1.00 233.04 ? 1    DC  I "O4'" 1 
ATOM   1790  C  "C3'" . DC  E  3 1    ? 44.292  90.384   78.894  1.00 233.24 ? 1    DC  I "C3'" 1 
ATOM   1791  O  "O3'" . DC  E  3 1    ? 45.499  89.795   79.386  1.00 231.95 ? 1    DC  I "O3'" 1 
ATOM   1792  C  "C2'" . DC  E  3 1    ? 43.473  90.912   80.053  1.00 232.46 ? 1    DC  I "C2'" 1 
ATOM   1793  C  "C1'" . DC  E  3 1    ? 44.010  92.317   80.246  1.00 229.70 ? 1    DC  I "C1'" 1 
ATOM   1794  N  N1    . DC  E  3 1    ? 42.989  93.283   80.693  1.00 236.57 ? 1    DC  I N1    1 
ATOM   1795  C  C2    . DC  E  3 1    ? 43.015  93.730   82.019  1.00 230.53 ? 1    DC  I C2    1 
ATOM   1796  O  O2    . DC  E  3 1    ? 43.897  93.307   82.779  1.00 225.19 ? 1    DC  I O2    1 
ATOM   1797  N  N3    . DC  E  3 1    ? 42.081  94.613   82.438  1.00 230.16 ? 1    DC  I N3    1 
ATOM   1798  C  C4    . DC  E  3 1    ? 41.146  95.047   81.589  1.00 242.50 ? 1    DC  I C4    1 
ATOM   1799  N  N4    . DC  E  3 1    ? 40.243  95.918   82.046  1.00 247.97 ? 1    DC  I N4    1 
ATOM   1800  C  C5    . DC  E  3 1    ? 41.088  94.599   80.237  1.00 250.02 ? 1    DC  I C5    1 
ATOM   1801  C  C6    . DC  E  3 1    ? 42.020  93.725   79.835  1.00 244.68 ? 1    DC  I C6    1 
ATOM   1802  P  P     . DG  E  3 2    ? 45.557  88.257   79.875  1.00 230.26 ? 2    DG  I P     1 
ATOM   1803  O  OP1   . DG  E  3 2    ? 46.584  87.494   79.113  1.00 227.97 ? 2    DG  I OP1   1 
ATOM   1804  O  OP2   . DG  E  3 2    ? 44.176  87.719   79.980  1.00 238.39 ? 2    DG  I OP2   1 
ATOM   1805  O  "O5'" . DG  E  3 2    ? 46.110  88.427   81.357  1.00 220.65 ? 2    DG  I "O5'" 1 
ATOM   1806  C  "C5'" . DG  E  3 2    ? 47.176  89.351   81.644  1.00 213.86 ? 2    DG  I "C5'" 1 
ATOM   1807  C  "C4'" . DG  E  3 2    ? 47.319  89.535   83.138  1.00 206.55 ? 2    DG  I "C4'" 1 
ATOM   1808  O  "O4'" . DG  E  3 2    ? 46.365  90.513   83.615  1.00 207.04 ? 2    DG  I "O4'" 1 
ATOM   1809  C  "C3'" . DG  E  3 2    ? 47.072  88.277   83.969  1.00 202.81 ? 2    DG  I "C3'" 1 
ATOM   1810  O  "O3'" . DG  E  3 2    ? 47.969  88.256   85.080  1.00 203.89 ? 2    DG  I "O3'" 1 
ATOM   1811  C  "C2'" . DG  E  3 2    ? 45.633  88.435   84.416  1.00 205.04 ? 2    DG  I "C2'" 1 
ATOM   1812  C  "C1'" . DG  E  3 2    ? 45.527  89.935   84.608  1.00 206.36 ? 2    DG  I "C1'" 1 
ATOM   1813  N  N9    . DG  E  3 2    ? 44.185  90.489   84.443  1.00 211.19 ? 2    DG  I N9    1 
ATOM   1814  C  C8    . DG  E  3 2    ? 43.205  90.055   83.583  1.00 213.92 ? 2    DG  I C8    1 
ATOM   1815  N  N7    . DG  E  3 2    ? 42.112  90.766   83.651  1.00 222.38 ? 2    DG  I N7    1 
ATOM   1816  C  C5    . DG  E  3 2    ? 42.382  91.718   84.625  1.00 221.72 ? 2    DG  I C5    1 
ATOM   1817  C  C6    . DG  E  3 2    ? 41.572  92.771   85.132  1.00 227.37 ? 2    DG  I C6    1 
ATOM   1818  O  O6    . DG  E  3 2    ? 40.414  93.078   84.818  1.00 230.94 ? 2    DG  I O6    1 
ATOM   1819  N  N1    . DG  E  3 2    ? 42.243  93.508   86.103  1.00 226.65 ? 2    DG  I N1    1 
ATOM   1820  C  C2    . DG  E  3 2    ? 43.524  93.264   86.533  1.00 225.72 ? 2    DG  I C2    1 
ATOM   1821  N  N2    . DG  E  3 2    ? 43.996  94.086   87.482  1.00 229.51 ? 2    DG  I N2    1 
ATOM   1822  N  N3    . DG  E  3 2    ? 44.290  92.291   86.064  1.00 215.99 ? 2    DG  I N3    1 
ATOM   1823  C  C4    . DG  E  3 2    ? 43.659  91.562   85.121  1.00 214.41 ? 2    DG  I C4    1 
ATOM   1824  P  P     . DA  E  3 3    ? 48.164  86.945   85.974  1.00 211.20 ? 3    DA  I P     1 
ATOM   1825  O  OP1   . DA  E  3 3    ? 49.595  86.550   85.895  1.00 215.25 ? 3    DA  I OP1   1 
ATOM   1826  O  OP2   . DA  E  3 3    ? 47.108  85.940   85.662  1.00 206.17 ? 3    DA  I OP2   1 
ATOM   1827  O  "O5'" . DA  E  3 3    ? 47.903  87.566   87.418  1.00 206.37 ? 3    DA  I "O5'" 1 
ATOM   1828  C  "C5'" . DA  E  3 3    ? 48.590  88.762   87.836  1.00 203.49 ? 3    DA  I "C5'" 1 
ATOM   1829  C  "C4'" . DA  E  3 3    ? 47.894  89.370   89.031  1.00 199.55 ? 3    DA  I "C4'" 1 
ATOM   1830  O  "O4'" . DA  E  3 3    ? 46.625  89.931   88.623  1.00 202.00 ? 3    DA  I "O4'" 1 
ATOM   1831  C  "C3'" . DA  E  3 3    ? 47.588  88.380   90.155  1.00 195.50 ? 3    DA  I "C3'" 1 
ATOM   1832  O  "O3'" . DA  E  3 3    ? 47.950  88.968   91.404  1.00 194.54 ? 3    DA  I "O3'" 1 
ATOM   1833  C  "C2'" . DA  E  3 3    ? 46.098  88.135   90.025  1.00 198.39 ? 3    DA  I "C2'" 1 
ATOM   1834  C  "C1'" . DA  E  3 3    ? 45.593  89.454   89.468  1.00 204.82 ? 3    DA  I "C1'" 1 
ATOM   1835  N  N9    . DA  E  3 3    ? 44.365  89.371   88.673  1.00 210.09 ? 3    DA  I N9    1 
ATOM   1836  C  C8    . DA  E  3 3    ? 44.034  88.415   87.744  1.00 209.37 ? 3    DA  I C8    1 
ATOM   1837  N  N7    . DA  E  3 3    ? 42.863  88.604   87.186  1.00 216.87 ? 3    DA  I N7    1 
ATOM   1838  C  C5    . DA  E  3 3    ? 42.387  89.760   87.790  1.00 213.83 ? 3    DA  I C5    1 
ATOM   1839  C  C6    . DA  E  3 3    ? 41.194  90.491   87.630  1.00 210.27 ? 3    DA  I C6    1 
ATOM   1840  N  N6    . DA  E  3 3    ? 40.227  90.151   86.775  1.00 212.52 ? 3    DA  I N6    1 
ATOM   1841  N  N1    . DA  E  3 3    ? 41.026  91.596   88.390  1.00 206.27 ? 3    DA  I N1    1 
ATOM   1842  C  C2    . DA  E  3 3    ? 41.999  91.940   89.244  1.00 209.19 ? 3    DA  I C2    1 
ATOM   1843  N  N3    . DA  E  3 3    ? 43.167  91.339   89.478  1.00 212.95 ? 3    DA  I N3    1 
ATOM   1844  C  C4    . DA  E  3 3    ? 43.301  90.243   88.709  1.00 215.53 ? 3    DA  I C4    1 
ATOM   1845  P  P     . DA  E  3 4    ? 48.173  88.103   92.733  1.00 194.41 ? 4    DA  I P     1 
ATOM   1846  O  OP1   . DA  E  3 4    ? 49.610  88.229   93.082  1.00 189.96 ? 4    DA  I OP1   1 
ATOM   1847  O  OP2   . DA  E  3 4    ? 47.548  86.753   92.584  1.00 189.34 ? 4    DA  I OP2   1 
ATOM   1848  O  "O5'" . DA  E  3 4    ? 47.369  88.920   93.839  1.00 195.40 ? 4    DA  I "O5'" 1 
ATOM   1849  C  "C5'" . DA  E  3 4    ? 47.263  90.356   93.780  1.00 192.04 ? 4    DA  I "C5'" 1 
ATOM   1850  C  "C4'" . DA  E  3 4    ? 45.893  90.803   94.230  1.00 192.51 ? 4    DA  I "C4'" 1 
ATOM   1851  O  "O4'" . DA  E  3 4    ? 44.898  90.443   93.241  1.00 192.09 ? 4    DA  I "O4'" 1 
ATOM   1852  C  "C3'" . DA  E  3 4    ? 45.417  90.193   95.550  1.00 193.45 ? 4    DA  I "C3'" 1 
ATOM   1853  O  "O3'" . DA  E  3 4    ? 44.918  91.242   96.388  1.00 198.28 ? 4    DA  I "O3'" 1 
ATOM   1854  C  "C2'" . DA  E  3 4    ? 44.335  89.214   95.123  1.00 191.61 ? 4    DA  I "C2'" 1 
ATOM   1855  C  "C1'" . DA  E  3 4    ? 43.766  89.914   93.911  1.00 194.53 ? 4    DA  I "C1'" 1 
ATOM   1856  N  N9    . DA  E  3 4    ? 43.033  89.074   92.964  1.00 195.35 ? 4    DA  I N9    1 
ATOM   1857  C  C8    . DA  E  3 4    ? 43.376  87.827   92.507  1.00 192.84 ? 4    DA  I C8    1 
ATOM   1858  N  N7    . DA  E  3 4    ? 42.530  87.334   91.635  1.00 198.37 ? 4    DA  I N7    1 
ATOM   1859  C  C5    . DA  E  3 4    ? 41.566  88.324   91.508  1.00 202.86 ? 4    DA  I C5    1 
ATOM   1860  C  C6    . DA  E  3 4    ? 40.395  88.413   90.732  1.00 206.62 ? 4    DA  I C6    1 
ATOM   1861  N  N6    . DA  E  3 4    ? 39.977  87.450   89.905  1.00 204.07 ? 4    DA  I N6    1 
ATOM   1862  N  N1    . DA  E  3 4    ? 39.649  89.534   90.846  1.00 208.68 ? 4    DA  I N1    1 
ATOM   1863  C  C2    . DA  E  3 4    ? 40.066  90.499   91.676  1.00 210.46 ? 4    DA  I C2    1 
ATOM   1864  N  N3    . DA  E  3 4    ? 41.152  90.536   92.447  1.00 208.49 ? 4    DA  I N3    1 
ATOM   1865  C  C4    . DA  E  3 4    ? 41.865  89.404   92.319  1.00 202.24 ? 4    DA  I C4    1 
ATOM   1866  P  P     . DA  E  3 5    ? 44.981  91.122   97.971  1.00 201.86 ? 5    DA  I P     1 
ATOM   1867  O  OP1   . DA  E  3 5    ? 46.035  92.031   98.487  1.00 203.94 ? 5    DA  I OP1   1 
ATOM   1868  O  OP2   . DA  E  3 5    ? 44.987  89.682   98.340  1.00 198.24 ? 5    DA  I OP2   1 
ATOM   1869  O  "O5'" . DA  E  3 5    ? 43.574  91.704   98.427  1.00 213.87 ? 5    DA  I "O5'" 1 
ATOM   1870  C  "C5'" . DA  E  3 5    ? 42.910  92.742   97.692  1.00 219.11 ? 5    DA  I "C5'" 1 
ATOM   1871  C  "C4'" . DA  E  3 5    ? 41.416  92.512   97.725  1.00 226.86 ? 5    DA  I "C4'" 1 
ATOM   1872  O  "O4'" . DA  E  3 5    ? 41.031  91.573   96.691  1.00 222.09 ? 5    DA  I "O4'" 1 
ATOM   1873  C  "C3'" . DA  E  3 5    ? 40.874  91.930   99.034  1.00 226.74 ? 5    DA  I "C3'" 1 
ATOM   1874  O  "O3'" . DA  E  3 5    ? 39.649  92.588   99.365  1.00 234.41 ? 5    DA  I "O3'" 1 
ATOM   1875  C  "C2'" . DA  E  3 5    ? 40.612  90.477   98.687  1.00 219.05 ? 5    DA  I "C2'" 1 
ATOM   1876  C  "C1'" . DA  E  3 5    ? 40.161  90.609   97.250  1.00 217.11 ? 5    DA  I "C1'" 1 
ATOM   1877  N  N9    . DA  E  3 5    ? 40.252  89.402   96.437  1.00 213.23 ? 5    DA  I N9    1 
ATOM   1878  C  C8    . DA  E  3 5    ? 41.138  88.362   96.563  1.00 210.85 ? 5    DA  I C8    1 
ATOM   1879  N  N7    . DA  E  3 5    ? 40.970  87.414   95.673  1.00 216.48 ? 5    DA  I N7    1 
ATOM   1880  C  C5    . DA  E  3 5    ? 39.909  87.864   94.902  1.00 215.59 ? 5    DA  I C5    1 
ATOM   1881  C  C6    . DA  E  3 5    ? 39.246  87.315   93.786  1.00 213.90 ? 5    DA  I C6    1 
ATOM   1882  N  N6    . DA  E  3 5    ? 39.577  86.148   93.227  1.00 208.83 ? 5    DA  I N6    1 
ATOM   1883  N  N1    . DA  E  3 5    ? 38.215  88.015   93.260  1.00 216.41 ? 5    DA  I N1    1 
ATOM   1884  C  C2    . DA  E  3 5    ? 37.884  89.186   93.819  1.00 224.28 ? 5    DA  I C2    1 
ATOM   1885  N  N3    . DA  E  3 5    ? 38.433  89.806   94.866  1.00 228.83 ? 5    DA  I N3    1 
ATOM   1886  C  C4    . DA  E  3 5    ? 39.454  89.086   95.364  1.00 220.94 ? 5    DA  I C4    1 
ATOM   1887  P  P     . DC  E  3 6    ? 39.120  92.657   100.862 1.00 238.42 ? 6    DC  I P     1 
ATOM   1888  O  OP1   . DC  E  3 6    ? 39.503  93.976   101.448 1.00 239.61 ? 6    DC  I OP1   1 
ATOM   1889  O  OP2   . DC  E  3 6    ? 39.477  91.390   101.552 1.00 233.66 ? 6    DC  I OP2   1 
ATOM   1890  O  "O5'" . DC  E  3 6    ? 37.541  92.630   100.684 1.00 235.33 ? 6    DC  I "O5'" 1 
ATOM   1891  C  "C5'" . DC  E  3 6    ? 36.911  92.981   99.444  1.00 230.74 ? 6    DC  I "C5'" 1 
ATOM   1892  C  "C4'" . DC  E  3 6    ? 35.741  92.059   99.204  1.00 234.34 ? 6    DC  I "C4'" 1 
ATOM   1893  O  "O4'" . DC  E  3 6    ? 36.176  90.902   98.451  1.00 229.07 ? 6    DC  I "O4'" 1 
ATOM   1894  C  "C3'" . DC  E  3 6    ? 35.071  91.508   100.469 1.00 237.30 ? 6    DC  I "C3'" 1 
ATOM   1895  O  "O3'" . DC  E  3 6    ? 33.657  91.520   100.300 1.00 244.76 ? 6    DC  I "O3'" 1 
ATOM   1896  C  "C2'" . DC  E  3 6    ? 35.566  90.075   100.543 1.00 226.01 ? 6    DC  I "C2'" 1 
ATOM   1897  C  "C1'" . DC  E  3 6    ? 35.668  89.728   99.072  1.00 222.34 ? 6    DC  I "C1'" 1 
ATOM   1898  N  N1    . DC  E  3 6    ? 36.556  88.605   98.716  1.00 213.50 ? 6    DC  I N1    1 
ATOM   1899  C  C2    . DC  E  3 6    ? 36.163  87.736   97.695  1.00 209.42 ? 6    DC  I C2    1 
ATOM   1900  O  O2    . DC  E  3 6    ? 35.066  87.911   97.147  1.00 216.72 ? 6    DC  I O2    1 
ATOM   1901  N  N3    . DC  E  3 6    ? 36.974  86.712   97.349  1.00 203.16 ? 6    DC  I N3    1 
ATOM   1902  C  C4    . DC  E  3 6    ? 38.141  86.550   97.969  1.00 204.33 ? 6    DC  I C4    1 
ATOM   1903  N  N4    . DC  E  3 6    ? 38.915  85.533   97.588  1.00 205.33 ? 6    DC  I N4    1 
ATOM   1904  C  C5    . DC  E  3 6    ? 38.569  87.422   99.011  1.00 204.19 ? 6    DC  I C5    1 
ATOM   1905  C  C6    . DC  E  3 6    ? 37.753  88.427   99.349  1.00 210.99 ? 6    DC  I C6    1 
ATOM   1906  P  P     . DG  E  3 7    ? 32.697  91.548   101.562 1.00 253.62 ? 7    DG  I P     1 
ATOM   1907  O  OP1   . DG  E  3 7    ? 32.340  92.978   101.750 1.00 266.87 ? 7    DG  I OP1   1 
ATOM   1908  O  OP2   . DG  E  3 7    ? 33.331  90.786   102.668 1.00 247.38 ? 7    DG  I OP2   1 
ATOM   1909  O  "O5'" . DG  E  3 7    ? 31.440  90.739   101.015 1.00 247.49 ? 7    DG  I "O5'" 1 
ATOM   1910  C  "C5'" . DG  E  3 7    ? 30.953  90.960   99.676  1.00 251.74 ? 7    DG  I "C5'" 1 
ATOM   1911  C  "C4'" . DG  E  3 7    ? 30.444  89.671   99.075  1.00 246.36 ? 7    DG  I "C4'" 1 
ATOM   1912  O  "O4'" . DG  E  3 7    ? 31.549  88.788   98.762  1.00 237.36 ? 7    DG  I "O4'" 1 
ATOM   1913  C  "C3'" . DG  E  3 7    ? 29.506  88.873   99.982  1.00 245.87 ? 7    DG  I "C3'" 1 
ATOM   1914  O  "O3'" . DG  E  3 7    ? 28.390  88.411   99.213  1.00 243.58 ? 7    DG  I "O3'" 1 
ATOM   1915  C  "C2'" . DG  E  3 7    ? 30.379  87.734   100.475 1.00 241.19 ? 7    DG  I "C2'" 1 
ATOM   1916  C  "C1'" . DG  E  3 7    ? 31.276  87.497   99.277  1.00 236.86 ? 7    DG  I "C1'" 1 
ATOM   1917  N  N9    . DG  E  3 7    ? 32.552  86.850   99.568  1.00 232.27 ? 7    DG  I N9    1 
ATOM   1918  C  C8    . DG  E  3 7    ? 33.458  87.206   100.538 1.00 231.44 ? 7    DG  I C8    1 
ATOM   1919  N  N7    . DG  E  3 7    ? 34.521  86.448   100.550 1.00 228.75 ? 7    DG  I N7    1 
ATOM   1920  C  C5    . DG  E  3 7    ? 34.300  85.530   99.533  1.00 230.23 ? 7    DG  I C5    1 
ATOM   1921  C  C6    . DG  E  3 7    ? 35.108  84.454   99.072  1.00 229.25 ? 7    DG  I C6    1 
ATOM   1922  O  O6    . DG  E  3 7    ? 36.213  84.086   99.489  1.00 215.74 ? 7    DG  I O6    1 
ATOM   1923  N  N1    . DG  E  3 7    ? 34.505  83.780   98.013  1.00 228.66 ? 7    DG  I N1    1 
ATOM   1924  C  C2    . DG  E  3 7    ? 33.283  84.096   97.468  1.00 227.19 ? 7    DG  I C2    1 
ATOM   1925  N  N2    . DG  E  3 7    ? 32.872  83.330   96.448  1.00 225.67 ? 7    DG  I N2    1 
ATOM   1926  N  N3    . DG  E  3 7    ? 32.522  85.096   97.887  1.00 228.02 ? 7    DG  I N3    1 
ATOM   1927  C  C4    . DG  E  3 7    ? 33.090  85.767   98.914  1.00 231.96 ? 7    DG  I C4    1 
ATOM   1928  P  P     . DA  E  3 8    ? 26.983  88.046   99.873  1.00 244.19 ? 8    DA  I P     1 
ATOM   1929  O  OP1   . DA  E  3 8    ? 25.976  88.971   99.297  1.00 250.87 ? 8    DA  I OP1   1 
ATOM   1930  O  OP2   . DA  E  3 8    ? 27.149  87.971   101.353 1.00 250.74 ? 8    DA  I OP2   1 
ATOM   1931  O  "O5'" . DA  E  3 8    ? 26.729  86.590   99.277  1.00 242.30 ? 8    DA  I "O5'" 1 
ATOM   1932  C  "C5'" . DA  E  3 8    ? 26.825  86.336   97.860  1.00 240.49 ? 8    DA  I "C5'" 1 
ATOM   1933  C  "C4'" . DA  E  3 8    ? 27.185  84.891   97.594  1.00 235.65 ? 8    DA  I "C4'" 1 
ATOM   1934  O  "O4'" . DA  E  3 8    ? 28.551  84.648   98.000  1.00 232.12 ? 8    DA  I "O4'" 1 
ATOM   1935  C  "C3'" . DA  E  3 8    ? 26.325  83.856   98.327  1.00 238.65 ? 8    DA  I "C3'" 1 
ATOM   1936  O  "O3'" . DA  E  3 8    ? 25.690  82.966   97.400  1.00 240.98 ? 8    DA  I "O3'" 1 
ATOM   1937  C  "C2'" . DA  E  3 8    ? 27.301  83.128   99.239  1.00 232.97 ? 8    DA  I "C2'" 1 
ATOM   1938  C  "C1'" . DA  E  3 8    ? 28.644  83.360   98.573  1.00 230.23 ? 8    DA  I "C1'" 1 
ATOM   1939  N  N9    . DA  E  3 8    ? 29.791  83.355   99.482  1.00 225.62 ? 8    DA  I N9    1 
ATOM   1940  C  C8    . DA  E  3 8    ? 29.969  84.138   100.595 1.00 221.13 ? 8    DA  I C8    1 
ATOM   1941  N  N7    . DA  E  3 8    ? 31.101  83.919   101.220 1.00 219.84 ? 8    DA  I N7    1 
ATOM   1942  C  C5    . DA  E  3 8    ? 31.712  82.926   100.467 1.00 214.75 ? 8    DA  I C5    1 
ATOM   1943  C  C6    . DA  E  3 8    ? 32.942  82.254   100.603 1.00 205.50 ? 8    DA  I C6    1 
ATOM   1944  N  N6    . DA  E  3 8    ? 33.809  82.492   101.588 1.00 202.52 ? 8    DA  I N6    1 
ATOM   1945  N  N1    . DA  E  3 8    ? 33.248  81.311   99.685  1.00 203.35 ? 8    DA  I N1    1 
ATOM   1946  C  C2    . DA  E  3 8    ? 32.375  81.068   98.698  1.00 211.42 ? 8    DA  I C2    1 
ATOM   1947  N  N3    . DA  E  3 8    ? 31.191  81.636   98.462  1.00 220.45 ? 8    DA  I N3    1 
ATOM   1948  C  C4    . DA  E  3 8    ? 30.916  82.568   99.393  1.00 222.06 ? 8    DA  I C4    1 
ATOM   1949  P  P     . DC  E  3 9    ? 24.542  81.935   97.868  1.00 247.07 ? 9    DC  I P     1 
ATOM   1950  O  OP1   . DC  E  3 9    ? 23.443  81.946   96.865  1.00 254.31 ? 9    DC  I OP1   1 
ATOM   1951  O  OP2   . DC  E  3 9    ? 24.223  82.097   99.313  1.00 245.71 ? 9    DC  I OP2   1 
ATOM   1952  O  "O5'" . DC  E  3 9    ? 25.287  80.540   97.725  1.00 231.53 ? 9    DC  I "O5'" 1 
ATOM   1953  C  "C5'" . DC  E  3 9    ? 26.009  80.211   96.527  1.00 234.67 ? 9    DC  I "C5'" 1 
ATOM   1954  C  "C4'" . DC  E  3 9    ? 26.886  79.008   96.783  1.00 227.57 ? 9    DC  I "C4'" 1 
ATOM   1955  O  "O4'" . DC  E  3 9    ? 27.935  79.379   97.706  1.00 228.21 ? 9    DC  I "O4'" 1 
ATOM   1956  C  "C3'" . DC  E  3 9    ? 26.150  77.818   97.409  1.00 230.71 ? 9    DC  I "C3'" 1 
ATOM   1957  O  "O3'" . DC  E  3 9    ? 26.337  76.620   96.642  1.00 228.70 ? 9    DC  I "O3'" 1 
ATOM   1958  C  "C2'" . DC  E  3 9    ? 26.718  77.715   98.816  1.00 228.25 ? 9    DC  I "C2'" 1 
ATOM   1959  C  "C1'" . DC  E  3 9    ? 28.079  78.384   98.700  1.00 225.92 ? 9    DC  I "C1'" 1 
ATOM   1960  N  N1    . DC  E  3 9    ? 28.573  79.039   99.928  1.00 219.77 ? 9    DC  I N1    1 
ATOM   1961  C  C2    . DC  E  3 9    ? 29.894  78.815   100.329 1.00 211.43 ? 9    DC  I C2    1 
ATOM   1962  O  O2    . DC  E  3 9    ? 30.612  78.070   99.642  1.00 201.81 ? 9    DC  I O2    1 
ATOM   1963  N  N3    . DC  E  3 9    ? 30.354  79.411   101.454 1.00 210.69 ? 9    DC  I N3    1 
ATOM   1964  C  C4    . DC  E  3 9    ? 29.552  80.213   102.159 1.00 213.69 ? 9    DC  I C4    1 
ATOM   1965  N  N4    . DC  E  3 9    ? 30.045  80.781   103.262 1.00 215.10 ? 9    DC  I N4    1 
ATOM   1966  C  C5    . DC  E  3 9    ? 28.207  80.467   101.767 1.00 219.10 ? 9    DC  I C5    1 
ATOM   1967  C  C6    . DC  E  3 9    ? 27.761  79.864   100.657 1.00 220.76 ? 9    DC  I C6    1 
ATOM   1968  P  P     . DG  E  3 10   ? 25.356  75.343   96.810  1.00 224.39 ? 10   DG  I P     1 
ATOM   1969  O  OP1   . DG  E  3 10   ? 24.764  74.951   95.497  1.00 228.65 ? 10   DG  I OP1   1 
ATOM   1970  O  OP2   . DG  E  3 10   ? 24.458  75.603   97.961  1.00 216.03 ? 10   DG  I OP2   1 
ATOM   1971  O  "O5'" . DG  E  3 10   ? 26.359  74.183   97.238  1.00 213.08 ? 10   DG  I "O5'" 1 
ATOM   1972  C  "C5'" . DG  E  3 10   ? 27.729  74.169   96.790  1.00 211.67 ? 10   DG  I "C5'" 1 
ATOM   1973  C  "C4'" . DG  E  3 10   ? 28.588  73.480   97.824  1.00 209.08 ? 10   DG  I "C4'" 1 
ATOM   1974  O  "O4'" . DG  E  3 10   ? 28.987  74.446   98.829  1.00 206.71 ? 10   DG  I "O4'" 1 
ATOM   1975  C  "C3'" . DG  E  3 10   ? 27.875  72.355   98.582  1.00 217.13 ? 10   DG  I "C3'" 1 
ATOM   1976  O  "O3'" . DG  E  3 10   ? 28.731  71.227   98.785  1.00 217.33 ? 10   DG  I "O3'" 1 
ATOM   1977  C  "C2'" . DG  E  3 10   ? 27.560  72.987   99.925  1.00 214.90 ? 10   DG  I "C2'" 1 
ATOM   1978  C  "C1'" . DG  E  3 10   ? 28.786  73.859   100.099 1.00 207.60 ? 10   DG  I "C1'" 1 
ATOM   1979  N  N9    . DG  E  3 10   ? 28.687  74.931   101.083 1.00 206.86 ? 10   DG  I N9    1 
ATOM   1980  C  C8    . DG  E  3 10   ? 27.585  75.701   101.369 1.00 212.86 ? 10   DG  I C8    1 
ATOM   1981  N  N7    . DG  E  3 10   ? 27.804  76.578   102.311 1.00 215.69 ? 10   DG  I N7    1 
ATOM   1982  C  C5    . DG  E  3 10   ? 29.128  76.371   102.673 1.00 212.83 ? 10   DG  I C5    1 
ATOM   1983  C  C6    . DG  E  3 10   ? 29.929  77.026   103.644 1.00 216.15 ? 10   DG  I C6    1 
ATOM   1984  O  O6    . DG  E  3 10   ? 29.616  77.952   104.404 1.00 220.16 ? 10   DG  I O6    1 
ATOM   1985  N  N1    . DG  E  3 10   ? 31.219  76.507   103.678 1.00 213.38 ? 10   DG  I N1    1 
ATOM   1986  C  C2    . DG  E  3 10   ? 31.683  75.485   102.882 1.00 206.68 ? 10   DG  I C2    1 
ATOM   1987  N  N2    . DG  E  3 10   ? 32.956  75.115   103.071 1.00 204.00 ? 10   DG  I N2    1 
ATOM   1988  N  N3    . DG  E  3 10   ? 30.948  74.872   101.968 1.00 203.92 ? 10   DG  I N3    1 
ATOM   1989  C  C4    . DG  E  3 10   ? 29.689  75.360   101.921 1.00 208.89 ? 10   DG  I C4    1 
ATOM   1990  P  P     . DG  E  3 11   ? 29.004  70.130   97.659  1.00 218.03 ? 11   DG  I P     1 
ATOM   1991  O  OP1   . DG  E  3 11   ? 28.912  70.804   96.334  1.00 222.34 ? 11   DG  I OP1   1 
ATOM   1992  O  OP2   . DG  E  3 11   ? 28.126  68.967   97.955  1.00 219.82 ? 11   DG  I OP2   1 
ATOM   1993  O  "O5'" . DG  E  3 11   ? 30.508  69.678   97.943  1.00 219.89 ? 11   DG  I "O5'" 1 
ATOM   1994  C  "C5'" . DG  E  3 11   ? 31.457  70.536   98.624  1.00 215.91 ? 11   DG  I "C5'" 1 
ATOM   1995  C  "C4'" . DG  E  3 11   ? 32.330  69.741   99.571  1.00 212.52 ? 11   DG  I "C4'" 1 
ATOM   1996  O  "O4'" . DG  E  3 11   ? 32.460  70.454   100.825 1.00 206.49 ? 11   DG  I "O4'" 1 
ATOM   1997  C  "C3'" . DG  E  3 11   ? 31.821  68.349   99.948  1.00 210.64 ? 11   DG  I "C3'" 1 
ATOM   1998  O  "O3'" . DG  E  3 11   ? 32.907  67.437   100.179 1.00 212.82 ? 11   DG  I "O3'" 1 
ATOM   1999  C  "C2'" . DG  E  3 11   ? 31.017  68.610   101.210 1.00 208.25 ? 11   DG  I "C2'" 1 
ATOM   2000  C  "C1'" . DG  E  3 11   ? 31.717  69.805   101.853 1.00 201.08 ? 11   DG  I "C1'" 1 
ATOM   2001  N  N9    . DG  E  3 11   ? 30.828  70.797   102.449 1.00 197.59 ? 11   DG  I N9    1 
ATOM   2002  C  C8    . DG  E  3 11   ? 29.578  71.163   102.010 1.00 198.80 ? 11   DG  I C8    1 
ATOM   2003  N  N7    . DG  E  3 11   ? 29.033  72.100   102.738 1.00 199.40 ? 11   DG  I N7    1 
ATOM   2004  C  C5    . DG  E  3 11   ? 29.981  72.371   103.714 1.00 203.76 ? 11   DG  I C5    1 
ATOM   2005  C  C6    . DG  E  3 11   ? 29.955  73.304   104.787 1.00 206.54 ? 11   DG  I C6    1 
ATOM   2006  O  O6    . DG  E  3 11   ? 29.067  74.108   105.090 1.00 204.53 ? 11   DG  I O6    1 
ATOM   2007  N  N1    . DG  E  3 11   ? 31.127  73.253   105.536 1.00 210.91 ? 11   DG  I N1    1 
ATOM   2008  C  C2    . DG  E  3 11   ? 32.188  72.417   105.285 1.00 219.74 ? 11   DG  I C2    1 
ATOM   2009  N  N2    . DG  E  3 11   ? 33.229  72.516   106.125 1.00 222.28 ? 11   DG  I N2    1 
ATOM   2010  N  N3    . DG  E  3 11   ? 32.226  71.549   104.284 1.00 220.53 ? 11   DG  I N3    1 
ATOM   2011  C  C4    . DG  E  3 11   ? 31.098  71.580   103.545 1.00 205.89 ? 11   DG  I C4    1 
ATOM   2012  P  P     . DC  E  3 12   ? 32.687  65.857   100.425 1.00 217.13 ? 12   DC  I P     1 
ATOM   2013  O  OP1   . DC  E  3 12   ? 33.893  65.096   100.011 1.00 218.37 ? 12   DC  I OP1   1 
ATOM   2014  O  OP2   . DC  E  3 12   ? 31.350  65.453   99.909  1.00 216.06 ? 12   DC  I OP2   1 
ATOM   2015  O  "O5'" . DC  E  3 12   ? 32.699  65.783   102.014 1.00 216.74 ? 12   DC  I "O5'" 1 
ATOM   2016  C  "C5'" . DC  E  3 12   ? 33.793  66.350   102.749 1.00 213.33 ? 12   DC  I "C5'" 1 
ATOM   2017  C  "C4'" . DC  E  3 12   ? 33.425  66.482   104.208 1.00 216.10 ? 12   DC  I "C4'" 1 
ATOM   2018  O  "O4'" . DC  E  3 12   ? 32.483  67.568   104.404 1.00 214.81 ? 12   DC  I "O4'" 1 
ATOM   2019  C  "C3'" . DC  E  3 12   ? 32.774  65.239   104.819 1.00 218.10 ? 12   DC  I "C3'" 1 
ATOM   2020  O  "O3'" . DC  E  3 12   ? 33.384  64.963   106.079 1.00 220.28 ? 12   DC  I "O3'" 1 
ATOM   2021  C  "C2'" . DC  E  3 12   ? 31.326  65.649   105.014 1.00 218.07 ? 12   DC  I "C2'" 1 
ATOM   2022  C  "C1'" . DC  E  3 12   ? 31.473  67.132   105.297 1.00 218.61 ? 12   DC  I "C1'" 1 
ATOM   2023  N  N1    . DC  E  3 12   ? 30.271  67.965   105.082 1.00 219.14 ? 12   DC  I N1    1 
ATOM   2024  C  C2    . DC  E  3 12   ? 30.007  69.013   105.974 1.00 212.40 ? 12   DC  I C2    1 
ATOM   2025  O  O2    . DC  E  3 12   ? 30.790  69.210   106.915 1.00 215.33 ? 12   DC  I O2    1 
ATOM   2026  N  N3    . DC  E  3 12   ? 28.907  69.781   105.788 1.00 204.33 ? 12   DC  I N3    1 
ATOM   2027  C  C4    . DC  E  3 12   ? 28.092  69.538   104.759 1.00 210.30 ? 12   DC  I C4    1 
ATOM   2028  N  N4    . DC  E  3 12   ? 27.018  70.318   104.615 1.00 207.26 ? 12   DC  I N4    1 
ATOM   2029  C  C5    . DC  E  3 12   ? 28.338  68.479   103.835 1.00 216.76 ? 12   DC  I C5    1 
ATOM   2030  C  C6    . DC  E  3 12   ? 29.427  67.722   104.034 1.00 219.16 ? 12   DC  I C6    1 
ATOM   2031  P  P     . DC  E  3 13   ? 33.332  63.518   106.730 1.00 216.90 ? 13   DC  I P     1 
ATOM   2032  O  OP1   . DC  E  3 13   ? 34.515  62.805   106.173 1.00 223.74 ? 13   DC  I OP1   1 
ATOM   2033  O  OP2   . DC  E  3 13   ? 31.977  62.957   106.543 1.00 210.75 ? 13   DC  I OP2   1 
ATOM   2034  O  "O5'" . DC  E  3 13   ? 33.482  63.816   108.287 1.00 214.47 ? 13   DC  I "O5'" 1 
ATOM   2035  C  "C5'" . DC  E  3 13   ? 33.823  65.131   108.781 1.00 217.05 ? 13   DC  I "C5'" 1 
ATOM   2036  C  "C4'" . DC  E  3 13   ? 32.875  65.537   109.886 1.00 221.16 ? 13   DC  I "C4'" 1 
ATOM   2037  O  "O4'" . DC  E  3 13   ? 31.780  66.309   109.329 1.00 214.89 ? 13   DC  I "O4'" 1 
ATOM   2038  C  "C3'" . DC  E  3 13   ? 32.224  64.366   110.631 1.00 228.10 ? 13   DC  I "C3'" 1 
ATOM   2039  O  "O3'" . DC  E  3 13   ? 32.114  64.617   112.044 1.00 235.86 ? 13   DC  I "O3'" 1 
ATOM   2040  C  "C2'" . DC  E  3 13   ? 30.860  64.273   109.974 1.00 220.94 ? 13   DC  I "C2'" 1 
ATOM   2041  C  "C1'" . DC  E  3 13   ? 30.561  65.748   109.785 1.00 213.28 ? 13   DC  I "C1'" 1 
ATOM   2042  N  N1    . DC  E  3 13   ? 29.496  66.112   108.832 1.00 204.67 ? 13   DC  I N1    1 
ATOM   2043  C  C2    . DC  E  3 13   ? 28.827  67.325   109.020 1.00 211.35 ? 13   DC  I C2    1 
ATOM   2044  O  O2    . DC  E  3 13   ? 29.160  68.053   109.968 1.00 215.38 ? 13   DC  I O2    1 
ATOM   2045  N  N3    . DC  E  3 13   ? 27.833  67.673   108.171 1.00 214.82 ? 13   DC  I N3    1 
ATOM   2046  C  C4    . DC  E  3 13   ? 27.504  66.862   107.164 1.00 214.43 ? 13   DC  I C4    1 
ATOM   2047  N  N4    . DC  E  3 13   ? 26.520  67.247   106.349 1.00 217.57 ? 13   DC  I N4    1 
ATOM   2048  C  C5    . DC  E  3 13   ? 28.167  65.618   106.951 1.00 205.56 ? 13   DC  I C5    1 
ATOM   2049  C  C6    . DC  E  3 13   ? 29.142  65.282   107.805 1.00 201.96 ? 13   DC  I C6    1 
ATOM   2050  P  P     . DA  E  3 14   ? 33.313  64.376   113.117 1.00 244.65 ? 14   DA  I P     1 
ATOM   2051  O  OP1   . DA  E  3 14   ? 34.615  64.325   112.392 1.00 246.65 ? 14   DA  I OP1   1 
ATOM   2052  O  OP2   . DA  E  3 14   ? 32.944  63.244   114.008 1.00 230.53 ? 14   DA  I OP2   1 
ATOM   2053  O  "O5'" . DA  E  3 14   ? 33.334  65.689   114.024 1.00 233.11 ? 14   DA  I "O5'" 1 
ATOM   2054  C  "C5'" . DA  E  3 14   ? 32.695  66.915   113.606 1.00 227.46 ? 14   DA  I "C5'" 1 
ATOM   2055  C  "C4'" . DA  E  3 14   ? 31.494  67.222   114.473 1.00 228.51 ? 14   DA  I "C4'" 1 
ATOM   2056  O  "O4'" . DA  E  3 14   ? 30.316  67.337   113.638 1.00 227.40 ? 14   DA  I "O4'" 1 
ATOM   2057  C  "C3'" . DA  E  3 14   ? 31.163  66.178   115.544 1.00 227.14 ? 14   DA  I "C3'" 1 
ATOM   2058  O  "O3'" . DA  E  3 14   ? 30.910  66.804   116.802 1.00 231.92 ? 14   DA  I "O3'" 1 
ATOM   2059  C  "C2'" . DA  E  3 14   ? 29.936  65.471   114.994 1.00 225.42 ? 14   DA  I "C2'" 1 
ATOM   2060  C  "C1'" . DA  E  3 14   ? 29.261  66.555   114.172 1.00 222.23 ? 14   DA  I "C1'" 1 
ATOM   2061  N  N9    . DA  E  3 14   ? 28.454  66.068   113.053 1.00 213.89 ? 14   DA  I N9    1 
ATOM   2062  C  C8    . DA  E  3 14   ? 28.656  64.930   112.311 1.00 213.74 ? 14   DA  I C8    1 
ATOM   2063  N  N7    . DA  E  3 14   ? 27.776  64.760   111.354 1.00 216.26 ? 14   DA  I N7    1 
ATOM   2064  C  C5    . DA  E  3 14   ? 26.933  65.856   111.478 1.00 217.42 ? 14   DA  I C5    1 
ATOM   2065  C  C6    . DA  E  3 14   ? 25.791  66.257   110.762 1.00 216.42 ? 14   DA  I C6    1 
ATOM   2066  N  N6    . DA  E  3 14   ? 25.281  65.570   109.739 1.00 216.93 ? 14   DA  I N6    1 
ATOM   2067  N  N1    . DA  E  3 14   ? 25.183  67.403   111.138 1.00 212.52 ? 14   DA  I N1    1 
ATOM   2068  C  C2    . DA  E  3 14   ? 25.690  68.088   112.172 1.00 216.38 ? 14   DA  I C2    1 
ATOM   2069  N  N3    . DA  E  3 14   ? 26.762  67.818   112.917 1.00 215.61 ? 14   DA  I N3    1 
ATOM   2070  C  C4    . DA  E  3 14   ? 27.342  66.672   112.517 1.00 214.33 ? 14   DA  I C4    1 
ATOM   2071  P  P     . DG  E  3 15   ? 30.520  65.921   118.086 1.00 246.34 ? 15   DG  I P     1 
ATOM   2072  O  OP1   . DG  E  3 15   ? 30.825  66.682   119.335 1.00 251.87 ? 15   DG  I OP1   1 
ATOM   2073  O  OP2   . DG  E  3 15   ? 31.036  64.537   117.923 1.00 239.71 ? 15   DG  I OP2   1 
ATOM   2074  O  "O5'" . DG  E  3 15   ? 28.939  65.835   117.924 1.00 230.57 ? 15   DG  I "O5'" 1 
ATOM   2075  C  "C5'" . DG  E  3 15   ? 28.149  67.014   117.703 1.00 226.94 ? 15   DG  I "C5'" 1 
ATOM   2076  C  "C4'" . DG  E  3 15   ? 26.756  66.621   117.274 1.00 224.24 ? 15   DG  I "C4'" 1 
ATOM   2077  O  "O4'" . DG  E  3 15   ? 26.794  65.974   115.984 1.00 224.63 ? 15   DG  I "O4'" 1 
ATOM   2078  C  "C3'" . DG  E  3 15   ? 26.055  65.640   118.217 1.00 229.01 ? 15   DG  I "C3'" 1 
ATOM   2079  O  "O3'" . DG  E  3 15   ? 24.925  66.300   118.780 1.00 232.05 ? 15   DG  I "O3'" 1 
ATOM   2080  C  "C2'" . DG  E  3 15   ? 25.655  64.468   117.330 1.00 224.89 ? 15   DG  I "C2'" 1 
ATOM   2081  C  "C1'" . DG  E  3 15   ? 25.727  65.048   115.935 1.00 223.11 ? 15   DG  I "C1'" 1 
ATOM   2082  N  N9    . DG  E  3 15   ? 26.000  64.090   114.863 1.00 223.97 ? 15   DG  I N9    1 
ATOM   2083  C  C8    . DG  E  3 15   ? 27.087  63.256   114.744 1.00 222.59 ? 15   DG  I C8    1 
ATOM   2084  N  N7    . DG  E  3 15   ? 27.048  62.514   113.669 1.00 218.12 ? 15   DG  I N7    1 
ATOM   2085  C  C5    . DG  E  3 15   ? 25.865  62.881   113.041 1.00 218.56 ? 15   DG  I C5    1 
ATOM   2086  C  C6    . DG  E  3 15   ? 25.285  62.417   111.830 1.00 215.53 ? 15   DG  I C6    1 
ATOM   2087  O  O6    . DG  E  3 15   ? 25.712  61.558   111.052 1.00 218.04 ? 15   DG  I O6    1 
ATOM   2088  N  N1    . DG  E  3 15   ? 24.080  63.061   111.558 1.00 211.13 ? 15   DG  I N1    1 
ATOM   2089  C  C2    . DG  E  3 15   ? 23.503  64.022   112.352 1.00 216.58 ? 15   DG  I C2    1 
ATOM   2090  N  N2    . DG  E  3 15   ? 22.331  64.517   111.928 1.00 211.74 ? 15   DG  I N2    1 
ATOM   2091  N  N3    . DG  E  3 15   ? 24.033  64.461   113.484 1.00 226.93 ? 15   DG  I N3    1 
ATOM   2092  C  C4    . DG  E  3 15   ? 25.207  63.853   113.763 1.00 223.55 ? 15   DG  I C4    1 
ATOM   2093  P  P     . DT  E  3 16   ? 24.292  65.763   120.130 1.00 233.51 ? 16   DT  I P     1 
ATOM   2094  O  OP1   . DT  E  3 16   ? 24.961  66.543   121.202 1.00 244.09 ? 16   DT  I OP1   1 
ATOM   2095  O  OP2   . DT  E  3 16   ? 24.388  64.283   120.146 1.00 237.53 ? 16   DT  I OP2   1 
ATOM   2096  O  "O5'" . DT  E  3 16   ? 22.762  66.191   119.980 1.00 240.57 ? 16   DT  I "O5'" 1 
ATOM   2097  C  "C5'" . DT  E  3 16   ? 22.163  66.494   118.695 1.00 236.84 ? 16   DT  I "C5'" 1 
ATOM   2098  C  "C4'" . DT  E  3 16   ? 21.361  65.324   118.165 1.00 236.13 ? 16   DT  I "C4'" 1 
ATOM   2099  O  "O4'" . DT  E  3 16   ? 22.130  64.576   117.202 1.00 232.03 ? 16   DT  I "O4'" 1 
ATOM   2100  C  "C3'" . DT  E  3 16   ? 20.896  64.294   119.199 1.00 240.21 ? 16   DT  I "C3'" 1 
ATOM   2101  O  "O3'" . DT  E  3 16   ? 19.517  64.513   119.494 1.00 243.44 ? 16   DT  I "O3'" 1 
ATOM   2102  C  "C2'" . DT  E  3 16   ? 21.128  62.943   118.531 1.00 230.61 ? 16   DT  I "C2'" 1 
ATOM   2103  C  "C1'" . DT  E  3 16   ? 21.560  63.286   117.118 1.00 227.22 ? 16   DT  I "C1'" 1 
ATOM   2104  N  N1    . DT  E  3 16   ? 22.558  62.387   116.496 1.00 229.16 ? 16   DT  I N1    1 
ATOM   2105  C  C2    . DT  E  3 16   ? 22.421  62.126   115.150 1.00 226.46 ? 16   DT  I C2    1 
ATOM   2106  O  O2    . DT  E  3 16   ? 21.513  62.580   114.471 1.00 227.43 ? 16   DT  I O2    1 
ATOM   2107  N  N3    . DT  E  3 16   ? 23.385  61.300   114.626 1.00 220.51 ? 16   DT  I N3    1 
ATOM   2108  C  C4    . DT  E  3 16   ? 24.457  60.737   115.295 1.00 219.57 ? 16   DT  I C4    1 
ATOM   2109  O  O4    . DT  E  3 16   ? 25.240  60.009   114.692 1.00 210.48 ? 16   DT  I O4    1 
ATOM   2110  C  C5    . DT  E  3 16   ? 24.545  61.059   116.701 1.00 224.10 ? 16   DT  I C5    1 
ATOM   2111  C  C7    . DT  E  3 16   ? 25.663  60.481   117.509 1.00 215.92 ? 16   DT  I C7    1 
ATOM   2112  C  C6    . DT  E  3 16   ? 23.604  61.857   117.224 1.00 230.43 ? 16   DT  I C6    1 
ATOM   2113  P  P     . DG  E  3 17   ? 18.754  63.676   120.613 1.00 247.06 ? 17   DG  I P     1 
ATOM   2114  O  OP1   . DG  E  3 17   ? 17.839  64.622   121.309 1.00 256.63 ? 17   DG  I OP1   1 
ATOM   2115  O  OP2   . DG  E  3 17   ? 19.723  62.856   121.393 1.00 243.07 ? 17   DG  I OP2   1 
ATOM   2116  O  "O5'" . DG  E  3 17   ? 17.876  62.674   119.743 1.00 252.39 ? 17   DG  I "O5'" 1 
ATOM   2117  C  "C5'" . DG  E  3 17   ? 17.550  62.949   118.366 1.00 250.71 ? 17   DG  I "C5'" 1 
ATOM   2118  C  "C4'" . DG  E  3 17   ? 17.278  61.657   117.632 1.00 249.04 ? 17   DG  I "C4'" 1 
ATOM   2119  O  "O4'" . DG  E  3 17   ? 18.516  61.137   117.085 1.00 236.83 ? 17   DG  I "O4'" 1 
ATOM   2120  C  "C3'" . DG  E  3 17   ? 16.691  60.539   118.504 1.00 253.64 ? 17   DG  I "C3'" 1 
ATOM   2121  O  "O3'" . DG  E  3 17   ? 15.673  59.831   117.789 1.00 262.40 ? 17   DG  I "O3'" 1 
ATOM   2122  C  "C2'" . DG  E  3 17   ? 17.892  59.656   118.787 1.00 250.11 ? 17   DG  I "C2'" 1 
ATOM   2123  C  "C1'" . DG  E  3 17   ? 18.655  59.780   117.480 1.00 245.31 ? 17   DG  I "C1'" 1 
ATOM   2124  N  N9    . DG  E  3 17   ? 20.079  59.464   117.540 1.00 242.85 ? 17   DG  I N9    1 
ATOM   2125  C  C8    . DG  E  3 17   ? 20.961  59.738   118.558 1.00 244.70 ? 17   DG  I C8    1 
ATOM   2126  N  N7    . DG  E  3 17   ? 22.172  59.322   118.311 1.00 238.20 ? 17   DG  I N7    1 
ATOM   2127  C  C5    . DG  E  3 17   ? 22.081  58.721   117.064 1.00 232.74 ? 17   DG  I C5    1 
ATOM   2128  C  C6    . DG  E  3 17   ? 23.072  58.080   116.280 1.00 233.78 ? 17   DG  I C6    1 
ATOM   2129  O  O6    . DG  E  3 17   ? 24.271  57.916   116.537 1.00 235.84 ? 17   DG  I O6    1 
ATOM   2130  N  N1    . DG  E  3 17   ? 22.550  57.615   115.076 1.00 234.22 ? 17   DG  I N1    1 
ATOM   2131  C  C2    . DG  E  3 17   ? 21.240  57.744   114.681 1.00 232.99 ? 17   DG  I C2    1 
ATOM   2132  N  N2    . DG  E  3 17   ? 20.926  57.226   113.484 1.00 228.36 ? 17   DG  I N2    1 
ATOM   2133  N  N3    . DG  E  3 17   ? 20.308  58.340   115.403 1.00 237.38 ? 17   DG  I N3    1 
ATOM   2134  C  C4    . DG  E  3 17   ? 20.795  58.798   116.576 1.00 236.02 ? 17   DG  I C4    1 
ATOM   2135  P  P     . DC  E  3 18   ? 14.540  58.908   118.458 1.00 261.44 ? 18   DC  I P     1 
ATOM   2136  O  OP1   . DC  E  3 18   ? 13.303  59.716   118.582 1.00 279.23 ? 18   DC  I OP1   1 
ATOM   2137  O  OP2   . DC  E  3 18   ? 15.091  58.222   119.654 1.00 260.16 ? 18   DC  I OP2   1 
ATOM   2138  O  "O5'" . DC  E  3 18   ? 14.298  57.802   117.334 1.00 271.94 ? 18   DC  I "O5'" 1 
ATOM   2139  C  "C5'" . DC  E  3 18   ? 14.233  58.155   115.931 1.00 270.16 ? 18   DC  I "C5'" 1 
ATOM   2140  C  "C4'" . DC  E  3 18   ? 15.171  57.295   115.113 1.00 262.27 ? 18   DC  I "C4'" 1 
ATOM   2141  O  "O4'" . DC  E  3 18   ? 16.500  57.278   115.697 1.00 257.48 ? 18   DC  I "O4'" 1 
ATOM   2142  C  "C3'" . DC  E  3 18   ? 14.760  55.826   114.994 1.00 258.45 ? 18   DC  I "C3'" 1 
ATOM   2143  O  "O3'" . DC  E  3 18   ? 15.132  55.323   113.705 1.00 262.27 ? 18   DC  I "O3'" 1 
ATOM   2144  C  "C2'" . DC  E  3 18   ? 15.635  55.149   116.029 1.00 252.24 ? 18   DC  I "C2'" 1 
ATOM   2145  C  "C1'" . DC  E  3 18   ? 16.918  55.924   115.812 1.00 251.29 ? 18   DC  I "C1'" 1 
ATOM   2146  N  N1    . DC  E  3 18   ? 17.931  55.839   116.879 1.00 246.10 ? 18   DC  I N1    1 
ATOM   2147  C  C2    . DC  E  3 18   ? 19.242  55.480   116.539 1.00 239.90 ? 18   DC  I C2    1 
ATOM   2148  O  O2    . DC  E  3 18   ? 19.512  55.239   115.353 1.00 234.04 ? 18   DC  I O2    1 
ATOM   2149  N  N3    . DC  E  3 18   ? 20.181  55.407   117.510 1.00 235.94 ? 18   DC  I N3    1 
ATOM   2150  C  C4    . DC  E  3 18   ? 19.853  55.681   118.775 1.00 245.11 ? 18   DC  I C4    1 
ATOM   2151  N  N4    . DC  E  3 18   ? 20.811  55.596   119.700 1.00 253.43 ? 18   DC  I N4    1 
ATOM   2152  C  C5    . DC  E  3 18   ? 18.526  56.043   119.149 1.00 248.32 ? 18   DC  I C5    1 
ATOM   2153  C  C6    . DC  E  3 18   ? 17.605  56.108   118.179 1.00 246.87 ? 18   DC  I C6    1 
ATOM   2154  P  P     . DC  E  3 19   ? 14.251  55.427   112.366 1.00 276.67 ? 19   DC  I P     1 
ATOM   2155  O  OP1   . DC  E  3 19   ? 14.325  56.797   111.793 1.00 271.72 ? 19   DC  I OP1   1 
ATOM   2156  O  OP2   . DC  E  3 19   ? 12.926  54.791   112.601 1.00 300.06 ? 19   DC  I OP2   1 
ATOM   2157  O  "O5'" . DC  E  3 19   ? 15.083  54.486   111.391 1.00 257.88 ? 19   DC  I "O5'" 1 
ATOM   2158  C  "C5'" . DC  E  3 19   ? 16.488  54.707   111.201 1.00 253.36 ? 19   DC  I "C5'" 1 
ATOM   2159  C  "C4'" . DC  E  3 19   ? 17.252  53.404   111.261 1.00 252.26 ? 19   DC  I "C4'" 1 
ATOM   2160  O  "O4'" . DC  E  3 19   ? 17.958  53.303   112.522 1.00 255.15 ? 19   DC  I "O4'" 1 
ATOM   2161  C  "C3'" . DC  E  3 19   ? 16.415  52.126   111.133 1.00 258.51 ? 19   DC  I "C3'" 1 
ATOM   2162  O  "O3'" . DC  E  3 19   ? 16.996  51.256   110.153 1.00 258.95 ? 19   DC  I "O3'" 1 
ATOM   2163  C  "C2'" . DC  E  3 19   ? 16.445  51.532   112.533 1.00 259.67 ? 19   DC  I "C2'" 1 
ATOM   2164  C  "C1'" . DC  E  3 19   ? 17.798  51.994   113.048 1.00 252.76 ? 19   DC  I "C1'" 1 
ATOM   2165  N  N1    . DC  E  3 19   ? 17.969  52.066   114.517 1.00 240.00 ? 19   DC  I N1    1 
ATOM   2166  C  C2    . DC  E  3 19   ? 19.258  52.223   115.030 1.00 229.70 ? 19   DC  I C2    1 
ATOM   2167  O  O2    . DC  E  3 19   ? 20.213  52.284   114.243 1.00 235.52 ? 19   DC  I O2    1 
ATOM   2168  N  N3    . DC  E  3 19   ? 19.433  52.304   116.368 1.00 231.99 ? 19   DC  I N3    1 
ATOM   2169  C  C4    . DC  E  3 19   ? 18.380  52.226   117.184 1.00 237.97 ? 19   DC  I C4    1 
ATOM   2170  N  N4    . DC  E  3 19   ? 18.599  52.299   118.499 1.00 242.08 ? 19   DC  I N4    1 
ATOM   2171  C  C5    . DC  E  3 19   ? 17.054  52.060   116.691 1.00 238.16 ? 19   DC  I C5    1 
ATOM   2172  C  C6    . DC  E  3 19   ? 16.897  51.983   115.363 1.00 241.36 ? 19   DC  I C6    1 
ATOM   2173  P  P     . DA  E  3 20   ? 16.375  49.816   109.783 1.00 261.01 ? 20   DA  I P     1 
ATOM   2174  O  OP1   . DA  E  3 20   ? 16.576  49.600   108.328 1.00 270.17 ? 20   DA  I OP1   1 
ATOM   2175  O  OP2   . DA  E  3 20   ? 15.012  49.650   110.363 1.00 262.24 ? 20   DA  I OP2   1 
ATOM   2176  O  "O5'" . DA  E  3 20   ? 17.371  48.849   110.564 1.00 249.15 ? 20   DA  I "O5'" 1 
ATOM   2177  C  "C5'" . DA  E  3 20   ? 18.798  48.954   110.391 1.00 239.85 ? 20   DA  I "C5'" 1 
ATOM   2178  C  "C4'" . DA  E  3 20   ? 19.513  47.900   111.206 1.00 236.81 ? 20   DA  I "C4'" 1 
ATOM   2179  O  "O4'" . DA  E  3 20   ? 19.535  48.295   112.599 1.00 230.52 ? 20   DA  I "O4'" 1 
ATOM   2180  C  "C3'" . DA  E  3 20   ? 18.884  46.503   111.174 1.00 239.16 ? 20   DA  I "C3'" 1 
ATOM   2181  O  "O3'" . DA  E  3 20   ? 19.858  45.454   111.147 1.00 242.30 ? 20   DA  I "O3'" 1 
ATOM   2182  C  "C2'" . DA  E  3 20   ? 18.145  46.420   112.492 1.00 235.46 ? 20   DA  I "C2'" 1 
ATOM   2183  C  "C1'" . DA  E  3 20   ? 19.054  47.228   113.398 1.00 233.52 ? 20   DA  I "C1'" 1 
ATOM   2184  N  N9    . DA  E  3 20   ? 18.398  47.801   114.575 1.00 236.49 ? 20   DA  I N9    1 
ATOM   2185  C  C8    . DA  E  3 20   ? 17.119  48.292   114.675 1.00 233.32 ? 20   DA  I C8    1 
ATOM   2186  N  N7    . DA  E  3 20   ? 16.814  48.729   115.872 1.00 228.60 ? 20   DA  I N7    1 
ATOM   2187  C  C5    . DA  E  3 20   ? 17.965  48.508   116.611 1.00 228.27 ? 20   DA  I C5    1 
ATOM   2188  C  C6    . DA  E  3 20   ? 18.289  48.761   117.954 1.00 232.49 ? 20   DA  I C6    1 
ATOM   2189  N  N6    . DA  E  3 20   ? 17.441  49.311   118.826 1.00 239.00 ? 20   DA  I N6    1 
ATOM   2190  N  N1    . DA  E  3 20   ? 19.528  48.428   118.375 1.00 230.78 ? 20   DA  I N1    1 
ATOM   2191  C  C2    . DA  E  3 20   ? 20.375  47.875   117.500 1.00 230.79 ? 20   DA  I C2    1 
ATOM   2192  N  N3    . DA  E  3 20   ? 20.188  47.589   116.213 1.00 232.18 ? 20   DA  I N3    1 
ATOM   2193  C  C4    . DA  E  3 20   ? 18.946  47.932   115.827 1.00 231.05 ? 20   DA  I C4    1 
HETATM 2194  N  N1    . DOC E  3 21   ? 19.537  44.692   116.308 1.00 185.71 ? 21   DOC I N1    1 
HETATM 2195  C  C2    . DOC E  3 21   ? 19.360  45.147   117.652 1.00 185.53 ? 21   DOC I C2    1 
HETATM 2196  N  N3    . DOC E  3 21   ? 18.134  45.543   118.077 1.00 181.03 ? 21   DOC I N3    1 
HETATM 2197  C  C4    . DOC E  3 21   ? 17.067  45.507   117.251 1.00 175.59 ? 21   DOC I C4    1 
HETATM 2198  C  C5    . DOC E  3 21   ? 17.209  45.066   115.944 1.00 174.84 ? 21   DOC I C5    1 
HETATM 2199  C  C6    . DOC E  3 21   ? 18.464  44.656   115.491 1.00 180.83 ? 21   DOC I C6    1 
HETATM 2200  O  O2    . DOC E  3 21   ? 20.323  45.193   118.462 1.00 182.59 ? 21   DOC I O2    1 
HETATM 2201  N  N4    . DOC E  3 21   ? 15.862  45.899   117.705 1.00 180.13 ? 21   DOC I N4    1 
HETATM 2202  C  "C1'" . DOC E  3 21   ? 20.865  44.230   115.832 1.00 183.83 ? 21   DOC I "C1'" 1 
HETATM 2203  C  "C2'" . DOC E  3 21   ? 20.863  42.712   115.588 1.00 192.16 ? 21   DOC I "C2'" 1 
HETATM 2204  C  "C3'" . DOC E  3 21   ? 21.575  42.495   114.268 1.00 192.92 ? 21   DOC I "C3'" 1 
HETATM 2205  C  "C4'" . DOC E  3 21   ? 21.863  43.894   113.746 1.00 188.96 ? 21   DOC I "C4'" 1 
HETATM 2206  O  "O4'" . DOC E  3 21   ? 21.240  44.844   114.613 1.00 173.14 ? 21   DOC I "O4'" 1 
HETATM 2207  C  "C5'" . DOC E  3 21   ? 21.348  44.065   112.318 1.00 203.40 ? 21   DOC I "C5'" 1 
HETATM 2208  O  "O5'" . DOC E  3 21   ? 19.914  44.134   112.268 1.00 215.95 ? 21   DOC I "O5'" 1 
HETATM 2209  P  P     . DOC E  3 21   ? 19.153  44.022   110.847 1.00 222.36 ? 21   DOC I P     1 
HETATM 2210  O  OP1   . DOC E  3 21   ? 19.972  43.120   109.938 1.00 232.18 ? 21   DOC I OP1   1 
HETATM 2211  O  OP2   . DOC E  3 21   ? 17.712  43.661   111.141 1.00 229.31 ? 21   DOC I OP2   1 
ATOM   2212  P  P     . DT  F  2 6    ? 5.924   41.524   126.187 1.00 208.34 ? 6    DT  J P     1 
ATOM   2213  O  OP1   . DT  F  2 6    ? 5.186   40.731   127.212 1.00 203.70 ? 6    DT  J OP1   1 
ATOM   2214  O  OP2   . DT  F  2 6    ? 5.194   42.100   125.033 1.00 203.81 ? 6    DT  J OP2   1 
ATOM   2215  O  "O5'" . DT  F  2 6    ? 6.725   42.709   126.892 1.00 212.72 ? 6    DT  J "O5'" 1 
ATOM   2216  C  "C5'" . DT  F  2 6    ? 7.647   42.451   127.970 1.00 211.06 ? 6    DT  J "C5'" 1 
ATOM   2217  C  "C4'" . DT  F  2 6    ? 8.963   43.159   127.732 1.00 207.54 ? 6    DT  J "C4'" 1 
ATOM   2218  O  "O4'" . DT  F  2 6    ? 9.481   42.831   126.421 1.00 201.12 ? 6    DT  J "O4'" 1 
ATOM   2219  C  "C3'" . DT  F  2 6    ? 8.908   44.693   127.801 1.00 207.08 ? 6    DT  J "C3'" 1 
ATOM   2220  O  "O3'" . DT  F  2 6    ? 9.891   45.179   128.721 1.00 209.58 ? 6    DT  J "O3'" 1 
ATOM   2221  C  "C2'" . DT  F  2 6    ? 9.185   45.142   126.376 1.00 197.05 ? 6    DT  J "C2'" 1 
ATOM   2222  C  "C1'" . DT  F  2 6    ? 10.017  44.002   125.830 1.00 196.82 ? 6    DT  J "C1'" 1 
ATOM   2223  N  N1    . DT  F  2 6    ? 9.976   43.821   124.364 1.00 196.99 ? 6    DT  J N1    1 
ATOM   2224  C  C2    . DT  F  2 6    ? 11.118  43.322   123.753 1.00 190.84 ? 6    DT  J C2    1 
ATOM   2225  O  O2    . DT  F  2 6    ? 12.149  43.033   124.364 1.00 181.73 ? 6    DT  J O2    1 
ATOM   2226  N  N3    . DT  F  2 6    ? 11.010  43.170   122.392 1.00 190.20 ? 6    DT  J N3    1 
ATOM   2227  C  C4    . DT  F  2 6    ? 9.931   43.455   121.597 1.00 187.08 ? 6    DT  J C4    1 
ATOM   2228  O  O4    . DT  F  2 6    ? 9.996   43.249   120.386 1.00 175.13 ? 6    DT  J O4    1 
ATOM   2229  C  C5    . DT  F  2 6    ? 8.777   43.990   122.293 1.00 192.55 ? 6    DT  J C5    1 
ATOM   2230  C  C7    . DT  F  2 6    ? 7.553   44.335   121.509 1.00 193.64 ? 6    DT  J C7    1 
ATOM   2231  C  C6    . DT  F  2 6    ? 8.861   44.151   123.625 1.00 199.55 ? 6    DT  J C6    1 
ATOM   2232  P  P     . DT  F  2 7    ? 10.355  46.706   128.916 1.00 202.43 ? 7    DT  J P     1 
ATOM   2233  O  OP1   . DT  F  2 7    ? 10.346  46.949   130.380 1.00 217.02 ? 7    DT  J OP1   1 
ATOM   2234  O  OP2   . DT  F  2 7    ? 9.721   47.692   128.004 1.00 187.28 ? 7    DT  J OP2   1 
ATOM   2235  O  "O5'" . DT  F  2 7    ? 11.866  46.531   128.460 1.00 199.78 ? 7    DT  J "O5'" 1 
ATOM   2236  C  "C5'" . DT  F  2 7    ? 12.672  45.479   129.018 1.00 203.21 ? 7    DT  J "C5'" 1 
ATOM   2237  C  "C4'" . DT  F  2 7    ? 14.087  45.591   128.505 1.00 204.81 ? 7    DT  J "C4'" 1 
ATOM   2238  O  "O4'" . DT  F  2 7    ? 14.159  45.048   127.165 1.00 204.42 ? 7    DT  J "O4'" 1 
ATOM   2239  C  "C3'" . DT  F  2 7    ? 14.631  47.019   128.407 1.00 202.15 ? 7    DT  J "C3'" 1 
ATOM   2240  O  "O3'" . DT  F  2 7    ? 16.002  47.027   128.801 1.00 200.04 ? 7    DT  J "O3'" 1 
ATOM   2241  C  "C2'" . DT  F  2 7    ? 14.512  47.336   126.929 1.00 201.66 ? 7    DT  J "C2'" 1 
ATOM   2242  C  "C1'" . DT  F  2 7    ? 14.814  45.980   126.321 1.00 201.89 ? 7    DT  J "C1'" 1 
ATOM   2243  N  N1    . DT  F  2 7    ? 14.341  45.747   124.946 1.00 205.91 ? 7    DT  J N1    1 
ATOM   2244  C  C2    . DT  F  2 7    ? 14.754  44.577   124.324 1.00 198.68 ? 7    DT  J C2    1 
ATOM   2245  O  O2    . DT  F  2 7    ? 15.480  43.737   124.860 1.00 186.87 ? 7    DT  J O2    1 
ATOM   2246  N  N3    . DT  F  2 7    ? 14.280  44.421   123.044 1.00 195.63 ? 7    DT  J N3    1 
ATOM   2247  C  C4    . DT  F  2 7    ? 13.474  45.274   122.336 1.00 197.15 ? 7    DT  J C4    1 
ATOM   2248  O  O4    . DT  F  2 7    ? 13.129  44.976   121.193 1.00 210.68 ? 7    DT  J O4    1 
ATOM   2249  C  C5    . DT  F  2 7    ? 13.094  46.486   123.034 1.00 198.58 ? 7    DT  J C5    1 
ATOM   2250  C  C7    . DT  F  2 7    ? 12.217  47.478   122.341 1.00 202.22 ? 7    DT  J C7    1 
ATOM   2251  C  C6    . DT  F  2 7    ? 13.548  46.662   124.287 1.00 201.61 ? 7    DT  J C6    1 
ATOM   2252  P  P     . DG  F  2 8    ? 16.720  48.341   129.331 1.00 196.38 ? 8    DG  J P     1 
ATOM   2253  O  OP1   . DG  F  2 8    ? 16.566  48.342   130.812 1.00 201.55 ? 8    DG  J OP1   1 
ATOM   2254  O  OP2   . DG  F  2 8    ? 16.238  49.500   128.532 1.00 193.45 ? 8    DG  J OP2   1 
ATOM   2255  O  "O5'" . DG  F  2 8    ? 18.238  48.071   128.928 1.00 197.58 ? 8    DG  J "O5'" 1 
ATOM   2256  C  "C5'" . DG  F  2 8    ? 18.779  46.730   128.832 1.00 193.91 ? 8    DG  J "C5'" 1 
ATOM   2257  C  "C4'" . DG  F  2 8    ? 19.576  46.561   127.557 1.00 185.15 ? 8    DG  J "C4'" 1 
ATOM   2258  O  "O4'" . DG  F  2 8    ? 18.685  46.339   126.438 1.00 180.19 ? 8    DG  J "O4'" 1 
ATOM   2259  C  "C3'" . DG  F  2 8    ? 20.454  47.760   127.180 1.00 179.61 ? 8    DG  J "C3'" 1 
ATOM   2260  O  "O3'" . DG  F  2 8    ? 21.831  47.385   127.058 1.00 184.73 ? 8    DG  J "O3'" 1 
ATOM   2261  C  "C2'" . DG  F  2 8    ? 19.900  48.225   125.846 1.00 179.12 ? 8    DG  J "C2'" 1 
ATOM   2262  C  "C1'" . DG  F  2 8    ? 19.221  46.984   125.303 1.00 176.17 ? 8    DG  J "C1'" 1 
ATOM   2263  N  N9    . DG  F  2 8    ? 18.134  47.231   124.356 1.00 175.27 ? 8    DG  J N9    1 
ATOM   2264  C  C8    . DG  F  2 8    ? 17.099  48.128   124.487 1.00 174.47 ? 8    DG  J C8    1 
ATOM   2265  N  N7    . DG  F  2 8    ? 16.289  48.128   123.463 1.00 175.01 ? 8    DG  J N7    1 
ATOM   2266  C  C5    . DG  F  2 8    ? 16.827  47.184   122.599 1.00 183.31 ? 8    DG  J C5    1 
ATOM   2267  C  C6    . DG  F  2 8    ? 16.383  46.745   121.318 1.00 183.73 ? 8    DG  J C6    1 
ATOM   2268  O  O6    . DG  F  2 8    ? 15.398  47.121   120.671 1.00 180.74 ? 8    DG  J O6    1 
ATOM   2269  N  N1    . DG  F  2 8    ? 17.223  45.766   120.794 1.00 180.39 ? 8    DG  J N1    1 
ATOM   2270  C  C2    . DG  F  2 8    ? 18.345  45.273   121.416 1.00 186.38 ? 8    DG  J C2    1 
ATOM   2271  N  N2    . DG  F  2 8    ? 19.025  44.330   120.746 1.00 189.84 ? 8    DG  J N2    1 
ATOM   2272  N  N3    . DG  F  2 8    ? 18.767  45.672   122.607 1.00 183.74 ? 8    DG  J N3    1 
ATOM   2273  C  C4    . DG  F  2 8    ? 17.968  46.624   123.134 1.00 179.21 ? 8    DG  J C4    1 
ATOM   2274  P  P     . DT  F  2 9    ? 23.006  48.449   127.341 1.00 193.31 ? 9    DT  J P     1 
ATOM   2275  O  OP1   . DT  F  2 9    ? 23.827  47.966   128.486 1.00 195.53 ? 9    DT  J OP1   1 
ATOM   2276  O  OP2   . DT  F  2 9    ? 22.424  49.816   127.366 1.00 194.90 ? 9    DT  J OP2   1 
ATOM   2277  O  "O5'" . DT  F  2 9    ? 23.946  48.360   126.061 1.00 182.72 ? 9    DT  J "O5'" 1 
ATOM   2278  C  "C5'" . DT  F  2 9    ? 24.654  47.148   125.766 1.00 180.45 ? 9    DT  J "C5'" 1 
ATOM   2279  C  "C4'" . DT  F  2 9    ? 24.753  46.978   124.271 1.00 177.70 ? 9    DT  J "C4'" 1 
ATOM   2280  O  "O4'" . DT  F  2 9    ? 23.445  47.196   123.689 1.00 173.38 ? 9    DT  J "O4'" 1 
ATOM   2281  C  "C3'" . DT  F  2 9    ? 25.704  47.964   123.583 1.00 176.94 ? 9    DT  J "C3'" 1 
ATOM   2282  O  "O3'" . DT  F  2 9    ? 26.563  47.284   122.660 1.00 180.30 ? 9    DT  J "O3'" 1 
ATOM   2283  C  "C2'" . DT  F  2 9    ? 24.774  48.942   122.885 1.00 174.66 ? 9    DT  J "C2'" 1 
ATOM   2284  C  "C1'" . DT  F  2 9    ? 23.559  48.079   122.587 1.00 174.32 ? 9    DT  J "C1'" 1 
ATOM   2285  N  N1    . DT  F  2 9    ? 22.272  48.796   122.445 1.00 169.13 ? 9    DT  J N1    1 
ATOM   2286  C  C2    . DT  F  2 9    ? 21.448  48.462   121.393 1.00 164.23 ? 9    DT  J C2    1 
ATOM   2287  O  O2    . DT  F  2 9    ? 21.732  47.614   120.564 1.00 164.34 ? 9    DT  J O2    1 
ATOM   2288  N  N3    . DT  F  2 9    ? 20.269  49.164   121.347 1.00 166.77 ? 9    DT  J N3    1 
ATOM   2289  C  C4    . DT  F  2 9    ? 19.848  50.149   122.222 1.00 170.38 ? 9    DT  J C4    1 
ATOM   2290  O  O4    . DT  F  2 9    ? 18.761  50.696   122.052 1.00 178.09 ? 9    DT  J O4    1 
ATOM   2291  C  C5    . DT  F  2 9    ? 20.764  50.450   123.299 1.00 167.68 ? 9    DT  J C5    1 
ATOM   2292  C  C7    . DT  F  2 9    ? 20.387  51.494   124.302 1.00 162.91 ? 9    DT  J C7    1 
ATOM   2293  C  C6    . DT  F  2 9    ? 21.913  49.765   123.358 1.00 169.42 ? 9    DT  J C6    1 
ATOM   2294  P  P     . DG  F  2 10   ? 27.919  47.943   122.125 1.00 182.10 ? 10   DG  J P     1 
ATOM   2295  O  OP1   . DG  F  2 10   ? 29.102  47.252   122.711 1.00 183.68 ? 10   DG  J OP1   1 
ATOM   2296  O  OP2   . DG  F  2 10   ? 27.782  49.411   122.271 1.00 186.87 ? 10   DG  J OP2   1 
ATOM   2297  O  "O5'" . DG  F  2 10   ? 27.889  47.637   120.562 1.00 186.85 ? 10   DG  J "O5'" 1 
ATOM   2298  C  "C5'" . DG  F  2 10   ? 28.962  48.068   119.705 1.00 184.14 ? 10   DG  J "C5'" 1 
ATOM   2299  C  "C4'" . DG  F  2 10   ? 28.439  48.375   118.320 1.00 181.68 ? 10   DG  J "C4'" 1 
ATOM   2300  O  "O4'" . DG  F  2 10   ? 27.037  48.732   118.397 1.00 180.97 ? 10   DG  J "O4'" 1 
ATOM   2301  C  "C3'" . DG  F  2 10   ? 29.129  49.547   117.620 1.00 179.40 ? 10   DG  J "C3'" 1 
ATOM   2302  O  "O3'" . DG  F  2 10   ? 29.276  49.271   116.217 1.00 184.09 ? 10   DG  J "O3'" 1 
ATOM   2303  C  "C2'" . DG  F  2 10   ? 28.190  50.705   117.900 1.00 172.62 ? 10   DG  J "C2'" 1 
ATOM   2304  C  "C1'" . DG  F  2 10   ? 26.840  50.015   117.827 1.00 176.81 ? 10   DG  J "C1'" 1 
ATOM   2305  N  N9    . DG  F  2 10   ? 25.751  50.660   118.551 1.00 178.75 ? 10   DG  J N9    1 
ATOM   2306  C  C8    . DG  F  2 10   ? 25.821  51.324   119.752 1.00 181.64 ? 10   DG  J C8    1 
ATOM   2307  N  N7    . DG  F  2 10   ? 24.668  51.790   120.147 1.00 178.50 ? 10   DG  J N7    1 
ATOM   2308  C  C5    . DG  F  2 10   ? 23.781  51.396   119.155 1.00 178.08 ? 10   DG  J C5    1 
ATOM   2309  C  C6    . DG  F  2 10   ? 22.385  51.611   119.035 1.00 179.01 ? 10   DG  J C6    1 
ATOM   2310  O  O6    . DG  F  2 10   ? 21.629  52.210   119.809 1.00 181.76 ? 10   DG  J O6    1 
ATOM   2311  N  N1    . DG  F  2 10   ? 21.878  51.044   117.868 1.00 178.71 ? 10   DG  J N1    1 
ATOM   2312  C  C2    . DG  F  2 10   ? 22.621  50.366   116.933 1.00 176.58 ? 10   DG  J C2    1 
ATOM   2313  N  N2    . DG  F  2 10   ? 21.951  49.897   115.869 1.00 172.73 ? 10   DG  J N2    1 
ATOM   2314  N  N3    . DG  F  2 10   ? 23.924  50.162   117.033 1.00 175.95 ? 10   DG  J N3    1 
ATOM   2315  C  C4    . DG  F  2 10   ? 24.434  50.699   118.162 1.00 176.53 ? 10   DG  J C4    1 
ATOM   2316  P  P     . DG  F  2 11   ? 30.321  50.015   115.232 1.00 179.84 ? 11   DG  J P     1 
ATOM   2317  O  OP1   . DG  F  2 11   ? 31.281  49.023   114.700 1.00 181.51 ? 11   DG  J OP1   1 
ATOM   2318  O  OP2   . DG  F  2 11   ? 30.832  51.257   115.869 1.00 195.20 ? 11   DG  J OP2   1 
ATOM   2319  O  "O5'" . DG  F  2 11   ? 29.420  50.438   113.989 1.00 182.52 ? 11   DG  J "O5'" 1 
ATOM   2320  C  "C5'" . DG  F  2 11   ? 28.705  49.443   113.237 1.00 184.40 ? 11   DG  J "C5'" 1 
ATOM   2321  C  "C4'" . DG  F  2 11   ? 27.504  50.057   112.554 1.00 184.88 ? 11   DG  J "C4'" 1 
ATOM   2322  O  "O4'" . DG  F  2 11   ? 26.619  50.641   113.541 1.00 186.26 ? 11   DG  J "O4'" 1 
ATOM   2323  C  "C3'" . DG  F  2 11   ? 27.833  51.174   111.558 1.00 184.98 ? 11   DG  J "C3'" 1 
ATOM   2324  O  "O3'" . DG  F  2 11   ? 27.101  51.009   110.336 1.00 185.49 ? 11   DG  J "O3'" 1 
ATOM   2325  C  "C2'" . DG  F  2 11   ? 27.419  52.439   112.286 1.00 184.88 ? 11   DG  J "C2'" 1 
ATOM   2326  C  "C1'" . DG  F  2 11   ? 26.268  51.958   113.150 1.00 183.17 ? 11   DG  J "C1'" 1 
ATOM   2327  N  N9    . DG  F  2 11   ? 26.054  52.744   114.359 1.00 184.40 ? 11   DG  J N9    1 
ATOM   2328  C  C8    . DG  F  2 11   ? 26.972  53.050   115.337 1.00 183.49 ? 11   DG  J C8    1 
ATOM   2329  N  N7    . DG  F  2 11   ? 26.486  53.786   116.303 1.00 180.00 ? 11   DG  J N7    1 
ATOM   2330  C  C5    . DG  F  2 11   ? 25.155  53.991   115.955 1.00 177.37 ? 11   DG  J C5    1 
ATOM   2331  C  C6    . DG  F  2 11   ? 24.119  54.706   116.603 1.00 173.21 ? 11   DG  J C6    1 
ATOM   2332  O  O6    . DG  F  2 11   ? 24.172  55.334   117.669 1.00 172.40 ? 11   DG  J O6    1 
ATOM   2333  N  N1    . DG  F  2 11   ? 22.923  54.647   115.887 1.00 171.61 ? 11   DG  J N1    1 
ATOM   2334  C  C2    . DG  F  2 11   ? 22.744  53.980   114.695 1.00 171.37 ? 11   DG  J C2    1 
ATOM   2335  N  N2    . DG  F  2 11   ? 21.518  54.031   114.147 1.00 171.70 ? 11   DG  J N2    1 
ATOM   2336  N  N3    . DG  F  2 11   ? 23.707  53.307   114.080 1.00 172.73 ? 11   DG  J N3    1 
ATOM   2337  C  C4    . DG  F  2 11   ? 24.880  53.353   114.760 1.00 181.37 ? 11   DG  J C4    1 
ATOM   2338  P  P     . DC  F  2 12   ? 27.455  51.846   109.012 1.00 176.34 ? 12   DC  J P     1 
ATOM   2339  O  OP1   . DC  F  2 12   ? 27.731  50.919   107.882 1.00 179.46 ? 12   DC  J OP1   1 
ATOM   2340  O  OP2   . DC  F  2 12   ? 28.448  52.890   109.361 1.00 181.14 ? 12   DC  J OP2   1 
ATOM   2341  O  "O5'" . DC  F  2 12   ? 26.099  52.614   108.696 1.00 180.72 ? 12   DC  J "O5'" 1 
ATOM   2342  C  "C5'" . DC  F  2 12   ? 24.857  51.903   108.526 1.00 190.39 ? 12   DC  J "C5'" 1 
ATOM   2343  C  "C4'" . DC  F  2 12   ? 23.699  52.860   108.688 1.00 187.94 ? 12   DC  J "C4'" 1 
ATOM   2344  O  "O4'" . DC  F  2 12   ? 23.797  53.489   109.991 1.00 183.24 ? 12   DC  J "O4'" 1 
ATOM   2345  C  "C3'" . DC  F  2 12   ? 23.678  54.006   107.669 1.00 190.36 ? 12   DC  J "C3'" 1 
ATOM   2346  O  "O3'" . DC  F  2 12   ? 22.344  54.375   107.272 1.00 183.90 ? 12   DC  J "O3'" 1 
ATOM   2347  C  "C2'" . DC  F  2 12   ? 24.355  55.137   108.420 1.00 188.93 ? 12   DC  J "C2'" 1 
ATOM   2348  C  "C1'" . DC  F  2 12   ? 23.839  54.902   109.832 1.00 182.55 ? 12   DC  J "C1'" 1 
ATOM   2349  N  N1    . DC  F  2 12   ? 24.639  55.464   110.935 1.00 172.88 ? 12   DC  J N1    1 
ATOM   2350  C  C2    . DC  F  2 12   ? 23.974  55.946   112.069 1.00 172.53 ? 12   DC  J C2    1 
ATOM   2351  O  O2    . DC  F  2 12   ? 22.734  55.899   112.102 1.00 171.50 ? 12   DC  J O2    1 
ATOM   2352  N  N3    . DC  F  2 12   ? 24.695  56.460   113.092 1.00 169.72 ? 12   DC  J N3    1 
ATOM   2353  C  C4    . DC  F  2 12   ? 26.028  56.495   113.016 1.00 163.82 ? 12   DC  J C4    1 
ATOM   2354  N  N4    . DC  F  2 12   ? 26.699  57.009   114.050 1.00 161.55 ? 12   DC  J N4    1 
ATOM   2355  C  C5    . DC  F  2 12   ? 26.731  56.014   111.873 1.00 165.36 ? 12   DC  J C5    1 
ATOM   2356  C  C6    . DC  F  2 12   ? 26.005  55.508   110.867 1.00 165.73 ? 12   DC  J C6    1 
ATOM   2357  P  P     . DA  F  2 13   ? 21.958  54.899   105.791 1.00 169.86 ? 13   DA  J P     1 
ATOM   2358  O  OP1   . DA  F  2 13   ? 21.482  53.709   105.039 1.00 168.02 ? 13   DA  J OP1   1 
ATOM   2359  O  OP2   . DA  F  2 13   ? 23.061  55.724   105.227 1.00 159.10 ? 13   DA  J OP2   1 
ATOM   2360  O  "O5'" . DA  F  2 13   ? 20.734  55.890   106.047 1.00 164.68 ? 13   DA  J "O5'" 1 
ATOM   2361  C  "C5'" . DA  F  2 13   ? 19.410  55.404   106.342 1.00 166.94 ? 13   DA  J "C5'" 1 
ATOM   2362  C  "C4'" . DA  F  2 13   ? 18.597  56.479   107.026 1.00 171.78 ? 13   DA  J "C4'" 1 
ATOM   2363  O  "O4'" . DA  F  2 13   ? 19.193  56.789   108.311 1.00 177.02 ? 13   DA  J "O4'" 1 
ATOM   2364  C  "C3'" . DA  F  2 13   ? 18.510  57.804   106.266 1.00 169.80 ? 13   DA  J "C3'" 1 
ATOM   2365  O  "O3'" . DA  F  2 13   ? 17.207  58.392   106.392 1.00 171.53 ? 13   DA  J "O3'" 1 
ATOM   2366  C  "C2'" . DA  F  2 13   ? 19.566  58.663   106.937 1.00 171.40 ? 13   DA  J "C2'" 1 
ATOM   2367  C  "C1'" . DA  F  2 13   ? 19.551  58.163   108.373 1.00 172.71 ? 13   DA  J "C1'" 1 
ATOM   2368  N  N9    . DA  F  2 13   ? 20.842  58.256   109.053 1.00 169.40 ? 13   DA  J N9    1 
ATOM   2369  C  C8    . DA  F  2 13   ? 22.042  57.756   108.614 1.00 169.67 ? 13   DA  J C8    1 
ATOM   2370  N  N7    . DA  F  2 13   ? 23.041  57.984   109.432 1.00 176.48 ? 13   DA  J N7    1 
ATOM   2371  C  C5    . DA  F  2 13   ? 22.460  58.682   110.481 1.00 175.05 ? 13   DA  J C5    1 
ATOM   2372  C  C6    . DA  F  2 13   ? 22.988  59.217   111.670 1.00 174.56 ? 13   DA  J C6    1 
ATOM   2373  N  N6    . DA  F  2 13   ? 24.275  59.129   112.012 1.00 180.44 ? 13   DA  J N6    1 
ATOM   2374  N  N1    . DA  F  2 13   ? 22.138  59.857   112.504 1.00 168.67 ? 13   DA  J N1    1 
ATOM   2375  C  C2    . DA  F  2 13   ? 20.850  59.949   112.159 1.00 164.30 ? 13   DA  J C2    1 
ATOM   2376  N  N3    . DA  F  2 13   ? 20.233  59.482   111.073 1.00 167.18 ? 13   DA  J N3    1 
ATOM   2377  C  C4    . DA  F  2 13   ? 21.105  58.856   110.263 1.00 172.86 ? 13   DA  J C4    1 
ATOM   2378  P  P     . DC  F  2 14   ? 16.681  59.605   105.473 1.00 170.13 ? 14   DC  J P     1 
ATOM   2379  O  OP1   . DC  F  2 14   ? 15.222  59.435   105.243 1.00 161.39 ? 14   DC  J OP1   1 
ATOM   2380  O  OP2   . DC  F  2 14   ? 17.598  59.791   104.311 1.00 163.15 ? 14   DC  J OP2   1 
ATOM   2381  O  "O5'" . DC  F  2 14   ? 16.865  60.860   106.436 1.00 169.08 ? 14   DC  J "O5'" 1 
ATOM   2382  C  "C5'" . DC  F  2 14   ? 15.875  61.204   107.417 1.00 167.43 ? 14   DC  J "C5'" 1 
ATOM   2383  C  "C4'" . DC  F  2 14   ? 16.416  62.273   108.338 1.00 175.63 ? 14   DC  J "C4'" 1 
ATOM   2384  O  "O4'" . DC  F  2 14   ? 17.740  61.903   108.795 1.00 179.84 ? 14   DC  J "O4'" 1 
ATOM   2385  C  "C3'" . DC  F  2 14   ? 16.555  63.665   107.710 1.00 178.89 ? 14   DC  J "C3'" 1 
ATOM   2386  O  "O3'" . DC  F  2 14   ? 16.022  64.660   108.593 1.00 184.22 ? 14   DC  J "O3'" 1 
ATOM   2387  C  "C2'" . DC  F  2 14   ? 18.053  63.823   107.497 1.00 175.93 ? 14   DC  J "C2'" 1 
ATOM   2388  C  "C1'" . DC  F  2 14   ? 18.630  63.000   108.636 1.00 175.62 ? 14   DC  J "C1'" 1 
ATOM   2389  N  N1    . DC  F  2 14   ? 19.994  62.461   108.434 1.00 171.97 ? 14   DC  J N1    1 
ATOM   2390  C  C2    . DC  F  2 14   ? 20.888  62.464   109.516 1.00 173.45 ? 14   DC  J C2    1 
ATOM   2391  O  O2    . DC  F  2 14   ? 20.519  62.943   110.602 1.00 166.44 ? 14   DC  J O2    1 
ATOM   2392  N  N3    . DC  F  2 14   ? 22.134  61.960   109.344 1.00 171.33 ? 14   DC  J N3    1 
ATOM   2393  C  C4    . DC  F  2 14   ? 22.493  61.456   108.158 1.00 163.38 ? 14   DC  J C4    1 
ATOM   2394  N  N4    . DC  F  2 14   ? 23.731  60.970   108.034 1.00 166.38 ? 14   DC  J N4    1 
ATOM   2395  C  C5    . DC  F  2 14   ? 21.600  61.431   107.047 1.00 154.82 ? 14   DC  J C5    1 
ATOM   2396  C  C6    . DC  F  2 14   ? 20.374  61.942   107.225 1.00 160.34 ? 14   DC  J C6    1 
ATOM   2397  P  P     . DT  F  2 15   ? 15.931  66.203   108.173 1.00 184.73 ? 15   DT  J P     1 
ATOM   2398  O  OP1   . DT  F  2 15   ? 14.594  66.684   108.604 1.00 188.39 ? 15   DT  J OP1   1 
ATOM   2399  O  OP2   . DT  F  2 15   ? 16.358  66.380   106.758 1.00 187.70 ? 15   DT  J OP2   1 
ATOM   2400  O  "O5'" . DT  F  2 15   ? 17.036  66.890   109.094 1.00 188.22 ? 15   DT  J "O5'" 1 
ATOM   2401  C  "C5'" . DT  F  2 15   ? 17.220  68.320   109.085 1.00 180.52 ? 15   DT  J "C5'" 1 
ATOM   2402  C  "C4'" . DT  F  2 15   ? 18.373  68.721   109.980 1.00 174.42 ? 15   DT  J "C4'" 1 
ATOM   2403  O  "O4'" . DT  F  2 15   ? 19.373  67.675   110.016 1.00 165.92 ? 15   DT  J "O4'" 1 
ATOM   2404  C  "C3'" . DT  F  2 15   ? 19.106  69.989   109.542 1.00 174.81 ? 15   DT  J "C3'" 1 
ATOM   2405  O  "O3'" . DT  F  2 15   ? 19.487  70.797   110.659 1.00 173.79 ? 15   DT  J "O3'" 1 
ATOM   2406  C  "C2'" . DT  F  2 15   ? 20.320  69.471   108.790 1.00 172.66 ? 15   DT  J "C2'" 1 
ATOM   2407  C  "C1'" . DT  F  2 15   ? 20.592  68.112   109.419 1.00 166.56 ? 15   DT  J "C1'" 1 
ATOM   2408  N  N1    . DT  F  2 15   ? 21.035  67.064   108.471 1.00 164.50 ? 15   DT  J N1    1 
ATOM   2409  C  C2    . DT  F  2 15   ? 22.051  66.227   108.875 1.00 164.09 ? 15   DT  J C2    1 
ATOM   2410  O  O2    . DT  F  2 15   ? 22.614  66.334   109.953 1.00 168.76 ? 15   DT  J O2    1 
ATOM   2411  N  N3    . DT  F  2 15   ? 22.406  65.271   107.952 1.00 155.84 ? 15   DT  J N3    1 
ATOM   2412  C  C4    . DT  F  2 15   ? 21.846  65.065   106.705 1.00 148.15 ? 15   DT  J C4    1 
ATOM   2413  O  O4    . DT  F  2 15   ? 22.261  64.157   105.991 1.00 144.13 ? 15   DT  J O4    1 
ATOM   2414  C  C5    . DT  F  2 15   ? 20.779  65.974   106.350 1.00 150.68 ? 15   DT  J C5    1 
ATOM   2415  C  C7    . DT  F  2 15   ? 20.107  65.821   105.021 1.00 149.77 ? 15   DT  J C7    1 
ATOM   2416  C  C6    . DT  F  2 15   ? 20.428  66.912   107.240 1.00 155.97 ? 15   DT  J C6    1 
ATOM   2417  P  P     . DG  F  2 16   ? 19.575  72.379   110.445 1.00 164.13 ? 16   DG  J P     1 
ATOM   2418  O  OP1   . DG  F  2 16   ? 18.233  72.941   110.749 1.00 160.28 ? 16   DG  J OP1   1 
ATOM   2419  O  OP2   . DG  F  2 16   ? 20.196  72.623   109.119 1.00 153.40 ? 16   DG  J OP2   1 
ATOM   2420  O  "O5'" . DG  F  2 16   ? 20.603  72.832   111.573 1.00 170.02 ? 16   DG  J "O5'" 1 
ATOM   2421  C  "C5'" . DG  F  2 16   ? 20.765  74.222   111.918 1.00 170.96 ? 16   DG  J "C5'" 1 
ATOM   2422  C  "C4'" . DG  F  2 16   ? 22.155  74.461   112.453 1.00 169.51 ? 16   DG  J "C4'" 1 
ATOM   2423  O  "O4'" . DG  F  2 16   ? 23.068  73.529   111.827 1.00 165.39 ? 16   DG  J "O4'" 1 
ATOM   2424  C  "C3'" . DG  F  2 16   ? 22.721  75.847   112.159 1.00 173.99 ? 16   DG  J "C3'" 1 
ATOM   2425  O  "O3'" . DG  F  2 16   ? 23.583  76.256   113.230 1.00 172.36 ? 16   DG  J "O3'" 1 
ATOM   2426  C  "C2'" . DG  F  2 16   ? 23.437  75.641   110.836 1.00 175.19 ? 16   DG  J "C2'" 1 
ATOM   2427  C  "C1'" . DG  F  2 16   ? 23.974  74.222   110.973 1.00 175.52 ? 16   DG  J "C1'" 1 
ATOM   2428  N  N9    . DG  F  2 16   ? 24.098  73.451   109.737 1.00 179.97 ? 16   DG  J N9    1 
ATOM   2429  C  C8    . DG  F  2 16   ? 23.451  73.663   108.544 1.00 176.66 ? 16   DG  J C8    1 
ATOM   2430  N  N7    . DG  F  2 16   ? 23.765  72.787   107.629 1.00 181.69 ? 16   DG  J N7    1 
ATOM   2431  C  C5    . DG  F  2 16   ? 24.663  71.936   108.259 1.00 178.59 ? 16   DG  J C5    1 
ATOM   2432  C  C6    . DG  F  2 16   ? 25.345  70.790   107.769 1.00 179.93 ? 16   DG  J C6    1 
ATOM   2433  O  O6    . DG  F  2 16   ? 25.287  70.281   106.643 1.00 176.80 ? 16   DG  J O6    1 
ATOM   2434  N  N1    . DG  F  2 16   ? 26.169  70.233   108.740 1.00 179.23 ? 16   DG  J N1    1 
ATOM   2435  C  C2    . DG  F  2 16   ? 26.316  70.711   110.020 1.00 175.19 ? 16   DG  J C2    1 
ATOM   2436  N  N2    . DG  F  2 16   ? 27.162  70.036   110.811 1.00 176.14 ? 16   DG  J N2    1 
ATOM   2437  N  N3    . DG  F  2 16   ? 25.683  71.773   110.490 1.00 169.16 ? 16   DG  J N3    1 
ATOM   2438  C  C4    . DG  F  2 16   ? 24.879  72.333   109.561 1.00 178.13 ? 16   DG  J C4    1 
ATOM   2439  P  P     . DG  F  2 17   ? 24.077  77.777   113.386 1.00 176.62 ? 17   DG  J P     1 
ATOM   2440  O  OP1   . DG  F  2 17   ? 23.532  78.281   114.667 1.00 177.52 ? 17   DG  J OP1   1 
ATOM   2441  O  OP2   . DG  F  2 17   ? 23.800  78.523   112.131 1.00 180.84 ? 17   DG  J OP2   1 
ATOM   2442  O  "O5'" . DG  F  2 17   ? 25.654  77.623   113.551 1.00 174.60 ? 17   DG  J "O5'" 1 
ATOM   2443  C  "C5'" . DG  F  2 17   ? 26.198  76.738   114.545 1.00 175.54 ? 17   DG  J "C5'" 1 
ATOM   2444  C  "C4'" . DG  F  2 17   ? 27.439  76.058   114.020 1.00 175.63 ? 17   DG  J "C4'" 1 
ATOM   2445  O  "O4'" . DG  F  2 17   ? 27.140  75.310   112.820 1.00 181.76 ? 17   DG  J "O4'" 1 
ATOM   2446  C  "C3'" . DG  F  2 17   ? 28.581  77.011   113.655 1.00 177.45 ? 17   DG  J "C3'" 1 
ATOM   2447  O  "O3'" . DG  F  2 17   ? 29.712  76.700   114.476 1.00 175.89 ? 17   DG  J "O3'" 1 
ATOM   2448  C  "C2'" . DG  F  2 17   ? 28.837  76.754   112.176 1.00 178.22 ? 17   DG  J "C2'" 1 
ATOM   2449  C  "C1'" . DG  F  2 17   ? 28.265  75.366   111.963 1.00 181.18 ? 17   DG  J "C1'" 1 
ATOM   2450  N  N9    . DG  F  2 17   ? 27.811  75.066   110.606 1.00 181.62 ? 17   DG  J N9    1 
ATOM   2451  C  C8    . DG  F  2 17   ? 26.926  75.803   109.856 1.00 182.96 ? 17   DG  J C8    1 
ATOM   2452  N  N7    . DG  F  2 17   ? 26.688  75.281   108.683 1.00 182.57 ? 17   DG  J N7    1 
ATOM   2453  C  C5    . DG  F  2 17   ? 27.461  74.128   108.656 1.00 181.09 ? 17   DG  J C5    1 
ATOM   2454  C  C6    . DG  F  2 17   ? 27.608  73.145   107.643 1.00 180.80 ? 17   DG  J C6    1 
ATOM   2455  O  O6    . DG  F  2 17   ? 27.063  73.094   106.535 1.00 176.47 ? 17   DG  J O6    1 
ATOM   2456  N  N1    . DG  F  2 17   ? 28.482  72.133   108.033 1.00 183.54 ? 17   DG  J N1    1 
ATOM   2457  C  C2    . DG  F  2 17   ? 29.136  72.077   109.241 1.00 180.82 ? 17   DG  J C2    1 
ATOM   2458  N  N2    . DG  F  2 17   ? 29.940  71.018   109.431 1.00 174.99 ? 17   DG  J N2    1 
ATOM   2459  N  N3    . DG  F  2 17   ? 29.004  72.985   110.196 1.00 185.76 ? 17   DG  J N3    1 
ATOM   2460  C  C4    . DG  F  2 17   ? 28.156  73.976   109.838 1.00 183.93 ? 17   DG  J C4    1 
ATOM   2461  P  P     . DC  F  2 18   ? 30.973  77.670   114.586 1.00 174.57 ? 18   DC  J P     1 
ATOM   2462  O  OP1   . DC  F  2 18   ? 31.170  78.086   116.007 1.00 163.26 ? 18   DC  J OP1   1 
ATOM   2463  O  OP2   . DC  F  2 18   ? 30.795  78.708   113.533 1.00 180.08 ? 18   DC  J OP2   1 
ATOM   2464  O  "O5'" . DC  F  2 18   ? 32.175  76.725   114.138 1.00 168.81 ? 18   DC  J "O5'" 1 
ATOM   2465  C  "C5'" . DC  F  2 18   ? 32.167  75.303   114.380 1.00 168.55 ? 18   DC  J "C5'" 1 
ATOM   2466  C  "C4'" . DC  F  2 18   ? 33.046  74.586   113.381 1.00 173.40 ? 18   DC  J "C4'" 1 
ATOM   2467  O  "O4'" . DC  F  2 18   ? 32.339  74.411   112.127 1.00 177.36 ? 18   DC  J "O4'" 1 
ATOM   2468  C  "C3'" . DC  F  2 18   ? 34.353  75.303   113.030 1.00 180.89 ? 18   DC  J "C3'" 1 
ATOM   2469  O  "O3'" . DC  F  2 18   ? 35.434  74.367   112.937 1.00 184.76 ? 18   DC  J "O3'" 1 
ATOM   2470  C  "C2'" . DC  F  2 18   ? 34.059  75.938   111.683 1.00 177.75 ? 18   DC  J "C2'" 1 
ATOM   2471  C  "C1'" . DC  F  2 18   ? 33.129  74.913   111.056 1.00 176.34 ? 18   DC  J "C1'" 1 
ATOM   2472  N  N1    . DC  F  2 18   ? 32.215  75.401   110.001 1.00 174.68 ? 18   DC  J N1    1 
ATOM   2473  C  C2    . DC  F  2 18   ? 31.830  74.512   108.991 1.00 170.82 ? 18   DC  J C2    1 
ATOM   2474  O  O2    . DC  F  2 18   ? 32.274  73.352   109.011 1.00 174.19 ? 18   DC  J O2    1 
ATOM   2475  N  N3    . DC  F  2 18   ? 30.990  74.936   108.019 1.00 168.40 ? 18   DC  J N3    1 
ATOM   2476  C  C4    . DC  F  2 18   ? 30.532  76.189   108.034 1.00 176.96 ? 18   DC  J C4    1 
ATOM   2477  N  N4    . DC  F  2 18   ? 29.703  76.563   107.055 1.00 174.73 ? 18   DC  J N4    1 
ATOM   2478  C  C5    . DC  F  2 18   ? 30.902  77.115   109.054 1.00 180.32 ? 18   DC  J C5    1 
ATOM   2479  C  C6    . DC  F  2 18   ? 31.739  76.683   110.008 1.00 178.18 ? 18   DC  J C6    1 
ATOM   2480  P  P     . DC  F  2 19   ? 36.973  74.820   113.002 1.00 184.28 ? 19   DC  J P     1 
ATOM   2481  O  OP1   . DC  F  2 19   ? 37.623  74.090   114.125 1.00 169.54 ? 19   DC  J OP1   1 
ATOM   2482  O  OP2   . DC  F  2 19   ? 37.075  76.303   112.924 1.00 185.64 ? 19   DC  J OP2   1 
ATOM   2483  O  "O5'" . DC  F  2 19   ? 37.531  74.240   111.630 1.00 175.38 ? 19   DC  J "O5'" 1 
ATOM   2484  C  "C5'" . DC  F  2 19   ? 37.238  72.890   111.227 1.00 170.98 ? 19   DC  J "C5'" 1 
ATOM   2485  C  "C4'" . DC  F  2 19   ? 37.398  72.762   109.732 1.00 166.99 ? 19   DC  J "C4'" 1 
ATOM   2486  O  "O4'" . DC  F  2 19   ? 36.295  73.422   109.061 1.00 169.80 ? 19   DC  J "O4'" 1 
ATOM   2487  C  "C3'" . DC  F  2 19   ? 38.673  73.406   109.185 1.00 171.75 ? 19   DC  J "C3'" 1 
ATOM   2488  O  "O3'" . DC  F  2 19   ? 39.293  72.508   108.263 1.00 174.72 ? 19   DC  J "O3'" 1 
ATOM   2489  C  "C2'" . DC  F  2 19   ? 38.178  74.682   108.522 1.00 173.64 ? 19   DC  J "C2'" 1 
ATOM   2490  C  "C1'" . DC  F  2 19   ? 36.806  74.259   108.035 1.00 172.78 ? 19   DC  J "C1'" 1 
ATOM   2491  N  N1    . DC  F  2 19   ? 35.832  75.345   107.793 1.00 166.77 ? 19   DC  J N1    1 
ATOM   2492  C  C2    . DC  F  2 19   ? 35.031  75.292   106.644 1.00 165.00 ? 19   DC  J C2    1 
ATOM   2493  O  O2    . DC  F  2 19   ? 35.166  74.338   105.864 1.00 168.09 ? 19   DC  J O2    1 
ATOM   2494  N  N3    . DC  F  2 19   ? 34.131  76.277   106.418 1.00 165.37 ? 19   DC  J N3    1 
ATOM   2495  C  C4    . DC  F  2 19   ? 34.018  77.289   107.282 1.00 162.88 ? 19   DC  J C4    1 
ATOM   2496  N  N4    . DC  F  2 19   ? 33.120  78.241   107.019 1.00 156.66 ? 19   DC  J N4    1 
ATOM   2497  C  C5    . DC  F  2 19   ? 34.822  77.370   108.457 1.00 164.14 ? 19   DC  J C5    1 
ATOM   2498  C  C6    . DC  F  2 19   ? 35.710  76.389   108.668 1.00 165.22 ? 19   DC  J C6    1 
ATOM   2499  P  P     . DG  F  2 20   ? 40.753  72.808   107.686 1.00 180.67 ? 20   DG  J P     1 
ATOM   2500  O  OP1   . DG  F  2 20   ? 41.580  71.629   108.054 1.00 179.90 ? 20   DG  J OP1   1 
ATOM   2501  O  OP2   . DG  F  2 20   ? 41.186  74.169   108.129 1.00 178.81 ? 20   DG  J OP2   1 
ATOM   2502  O  "O5'" . DG  F  2 20   ? 40.504  72.833   106.109 1.00 178.86 ? 20   DG  J "O5'" 1 
ATOM   2503  C  "C5'" . DG  F  2 20   ? 39.579  71.921   105.469 1.00 170.83 ? 20   DG  J "C5'" 1 
ATOM   2504  C  "C4'" . DG  F  2 20   ? 39.304  72.319   104.036 1.00 165.68 ? 20   DG  J "C4'" 1 
ATOM   2505  O  "O4'" . DG  F  2 20   ? 38.269  73.329   104.012 1.00 161.16 ? 20   DG  J "O4'" 1 
ATOM   2506  C  "C3'" . DG  F  2 20   ? 40.483  72.908   103.258 1.00 171.85 ? 20   DG  J "C3'" 1 
ATOM   2507  O  "O3'" . DG  F  2 20   ? 40.427  72.450   101.899 1.00 178.51 ? 20   DG  J "O3'" 1 
ATOM   2508  C  "C2'" . DG  F  2 20   ? 40.266  74.407   103.393 1.00 169.63 ? 20   DG  J "C2'" 1 
ATOM   2509  C  "C1'" . DG  F  2 20   ? 38.749  74.502   103.366 1.00 166.63 ? 20   DG  J "C1'" 1 
ATOM   2510  N  N9    . DG  F  2 20   ? 38.196  75.657   104.065 1.00 163.18 ? 20   DG  J N9    1 
ATOM   2511  C  C8    . DG  F  2 20   ? 38.619  76.182   105.262 1.00 158.46 ? 20   DG  J C8    1 
ATOM   2512  N  N7    . DG  F  2 20   ? 37.927  77.223   105.638 1.00 158.64 ? 20   DG  J N7    1 
ATOM   2513  C  C5    . DG  F  2 20   ? 36.990  77.396   104.628 1.00 162.26 ? 20   DG  J C5    1 
ATOM   2514  C  C6    . DG  F  2 20   ? 35.968  78.370   104.479 1.00 163.23 ? 20   DG  J C6    1 
ATOM   2515  O  O6    . DG  F  2 20   ? 35.678  79.305   105.235 1.00 160.19 ? 20   DG  J O6    1 
ATOM   2516  N  N1    . DG  F  2 20   ? 35.248  78.180   103.302 1.00 163.80 ? 20   DG  J N1    1 
ATOM   2517  C  C2    . DG  F  2 20   ? 35.485  77.187   102.383 1.00 163.36 ? 20   DG  J C2    1 
ATOM   2518  N  N2    . DG  F  2 20   ? 34.683  77.170   101.307 1.00 167.29 ? 20   DG  J N2    1 
ATOM   2519  N  N3    . DG  F  2 20   ? 36.435  76.274   102.510 1.00 162.66 ? 20   DG  J N3    1 
ATOM   2520  C  C4    . DG  F  2 20   ? 37.143  76.437   103.649 1.00 163.72 ? 20   DG  J C4    1 
ATOM   2521  P  P     . DT  F  2 21   ? 41.082  73.206   100.636 1.00 183.30 ? 21   DT  J P     1 
ATOM   2522  O  OP1   . DT  F  2 21   ? 41.068  72.277   99.473  1.00 173.93 ? 21   DT  J OP1   1 
ATOM   2523  O  OP2   . DT  F  2 21   ? 42.343  73.904   101.018 1.00 176.55 ? 21   DT  J OP2   1 
ATOM   2524  O  "O5'" . DT  F  2 21   ? 39.997  74.338   100.359 1.00 167.96 ? 21   DT  J "O5'" 1 
ATOM   2525  C  "C5'" . DT  F  2 21   ? 39.988  75.055   99.122  1.00 164.13 ? 21   DT  J "C5'" 1 
ATOM   2526  C  "C4'" . DT  F  2 21   ? 38.606  74.998   98.517  1.00 168.14 ? 21   DT  J "C4'" 1 
ATOM   2527  O  "O4'" . DT  F  2 21   ? 37.725  75.876   99.258  1.00 168.77 ? 21   DT  J "O4'" 1 
ATOM   2528  C  "C3'" . DT  F  2 21   ? 38.535  75.436   97.053  1.00 176.24 ? 21   DT  J "C3'" 1 
ATOM   2529  O  "O3'" . DT  F  2 21   ? 37.766  74.506   96.275  1.00 178.84 ? 21   DT  J "O3'" 1 
ATOM   2530  C  "C2'" . DT  F  2 21   ? 37.919  76.825   97.117  1.00 173.49 ? 21   DT  J "C2'" 1 
ATOM   2531  C  "C1'" . DT  F  2 21   ? 37.084  76.799   98.389  1.00 168.64 ? 21   DT  J "C1'" 1 
ATOM   2532  N  N1    . DT  F  2 21   ? 36.995  78.103   99.093  1.00 162.38 ? 21   DT  J N1    1 
ATOM   2533  C  C2    . DT  F  2 21   ? 35.821  78.817   99.032  1.00 154.19 ? 21   DT  J C2    1 
ATOM   2534  O  O2    . DT  F  2 21   ? 34.826  78.420   98.449  1.00 151.16 ? 21   DT  J O2    1 
ATOM   2535  N  N3    . DT  F  2 21   ? 35.839  80.010   99.709  1.00 155.83 ? 21   DT  J N3    1 
ATOM   2536  C  C4    . DT  F  2 21   ? 36.893  80.549   100.422 1.00 161.26 ? 21   DT  J C4    1 
ATOM   2537  O  O4    . DT  F  2 21   ? 36.760  81.635   100.981 1.00 171.85 ? 21   DT  J O4    1 
ATOM   2538  C  C5    . DT  F  2 21   ? 38.097  79.749   100.442 1.00 158.86 ? 21   DT  J C5    1 
ATOM   2539  C  C7    . DT  F  2 21   ? 39.298  80.257   101.177 1.00 146.33 ? 21   DT  J C7    1 
ATOM   2540  C  C6    . DT  F  2 21   ? 38.088  78.583   99.785  1.00 164.16 ? 21   DT  J C6    1 
ATOM   2541  P  P     . DC  F  2 22   ? 37.936  74.349   94.687  1.00 177.52 ? 22   DC  J P     1 
ATOM   2542  O  OP1   . DC  F  2 22   ? 37.365  73.017   94.344  1.00 176.54 ? 22   DC  J OP1   1 
ATOM   2543  O  OP2   . DC  F  2 22   ? 39.325  74.678   94.279  1.00 165.46 ? 22   DC  J OP2   1 
ATOM   2544  O  "O5'" . DC  F  2 22   ? 36.962  75.478   94.123  1.00 172.79 ? 22   DC  J "O5'" 1 
ATOM   2545  C  "C5'" . DC  F  2 22   ? 35.541  75.433   94.376  1.00 163.79 ? 22   DC  J "C5'" 1 
ATOM   2546  C  "C4'" . DC  F  2 22   ? 34.887  76.742   93.997  1.00 161.11 ? 22   DC  J "C4'" 1 
ATOM   2547  O  "O4'" . DC  F  2 22   ? 35.159  77.745   95.005  1.00 162.53 ? 22   DC  J "O4'" 1 
ATOM   2548  C  "C3'" . DC  F  2 22   ? 35.345  77.342   92.663  1.00 164.29 ? 22   DC  J "C3'" 1 
ATOM   2549  O  "O3'" . DC  F  2 22   ? 34.212  77.584   91.827  1.00 164.91 ? 22   DC  J "O3'" 1 
ATOM   2550  C  "C2'" . DC  F  2 22   ? 36.048  78.636   93.050  1.00 161.65 ? 22   DC  J "C2'" 1 
ATOM   2551  C  "C1'" . DC  F  2 22   ? 35.390  78.991   94.369  1.00 159.95 ? 22   DC  J "C1'" 1 
ATOM   2552  N  N1    . DC  F  2 22   ? 36.170  79.839   95.294  1.00 157.12 ? 22   DC  J N1    1 
ATOM   2553  C  C2    . DC  F  2 22   ? 35.511  80.857   95.998  1.00 160.17 ? 22   DC  J C2    1 
ATOM   2554  O  O2    . DC  F  2 22   ? 34.299  81.034   95.807  1.00 154.38 ? 22   DC  J O2    1 
ATOM   2555  N  N3    . DC  F  2 22   ? 36.212  81.622   96.866  1.00 162.24 ? 22   DC  J N3    1 
ATOM   2556  C  C4    . DC  F  2 22   ? 37.516  81.400   97.048  1.00 170.46 ? 22   DC  J C4    1 
ATOM   2557  N  N4    . DC  F  2 22   ? 38.165  82.180   97.914  1.00 177.47 ? 22   DC  J N4    1 
ATOM   2558  C  C5    . DC  F  2 22   ? 38.209  80.366   96.354  1.00 168.71 ? 22   DC  J C5    1 
ATOM   2559  C  C6    . DC  F  2 22   ? 37.504  79.615   95.497  1.00 163.39 ? 22   DC  J C6    1 
ATOM   2560  P  P     . DG  F  2 23   ? 34.331  77.808   90.241  1.00 172.11 ? 23   DG  J P     1 
ATOM   2561  O  OP1   . DG  F  2 23   ? 33.548  76.708   89.612  1.00 167.19 ? 23   DG  J OP1   1 
ATOM   2562  O  OP2   . DG  F  2 23   ? 35.738  78.062   89.810  1.00 158.03 ? 23   DG  J OP2   1 
ATOM   2563  O  "O5'" . DG  F  2 23   ? 33.529  79.169   90.042  1.00 169.33 ? 23   DG  J "O5'" 1 
ATOM   2564  C  "C5'" . DG  F  2 23   ? 32.316  79.435   90.771  1.00 161.10 ? 23   DG  J "C5'" 1 
ATOM   2565  C  "C4'" . DG  F  2 23   ? 32.068  80.924   90.841  1.00 156.61 ? 23   DG  J "C4'" 1 
ATOM   2566  O  "O4'" . DG  F  2 23   ? 32.925  81.515   91.845  1.00 155.89 ? 23   DG  J "O4'" 1 
ATOM   2567  C  "C3'" . DG  F  2 23   ? 32.342  81.699   89.548  1.00 151.10 ? 23   DG  J "C3'" 1 
ATOM   2568  O  "O3'" . DG  F  2 23   ? 31.363  82.723   89.379  1.00 147.99 ? 23   DG  J "O3'" 1 
ATOM   2569  C  "C2'" . DG  F  2 23   ? 33.683  82.355   89.806  1.00 153.61 ? 23   DG  J "C2'" 1 
ATOM   2570  C  "C1'" . DG  F  2 23   ? 33.579  82.648   91.289  1.00 162.45 ? 23   DG  J "C1'" 1 
ATOM   2571  N  N9    . DG  F  2 23   ? 34.844  82.830   91.998  1.00 169.39 ? 23   DG  J N9    1 
ATOM   2572  C  C8    . DG  F  2 23   ? 36.030  82.174   91.770  1.00 169.45 ? 23   DG  J C8    1 
ATOM   2573  N  N7    . DG  F  2 23   ? 36.983  82.542   92.582  1.00 169.20 ? 23   DG  J N7    1 
ATOM   2574  C  C5    . DG  F  2 23   ? 36.392  83.498   93.396  1.00 171.51 ? 23   DG  J C5    1 
ATOM   2575  C  C6    . DG  F  2 23   ? 36.932  84.254   94.469  1.00 174.84 ? 23   DG  J C6    1 
ATOM   2576  O  O6    . DG  F  2 23   ? 38.082  84.231   94.925  1.00 172.40 ? 23   DG  J O6    1 
ATOM   2577  N  N1    . DG  F  2 23   ? 35.982  85.105   95.025  1.00 173.29 ? 23   DG  J N1    1 
ATOM   2578  C  C2    . DG  F  2 23   ? 34.682  85.224   94.597  1.00 172.33 ? 23   DG  J C2    1 
ATOM   2579  N  N2    . DG  F  2 23   ? 33.919  86.109   95.258  1.00 170.99 ? 23   DG  J N2    1 
ATOM   2580  N  N3    . DG  F  2 23   ? 34.165  84.523   93.600  1.00 167.39 ? 23   DG  J N3    1 
ATOM   2581  C  C4    . DG  F  2 23   ? 35.070  83.686   93.049  1.00 168.00 ? 23   DG  J C4    1 
ATOM   2582  P  P     . DT  F  2 24   ? 30.958  83.307   87.951  1.00 152.68 ? 24   DT  J P     1 
ATOM   2583  O  OP1   . DT  F  2 24   ? 29.715  82.648   87.460  1.00 148.83 ? 24   DT  J OP1   1 
ATOM   2584  O  OP2   . DT  F  2 24   ? 32.175  83.321   87.099  1.00 158.78 ? 24   DT  J OP2   1 
ATOM   2585  O  "O5'" . DT  F  2 24   ? 30.559  84.811   88.299  1.00 150.61 ? 24   DT  J "O5'" 1 
ATOM   2586  C  "C5'" . DT  F  2 24   ? 29.973  85.158   89.567  1.00 141.10 ? 24   DT  J "C5'" 1 
ATOM   2587  C  "C4'" . DT  F  2 24   ? 30.631  86.400   90.121  1.00 142.36 ? 24   DT  J "C4'" 1 
ATOM   2588  O  "O4'" . DT  F  2 24   ? 31.944  86.093   90.644  1.00 139.77 ? 24   DT  J "O4'" 1 
ATOM   2589  C  "C3'" . DT  F  2 24   ? 30.832  87.527   89.103  1.00 146.57 ? 24   DT  J "C3'" 1 
ATOM   2590  O  "O3'" . DT  F  2 24   ? 30.087  88.675   89.503  1.00 159.05 ? 24   DT  J "O3'" 1 
ATOM   2591  C  "C2'" . DT  F  2 24   ? 32.320  87.834   89.152  1.00 146.18 ? 24   DT  J "C2'" 1 
ATOM   2592  C  "C1'" . DT  F  2 24   ? 32.758  87.238   90.473  1.00 145.69 ? 24   DT  J "C1'" 1 
ATOM   2593  N  N1    . DT  F  2 24   ? 34.172  86.808   90.524  1.00 148.41 ? 24   DT  J N1    1 
ATOM   2594  C  C2    . DT  F  2 24   ? 35.015  87.388   91.448  1.00 148.76 ? 24   DT  J C2    1 
ATOM   2595  O  O2    . DT  F  2 24   ? 34.659  88.260   92.224  1.00 146.57 ? 24   DT  J O2    1 
ATOM   2596  N  N3    . DT  F  2 24   ? 36.300  86.907   91.431  1.00 147.19 ? 24   DT  J N3    1 
ATOM   2597  C  C4    . DT  F  2 24   ? 36.815  85.932   90.597  1.00 148.03 ? 24   DT  J C4    1 
ATOM   2598  O  O4    . DT  F  2 24   ? 37.994  85.607   90.694  1.00 154.17 ? 24   DT  J O4    1 
ATOM   2599  C  C5    . DT  F  2 24   ? 35.878  85.372   89.650  1.00 146.58 ? 24   DT  J C5    1 
ATOM   2600  C  C7    . DT  F  2 24   ? 36.346  84.310   88.706  1.00 144.88 ? 24   DT  J C7    1 
ATOM   2601  C  C6    . DT  F  2 24   ? 34.621  85.834   89.660  1.00 148.29 ? 24   DT  J C6    1 
ATOM   2602  P  P     . DT  F  2 25   ? 29.804  89.875   88.493  1.00 168.85 ? 25   DT  J P     1 
ATOM   2603  O  OP1   . DT  F  2 25   ? 28.334  90.132   88.483  1.00 177.26 ? 25   DT  J OP1   1 
ATOM   2604  O  OP2   . DT  F  2 25   ? 30.534  89.636   87.218  1.00 171.63 ? 25   DT  J OP2   1 
ATOM   2605  O  "O5'" . DT  F  2 25   ? 30.501  91.109   89.212  1.00 164.18 ? 25   DT  J "O5'" 1 
ATOM   2606  C  "C5'" . DT  F  2 25   ? 30.464  91.254   90.640  1.00 160.10 ? 25   DT  J "C5'" 1 
ATOM   2607  C  "C4'" . DT  F  2 25   ? 31.685  92.021   91.083  1.00 162.07 ? 25   DT  J "C4'" 1 
ATOM   2608  O  "O4'" . DT  F  2 25   ? 32.861  91.185   90.945  1.00 164.88 ? 25   DT  J "O4'" 1 
ATOM   2609  C  "C3'" . DT  F  2 25   ? 31.960  93.293   90.269  1.00 161.61 ? 25   DT  J "C3'" 1 
ATOM   2610  O  "O3'" . DT  F  2 25   ? 32.038  94.418   91.152  1.00 158.59 ? 25   DT  J "O3'" 1 
ATOM   2611  C  "C2'" . DT  F  2 25   ? 33.288  93.018   89.575  1.00 163.48 ? 25   DT  J "C2'" 1 
ATOM   2612  C  "C1'" . DT  F  2 25   ? 33.934  91.987   90.485  1.00 159.80 ? 25   DT  J "C1'" 1 
ATOM   2613  N  N1    . DT  F  2 25   ? 34.930  91.099   89.857  1.00 149.90 ? 25   DT  J N1    1 
ATOM   2614  C  C2    . DT  F  2 25   ? 36.149  90.941   90.476  1.00 154.30 ? 25   DT  J C2    1 
ATOM   2615  O  O2    . DT  F  2 25   ? 36.453  91.515   91.508  1.00 154.44 ? 25   DT  J O2    1 
ATOM   2616  N  N3    . DT  F  2 25   ? 37.011  90.090   89.831  1.00 159.76 ? 25   DT  J N3    1 
ATOM   2617  C  C4    . DT  F  2 25   ? 36.778  89.394   88.660  1.00 153.11 ? 25   DT  J C4    1 
ATOM   2618  O  O4    . DT  F  2 25   ? 37.646  88.656   88.205  1.00 146.35 ? 25   DT  J O4    1 
ATOM   2619  C  C5    . DT  F  2 25   ? 35.477  89.604   88.068  1.00 154.24 ? 25   DT  J C5    1 
ATOM   2620  C  C7    . DT  F  2 25   ? 35.135  88.895   86.795  1.00 155.85 ? 25   DT  J C7    1 
ATOM   2621  C  C6    . DT  F  2 25   ? 34.630  90.436   88.687  1.00 152.75 ? 25   DT  J C6    1 
ATOM   2622  P  P     . DT  F  2 26   ? 31.826  95.909   90.649  1.00 152.07 ? 26   DT  J P     1 
ATOM   2623  O  OP1   . DT  F  2 26   ? 30.592  96.432   91.294  1.00 166.65 ? 26   DT  J OP1   1 
ATOM   2624  O  OP2   . DT  F  2 26   ? 31.942  95.918   89.172  1.00 168.29 ? 26   DT  J OP2   1 
ATOM   2625  O  "O5'" . DT  F  2 26   ? 33.072  96.699   91.246  1.00 147.67 ? 26   DT  J "O5'" 1 
ATOM   2626  C  "C5'" . DT  F  2 26   ? 33.708  96.301   92.471  1.00 149.40 ? 26   DT  J "C5'" 1 
ATOM   2627  C  "C4'" . DT  F  2 26   ? 35.211  96.334   92.310  1.00 162.07 ? 26   DT  J "C4'" 1 
ATOM   2628  O  "O4'" . DT  F  2 26   ? 35.656  95.257   91.458  1.00 170.76 ? 26   DT  J "O4'" 1 
ATOM   2629  C  "C3'" . DT  F  2 26   ? 35.781  97.612   91.682  1.00 169.89 ? 26   DT  J "C3'" 1 
ATOM   2630  O  "O3'" . DT  F  2 26   ? 36.337  98.448   92.705  1.00 176.40 ? 26   DT  J "O3'" 1 
ATOM   2631  C  "C2'" . DT  F  2 26   ? 36.837  97.123   90.694  1.00 164.58 ? 26   DT  J "C2'" 1 
ATOM   2632  C  "C1'" . DT  F  2 26   ? 36.914  95.623   90.921  1.00 166.44 ? 26   DT  J "C1'" 1 
ATOM   2633  N  N1    . DT  F  2 26   ? 37.154  94.803   89.711  1.00 166.21 ? 26   DT  J N1    1 
ATOM   2634  C  C2    . DT  F  2 26   ? 38.282  94.012   89.673  1.00 165.97 ? 26   DT  J C2    1 
ATOM   2635  O  O2    . DT  F  2 26   ? 39.098  93.972   90.578  1.00 165.27 ? 26   DT  J O2    1 
ATOM   2636  N  N3    . DT  F  2 26   ? 38.423  93.269   88.525  1.00 163.34 ? 26   DT  J N3    1 
ATOM   2637  C  C4    . DT  F  2 26   ? 37.565  93.239   87.439  1.00 164.58 ? 26   DT  J C4    1 
ATOM   2638  O  O4    . DT  F  2 26   ? 37.823  92.525   86.474  1.00 158.77 ? 26   DT  J O4    1 
ATOM   2639  C  C5    . DT  F  2 26   ? 36.401  94.090   87.549  1.00 166.84 ? 26   DT  J C5    1 
ATOM   2640  C  C7    . DT  F  2 26   ? 35.416  94.119   86.422  1.00 160.14 ? 26   DT  J C7    1 
ATOM   2641  C  C6    . DT  F  2 26   ? 36.255  94.818   88.665  1.00 166.47 ? 26   DT  J C6    1 
ATOM   2642  P  P     . DC  F  2 27   ? 36.881  99.928   92.439  1.00 166.25 ? 27   DC  J P     1 
ATOM   2643  O  OP1   . DC  F  2 27   ? 36.671  100.724  93.672  1.00 170.31 ? 27   DC  J OP1   1 
ATOM   2644  O  OP2   . DC  F  2 27   ? 36.387  100.441  91.136  1.00 165.95 ? 27   DC  J OP2   1 
ATOM   2645  O  "O5'" . DC  F  2 27   ? 38.445  99.681   92.287  1.00 178.10 ? 27   DC  J "O5'" 1 
ATOM   2646  C  "C5'" . DC  F  2 27   ? 39.174  98.801   93.166  1.00 180.64 ? 27   DC  J "C5'" 1 
ATOM   2647  C  "C4'" . DC  F  2 27   ? 40.517  98.456   92.559  1.00 192.46 ? 27   DC  J "C4'" 1 
ATOM   2648  O  "O4'" . DC  F  2 27   ? 40.358  97.498   91.480  1.00 188.41 ? 27   DC  J "O4'" 1 
ATOM   2649  C  "C3'" . DC  F  2 27   ? 41.288  99.639   91.962  1.00 194.02 ? 27   DC  J "C3'" 1 
ATOM   2650  O  "O3'" . DC  F  2 27   ? 42.663  99.596   92.354  1.00 204.56 ? 27   DC  J "O3'" 1 
ATOM   2651  C  "C2'" . DC  F  2 27   ? 41.152  99.439   90.462  1.00 187.42 ? 27   DC  J "C2'" 1 
ATOM   2652  C  "C1'" . DC  F  2 27   ? 41.101  97.929   90.350  1.00 173.49 ? 27   DC  J "C1'" 1 
ATOM   2653  N  N1    . DC  F  2 27   ? 40.449  97.388   89.141  1.00 163.82 ? 27   DC  J N1    1 
ATOM   2654  C  C2    . DC  F  2 27   ? 41.053  96.311   88.487  1.00 157.87 ? 27   DC  J C2    1 
ATOM   2655  O  O2    . DC  F  2 27   ? 42.116  95.859   88.933  1.00 153.28 ? 27   DC  J O2    1 
ATOM   2656  N  N3    . DC  F  2 27   ? 40.463  95.788   87.387  1.00 160.59 ? 27   DC  J N3    1 
ATOM   2657  C  C4    . DC  F  2 27   ? 39.318  96.303   86.936  1.00 164.17 ? 27   DC  J C4    1 
ATOM   2658  N  N4    . DC  F  2 27   ? 38.773  95.756   85.843  1.00 163.24 ? 27   DC  J N4    1 
ATOM   2659  C  C5    . DC  F  2 27   ? 38.677  97.399   87.586  1.00 163.80 ? 27   DC  J C5    1 
ATOM   2660  C  C6    . DC  F  2 27   ? 39.273  97.907   88.673  1.00 164.42 ? 27   DC  J C6    1 
ATOM   2661  P  P     . DG  F  2 28   ? 43.621  100.875  92.184  1.00 226.74 ? 28   DG  J P     1 
ATOM   2662  O  OP1   . DG  F  2 28   ? 44.236  101.155  93.512  1.00 228.86 ? 28   DG  J OP1   1 
ATOM   2663  O  OP2   . DG  F  2 28   ? 42.919  101.964  91.449  1.00 217.72 ? 28   DG  J OP2   1 
ATOM   2664  O  "O5'" . DG  F  2 28   ? 44.757  100.304  91.224  1.00 217.21 ? 28   DG  J "O5'" 1 
ATOM   2665  C  "C5'" . DG  F  2 28   ? 45.584  99.200   91.635  1.00 202.57 ? 28   DG  J "C5'" 1 
ATOM   2666  C  "C4'" . DG  F  2 28   ? 46.362  98.669   90.453  1.00 191.62 ? 28   DG  J "C4'" 1 
ATOM   2667  O  "O4'" . DG  F  2 28   ? 45.442  98.069   89.512  1.00 177.82 ? 28   DG  J "O4'" 1 
ATOM   2668  C  "C3'" . DG  F  2 28   ? 47.138  99.731   89.666  1.00 201.23 ? 28   DG  J "C3'" 1 
ATOM   2669  O  "O3'" . DG  F  2 28   ? 48.420  99.255   89.236  1.00 216.82 ? 28   DG  J "O3'" 1 
ATOM   2670  C  "C2'" . DG  F  2 28   ? 46.272  99.978   88.448  1.00 192.84 ? 28   DG  J "C2'" 1 
ATOM   2671  C  "C1'" . DG  F  2 28   ? 45.684  98.601   88.221  1.00 181.53 ? 28   DG  J "C1'" 1 
ATOM   2672  N  N9    . DG  F  2 28   ? 44.431  98.580   87.476  1.00 174.84 ? 28   DG  J N9    1 
ATOM   2673  C  C8    . DG  F  2 28   ? 43.354  99.423   87.616  1.00 171.83 ? 28   DG  J C8    1 
ATOM   2674  N  N7    . DG  F  2 28   ? 42.382  99.153   86.787  1.00 172.76 ? 28   DG  J N7    1 
ATOM   2675  C  C5    . DG  F  2 28   ? 42.852  98.078   86.046  1.00 178.12 ? 28   DG  J C5    1 
ATOM   2676  C  C6    . DG  F  2 28   ? 42.241  97.351   84.988  1.00 180.82 ? 28   DG  J C6    1 
ATOM   2677  O  O6    . DG  F  2 28   ? 41.125  97.519   84.482  1.00 175.30 ? 28   DG  J O6    1 
ATOM   2678  N  N1    . DG  F  2 28   ? 43.070  96.334   84.521  1.00 182.20 ? 28   DG  J N1    1 
ATOM   2679  C  C2    . DG  F  2 28   ? 44.325  96.054   85.004  1.00 181.64 ? 28   DG  J C2    1 
ATOM   2680  N  N2    . DG  F  2 28   ? 44.966  95.027   84.428  1.00 179.07 ? 28   DG  J N2    1 
ATOM   2681  N  N3    . DG  F  2 28   ? 44.904  96.723   85.989  1.00 184.87 ? 28   DG  J N3    1 
ATOM   2682  C  C4    . DG  F  2 28   ? 44.117  97.716   86.456  1.00 179.89 ? 28   DG  J C4    1 
ATOM   2683  P  P     . DC  G  1 1    ? 89.297  -105.876 23.659  1.00 193.45 ? 1    DC  K P     1 
ATOM   2684  O  OP1   . DC  G  1 1    ? 88.574  -105.118 24.713  1.00 205.45 ? 1    DC  K OP1   1 
ATOM   2685  O  OP2   . DC  G  1 1    ? 88.532  -106.655 22.655  1.00 177.99 ? 1    DC  K OP2   1 
ATOM   2686  O  "O5'" . DC  G  1 1    ? 90.254  -104.850 22.901  1.00 181.47 ? 1    DC  K "O5'" 1 
ATOM   2687  C  "C5'" . DC  G  1 1    ? 91.677  -105.080 22.818  1.00 172.00 ? 1    DC  K "C5'" 1 
ATOM   2688  C  "C4'" . DC  G  1 1    ? 92.094  -105.222 21.374  1.00 162.15 ? 1    DC  K "C4'" 1 
ATOM   2689  O  "O4'" . DC  G  1 1    ? 91.285  -106.240 20.751  1.00 156.99 ? 1    DC  K "O4'" 1 
ATOM   2690  C  "C3'" . DC  G  1 1    ? 91.895  -103.958 20.535  1.00 165.12 ? 1    DC  K "C3'" 1 
ATOM   2691  O  "O3'" . DC  G  1 1    ? 93.146  -103.317 20.263  1.00 169.42 ? 1    DC  K "O3'" 1 
ATOM   2692  C  "C2'" . DC  G  1 1    ? 91.214  -104.441 19.261  1.00 162.05 ? 1    DC  K "C2'" 1 
ATOM   2693  C  "C1'" . DC  G  1 1    ? 91.198  -105.957 19.371  1.00 156.94 ? 1    DC  K "C1'" 1 
ATOM   2694  N  N1    . DC  G  1 1    ? 89.980  -106.604 18.851  1.00 155.34 ? 1    DC  K N1    1 
ATOM   2695  C  C2    . DC  G  1 1    ? 90.106  -107.570 17.848  1.00 157.19 ? 1    DC  K C2    1 
ATOM   2696  O  O2    . DC  G  1 1    ? 91.237  -107.844 17.416  1.00 152.28 ? 1    DC  K O2    1 
ATOM   2697  N  N3    . DC  G  1 1    ? 88.993  -108.174 17.367  1.00 161.53 ? 1    DC  K N3    1 
ATOM   2698  C  C4    . DC  G  1 1    ? 87.793  -107.852 17.859  1.00 159.35 ? 1    DC  K C4    1 
ATOM   2699  N  N4    . DC  G  1 1    ? 86.722  -108.474 17.357  1.00 157.07 ? 1    DC  K N4    1 
ATOM   2700  C  C5    . DC  G  1 1    ? 87.637  -106.870 18.880  1.00 158.08 ? 1    DC  K C5    1 
ATOM   2701  C  C6    . DC  G  1 1    ? 88.747  -106.280 19.346  1.00 158.61 ? 1    DC  K C6    1 
ATOM   2702  P  P     . DG  G  1 2    ? 93.185  -101.854 19.592  1.00 165.36 ? 2    DG  K P     1 
ATOM   2703  O  OP1   . DG  G  1 2    ? 94.408  -101.176 20.088  1.00 171.82 ? 2    DG  K OP1   1 
ATOM   2704  O  OP2   . DG  G  1 2    ? 91.862  -101.189 19.717  1.00 166.09 ? 2    DG  K OP2   1 
ATOM   2705  O  "O5'" . DG  G  1 2    ? 93.413  -102.166 18.052  1.00 153.81 ? 2    DG  K "O5'" 1 
ATOM   2706  C  "C5'" . DG  G  1 2    ? 94.512  -103.003 17.653  1.00 162.69 ? 2    DG  K "C5'" 1 
ATOM   2707  C  "C4'" . DG  G  1 2    ? 94.457  -103.274 16.167  1.00 160.70 ? 2    DG  K "C4'" 1 
ATOM   2708  O  "O4'" . DG  G  1 2    ? 93.355  -104.166 15.871  1.00 155.19 ? 2    DG  K "O4'" 1 
ATOM   2709  C  "C3'" . DG  G  1 2    ? 94.243  -102.032 15.297  1.00 157.52 ? 2    DG  K "C3'" 1 
ATOM   2710  O  "O3'" . DG  G  1 2    ? 95.057  -102.088 14.129  1.00 157.56 ? 2    DG  K "O3'" 1 
ATOM   2711  C  "C2'" . DG  G  1 2    ? 92.777  -102.109 14.925  1.00 155.47 ? 2    DG  K "C2'" 1 
ATOM   2712  C  "C1'" . DG  G  1 2    ? 92.547  -103.606 14.855  1.00 152.49 ? 2    DG  K "C1'" 1 
ATOM   2713  N  N9    . DG  G  1 2    ? 91.170  -104.023 15.095  1.00 149.30 ? 2    DG  K N9    1 
ATOM   2714  C  C8    . DG  G  1 2    ? 90.294  -103.524 16.029  1.00 147.78 ? 2    DG  K C8    1 
ATOM   2715  N  N7    . DG  G  1 2    ? 89.124  -104.101 15.992  1.00 155.06 ? 2    DG  K N7    1 
ATOM   2716  C  C5    . DG  G  1 2    ? 89.239  -105.046 14.982  1.00 155.67 ? 2    DG  K C5    1 
ATOM   2717  C  C6    . DG  G  1 2    ? 88.291  -105.984 14.483  1.00 160.87 ? 2    DG  K C6    1 
ATOM   2718  O  O6    . DG  G  1 2    ? 87.122  -106.174 14.848  1.00 152.90 ? 2    DG  K O6    1 
ATOM   2719  N  N1    . DG  G  1 2    ? 88.824  -106.744 13.446  1.00 157.20 ? 2    DG  K N1    1 
ATOM   2720  C  C2    . DG  G  1 2    ? 90.100  -106.624 12.955  1.00 157.79 ? 2    DG  K C2    1 
ATOM   2721  N  N2    . DG  G  1 2    ? 90.428  -107.452 11.954  1.00 169.24 ? 2    DG  K N2    1 
ATOM   2722  N  N3    . DG  G  1 2    ? 90.991  -105.759 13.412  1.00 150.40 ? 2    DG  K N3    1 
ATOM   2723  C  C4    . DG  G  1 2    ? 90.495  -105.006 14.416  1.00 149.78 ? 2    DG  K C4    1 
ATOM   2724  P  P     . DA  G  1 3    ? 95.306  -100.798 13.217  1.00 156.09 ? 3    DA  K P     1 
ATOM   2725  O  OP1   . DA  G  1 3    ? 96.737  -100.403 13.354  1.00 154.22 ? 3    DA  K OP1   1 
ATOM   2726  O  OP2   . DA  G  1 3    ? 94.236  -99.790  13.448  1.00 141.47 ? 3    DA  K OP2   1 
ATOM   2727  O  "O5'" . DA  G  1 3    ? 95.095  -101.457 11.779  1.00 160.72 ? 3    DA  K "O5'" 1 
ATOM   2728  C  "C5'" . DA  G  1 3    ? 95.737  -102.704 11.423  1.00 162.54 ? 3    DA  K "C5'" 1 
ATOM   2729  C  "C4'" . DA  G  1 3    ? 94.981  -103.372 10.299  1.00 161.25 ? 3    DA  K "C4'" 1 
ATOM   2730  O  "O4'" . DA  G  1 3    ? 93.674  -103.785 10.768  1.00 160.07 ? 3    DA  K "O4'" 1 
ATOM   2731  C  "C3'" . DA  G  1 3    ? 94.749  -102.462 9.092   1.00 164.56 ? 3    DA  K "C3'" 1 
ATOM   2732  O  "O3'" . DA  G  1 3    ? 95.156  -103.135 7.901   1.00 166.93 ? 3    DA  K "O3'" 1 
ATOM   2733  C  "C2'" . DA  G  1 3    ? 93.265  -102.135 9.149   1.00 166.50 ? 3    DA  K "C2'" 1 
ATOM   2734  C  "C1'" . DA  G  1 3    ? 92.665  -103.322 9.888   1.00 166.43 ? 3    DA  K "C1'" 1 
ATOM   2735  N  N9    . DA  G  1 3    ? 91.478  -103.005 10.688  1.00 168.87 ? 3    DA  K N9    1 
ATOM   2736  C  C8    . DA  G  1 3    ? 91.303  -101.955 11.557  1.00 169.54 ? 3    DA  K C8    1 
ATOM   2737  N  N7    . DA  G  1 3    ? 90.124  -101.935 12.130  1.00 170.97 ? 3    DA  K N7    1 
ATOM   2738  C  C5    . DA  G  1 3    ? 89.477  -103.046 11.602  1.00 170.26 ? 3    DA  K C5    1 
ATOM   2739  C  C6    . DA  G  1 3    ? 88.193  -103.580 11.808  1.00 167.50 ? 3    DA  K C6    1 
ATOM   2740  N  N6    . DA  G  1 3    ? 87.294  -103.046 12.637  1.00 174.15 ? 3    DA  K N6    1 
ATOM   2741  N  N1    . DA  G  1 3    ? 87.860  -104.698 11.127  1.00 166.49 ? 3    DA  K N1    1 
ATOM   2742  C  C2    . DA  G  1 3    ? 88.762  -105.233 10.294  1.00 172.19 ? 3    DA  K C2    1 
ATOM   2743  N  N3    . DA  G  1 3    ? 89.999  -104.823 10.016  1.00 173.41 ? 3    DA  K N3    1 
ATOM   2744  C  C4    . DA  G  1 3    ? 90.299  -103.713 10.712  1.00 170.89 ? 3    DA  K C4    1 
ATOM   2745  P  P     . DA  G  1 4    ? 95.310  -102.348 6.523   1.00 170.52 ? 4    DA  K P     1 
ATOM   2746  O  OP1   . DA  G  1 4    ? 96.529  -102.824 5.806   1.00 169.08 ? 4    DA  K OP1   1 
ATOM   2747  O  OP2   . DA  G  1 4    ? 95.134  -100.900 6.810   1.00 165.24 ? 4    DA  K OP2   1 
ATOM   2748  O  "O5'" . DA  G  1 4    ? 94.052  -102.891 5.713   1.00 164.49 ? 4    DA  K "O5'" 1 
ATOM   2749  C  "C5'" . DA  G  1 4    ? 93.749  -104.298 5.684   1.00 169.97 ? 4    DA  K "C5'" 1 
ATOM   2750  C  "C4'" . DA  G  1 4    ? 92.310  -104.502 5.276   1.00 168.49 ? 4    DA  K "C4'" 1 
ATOM   2751  O  "O4'" . DA  G  1 4    ? 91.437  -103.996 6.310   1.00 171.01 ? 4    DA  K "O4'" 1 
ATOM   2752  C  "C3'" . DA  G  1 4    ? 91.914  -103.782 3.985   1.00 169.65 ? 4    DA  K "C3'" 1 
ATOM   2753  O  "O3'" . DA  G  1 4    ? 91.484  -104.743 3.020   1.00 170.08 ? 4    DA  K "O3'" 1 
ATOM   2754  C  "C2'" . DA  G  1 4    ? 90.805  -102.826 4.404   1.00 170.45 ? 4    DA  K "C2'" 1 
ATOM   2755  C  "C1'" . DA  G  1 4    ? 90.297  -103.427 5.701   1.00 168.83 ? 4    DA  K "C1'" 1 
ATOM   2756  N  N9    . DA  G  1 4    ? 89.706  -102.474 6.646   1.00 165.86 ? 4    DA  K N9    1 
ATOM   2757  C  C8    . DA  G  1 4    ? 90.199  -101.254 7.038   1.00 163.66 ? 4    DA  K C8    1 
ATOM   2758  N  N7    . DA  G  1 4    ? 89.441  -100.634 7.910   1.00 157.39 ? 4    DA  K N7    1 
ATOM   2759  C  C5    . DA  G  1 4    ? 88.377  -101.503 8.106   1.00 161.10 ? 4    DA  K C5    1 
ATOM   2760  C  C6    . DA  G  1 4    ? 87.230  -101.428 8.914   1.00 161.74 ? 4    DA  K C6    1 
ATOM   2761  N  N6    . DA  G  1 4    ? 86.951  -100.391 9.707   1.00 169.24 ? 4    DA  K N6    1 
ATOM   2762  N  N1    . DA  G  1 4    ? 86.366  -102.466 8.877   1.00 160.87 ? 4    DA  K N1    1 
ATOM   2763  C  C2    . DA  G  1 4    ? 86.644  -103.506 8.078   1.00 159.34 ? 4    DA  K C2    1 
ATOM   2764  N  N3    . DA  G  1 4    ? 87.688  -103.692 7.274   1.00 164.60 ? 4    DA  K N3    1 
ATOM   2765  C  C4    . DA  G  1 4    ? 88.529  -102.642 7.335   1.00 164.16 ? 4    DA  K C4    1 
ATOM   2766  P  P     . DA  G  1 5    ? 91.415  -104.358 1.477   1.00 174.27 ? 5    DA  K P     1 
ATOM   2767  O  OP1   . DA  G  1 5    ? 92.570  -105.006 0.795   1.00 170.26 ? 5    DA  K OP1   1 
ATOM   2768  O  OP2   . DA  G  1 5    ? 91.256  -102.888 1.379   1.00 167.56 ? 5    DA  K OP2   1 
ATOM   2769  O  "O5'" . DA  G  1 5    ? 90.025  -105.013 1.046   1.00 175.52 ? 5    DA  K "O5'" 1 
ATOM   2770  C  "C5'" . DA  G  1 5    ? 89.190  -105.746 1.972   1.00 170.86 ? 5    DA  K "C5'" 1 
ATOM   2771  C  "C4'" . DA  G  1 5    ? 87.744  -105.323 1.853   1.00 168.86 ? 5    DA  K "C4'" 1 
ATOM   2772  O  "O4'" . DA  G  1 5    ? 87.436  -104.356 2.888   1.00 171.40 ? 5    DA  K "O4'" 1 
ATOM   2773  C  "C3'" . DA  G  1 5    ? 87.357  -104.660 0.530   1.00 171.86 ? 5    DA  K "C3'" 1 
ATOM   2774  O  "O3'" . DA  G  1 5    ? 86.075  -105.136 0.115   1.00 175.38 ? 5    DA  K "O3'" 1 
ATOM   2775  C  "C2'" . DA  G  1 5    ? 87.315  -103.184 0.882   1.00 173.56 ? 5    DA  K "C2'" 1 
ATOM   2776  C  "C1'" . DA  G  1 5    ? 86.788  -103.238 2.302   1.00 170.67 ? 5    DA  K "C1'" 1 
ATOM   2777  N  N9    . DA  G  1 5    ? 87.052  -102.064 3.141   1.00 166.15 ? 5    DA  K N9    1 
ATOM   2778  C  C8    . DA  G  1 5    ? 88.076  -101.152 3.050   1.00 165.87 ? 5    DA  K C8    1 
ATOM   2779  N  N7    . DA  G  1 5    ? 88.027  -100.209 3.962   1.00 163.29 ? 5    DA  K N7    1 
ATOM   2780  C  C5    . DA  G  1 5    ? 86.894  -100.520 4.702   1.00 167.42 ? 5    DA  K C5    1 
ATOM   2781  C  C6    . DA  G  1 5    ? 86.290  -99.905  5.816   1.00 161.91 ? 5    DA  K C6    1 
ATOM   2782  N  N6    . DA  G  1 5    ? 86.760  -98.802  6.400   1.00 156.52 ? 5    DA  K N6    1 
ATOM   2783  N  N1    . DA  G  1 5    ? 85.165  -100.468 6.310   1.00 156.18 ? 5    DA  K N1    1 
ATOM   2784  C  C2    . DA  G  1 5    ? 84.688  -101.574 5.722   1.00 155.35 ? 5    DA  K C2    1 
ATOM   2785  N  N3    . DA  G  1 5    ? 85.167  -102.244 4.675   1.00 160.63 ? 5    DA  K N3    1 
ATOM   2786  C  C4    . DA  G  1 5    ? 86.284  -101.660 4.207   1.00 166.02 ? 5    DA  K C4    1 
ATOM   2787  P  P     . DC  G  1 6    ? 85.567  -105.003 -1.399  1.00 190.82 ? 6    DC  K P     1 
ATOM   2788  O  OP1   . DC  G  1 6    ? 85.818  -106.330 -2.026  1.00 193.74 ? 6    DC  K OP1   1 
ATOM   2789  O  OP2   . DC  G  1 6    ? 86.141  -103.772 -2.013  1.00 176.91 ? 6    DC  K OP2   1 
ATOM   2790  O  "O5'" . DC  G  1 6    ? 83.997  -104.767 -1.243  1.00 176.31 ? 6    DC  K "O5'" 1 
ATOM   2791  C  "C5'" . DC  G  1 6    ? 83.246  -105.370 -0.164  1.00 172.11 ? 6    DC  K "C5'" 1 
ATOM   2792  C  "C4'" . DC  G  1 6    ? 82.194  -104.418 0.361   1.00 165.82 ? 6    DC  K "C4'" 1 
ATOM   2793  O  "O4'" . DC  G  1 6    ? 82.791  -103.413 1.217   1.00 148.02 ? 6    DC  K "O4'" 1 
ATOM   2794  C  "C3'" . DC  G  1 6    ? 81.419  -103.660 -0.723  1.00 167.46 ? 6    DC  K "C3'" 1 
ATOM   2795  O  "O3'" . DC  G  1 6    ? 80.011  -103.809 -0.529  1.00 173.77 ? 6    DC  K "O3'" 1 
ATOM   2796  C  "C2'" . DC  G  1 6    ? 81.857  -102.214 -0.557  1.00 157.04 ? 6    DC  K "C2'" 1 
ATOM   2797  C  "C1'" . DC  G  1 6    ? 82.234  -102.145 0.909   1.00 151.67 ? 6    DC  K "C1'" 1 
ATOM   2798  N  N1    . DC  G  1 6    ? 83.234  -101.115 1.243   1.00 149.50 ? 6    DC  K N1    1 
ATOM   2799  C  C2    . DC  G  1 6    ? 82.923  -100.149 2.208   1.00 143.06 ? 6    DC  K C2    1 
ATOM   2800  O  O2    . DC  G  1 6    ? 81.808  -100.176 2.751   1.00 141.60 ? 6    DC  K O2    1 
ATOM   2801  N  N3    . DC  G  1 6    ? 83.842  -99.211  2.523   1.00 139.79 ? 6    DC  K N3    1 
ATOM   2802  C  C4    . DC  G  1 6    ? 85.031  -99.213  1.920   1.00 137.87 ? 6    DC  K C4    1 
ATOM   2803  N  N4    . DC  G  1 6    ? 85.908  -98.270  2.269   1.00 138.79 ? 6    DC  K N4    1 
ATOM   2804  C  C5    . DC  G  1 6    ? 85.374  -100.181 0.932   1.00 144.36 ? 6    DC  K C5    1 
ATOM   2805  C  C6    . DC  G  1 6    ? 84.454  -101.104 0.626   1.00 147.68 ? 6    DC  K C6    1 
ATOM   2806  P  P     . DG  G  1 7    ? 78.987  -103.418 -1.683  1.00 169.80 ? 7    DG  K P     1 
ATOM   2807  O  OP1   . DG  G  1 7    ? 78.221  -104.631 -2.081  1.00 175.99 ? 7    DG  K OP1   1 
ATOM   2808  O  OP2   . DG  G  1 7    ? 79.780  -102.696 -2.709  1.00 171.79 ? 7    DG  K OP2   1 
ATOM   2809  O  "O5'" . DG  G  1 7    ? 78.032  -102.369 -0.945  1.00 169.83 ? 7    DG  K "O5'" 1 
ATOM   2810  C  "C5'" . DG  G  1 7    ? 77.600  -102.536 0.429   1.00 155.30 ? 7    DG  K "C5'" 1 
ATOM   2811  C  "C4'" . DG  G  1 7    ? 77.204  -101.203 1.024   1.00 151.60 ? 7    DG  K "C4'" 1 
ATOM   2812  O  "O4'" . DG  G  1 7    ? 78.384  -100.413 1.307   1.00 146.05 ? 7    DG  K "O4'" 1 
ATOM   2813  C  "C3'" . DG  G  1 7    ? 76.329  -100.329 0.125   1.00 159.65 ? 7    DG  K "C3'" 1 
ATOM   2814  O  "O3'" . DG  G  1 7    ? 75.352  -99.646  0.908   1.00 168.83 ? 7    DG  K "O3'" 1 
ATOM   2815  C  "C2'" . DG  G  1 7    ? 77.305  -99.315  -0.438  1.00 155.84 ? 7    DG  K "C2'" 1 
ATOM   2816  C  "C1'" . DG  G  1 7    ? 78.224  -99.120  0.746   1.00 150.66 ? 7    DG  K "C1'" 1 
ATOM   2817  N  N9    . DG  G  1 7    ? 79.549  -98.598  0.432   1.00 148.73 ? 7    DG  K N9    1 
ATOM   2818  C  C8    . DG  G  1 7    ? 80.362  -98.972  -0.608  1.00 152.00 ? 7    DG  K C8    1 
ATOM   2819  N  N7    . DG  G  1 7    ? 81.502  -98.336  -0.620  1.00 159.68 ? 7    DG  K N7    1 
ATOM   2820  C  C5    . DG  G  1 7    ? 81.436  -97.490  0.478   1.00 147.27 ? 7    DG  K C5    1 
ATOM   2821  C  C6    . DG  G  1 7    ? 82.380  -96.557  0.977   1.00 148.37 ? 7    DG  K C6    1 
ATOM   2822  O  O6    . DG  G  1 7    ? 83.501  -96.284  0.536   1.00 156.94 ? 7    DG  K O6    1 
ATOM   2823  N  N1    . DG  G  1 7    ? 81.907  -95.907  2.112   1.00 149.84 ? 7    DG  K N1    1 
ATOM   2824  C  C2    . DG  G  1 7    ? 80.686  -96.130  2.696   1.00 155.48 ? 7    DG  K C2    1 
ATOM   2825  N  N2    . DG  G  1 7    ? 80.411  -95.406  3.790   1.00 151.48 ? 7    DG  K N2    1 
ATOM   2826  N  N3    . DG  G  1 7    ? 79.798  -97.001  2.244   1.00 165.94 ? 7    DG  K N3    1 
ATOM   2827  C  C4    . DG  G  1 7    ? 80.237  -97.640  1.137   1.00 154.35 ? 7    DG  K C4    1 
ATOM   2828  P  P     . DA  G  1 8    ? 73.970  -99.181  0.260   1.00 182.49 ? 8    DA  K P     1 
ATOM   2829  O  OP1   . DA  G  1 8    ? 72.922  -100.158 0.670   1.00 183.67 ? 8    DA  K OP1   1 
ATOM   2830  O  OP2   . DA  G  1 8    ? 74.208  -98.921  -1.187  1.00 178.89 ? 8    DA  K OP2   1 
ATOM   2831  O  "O5'" . DA  G  1 8    ? 73.729  -97.805  1.027   1.00 162.68 ? 8    DA  K "O5'" 1 
ATOM   2832  C  "C5'" . DA  G  1 8    ? 73.871  -97.718  2.459   1.00 162.48 ? 8    DA  K "C5'" 1 
ATOM   2833  C  "C4'" . DA  G  1 8    ? 74.437  -96.372  2.845   1.00 162.54 ? 8    DA  K "C4'" 1 
ATOM   2834  O  "O4'" . DA  G  1 8    ? 75.800  -96.264  2.371   1.00 160.37 ? 8    DA  K "O4'" 1 
ATOM   2835  C  "C3'" . DA  G  1 8    ? 73.677  -95.166  2.277   1.00 160.98 ? 8    DA  K "C3'" 1 
ATOM   2836  O  "O3'" . DA  G  1 8    ? 73.144  -94.343  3.325   1.00 173.92 ? 8    DA  K "O3'" 1 
ATOM   2837  C  "C2'" . DA  G  1 8    ? 74.704  -94.430  1.432   1.00 158.16 ? 8    DA  K "C2'" 1 
ATOM   2838  C  "C1'" . DA  G  1 8    ? 76.042  -94.945  1.932   1.00 156.27 ? 8    DA  K "C1'" 1 
ATOM   2839  N  N9    . DA  G  1 8    ? 77.078  -94.998  0.901   1.00 155.96 ? 8    DA  K N9    1 
ATOM   2840  C  C8    . DA  G  1 8    ? 77.050  -95.675  -0.295  1.00 159.88 ? 8    DA  K C8    1 
ATOM   2841  N  N7    . DA  G  1 8    ? 78.137  -95.525  -1.013  1.00 162.91 ? 8    DA  K N7    1 
ATOM   2842  C  C5    . DA  G  1 8    ? 78.931  -94.687  -0.243  1.00 161.43 ? 8    DA  K C5    1 
ATOM   2843  C  C6    . DA  G  1 8    ? 80.209  -94.142  -0.452  1.00 162.83 ? 8    DA  K C6    1 
ATOM   2844  N  N6    . DA  G  1 8    ? 80.942  -94.372  -1.543  1.00 161.24 ? 8    DA  K N6    1 
ATOM   2845  N  N1    . DA  G  1 8    ? 80.715  -93.339  0.511   1.00 162.52 ? 8    DA  K N1    1 
ATOM   2846  C  C2    . DA  G  1 8    ? 79.977  -93.109  1.607   1.00 162.68 ? 8    DA  K C2    1 
ATOM   2847  N  N3    . DA  G  1 8    ? 78.765  -93.566  1.918   1.00 154.89 ? 8    DA  K N3    1 
ATOM   2848  C  C4    . DA  G  1 8    ? 78.290  -94.354  0.937   1.00 155.14 ? 8    DA  K C4    1 
ATOM   2849  P  P     . DC  G  1 9    ? 72.039  -93.189  3.074   1.00 182.02 ? 9    DC  K P     1 
ATOM   2850  O  OP1   . DC  G  1 9    ? 71.232  -92.905  4.294   1.00 161.06 ? 9    DC  K OP1   1 
ATOM   2851  O  OP2   . DC  G  1 9    ? 71.344  -93.464  1.793   1.00 179.82 ? 9    DC  K OP2   1 
ATOM   2852  O  "O5'" . DC  G  1 9    ? 73.011  -91.947  2.854   1.00 178.60 ? 9    DC  K "O5'" 1 
ATOM   2853  C  "C5'" . DC  G  1 9    ? 74.137  -91.726  3.733   1.00 178.66 ? 9    DC  K "C5'" 1 
ATOM   2854  C  "C4'" . DC  G  1 9    ? 74.939  -90.521  3.292   1.00 168.41 ? 9    DC  K "C4'" 1 
ATOM   2855  O  "O4'" . DC  G  1 9    ? 75.905  -90.904  2.282   1.00 163.56 ? 9    DC  K "O4'" 1 
ATOM   2856  C  "C3'" . DC  G  1 9    ? 74.117  -89.381  2.683   1.00 166.49 ? 9    DC  K "C3'" 1 
ATOM   2857  O  "O3'" . DC  G  1 9    ? 74.572  -88.108  3.161   1.00 165.54 ? 9    DC  K "O3'" 1 
ATOM   2858  C  "C2'" . DC  G  1 9    ? 74.352  -89.541  1.194   1.00 165.30 ? 9    DC  K "C2'" 1 
ATOM   2859  C  "C1'" . DC  G  1 9    ? 75.790  -90.028  1.173   1.00 164.36 ? 9    DC  K "C1'" 1 
ATOM   2860  N  N1    . DC  G  1 9    ? 76.219  -90.755  -0.041  1.00 162.21 ? 9    DC  K N1    1 
ATOM   2861  C  C2    . DC  G  1 9    ? 77.501  -90.511  -0.541  1.00 163.49 ? 9    DC  K C2    1 
ATOM   2862  O  O2    . DC  G  1 9    ? 78.234  -89.706  0.054   1.00 169.42 ? 9    DC  K O2    1 
ATOM   2863  N  N3    . DC  G  1 9    ? 77.912  -91.158  -1.656  1.00 166.14 ? 9    DC  K N3    1 
ATOM   2864  C  C4    . DC  G  1 9    ? 77.095  -92.019  -2.266  1.00 164.94 ? 9    DC  K C4    1 
ATOM   2865  N  N4    . DC  G  1 9    ? 77.544  -92.636  -3.364  1.00 163.58 ? 9    DC  K N4    1 
ATOM   2866  C  C5    . DC  G  1 9    ? 75.783  -92.286  -1.779  1.00 162.23 ? 9    DC  K C5    1 
ATOM   2867  C  C6    . DC  G  1 9    ? 75.389  -91.638  -0.675  1.00 160.46 ? 9    DC  K C6    1 
ATOM   2868  P  P     . DG  G  1 10   ? 73.554  -86.866  3.346   1.00 165.72 ? 10   DG  K P     1 
ATOM   2869  O  OP1   . DG  G  1 10   ? 72.927  -86.913  4.694   1.00 158.57 ? 10   DG  K OP1   1 
ATOM   2870  O  OP2   . DG  G  1 10   ? 72.686  -86.832  2.132   1.00 160.48 ? 10   DG  K OP2   1 
ATOM   2871  O  "O5'" . DG  G  1 10   ? 74.503  -85.585  3.313   1.00 161.61 ? 10   DG  K "O5'" 1 
ATOM   2872  C  "C5'" . DG  G  1 10   ? 75.849  -85.626  3.832   1.00 162.42 ? 10   DG  K "C5'" 1 
ATOM   2873  C  "C4'" . DG  G  1 10   ? 76.855  -85.177  2.793   1.00 165.87 ? 10   DG  K "C4'" 1 
ATOM   2874  O  "O4'" . DG  G  1 10   ? 76.988  -86.161  1.739   1.00 163.69 ? 10   DG  K "O4'" 1 
ATOM   2875  C  "C3'" . DG  G  1 10   ? 76.538  -83.846  2.101   1.00 165.90 ? 10   DG  K "C3'" 1 
ATOM   2876  O  "O3'" . DG  G  1 10   ? 77.557  -82.880  2.395   1.00 168.00 ? 10   DG  K "O3'" 1 
ATOM   2877  C  "C2'" . DG  G  1 10   ? 76.470  -84.192  0.619   1.00 162.88 ? 10   DG  K "C2'" 1 
ATOM   2878  C  "C1'" . DG  G  1 10   ? 77.250  -85.488  0.523   1.00 162.45 ? 10   DG  K "C1'" 1 
ATOM   2879  N  N9    . DG  G  1 10   ? 76.869  -86.377  -0.573  1.00 163.73 ? 10   DG  K N9    1 
ATOM   2880  C  C8    . DG  G  1 10   ? 75.620  -86.894  -0.821  1.00 162.10 ? 10   DG  K C8    1 
ATOM   2881  N  N7    . DG  G  1 10   ? 75.590  -87.685  -1.859  1.00 160.65 ? 10   DG  K N7    1 
ATOM   2882  C  C5    . DG  G  1 10   ? 76.897  -87.690  -2.326  1.00 158.61 ? 10   DG  K C5    1 
ATOM   2883  C  C6    . DG  G  1 10   ? 77.479  -88.378  -3.425  1.00 166.19 ? 10   DG  K C6    1 
ATOM   2884  O  O6    . DG  G  1 10   ? 76.932  -89.131  -4.242  1.00 165.03 ? 10   DG  K O6    1 
ATOM   2885  N  N1    . DG  G  1 10   ? 78.840  -88.107  -3.533  1.00 171.82 ? 10   DG  K N1    1 
ATOM   2886  C  C2    . DG  G  1 10   ? 79.552  -87.287  -2.692  1.00 161.62 ? 10   DG  K C2    1 
ATOM   2887  N  N2    . DG  G  1 10   ? 80.861  -87.152  -2.960  1.00 160.29 ? 10   DG  K N2    1 
ATOM   2888  N  N3    . DG  G  1 10   ? 79.023  -86.648  -1.662  1.00 155.84 ? 10   DG  K N3    1 
ATOM   2889  C  C4    . DG  G  1 10   ? 77.701  -86.892  -1.540  1.00 158.68 ? 10   DG  K C4    1 
ATOM   2890  P  P     . DG  G  1 11   ? 77.374  -81.304  2.125   1.00 163.46 ? 11   DG  K P     1 
ATOM   2891  O  OP1   . DG  G  1 11   ? 77.305  -80.614  3.441   1.00 158.59 ? 11   DG  K OP1   1 
ATOM   2892  O  OP2   . DG  G  1 11   ? 76.258  -81.134  1.163   1.00 162.84 ? 11   DG  K OP2   1 
ATOM   2893  O  "O5'" . DG  G  1 11   ? 78.722  -80.908  1.370   1.00 164.32 ? 11   DG  K "O5'" 1 
ATOM   2894  C  "C5'" . DG  G  1 11   ? 79.623  -81.904  0.819   1.00 167.97 ? 11   DG  K "C5'" 1 
ATOM   2895  C  "C4'" . DG  G  1 11   ? 79.984  -81.583  -0.615  1.00 167.51 ? 11   DG  K "C4'" 1 
ATOM   2896  O  "O4'" . DG  G  1 11   ? 79.540  -82.659  -1.484  1.00 161.69 ? 11   DG  K "O4'" 1 
ATOM   2897  C  "C3'" . DG  G  1 11   ? 79.341  -80.310  -1.176  1.00 172.26 ? 11   DG  K "C3'" 1 
ATOM   2898  O  "O3'" . DG  G  1 11   ? 80.179  -79.671  -2.140  1.00 172.40 ? 11   DG  K "O3'" 1 
ATOM   2899  C  "C2'" . DG  G  1 11   ? 78.141  -80.848  -1.925  1.00 168.66 ? 11   DG  K "C2'" 1 
ATOM   2900  C  "C1'" . DG  G  1 11   ? 78.761  -82.093  -2.527  1.00 166.27 ? 11   DG  K "C1'" 1 
ATOM   2901  N  N9    . DG  G  1 11   ? 77.837  -83.109  -3.022  1.00 168.76 ? 11   DG  K N9    1 
ATOM   2902  C  C8    . DG  G  1 11   ? 76.515  -83.276  -2.686  1.00 166.59 ? 11   DG  K C8    1 
ATOM   2903  N  N7    . DG  G  1 11   ? 75.943  -84.258  -3.329  1.00 168.23 ? 11   DG  K N7    1 
ATOM   2904  C  C5    . DG  G  1 11   ? 76.942  -84.757  -4.155  1.00 171.10 ? 11   DG  K C5    1 
ATOM   2905  C  C6    . DG  G  1 11   ? 76.912  -85.821  -5.100  1.00 165.55 ? 11   DG  K C6    1 
ATOM   2906  O  O6    . DG  G  1 11   ? 75.969  -86.566  -5.392  1.00 157.20 ? 11   DG  K O6    1 
ATOM   2907  N  N1    . DG  G  1 11   ? 78.146  -85.988  -5.722  1.00 165.46 ? 11   DG  K N1    1 
ATOM   2908  C  C2    . DG  G  1 11   ? 79.265  -85.230  -5.474  1.00 168.15 ? 11   DG  K C2    1 
ATOM   2909  N  N2    . DG  G  1 11   ? 80.364  -85.547  -6.174  1.00 170.83 ? 11   DG  K N2    1 
ATOM   2910  N  N3    . DG  G  1 11   ? 79.304  -84.234  -4.602  1.00 178.66 ? 11   DG  K N3    1 
ATOM   2911  C  C4    . DG  G  1 11   ? 78.116  -84.056  -3.982  1.00 178.45 ? 11   DG  K C4    1 
ATOM   2912  P  P     . DC  G  1 12   ? 81.386  -78.706  -1.757  1.00 184.84 ? 12   DC  K P     1 
ATOM   2913  O  OP1   . DC  G  1 12   ? 82.184  -79.280  -0.645  1.00 186.42 ? 12   DC  K OP1   1 
ATOM   2914  O  OP2   . DC  G  1 12   ? 80.834  -77.332  -1.630  1.00 191.79 ? 12   DC  K OP2   1 
ATOM   2915  O  "O5'" . DC  G  1 12   ? 82.251  -78.805  -3.091  1.00 180.13 ? 12   DC  K "O5'" 1 
ATOM   2916  C  "C5'" . DC  G  1 12   ? 82.677  -80.078  -3.618  1.00 174.63 ? 12   DC  K "C5'" 1 
ATOM   2917  C  "C4'" . DC  G  1 12   ? 82.332  -80.198  -5.086  1.00 174.94 ? 12   DC  K "C4'" 1 
ATOM   2918  O  "O4'" . DC  G  1 12   ? 81.155  -81.018  -5.259  1.00 166.89 ? 12   DC  K "O4'" 1 
ATOM   2919  C  "C3'" . DC  G  1 12   ? 82.049  -78.879  -5.814  1.00 176.69 ? 12   DC  K "C3'" 1 
ATOM   2920  O  "O3'" . DC  G  1 12   ? 83.016  -78.707  -6.854  1.00 187.77 ? 12   DC  K "O3'" 1 
ATOM   2921  C  "C2'" . DC  G  1 12   ? 80.628  -79.026  -6.340  1.00 167.89 ? 12   DC  K "C2'" 1 
ATOM   2922  C  "C1'" . DC  G  1 12   ? 80.403  -80.524  -6.350  1.00 161.39 ? 12   DC  K "C1'" 1 
ATOM   2923  N  N1    . DC  G  1 12   ? 79.009  -80.976  -6.177  1.00 158.08 ? 12   DC  K N1    1 
ATOM   2924  C  C2    . DC  G  1 12   ? 78.584  -82.111  -6.874  1.00 154.96 ? 12   DC  K C2    1 
ATOM   2925  O  O2    . DC  G  1 12   ? 79.380  -82.681  -7.633  1.00 153.09 ? 12   DC  K O2    1 
ATOM   2926  N  N3    . DC  G  1 12   ? 77.316  -82.554  -6.707  1.00 158.78 ? 12   DC  K N3    1 
ATOM   2927  C  C4    . DC  G  1 12   ? 76.492  -81.921  -5.868  1.00 152.07 ? 12   DC  K C4    1 
ATOM   2928  N  N4    . DC  G  1 12   ? 75.253  -82.396  -5.728  1.00 143.91 ? 12   DC  K N4    1 
ATOM   2929  C  C5    . DC  G  1 12   ? 76.904  -80.772  -5.133  1.00 156.93 ? 12   DC  K C5    1 
ATOM   2930  C  C6    . DC  G  1 12   ? 78.159  -80.338  -5.314  1.00 160.61 ? 12   DC  K C6    1 
ATOM   2931  P  P     . DC  G  1 13   ? 83.183  -77.318  -7.630  1.00 203.67 ? 13   DC  K P     1 
ATOM   2932  O  OP1   . DC  G  1 13   ? 84.552  -76.804  -7.382  1.00 201.90 ? 13   DC  K OP1   1 
ATOM   2933  O  OP2   . DC  G  1 13   ? 82.008  -76.453  -7.334  1.00 196.79 ? 13   DC  K OP2   1 
ATOM   2934  O  "O5'" . DC  G  1 13   ? 83.130  -77.749  -9.163  1.00 204.05 ? 13   DC  K "O5'" 1 
ATOM   2935  C  "C5'" . DC  G  1 13   ? 83.332  -79.119  -9.567  1.00 201.11 ? 13   DC  K "C5'" 1 
ATOM   2936  C  "C4'" . DC  G  1 13   ? 82.342  -79.496  -10.643 1.00 200.49 ? 13   DC  K "C4'" 1 
ATOM   2937  O  "O4'" . DC  G  1 13   ? 81.100  -79.935  -10.035 1.00 198.89 ? 13   DC  K "O4'" 1 
ATOM   2938  C  "C3'" . DC  G  1 13   ? 81.973  -78.361  -11.607 1.00 197.69 ? 13   DC  K "C3'" 1 
ATOM   2939  O  "O3'" . DC  G  1 13   ? 82.135  -78.775  -12.967 1.00 195.16 ? 13   DC  K "O3'" 1 
ATOM   2940  C  "C2'" . DC  G  1 13   ? 80.519  -78.062  -11.281 1.00 196.29 ? 13   DC  K "C2'" 1 
ATOM   2941  C  "C1'" . DC  G  1 13   ? 80.021  -79.405  -10.777 1.00 191.26 ? 13   DC  K "C1'" 1 
ATOM   2942  N  N1    . DC  G  1 13   ? 78.830  -79.392  -9.905  1.00 187.42 ? 13   DC  K N1    1 
ATOM   2943  C  C2    . DC  G  1 13   ? 77.960  -80.489  -9.946  1.00 190.28 ? 13   DC  K C2    1 
ATOM   2944  O  O2    . DC  G  1 13   ? 78.216  -81.430  -10.712 1.00 192.40 ? 13   DC  K O2    1 
ATOM   2945  N  N3    . DC  G  1 13   ? 76.864  -80.494  -9.151  1.00 180.48 ? 13   DC  K N3    1 
ATOM   2946  C  C4    . DC  G  1 13   ? 76.629  -79.465  -8.334  1.00 181.33 ? 13   DC  K C4    1 
ATOM   2947  N  N4    . DC  G  1 13   ? 75.537  -79.514  -7.569  1.00 173.07 ? 13   DC  K N4    1 
ATOM   2948  C  C5    . DC  G  1 13   ? 77.500  -78.338  -8.269  1.00 185.46 ? 13   DC  K C5    1 
ATOM   2949  C  C6    . DC  G  1 13   ? 78.577  -78.342  -9.066  1.00 187.10 ? 13   DC  K C6    1 
ATOM   2950  P  P     . DA  G  1 14   ? 82.106  -77.726  -14.174 1.00 202.59 ? 14   DA  K P     1 
ATOM   2951  O  OP1   . DA  G  1 14   ? 83.360  -77.917  -14.953 1.00 223.10 ? 14   DA  K OP1   1 
ATOM   2952  O  OP2   . DA  G  1 14   ? 81.765  -76.373  -13.661 1.00 193.45 ? 14   DA  K OP2   1 
ATOM   2953  O  "O5'" . DA  G  1 14   ? 80.874  -78.217  -15.055 1.00 192.74 ? 14   DA  K "O5'" 1 
ATOM   2954  C  "C5'" . DA  G  1 14   ? 80.640  -79.613  -15.316 1.00 190.51 ? 14   DA  K "C5'" 1 
ATOM   2955  C  "C4'" . DA  G  1 14   ? 79.178  -79.835  -15.624 1.00 189.91 ? 14   DA  K "C4'" 1 
ATOM   2956  O  "O4'" . DA  G  1 14   ? 78.391  -79.749  -14.408 1.00 188.88 ? 14   DA  K "O4'" 1 
ATOM   2957  C  "C3'" . DA  G  1 14   ? 78.564  -78.810  -16.577 1.00 188.45 ? 14   DA  K "C3'" 1 
ATOM   2958  O  "O3'" . DA  G  1 14   ? 77.615  -79.488  -17.399 1.00 195.51 ? 14   DA  K "O3'" 1 
ATOM   2959  C  "C2'" . DA  G  1 14   ? 77.819  -77.877  -15.642 1.00 185.35 ? 14   DA  K "C2'" 1 
ATOM   2960  C  "C1'" . DA  G  1 14   ? 77.288  -78.896  -14.661 1.00 181.16 ? 14   DA  K "C1'" 1 
ATOM   2961  N  N9    . DA  G  1 14   ? 76.793  -78.388  -13.382 1.00 180.03 ? 14   DA  K N9    1 
ATOM   2962  C  C8    . DA  G  1 14   ? 77.326  -77.420  -12.568 1.00 181.35 ? 14   DA  K C8    1 
ATOM   2963  N  N7    . DA  G  1 14   ? 76.625  -77.199  -11.482 1.00 181.10 ? 14   DA  K N7    1 
ATOM   2964  C  C5    . DA  G  1 14   ? 75.556  -78.078  -11.590 1.00 174.74 ? 14   DA  K C5    1 
ATOM   2965  C  C6    . DA  G  1 14   ? 74.447  -78.330  -10.762 1.00 175.33 ? 14   DA  K C6    1 
ATOM   2966  N  N6    . DA  G  1 14   ? 74.224  -77.694  -9.609  1.00 182.46 ? 14   DA  K N6    1 
ATOM   2967  N  N1    . DA  G  1 14   ? 73.563  -79.269  -11.163 1.00 171.11 ? 14   DA  K N1    1 
ATOM   2968  C  C2    . DA  G  1 14   ? 73.783  -79.904  -12.320 1.00 168.21 ? 14   DA  K C2    1 
ATOM   2969  N  N3    . DA  G  1 14   ? 74.783  -79.753  -13.185 1.00 174.51 ? 14   DA  K N3    1 
ATOM   2970  C  C4    . DA  G  1 14   ? 75.644  -78.813  -12.757 1.00 175.75 ? 14   DA  K C4    1 
ATOM   2971  P  P     . DG  G  1 15   ? 77.519  -79.199  -18.960 1.00 205.26 ? 15   DG  K P     1 
ATOM   2972  O  OP1   . DG  G  1 15   ? 78.643  -79.956  -19.563 1.00 211.56 ? 15   DG  K OP1   1 
ATOM   2973  O  OP2   . DG  G  1 15   ? 77.440  -77.722  -19.105 1.00 202.42 ? 15   DG  K OP2   1 
ATOM   2974  O  "O5'" . DG  G  1 15   ? 76.147  -79.837  -19.466 1.00 193.99 ? 15   DG  K "O5'" 1 
ATOM   2975  C  "C5'" . DG  G  1 15   ? 75.438  -80.829  -18.693 1.00 189.06 ? 15   DG  K "C5'" 1 
ATOM   2976  C  "C4'" . DG  G  1 15   ? 73.987  -80.438  -18.532 1.00 188.21 ? 15   DG  K "C4'" 1 
ATOM   2977  O  "O4'" . DG  G  1 15   ? 73.790  -79.826  -17.233 1.00 184.22 ? 15   DG  K "O4'" 1 
ATOM   2978  C  "C3'" . DG  G  1 15   ? 73.457  -79.440  -19.567 1.00 195.46 ? 15   DG  K "C3'" 1 
ATOM   2979  O  "O3'" . DG  G  1 15   ? 72.228  -79.931  -20.114 1.00 195.49 ? 15   DG  K "O3'" 1 
ATOM   2980  C  "C2'" . DG  G  1 15   ? 73.319  -78.144  -18.783 1.00 197.94 ? 15   DG  K "C2'" 1 
ATOM   2981  C  "C1'" . DG  G  1 15   ? 73.029  -78.639  -17.378 1.00 191.96 ? 15   DG  K "C1'" 1 
ATOM   2982  N  N9    . DG  G  1 15   ? 73.403  -77.729  -16.295 1.00 192.14 ? 15   DG  K N9    1 
ATOM   2983  C  C8    . DG  G  1 15   ? 74.443  -76.830  -16.282 1.00 193.10 ? 15   DG  K C8    1 
ATOM   2984  N  N7    . DG  G  1 15   ? 74.527  -76.161  -15.164 1.00 186.00 ? 15   DG  K N7    1 
ATOM   2985  C  C5    . DG  G  1 15   ? 73.481  -76.647  -14.392 1.00 180.91 ? 15   DG  K C5    1 
ATOM   2986  C  C6    . DG  G  1 15   ? 73.066  -76.297  -13.081 1.00 180.34 ? 15   DG  K C6    1 
ATOM   2987  O  O6    . DG  G  1 15   ? 73.560  -75.460  -12.314 1.00 174.47 ? 15   DG  K O6    1 
ATOM   2988  N  N1    . DG  G  1 15   ? 71.955  -77.034  -12.682 1.00 178.65 ? 15   DG  K N1    1 
ATOM   2989  C  C2    . DG  G  1 15   ? 71.322  -77.985  -13.447 1.00 177.74 ? 15   DG  K C2    1 
ATOM   2990  N  N2    . DG  G  1 15   ? 70.264  -78.590  -12.888 1.00 180.25 ? 15   DG  K N2    1 
ATOM   2991  N  N3    . DG  G  1 15   ? 71.697  -78.317  -14.670 1.00 181.35 ? 15   DG  K N3    1 
ATOM   2992  C  C4    . DG  G  1 15   ? 72.775  -77.613  -15.078 1.00 183.44 ? 15   DG  K C4    1 
ATOM   2993  P  P     . DT  G  1 16   ? 71.238  -79.043  -21.007 1.00 199.52 ? 16   DT  K P     1 
ATOM   2994  O  OP1   . DT  G  1 16   ? 70.567  -79.951  -21.978 1.00 209.87 ? 16   DT  K OP1   1 
ATOM   2995  O  OP2   . DT  G  1 16   ? 71.960  -77.838  -21.489 1.00 206.86 ? 16   DT  K OP2   1 
ATOM   2996  O  "O5'" . DT  G  1 16   ? 70.146  -78.573  -19.951 1.00 185.91 ? 16   DT  K "O5'" 1 
ATOM   2997  C  "C5'" . DT  G  1 16   ? 69.522  -79.532  -19.082 1.00 179.09 ? 16   DT  K "C5'" 1 
ATOM   2998  C  "C4'" . DT  G  1 16   ? 68.662  -78.827  -18.061 1.00 176.78 ? 16   DT  K "C4'" 1 
ATOM   2999  O  "O4'" . DT  G  1 16   ? 69.489  -78.063  -17.151 1.00 178.44 ? 16   DT  K "O4'" 1 
ATOM   3000  C  "C3'" . DT  G  1 16   ? 67.639  -77.845  -18.643 1.00 176.65 ? 16   DT  K "C3'" 1 
ATOM   3001  O  "O3'" . DT  G  1 16   ? 66.326  -78.189  -18.189 1.00 171.10 ? 16   DT  K "O3'" 1 
ATOM   3002  C  "C2'" . DT  G  1 16   ? 68.070  -76.487  -18.108 1.00 179.62 ? 16   DT  K "C2'" 1 
ATOM   3003  C  "C1'" . DT  G  1 16   ? 68.827  -76.848  -16.845 1.00 178.00 ? 16   DT  K "C1'" 1 
ATOM   3004  N  N1    . DT  G  1 16   ? 69.848  -75.865  -16.409 1.00 181.37 ? 16   DT  K N1    1 
ATOM   3005  C  C2    . DT  G  1 16   ? 69.798  -75.394  -15.112 1.00 175.46 ? 16   DT  K C2    1 
ATOM   3006  O  O2    . DT  G  1 16   ? 68.948  -75.738  -14.304 1.00 159.98 ? 16   DT  K O2    1 
ATOM   3007  N  N3    . DT  G  1 16   ? 70.786  -74.494  -14.794 1.00 173.00 ? 16   DT  K N3    1 
ATOM   3008  C  C4    . DT  G  1 16   ? 71.795  -74.032  -15.619 1.00 177.87 ? 16   DT  K C4    1 
ATOM   3009  O  O4    . DT  G  1 16   ? 72.614  -73.223  -15.188 1.00 179.21 ? 16   DT  K O4    1 
ATOM   3010  C  C5    . DT  G  1 16   ? 71.788  -74.567  -16.962 1.00 180.99 ? 16   DT  K C5    1 
ATOM   3011  C  C7    . DT  G  1 16   ? 72.840  -74.119  -17.928 1.00 177.40 ? 16   DT  K C7    1 
ATOM   3012  C  C6    . DT  G  1 16   ? 70.829  -75.445  -17.286 1.00 184.05 ? 16   DT  K C6    1 
ATOM   3013  P  P     . DG  G  1 17   ? 65.013  -77.651  -18.918 1.00 165.20 ? 17   DG  K P     1 
ATOM   3014  O  OP1   . DG  G  1 17   ? 64.295  -78.826  -19.458 1.00 166.53 ? 17   DG  K OP1   1 
ATOM   3015  O  OP2   . DG  G  1 17   ? 65.396  -76.533  -19.822 1.00 176.34 ? 17   DG  K OP2   1 
ATOM   3016  O  "O5'" . DG  G  1 17   ? 64.099  -77.094  -17.739 1.00 178.27 ? 17   DG  K "O5'" 1 
ATOM   3017  C  "C5'" . DG  G  1 17   ? 64.505  -77.195  -16.359 1.00 182.00 ? 17   DG  K "C5'" 1 
ATOM   3018  C  "C4'" . DG  G  1 17   ? 63.835  -76.126  -15.526 1.00 186.31 ? 17   DG  K "C4'" 1 
ATOM   3019  O  "O4'" . DG  G  1 17   ? 64.828  -75.155  -15.118 1.00 176.61 ? 17   DG  K "O4'" 1 
ATOM   3020  C  "C3'" . DG  G  1 17   ? 62.733  -75.324  -16.224 1.00 190.65 ? 17   DG  K "C3'" 1 
ATOM   3021  O  "O3'" . DG  G  1 17   ? 61.679  -75.028  -15.290 1.00 208.73 ? 17   DG  K "O3'" 1 
ATOM   3022  C  "C2'" . DG  G  1 17   ? 63.475  -74.102  -16.733 1.00 184.91 ? 17   DG  K "C2'" 1 
ATOM   3023  C  "C1'" . DG  G  1 17   ? 64.503  -73.873  -15.637 1.00 181.35 ? 17   DG  K "C1'" 1 
ATOM   3024  N  N9    . DG  G  1 17   ? 65.749  -73.226  -16.047 1.00 184.77 ? 17   DG  K N9    1 
ATOM   3025  C  C8    . DG  G  1 17   ? 66.363  -73.274  -17.277 1.00 180.66 ? 17   DG  K C8    1 
ATOM   3026  N  N7    . DG  G  1 17   ? 67.478  -72.596  -17.319 1.00 174.66 ? 17   DG  K N7    1 
ATOM   3027  C  C5    . DG  G  1 17   ? 67.610  -72.072  -16.040 1.00 176.51 ? 17   DG  K C5    1 
ATOM   3028  C  C6    . DG  G  1 17   ? 68.625  -71.251  -15.481 1.00 179.15 ? 17   DG  K C6    1 
ATOM   3029  O  O6    . DG  G  1 17   ? 69.645  -70.806  -16.023 1.00 175.27 ? 17   DG  K O6    1 
ATOM   3030  N  N1    . DG  G  1 17   ? 68.366  -70.956  -14.146 1.00 178.80 ? 17   DG  K N1    1 
ATOM   3031  C  C2    . DG  G  1 17   ? 67.271  -71.391  -13.439 1.00 175.99 ? 17   DG  K C2    1 
ATOM   3032  N  N2    . DG  G  1 17   ? 67.195  -70.999  -12.160 1.00 181.57 ? 17   DG  K N2    1 
ATOM   3033  N  N3    . DG  G  1 17   ? 66.322  -72.158  -13.947 1.00 173.72 ? 17   DG  K N3    1 
ATOM   3034  C  C4    . DG  G  1 17   ? 66.553  -72.456  -15.243 1.00 177.63 ? 17   DG  K C4    1 
ATOM   3035  P  P     . DC  G  1 18   ? 60.315  -74.217  -15.603 1.00 222.40 ? 18   DC  K P     1 
ATOM   3036  O  OP1   . DC  G  1 18   ? 59.149  -74.980  -15.087 1.00 210.38 ? 18   DC  K OP1   1 
ATOM   3037  O  OP2   . DC  G  1 18   ? 60.324  -73.767  -17.019 1.00 225.94 ? 18   DC  K OP2   1 
ATOM   3038  O  "O5'" . DC  G  1 18   ? 60.449  -72.939  -14.660 1.00 223.25 ? 18   DC  K "O5'" 1 
ATOM   3039  C  "C5'" . DC  G  1 18   ? 60.857  -73.078  -13.283 1.00 214.53 ? 18   DC  K "C5'" 1 
ATOM   3040  C  "C4'" . DC  G  1 18   ? 61.368  -71.758  -12.754 1.00 209.71 ? 18   DC  K "C4'" 1 
ATOM   3041  O  "O4'" . DC  G  1 18   ? 62.655  -71.465  -13.345 1.00 208.26 ? 18   DC  K "O4'" 1 
ATOM   3042  C  "C3'" . DC  G  1 18   ? 60.456  -70.565  -13.052 1.00 207.97 ? 18   DC  K "C3'" 1 
ATOM   3043  O  "O3'" . DC  G  1 18   ? 60.041  -69.958  -11.827 1.00 207.04 ? 18   DC  K "O3'" 1 
ATOM   3044  C  "C2'" . DC  G  1 18   ? 61.288  -69.640  -13.927 1.00 206.97 ? 18   DC  K "C2'" 1 
ATOM   3045  C  "C1'" . DC  G  1 18   ? 62.724  -70.111  -13.752 1.00 207.15 ? 18   DC  K "C1'" 1 
ATOM   3046  N  N1    . DC  G  1 18   ? 63.544  -70.050  -14.978 1.00 204.31 ? 18   DC  K N1    1 
ATOM   3047  C  C2    . DC  G  1 18   ? 64.789  -69.416  -14.927 1.00 196.91 ? 18   DC  K C2    1 
ATOM   3048  O  O2    . DC  G  1 18   ? 65.164  -68.917  -13.855 1.00 189.05 ? 18   DC  K O2    1 
ATOM   3049  N  N3    . DC  G  1 18   ? 65.548  -69.357  -16.046 1.00 196.25 ? 18   DC  K N3    1 
ATOM   3050  C  C4    . DC  G  1 18   ? 65.109  -69.908  -17.181 1.00 193.23 ? 18   DC  K C4    1 
ATOM   3051  N  N4    . DC  G  1 18   ? 65.891  -69.828  -18.259 1.00 196.04 ? 18   DC  K N4    1 
ATOM   3052  C  C5    . DC  G  1 18   ? 63.848  -70.566  -17.259 1.00 194.65 ? 18   DC  K C5    1 
ATOM   3053  C  C6    . DC  G  1 18   ? 63.105  -70.614  -16.145 1.00 202.86 ? 18   DC  K C6    1 
ATOM   3054  P  P     . DC  G  1 19   ? 58.742  -69.034  -11.753 1.00 200.31 ? 19   DC  K P     1 
ATOM   3055  O  OP1   . DC  G  1 19   ? 57.682  -69.870  -11.135 1.00 196.37 ? 19   DC  K OP1   1 
ATOM   3056  O  OP2   . DC  G  1 19   ? 58.508  -68.443  -13.092 1.00 202.44 ? 19   DC  K OP2   1 
ATOM   3057  O  "O5'" . DC  G  1 19   ? 59.204  -67.861  -10.774 1.00 207.38 ? 19   DC  K "O5'" 1 
ATOM   3058  C  "C5'" . DC  G  1 19   ? 60.556  -67.777  -10.251 1.00 204.88 ? 19   DC  K "C5'" 1 
ATOM   3059  C  "C4'" . DC  G  1 19   ? 61.243  -66.505  -10.696 1.00 207.20 ? 19   DC  K "C4'" 1 
ATOM   3060  O  "O4'" . DC  G  1 19   ? 61.958  -66.727  -11.939 1.00 201.54 ? 19   DC  K "O4'" 1 
ATOM   3061  C  "C3'" . DC  G  1 19   ? 60.320  -65.309  -10.949 1.00 208.45 ? 19   DC  K "C3'" 1 
ATOM   3062  O  "O3'" . DC  G  1 19   ? 60.910  -64.142  -10.372 1.00 212.78 ? 19   DC  K "O3'" 1 
ATOM   3063  C  "C2'" . DC  G  1 19   ? 60.276  -65.216  -12.465 1.00 206.14 ? 19   DC  K "C2'" 1 
ATOM   3064  C  "C1'" . DC  G  1 19   ? 61.691  -65.643  -12.812 1.00 202.17 ? 19   DC  K "C1'" 1 
ATOM   3065  N  N1    . DC  G  1 19   ? 61.961  -66.090  -14.192 1.00 192.19 ? 19   DC  K N1    1 
ATOM   3066  C  C2    . DC  G  1 19   ? 63.292  -66.188  -14.610 1.00 192.55 ? 19   DC  K C2    1 
ATOM   3067  O  O2    . DC  G  1 19   ? 64.194  -65.900  -13.810 1.00 202.48 ? 19   DC  K O2    1 
ATOM   3068  N  N3    . DC  G  1 19   ? 63.561  -66.595  -15.871 1.00 190.72 ? 19   DC  K N3    1 
ATOM   3069  C  C4    . DC  G  1 19   ? 62.562  -66.897  -16.702 1.00 192.10 ? 19   DC  K C4    1 
ATOM   3070  N  N4    . DC  G  1 19   ? 62.875  -67.292  -17.938 1.00 198.92 ? 19   DC  K N4    1 
ATOM   3071  C  C5    . DC  G  1 19   ? 61.197  -66.806  -16.303 1.00 190.78 ? 19   DC  K C5    1 
ATOM   3072  C  C6    . DC  G  1 19   ? 60.944  -66.401  -15.052 1.00 190.54 ? 19   DC  K C6    1 
ATOM   3073  P  P     . DA  G  1 20   ? 60.110  -63.204  -9.357  1.00 226.33 ? 20   DA  K P     1 
ATOM   3074  O  OP1   . DA  G  1 20   ? 60.241  -63.761  -7.990  1.00 229.31 ? 20   DA  K OP1   1 
ATOM   3075  O  OP2   . DA  G  1 20   ? 58.754  -63.005  -9.932  1.00 240.06 ? 20   DA  K OP2   1 
ATOM   3076  O  "O5'" . DA  G  1 20   ? 60.941  -61.843  -9.432  1.00 232.01 ? 20   DA  K "O5'" 1 
ATOM   3077  C  "C5'" . DA  G  1 20   ? 62.385  -61.826  -9.314  1.00 227.01 ? 20   DA  K "C5'" 1 
ATOM   3078  C  "C4'" . DA  G  1 20   ? 63.023  -61.011  -10.418 1.00 227.90 ? 20   DA  K "C4'" 1 
ATOM   3079  O  "O4'" . DA  G  1 20   ? 62.989  -61.746  -11.668 1.00 222.18 ? 20   DA  K "O4'" 1 
ATOM   3080  C  "C3'" . DA  G  1 20   ? 62.368  -59.649  -10.694 1.00 232.30 ? 20   DA  K "C3'" 1 
ATOM   3081  O  "O3'" . DA  G  1 20   ? 63.306  -58.570  -10.568 1.00 235.01 ? 20   DA  K "O3'" 1 
ATOM   3082  C  "C2'" . DA  G  1 20   ? 61.810  -59.784  -12.105 1.00 228.17 ? 20   DA  K "C2'" 1 
ATOM   3083  C  "C1'" . DA  G  1 20   ? 62.700  -60.848  -12.724 1.00 219.26 ? 20   DA  K "C1'" 1 
ATOM   3084  N  N9    . DA  G  1 20   ? 62.109  -61.613  -13.826 1.00 203.74 ? 20   DA  K N9    1 
ATOM   3085  C  C8    . DA  G  1 20   ? 60.819  -62.065  -13.957 1.00 194.21 ? 20   DA  K C8    1 
ATOM   3086  N  N7    . DA  G  1 20   ? 60.600  -62.725  -15.068 1.00 189.21 ? 20   DA  K N7    1 
ATOM   3087  C  C5    . DA  G  1 20   ? 61.829  -62.706  -15.714 1.00 197.12 ? 20   DA  K C5    1 
ATOM   3088  C  C6    . DA  G  1 20   ? 62.262  -63.236  -16.946 1.00 194.61 ? 20   DA  K C6    1 
ATOM   3089  N  N6    . DA  G  1 20   ? 61.472  -63.917  -17.780 1.00 188.53 ? 20   DA  K N6    1 
ATOM   3090  N  N1    . DA  G  1 20   ? 63.552  -63.035  -17.297 1.00 195.04 ? 20   DA  K N1    1 
ATOM   3091  C  C2    . DA  G  1 20   ? 64.345  -62.349  -16.462 1.00 198.25 ? 20   DA  K C2    1 
ATOM   3092  N  N3    . DA  G  1 20   ? 64.056  -61.809  -15.278 1.00 194.01 ? 20   DA  K N3    1 
ATOM   3093  C  C4    . DA  G  1 20   ? 62.768  -62.024  -14.960 1.00 198.54 ? 20   DA  K C4    1 
ATOM   3094  P  P     . DT  H  2 5    ? 49.476  -54.647  -19.776 1.00 254.74 ? 5    DT  L P     1 
ATOM   3095  O  OP1   . DT  H  2 5    ? 48.306  -54.742  -18.867 1.00 259.61 ? 5    DT  L OP1   1 
ATOM   3096  O  OP2   . DT  H  2 5    ? 50.856  -54.737  -19.225 1.00 249.82 ? 5    DT  L OP2   1 
ATOM   3097  O  "O5'" . DT  H  2 5    ? 49.310  -55.700  -20.960 1.00 231.60 ? 5    DT  L "O5'" 1 
ATOM   3098  C  "C5'" . DT  H  2 5    ? 49.465  -55.289  -22.334 1.00 222.03 ? 5    DT  L "C5'" 1 
ATOM   3099  C  "C4'" . DT  H  2 5    ? 50.390  -56.225  -23.079 1.00 207.62 ? 5    DT  L "C4'" 1 
ATOM   3100  O  "O4'" . DT  H  2 5    ? 51.736  -56.116  -22.554 1.00 199.55 ? 5    DT  L "O4'" 1 
ATOM   3101  C  "C3'" . DT  H  2 5    ? 50.022  -57.708  -22.995 1.00 199.64 ? 5    DT  L "C3'" 1 
ATOM   3102  O  "O3'" . DT  H  2 5    ? 50.196  -58.341  -24.263 1.00 191.84 ? 5    DT  L "O3'" 1 
ATOM   3103  C  "C2'" . DT  H  2 5    ? 51.021  -58.270  -22.000 1.00 194.17 ? 5    DT  L "C2'" 1 
ATOM   3104  C  "C1'" . DT  H  2 5    ? 52.242  -57.413  -22.280 1.00 189.65 ? 5    DT  L "C1'" 1 
ATOM   3105  N  N1    . DT  H  2 5    ? 53.222  -57.280  -21.185 1.00 188.68 ? 5    DT  L N1    1 
ATOM   3106  C  C2    . DT  H  2 5    ? 54.532  -56.976  -21.530 1.00 184.42 ? 5    DT  L C2    1 
ATOM   3107  O  O2    . DT  H  2 5    ? 54.912  -56.814  -22.691 1.00 180.02 ? 5    DT  L O2    1 
ATOM   3108  N  N3    . DT  H  2 5    ? 55.386  -56.864  -20.461 1.00 179.95 ? 5    DT  L N3    1 
ATOM   3109  C  C4    . DT  H  2 5    ? 55.093  -57.022  -19.130 1.00 182.57 ? 5    DT  L C4    1 
ATOM   3110  O  O4    . DT  H  2 5    ? 55.980  -56.875  -18.291 1.00 181.98 ? 5    DT  L O4    1 
ATOM   3111  C  C5    . DT  H  2 5    ? 53.714  -57.357  -18.838 1.00 190.95 ? 5    DT  L C5    1 
ATOM   3112  C  C7    . DT  H  2 5    ? 53.300  -57.551  -17.415 1.00 197.28 ? 5    DT  L C7    1 
ATOM   3113  C  C6    . DT  H  2 5    ? 52.860  -57.475  -19.870 1.00 192.39 ? 5    DT  L C6    1 
ATOM   3114  P  P     . DT  H  2 6    ? 49.389  -59.667  -24.595 1.00 191.14 ? 6    DT  L P     1 
ATOM   3115  O  OP1   . DT  H  2 6    ? 48.322  -59.325  -25.565 1.00 211.18 ? 6    DT  L OP1   1 
ATOM   3116  O  OP2   . DT  H  2 6    ? 49.047  -60.342  -23.320 1.00 202.71 ? 6    DT  L OP2   1 
ATOM   3117  O  "O5'" . DT  H  2 6    ? 50.448  -60.574  -25.360 1.00 193.03 ? 6    DT  L "O5'" 1 
ATOM   3118  C  "C5'" . DT  H  2 6    ? 51.121  -60.105  -26.538 1.00 186.22 ? 6    DT  L "C5'" 1 
ATOM   3119  C  "C4'" . DT  H  2 6    ? 52.588  -60.453  -26.447 1.00 185.23 ? 6    DT  L "C4'" 1 
ATOM   3120  O  "O4'" . DT  H  2 6    ? 53.100  -60.062  -25.149 1.00 185.38 ? 6    DT  L "O4'" 1 
ATOM   3121  C  "C3'" . DT  H  2 6    ? 52.905  -61.946  -26.583 1.00 190.28 ? 6    DT  L "C3'" 1 
ATOM   3122  O  "O3'" . DT  H  2 6    ? 54.128  -62.106  -27.305 1.00 193.19 ? 6    DT  L "O3'" 1 
ATOM   3123  C  "C2'" . DT  H  2 6    ? 53.074  -62.390  -25.144 1.00 192.09 ? 6    DT  L "C2'" 1 
ATOM   3124  C  "C1'" . DT  H  2 6    ? 53.765  -61.171  -24.565 1.00 193.29 ? 6    DT  L "C1'" 1 
ATOM   3125  N  N1    . DT  H  2 6    ? 53.716  -61.012  -23.096 1.00 202.59 ? 6    DT  L N1    1 
ATOM   3126  C  C2    . DT  H  2 6    ? 54.708  -60.246  -22.499 1.00 203.00 ? 6    DT  L C2    1 
ATOM   3127  O  O2    . DT  H  2 6    ? 55.611  -59.690  -23.126 1.00 197.09 ? 6    DT  L O2    1 
ATOM   3128  N  N3    . DT  H  2 6    ? 54.602  -60.151  -21.133 1.00 208.45 ? 6    DT  L N3    1 
ATOM   3129  C  C4    . DT  H  2 6    ? 53.655  -60.720  -20.321 1.00 212.30 ? 6    DT  L C4    1 
ATOM   3130  O  O4    . DT  H  2 6    ? 53.698  -60.525  -19.107 1.00 213.80 ? 6    DT  L O4    1 
ATOM   3131  C  C5    . DT  H  2 6    ? 52.659  -61.523  -21.003 1.00 214.12 ? 6    DT  L C5    1 
ATOM   3132  C  C7    . DT  H  2 6    ? 51.587  -62.185  -20.201 1.00 221.56 ? 6    DT  L C7    1 
ATOM   3133  C  C6    . DT  H  2 6    ? 52.745  -61.632  -22.341 1.00 210.08 ? 6    DT  L C6    1 
ATOM   3134  P  P     . DT  H  2 7    ? 54.742  -63.526  -27.704 1.00 190.89 ? 7    DT  L P     1 
ATOM   3135  O  OP1   . DT  H  2 7    ? 53.896  -64.068  -28.801 1.00 196.33 ? 7    DT  L OP1   1 
ATOM   3136  O  OP2   . DT  H  2 7    ? 54.951  -64.333  -26.474 1.00 168.85 ? 7    DT  L OP2   1 
ATOM   3137  O  "O5'" . DT  H  2 7    ? 56.172  -63.154  -28.309 1.00 193.71 ? 7    DT  L "O5'" 1 
ATOM   3138  C  "C5'" . DT  H  2 7    ? 56.648  -61.790  -28.416 1.00 189.34 ? 7    DT  L "C5'" 1 
ATOM   3139  C  "C4'" . DT  H  2 7    ? 57.920  -61.605  -27.620 1.00 183.55 ? 7    DT  L "C4'" 1 
ATOM   3140  O  "O4'" . DT  H  2 7    ? 57.610  -61.143  -26.290 1.00 185.75 ? 7    DT  L "O4'" 1 
ATOM   3141  C  "C3'" . DT  H  2 7    ? 58.762  -62.866  -27.414 1.00 184.28 ? 7    DT  L "C3'" 1 
ATOM   3142  O  "O3'" . DT  H  2 7    ? 59.726  -63.017  -28.471 1.00 182.50 ? 7    DT  L "O3'" 1 
ATOM   3143  C  "C2'" . DT  H  2 7    ? 59.387  -62.665  -26.036 1.00 185.01 ? 7    DT  L "C2'" 1 
ATOM   3144  C  "C1'" . DT  H  2 7    ? 58.763  -61.375  -25.503 1.00 186.98 ? 7    DT  L "C1'" 1 
ATOM   3145  N  N1    . DT  H  2 7    ? 58.352  -61.382  -24.084 1.00 189.73 ? 7    DT  L N1    1 
ATOM   3146  C  C2    . DT  H  2 7    ? 58.730  -60.305  -23.294 1.00 199.18 ? 7    DT  L C2    1 
ATOM   3147  O  O2    . DT  H  2 7    ? 59.379  -59.345  -23.712 1.00 207.41 ? 7    DT  L O2    1 
ATOM   3148  N  N3    . DT  H  2 7    ? 58.315  -60.391  -21.987 1.00 197.58 ? 7    DT  L N3    1 
ATOM   3149  C  C4    . DT  H  2 7    ? 57.595  -61.399  -21.397 1.00 192.80 ? 7    DT  L C4    1 
ATOM   3150  O  O4    . DT  H  2 7    ? 57.294  -61.314  -20.208 1.00 176.43 ? 7    DT  L O4    1 
ATOM   3151  C  C5    . DT  H  2 7    ? 57.248  -62.502  -22.271 1.00 195.16 ? 7    DT  L C5    1 
ATOM   3152  C  C7    . DT  H  2 7    ? 56.466  -63.648  -21.717 1.00 198.86 ? 7    DT  L C7    1 
ATOM   3153  C  C6    . DT  H  2 7    ? 57.647  -62.440  -23.554 1.00 188.71 ? 7    DT  L C6    1 
ATOM   3154  P  P     . DG  H  2 8    ? 60.824  -64.203  -28.520 1.00 181.47 ? 8    DG  L P     1 
ATOM   3155  O  OP1   . DG  H  2 8    ? 61.199  -64.437  -29.936 1.00 174.74 ? 8    DG  L OP1   1 
ATOM   3156  O  OP2   . DG  H  2 8    ? 60.312  -65.346  -27.710 1.00 177.12 ? 8    DG  L OP2   1 
ATOM   3157  O  "O5'" . DG  H  2 8    ? 62.102  -63.576  -27.798 1.00 179.05 ? 8    DG  L "O5'" 1 
ATOM   3158  C  "C5'" . DG  H  2 8    ? 62.549  -62.228  -28.081 1.00 175.88 ? 8    DG  L "C5'" 1 
ATOM   3159  C  "C4'" . DG  H  2 8    ? 63.592  -61.774  -27.081 1.00 174.26 ? 8    DG  L "C4'" 1 
ATOM   3160  O  "O4'" . DG  H  2 8    ? 62.977  -61.451  -25.810 1.00 161.91 ? 8    DG  L "O4'" 1 
ATOM   3161  C  "C3'" . DG  H  2 8    ? 64.694  -62.791  -26.775 1.00 172.36 ? 8    DG  L "C3'" 1 
ATOM   3162  O  "O3'" . DG  H  2 8    ? 65.971  -62.148  -26.785 1.00 181.50 ? 8    DG  L "O3'" 1 
ATOM   3163  C  "C2'" . DG  H  2 8    ? 64.332  -63.305  -25.394 1.00 164.02 ? 8    DG  L "C2'" 1 
ATOM   3164  C  "C1'" . DG  H  2 8    ? 63.670  -62.099  -24.759 1.00 162.71 ? 8    DG  L "C1'" 1 
ATOM   3165  N  N9    . DG  H  2 8    ? 62.703  -62.404  -23.707 1.00 172.13 ? 8    DG  L N9    1 
ATOM   3166  C  C8    . DG  H  2 8    ? 61.694  -63.336  -23.748 1.00 168.95 ? 8    DG  L C8    1 
ATOM   3167  N  N7    . DG  H  2 8    ? 60.984  -63.370  -22.653 1.00 171.62 ? 8    DG  L N7    1 
ATOM   3168  C  C5    . DG  H  2 8    ? 61.556  -62.401  -21.840 1.00 176.48 ? 8    DG  L C5    1 
ATOM   3169  C  C6    . DG  H  2 8    ? 61.215  -61.982  -20.526 1.00 182.10 ? 8    DG  L C6    1 
ATOM   3170  O  O6    . DG  H  2 8    ? 60.307  -62.399  -19.795 1.00 182.61 ? 8    DG  L O6    1 
ATOM   3171  N  N1    . DG  H  2 8    ? 62.058  -60.968  -20.077 1.00 185.62 ? 8    DG  L N1    1 
ATOM   3172  C  C2    . DG  H  2 8    ? 63.093  -60.424  -20.799 1.00 182.71 ? 8    DG  L C2    1 
ATOM   3173  N  N2    . DG  H  2 8    ? 63.791  -59.453  -20.194 1.00 180.65 ? 8    DG  L N2    1 
ATOM   3174  N  N3    . DG  H  2 8    ? 63.422  -60.808  -22.022 1.00 188.19 ? 8    DG  L N3    1 
ATOM   3175  C  C4    . DG  H  2 8    ? 62.617  -61.792  -22.478 1.00 180.76 ? 8    DG  L C4    1 
ATOM   3176  P  P     . DT  H  2 9    ? 67.356  -62.954  -26.771 1.00 174.92 ? 9    DT  L P     1 
ATOM   3177  O  OP1   . DT  H  2 9    ? 68.145  -62.468  -27.920 1.00 179.32 ? 9    DT  L OP1   1 
ATOM   3178  O  OP2   . DT  H  2 9    ? 67.087  -64.405  -26.632 1.00 174.07 ? 9    DT  L OP2   1 
ATOM   3179  O  "O5'" . DT  H  2 9    ? 68.051  -62.449  -25.428 1.00 179.95 ? 9    DT  L "O5'" 1 
ATOM   3180  C  "C5'" . DT  H  2 9    ? 67.983  -61.064  -25.010 1.00 179.80 ? 9    DT  L "C5'" 1 
ATOM   3181  C  "C4'" . DT  H  2 9    ? 68.355  -60.933  -23.552 1.00 173.94 ? 9    DT  L "C4'" 1 
ATOM   3182  O  "O4'" . DT  H  2 9    ? 67.201  -61.268  -22.742 1.00 163.10 ? 9    DT  L "O4'" 1 
ATOM   3183  C  "C3'" . DT  H  2 9    ? 69.484  -61.861  -23.095 1.00 174.43 ? 9    DT  L "C3'" 1 
ATOM   3184  O  "O3'" . DT  H  2 9    ? 70.399  -61.177  -22.225 1.00 186.29 ? 9    DT  L "O3'" 1 
ATOM   3185  C  "C2'" . DT  H  2 9    ? 68.742  -62.997  -22.414 1.00 164.06 ? 9    DT  L "C2'" 1 
ATOM   3186  C  "C1'" . DT  H  2 9    ? 67.553  -62.268  -21.803 1.00 166.47 ? 9    DT  L "C1'" 1 
ATOM   3187  N  N1    . DT  H  2 9    ? 66.342  -63.080  -21.515 1.00 168.57 ? 9    DT  L N1    1 
ATOM   3188  C  C2    . DT  H  2 9    ? 65.572  -62.739  -20.423 1.00 168.56 ? 9    DT  L C2    1 
ATOM   3189  O  O2    . DT  H  2 9    ? 65.828  -61.796  -19.692 1.00 173.48 ? 9    DT  L O2    1 
ATOM   3190  N  N3    . DT  H  2 9    ? 64.477  -63.545  -20.220 1.00 160.70 ? 9    DT  L N3    1 
ATOM   3191  C  C4    . DT  H  2 9    ? 64.091  -64.632  -20.981 1.00 155.62 ? 9    DT  L C4    1 
ATOM   3192  O  O4    . DT  H  2 9    ? 63.088  -65.267  -20.672 1.00 158.73 ? 9    DT  L O4    1 
ATOM   3193  C  C5    . DT  H  2 9    ? 64.946  -64.934  -22.108 1.00 152.31 ? 9    DT  L C5    1 
ATOM   3194  C  C7    . DT  H  2 9    ? 64.610  -66.099  -22.984 1.00 144.71 ? 9    DT  L C7    1 
ATOM   3195  C  C6    . DT  H  2 9    ? 66.014  -64.155  -22.314 1.00 161.34 ? 9    DT  L C6    1 
ATOM   3196  P  P     . DG  H  2 10   ? 72.012  -61.355  -22.236 1.00 199.81 ? 10   DG  L P     1 
ATOM   3197  O  OP1   . DG  H  2 10   ? 72.590  -60.170  -22.929 1.00 204.99 ? 10   DG  L OP1   1 
ATOM   3198  O  OP2   . DG  H  2 10   ? 72.409  -62.728  -22.657 1.00 189.46 ? 10   DG  L OP2   1 
ATOM   3199  O  "O5'" . DG  H  2 10   ? 72.426  -61.236  -20.703 1.00 197.75 ? 10   DG  L "O5'" 1 
ATOM   3200  C  "C5'" . DG  H  2 10   ? 71.834  -60.240  -19.843 1.00 201.51 ? 10   DG  L "C5'" 1 
ATOM   3201  C  "C4'" . DG  H  2 10   ? 71.635  -60.795  -18.451 1.00 199.77 ? 10   DG  L "C4'" 1 
ATOM   3202  O  "O4'" . DG  H  2 10   ? 70.421  -61.587  -18.386 1.00 191.59 ? 10   DG  L "O4'" 1 
ATOM   3203  C  "C3'" . DG  H  2 10   ? 72.767  -61.700  -17.959 1.00 204.33 ? 10   DG  L "C3'" 1 
ATOM   3204  O  "O3'" . DG  H  2 10   ? 73.179  -61.258  -16.662 1.00 210.32 ? 10   DG  L "O3'" 1 
ATOM   3205  C  "C2'" . DG  H  2 10   ? 72.149  -63.090  -17.965 1.00 200.06 ? 10   DG  L "C2'" 1 
ATOM   3206  C  "C1'" . DG  H  2 10   ? 70.687  -62.792  -17.687 1.00 193.16 ? 10   DG  L "C1'" 1 
ATOM   3207  N  N9    . DG  H  2 10   ? 69.726  -63.799  -18.136 1.00 183.87 ? 10   DG  L N9    1 
ATOM   3208  C  C8    . DG  H  2 10   ? 69.770  -64.537  -19.294 1.00 176.76 ? 10   DG  L C8    1 
ATOM   3209  N  N7    . DG  H  2 10   ? 68.761  -65.357  -19.417 1.00 170.43 ? 10   DG  L N7    1 
ATOM   3210  C  C5    . DG  H  2 10   ? 68.007  -65.150  -18.271 1.00 172.05 ? 10   DG  L C5    1 
ATOM   3211  C  C6    . DG  H  2 10   ? 66.794  -65.754  -17.845 1.00 173.90 ? 10   DG  L C6    1 
ATOM   3212  O  O6    . DG  H  2 10   ? 66.122  -66.623  -18.415 1.00 171.24 ? 10   DG  L O6    1 
ATOM   3213  N  N1    . DG  H  2 10   ? 66.377  -65.253  -16.616 1.00 183.27 ? 10   DG  L N1    1 
ATOM   3214  C  C2    . DG  H  2 10   ? 67.038  -64.291  -15.889 1.00 184.39 ? 10   DG  L C2    1 
ATOM   3215  N  N2    . DG  H  2 10   ? 66.477  -63.937  -14.723 1.00 183.52 ? 10   DG  L N2    1 
ATOM   3216  N  N3    . DG  H  2 10   ? 68.165  -63.717  -16.277 1.00 185.26 ? 10   DG  L N3    1 
ATOM   3217  C  C4    . DG  H  2 10   ? 68.589  -64.190  -17.469 1.00 182.03 ? 10   DG  L C4    1 
ATOM   3218  P  P     . DG  H  2 11   ? 74.550  -61.719  -15.987 1.00 209.05 ? 11   DG  L P     1 
ATOM   3219  O  OP1   . DG  H  2 11   ? 75.409  -60.517  -15.818 1.00 210.82 ? 11   DG  L OP1   1 
ATOM   3220  O  OP2   . DG  H  2 11   ? 75.065  -62.889  -16.751 1.00 199.05 ? 11   DG  L OP2   1 
ATOM   3221  O  "O5'" . DG  H  2 11   ? 74.039  -62.191  -14.551 1.00 206.58 ? 11   DG  L "O5'" 1 
ATOM   3222  C  "C5'" . DG  H  2 11   ? 73.105  -61.404  -13.781 1.00 201.73 ? 11   DG  L "C5'" 1 
ATOM   3223  C  "C4'" . DG  H  2 11   ? 72.215  -62.300  -12.951 1.00 199.15 ? 11   DG  L "C4'" 1 
ATOM   3224  O  "O4'" . DG  H  2 11   ? 71.354  -63.075  -13.815 1.00 191.01 ? 11   DG  L "O4'" 1 
ATOM   3225  C  "C3'" . DG  H  2 11   ? 72.952  -63.308  -12.058 1.00 201.23 ? 11   DG  L "C3'" 1 
ATOM   3226  O  "O3'" . DG  H  2 11   ? 72.636  -63.088  -10.678 1.00 205.26 ? 11   DG  L "O3'" 1 
ATOM   3227  C  "C2'" . DG  H  2 11   ? 72.456  -64.667  -12.526 1.00 194.61 ? 11   DG  L "C2'" 1 
ATOM   3228  C  "C1'" . DG  H  2 11   ? 71.147  -64.337  -13.213 1.00 197.49 ? 11   DG  L "C1'" 1 
ATOM   3229  N  N9    . DG  H  2 11   ? 70.746  -65.272  -14.259 1.00 193.87 ? 11   DG  L N9    1 
ATOM   3230  C  C8    . DG  H  2 11   ? 71.444  -65.593  -15.397 1.00 190.29 ? 11   DG  L C8    1 
ATOM   3231  N  N7    . DG  H  2 11   ? 70.822  -66.457  -16.153 1.00 192.44 ? 11   DG  L N7    1 
ATOM   3232  C  C5    . DG  H  2 11   ? 69.644  -66.725  -15.471 1.00 191.36 ? 11   DG  L C5    1 
ATOM   3233  C  C6    . DG  H  2 11   ? 68.566  -67.589  -15.800 1.00 185.92 ? 11   DG  L C6    1 
ATOM   3234  O  O6    . DG  H  2 11   ? 68.433  -68.310  -16.797 1.00 176.24 ? 11   DG  L O6    1 
ATOM   3235  N  N1    . DG  H  2 11   ? 67.568  -67.555  -14.830 1.00 181.07 ? 11   DG  L N1    1 
ATOM   3236  C  C2    . DG  H  2 11   ? 67.603  -66.791  -13.688 1.00 183.46 ? 11   DG  L C2    1 
ATOM   3237  N  N2    . DG  H  2 11   ? 66.543  -66.894  -12.874 1.00 183.30 ? 11   DG  L N2    1 
ATOM   3238  N  N3    . DG  H  2 11   ? 68.601  -65.983  -13.370 1.00 190.02 ? 11   DG  L N3    1 
ATOM   3239  C  C4    . DG  H  2 11   ? 69.580  -66.000  -14.300 1.00 192.05 ? 11   DG  L C4    1 
ATOM   3240  P  P     . DC  H  2 12   ? 73.461  -63.790  -9.495  1.00 201.73 ? 12   DC  L P     1 
ATOM   3241  O  OP1   . DC  H  2 12   ? 73.655  -62.840  -8.369  1.00 212.16 ? 12   DC  L OP1   1 
ATOM   3242  O  OP2   . DC  H  2 12   ? 74.628  -64.513  -10.062 1.00 197.44 ? 12   DC  L OP2   1 
ATOM   3243  O  "O5'" . DC  H  2 12   ? 72.422  -64.886  -9.000  1.00 196.43 ? 12   DC  L "O5'" 1 
ATOM   3244  C  "C5'" . DC  H  2 12   ? 71.034  -64.563  -8.815  1.00 193.53 ? 12   DC  L "C5'" 1 
ATOM   3245  C  "C4'" . DC  H  2 12   ? 70.232  -65.834  -8.664  1.00 185.91 ? 12   DC  L "C4'" 1 
ATOM   3246  O  "O4'" . DC  H  2 12   ? 70.119  -66.498  -9.949  1.00 176.28 ? 12   DC  L "O4'" 1 
ATOM   3247  C  "C3'" . DC  H  2 12   ? 70.843  -66.861  -7.704  1.00 182.76 ? 12   DC  L "C3'" 1 
ATOM   3248  O  "O3'" . DC  H  2 12   ? 69.830  -67.418  -6.852  1.00 182.71 ? 12   DC  L "O3'" 1 
ATOM   3249  C  "C2'" . DC  H  2 12   ? 71.470  -67.882  -8.638  1.00 175.25 ? 12   DC  L "C2'" 1 
ATOM   3250  C  "C1'" . DC  H  2 12   ? 70.502  -67.858  -9.807  1.00 175.55 ? 12   DC  L "C1'" 1 
ATOM   3251  N  N1    . DC  H  2 12   ? 71.014  -68.333  -11.111 1.00 174.19 ? 12   DC  L N1    1 
ATOM   3252  C  C2    . DC  H  2 12   ? 70.165  -69.090  -11.927 1.00 173.84 ? 12   DC  L C2    1 
ATOM   3253  O  O2    . DC  H  2 12   ? 69.019  -69.345  -11.527 1.00 183.53 ? 12   DC  L O2    1 
ATOM   3254  N  N3    . DC  H  2 12   ? 70.612  -69.523  -13.129 1.00 167.33 ? 12   DC  L N3    1 
ATOM   3255  C  C4    . DC  H  2 12   ? 71.851  -69.224  -13.527 1.00 164.22 ? 12   DC  L C4    1 
ATOM   3256  N  N4    . DC  H  2 12   ? 72.251  -69.672  -14.720 1.00 152.82 ? 12   DC  L N4    1 
ATOM   3257  C  C5    . DC  H  2 12   ? 72.736  -68.450  -12.719 1.00 167.80 ? 12   DC  L C5    1 
ATOM   3258  C  C6    . DC  H  2 12   ? 72.282  -68.033  -11.529 1.00 172.39 ? 12   DC  L C6    1 
ATOM   3259  P  P     . DA  H  2 13   ? 70.139  -67.992  -5.379  1.00 182.14 ? 13   DA  L P     1 
ATOM   3260  O  OP1   . DA  H  2 13   ? 69.577  -67.080  -4.351  1.00 177.71 ? 13   DA  L OP1   1 
ATOM   3261  O  OP2   . DA  H  2 13   ? 71.578  -68.366  -5.299  1.00 182.03 ? 13   DA  L OP2   1 
ATOM   3262  O  "O5'" . DA  H  2 13   ? 69.277  -69.334  -5.395  1.00 184.36 ? 13   DA  L "O5'" 1 
ATOM   3263  C  "C5'" . DA  H  2 13   ? 67.853  -69.314  -5.610  1.00 181.38 ? 13   DA  L "C5'" 1 
ATOM   3264  C  "C4'" . DA  H  2 13   ? 67.416  -70.562  -6.343  1.00 181.39 ? 13   DA  L "C4'" 1 
ATOM   3265  O  "O4'" . DA  H  2 13   ? 68.109  -70.654  -7.613  1.00 164.71 ? 13   DA  L "O4'" 1 
ATOM   3266  C  "C3'" . DA  H  2 13   ? 67.689  -71.880  -5.607  1.00 178.23 ? 13   DA  L "C3'" 1 
ATOM   3267  O  "O3'" . DA  H  2 13   ? 66.511  -72.694  -5.583  1.00 177.20 ? 13   DA  L "O3'" 1 
ATOM   3268  C  "C2'" . DA  H  2 13   ? 68.782  -72.536  -6.432  1.00 171.89 ? 13   DA  L "C2'" 1 
ATOM   3269  C  "C1'" . DA  H  2 13   ? 68.495  -71.997  -7.819  1.00 163.96 ? 13   DA  L "C1'" 1 
ATOM   3270  N  N9    . DA  H  2 13   ? 69.640  -71.996  -8.722  1.00 156.59 ? 13   DA  L N9    1 
ATOM   3271  C  C8    . DA  H  2 13   ? 70.889  -71.481  -8.483  1.00 161.40 ? 13   DA  L C8    1 
ATOM   3272  N  N7    . DA  H  2 13   ? 71.721  -71.625  -9.487  1.00 154.74 ? 13   DA  L N7    1 
ATOM   3273  C  C5    . DA  H  2 13   ? 70.966  -72.274  -10.453 1.00 150.66 ? 13   DA  L C5    1 
ATOM   3274  C  C6    . DA  H  2 13   ? 71.271  -72.715  -11.753 1.00 154.32 ? 13   DA  L C6    1 
ATOM   3275  N  N6    . DA  H  2 13   ? 72.466  -72.560  -12.327 1.00 156.72 ? 13   DA  L N6    1 
ATOM   3276  N  N1    . DA  H  2 13   ? 70.294  -73.334  -12.453 1.00 154.99 ? 13   DA  L N1    1 
ATOM   3277  C  C2    . DA  H  2 13   ? 69.096  -73.497  -11.875 1.00 154.63 ? 13   DA  L C2    1 
ATOM   3278  N  N3    . DA  H  2 13   ? 68.689  -73.123  -10.662 1.00 155.40 ? 13   DA  L N3    1 
ATOM   3279  C  C4    . DA  H  2 13   ? 69.683  -72.511  -9.994  1.00 152.87 ? 13   DA  L C4    1 
ATOM   3280  P  P     . DC  H  2 14   ? 66.419  -74.037  -4.723  1.00 177.43 ? 14   DC  L P     1 
ATOM   3281  O  OP1   . DC  H  2 14   ? 65.129  -74.048  -3.971  1.00 189.62 ? 14   DC  L OP1   1 
ATOM   3282  O  OP2   . DC  H  2 14   ? 67.694  -74.217  -3.985  1.00 177.56 ? 14   DC  L OP2   1 
ATOM   3283  O  "O5'" . DC  H  2 14   ? 66.369  -75.127  -5.885  1.00 172.18 ? 14   DC  L "O5'" 1 
ATOM   3284  C  "C5'" . DC  H  2 14   ? 65.228  -75.253  -6.759  1.00 171.00 ? 14   DC  L "C5'" 1 
ATOM   3285  C  "C4'" . DC  H  2 14   ? 65.403  -76.435  -7.687  1.00 171.54 ? 14   DC  L "C4'" 1 
ATOM   3286  O  "O4'" . DC  H  2 14   ? 66.518  -76.184  -8.578  1.00 177.00 ? 14   DC  L "O4'" 1 
ATOM   3287  C  "C3'" . DC  H  2 14   ? 65.704  -77.771  -6.999  1.00 176.15 ? 14   DC  L "C3'" 1 
ATOM   3288  O  "O3'" . DC  H  2 14   ? 64.986  -78.864  -7.588  1.00 179.78 ? 14   DC  L "O3'" 1 
ATOM   3289  C  "C2'" . DC  H  2 14   ? 67.200  -77.948  -7.190  1.00 174.52 ? 14   DC  L "C2'" 1 
ATOM   3290  C  "C1'" . DC  H  2 14   ? 67.443  -77.262  -8.523  1.00 175.53 ? 14   DC  L "C1'" 1 
ATOM   3291  N  N1    . DC  H  2 14   ? 68.803  -76.714  -8.730  1.00 178.79 ? 14   DC  L N1    1 
ATOM   3292  C  C2    . DC  H  2 14   ? 69.393  -76.838  -9.995  1.00 172.61 ? 14   DC  L C2    1 
ATOM   3293  O  O2    . DC  H  2 14   ? 68.762  -77.406  -10.901 1.00 156.09 ? 14   DC  L O2    1 
ATOM   3294  N  N3    . DC  H  2 14   ? 70.637  -76.342  -10.197 1.00 171.28 ? 14   DC  L N3    1 
ATOM   3295  C  C4    . DC  H  2 14   ? 71.284  -75.736  -9.197  1.00 173.94 ? 14   DC  L C4    1 
ATOM   3296  N  N4    . DC  H  2 14   ? 72.505  -75.257  -9.444  1.00 172.69 ? 14   DC  L N4    1 
ATOM   3297  C  C5    . DC  H  2 14   ? 70.707  -75.595  -7.901  1.00 173.22 ? 14   DC  L C5    1 
ATOM   3298  C  C6    . DC  H  2 14   ? 69.476  -76.092  -7.713  1.00 175.78 ? 14   DC  L C6    1 
ATOM   3299  P  P     . DT  H  2 15   ? 64.882  -80.306  -6.848  1.00 192.21 ? 15   DT  L P     1 
ATOM   3300  O  OP1   . DT  H  2 15   ? 63.457  -80.704  -6.669  1.00 190.41 ? 15   DT  L OP1   1 
ATOM   3301  O  OP2   . DT  H  2 15   ? 65.800  -80.319  -5.671  1.00 181.03 ? 15   DT  L OP2   1 
ATOM   3302  O  "O5'" . DT  H  2 15   ? 65.483  -81.317  -7.921  1.00 174.22 ? 15   DT  L "O5'" 1 
ATOM   3303  C  "C5'" . DT  H  2 15   ? 64.980  -81.365  -9.272  1.00 169.83 ? 15   DT  L "C5'" 1 
ATOM   3304  C  "C4'" . DT  H  2 15   ? 66.015  -81.968  -10.195 1.00 166.40 ? 15   DT  L "C4'" 1 
ATOM   3305  O  "O4'" . DT  H  2 15   ? 67.199  -81.138  -10.211 1.00 161.04 ? 15   DT  L "O4'" 1 
ATOM   3306  C  "C3'" . DT  H  2 15   ? 66.474  -83.378  -9.804  1.00 170.92 ? 15   DT  L "C3'" 1 
ATOM   3307  O  "O3'" . DT  H  2 15   ? 66.138  -84.350  -10.808 1.00 174.89 ? 15   DT  L "O3'" 1 
ATOM   3308  C  "C2'" . DT  H  2 15   ? 67.979  -83.258  -9.599  1.00 159.60 ? 15   DT  L "C2'" 1 
ATOM   3309  C  "C1'" . DT  H  2 15   ? 68.360  -81.945  -10.255 1.00 155.54 ? 15   DT  L "C1'" 1 
ATOM   3310  N  N1    . DT  H  2 15   ? 69.450  -81.209  -9.572  1.00 158.80 ? 15   DT  L N1    1 
ATOM   3311  C  C2    . DT  H  2 15   ? 70.615  -80.952  -10.266 1.00 157.54 ? 15   DT  L C2    1 
ATOM   3312  O  O2    . DT  H  2 15   ? 70.801  -81.301  -11.421 1.00 142.16 ? 15   DT  L O2    1 
ATOM   3313  N  N3    . DT  H  2 15   ? 71.566  -80.266  -9.551  1.00 160.81 ? 15   DT  L N3    1 
ATOM   3314  C  C4    . DT  H  2 15   ? 71.471  -79.821  -8.245  1.00 162.97 ? 15   DT  L C4    1 
ATOM   3315  O  O4    . DT  H  2 15   ? 72.408  -79.207  -7.740  1.00 160.38 ? 15   DT  L O4    1 
ATOM   3316  C  C5    . DT  H  2 15   ? 70.226  -80.128  -7.576  1.00 160.05 ? 15   DT  L C5    1 
ATOM   3317  C  C7    . DT  H  2 15   ? 70.033  -79.685  -6.161  1.00 152.12 ? 15   DT  L C7    1 
ATOM   3318  C  C6    . DT  H  2 15   ? 69.290  -80.796  -8.265  1.00 161.66 ? 15   DT  L C6    1 
ATOM   3319  P  P     . DG  H  2 16   ? 66.249  -85.948  -10.551 1.00 173.00 ? 16   DG  L P     1 
ATOM   3320  O  OP1   . DG  H  2 16   ? 65.138  -86.652  -11.240 1.00 183.89 ? 16   DG  L OP1   1 
ATOM   3321  O  OP2   . DG  H  2 16   ? 66.488  -86.210  -9.109  1.00 179.46 ? 16   DG  L OP2   1 
ATOM   3322  O  "O5'" . DG  H  2 16   ? 67.582  -86.341  -11.326 1.00 171.16 ? 16   DG  L "O5'" 1 
ATOM   3323  C  "C5'" . DG  H  2 16   ? 67.843  -85.797  -12.631 1.00 179.54 ? 16   DG  L "C5'" 1 
ATOM   3324  C  "C4'" . DG  H  2 16   ? 69.292  -86.004  -12.999 1.00 178.63 ? 16   DG  L "C4'" 1 
ATOM   3325  O  "O4'" . DG  H  2 16   ? 70.131  -85.041  -12.310 1.00 174.03 ? 16   DG  L "O4'" 1 
ATOM   3326  C  "C3'" . DG  H  2 16   ? 69.841  -87.382  -12.633 1.00 177.56 ? 16   DG  L "C3'" 1 
ATOM   3327  O  "O3'" . DG  H  2 16   ? 70.640  -87.841  -13.723 1.00 182.14 ? 16   DG  L "O3'" 1 
ATOM   3328  C  "C2'" . DG  H  2 16   ? 70.653  -87.115  -11.379 1.00 176.65 ? 16   DG  L "C2'" 1 
ATOM   3329  C  "C1'" . DG  H  2 16   ? 71.189  -85.721  -11.653 1.00 168.68 ? 16   DG  L "C1'" 1 
ATOM   3330  N  N9    . DG  H  2 16   ? 71.572  -84.937  -10.481 1.00 163.62 ? 16   DG  L N9    1 
ATOM   3331  C  C8    . DG  H  2 16   ? 70.951  -84.905  -9.254  1.00 164.14 ? 16   DG  L C8    1 
ATOM   3332  N  N7    . DG  H  2 16   ? 71.529  -84.094  -8.408  1.00 156.44 ? 16   DG  L N7    1 
ATOM   3333  C  C5    . DG  H  2 16   ? 72.591  -83.555  -9.121  1.00 157.25 ? 16   DG  L C5    1 
ATOM   3334  C  C6    . DG  H  2 16   ? 73.575  -82.612  -8.730  1.00 152.37 ? 16   DG  L C6    1 
ATOM   3335  O  O6    . DG  H  2 16   ? 73.710  -82.049  -7.639  1.00 149.33 ? 16   DG  L O6    1 
ATOM   3336  N  N1    . DG  H  2 16   ? 74.467  -82.343  -9.764  1.00 152.00 ? 16   DG  L N1    1 
ATOM   3337  C  C2    . DG  H  2 16   ? 74.416  -82.906  -11.016 1.00 150.19 ? 16   DG  L C2    1 
ATOM   3338  N  N2    . DG  H  2 16   ? 75.365  -82.517  -11.878 1.00 150.13 ? 16   DG  L N2    1 
ATOM   3339  N  N3    . DG  H  2 16   ? 73.504  -83.786  -11.394 1.00 149.35 ? 16   DG  L N3    1 
ATOM   3340  C  C4    . DG  H  2 16   ? 72.630  -84.064  -10.403 1.00 158.20 ? 16   DG  L C4    1 
ATOM   3341  P  P     . DG  H  2 17   ? 71.030  -89.378  -13.855 1.00 195.33 ? 17   DG  L P     1 
ATOM   3342  O  OP1   . DG  H  2 17   ? 70.336  -89.961  -15.037 1.00 196.57 ? 17   DG  L OP1   1 
ATOM   3343  O  OP2   . DG  H  2 17   ? 70.898  -90.022  -12.521 1.00 194.89 ? 17   DG  L OP2   1 
ATOM   3344  O  "O5'" . DG  H  2 17   ? 72.586  -89.327  -14.184 1.00 199.24 ? 17   DG  L "O5'" 1 
ATOM   3345  C  "C5'" . DG  H  2 17   ? 73.195  -88.190  -14.832 1.00 190.00 ? 17   DG  L "C5'" 1 
ATOM   3346  C  "C4'" . DG  H  2 17   ? 74.697  -88.241  -14.666 1.00 183.13 ? 17   DG  L "C4'" 1 
ATOM   3347  O  "O4'" . DG  H  2 17   ? 75.094  -87.359  -13.587 1.00 165.54 ? 17   DG  L "O4'" 1 
ATOM   3348  C  "C3'" . DG  H  2 17   ? 75.264  -89.621  -14.319 1.00 191.39 ? 17   DG  L "C3'" 1 
ATOM   3349  O  "O3'" . DG  H  2 17   ? 76.501  -89.887  -14.997 1.00 207.56 ? 17   DG  L "O3'" 1 
ATOM   3350  C  "C2'" . DG  H  2 17   ? 75.420  -89.566  -12.811 1.00 184.72 ? 17   DG  L "C2'" 1 
ATOM   3351  C  "C1'" . DG  H  2 17   ? 75.709  -88.095  -12.537 1.00 172.34 ? 17   DG  L "C1'" 1 
ATOM   3352  N  N9    . DG  H  2 17   ? 75.192  -87.590  -11.265 1.00 164.98 ? 17   DG  L N9    1 
ATOM   3353  C  C8    . DG  H  2 17   ? 74.043  -87.981  -10.618 1.00 162.49 ? 17   DG  L C8    1 
ATOM   3354  N  N7    . DG  H  2 17   ? 73.843  -87.341  -9.498  1.00 154.59 ? 17   DG  L N7    1 
ATOM   3355  C  C5    . DG  H  2 17   ? 74.928  -86.482  -9.395  1.00 156.85 ? 17   DG  L C5    1 
ATOM   3356  C  C6    . DG  H  2 17   ? 75.261  -85.540  -8.387  1.00 152.35 ? 17   DG  L C6    1 
ATOM   3357  O  O6    . DG  H  2 17   ? 74.637  -85.264  -7.354  1.00 141.59 ? 17   DG  L O6    1 
ATOM   3358  N  N1    . DG  H  2 17   ? 76.452  -84.880  -8.677  1.00 148.82 ? 17   DG  L N1    1 
ATOM   3359  C  C2    . DG  H  2 17   ? 77.222  -85.097  -9.794  1.00 149.63 ? 17   DG  L C2    1 
ATOM   3360  N  N2    . DG  H  2 17   ? 78.332  -84.355  -9.897  1.00 157.55 ? 17   DG  L N2    1 
ATOM   3361  N  N3    . DG  H  2 17   ? 76.923  -85.972  -10.740 1.00 154.04 ? 17   DG  L N3    1 
ATOM   3362  C  C4    . DG  H  2 17   ? 75.771  -86.625  -10.477 1.00 159.21 ? 17   DG  L C4    1 
ATOM   3363  P  P     . DC  H  2 18   ? 77.286  -91.304  -14.932 1.00 219.38 ? 18   DC  L P     1 
ATOM   3364  O  OP1   . DC  H  2 18   ? 77.695  -91.670  -16.315 1.00 226.72 ? 18   DC  L OP1   1 
ATOM   3365  O  OP2   . DC  H  2 18   ? 76.538  -92.292  -14.113 1.00 205.16 ? 18   DC  L OP2   1 
ATOM   3366  O  "O5'" . DC  H  2 18   ? 78.601  -90.895  -14.129 1.00 204.77 ? 18   DC  L "O5'" 1 
ATOM   3367  C  "C5'" . DC  H  2 18   ? 79.367  -89.732  -14.509 1.00 198.64 ? 18   DC  L "C5'" 1 
ATOM   3368  C  "C4'" . DC  H  2 18   ? 80.093  -89.164  -13.314 1.00 189.14 ? 18   DC  L "C4'" 1 
ATOM   3369  O  "O4'" . DC  H  2 18   ? 79.145  -88.776  -12.299 1.00 179.96 ? 18   DC  L "O4'" 1 
ATOM   3370  C  "C3'" . DC  H  2 18   ? 81.066  -90.135  -12.639 1.00 192.74 ? 18   DC  L "C3'" 1 
ATOM   3371  O  "O3'" . DC  H  2 18   ? 82.409  -89.707  -12.890 1.00 199.19 ? 18   DC  L "O3'" 1 
ATOM   3372  C  "C2'" . DC  H  2 18   ? 80.686  -90.101  -11.164 1.00 186.50 ? 18   DC  L "C2'" 1 
ATOM   3373  C  "C1'" . DC  H  2 18   ? 79.779  -88.890  -11.041 1.00 182.98 ? 18   DC  L "C1'" 1 
ATOM   3374  N  N1    . DC  H  2 18   ? 78.728  -88.996  -10.010 1.00 180.93 ? 18   DC  L N1    1 
ATOM   3375  C  C2    . DC  H  2 18   ? 78.723  -88.088  -8.943  1.00 174.60 ? 18   DC  L C2    1 
ATOM   3376  O  O2    . DC  H  2 18   ? 79.611  -87.226  -8.886  1.00 176.88 ? 18   DC  L O2    1 
ATOM   3377  N  N3    . DC  H  2 18   ? 77.758  -88.180  -7.999  1.00 171.08 ? 18   DC  L N3    1 
ATOM   3378  C  C4    . DC  H  2 18   ? 76.821  -89.126  -8.094  1.00 177.37 ? 18   DC  L C4    1 
ATOM   3379  N  N4    . DC  H  2 18   ? 75.891  -89.182  -7.138  1.00 178.76 ? 18   DC  L N4    1 
ATOM   3380  C  C5    . DC  H  2 18   ? 76.800  -90.060  -9.171  1.00 179.21 ? 18   DC  L C5    1 
ATOM   3381  C  C6    . DC  H  2 18   ? 77.762  -89.960  -10.097 1.00 180.87 ? 18   DC  L C6    1 
ATOM   3382  P  P     . DC  H  2 19   ? 83.670  -90.550  -12.373 1.00 218.19 ? 19   DC  L P     1 
ATOM   3383  O  OP1   . DC  H  2 19   ? 84.807  -90.310  -13.303 1.00 231.39 ? 19   DC  L OP1   1 
ATOM   3384  O  OP2   . DC  H  2 19   ? 83.248  -91.945  -12.056 1.00 210.58 ? 19   DC  L OP2   1 
ATOM   3385  O  "O5'" . DC  H  2 19   ? 84.045  -89.838  -11.001 1.00 199.29 ? 19   DC  L "O5'" 1 
ATOM   3386  C  "C5'" . DC  H  2 19   ? 84.017  -88.405  -10.876 1.00 191.81 ? 19   DC  L "C5'" 1 
ATOM   3387  C  "C4'" . DC  H  2 19   ? 84.255  -88.012  -9.437  1.00 186.02 ? 19   DC  L "C4'" 1 
ATOM   3388  O  "O4'" . DC  H  2 19   ? 83.012  -88.106  -8.701  1.00 174.94 ? 19   DC  L "O4'" 1 
ATOM   3389  C  "C3'" . DC  H  2 19   ? 85.263  -88.895  -8.695  1.00 191.04 ? 19   DC  L "C3'" 1 
ATOM   3390  O  "O3'" . DC  H  2 19   ? 86.142  -88.114  -7.886  1.00 198.47 ? 19   DC  L "O3'" 1 
ATOM   3391  C  "C2'" . DC  H  2 19   ? 84.398  -89.774  -7.814  1.00 182.53 ? 19   DC  L "C2'" 1 
ATOM   3392  C  "C1'" . DC  H  2 19   ? 83.214  -88.869  -7.525  1.00 172.62 ? 19   DC  L "C1'" 1 
ATOM   3393  N  N1    . DC  H  2 19   ? 81.952  -89.559  -7.210  1.00 164.32 ? 19   DC  L N1    1 
ATOM   3394  C  C2    . DC  H  2 19   ? 81.160  -89.057  -6.174  1.00 165.66 ? 19   DC  L C2    1 
ATOM   3395  O  O2    . DC  H  2 19   ? 81.544  -88.049  -5.560  1.00 159.28 ? 19   DC  L O2    1 
ATOM   3396  N  N3    . DC  H  2 19   ? 79.996  -89.679  -5.870  1.00 169.98 ? 19   DC  L N3    1 
ATOM   3397  C  C4    . DC  H  2 19   ? 79.620  -90.764  -6.552  1.00 167.51 ? 19   DC  L C4    1 
ATOM   3398  N  N4    . DC  H  2 19   ? 78.468  -91.348  -6.215  1.00 168.39 ? 19   DC  L N4    1 
ATOM   3399  C  C5    . DC  H  2 19   ? 80.408  -91.295  -7.614  1.00 165.70 ? 19   DC  L C5    1 
ATOM   3400  C  C6    . DC  H  2 19   ? 81.553  -90.665  -7.908  1.00 167.13 ? 19   DC  L C6    1 
ATOM   3401  P  P     . DG  H  2 20   ? 87.611  -88.647  -7.551  1.00 219.92 ? 20   DG  L P     1 
ATOM   3402  O  OP1   . DG  H  2 20   ? 88.596  -87.755  -8.224  1.00 226.82 ? 20   DG  L OP1   1 
ATOM   3403  O  OP2   . DG  H  2 20   ? 87.672  -90.117  -7.769  1.00 228.46 ? 20   DG  L OP2   1 
ATOM   3404  O  "O5'" . DG  H  2 20   ? 87.686  -88.382  -5.984  1.00 212.99 ? 20   DG  L "O5'" 1 
ATOM   3405  C  "C5'" . DG  H  2 20   ? 87.242  -87.134  -5.421  1.00 201.16 ? 20   DG  L "C5'" 1 
ATOM   3406  C  "C4'" . DG  H  2 20   ? 86.767  -87.343  -4.000  1.00 188.75 ? 20   DG  L "C4'" 1 
ATOM   3407  O  "O4'" . DG  H  2 20   ? 85.471  -87.986  -3.996  1.00 171.59 ? 20   DG  L "O4'" 1 
ATOM   3408  C  "C3'" . DG  H  2 20   ? 87.668  -88.228  -3.134  1.00 184.89 ? 20   DG  L "C3'" 1 
ATOM   3409  O  "O3'" . DG  H  2 20   ? 87.707  -87.714  -1.803  1.00 176.20 ? 20   DG  L "O3'" 1 
ATOM   3410  C  "C2'" . DG  H  2 20   ? 86.941  -89.557  -3.118  1.00 173.68 ? 20   DG  L "C2'" 1 
ATOM   3411  C  "C1'" . DG  H  2 20   ? 85.511  -89.073  -3.089  1.00 169.09 ? 20   DG  L "C1'" 1 
ATOM   3412  N  N9    . DG  H  2 20   ? 84.502  -90.036  -3.503  1.00 167.43 ? 20   DG  L N9    1 
ATOM   3413  C  C8    . DG  H  2 20   ? 84.599  -90.970  -4.506  1.00 175.10 ? 20   DG  L C8    1 
ATOM   3414  N  N7    . DG  H  2 20   ? 83.516  -91.685  -4.645  1.00 176.92 ? 20   DG  L N7    1 
ATOM   3415  C  C5    . DG  H  2 20   ? 82.650  -91.189  -3.680  1.00 165.05 ? 20   DG  L C5    1 
ATOM   3416  C  C6    . DG  H  2 20   ? 81.324  -91.572  -3.352  1.00 164.03 ? 20   DG  L C6    1 
ATOM   3417  O  O6    . DG  H  2 20   ? 80.624  -92.449  -3.873  1.00 163.72 ? 20   DG  L O6    1 
ATOM   3418  N  N1    . DG  H  2 20   ? 80.815  -90.806  -2.307  1.00 161.85 ? 20   DG  L N1    1 
ATOM   3419  C  C2    . DG  H  2 20   ? 81.497  -89.805  -1.656  1.00 159.05 ? 20   DG  L C2    1 
ATOM   3420  N  N2    . DG  H  2 20   ? 80.837  -89.180  -0.671  1.00 160.44 ? 20   DG  L N2    1 
ATOM   3421  N  N3    . DG  H  2 20   ? 82.731  -89.438  -1.955  1.00 153.95 ? 20   DG  L N3    1 
ATOM   3422  C  C4    . DG  H  2 20   ? 83.244  -90.169  -2.968  1.00 163.04 ? 20   DG  L C4    1 
ATOM   3423  P  P     . DT  H  2 21   ? 89.033  -87.844  -0.933  1.00 185.39 ? 21   DT  L P     1 
ATOM   3424  O  OP1   . DT  H  2 21   ? 89.970  -86.740  -1.299  1.00 182.11 ? 21   DT  L OP1   1 
ATOM   3425  O  OP2   . DT  H  2 21   ? 89.484  -89.256  -1.047  1.00 190.06 ? 21   DT  L OP2   1 
ATOM   3426  O  "O5'" . DT  H  2 21   ? 88.410  -87.609  0.515   1.00 175.73 ? 21   DT  L "O5'" 1 
ATOM   3427  C  "C5'" . DT  H  2 21   ? 87.296  -86.712  0.723   1.00 170.66 ? 21   DT  L "C5'" 1 
ATOM   3428  C  "C4'" . DT  H  2 21   ? 86.216  -87.367  1.556   1.00 164.81 ? 21   DT  L "C4'" 1 
ATOM   3429  O  "O4'" . DT  H  2 21   ? 85.515  -88.365  0.783   1.00 163.18 ? 21   DT  L "O4'" 1 
ATOM   3430  C  "C3'" . DT  H  2 21   ? 86.705  -88.074  2.826   1.00 164.74 ? 21   DT  L "C3'" 1 
ATOM   3431  O  "O3'" . DT  H  2 21   ? 86.246  -87.361  3.982   1.00 167.06 ? 21   DT  L "O3'" 1 
ATOM   3432  C  "C2'" . DT  H  2 21   ? 86.116  -89.474  2.741   1.00 158.85 ? 21   DT  L "C2'" 1 
ATOM   3433  C  "C1'" . DT  H  2 21   ? 85.050  -89.361  1.671   1.00 159.34 ? 21   DT  L "C1'" 1 
ATOM   3434  N  N1    . DT  H  2 21   ? 84.817  -90.595  0.893   1.00 164.26 ? 21   DT  L N1    1 
ATOM   3435  C  C2    . DT  H  2 21   ? 83.620  -91.253  1.066   1.00 167.68 ? 21   DT  L C2    1 
ATOM   3436  O  O2    . DT  H  2 21   ? 82.749  -90.866  1.830   1.00 159.66 ? 21   DT  L O2    1 
ATOM   3437  N  N3    . DT  H  2 21   ? 83.475  -92.387  0.302   1.00 174.59 ? 21   DT  L N3    1 
ATOM   3438  C  C4    . DT  H  2 21   ? 84.390  -92.915  -0.594  1.00 167.60 ? 21   DT  L C4    1 
ATOM   3439  O  O4    . DT  H  2 21   ? 84.121  -93.940  -1.216  1.00 159.60 ? 21   DT  L O4    1 
ATOM   3440  C  C5    . DT  H  2 21   ? 85.621  -92.174  -0.723  1.00 163.68 ? 21   DT  L C5    1 
ATOM   3441  C  C7    . DT  H  2 21   ? 86.668  -92.670  -1.669  1.00 170.27 ? 21   DT  L C7    1 
ATOM   3442  C  C6    . DT  H  2 21   ? 85.773  -91.067  0.018   1.00 166.68 ? 21   DT  L C6    1 
ATOM   3443  P  P     . DC  H  2 22   ? 86.819  -87.652  5.456   1.00 178.72 ? 22   DC  L P     1 
ATOM   3444  O  OP1   . DC  H  2 22   ? 86.938  -86.352  6.170   1.00 176.53 ? 22   DC  L OP1   1 
ATOM   3445  O  OP2   . DC  H  2 22   ? 88.006  -88.538  5.353   1.00 184.03 ? 22   DC  L OP2   1 
ATOM   3446  O  "O5'" . DC  H  2 22   ? 85.640  -88.503  6.109   1.00 166.19 ? 22   DC  L "O5'" 1 
ATOM   3447  C  "C5'" . DC  H  2 22   ? 84.267  -88.093  5.948   1.00 159.57 ? 22   DC  L "C5'" 1 
ATOM   3448  C  "C4'" . DC  H  2 22   ? 83.327  -89.202  6.356   1.00 154.48 ? 22   DC  L "C4'" 1 
ATOM   3449  O  "O4'" . DC  H  2 22   ? 83.324  -90.252  5.358   1.00 156.79 ? 22   DC  L "O4'" 1 
ATOM   3450  C  "C3'" . DC  H  2 22   ? 83.666  -89.879  7.684   1.00 154.25 ? 22   DC  L "C3'" 1 
ATOM   3451  O  "O3'" . DC  H  2 22   ? 82.469  -90.079  8.438   1.00 152.03 ? 22   DC  L "O3'" 1 
ATOM   3452  C  "C2'" . DC  H  2 22   ? 84.282  -91.202  7.269   1.00 153.34 ? 22   DC  L "C2'" 1 
ATOM   3453  C  "C1'" . DC  H  2 22   ? 83.539  -91.510  5.983   1.00 151.40 ? 22   DC  L "C1'" 1 
ATOM   3454  N  N1    . DC  H  2 22   ? 84.238  -92.383  5.019   1.00 147.58 ? 22   DC  L N1    1 
ATOM   3455  C  C2    . DC  H  2 22   ? 83.503  -93.365  4.350   1.00 143.69 ? 22   DC  L C2    1 
ATOM   3456  O  O2    . DC  H  2 22   ? 82.294  -93.478  4.594   1.00 138.87 ? 22   DC  L O2    1 
ATOM   3457  N  N3    . DC  H  2 22   ? 84.126  -94.159  3.448   1.00 150.57 ? 22   DC  L N3    1 
ATOM   3458  C  C4    . DC  H  2 22   ? 85.429  -93.996  3.203   1.00 145.05 ? 22   DC  L C4    1 
ATOM   3459  N  N4    . DC  H  2 22   ? 86.004  -94.802  2.308   1.00 139.07 ? 22   DC  L N4    1 
ATOM   3460  C  C5    . DC  H  2 22   ? 86.202  -93.002  3.869   1.00 147.65 ? 22   DC  L C5    1 
ATOM   3461  C  C6    . DC  H  2 22   ? 85.572  -92.224  4.760   1.00 150.38 ? 22   DC  L C6    1 
ATOM   3462  P  P     . DG  H  2 23   ? 82.552  -90.280  10.011  1.00 157.64 ? 23   DG  L P     1 
ATOM   3463  O  OP1   . DG  H  2 23   ? 81.954  -89.096  10.674  1.00 161.41 ? 23   DG  L OP1   1 
ATOM   3464  O  OP2   . DG  H  2 23   ? 83.937  -90.697  10.348  1.00 155.61 ? 23   DG  L OP2   1 
ATOM   3465  O  "O5'" . DG  H  2 23   ? 81.579  -91.512  10.261  1.00 143.17 ? 23   DG  L "O5'" 1 
ATOM   3466  C  "C5'" . DG  H  2 23   ? 80.379  -91.667  9.498   1.00 136.90 ? 23   DG  L "C5'" 1 
ATOM   3467  C  "C4'" . DG  H  2 23   ? 80.025  -93.131  9.392   1.00 137.62 ? 23   DG  L "C4'" 1 
ATOM   3468  O  "O4'" . DG  H  2 23   ? 80.797  -93.746  8.334   1.00 135.38 ? 23   DG  L "O4'" 1 
ATOM   3469  C  "C3'" . DG  H  2 23   ? 80.302  -93.957  10.651  1.00 140.67 ? 23   DG  L "C3'" 1 
ATOM   3470  O  "O3'" . DG  H  2 23   ? 79.204  -94.841  10.877  1.00 142.79 ? 23   DG  L "O3'" 1 
ATOM   3471  C  "C2'" . DG  H  2 23   ? 81.556  -94.734  10.296  1.00 142.08 ? 23   DG  L "C2'" 1 
ATOM   3472  C  "C1'" . DG  H  2 23   ? 81.352  -94.958  8.814   1.00 141.03 ? 23   DG  L "C1'" 1 
ATOM   3473  N  N9    . DG  H  2 23   ? 82.555  -95.245  8.038   1.00 146.65 ? 23   DG  L N9    1 
ATOM   3474  C  C8    . DG  H  2 23   ? 83.809  -94.709  8.210   1.00 153.90 ? 23   DG  L C8    1 
ATOM   3475  N  N7    . DG  H  2 23   ? 84.680  -95.154  7.343   1.00 157.46 ? 23   DG  L N7    1 
ATOM   3476  C  C5    . DG  H  2 23   ? 83.958  -96.037  6.553   1.00 153.67 ? 23   DG  L C5    1 
ATOM   3477  C  C6    . DG  H  2 23   ? 84.371  -96.834  5.456   1.00 152.67 ? 23   DG  L C6    1 
ATOM   3478  O  O6    . DG  H  2 23   ? 85.495  -96.926  4.951   1.00 159.83 ? 23   DG  L O6    1 
ATOM   3479  N  N1    . DG  H  2 23   ? 83.318  -97.586  4.944   1.00 153.91 ? 23   DG  L N1    1 
ATOM   3480  C  C2    . DG  H  2 23   ? 82.033  -97.576  5.427   1.00 158.54 ? 23   DG  L C2    1 
ATOM   3481  N  N2    . DG  H  2 23   ? 81.157  -98.371  4.794   1.00 165.14 ? 23   DG  L N2    1 
ATOM   3482  N  N3    . DG  H  2 23   ? 81.636  -96.844  6.458   1.00 158.66 ? 23   DG  L N3    1 
ATOM   3483  C  C4    . DG  H  2 23   ? 82.645  -96.106  6.970   1.00 156.07 ? 23   DG  L C4    1 
ATOM   3484  P  P     . DT  H  2 24   ? 78.851  -95.395  12.325  1.00 156.60 ? 24   DT  L P     1 
ATOM   3485  O  OP1   . DT  H  2 24   ? 77.767  -94.534  12.882  1.00 160.17 ? 24   DT  L OP1   1 
ATOM   3486  O  OP2   . DT  H  2 24   ? 80.118  -95.570  13.075  1.00 160.58 ? 24   DT  L OP2   1 
ATOM   3487  O  "O5'" . DT  H  2 24   ? 78.295  -96.858  12.027  1.00 158.86 ? 24   DT  L "O5'" 1 
ATOM   3488  C  "C5'" . DT  H  2 24   ? 77.499  -97.143  10.857  1.00 153.29 ? 24   DT  L "C5'" 1 
ATOM   3489  C  "C4'" . DT  H  2 24   ? 77.999  -98.383  10.148  1.00 149.97 ? 24   DT  L "C4'" 1 
ATOM   3490  O  "O4'" . DT  H  2 24   ? 79.299  -98.141  9.560   1.00 151.50 ? 24   DT  L "O4'" 1 
ATOM   3491  C  "C3'" . DT  H  2 24   ? 78.149  -99.628  11.034  1.00 151.22 ? 24   DT  L "C3'" 1 
ATOM   3492  O  "O3'" . DT  H  2 24   ? 77.275  -100.668 10.580  1.00 156.24 ? 24   DT  L "O3'" 1 
ATOM   3493  C  "C2'" . DT  H  2 24   ? 79.611  -100.025 10.888  1.00 151.21 ? 24   DT  L "C2'" 1 
ATOM   3494  C  "C1'" . DT  H  2 24   ? 80.021  -99.354  9.589   1.00 155.86 ? 24   DT  L "C1'" 1 
ATOM   3495  N  N1    . DT  H  2 24   ? 81.462  -99.040  9.450   1.00 157.85 ? 24   DT  L N1    1 
ATOM   3496  C  C2    . DT  H  2 24   ? 82.118  -99.527  8.342   1.00 162.14 ? 24   DT  L C2    1 
ATOM   3497  O  O2    . DT  H  2 24   ? 81.564  -100.189 7.479   1.00 170.72 ? 24   DT  L O2    1 
ATOM   3498  N  N3    . DT  H  2 24   ? 83.454  -99.212  8.282   1.00 166.45 ? 24   DT  L N3    1 
ATOM   3499  C  C4    . DT  H  2 24   ? 84.181  -98.475  9.199   1.00 165.58 ? 24   DT  L C4    1 
ATOM   3500  O  O4    . DT  H  2 24   ? 85.376  -98.271  9.011   1.00 163.77 ? 24   DT  L O4    1 
ATOM   3501  C  C5    . DT  H  2 24   ? 83.428  -97.998  10.338  1.00 166.94 ? 24   DT  L C5    1 
ATOM   3502  C  C7    . DT  H  2 24   ? 84.133  -97.191  11.383  1.00 167.97 ? 24   DT  L C7    1 
ATOM   3503  C  C6    . DT  H  2 24   ? 82.127  -98.306  10.410  1.00 161.46 ? 24   DT  L C6    1 
ATOM   3504  P  P     . DT  H  2 25   ? 76.695  -101.844 11.511  1.00 163.74 ? 25   DT  L P     1 
ATOM   3505  O  OP1   . DT  H  2 25   ? 75.214  -101.786 11.490  1.00 171.79 ? 25   DT  L OP1   1 
ATOM   3506  O  OP2   . DT  H  2 25   ? 77.406  -101.832 12.814  1.00 166.30 ? 25   DT  L OP2   1 
ATOM   3507  O  "O5'" . DT  H  2 25   ? 77.097  -103.170 10.724  1.00 169.43 ? 25   DT  L "O5'" 1 
ATOM   3508  C  "C5'" . DT  H  2 25   ? 77.159  -103.197 9.280   1.00 169.66 ? 25   DT  L "C5'" 1 
ATOM   3509  C  "C4'" . DT  H  2 25   ? 78.228  -104.155 8.805   1.00 167.15 ? 25   DT  L "C4'" 1 
ATOM   3510  O  "O4'" . DT  H  2 25   ? 79.520  -103.501 8.818   1.00 160.15 ? 25   DT  L "O4'" 1 
ATOM   3511  C  "C3'" . DT  H  2 25   ? 78.386  -105.419 9.655   1.00 173.68 ? 25   DT  L "C3'" 1 
ATOM   3512  O  "O3'" . DT  H  2 25   ? 78.467  -106.568 8.813   1.00 173.32 ? 25   DT  L "O3'" 1 
ATOM   3513  C  "C2'" . DT  H  2 25   ? 79.689  -105.192 10.404  1.00 173.60 ? 25   DT  L "C2'" 1 
ATOM   3514  C  "C1'" . DT  H  2 25   ? 80.475  -104.371 9.402   1.00 167.54 ? 25   DT  L "C1'" 1 
ATOM   3515  N  N1    . DT  H  2 25   ? 81.581  -103.542 9.931   1.00 163.52 ? 25   DT  L N1    1 
ATOM   3516  C  C2    . DT  H  2 25   ? 82.631  -103.274 9.080   1.00 160.94 ? 25   DT  L C2    1 
ATOM   3517  O  O2    . DT  H  2 25   ? 82.693  -103.708 7.941   1.00 169.15 ? 25   DT  L O2    1 
ATOM   3518  N  N3    . DT  H  2 25   ? 83.616  -102.480 9.616   1.00 154.44 ? 25   DT  L N3    1 
ATOM   3519  C  C4    . DT  H  2 25   ? 83.652  -101.942 10.889  1.00 159.22 ? 25   DT  L C4    1 
ATOM   3520  O  O4    . DT  H  2 25   ? 84.603  -101.243 11.229  1.00 154.72 ? 25   DT  L O4    1 
ATOM   3521  C  C5    . DT  H  2 25   ? 82.516  -102.262 11.728  1.00 165.91 ? 25   DT  L C5    1 
ATOM   3522  C  C7    . DT  H  2 25   ? 82.463  -101.714 13.119  1.00 163.21 ? 25   DT  L C7    1 
ATOM   3523  C  C6    . DT  H  2 25   ? 81.552  -103.036 11.213  1.00 163.00 ? 25   DT  L C6    1 
ATOM   3524  P  P     . DT  H  2 26   ? 78.155  -107.995 9.437   1.00 186.05 ? 26   DT  L P     1 
ATOM   3525  O  OP1   . DT  H  2 26   ? 76.903  -108.467 8.799   1.00 199.71 ? 26   DT  L OP1   1 
ATOM   3526  O  OP2   . DT  H  2 26   ? 78.253  -107.940 10.918  1.00 174.49 ? 26   DT  L OP2   1 
ATOM   3527  O  "O5'" . DT  H  2 26   ? 79.360  -108.878 8.890   1.00 183.90 ? 26   DT  L "O5'" 1 
ATOM   3528  C  "C5'" . DT  H  2 26   ? 79.831  -108.737 7.538   1.00 182.31 ? 26   DT  L "C5'" 1 
ATOM   3529  C  "C4'" . DT  H  2 26   ? 81.337  -108.834 7.512   1.00 181.25 ? 26   DT  L "C4'" 1 
ATOM   3530  O  "O4'" . DT  H  2 26   ? 81.909  -107.753 8.281   1.00 175.65 ? 26   DT  L "O4'" 1 
ATOM   3531  C  "C3'" . DT  H  2 26   ? 81.895  -110.127 8.113   1.00 186.27 ? 26   DT  L "C3'" 1 
ATOM   3532  O  "O3'" . DT  H  2 26   ? 82.412  -110.970 7.076   1.00 191.63 ? 26   DT  L "O3'" 1 
ATOM   3533  C  "C2'" . DT  H  2 26   ? 82.976  -109.665 9.083   1.00 186.20 ? 26   DT  L "C2'" 1 
ATOM   3534  C  "C1'" . DT  H  2 26   ? 83.162  -108.188 8.769   1.00 182.47 ? 26   DT  L "C1'" 1 
ATOM   3535  N  N1    . DT  H  2 26   ? 83.530  -107.331 9.926   1.00 180.31 ? 26   DT  L N1    1 
ATOM   3536  C  C2    . DT  H  2 26   ? 84.755  -106.698 9.918   1.00 173.42 ? 26   DT  L C2    1 
ATOM   3537  O  O2    . DT  H  2 26   ? 85.557  -106.803 9.003   1.00 163.71 ? 26   DT  L O2    1 
ATOM   3538  N  N3    . DT  H  2 26   ? 85.005  -105.924 11.026  1.00 168.75 ? 26   DT  L N3    1 
ATOM   3539  C  C4    . DT  H  2 26   ? 84.172  -105.726 12.113  1.00 171.11 ? 26   DT  L C4    1 
ATOM   3540  O  O4    . DT  H  2 26   ? 84.533  -105.003 13.038  1.00 168.52 ? 26   DT  L O4    1 
ATOM   3541  C  C5    . DT  H  2 26   ? 82.906  -106.422 12.055  1.00 171.62 ? 26   DT  L C5    1 
ATOM   3542  C  C7    . DT  H  2 26   ? 81.942  -106.268 13.188  1.00 168.27 ? 26   DT  L C7    1 
ATOM   3543  C  C6    . DT  H  2 26   ? 82.653  -107.180 10.980  1.00 175.95 ? 26   DT  L C6    1 
ATOM   3544  P  P     . DC  H  2 27   ? 82.723  -112.532 7.304   1.00 196.64 ? 27   DC  L P     1 
ATOM   3545  O  OP1   . DC  H  2 27   ? 82.357  -113.302 6.088   1.00 207.63 ? 27   DC  L OP1   1 
ATOM   3546  O  OP2   . DC  H  2 27   ? 82.129  -112.914 8.613   1.00 197.04 ? 27   DC  L OP2   1 
ATOM   3547  O  "O5'" . DC  H  2 27   ? 84.313  -112.593 7.398   1.00 189.91 ? 27   DC  L "O5'" 1 
ATOM   3548  C  "C5'" . DC  H  2 27   ? 85.158  -111.974 6.408   1.00 186.72 ? 27   DC  L "C5'" 1 
ATOM   3549  C  "C4'" . DC  H  2 27   ? 86.500  -111.627 7.010   1.00 186.33 ? 27   DC  L "C4'" 1 
ATOM   3550  O  "O4'" . DC  H  2 27   ? 86.313  -110.681 8.090   1.00 182.55 ? 27   DC  L "O4'" 1 
ATOM   3551  C  "C3'" . DC  H  2 27   ? 87.267  -112.815 7.600   1.00 192.74 ? 27   DC  L "C3'" 1 
ATOM   3552  O  "O3'" . DC  H  2 27   ? 88.532  -112.981 6.953   1.00 199.89 ? 27   DC  L "O3'" 1 
ATOM   3553  C  "C2'" . DC  H  2 27   ? 87.447  -112.469 9.071   1.00 187.61 ? 27   DC  L "C2'" 1 
ATOM   3554  C  "C1'" . DC  H  2 27   ? 87.241  -110.964 9.120   1.00 181.71 ? 27   DC  L "C1'" 1 
ATOM   3555  N  N1    . DC  H  2 27   ? 86.693  -110.435 10.388  1.00 173.81 ? 27   DC  L N1    1 
ATOM   3556  C  C2    . DC  H  2 27   ? 87.384  -109.416 11.052  1.00 169.44 ? 27   DC  L C2    1 
ATOM   3557  O  O2    . DC  H  2 27   ? 88.436  -108.985 10.560  1.00 170.39 ? 27   DC  L O2    1 
ATOM   3558  N  N3    . DC  H  2 27   ? 86.888  -108.926 12.211  1.00 171.08 ? 27   DC  L N3    1 
ATOM   3559  C  C4    . DC  H  2 27   ? 85.752  -109.419 12.711  1.00 169.87 ? 27   DC  L C4    1 
ATOM   3560  N  N4    . DC  H  2 27   ? 85.298  -108.907 13.857  1.00 167.93 ? 27   DC  L N4    1 
ATOM   3561  C  C5    . DC  H  2 27   ? 85.029  -110.458 12.057  1.00 172.01 ? 27   DC  L C5    1 
ATOM   3562  C  C6    . DC  H  2 27   ? 85.530  -110.932 10.910  1.00 175.37 ? 27   DC  L C6    1 
ATOM   3563  P  P     . DG  H  2 28   ? 89.390  -114.327 7.118   1.00 215.01 ? 28   DG  L P     1 
ATOM   3564  O  OP1   . DG  H  2 28   ? 90.041  -114.630 5.819   1.00 221.93 ? 28   DG  L OP1   1 
ATOM   3565  O  OP2   . DG  H  2 28   ? 88.598  -115.378 7.806   1.00 215.91 ? 28   DG  L OP2   1 
ATOM   3566  O  "O5'" . DG  H  2 28   ? 90.556  -113.849 8.088   1.00 216.49 ? 28   DG  L "O5'" 1 
ATOM   3567  C  "C5'" . DG  H  2 28   ? 91.511  -112.870 7.643   1.00 219.23 ? 28   DG  L "C5'" 1 
ATOM   3568  C  "C4'" . DG  H  2 28   ? 92.296  -112.340 8.820   1.00 215.21 ? 28   DG  L "C4'" 1 
ATOM   3569  O  "O4'" . DG  H  2 28   ? 91.393  -111.734 9.775   1.00 206.98 ? 28   DG  L "O4'" 1 
ATOM   3570  C  "C3'" . DG  H  2 28   ? 93.097  -113.391 9.598   1.00 216.72 ? 28   DG  L "C3'" 1 
ATOM   3571  O  "O3'" . DG  H  2 28   ? 94.446  -112.948 9.782   1.00 219.77 ? 28   DG  L "O3'" 1 
ATOM   3572  C  "C2'" . DG  H  2 28   ? 92.386  -113.483 10.937  1.00 205.93 ? 28   DG  L "C2'" 1 
ATOM   3573  C  "C1'" . DG  H  2 28   ? 91.814  -112.089 11.077  1.00 197.51 ? 28   DG  L "C1'" 1 
ATOM   3574  N  N9    . DG  H  2 28   ? 90.666  -111.974 11.964  1.00 186.51 ? 28   DG  L N9    1 
ATOM   3575  C  C8    . DG  H  2 28   ? 89.514  -112.723 11.941  1.00 191.94 ? 28   DG  L C8    1 
ATOM   3576  N  N7    . DG  H  2 28   ? 88.662  -112.382 12.869  1.00 184.91 ? 28   DG  L N7    1 
ATOM   3577  C  C5    . DG  H  2 28   ? 89.291  -111.346 13.546  1.00 182.81 ? 28   DG  L C5    1 
ATOM   3578  C  C6    . DG  H  2 28   ? 88.856  -110.576 14.656  1.00 181.17 ? 28   DG  L C6    1 
ATOM   3579  O  O6    . DG  H  2 28   ? 87.790  -110.658 15.281  1.00 182.51 ? 28   DG  L O6    1 
ATOM   3580  N  N1    . DG  H  2 28   ? 89.809  -109.632 15.028  1.00 172.35 ? 28   DG  L N1    1 
ATOM   3581  C  C2    . DG  H  2 28   ? 91.025  -109.453 14.414  1.00 173.22 ? 28   DG  L C2    1 
ATOM   3582  N  N2    . DG  H  2 28   ? 91.806  -108.488 14.918  1.00 170.97 ? 28   DG  L N2    1 
ATOM   3583  N  N3    . DG  H  2 28   ? 91.441  -110.164 13.379  1.00 175.58 ? 28   DG  L N3    1 
ATOM   3584  C  C4    . DG  H  2 28   ? 90.529  -111.084 12.999  1.00 181.79 ? 28   DG  L C4    1 
ATOM   3585  N  N     . LEU I  4 5    ? 57.974  27.004   -16.278 1.00 196.22 ? 5    LEU A N     1 
ATOM   3586  C  CA    . LEU I  4 5    ? 57.562  25.628   -16.701 1.00 204.17 ? 5    LEU A CA    1 
ATOM   3587  C  C     . LEU I  4 5    ? 56.889  24.869   -15.537 1.00 198.65 ? 5    LEU A C     1 
ATOM   3588  O  O     . LEU I  4 5    ? 57.556  24.325   -14.656 1.00 195.17 ? 5    LEU A O     1 
ATOM   3589  C  CB    . LEU I  4 5    ? 58.784  24.872   -17.240 1.00 207.11 ? 5    LEU A CB    1 
ATOM   3590  C  CG    . LEU I  4 5    ? 58.560  23.666   -18.165 1.00 218.40 ? 5    LEU A CG    1 
ATOM   3591  C  CD1   . LEU I  4 5    ? 57.414  23.874   -19.152 1.00 217.78 ? 5    LEU A CD1   1 
ATOM   3592  C  CD2   . LEU I  4 5    ? 59.848  23.341   -18.913 1.00 221.47 ? 5    LEU A CD2   1 
ATOM   3593  N  N     . LYS I  4 6    ? 55.558  24.831   -15.552 1.00 192.61 ? 6    LYS A N     1 
ATOM   3594  C  CA    . LYS I  4 6    ? 54.778  24.418   -14.378 1.00 193.29 ? 6    LYS A CA    1 
ATOM   3595  C  C     . LYS I  4 6    ? 53.859  23.219   -14.683 1.00 182.40 ? 6    LYS A C     1 
ATOM   3596  O  O     . LYS I  4 6    ? 53.694  22.819   -15.847 1.00 169.05 ? 6    LYS A O     1 
ATOM   3597  C  CB    . LYS I  4 6    ? 54.001  25.627   -13.781 1.00 196.12 ? 6    LYS A CB    1 
ATOM   3598  C  CG    . LYS I  4 6    ? 53.313  26.564   -14.783 1.00 192.20 ? 6    LYS A CG    1 
ATOM   3599  C  CD    . LYS I  4 6    ? 52.871  27.871   -14.129 1.00 189.76 ? 6    LYS A CD    1 
ATOM   3600  C  CE    . LYS I  4 6    ? 52.426  28.912   -15.151 1.00 182.29 ? 6    LYS A CE    1 
ATOM   3601  N  NZ    . LYS I  4 6    ? 51.144  28.547   -15.811 1.00 178.49 ? 6    LYS A NZ    1 
ATOM   3602  N  N     . PHE I  4 7    ? 53.293  22.643   -13.619 1.00 161.30 ? 7    PHE A N     1 
ATOM   3603  C  CA    . PHE I  4 7    ? 52.544  21.397   -13.708 1.00 145.56 ? 7    PHE A CA    1 
ATOM   3604  C  C     . PHE I  4 7    ? 51.294  21.459   -12.851 1.00 138.72 ? 7    PHE A C     1 
ATOM   3605  O  O     . PHE I  4 7    ? 51.238  22.192   -11.870 1.00 144.00 ? 7    PHE A O     1 
ATOM   3606  C  CB    . PHE I  4 7    ? 53.437  20.257   -13.237 1.00 147.65 ? 7    PHE A CB    1 
ATOM   3607  C  CG    . PHE I  4 7    ? 52.897  18.898   -13.534 1.00 145.03 ? 7    PHE A CG    1 
ATOM   3608  C  CD1   . PHE I  4 7    ? 53.010  18.365   -14.792 1.00 151.29 ? 7    PHE A CD1   1 
ATOM   3609  C  CD2   . PHE I  4 7    ? 52.295  18.145   -12.544 1.00 150.11 ? 7    PHE A CD2   1 
ATOM   3610  C  CE1   . PHE I  4 7    ? 52.513  17.106   -15.069 1.00 158.96 ? 7    PHE A CE1   1 
ATOM   3611  C  CE2   . PHE I  4 7    ? 51.797  16.887   -12.809 1.00 149.73 ? 7    PHE A CE2   1 
ATOM   3612  C  CZ    . PHE I  4 7    ? 51.900  16.367   -14.076 1.00 152.94 ? 7    PHE A CZ    1 
ATOM   3613  N  N     . ALA I  4 8    ? 50.299  20.669   -13.228 1.00 134.50 ? 8    ALA A N     1 
ATOM   3614  C  CA    . ALA I  4 8    ? 49.017  20.623   -12.533 1.00 131.89 ? 8    ALA A CA    1 
ATOM   3615  C  C     . ALA I  4 8    ? 48.465  19.188   -12.611 1.00 128.09 ? 8    ALA A C     1 
ATOM   3616  O  O     . ALA I  4 8    ? 48.138  18.719   -13.689 1.00 125.56 ? 8    ALA A O     1 
ATOM   3617  C  CB    . ALA I  4 8    ? 48.049  21.622   -13.171 1.00 123.68 ? 8    ALA A CB    1 
ATOM   3618  N  N     . HIS I  4 9    ? 48.378  18.487   -11.481 1.00 133.70 ? 9    HIS A N     1 
ATOM   3619  C  CA    . HIS I  4 9    ? 47.905  17.095   -11.482 1.00 134.87 ? 9    HIS A CA    1 
ATOM   3620  C  C     . HIS I  4 9    ? 46.455  17.000   -11.848 1.00 132.89 ? 9    HIS A C     1 
ATOM   3621  O  O     . HIS I  4 9    ? 45.599  17.651   -11.235 1.00 140.70 ? 9    HIS A O     1 
ATOM   3622  C  CB    . HIS I  4 9    ? 48.135  16.450   -10.130 1.00 139.32 ? 9    HIS A CB    1 
ATOM   3623  C  CG    . HIS I  4 9    ? 49.551  16.072   -9.902  1.00 138.09 ? 9    HIS A CG    1 
ATOM   3624  N  ND1   . HIS I  4 9    ? 50.010  14.855   -10.195 1.00 146.77 ? 9    HIS A ND1   1 
ATOM   3625  C  CD2   . HIS I  4 9    ? 50.635  16.812   -9.431  1.00 137.18 ? 9    HIS A CD2   1 
ATOM   3626  C  CE1   . HIS I  4 9    ? 51.327  14.801   -9.901  1.00 153.23 ? 9    HIS A CE1   1 
ATOM   3627  N  NE2   . HIS I  4 9    ? 51.702  16.007   -9.442  1.00 142.44 ? 9    HIS A NE2   1 
ATOM   3628  N  N     . LEU I  4 10   ? 46.178  16.220   -12.885 1.00 124.45 ? 10   LEU A N     1 
ATOM   3629  C  CA    . LEU I  4 10   ? 44.813  15.970   -13.341 1.00 120.03 ? 10   LEU A CA    1 
ATOM   3630  C  C     . LEU I  4 10   ? 44.357  14.589   -12.893 1.00 120.13 ? 10   LEU A C     1 
ATOM   3631  O  O     . LEU I  4 10   ? 43.158  14.299   -12.919 1.00 126.09 ? 10   LEU A O     1 
ATOM   3632  C  CB    . LEU I  4 10   ? 44.708  16.055   -14.868 1.00 118.09 ? 10   LEU A CB    1 
ATOM   3633  C  CG    . LEU I  4 10   ? 44.992  17.403   -15.538 1.00 117.22 ? 10   LEU A CG    1 
ATOM   3634  C  CD1   . LEU I  4 10   ? 45.134  17.203   -17.032 1.00 122.49 ? 10   LEU A CD1   1 
ATOM   3635  C  CD2   . LEU I  4 10   ? 43.917  18.443   -15.258 1.00 113.68 ? 10   LEU A CD2   1 
ATOM   3636  N  N     . HIS I  4 11   ? 45.308  13.737   -12.502 1.00 117.67 ? 11   HIS A N     1 
ATOM   3637  C  CA    . HIS I  4 11   ? 44.991  12.415   -11.966 1.00 121.96 ? 11   HIS A CA    1 
ATOM   3638  C  C     . HIS I  4 11   ? 45.535  12.291   -10.585 1.00 129.33 ? 11   HIS A C     1 
ATOM   3639  O  O     . HIS I  4 11   ? 46.711  11.939   -10.393 1.00 135.03 ? 11   HIS A O     1 
ATOM   3640  C  CB    . HIS I  4 11   ? 45.557  11.309   -12.838 1.00 125.60 ? 11   HIS A CB    1 
ATOM   3641  C  CG    . HIS I  4 11   ? 44.913  9.946    -12.609 1.00 130.95 ? 11   HIS A CG    1 
ATOM   3642  N  ND1   . HIS I  4 11   ? 44.449  9.183    -13.625 1.00 129.15 ? 11   HIS A ND1   1 
ATOM   3643  C  CD2   . HIS I  4 11   ? 44.678  9.214    -11.427 1.00 134.43 ? 11   HIS A CD2   1 
ATOM   3644  C  CE1   . HIS I  4 11   ? 43.954  8.024    -13.125 1.00 135.00 ? 11   HIS A CE1   1 
ATOM   3645  N  NE2   . HIS I  4 11   ? 44.102  8.039    -11.778 1.00 126.12 ? 11   HIS A NE2   1 
ATOM   3646  N  N     . GLN I  4 12   ? 44.678  12.590   -9.606  1.00 135.17 ? 12   GLN A N     1 
ATOM   3647  C  CA    . GLN I  4 12   ? 45.037  12.532   -8.189  1.00 125.99 ? 12   GLN A CA    1 
ATOM   3648  C  C     . GLN I  4 12   ? 43.905  11.920   -7.398  1.00 126.10 ? 12   GLN A C     1 
ATOM   3649  O  O     . GLN I  4 12   ? 42.742  12.229   -7.632  1.00 132.05 ? 12   GLN A O     1 
ATOM   3650  C  CB    . GLN I  4 12   ? 45.307  13.930   -7.667  1.00 125.41 ? 12   GLN A CB    1 
ATOM   3651  C  CG    . GLN I  4 12   ? 45.752  13.995   -6.220  1.00 126.38 ? 12   GLN A CG    1 
ATOM   3652  C  CD    . GLN I  4 12   ? 47.058  13.292   -5.971  1.00 129.30 ? 12   GLN A CD    1 
ATOM   3653  O  OE1   . GLN I  4 12   ? 47.947  13.272   -6.829  1.00 149.54 ? 12   GLN A OE1   1 
ATOM   3654  N  NE2   . GLN I  4 12   ? 47.191  12.722   -4.784  1.00 120.36 ? 12   GLN A NE2   1 
ATOM   3655  N  N     . HIS I  4 13   ? 44.255  11.054   -6.460  1.00 125.45 ? 13   HIS A N     1 
ATOM   3656  C  CA    . HIS I  4 13   ? 43.278  10.441   -5.571  1.00 123.14 ? 13   HIS A CA    1 
ATOM   3657  C  C     . HIS I  4 13   ? 43.351  11.050   -4.184  1.00 121.03 ? 13   HIS A C     1 
ATOM   3658  O  O     . HIS I  4 13   ? 44.436  11.319   -3.669  1.00 117.19 ? 13   HIS A O     1 
ATOM   3659  C  CB    . HIS I  4 13   ? 43.523  8.939    -5.499  1.00 122.06 ? 13   HIS A CB    1 
ATOM   3660  C  CG    . HIS I  4 13   ? 43.250  8.220    -6.780  1.00 119.05 ? 13   HIS A CG    1 
ATOM   3661  N  ND1   . HIS I  4 13   ? 42.137  7.500    -6.969  1.00 124.83 ? 13   HIS A ND1   1 
ATOM   3662  C  CD2   . HIS I  4 13   ? 44.000  8.115    -7.957  1.00 133.31 ? 13   HIS A CD2   1 
ATOM   3663  C  CE1   . HIS I  4 13   ? 42.151  6.963    -8.217  1.00 133.27 ? 13   HIS A CE1   1 
ATOM   3664  N  NE2   . HIS I  4 13   ? 43.299  7.335    -8.822  1.00 132.72 ? 13   HIS A NE2   1 
ATOM   3665  N  N     . THR I  4 14   ? 42.192  11.267   -3.570  1.00 121.78 ? 14   THR A N     1 
ATOM   3666  C  CA    . THR I  4 14   ? 42.109  11.789   -2.210  1.00 121.74 ? 14   THR A CA    1 
ATOM   3667  C  C     . THR I  4 14   ? 41.680  10.691   -1.232  1.00 126.92 ? 14   THR A C     1 
ATOM   3668  O  O     . THR I  4 14   ? 41.541  9.511    -1.615  1.00 122.16 ? 14   THR A O     1 
ATOM   3669  C  CB    . THR I  4 14   ? 41.093  12.918   -2.156  1.00 118.11 ? 14   THR A CB    1 
ATOM   3670  O  OG1   . THR I  4 14   ? 39.819  12.416   -2.570  1.00 110.63 ? 14   THR A OG1   1 
ATOM   3671  C  CG2   . THR I  4 14   ? 41.539  14.028   -3.079  1.00 127.58 ? 14   THR A CG2   1 
ATOM   3672  N  N     . GLN I  4 15   ? 41.480  11.091   0.028   1.00 123.99 ? 15   GLN A N     1 
ATOM   3673  C  CA    . GLN I  4 15   ? 40.980  10.200   1.089   1.00 126.42 ? 15   GLN A CA    1 
ATOM   3674  C  C     . GLN I  4 15   ? 39.653  9.502    0.747   1.00 124.16 ? 15   GLN A C     1 
ATOM   3675  O  O     . GLN I  4 15   ? 39.326  8.426    1.290   1.00 111.72 ? 15   GLN A O     1 
ATOM   3676  C  CB    . GLN I  4 15   ? 40.815  10.973   2.406   1.00 129.32 ? 15   GLN A CB    1 
ATOM   3677  C  CG    . GLN I  4 15   ? 39.732  12.051   2.393   1.00 133.38 ? 15   GLN A CG    1 
ATOM   3678  C  CD    . GLN I  4 15   ? 39.749  12.897   3.651   1.00 136.94 ? 15   GLN A CD    1 
ATOM   3679  O  OE1   . GLN I  4 15   ? 39.808  14.128   3.604   1.00 138.84 ? 15   GLN A OE1   1 
ATOM   3680  N  NE2   . GLN I  4 15   ? 39.706  12.232   4.792   1.00 150.60 ? 15   GLN A NE2   1 
ATOM   3681  N  N     . PHE I  4 16   ? 38.889  10.129   -0.146  1.00 125.39 ? 16   PHE A N     1 
ATOM   3682  C  CA    . PHE I  4 16   ? 37.568  9.627    -0.517  1.00 129.83 ? 16   PHE A CA    1 
ATOM   3683  C  C     . PHE I  4 16   ? 37.634  8.374    -1.385  1.00 130.32 ? 16   PHE A C     1 
ATOM   3684  O  O     . PHE I  4 16   ? 36.625  7.691    -1.560  1.00 135.73 ? 16   PHE A O     1 
ATOM   3685  C  CB    . PHE I  4 16   ? 36.739  10.725   -1.197  1.00 125.63 ? 16   PHE A CB    1 
ATOM   3686  C  CG    . PHE I  4 16   ? 36.397  11.875   -0.281  1.00 128.14 ? 16   PHE A CG    1 
ATOM   3687  C  CD1   . PHE I  4 16   ? 37.206  13.000   -0.225  1.00 128.83 ? 16   PHE A CD1   1 
ATOM   3688  C  CD2   . PHE I  4 16   ? 35.285  11.819   0.555   1.00 131.20 ? 16   PHE A CD2   1 
ATOM   3689  C  CE1   . PHE I  4 16   ? 36.899  14.061   0.618   1.00 130.75 ? 16   PHE A CE1   1 
ATOM   3690  C  CE2   . PHE I  4 16   ? 34.976  12.877   1.402   1.00 132.16 ? 16   PHE A CE2   1 
ATOM   3691  C  CZ    . PHE I  4 16   ? 35.780  14.004   1.429   1.00 128.42 ? 16   PHE A CZ    1 
ATOM   3692  N  N     . SER I  4 17   ? 38.811  8.081    -1.934  1.00 129.36 ? 17   SER A N     1 
ATOM   3693  C  CA    . SER I  4 17   ? 39.078  6.753    -2.488  1.00 125.28 ? 17   SER A CA    1 
ATOM   3694  C  C     . SER I  4 17   ? 39.277  5.787    -1.315  1.00 119.81 ? 17   SER A C     1 
ATOM   3695  O  O     . SER I  4 17   ? 40.383  5.641    -0.816  1.00 120.29 ? 17   SER A O     1 
ATOM   3696  C  CB    . SER I  4 17   ? 40.320  6.794    -3.380  1.00 129.12 ? 17   SER A CB    1 
ATOM   3697  O  OG    . SER I  4 17   ? 40.113  7.609    -4.527  1.00 122.14 ? 17   SER A OG    1 
ATOM   3698  N  N     . LEU I  4 18   ? 38.198  5.132    -0.895  1.00 117.73 ? 18   LEU A N     1 
ATOM   3699  C  CA    . LEU I  4 18   ? 38.108  4.493    0.427   1.00 121.30 ? 18   LEU A CA    1 
ATOM   3700  C  C     . LEU I  4 18   ? 39.075  3.317    0.638   1.00 129.39 ? 18   LEU A C     1 
ATOM   3701  O  O     . LEU I  4 18   ? 39.521  3.048    1.767   1.00 134.45 ? 18   LEU A O     1 
ATOM   3702  C  CB    . LEU I  4 18   ? 36.670  4.009    0.669   1.00 123.01 ? 18   LEU A CB    1 
ATOM   3703  C  CG    . LEU I  4 18   ? 35.532  5.039    0.603   1.00 121.07 ? 18   LEU A CG    1 
ATOM   3704  C  CD1   . LEU I  4 18   ? 34.169  4.374    0.659   1.00 125.65 ? 18   LEU A CD1   1 
ATOM   3705  C  CD2   . LEU I  4 18   ? 35.653  6.044    1.731   1.00 129.14 ? 18   LEU A CD2   1 
ATOM   3706  N  N     . LEU I  4 19   ? 39.383  2.610    -0.441  1.00 126.81 ? 19   LEU A N     1 
ATOM   3707  C  CA    . LEU I  4 19   ? 40.212  1.419    -0.353  1.00 127.97 ? 19   LEU A CA    1 
ATOM   3708  C  C     . LEU I  4 19   ? 41.701  1.748    -0.302  1.00 129.17 ? 19   LEU A C     1 
ATOM   3709  O  O     . LEU I  4 19   ? 42.372  1.366    0.664   1.00 122.05 ? 19   LEU A O     1 
ATOM   3710  C  CB    . LEU I  4 19   ? 39.903  0.498    -1.534  1.00 126.83 ? 19   LEU A CB    1 
ATOM   3711  C  CG    . LEU I  4 19   ? 38.470  -0.050   -1.530  1.00 123.46 ? 19   LEU A CG    1 
ATOM   3712  C  CD1   . LEU I  4 19   ? 38.139  -0.811   -2.810  1.00 124.62 ? 19   LEU A CD1   1 
ATOM   3713  C  CD2   . LEU I  4 19   ? 38.262  -0.934   -0.302  1.00 125.19 ? 19   LEU A CD2   1 
ATOM   3714  N  N     . ASP I  4 20   ? 42.181  2.466    -1.337  1.00 139.80 ? 20   ASP A N     1 
ATOM   3715  C  CA    . ASP I  4 20   ? 43.621  2.768    -1.588  1.00 138.91 ? 20   ASP A CA    1 
ATOM   3716  C  C     . ASP I  4 20   ? 44.005  4.254    -1.489  1.00 135.11 ? 20   ASP A C     1 
ATOM   3717  O  O     . ASP I  4 20   ? 45.156  4.599    -1.713  1.00 147.70 ? 20   ASP A O     1 
ATOM   3718  C  CB    . ASP I  4 20   ? 44.110  2.206    -2.973  1.00 140.15 ? 20   ASP A CB    1 
ATOM   3719  C  CG    . ASP I  4 20   ? 43.454  2.909    -4.208  1.00 139.00 ? 20   ASP A CG    1 
ATOM   3720  O  OD1   . ASP I  4 20   ? 42.369  3.476    -3.981  1.00 148.41 ? 20   ASP A OD1   1 
ATOM   3721  O  OD2   . ASP I  4 20   ? 43.980  2.895    -5.389  1.00 111.44 ? 20   ASP A OD2   1 
ATOM   3722  N  N     . GLY I  4 21   ? 43.065  5.130    -1.155  1.00 131.01 ? 21   GLY A N     1 
ATOM   3723  C  CA    . GLY I  4 21   ? 43.374  6.564    -1.039  1.00 131.37 ? 21   GLY A CA    1 
ATOM   3724  C  C     . GLY I  4 21   ? 43.915  6.930    0.320   1.00 122.76 ? 21   GLY A C     1 
ATOM   3725  O  O     . GLY I  4 21   ? 43.302  6.596    1.313   1.00 130.41 ? 21   GLY A O     1 
ATOM   3726  N  N     . ALA I  4 22   ? 45.055  7.612    0.366   1.00 122.30 ? 22   ALA A N     1 
ATOM   3727  C  CA    . ALA I  4 22   ? 45.684  7.992    1.635   1.00 122.64 ? 22   ALA A CA    1 
ATOM   3728  C  C     . ALA I  4 22   ? 45.954  9.496    1.759   1.00 118.86 ? 22   ALA A C     1 
ATOM   3729  O  O     . ALA I  4 22   ? 46.545  9.953    2.738   1.00 118.91 ? 22   ALA A O     1 
ATOM   3730  C  CB    . ALA I  4 22   ? 46.979  7.204    1.814   1.00 121.58 ? 22   ALA A CB    1 
ATOM   3731  N  N     . ALA I  4 23   ? 45.512  10.268   0.777   1.00 119.24 ? 23   ALA A N     1 
ATOM   3732  C  CA    . ALA I  4 23   ? 45.837  11.689   0.731   1.00 122.41 ? 23   ALA A CA    1 
ATOM   3733  C  C     . ALA I  4 23   ? 44.670  12.500   1.265   1.00 122.41 ? 23   ALA A C     1 
ATOM   3734  O  O     . ALA I  4 23   ? 43.589  12.484   0.669   1.00 116.72 ? 23   ALA A O     1 
ATOM   3735  C  CB    . ALA I  4 23   ? 46.170  12.107   -0.692  1.00 118.02 ? 23   ALA A CB    1 
ATOM   3736  N  N     . LYS I  4 24   ? 44.889  13.191   2.387   1.00 125.15 ? 24   LYS A N     1 
ATOM   3737  C  CA    . LYS I  4 24   ? 43.837  13.983   3.051   1.00 128.95 ? 24   LYS A CA    1 
ATOM   3738  C  C     . LYS I  4 24   ? 43.567  15.229   2.236   1.00 126.03 ? 24   LYS A C     1 
ATOM   3739  O  O     . LYS I  4 24   ? 44.424  15.670   1.484   1.00 121.06 ? 24   LYS A O     1 
ATOM   3740  C  CB    . LYS I  4 24   ? 44.232  14.395   4.483   1.00 132.82 ? 24   LYS A CB    1 
ATOM   3741  C  CG    . LYS I  4 24   ? 44.449  13.242   5.447   1.00 132.55 ? 24   LYS A CG    1 
ATOM   3742  C  CD    . LYS I  4 24   ? 44.870  13.730   6.823   1.00 131.32 ? 24   LYS A CD    1 
ATOM   3743  C  CE    . LYS I  4 24   ? 45.496  12.605   7.639   1.00 129.27 ? 24   LYS A CE    1 
ATOM   3744  N  NZ    . LYS I  4 24   ? 45.735  12.975   9.063   1.00 132.66 ? 24   LYS A NZ    1 
ATOM   3745  N  N     . LEU I  4 25   ? 42.384  15.801   2.417   1.00 126.45 ? 25   LEU A N     1 
ATOM   3746  C  CA    . LEU I  4 25   ? 41.918  16.879   1.564   1.00 136.36 ? 25   LEU A CA    1 
ATOM   3747  C  C     . LEU I  4 25   ? 42.597  18.217   1.897   1.00 145.02 ? 25   LEU A C     1 
ATOM   3748  O  O     . LEU I  4 25   ? 42.792  19.070   1.011   1.00 145.21 ? 25   LEU A O     1 
ATOM   3749  C  CB    . LEU I  4 25   ? 40.388  17.008   1.663   1.00 139.48 ? 25   LEU A CB    1 
ATOM   3750  C  CG    . LEU I  4 25   ? 39.694  17.532   0.405   1.00 136.06 ? 25   LEU A CG    1 
ATOM   3751  C  CD1   . LEU I  4 25   ? 39.820  16.483   -0.684  1.00 132.17 ? 25   LEU A CD1   1 
ATOM   3752  C  CD2   . LEU I  4 25   ? 38.232  17.849   0.667   1.00 136.62 ? 25   LEU A CD2   1 
ATOM   3753  N  N     . GLN I  4 26   ? 42.954  18.400   3.168   1.00 147.52 ? 26   GLN A N     1 
ATOM   3754  C  CA    . GLN I  4 26   ? 43.548  19.663   3.618   1.00 146.81 ? 26   GLN A CA    1 
ATOM   3755  C  C     . GLN I  4 26   ? 45.019  19.768   3.207   1.00 143.62 ? 26   GLN A C     1 
ATOM   3756  O  O     . GLN I  4 26   ? 45.412  20.666   2.468   1.00 136.50 ? 26   GLN A O     1 
ATOM   3757  C  CB    . GLN I  4 26   ? 43.407  19.809   5.142   1.00 138.70 ? 26   GLN A CB    1 
ATOM   3758  C  CG    . GLN I  4 26   ? 44.045  21.062   5.718   1.00 134.11 ? 26   GLN A CG    1 
ATOM   3759  C  CD    . GLN I  4 26   ? 43.607  22.314   4.995   1.00 136.10 ? 26   GLN A CD    1 
ATOM   3760  O  OE1   . GLN I  4 26   ? 42.475  22.408   4.520   1.00 150.30 ? 26   GLN A OE1   1 
ATOM   3761  N  NE2   . GLN I  4 26   ? 44.504  23.282   4.902   1.00 134.20 ? 26   GLN A NE2   1 
ATOM   3762  N  N     . ASP I  4 27   ? 45.821  18.832   3.694   1.00 144.19 ? 27   ASP A N     1 
ATOM   3763  C  CA    . ASP I  4 27   ? 47.259  18.894   3.511   1.00 144.32 ? 27   ASP A CA    1 
ATOM   3764  C  C     . ASP I  4 27   ? 47.661  18.731   2.039   1.00 141.97 ? 27   ASP A C     1 
ATOM   3765  O  O     . ASP I  4 27   ? 48.735  19.169   1.647   1.00 149.31 ? 27   ASP A O     1 
ATOM   3766  C  CB    . ASP I  4 27   ? 47.975  17.874   4.426   1.00 151.19 ? 27   ASP A CB    1 
ATOM   3767  C  CG    . ASP I  4 27   ? 47.700  16.412   4.044   1.00 158.52 ? 27   ASP A CG    1 
ATOM   3768  O  OD1   . ASP I  4 27   ? 46.876  16.166   3.135   1.00 170.31 ? 27   ASP A OD1   1 
ATOM   3769  O  OD2   . ASP I  4 27   ? 48.317  15.505   4.659   1.00 158.00 ? 27   ASP A OD2   1 
ATOM   3770  N  N     . LEU I  4 28   ? 46.799  18.116   1.232   1.00 134.79 ? 28   LEU A N     1 
ATOM   3771  C  CA    . LEU I  4 28   ? 47.063  17.945   -0.198  1.00 131.96 ? 28   LEU A CA    1 
ATOM   3772  C  C     . LEU I  4 28   ? 47.022  19.276   -0.932  1.00 127.80 ? 28   LEU A C     1 
ATOM   3773  O  O     . LEU I  4 28   ? 47.893  19.571   -1.724  1.00 125.49 ? 28   LEU A O     1 
ATOM   3774  C  CB    . LEU I  4 28   ? 46.041  16.984   -0.816  1.00 134.28 ? 28   LEU A CB    1 
ATOM   3775  C  CG    . LEU I  4 28   ? 46.071  16.723   -2.322  1.00 131.92 ? 28   LEU A CG    1 
ATOM   3776  C  CD1   . LEU I  4 28   ? 47.460  16.286   -2.771  1.00 138.66 ? 28   LEU A CD1   1 
ATOM   3777  C  CD2   . LEU I  4 28   ? 45.035  15.666   -2.677  1.00 130.02 ? 28   LEU A CD2   1 
ATOM   3778  N  N     . LEU I  4 29   ? 46.004  20.077   -0.651  1.00 137.91 ? 29   LEU A N     1 
ATOM   3779  C  CA    . LEU I  4 29   ? 45.826  21.373   -1.303  1.00 135.43 ? 29   LEU A CA    1 
ATOM   3780  C  C     . LEU I  4 29   ? 46.922  22.384   -0.953  1.00 136.89 ? 29   LEU A C     1 
ATOM   3781  O  O     . LEU I  4 29   ? 47.288  23.200   -1.792  1.00 141.01 ? 29   LEU A O     1 
ATOM   3782  C  CB    . LEU I  4 29   ? 44.463  21.960   -0.936  1.00 133.76 ? 29   LEU A CB    1 
ATOM   3783  C  CG    . LEU I  4 29   ? 43.266  21.222   -1.523  1.00 132.74 ? 29   LEU A CG    1 
ATOM   3784  C  CD1   . LEU I  4 29   ? 41.965  21.613   -0.838  1.00 127.59 ? 29   LEU A CD1   1 
ATOM   3785  C  CD2   . LEU I  4 29   ? 43.203  21.503   -3.019  1.00 134.59 ? 29   LEU A CD2   1 
ATOM   3786  N  N     . LYS I  4 30   ? 47.428  22.345   0.278   1.00 137.55 ? 30   LYS A N     1 
ATOM   3787  C  CA    . LYS I  4 30   ? 48.486  23.267   0.681   1.00 145.68 ? 30   LYS A CA    1 
ATOM   3788  C  C     . LYS I  4 30   ? 49.826  22.894   0.056   1.00 145.01 ? 30   LYS A C     1 
ATOM   3789  O  O     . LYS I  4 30   ? 50.666  23.758   -0.178  1.00 155.08 ? 30   LYS A O     1 
ATOM   3790  C  CB    . LYS I  4 30   ? 48.611  23.368   2.208   1.00 150.46 ? 30   LYS A CB    1 
ATOM   3791  C  CG    . LYS I  4 30   ? 49.251  22.173   2.882   1.00 157.44 ? 30   LYS A CG    1 
ATOM   3792  C  CD    . LYS I  4 30   ? 49.237  22.319   4.399   1.00 163.46 ? 30   LYS A CD    1 
ATOM   3793  C  CE    . LYS I  4 30   ? 49.950  21.141   5.058   1.00 163.82 ? 30   LYS A CE    1 
ATOM   3794  N  NZ    . LYS I  4 30   ? 49.814  21.092   6.540   1.00 158.17 ? 30   LYS A NZ    1 
ATOM   3795  N  N     . TRP I  4 31   ? 50.028  21.613   -0.217  1.00 143.50 ? 31   TRP A N     1 
ATOM   3796  C  CA    . TRP I  4 31   ? 51.254  21.159   -0.885  1.00 142.05 ? 31   TRP A CA    1 
ATOM   3797  C  C     . TRP I  4 31   ? 51.271  21.604   -2.322  1.00 143.07 ? 31   TRP A C     1 
ATOM   3798  O  O     . TRP I  4 31   ? 52.308  22.019   -2.847  1.00 138.13 ? 31   TRP A O     1 
ATOM   3799  C  CB    . TRP I  4 31   ? 51.361  19.644   -0.800  1.00 140.50 ? 31   TRP A CB    1 
ATOM   3800  C  CG    . TRP I  4 31   ? 52.637  19.088   -1.367  1.00 141.96 ? 31   TRP A CG    1 
ATOM   3801  C  CD1   . TRP I  4 31   ? 52.785  18.267   -2.486  1.00 139.84 ? 31   TRP A CD1   1 
ATOM   3802  C  CD2   . TRP I  4 31   ? 54.002  19.292   -0.861  1.00 145.53 ? 31   TRP A CD2   1 
ATOM   3803  N  NE1   . TRP I  4 31   ? 54.109  17.961   -2.703  1.00 133.57 ? 31   TRP A NE1   1 
ATOM   3804  C  CE2   . TRP I  4 31   ? 54.890  18.540   -1.769  1.00 139.63 ? 31   TRP A CE2   1 
ATOM   3805  C  CE3   . TRP I  4 31   ? 54.561  20.003   0.205   1.00 138.62 ? 31   TRP A CE3   1 
ATOM   3806  C  CZ2   . TRP I  4 31   ? 56.260  18.517   -1.596  1.00 141.51 ? 31   TRP A CZ2   1 
ATOM   3807  C  CZ3   . TRP I  4 31   ? 55.949  19.966   0.369   1.00 142.26 ? 31   TRP A CZ3   1 
ATOM   3808  C  CH2   . TRP I  4 31   ? 56.776  19.238   -0.509  1.00 144.51 ? 31   TRP A CH2   1 
ATOM   3809  N  N     . VAL I  4 32   ? 50.106  21.518   -2.963  1.00 143.54 ? 32   VAL A N     1 
ATOM   3810  C  CA    . VAL I  4 32   ? 49.911  21.989   -4.329  1.00 134.51 ? 32   VAL A CA    1 
ATOM   3811  C  C     . VAL I  4 32   ? 50.023  23.496   -4.378  1.00 140.53 ? 32   VAL A C     1 
ATOM   3812  O  O     . VAL I  4 32   ? 50.492  24.042   -5.366  1.00 149.23 ? 32   VAL A O     1 
ATOM   3813  C  CB    . VAL I  4 32   ? 48.522  21.600   -4.861  1.00 129.57 ? 32   VAL A CB    1 
ATOM   3814  C  CG1   . VAL I  4 32   ? 48.227  22.304   -6.178  1.00 136.16 ? 32   VAL A CG1   1 
ATOM   3815  C  CG2   . VAL I  4 32   ? 48.433  20.092   -5.022  1.00 129.65 ? 32   VAL A CG2   1 
ATOM   3816  N  N     . LYS I  4 33   ? 49.576  24.162   -3.313  1.00 144.89 ? 33   LYS A N     1 
ATOM   3817  C  CA    . LYS I  4 33   ? 49.645  25.621   -3.208  1.00 142.06 ? 33   LYS A CA    1 
ATOM   3818  C  C     . LYS I  4 33   ? 51.089  26.089   -2.998  1.00 142.48 ? 33   LYS A C     1 
ATOM   3819  O  O     . LYS I  4 33   ? 51.556  26.998   -3.686  1.00 144.18 ? 33   LYS A O     1 
ATOM   3820  C  CB    . LYS I  4 33   ? 48.730  26.110   -2.072  1.00 142.23 ? 33   LYS A CB    1 
ATOM   3821  C  CG    . LYS I  4 33   ? 48.591  27.623   -1.911  1.00 147.78 ? 33   LYS A CG    1 
ATOM   3822  C  CD    . LYS I  4 33   ? 47.884  28.278   -3.088  1.00 152.70 ? 33   LYS A CD    1 
ATOM   3823  C  CE    . LYS I  4 33   ? 47.787  29.786   -2.906  1.00 160.74 ? 33   LYS A CE    1 
ATOM   3824  N  NZ    . LYS I  4 33   ? 47.178  30.466   -4.086  1.00 170.91 ? 33   LYS A NZ    1 
ATOM   3825  N  N     . GLU I  4 34   ? 51.794  25.455   -2.065  1.00 144.05 ? 34   GLU A N     1 
ATOM   3826  C  CA    . GLU I  4 34   ? 53.186  25.819   -1.743  1.00 147.03 ? 34   GLU A CA    1 
ATOM   3827  C  C     . GLU I  4 34   ? 54.176  25.472   -2.863  1.00 145.07 ? 34   GLU A C     1 
ATOM   3828  O  O     . GLU I  4 34   ? 55.200  26.135   -3.019  1.00 142.71 ? 34   GLU A O     1 
ATOM   3829  C  CB    . GLU I  4 34   ? 53.629  25.149   -0.427  1.00 150.39 ? 34   GLU A CB    1 
ATOM   3830  C  CG    . GLU I  4 34   ? 52.967  25.754   0.811   1.00 150.95 ? 34   GLU A CG    1 
ATOM   3831  C  CD    . GLU I  4 34   ? 53.107  24.915   2.074   1.00 150.35 ? 34   GLU A CD    1 
ATOM   3832  O  OE1   . GLU I  4 34   ? 52.840  23.693   2.039   1.00 160.62 ? 34   GLU A OE1   1 
ATOM   3833  O  OE2   . GLU I  4 34   ? 53.456  25.490   3.125   1.00 158.20 ? 34   GLU A OE2   1 
ATOM   3834  N  N     . THR I  4 35   ? 53.882  24.431   -3.635  1.00 143.09 ? 35   THR A N     1 
ATOM   3835  C  CA    . THR I  4 35   ? 54.755  24.043   -4.744  1.00 145.60 ? 35   THR A CA    1 
ATOM   3836  C  C     . THR I  4 35   ? 54.582  24.955   -5.954  1.00 149.89 ? 35   THR A C     1 
ATOM   3837  O  O     . THR I  4 35   ? 55.562  25.347   -6.594  1.00 168.36 ? 35   THR A O     1 
ATOM   3838  C  CB    . THR I  4 35   ? 54.497  22.598   -5.194  1.00 145.67 ? 35   THR A CB    1 
ATOM   3839  O  OG1   . THR I  4 35   ? 54.730  21.698   -4.097  1.00 145.33 ? 35   THR A OG1   1 
ATOM   3840  C  CG2   . THR I  4 35   ? 55.409  22.240   -6.361  1.00 139.62 ? 35   THR A CG2   1 
ATOM   3841  N  N     . THR I  4 36   ? 53.332  25.276   -6.269  1.00 145.44 ? 36   THR A N     1 
ATOM   3842  C  CA    . THR I  4 36   ? 53.006  26.116   -7.416  1.00 140.99 ? 36   THR A CA    1 
ATOM   3843  C  C     . THR I  4 36   ? 52.134  27.294   -6.964  1.00 138.55 ? 36   THR A C     1 
ATOM   3844  O  O     . THR I  4 36   ? 50.924  27.159   -6.827  1.00 148.53 ? 36   THR A O     1 
ATOM   3845  C  CB    . THR I  4 36   ? 52.278  25.293   -8.499  1.00 132.81 ? 36   THR A CB    1 
ATOM   3846  O  OG1   . THR I  4 36   ? 53.045  24.123   -8.803  1.00 128.40 ? 36   THR A OG1   1 
ATOM   3847  C  CG2   . THR I  4 36   ? 52.075  26.114   -9.745  1.00 133.64 ? 36   THR A CG2   1 
ATOM   3848  N  N     . PRO I  4 37   ? 52.749  28.453   -6.708  1.00 136.19 ? 37   PRO A N     1 
ATOM   3849  C  CA    . PRO I  4 37   ? 51.977  29.659   -6.372  1.00 141.45 ? 37   PRO A CA    1 
ATOM   3850  C  C     . PRO I  4 37   ? 51.142  30.228   -7.524  1.00 142.43 ? 37   PRO A C     1 
ATOM   3851  O  O     . PRO I  4 37   ? 50.037  30.704   -7.301  1.00 147.22 ? 37   PRO A O     1 
ATOM   3852  C  CB    . PRO I  4 37   ? 53.057  30.666   -5.955  1.00 141.09 ? 37   PRO A CB    1 
ATOM   3853  C  CG    . PRO I  4 37   ? 54.252  29.835   -5.603  1.00 139.64 ? 37   PRO A CG    1 
ATOM   3854  C  CD    . PRO I  4 37   ? 54.193  28.647   -6.511  1.00 137.04 ? 37   PRO A CD    1 
ATOM   3855  N  N     . GLU I  4 38   ? 51.676  30.170   -8.739  1.00 149.21 ? 38   GLU A N     1 
ATOM   3856  C  CA    . GLU I  4 38   ? 51.051  30.800   -9.899  1.00 150.02 ? 38   GLU A CA    1 
ATOM   3857  C  C     . GLU I  4 38   ? 49.924  29.930   -10.435 1.00 146.66 ? 38   GLU A C     1 
ATOM   3858  O  O     . GLU I  4 38   ? 50.201  28.922   -11.088 1.00 151.66 ? 38   GLU A O     1 
ATOM   3859  C  CB    . GLU I  4 38   ? 52.108  31.042   -11.003 1.00 150.52 ? 38   GLU A CB    1 
ATOM   3860  C  CG    . GLU I  4 38   ? 51.665  31.938   -12.160 1.00 145.56 ? 38   GLU A CG    1 
ATOM   3861  C  CD    . GLU I  4 38   ? 51.752  33.418   -11.846 1.00 144.12 ? 38   GLU A CD    1 
ATOM   3862  O  OE1   . GLU I  4 38   ? 51.468  34.216   -12.754 1.00 146.67 ? 38   GLU A OE1   1 
ATOM   3863  O  OE2   . GLU I  4 38   ? 52.094  33.790   -10.704 1.00 146.70 ? 38   GLU A OE2   1 
ATOM   3864  N  N     . ASP I  4 39   ? 48.672  30.335   -10.164 1.00 145.71 ? 39   ASP A N     1 
ATOM   3865  C  CA    . ASP I  4 39   ? 47.428  29.691   -10.694 1.00 143.75 ? 39   ASP A CA    1 
ATOM   3866  C  C     . ASP I  4 39   ? 47.333  28.193   -10.447 1.00 141.00 ? 39   ASP A C     1 
ATOM   3867  O  O     . ASP I  4 39   ? 47.259  27.408   -11.395 1.00 143.99 ? 39   ASP A O     1 
ATOM   3868  C  CB    . ASP I  4 39   ? 47.265  29.934   -12.197 1.00 143.72 ? 39   ASP A CB    1 
ATOM   3869  C  CG    . ASP I  4 39   ? 47.023  31.373   -12.526 1.00 152.31 ? 39   ASP A CG    1 
ATOM   3870  O  OD1   . ASP I  4 39   ? 47.172  32.229   -11.627 1.00 164.31 ? 39   ASP A OD1   1 
ATOM   3871  O  OD2   . ASP I  4 39   ? 46.677  31.648   -13.690 1.00 160.13 ? 39   ASP A OD2   1 
ATOM   3872  N  N     . PRO I  4 40   ? 47.320  27.793   -9.175  1.00 132.65 ? 40   PRO A N     1 
ATOM   3873  C  CA    . PRO I  4 40   ? 47.410  26.380   -8.854  1.00 128.92 ? 40   PRO A CA    1 
ATOM   3874  C  C     . PRO I  4 40   ? 46.138  25.648   -9.259  1.00 131.51 ? 40   PRO A C     1 
ATOM   3875  O  O     . PRO I  4 40   ? 45.050  26.204   -9.131  1.00 138.77 ? 40   PRO A O     1 
ATOM   3876  C  CB    . PRO I  4 40   ? 47.609  26.373   -7.343  1.00 133.73 ? 40   PRO A CB    1 
ATOM   3877  C  CG    . PRO I  4 40   ? 47.089  27.692   -6.866  1.00 136.05 ? 40   PRO A CG    1 
ATOM   3878  C  CD    . PRO I  4 40   ? 47.175  28.656   -7.994  1.00 133.16 ? 40   PRO A CD    1 
ATOM   3879  N  N     . ALA I  4 41   ? 46.278  24.425   -9.767  1.00 129.12 ? 41   ALA A N     1 
ATOM   3880  C  CA    . ALA I  4 41   ? 45.127  23.612   -10.147 1.00 129.73 ? 41   ALA A CA    1 
ATOM   3881  C  C     . ALA I  4 41   ? 45.309  22.167   -9.700  1.00 133.16 ? 41   ALA A C     1 
ATOM   3882  O  O     . ALA I  4 41   ? 46.423  21.635   -9.716  1.00 134.07 ? 41   ALA A O     1 
ATOM   3883  C  CB    . ALA I  4 41   ? 44.905  23.669   -11.648 1.00 136.44 ? 41   ALA A CB    1 
ATOM   3884  N  N     . LEU I  4 42   ? 44.206  21.534   -9.307  1.00 126.57 ? 42   LEU A N     1 
ATOM   3885  C  CA    . LEU I  4 42   ? 44.242  20.159   -8.840  1.00 124.37 ? 42   LEU A CA    1 
ATOM   3886  C  C     . LEU I  4 42   ? 42.928  19.485   -9.188  1.00 120.97 ? 42   LEU A C     1 
ATOM   3887  O  O     . LEU I  4 42   ? 41.886  20.119   -9.113  1.00 123.52 ? 42   LEU A O     1 
ATOM   3888  C  CB    . LEU I  4 42   ? 44.487  20.143   -7.329  1.00 124.17 ? 42   LEU A CB    1 
ATOM   3889  C  CG    . LEU I  4 42   ? 44.586  18.805   -6.595  1.00 121.25 ? 42   LEU A CG    1 
ATOM   3890  C  CD1   . LEU I  4 42   ? 45.652  17.898   -7.174  1.00 123.84 ? 42   LEU A CD1   1 
ATOM   3891  C  CD2   . LEU I  4 42   ? 44.896  19.097   -5.143  1.00 121.42 ? 42   LEU A CD2   1 
ATOM   3892  N  N     . ALA I  4 43   ? 42.983  18.219   -9.602  1.00 116.79 ? 43   ALA A N     1 
ATOM   3893  C  CA    . ALA I  4 43   ? 41.791  17.491   -10.011 1.00 112.19 ? 43   ALA A CA    1 
ATOM   3894  C  C     . ALA I  4 43   ? 41.587  16.315   -9.102  1.00 121.60 ? 43   ALA A C     1 
ATOM   3895  O  O     . ALA I  4 43   ? 42.445  15.429   -9.014  1.00 125.45 ? 43   ALA A O     1 
ATOM   3896  C  CB    . ALA I  4 43   ? 41.893  17.010   -11.442 1.00 98.06  ? 43   ALA A CB    1 
ATOM   3897  N  N     . MET I  4 44   ? 40.431  16.295   -8.446  1.00 124.03 ? 44   MET A N     1 
ATOM   3898  C  CA    . MET I  4 44   ? 40.044  15.164   -7.643  1.00 124.83 ? 44   MET A CA    1 
ATOM   3899  C  C     . MET I  4 44   ? 39.513  14.053   -8.557  1.00 130.36 ? 44   MET A C     1 
ATOM   3900  O  O     . MET I  4 44   ? 38.437  14.203   -9.146  1.00 139.69 ? 44   MET A O     1 
ATOM   3901  C  CB    . MET I  4 44   ? 38.970  15.594   -6.657  1.00 132.07 ? 44   MET A CB    1 
ATOM   3902  C  CG    . MET I  4 44   ? 38.619  14.538   -5.616  1.00 136.04 ? 44   MET A CG    1 
ATOM   3903  S  SD    . MET I  4 44   ? 37.000  14.821   -4.885  1.00 132.67 ? 44   MET A SD    1 
ATOM   3904  C  CE    . MET I  4 44   ? 36.003  14.263   -6.257  1.00 120.34 ? 44   MET A CE    1 
ATOM   3905  N  N     . THR I  4 45   ? 40.277  12.962   -8.687  1.00 129.38 ? 45   THR A N     1 
ATOM   3906  C  CA    . THR I  4 45   ? 39.854  11.767   -9.441  1.00 126.88 ? 45   THR A CA    1 
ATOM   3907  C  C     . THR I  4 45   ? 39.937  10.511   -8.559  1.00 126.10 ? 45   THR A C     1 
ATOM   3908  O  O     . THR I  4 45   ? 41.024  9.936    -8.409  1.00 131.67 ? 45   THR A O     1 
ATOM   3909  C  CB    . THR I  4 45   ? 40.709  11.557   -10.714 1.00 125.36 ? 45   THR A CB    1 
ATOM   3910  O  OG1   . THR I  4 45   ? 42.082  11.306   -10.365 1.00 125.64 ? 45   THR A OG1   1 
ATOM   3911  C  CG2   . THR I  4 45   ? 40.620  12.780   -11.600 1.00 117.35 ? 45   THR A CG2   1 
ATOM   3912  N  N     . ASP I  4 46   ? 38.794  10.107   -7.988  1.00 120.23 ? 46   ASP A N     1 
ATOM   3913  C  CA    . ASP I  4 46   ? 38.704  8.971    -7.071  1.00 119.29 ? 46   ASP A CA    1 
ATOM   3914  C  C     . ASP I  4 46   ? 38.075  7.760    -7.728  1.00 128.12 ? 46   ASP A C     1 
ATOM   3915  O  O     . ASP I  4 46   ? 37.426  7.881    -8.772  1.00 143.57 ? 46   ASP A O     1 
ATOM   3916  C  CB    . ASP I  4 46   ? 37.868  9.343    -5.878  1.00 122.47 ? 46   ASP A CB    1 
ATOM   3917  C  CG    . ASP I  4 46   ? 38.455  10.483   -5.098  1.00 128.76 ? 46   ASP A CG    1 
ATOM   3918  O  OD1   . ASP I  4 46   ? 39.674  10.435   -4.826  1.00 124.11 ? 46   ASP A OD1   1 
ATOM   3919  O  OD2   . ASP I  4 46   ? 37.692  11.425   -4.757  1.00 136.05 ? 46   ASP A OD2   1 
ATOM   3920  N  N     . HIS I  4 47   ? 38.256  6.595    -7.101  1.00 126.49 ? 47   HIS A N     1 
ATOM   3921  C  CA    . HIS I  4 47   ? 37.917  5.311    -7.721  1.00 118.76 ? 47   HIS A CA    1 
ATOM   3922  C  C     . HIS I  4 47   ? 36.450  5.063    -7.628  1.00 109.14 ? 47   HIS A C     1 
ATOM   3923  O  O     . HIS I  4 47   ? 35.937  4.737    -6.579  1.00 114.48 ? 47   HIS A O     1 
ATOM   3924  C  CB    . HIS I  4 47   ? 38.681  4.162    -7.064  1.00 122.85 ? 47   HIS A CB    1 
ATOM   3925  C  CG    . HIS I  4 47   ? 40.167  4.057    -7.448  1.00 125.71 ? 47   HIS A CG    1 
ATOM   3926  N  ND1   . HIS I  4 47   ? 40.579  3.651    -8.660  1.00 115.80 ? 47   HIS A ND1   1 
ATOM   3927  C  CD2   . HIS I  4 47   ? 41.342  4.231    -6.671  1.00 133.86 ? 47   HIS A CD2   1 
ATOM   3928  C  CE1   . HIS I  4 47   ? 41.941  3.584    -8.672  1.00 124.79 ? 47   HIS A CE1   1 
ATOM   3929  N  NE2   . HIS I  4 47   ? 42.408  3.932    -7.453  1.00 115.43 ? 47   HIS A NE2   1 
ATOM   3930  N  N     . GLY I  4 48   ? 35.750  5.241    -8.736  1.00 116.80 ? 48   GLY A N     1 
ATOM   3931  C  CA    . GLY I  4 48   ? 34.308  4.942    -8.813  1.00 122.77 ? 48   GLY A CA    1 
ATOM   3932  C  C     . GLY I  4 48   ? 33.429  5.584    -7.739  1.00 118.77 ? 48   GLY A C     1 
ATOM   3933  O  O     . GLY I  4 48   ? 32.569  4.926    -7.163  1.00 109.73 ? 48   GLY A O     1 
ATOM   3934  N  N     . ASN I  4 49   ? 33.666  6.865    -7.473  1.00 116.29 ? 49   ASN A N     1 
ATOM   3935  C  CA    . ASN I  4 49   ? 32.870  7.641    -6.548  1.00 108.71 ? 49   ASN A CA    1 
ATOM   3936  C  C     . ASN I  4 49   ? 33.068  9.154    -6.663  1.00 108.84 ? 49   ASN A C     1 
ATOM   3937  O  O     . ASN I  4 49   ? 34.051  9.658    -7.183  1.00 111.85 ? 49   ASN A O     1 
ATOM   3938  C  CB    . ASN I  4 49   ? 33.157  7.196    -5.112  1.00 110.48 ? 49   ASN A CB    1 
ATOM   3939  C  CG    . ASN I  4 49   ? 34.558  7.501    -4.663  1.00 109.36 ? 49   ASN A CG    1 
ATOM   3940  O  OD1   . ASN I  4 49   ? 34.854  8.631    -4.320  1.00 109.88 ? 49   ASN A OD1   1 
ATOM   3941  N  ND2   . ASN I  4 49   ? 35.416  6.479    -4.618  1.00 122.28 ? 49   ASN A ND2   1 
ATOM   3942  N  N     . LEU I  4 50   ? 32.126  9.889    -6.126  1.00 116.24 ? 50   LEU A N     1 
ATOM   3943  C  CA    . LEU I  4 50   ? 32.187  11.325   -6.190  1.00 118.30 ? 50   LEU A CA    1 
ATOM   3944  C  C     . LEU I  4 50   ? 31.808  11.910   -4.817  1.00 122.47 ? 50   LEU A C     1 
ATOM   3945  O  O     . LEU I  4 50   ? 31.002  12.839   -4.720  1.00 141.81 ? 50   LEU A O     1 
ATOM   3946  C  CB    . LEU I  4 50   ? 31.248  11.769   -7.304  1.00 116.14 ? 50   LEU A CB    1 
ATOM   3947  C  CG    . LEU I  4 50   ? 31.409  13.160   -7.858  1.00 115.56 ? 50   LEU A CG    1 
ATOM   3948  C  CD1   . LEU I  4 50   ? 32.759  13.269   -8.538  1.00 121.68 ? 50   LEU A CD1   1 
ATOM   3949  C  CD2   . LEU I  4 50   ? 30.280  13.411   -8.838  1.00 114.57 ? 50   LEU A CD2   1 
ATOM   3950  N  N     . PHE I  4 51   ? 32.410  11.362   -3.763  1.00 116.70 ? 51   PHE A N     1 
ATOM   3951  C  CA    . PHE I  4 51   ? 32.059  11.719   -2.393  1.00 116.66 ? 51   PHE A CA    1 
ATOM   3952  C  C     . PHE I  4 51   ? 32.577  13.105   -2.023  1.00 119.71 ? 51   PHE A C     1 
ATOM   3953  O  O     . PHE I  4 51   ? 31.841  13.941   -1.484  1.00 123.41 ? 51   PHE A O     1 
ATOM   3954  C  CB    . PHE I  4 51   ? 32.641  10.713   -1.394  1.00 111.59 ? 51   PHE A CB    1 
ATOM   3955  C  CG    . PHE I  4 51   ? 32.254  9.277    -1.643  1.00 109.48 ? 51   PHE A CG    1 
ATOM   3956  C  CD1   . PHE I  4 51   ? 33.177  8.266    -1.428  1.00 110.09 ? 51   PHE A CD1   1 
ATOM   3957  C  CD2   . PHE I  4 51   ? 30.981  8.930    -2.061  1.00 111.69 ? 51   PHE A CD2   1 
ATOM   3958  C  CE1   . PHE I  4 51   ? 32.844  6.942    -1.617  1.00 108.90 ? 51   PHE A CE1   1 
ATOM   3959  C  CE2   . PHE I  4 51   ? 30.644  7.601    -2.260  1.00 111.92 ? 51   PHE A CE2   1 
ATOM   3960  C  CZ    . PHE I  4 51   ? 31.578  6.606    -2.040  1.00 108.74 ? 51   PHE A CZ    1 
ATOM   3961  N  N     . GLY I  4 52   ? 33.855  13.334   -2.301  1.00 120.42 ? 52   GLY A N     1 
ATOM   3962  C  CA    . GLY I  4 52   ? 34.529  14.557   -1.883  1.00 120.28 ? 52   GLY A CA    1 
ATOM   3963  C  C     . GLY I  4 52   ? 34.263  15.761   -2.760  1.00 120.37 ? 52   GLY A C     1 
ATOM   3964  O  O     . GLY I  4 52   ? 34.657  16.868   -2.408  1.00 122.35 ? 52   GLY A O     1 
ATOM   3965  N  N     . ALA I  4 53   ? 33.582  15.554   -3.887  1.00 121.20 ? 53   ALA A N     1 
ATOM   3966  C  CA    . ALA I  4 53   ? 33.337  16.620   -4.874  1.00 126.64 ? 53   ALA A CA    1 
ATOM   3967  C  C     . ALA I  4 53   ? 32.998  17.999   -4.291  1.00 125.85 ? 53   ALA A C     1 
ATOM   3968  O  O     . ALA I  4 53   ? 33.596  19.010   -4.659  1.00 135.71 ? 53   ALA A O     1 
ATOM   3969  C  CB    . ALA I  4 53   ? 32.236  16.194   -5.829  1.00 127.89 ? 53   ALA A CB    1 
ATOM   3970  N  N     . VAL I  4 54   ? 32.027  18.044   -3.399  1.00 120.59 ? 54   VAL A N     1 
ATOM   3971  C  CA    . VAL I  4 54   ? 31.599  19.319   -2.850  1.00 126.07 ? 54   VAL A CA    1 
ATOM   3972  C  C     . VAL I  4 54   ? 32.617  19.809   -1.809  1.00 125.58 ? 54   VAL A C     1 
ATOM   3973  O  O     . VAL I  4 54   ? 32.966  20.995   -1.786  1.00 122.59 ? 54   VAL A O     1 
ATOM   3974  C  CB    . VAL I  4 54   ? 30.169  19.232   -2.255  1.00 131.97 ? 54   VAL A CB    1 
ATOM   3975  C  CG1   . VAL I  4 54   ? 29.744  20.553   -1.628  1.00 128.10 ? 54   VAL A CG1   1 
ATOM   3976  C  CG2   . VAL I  4 54   ? 29.167  18.840   -3.333  1.00 134.23 ? 54   VAL A CG2   1 
ATOM   3977  N  N     . GLU I  4 55   ? 33.097  18.899   -0.961  1.00 122.45 ? 55   GLU A N     1 
ATOM   3978  C  CA    . GLU I  4 55   ? 34.042  19.263   0.086   1.00 124.43 ? 55   GLU A CA    1 
ATOM   3979  C  C     . GLU I  4 55   ? 35.385  19.660   -0.528  1.00 129.09 ? 55   GLU A C     1 
ATOM   3980  O  O     . GLU I  4 55   ? 36.067  20.545   -0.018  1.00 134.08 ? 55   GLU A O     1 
ATOM   3981  C  CB    . GLU I  4 55   ? 34.226  18.123   1.090   1.00 127.18 ? 55   GLU A CB    1 
ATOM   3982  C  CG    . GLU I  4 55   ? 34.992  18.520   2.354   1.00 133.40 ? 55   GLU A CG    1 
ATOM   3983  C  CD    . GLU I  4 55   ? 35.129  17.386   3.368   1.00 142.13 ? 55   GLU A CD    1 
ATOM   3984  O  OE1   . GLU I  4 55   ? 34.178  16.575   3.502   1.00 150.14 ? 55   GLU A OE1   1 
ATOM   3985  O  OE2   . GLU I  4 55   ? 36.186  17.319   4.041   1.00 135.86 ? 55   GLU A OE2   1 
ATOM   3986  N  N     . PHE I  4 56   ? 35.759  19.005   -1.623  1.00 127.13 ? 56   PHE A N     1 
ATOM   3987  C  CA    . PHE I  4 56   ? 36.992  19.335   -2.328  1.00 128.38 ? 56   PHE A CA    1 
ATOM   3988  C  C     . PHE I  4 56   ? 36.880  20.675   -3.014  1.00 131.31 ? 56   PHE A C     1 
ATOM   3989  O  O     . PHE I  4 56   ? 37.835  21.445   -3.034  1.00 139.81 ? 56   PHE A O     1 
ATOM   3990  C  CB    . PHE I  4 56   ? 37.336  18.269   -3.365  1.00 127.81 ? 56   PHE A CB    1 
ATOM   3991  C  CG    . PHE I  4 56   ? 38.522  18.611   -4.208  1.00 122.49 ? 56   PHE A CG    1 
ATOM   3992  C  CD1   . PHE I  4 56   ? 39.808  18.418   -3.740  1.00 123.76 ? 56   PHE A CD1   1 
ATOM   3993  C  CD2   . PHE I  4 56   ? 38.351  19.134   -5.468  1.00 129.55 ? 56   PHE A CD2   1 
ATOM   3994  C  CE1   . PHE I  4 56   ? 40.909  18.750   -4.519  1.00 127.35 ? 56   PHE A CE1   1 
ATOM   3995  C  CE2   . PHE I  4 56   ? 39.444  19.466   -6.260  1.00 130.45 ? 56   PHE A CE2   1 
ATOM   3996  C  CZ    . PHE I  4 56   ? 40.728  19.274   -5.782  1.00 128.16 ? 56   PHE A CZ    1 
ATOM   3997  N  N     . TYR I  4 57   ? 35.719  20.947   -3.590  1.00 135.51 ? 57   TYR A N     1 
ATOM   3998  C  CA    . TYR I  4 57   ? 35.482  22.219   -4.271  1.00 134.04 ? 57   TYR A CA    1 
ATOM   3999  C  C     . TYR I  4 57   ? 35.537  23.410   -3.331  1.00 137.97 ? 57   TYR A C     1 
ATOM   4000  O  O     . TYR I  4 57   ? 36.176  24.401   -3.662  1.00 147.55 ? 57   TYR A O     1 
ATOM   4001  C  CB    . TYR I  4 57   ? 34.126  22.199   -4.933  1.00 130.21 ? 57   TYR A CB    1 
ATOM   4002  C  CG    . TYR I  4 57   ? 33.709  23.491   -5.573  1.00 123.62 ? 57   TYR A CG    1 
ATOM   4003  C  CD1   . TYR I  4 57   ? 34.067  23.777   -6.858  1.00 126.99 ? 57   TYR A CD1   1 
ATOM   4004  C  CD2   . TYR I  4 57   ? 32.894  24.385   -4.914  1.00 124.58 ? 57   TYR A CD2   1 
ATOM   4005  C  CE1   . TYR I  4 57   ? 33.648  24.935   -7.475  1.00 129.84 ? 57   TYR A CE1   1 
ATOM   4006  C  CE2   . TYR I  4 57   ? 32.471  25.550   -5.514  1.00 123.92 ? 57   TYR A CE2   1 
ATOM   4007  C  CZ    . TYR I  4 57   ? 32.850  25.823   -6.795  1.00 128.94 ? 57   TYR A CZ    1 
ATOM   4008  O  OH    . TYR I  4 57   ? 32.425  26.993   -7.396  1.00 143.44 ? 57   TYR A OH    1 
ATOM   4009  N  N     . LYS I  4 58   ? 34.859  23.330   -2.182  1.00 135.89 ? 58   LYS A N     1 
ATOM   4010  C  CA    . LYS I  4 58   ? 34.769  24.488   -1.288  1.00 139.19 ? 58   LYS A CA    1 
ATOM   4011  C  C     . LYS I  4 58   ? 36.033  24.678   -0.448  1.00 136.59 ? 58   LYS A C     1 
ATOM   4012  O  O     . LYS I  4 58   ? 36.264  25.764   0.069   1.00 145.77 ? 58   LYS A O     1 
ATOM   4013  C  CB    . LYS I  4 58   ? 33.487  24.464   -0.429  1.00 144.70 ? 58   LYS A CB    1 
ATOM   4014  C  CG    . LYS I  4 58   ? 33.384  23.377   0.636   1.00 147.33 ? 58   LYS A CG    1 
ATOM   4015  C  CD    . LYS I  4 58   ? 32.019  23.438   1.327   1.00 152.68 ? 58   LYS A CD    1 
ATOM   4016  C  CE    . LYS I  4 58   ? 31.911  22.475   2.512   1.00 160.58 ? 58   LYS A CE    1 
ATOM   4017  N  NZ    . LYS I  4 58   ? 31.540  21.069   2.159   1.00 149.02 ? 58   LYS A NZ    1 
ATOM   4018  N  N     . LYS I  4 59   ? 36.863  23.640   -0.337  1.00 132.16 ? 59   LYS A N     1 
ATOM   4019  C  CA    . LYS I  4 59   ? 38.136  23.743   0.406   1.00 127.54 ? 59   LYS A CA    1 
ATOM   4020  C  C     . LYS I  4 59   ? 39.249  24.170   -0.502  1.00 123.74 ? 59   LYS A C     1 
ATOM   4021  O  O     . LYS I  4 59   ? 40.142  24.873   -0.075  1.00 122.56 ? 59   LYS A O     1 
ATOM   4022  C  CB    . LYS I  4 59   ? 38.534  22.423   1.072   1.00 130.10 ? 59   LYS A CB    1 
ATOM   4023  C  CG    . LYS I  4 59   ? 37.813  22.133   2.382   1.00 134.99 ? 59   LYS A CG    1 
ATOM   4024  C  CD    . LYS I  4 59   ? 38.495  21.023   3.153   1.00 135.95 ? 59   LYS A CD    1 
ATOM   4025  C  CE    . LYS I  4 59   ? 37.874  20.839   4.522   1.00 136.26 ? 59   LYS A CE    1 
ATOM   4026  N  NZ    . LYS I  4 59   ? 38.692  19.920   5.363   1.00 136.46 ? 59   LYS A NZ    1 
ATOM   4027  N  N     . ALA I  4 60   ? 39.207  23.709   -1.748  1.00 129.79 ? 60   ALA A N     1 
ATOM   4028  C  CA    . ALA I  4 60   ? 40.173  24.114   -2.753  1.00 127.43 ? 60   ALA A CA    1 
ATOM   4029  C  C     . ALA I  4 60   ? 40.020  25.604   -2.999  1.00 124.80 ? 60   ALA A C     1 
ATOM   4030  O  O     . ALA I  4 60   ? 40.975  26.360   -2.874  1.00 133.99 ? 60   ALA A O     1 
ATOM   4031  C  CB    . ALA I  4 60   ? 39.965  23.337   -4.041  1.00 126.54 ? 60   ALA A CB    1 
ATOM   4032  N  N     . THR I  4 61   ? 38.804  26.025   -3.312  1.00 125.89 ? 61   THR A N     1 
ATOM   4033  C  CA    . THR I  4 61   ? 38.498  27.445   -3.559  1.00 132.91 ? 61   THR A CA    1 
ATOM   4034  C  C     . THR I  4 61   ? 38.782  28.310   -2.318  1.00 136.34 ? 61   THR A C     1 
ATOM   4035  O  O     . THR I  4 61   ? 39.083  29.501   -2.432  1.00 135.56 ? 61   THR A O     1 
ATOM   4036  C  CB    . THR I  4 61   ? 37.020  27.634   -4.020  1.00 127.38 ? 61   THR A CB    1 
ATOM   4037  O  OG1   . THR I  4 61   ? 36.838  28.919   -4.611  1.00 130.65 ? 61   THR A OG1   1 
ATOM   4038  C  CG2   . THR I  4 61   ? 36.070  27.503   -2.866  1.00 117.80 ? 61   THR A CG2   1 
ATOM   4039  N  N     . ALA I  4 62   ? 38.686  27.702   -1.138  1.00 139.89 ? 62   ALA A N     1 
ATOM   4040  C  CA    . ALA I  4 62   ? 39.021  28.381   0.113   1.00 134.16 ? 62   ALA A CA    1 
ATOM   4041  C  C     . ALA I  4 62   ? 40.519  28.605   0.266   1.00 131.24 ? 62   ALA A C     1 
ATOM   4042  O  O     . ALA I  4 62   ? 40.930  29.496   0.996   1.00 137.02 ? 62   ALA A O     1 
ATOM   4043  C  CB    . ALA I  4 62   ? 38.493  27.590   1.297   1.00 134.77 ? 62   ALA A CB    1 
ATOM   4044  N  N     . MET I  4 63   ? 41.328  27.790   -0.410  1.00 137.08 ? 63   MET A N     1 
ATOM   4045  C  CA    . MET I  4 63   ? 42.787  27.933   -0.384  1.00 141.45 ? 63   MET A CA    1 
ATOM   4046  C  C     . MET I  4 63   ? 43.341  28.695   -1.590  1.00 135.93 ? 63   MET A C     1 
ATOM   4047  O  O     . MET I  4 63   ? 44.544  28.926   -1.669  1.00 144.29 ? 63   MET A O     1 
ATOM   4048  C  CB    . MET I  4 63   ? 43.458  26.558   -0.280  1.00 144.27 ? 63   MET A CB    1 
ATOM   4049  C  CG    . MET I  4 63   ? 43.228  25.887   1.063   1.00 148.45 ? 63   MET A CG    1 
ATOM   4050  S  SD    . MET I  4 63   ? 44.521  24.729   1.535   1.00 168.11 ? 63   MET A SD    1 
ATOM   4051  C  CE    . MET I  4 63   ? 45.923  25.839   1.739   1.00 155.42 ? 63   MET A CE    1 
ATOM   4052  N  N     . GLY I  4 64   ? 42.472  29.089   -2.514  1.00 130.81 ? 64   GLY A N     1 
ATOM   4053  C  CA    . GLY I  4 64   ? 42.891  29.778   -3.733  1.00 128.86 ? 64   GLY A CA    1 
ATOM   4054  C  C     . GLY I  4 64   ? 43.322  28.868   -4.875  1.00 126.24 ? 64   GLY A C     1 
ATOM   4055  O  O     . GLY I  4 64   ? 43.857  29.346   -5.864  1.00 131.10 ? 64   GLY A O     1 
ATOM   4056  N  N     . VAL I  4 65   ? 43.090  27.564   -4.740  1.00 123.19 ? 65   VAL A N     1 
ATOM   4057  C  CA    . VAL I  4 65   ? 43.421  26.585   -5.777  1.00 118.13 ? 65   VAL A CA    1 
ATOM   4058  C  C     . VAL I  4 65   ? 42.178  26.282   -6.600  1.00 117.09 ? 65   VAL A C     1 
ATOM   4059  O  O     . VAL I  4 65   ? 41.086  26.192   -6.067  1.00 123.20 ? 65   VAL A O     1 
ATOM   4060  C  CB    . VAL I  4 65   ? 43.963  25.276   -5.161  1.00 112.83 ? 65   VAL A CB    1 
ATOM   4061  C  CG1   . VAL I  4 65   ? 44.192  24.225   -6.225  1.00 113.95 ? 65   VAL A CG1   1 
ATOM   4062  C  CG2   . VAL I  4 65   ? 45.262  25.535   -4.426  1.00 115.40 ? 65   VAL A CG2   1 
ATOM   4063  N  N     . LYS I  4 66   ? 42.342  26.124   -7.901  1.00 120.27 ? 66   LYS A N     1 
ATOM   4064  C  CA    . LYS I  4 66   ? 41.212  25.826   -8.770  1.00 126.91 ? 66   LYS A CA    1 
ATOM   4065  C  C     . LYS I  4 66   ? 40.901  24.327   -8.756  1.00 124.81 ? 66   LYS A C     1 
ATOM   4066  O  O     . LYS I  4 66   ? 41.749  23.514   -9.116  1.00 130.03 ? 66   LYS A O     1 
ATOM   4067  C  CB    . LYS I  4 66   ? 41.508  26.271   -10.197 1.00 133.37 ? 66   LYS A CB    1 
ATOM   4068  C  CG    . LYS I  4 66   ? 40.286  26.318   -11.105 1.00 135.59 ? 66   LYS A CG    1 
ATOM   4069  C  CD    . LYS I  4 66   ? 40.688  26.454   -12.574 1.00 139.97 ? 66   LYS A CD    1 
ATOM   4070  C  CE    . LYS I  4 66   ? 39.471  26.515   -13.480 1.00 132.15 ? 66   LYS A CE    1 
ATOM   4071  N  NZ    . LYS I  4 66   ? 39.847  26.388   -14.905 1.00 130.25 ? 66   LYS A NZ    1 
ATOM   4072  N  N     . PRO I  4 67   ? 39.683  23.959   -8.343  1.00 121.43 ? 67   PRO A N     1 
ATOM   4073  C  CA    . PRO I  4 67   ? 39.330  22.558   -8.333  1.00 123.29 ? 67   PRO A CA    1 
ATOM   4074  C  C     . PRO I  4 67   ? 38.887  22.078   -9.725  1.00 123.23 ? 67   PRO A C     1 
ATOM   4075  O  O     . PRO I  4 67   ? 38.332  22.863   -10.504 1.00 125.09 ? 67   PRO A O     1 
ATOM   4076  C  CB    . PRO I  4 67   ? 38.191  22.501   -7.301  1.00 124.75 ? 67   PRO A CB    1 
ATOM   4077  C  CG    . PRO I  4 67   ? 37.536  23.836   -7.390  1.00 124.96 ? 67   PRO A CG    1 
ATOM   4078  C  CD    . PRO I  4 67   ? 38.584  24.809   -7.844  1.00 125.48 ? 67   PRO A CD    1 
ATOM   4079  N  N     . ILE I  4 68   ? 39.157  20.806   -10.027 1.00 119.14 ? 68   ILE A N     1 
ATOM   4080  C  CA    . ILE I  4 68   ? 38.661  20.146   -11.237 1.00 117.61 ? 68   ILE A CA    1 
ATOM   4081  C  C     . ILE I  4 68   ? 37.990  18.840   -10.813 1.00 122.22 ? 68   ILE A C     1 
ATOM   4082  O  O     . ILE I  4 68   ? 38.661  17.898   -10.382 1.00 124.44 ? 68   ILE A O     1 
ATOM   4083  C  CB    . ILE I  4 68   ? 39.803  19.834   -12.228 1.00 115.99 ? 68   ILE A CB    1 
ATOM   4084  C  CG1   . ILE I  4 68   ? 40.520  21.093   -12.664 1.00 117.34 ? 68   ILE A CG1   1 
ATOM   4085  C  CG2   . ILE I  4 68   ? 39.293  19.168   -13.491 1.00 116.42 ? 68   ILE A CG2   1 
ATOM   4086  C  CD1   . ILE I  4 68   ? 41.673  20.779   -13.578 1.00 108.73 ? 68   ILE A CD1   1 
ATOM   4087  N  N     . ILE I  4 69   ? 36.664  18.793   -10.908 1.00 125.21 ? 69   ILE A N     1 
ATOM   4088  C  CA    . ILE I  4 69   ? 35.916  17.635   -10.446 1.00 127.02 ? 69   ILE A CA    1 
ATOM   4089  C  C     . ILE I  4 69   ? 36.098  16.505   -11.447 1.00 123.23 ? 69   ILE A C     1 
ATOM   4090  O  O     . ILE I  4 69   ? 35.560  16.558   -12.557 1.00 116.04 ? 69   ILE A O     1 
ATOM   4091  C  CB    . ILE I  4 69   ? 34.424  17.968   -10.212 1.00 130.63 ? 69   ILE A CB    1 
ATOM   4092  C  CG1   . ILE I  4 69   ? 34.314  18.927   -9.020  1.00 132.70 ? 69   ILE A CG1   1 
ATOM   4093  C  CG2   . ILE I  4 69   ? 33.592  16.709   -9.963  1.00 124.41 ? 69   ILE A CG2   1 
ATOM   4094  C  CD1   . ILE I  4 69   ? 32.890  19.283   -8.646  1.00 154.30 ? 69   ILE A CD1   1 
ATOM   4095  N  N     . GLY I  4 70   ? 36.886  15.504   -11.041 1.00 120.89 ? 70   GLY A N     1 
ATOM   4096  C  CA    . GLY I  4 70   ? 37.182  14.334   -11.872 1.00 123.68 ? 70   GLY A CA    1 
ATOM   4097  C  C     . GLY I  4 70   ? 36.476  13.087   -11.391 1.00 125.32 ? 70   GLY A C     1 
ATOM   4098  O  O     . GLY I  4 70   ? 35.726  13.122   -10.406 1.00 122.80 ? 70   GLY A O     1 
ATOM   4099  N  N     . TYR I  4 71   ? 36.730  11.983   -12.089 1.00 126.04 ? 71   TYR A N     1 
ATOM   4100  C  CA    . TYR I  4 71   ? 36.102  10.706   -11.782 1.00 122.01 ? 71   TYR A CA    1 
ATOM   4101  C  C     . TYR I  4 71   ? 36.806  9.570    -12.550 1.00 121.30 ? 71   TYR A C     1 
ATOM   4102  O  O     . TYR I  4 71   ? 36.612  9.421    -13.751 1.00 120.34 ? 71   TYR A O     1 
ATOM   4103  C  CB    . TYR I  4 71   ? 34.616  10.784   -12.143 1.00 121.39 ? 71   TYR A CB    1 
ATOM   4104  C  CG    . TYR I  4 71   ? 33.819  9.515    -11.929 1.00 120.32 ? 71   TYR A CG    1 
ATOM   4105  C  CD1   . TYR I  4 71   ? 33.488  9.095    -10.657 1.00 116.33 ? 71   TYR A CD1   1 
ATOM   4106  C  CD2   . TYR I  4 71   ? 33.371  8.758    -13.010 1.00 117.75 ? 71   TYR A CD2   1 
ATOM   4107  C  CE1   . TYR I  4 71   ? 32.752  7.943    -10.461 1.00 121.16 ? 71   TYR A CE1   1 
ATOM   4108  C  CE2   . TYR I  4 71   ? 32.626  7.617    -12.822 1.00 120.79 ? 71   TYR A CE2   1 
ATOM   4109  C  CZ    . TYR I  4 71   ? 32.317  7.210    -11.547 1.00 122.97 ? 71   TYR A CZ    1 
ATOM   4110  O  OH    . TYR I  4 71   ? 31.589  6.048    -11.368 1.00 133.97 ? 71   TYR A OH    1 
ATOM   4111  N  N     . GLU I  4 72   ? 37.642  8.794    -11.854 1.00 122.99 ? 72   GLU A N     1 
ATOM   4112  C  CA    . GLU I  4 72   ? 38.256  7.569    -12.427 1.00 130.85 ? 72   GLU A CA    1 
ATOM   4113  C  C     . GLU I  4 72   ? 37.271  6.370    -12.504 1.00 121.86 ? 72   GLU A C     1 
ATOM   4114  O  O     . GLU I  4 72   ? 37.267  5.487    -11.646 1.00 106.72 ? 72   GLU A O     1 
ATOM   4115  C  CB    . GLU I  4 72   ? 39.544  7.167    -11.662 1.00 132.93 ? 72   GLU A CB    1 
ATOM   4116  C  CG    . GLU I  4 72   ? 40.288  5.967    -12.266 1.00 138.30 ? 72   GLU A CG    1 
ATOM   4117  C  CD    . GLU I  4 72   ? 41.781  5.805    -11.859 1.00 152.18 ? 72   GLU A CD    1 
ATOM   4118  O  OE1   . GLU I  4 72   ? 42.376  6.628    -11.099 1.00 142.98 ? 72   GLU A OE1   1 
ATOM   4119  O  OE2   . GLU I  4 72   ? 42.406  4.805    -12.322 1.00 149.87 ? 72   GLU A OE2   1 
ATOM   4120  N  N     . ALA I  4 73   ? 36.478  6.341    -13.575 1.00 115.38 ? 73   ALA A N     1 
ATOM   4121  C  CA    . ALA I  4 73   ? 35.420  5.372    -13.730 1.00 116.66 ? 73   ALA A CA    1 
ATOM   4122  C  C     . ALA I  4 73   ? 35.948  3.953    -13.953 1.00 117.95 ? 73   ALA A C     1 
ATOM   4123  O  O     . ALA I  4 73   ? 36.909  3.751    -14.677 1.00 123.40 ? 73   ALA A O     1 
ATOM   4124  C  CB    . ALA I  4 73   ? 34.515  5.785    -14.884 1.00 118.16 ? 73   ALA A CB    1 
ATOM   4125  N  N     . TYR I  4 74   ? 35.293  2.979    -13.330 1.00 119.36 ? 74   TYR A N     1 
ATOM   4126  C  CA    . TYR I  4 74   ? 35.461  1.571    -13.685 1.00 120.12 ? 74   TYR A CA    1 
ATOM   4127  C  C     . TYR I  4 74   ? 34.590  1.228    -14.900 1.00 129.03 ? 74   TYR A C     1 
ATOM   4128  O  O     . TYR I  4 74   ? 33.367  1.143    -14.793 1.00 130.02 ? 74   TYR A O     1 
ATOM   4129  C  CB    . TYR I  4 74   ? 35.058  0.686    -12.517 1.00 122.78 ? 74   TYR A CB    1 
ATOM   4130  C  CG    . TYR I  4 74   ? 36.010  0.756    -11.363 1.00 123.64 ? 74   TYR A CG    1 
ATOM   4131  C  CD1   . TYR I  4 74   ? 35.652  1.365    -10.157 1.00 127.14 ? 74   TYR A CD1   1 
ATOM   4132  C  CD2   . TYR I  4 74   ? 37.282  0.220    -11.476 1.00 123.40 ? 74   TYR A CD2   1 
ATOM   4133  C  CE1   . TYR I  4 74   ? 36.548  1.432    -9.096  1.00 130.26 ? 74   TYR A CE1   1 
ATOM   4134  C  CE2   . TYR I  4 74   ? 38.187  0.285    -10.429 1.00 125.34 ? 74   TYR A CE2   1 
ATOM   4135  C  CZ    . TYR I  4 74   ? 37.814  0.885    -9.240  1.00 129.92 ? 74   TYR A CZ    1 
ATOM   4136  O  OH    . TYR I  4 74   ? 38.701  0.935    -8.195  1.00 136.14 ? 74   TYR A OH    1 
ATOM   4137  N  N     . VAL I  4 75   ? 35.234  0.910    -15.990 1.00 130.84 ? 75   VAL A N     1 
ATOM   4138  C  CA    . VAL I  4 75   ? 34.506  0.672    -17.186 1.00 125.83 ? 75   VAL A CA    1 
ATOM   4139  C  C     . VAL I  4 75   ? 34.376  -0.785   -17.450 1.00 130.32 ? 75   VAL A C     1 
ATOM   4140  O  O     . VAL I  4 75   ? 35.356  -1.500   -17.399 1.00 134.49 ? 75   VAL A O     1 
ATOM   4141  C  CB    . VAL I  4 75   ? 35.261  1.223    -18.343 1.00 123.70 ? 75   VAL A CB    1 
ATOM   4142  C  CG1   . VAL I  4 75   ? 34.377  1.172    -19.544 1.00 117.76 ? 75   VAL A CG1   1 
ATOM   4143  C  CG2   . VAL I  4 75   ? 35.675  2.637    -18.052 1.00 126.40 ? 75   VAL A CG2   1 
ATOM   4144  N  N     . ALA I  4 76   ? 33.162  -1.228   -17.737 1.00 130.88 ? 76   ALA A N     1 
ATOM   4145  C  CA    . ALA I  4 76   ? 32.929  -2.652   -17.973 1.00 127.16 ? 76   ALA A CA    1 
ATOM   4146  C  C     . ALA I  4 76   ? 33.557  -3.129   -19.289 1.00 132.15 ? 76   ALA A C     1 
ATOM   4147  O  O     . ALA I  4 76   ? 33.752  -2.342   -20.230 1.00 135.39 ? 76   ALA A O     1 
ATOM   4148  C  CB    . ALA I  4 76   ? 31.437  -2.941   -17.960 1.00 124.09 ? 76   ALA A CB    1 
ATOM   4149  N  N     . ALA I  4 77   ? 33.864  -4.423   -19.345 1.00 132.93 ? 77   ALA A N     1 
ATOM   4150  C  CA    . ALA I  4 77   ? 34.494  -5.038   -20.520 1.00 128.08 ? 77   ALA A CA    1 
ATOM   4151  C  C     . ALA I  4 77   ? 33.575  -4.979   -21.741 1.00 131.09 ? 77   ALA A C     1 
ATOM   4152  O  O     . ALA I  4 77   ? 34.036  -4.747   -22.868 1.00 127.73 ? 77   ALA A O     1 
ATOM   4153  C  CB    . ALA I  4 77   ? 34.866  -6.479   -20.210 1.00 124.66 ? 77   ALA A CB    1 
ATOM   4154  N  N     . GLU I  4 78   ? 32.277  -5.190   -21.509 1.00 132.19 ? 78   GLU A N     1 
ATOM   4155  C  CA    . GLU I  4 78   ? 31.286  -5.129   -22.577 1.00 139.45 ? 78   GLU A CA    1 
ATOM   4156  C  C     . GLU I  4 78   ? 30.028  -4.383   -22.144 1.00 131.11 ? 78   GLU A C     1 
ATOM   4157  O  O     . GLU I  4 78   ? 29.707  -3.322   -22.676 1.00 135.58 ? 78   GLU A O     1 
ATOM   4158  C  CB    . GLU I  4 78   ? 30.937  -6.540   -23.084 1.00 141.44 ? 78   GLU A CB    1 
ATOM   4159  C  CG    . GLU I  4 78   ? 32.051  -7.209   -23.887 1.00 142.14 ? 78   GLU A CG    1 
ATOM   4160  C  CD    . GLU I  4 78   ? 32.435  -6.444   -25.145 1.00 147.89 ? 78   GLU A CD    1 
ATOM   4161  O  OE1   . GLU I  4 78   ? 31.606  -5.659   -25.673 1.00 149.95 ? 78   GLU A OE1   1 
ATOM   4162  O  OE2   . GLU I  4 78   ? 33.579  -6.636   -25.608 1.00 151.78 ? 78   GLU A OE2   1 
ATOM   4163  N  N     . SER I  4 79   ? 29.307  -4.946   -21.193 1.00 127.63 ? 79   SER A N     1 
ATOM   4164  C  CA    . SER I  4 79   ? 28.101  -4.299   -20.680 1.00 123.95 ? 79   SER A CA    1 
ATOM   4165  C  C     . SER I  4 79   ? 28.128  -4.314   -19.171 1.00 121.99 ? 79   SER A C     1 
ATOM   4166  O  O     . SER I  4 79   ? 28.824  -5.135   -18.561 1.00 123.91 ? 79   SER A O     1 
ATOM   4167  C  CB    . SER I  4 79   ? 26.850  -5.011   -21.184 1.00 124.36 ? 79   SER A CB    1 
ATOM   4168  O  OG    . SER I  4 79   ? 25.662  -4.329   -20.809 1.00 114.52 ? 79   SER A OG    1 
ATOM   4169  N  N     . ARG I  4 80   ? 27.362  -3.408   -18.574 1.00 119.54 ? 80   ARG A N     1 
ATOM   4170  C  CA    . ARG I  4 80   ? 27.312  -3.287   -17.116 1.00 122.23 ? 80   ARG A CA    1 
ATOM   4171  C  C     . ARG I  4 80   ? 26.402  -4.315   -16.461 1.00 125.73 ? 80   ARG A C     1 
ATOM   4172  O  O     . ARG I  4 80   ? 26.519  -4.549   -15.270 1.00 126.49 ? 80   ARG A O     1 
ATOM   4173  C  CB    . ARG I  4 80   ? 26.875  -1.890   -16.708 1.00 119.59 ? 80   ARG A CB    1 
ATOM   4174  C  CG    . ARG I  4 80   ? 25.475  -1.508   -17.146 1.00 119.16 ? 80   ARG A CG    1 
ATOM   4175  C  CD    . ARG I  4 80   ? 25.261  -0.030   -16.913 1.00 119.65 ? 80   ARG A CD    1 
ATOM   4176  N  NE    . ARG I  4 80   ? 23.951  0.432    -17.359 1.00 115.35 ? 80   ARG A NE    1 
ATOM   4177  C  CZ    . ARG I  4 80   ? 23.601  0.630    -18.624 1.00 114.55 ? 80   ARG A CZ    1 
ATOM   4178  N  NH1   . ARG I  4 80   ? 24.438  0.381    -19.620 1.00 118.64 ? 80   ARG A NH1   1 
ATOM   4179  N  NH2   . ARG I  4 80   ? 22.391  1.085    -18.898 1.00 118.28 ? 80   ARG A NH2   1 
ATOM   4180  N  N     . PHE I  4 81   ? 25.532  -4.942   -17.247 1.00 129.28 ? 81   PHE A N     1 
ATOM   4181  C  CA    . PHE I  4 81   ? 24.691  -6.014   -16.758 1.00 133.46 ? 81   PHE A CA    1 
ATOM   4182  C  C     . PHE I  4 81   ? 25.443  -7.353   -16.654 1.00 133.05 ? 81   PHE A C     1 
ATOM   4183  O  O     . PHE I  4 81   ? 24.916  -8.303   -16.071 1.00 138.20 ? 81   PHE A O     1 
ATOM   4184  C  CB    . PHE I  4 81   ? 23.467  -6.149   -17.670 1.00 144.59 ? 81   PHE A CB    1 
ATOM   4185  C  CG    . PHE I  4 81   ? 22.749  -4.841   -17.929 1.00 142.98 ? 81   PHE A CG    1 
ATOM   4186  C  CD1   . PHE I  4 81   ? 22.748  -4.267   -19.205 1.00 154.11 ? 81   PHE A CD1   1 
ATOM   4187  C  CD2   . PHE I  4 81   ? 22.078  -4.185   -16.911 1.00 132.63 ? 81   PHE A CD2   1 
ATOM   4188  C  CE1   . PHE I  4 81   ? 22.081  -3.071   -19.456 1.00 145.43 ? 81   PHE A CE1   1 
ATOM   4189  C  CE2   . PHE I  4 81   ? 21.414  -2.987   -17.153 1.00 136.04 ? 81   PHE A CE2   1 
ATOM   4190  C  CZ    . PHE I  4 81   ? 21.413  -2.433   -18.427 1.00 138.87 ? 81   PHE A CZ    1 
ATOM   4191  N  N     . ASP I  4 82   ? 26.656  -7.423   -17.214 1.00 136.45 ? 82   ASP A N     1 
ATOM   4192  C  CA    . ASP I  4 82   ? 27.452  -8.663   -17.248 1.00 143.05 ? 82   ASP A CA    1 
ATOM   4193  C  C     . ASP I  4 82   ? 27.955  -9.004   -15.853 1.00 138.23 ? 82   ASP A C     1 
ATOM   4194  O  O     . ASP I  4 82   ? 28.481  -8.157   -15.155 1.00 127.11 ? 82   ASP A O     1 
ATOM   4195  C  CB    . ASP I  4 82   ? 28.640  -8.546   -18.219 1.00 142.46 ? 82   ASP A CB    1 
ATOM   4196  C  CG    . ASP I  4 82   ? 28.206  -8.346   -19.657 1.00 147.61 ? 82   ASP A CG    1 
ATOM   4197  O  OD1   . ASP I  4 82   ? 27.121  -8.852   -20.019 1.00 155.01 ? 82   ASP A OD1   1 
ATOM   4198  O  OD2   . ASP I  4 82   ? 28.951  -7.698   -20.429 1.00 155.78 ? 82   ASP A OD2   1 
ATOM   4199  N  N     . ARG I  4 83   ? 27.772  -10.252  -15.446 1.00 146.11 ? 83   ARG A N     1 
ATOM   4200  C  CA    . ARG I  4 83   ? 28.152  -10.671  -14.114 1.00 155.10 ? 83   ARG A CA    1 
ATOM   4201  C  C     . ARG I  4 83   ? 28.696  -12.094  -14.169 1.00 161.61 ? 83   ARG A C     1 
ATOM   4202  O  O     . ARG I  4 83   ? 29.418  -12.520  -13.263 1.00 173.12 ? 83   ARG A O     1 
ATOM   4203  C  CB    . ARG I  4 83   ? 26.940  -10.579  -13.187 1.00 158.98 ? 83   ARG A CB    1 
ATOM   4204  C  CG    . ARG I  4 83   ? 26.092  -9.335   -13.425 1.00 164.30 ? 83   ARG A CG    1 
ATOM   4205  C  CD    . ARG I  4 83   ? 24.997  -9.150   -12.395 1.00 174.45 ? 83   ARG A CD    1 
ATOM   4206  N  NE    . ARG I  4 83   ? 25.522  -8.661   -11.122 1.00 185.16 ? 83   ARG A NE    1 
ATOM   4207  C  CZ    . ARG I  4 83   ? 24.796  -8.085   -10.160 1.00 186.53 ? 83   ARG A CZ    1 
ATOM   4208  N  NH1   . ARG I  4 83   ? 23.483  -7.894   -10.305 1.00 183.58 ? 83   ARG A NH1   1 
ATOM   4209  N  NH2   . ARG I  4 83   ? 25.392  -7.690   -9.039  1.00 178.99 ? 83   ARG A NH2   1 
ATOM   4210  N  N     . GLY I  4 92   ? 36.534  -8.448   -16.272 1.00 149.25 ? 92   GLY A N     1 
ATOM   4211  C  CA    . GLY I  4 92   ? 35.975  -7.831   -15.076 1.00 151.77 ? 92   GLY A CA    1 
ATOM   4212  C  C     . GLY I  4 92   ? 35.591  -6.376   -15.297 1.00 159.86 ? 92   GLY A C     1 
ATOM   4213  O  O     . GLY I  4 92   ? 34.408  -6.058   -15.483 1.00 159.10 ? 92   GLY A O     1 
ATOM   4214  N  N     . TYR I  4 93   ? 36.594  -5.494   -15.269 1.00 160.04 ? 93   TYR A N     1 
ATOM   4215  C  CA    . TYR I  4 93   ? 36.390  -4.057   -15.502 1.00 152.42 ? 93   TYR A CA    1 
ATOM   4216  C  C     . TYR I  4 93   ? 37.692  -3.323   -15.870 1.00 151.38 ? 93   TYR A C     1 
ATOM   4217  O  O     . TYR I  4 93   ? 38.783  -3.879   -15.761 1.00 162.87 ? 93   TYR A O     1 
ATOM   4218  C  CB    . TYR I  4 93   ? 35.734  -3.409   -14.274 1.00 147.69 ? 93   TYR A CB    1 
ATOM   4219  C  CG    . TYR I  4 93   ? 36.448  -3.665   -12.967 1.00 144.54 ? 93   TYR A CG    1 
ATOM   4220  C  CD1   . TYR I  4 93   ? 37.594  -2.950   -12.617 1.00 144.28 ? 93   TYR A CD1   1 
ATOM   4221  C  CD2   . TYR I  4 93   ? 35.967  -4.611   -12.069 1.00 148.69 ? 93   TYR A CD2   1 
ATOM   4222  C  CE1   . TYR I  4 93   ? 38.245  -3.182   -11.411 1.00 150.75 ? 93   TYR A CE1   1 
ATOM   4223  C  CE2   . TYR I  4 93   ? 36.609  -4.851   -10.858 1.00 153.04 ? 93   TYR A CE2   1 
ATOM   4224  C  CZ    . TYR I  4 93   ? 37.748  -4.134   -10.529 1.00 151.28 ? 93   TYR A CZ    1 
ATOM   4225  O  OH    . TYR I  4 93   ? 38.388  -4.363   -9.326  1.00 144.69 ? 93   TYR A OH    1 
ATOM   4226  N  N     . PHE I  4 94   ? 37.561  -2.071   -16.295 1.00 146.17 ? 94   PHE A N     1 
ATOM   4227  C  CA    . PHE I  4 94   ? 38.687  -1.267   -16.743 1.00 146.03 ? 94   PHE A CA    1 
ATOM   4228  C  C     . PHE I  4 94   ? 38.630  0.152    -16.176 1.00 145.25 ? 94   PHE A C     1 
ATOM   4229  O  O     . PHE I  4 94   ? 37.540  0.695    -15.948 1.00 138.86 ? 94   PHE A O     1 
ATOM   4230  C  CB    . PHE I  4 94   ? 38.680  -1.187   -18.273 1.00 145.78 ? 94   PHE A CB    1 
ATOM   4231  C  CG    . PHE I  4 94   ? 39.262  -2.384   -18.941 1.00 146.21 ? 94   PHE A CG    1 
ATOM   4232  C  CD1   . PHE I  4 94   ? 38.448  -3.370   -19.456 1.00 152.04 ? 94   PHE A CD1   1 
ATOM   4233  C  CD2   . PHE I  4 94   ? 40.632  -2.520   -19.059 1.00 149.64 ? 94   PHE A CD2   1 
ATOM   4234  C  CE1   . PHE I  4 94   ? 38.987  -4.483   -20.079 1.00 156.24 ? 94   PHE A CE1   1 
ATOM   4235  C  CE2   . PHE I  4 94   ? 41.181  -3.623   -19.683 1.00 158.10 ? 94   PHE A CE2   1 
ATOM   4236  C  CZ    . PHE I  4 94   ? 40.357  -4.610   -20.194 1.00 160.56 ? 94   PHE A CZ    1 
ATOM   4237  N  N     . HIS I  4 95   ? 39.804  0.763    -16.002 1.00 137.31 ? 95   HIS A N     1 
ATOM   4238  C  CA    . HIS I  4 95   ? 39.905  2.142    -15.532 1.00 127.76 ? 95   HIS A CA    1 
ATOM   4239  C  C     . HIS I  4 95   ? 39.819  3.143    -16.651 1.00 127.31 ? 95   HIS A C     1 
ATOM   4240  O  O     . HIS I  4 95   ? 40.192  2.858    -17.798 1.00 125.27 ? 95   HIS A O     1 
ATOM   4241  C  CB    . HIS I  4 95   ? 41.215  2.347    -14.802 1.00 133.05 ? 95   HIS A CB    1 
ATOM   4242  C  CG    . HIS I  4 95   ? 41.339  1.545    -13.531 1.00 127.77 ? 95   HIS A CG    1 
ATOM   4243  N  ND1   . HIS I  4 95   ? 41.849  2.066    -12.394 1.00 123.91 ? 95   HIS A ND1   1 
ATOM   4244  C  CD2   . HIS I  4 95   ? 41.016  0.214    -13.253 1.00 120.16 ? 95   HIS A CD2   1 
ATOM   4245  C  CE1   . HIS I  4 95   ? 41.844  1.116    -11.441 1.00 128.31 ? 95   HIS A CE1   1 
ATOM   4246  N  NE2   . HIS I  4 95   ? 41.337  -0.017   -11.973 1.00 117.62 ? 95   HIS A NE2   1 
ATOM   4247  N  N     . LEU I  4 96   ? 39.336  4.338    -16.313 1.00 125.75 ? 96   LEU A N     1 
ATOM   4248  C  CA    . LEU I  4 96   ? 39.199  5.427    -17.274 1.00 122.24 ? 96   LEU A CA    1 
ATOM   4249  C  C     . LEU I  4 96   ? 39.029  6.740    -16.526 1.00 121.86 ? 96   LEU A C     1 
ATOM   4250  O  O     . LEU I  4 96   ? 38.078  6.902    -15.775 1.00 112.24 ? 96   LEU A O     1 
ATOM   4251  C  CB    . LEU I  4 96   ? 37.989  5.177    -18.185 1.00 123.11 ? 96   LEU A CB    1 
ATOM   4252  C  CG    . LEU I  4 96   ? 37.750  6.087    -19.389 1.00 114.19 ? 96   LEU A CG    1 
ATOM   4253  C  CD1   . LEU I  4 96   ? 38.941  6.040    -20.320 1.00 110.54 ? 96   LEU A CD1   1 
ATOM   4254  C  CD2   . LEU I  4 96   ? 36.480  5.654    -20.119 1.00 115.15 ? 96   LEU A CD2   1 
ATOM   4255  N  N     . THR I  4 97   ? 39.956  7.676    -16.736 1.00 131.81 ? 97   THR A N     1 
ATOM   4256  C  CA    . THR I  4 97   ? 39.886  9.017    -16.116 1.00 124.38 ? 97   THR A CA    1 
ATOM   4257  C  C     . THR I  4 97   ? 38.948  9.975    -16.862 1.00 121.61 ? 97   THR A C     1 
ATOM   4258  O  O     . THR I  4 97   ? 39.137  10.222   -18.064 1.00 129.30 ? 97   THR A O     1 
ATOM   4259  C  CB    . THR I  4 97   ? 41.268  9.702    -16.087 1.00 119.86 ? 97   THR A CB    1 
ATOM   4260  O  OG1   . THR I  4 97   ? 42.274  8.797    -15.609 1.00 120.97 ? 97   THR A OG1   1 
ATOM   4261  C  CG2   . THR I  4 97   ? 41.219  10.939   -15.199 1.00 113.02 ? 97   THR A CG2   1 
ATOM   4262  N  N     . LEU I  4 98   ? 37.975  10.541   -16.150 1.00 113.05 ? 98   LEU A N     1 
ATOM   4263  C  CA    . LEU I  4 98   ? 37.066  11.522   -16.740 1.00 109.68 ? 98   LEU A CA    1 
ATOM   4264  C  C     . LEU I  4 98   ? 37.120  12.844   -15.980 1.00 111.97 ? 98   LEU A C     1 
ATOM   4265  O  O     . LEU I  4 98   ? 37.133  12.840   -14.756 1.00 114.44 ? 98   LEU A O     1 
ATOM   4266  C  CB    . LEU I  4 98   ? 35.667  10.969   -16.740 1.00 107.76 ? 98   LEU A CB    1 
ATOM   4267  C  CG    . LEU I  4 98   ? 35.497  9.582    -17.390 1.00 109.11 ? 98   LEU A CG    1 
ATOM   4268  C  CD1   . LEU I  4 98   ? 34.055  9.096    -17.270 1.00 108.67 ? 98   LEU A CD1   1 
ATOM   4269  C  CD2   . LEU I  4 98   ? 35.882  9.604    -18.852 1.00 118.63 ? 98   LEU A CD2   1 
ATOM   4270  N  N     . LEU I  4 99   ? 37.195  13.963   -16.711 1.00 115.41 ? 99   LEU A N     1 
ATOM   4271  C  CA    . LEU I  4 99   ? 37.312  15.307   -16.120 1.00 114.50 ? 99   LEU A CA    1 
ATOM   4272  C  C     . LEU I  4 99   ? 36.192  16.218   -16.579 1.00 112.05 ? 99   LEU A C     1 
ATOM   4273  O  O     . LEU I  4 99   ? 35.898  16.268   -17.761 1.00 113.45 ? 99   LEU A O     1 
ATOM   4274  C  CB    . LEU I  4 99   ? 38.630  15.960   -16.520 1.00 118.95 ? 99   LEU A CB    1 
ATOM   4275  C  CG    . LEU I  4 99   ? 39.923  15.315   -16.053 1.00 118.70 ? 99   LEU A CG    1 
ATOM   4276  C  CD1   . LEU I  4 99   ? 41.094  16.086   -16.637 1.00 120.49 ? 99   LEU A CD1   1 
ATOM   4277  C  CD2   . LEU I  4 99   ? 39.974  15.343   -14.543 1.00 119.29 ? 99   LEU A CD2   1 
ATOM   4278  N  N     . ALA I  4 100  ? 35.597  16.962   -15.647 1.00 119.05 ? 100  ALA A N     1 
ATOM   4279  C  CA    . ALA I  4 100  ? 34.458  17.849   -15.949 1.00 124.59 ? 100  ALA A CA    1 
ATOM   4280  C  C     . ALA I  4 100  ? 34.876  19.123   -16.691 1.00 124.82 ? 100  ALA A C     1 
ATOM   4281  O  O     . ALA I  4 100  ? 35.645  19.926   -16.175 1.00 120.67 ? 100  ALA A O     1 
ATOM   4282  C  CB    . ALA I  4 100  ? 33.724  18.222   -14.673 1.00 132.04 ? 100  ALA A CB    1 
ATOM   4283  N  N     . LYS I  4 101  ? 34.350  19.293   -17.900 1.00 126.80 ? 101  LYS A N     1 
ATOM   4284  C  CA    . LYS I  4 101  ? 34.669  20.434   -18.750 1.00 127.46 ? 101  LYS A CA    1 
ATOM   4285  C  C     . LYS I  4 101  ? 33.937  21.675   -18.247 1.00 126.33 ? 101  LYS A C     1 
ATOM   4286  O  O     . LYS I  4 101  ? 34.542  22.738   -18.071 1.00 122.00 ? 101  LYS A O     1 
ATOM   4287  C  CB    . LYS I  4 101  ? 34.255  20.115   -20.195 1.00 137.85 ? 101  LYS A CB    1 
ATOM   4288  C  CG    . LYS I  4 101  ? 34.423  21.223   -21.226 1.00 142.18 ? 101  LYS A CG    1 
ATOM   4289  C  CD    . LYS I  4 101  ? 35.867  21.601   -21.420 1.00 150.12 ? 101  LYS A CD    1 
ATOM   4290  C  CE    . LYS I  4 101  ? 35.998  22.584   -22.571 1.00 159.66 ? 101  LYS A CE    1 
ATOM   4291  N  NZ    . LYS I  4 101  ? 37.405  23.043   -22.737 1.00 170.99 ? 101  LYS A NZ    1 
ATOM   4292  N  N     . ASP I  4 102  ? 32.630  21.532   -18.040 1.00 123.85 ? 102  ASP A N     1 
ATOM   4293  C  CA    . ASP I  4 102  ? 31.786  22.618   -17.574 1.00 124.44 ? 102  ASP A CA    1 
ATOM   4294  C  C     . ASP I  4 102  ? 30.657  22.032   -16.733 1.00 130.64 ? 102  ASP A C     1 
ATOM   4295  O  O     . ASP I  4 102  ? 30.660  20.831   -16.482 1.00 140.32 ? 102  ASP A O     1 
ATOM   4296  C  CB    . ASP I  4 102  ? 31.242  23.398   -18.765 1.00 126.41 ? 102  ASP A CB    1 
ATOM   4297  C  CG    . ASP I  4 102  ? 30.494  22.515   -19.756 1.00 127.57 ? 102  ASP A CG    1 
ATOM   4298  O  OD1   . ASP I  4 102  ? 29.361  22.098   -19.443 1.00 131.14 ? 102  ASP A OD1   1 
ATOM   4299  O  OD2   . ASP I  4 102  ? 31.023  22.270   -20.862 1.00 115.78 ? 102  ASP A OD2   1 
ATOM   4300  N  N     . PHE I  4 103  ? 29.702  22.863   -16.302 1.00 128.55 ? 103  PHE A N     1 
ATOM   4301  C  CA    . PHE I  4 103  ? 28.610  22.414   -15.436 1.00 118.70 ? 103  PHE A CA    1 
ATOM   4302  C  C     . PHE I  4 103  ? 27.761  21.288   -16.040 1.00 114.80 ? 103  PHE A C     1 
ATOM   4303  O  O     . PHE I  4 103  ? 27.309  20.420   -15.315 1.00 113.81 ? 103  PHE A O     1 
ATOM   4304  C  CB    . PHE I  4 103  ? 27.714  23.582   -15.025 1.00 122.14 ? 103  PHE A CB    1 
ATOM   4305  C  CG    . PHE I  4 103  ? 26.770  23.240   -13.903 1.00 128.67 ? 103  PHE A CG    1 
ATOM   4306  C  CD1   . PHE I  4 103  ? 27.233  23.167   -12.597 1.00 126.39 ? 103  PHE A CD1   1 
ATOM   4307  C  CD2   . PHE I  4 103  ? 25.428  22.955   -14.152 1.00 132.22 ? 103  PHE A CD2   1 
ATOM   4308  C  CE1   . PHE I  4 103  ? 26.383  22.830   -11.562 1.00 125.60 ? 103  PHE A CE1   1 
ATOM   4309  C  CE2   . PHE I  4 103  ? 24.573  22.624   -13.115 1.00 129.59 ? 103  PHE A CE2   1 
ATOM   4310  C  CZ    . PHE I  4 103  ? 25.054  22.563   -11.818 1.00 128.37 ? 103  PHE A CZ    1 
ATOM   4311  N  N     . THR I  4 104  ? 27.567  21.286   -17.357 1.00 122.43 ? 104  THR A N     1 
ATOM   4312  C  CA    . THR I  4 104  ? 26.917  20.155   -18.055 1.00 126.77 ? 104  THR A CA    1 
ATOM   4313  C  C     . THR I  4 104  ? 27.703  18.877   -17.814 1.00 129.41 ? 104  THR A C     1 
ATOM   4314  O  O     . THR I  4 104  ? 27.119  17.815   -17.584 1.00 135.39 ? 104  THR A O     1 
ATOM   4315  C  CB    . THR I  4 104  ? 26.834  20.364   -19.590 1.00 127.30 ? 104  THR A CB    1 
ATOM   4316  O  OG1   . THR I  4 104  ? 26.216  21.629   -19.885 1.00 139.09 ? 104  THR A OG1   1 
ATOM   4317  C  CG2   . THR I  4 104  ? 26.047  19.253   -20.247 1.00 117.99 ? 104  THR A CG2   1 
ATOM   4318  N  N     . GLY I  4 105  ? 29.029  18.998   -17.862 1.00 130.09 ? 105  GLY A N     1 
ATOM   4319  C  CA    . GLY I  4 105  ? 29.941  17.887   -17.579 1.00 125.54 ? 105  GLY A CA    1 
ATOM   4320  C  C     . GLY I  4 105  ? 29.885  17.390   -16.151 1.00 124.49 ? 105  GLY A C     1 
ATOM   4321  O  O     . GLY I  4 105  ? 30.060  16.197   -15.920 1.00 126.98 ? 105  GLY A O     1 
ATOM   4322  N  N     . TYR I  4 106  ? 29.654  18.309   -15.205 1.00 124.91 ? 106  TYR A N     1 
ATOM   4323  C  CA    . TYR I  4 106  ? 29.467  17.976   -13.793 1.00 118.25 ? 106  TYR A CA    1 
ATOM   4324  C  C     . TYR I  4 106  ? 28.205  17.171   -13.614 1.00 124.34 ? 106  TYR A C     1 
ATOM   4325  O  O     . TYR I  4 106  ? 28.214  16.163   -12.892 1.00 132.54 ? 106  TYR A O     1 
ATOM   4326  C  CB    . TYR I  4 106  ? 29.404  19.227   -12.922 1.00 117.70 ? 106  TYR A CB    1 
ATOM   4327  C  CG    . TYR I  4 106  ? 28.866  18.976   -11.534 1.00 118.70 ? 106  TYR A CG    1 
ATOM   4328  C  CD1   . TYR I  4 106  ? 29.656  18.388   -10.559 1.00 123.26 ? 106  TYR A CD1   1 
ATOM   4329  C  CD2   . TYR I  4 106  ? 27.564  19.319   -11.200 1.00 119.73 ? 106  TYR A CD2   1 
ATOM   4330  C  CE1   . TYR I  4 106  ? 29.161  18.138   -9.291  1.00 123.96 ? 106  TYR A CE1   1 
ATOM   4331  C  CE2   . TYR I  4 106  ? 27.059  19.077   -9.938  1.00 120.95 ? 106  TYR A CE2   1 
ATOM   4332  C  CZ    . TYR I  4 106  ? 27.858  18.486   -8.989  1.00 125.91 ? 106  TYR A CZ    1 
ATOM   4333  O  OH    . TYR I  4 106  ? 27.340  18.262   -7.731  1.00 135.97 ? 106  TYR A OH    1 
ATOM   4334  N  N     . GLN I  4 107  ? 27.119  17.599   -14.268 1.00 121.56 ? 107  GLN A N     1 
ATOM   4335  C  CA    . GLN I  4 107  ? 25.843  16.851   -14.218 1.00 114.69 ? 107  GLN A CA    1 
ATOM   4336  C  C     . GLN I  4 107  ? 26.006  15.460   -14.828 1.00 115.29 ? 107  GLN A C     1 
ATOM   4337  O  O     . GLN I  4 107  ? 25.490  14.482   -14.292 1.00 125.17 ? 107  GLN A O     1 
ATOM   4338  C  CB    . GLN I  4 107  ? 24.712  17.599   -14.926 1.00 112.28 ? 107  GLN A CB    1 
ATOM   4339  C  CG    . GLN I  4 107  ? 24.272  18.894   -14.248 1.00 109.31 ? 107  GLN A CG    1 
ATOM   4340  C  CD    . GLN I  4 107  ? 23.183  19.644   -15.006 1.00 107.08 ? 107  GLN A CD    1 
ATOM   4341  O  OE1   . GLN I  4 107  ? 22.977  19.455   -16.206 1.00 107.38 ? 107  GLN A OE1   1 
ATOM   4342  N  NE2   . GLN I  4 107  ? 22.483  20.509   -14.300 1.00 109.96 ? 107  GLN A NE2   1 
ATOM   4343  N  N     . ASN I  4 108  ? 26.730  15.365   -15.935 1.00 109.11 ? 108  ASN A N     1 
ATOM   4344  C  CA    . ASN I  4 108  ? 27.025  14.064   -16.544 1.00 115.19 ? 108  ASN A CA    1 
ATOM   4345  C  C     . ASN I  4 108  ? 27.922  13.139   -15.715 1.00 119.54 ? 108  ASN A C     1 
ATOM   4346  O  O     . ASN I  4 108  ? 27.799  11.912   -15.807 1.00 120.98 ? 108  ASN A O     1 
ATOM   4347  C  CB    . ASN I  4 108  ? 27.681  14.259   -17.909 1.00 125.16 ? 108  ASN A CB    1 
ATOM   4348  C  CG    . ASN I  4 108  ? 26.689  14.651   -18.971 1.00 121.34 ? 108  ASN A CG    1 
ATOM   4349  O  OD1   . ASN I  4 108  ? 25.561  15.015   -18.657 1.00 122.76 ? 108  ASN A OD1   1 
ATOM   4350  N  ND2   . ASN I  4 108  ? 27.104  14.583   -20.236 1.00 114.91 ? 108  ASN A ND2   1 
ATOM   4351  N  N     . LEU I  4 109  ? 28.853  13.709   -14.948 1.00 122.23 ? 109  LEU A N     1 
ATOM   4352  C  CA    . LEU I  4 109  ? 29.658  12.912   -14.011 1.00 120.86 ? 109  LEU A CA    1 
ATOM   4353  C  C     . LEU I  4 109  ? 28.804  12.391   -12.853 1.00 116.38 ? 109  LEU A C     1 
ATOM   4354  O  O     . LEU I  4 109  ? 28.955  11.259   -12.436 1.00 112.17 ? 109  LEU A O     1 
ATOM   4355  C  CB    . LEU I  4 109  ? 30.831  13.724   -13.461 1.00 116.03 ? 109  LEU A CB    1 
ATOM   4356  C  CG    . LEU I  4 109  ? 31.971  13.926   -14.439 1.00 110.71 ? 109  LEU A CG    1 
ATOM   4357  C  CD1   . LEU I  4 109  ? 33.064  14.781   -13.804 1.00 115.01 ? 109  LEU A CD1   1 
ATOM   4358  C  CD2   . LEU I  4 109  ? 32.490  12.567   -14.852 1.00 105.76 ? 109  LEU A CD2   1 
ATOM   4359  N  N     . VAL I  4 110  ? 27.905  13.227   -12.357 1.00 112.03 ? 110  VAL A N     1 
ATOM   4360  C  CA    . VAL I  4 110  ? 26.966  12.843   -11.311 1.00 115.78 ? 110  VAL A CA    1 
ATOM   4361  C  C     . VAL I  4 110  ? 26.072  11.660   -11.755 1.00 114.37 ? 110  VAL A C     1 
ATOM   4362  O  O     . VAL I  4 110  ? 25.821  10.740   -10.970 1.00 111.59 ? 110  VAL A O     1 
ATOM   4363  C  CB    . VAL I  4 110  ? 26.105  14.073   -10.914 1.00 118.91 ? 110  VAL A CB    1 
ATOM   4364  C  CG1   . VAL I  4 110  ? 24.994  13.708   -9.944  1.00 118.92 ? 110  VAL A CG1   1 
ATOM   4365  C  CG2   . VAL I  4 110  ? 26.989  15.170   -10.337 1.00 116.91 ? 110  VAL A CG2   1 
ATOM   4366  N  N     . ARG I  4 111  ? 25.601  11.688   -13.003 1.00 111.82 ? 111  ARG A N     1 
ATOM   4367  C  CA    . ARG I  4 111  ? 24.795  10.591   -13.560 1.00 118.20 ? 111  ARG A CA    1 
ATOM   4368  C  C     . ARG I  4 111  ? 25.596  9.292    -13.767 1.00 126.14 ? 111  ARG A C     1 
ATOM   4369  O  O     . ARG I  4 111  ? 25.124  8.207    -13.425 1.00 137.23 ? 111  ARG A O     1 
ATOM   4370  C  CB    . ARG I  4 111  ? 24.190  10.990   -14.902 1.00 119.60 ? 111  ARG A CB    1 
ATOM   4371  C  CG    . ARG I  4 111  ? 23.176  12.104   -14.842 1.00 122.33 ? 111  ARG A CG    1 
ATOM   4372  C  CD    . ARG I  4 111  ? 22.422  12.204   -16.158 1.00 132.79 ? 111  ARG A CD    1 
ATOM   4373  N  NE    . ARG I  4 111  ? 21.336  13.188   -16.086 1.00 145.63 ? 111  ARG A NE    1 
ATOM   4374  C  CZ    . ARG I  4 111  ? 21.448  14.492   -16.343 1.00 133.82 ? 111  ARG A CZ    1 
ATOM   4375  N  NH1   . ARG I  4 111  ? 22.594  15.020   -16.715 1.00 123.24 ? 111  ARG A NH1   1 
ATOM   4376  N  NH2   . ARG I  4 111  ? 20.390  15.283   -16.225 1.00 140.70 ? 111  ARG A NH2   1 
ATOM   4377  N  N     . LEU I  4 112  ? 26.790  9.394    -14.348 1.00 121.87 ? 112  LEU A N     1 
ATOM   4378  C  CA    . LEU I  4 112  ? 27.629  8.221    -14.549 1.00 118.98 ? 112  LEU A CA    1 
ATOM   4379  C  C     . LEU I  4 112  ? 27.977  7.558    -13.220 1.00 120.70 ? 112  LEU A C     1 
ATOM   4380  O  O     . LEU I  4 112  ? 28.037  6.337    -13.148 1.00 121.28 ? 112  LEU A O     1 
ATOM   4381  C  CB    . LEU I  4 112  ? 28.907  8.600    -15.298 1.00 120.40 ? 112  LEU A CB    1 
ATOM   4382  C  CG    . LEU I  4 112  ? 28.738  8.904    -16.784 1.00 117.44 ? 112  LEU A CG    1 
ATOM   4383  C  CD1   . LEU I  4 112  ? 30.023  9.423    -17.403 1.00 119.42 ? 112  LEU A CD1   1 
ATOM   4384  C  CD2   . LEU I  4 112  ? 28.301  7.658    -17.506 1.00 115.57 ? 112  LEU A CD2   1 
ATOM   4385  N  N     . ALA I  4 113  ? 28.207  8.373    -12.184 1.00 124.40 ? 113  ALA A N     1 
ATOM   4386  C  CA    . ALA I  4 113  ? 28.499  7.893    -10.828 1.00 116.96 ? 113  ALA A CA    1 
ATOM   4387  C  C     . ALA I  4 113  ? 27.313  7.147    -10.315 1.00 117.63 ? 113  ALA A C     1 
ATOM   4388  O  O     . ALA I  4 113  ? 27.460  6.052    -9.771  1.00 126.94 ? 113  ALA A O     1 
ATOM   4389  C  CB    . ALA I  4 113  ? 28.801  9.054    -9.884  1.00 111.65 ? 113  ALA A CB    1 
ATOM   4390  N  N     . SER I  4 114  ? 26.139  7.756    -10.479 1.00 118.33 ? 114  SER A N     1 
ATOM   4391  C  CA    . SER I  4 114  ? 24.896  7.229    -9.910  1.00 119.80 ? 114  SER A CA    1 
ATOM   4392  C  C     . SER I  4 114  ? 24.559  5.887    -10.539 1.00 114.10 ? 114  SER A C     1 
ATOM   4393  O  O     . SER I  4 114  ? 24.278  4.909    -9.847  1.00 109.79 ? 114  SER A O     1 
ATOM   4394  C  CB    . SER I  4 114  ? 23.754  8.227    -10.109 1.00 124.44 ? 114  SER A CB    1 
ATOM   4395  O  OG    . SER I  4 114  ? 24.011  9.443    -9.421  1.00 129.71 ? 114  SER A OG    1 
ATOM   4396  N  N     . ARG I  4 115  ? 24.633  5.840    -11.861 1.00 110.86 ? 115  ARG A N     1 
ATOM   4397  C  CA    . ARG I  4 115  ? 24.336  4.618    -12.588 1.00 108.57 ? 115  ARG A CA    1 
ATOM   4398  C  C     . ARG I  4 115  ? 25.386  3.537    -12.300 1.00 106.29 ? 115  ARG A C     1 
ATOM   4399  O  O     . ARG I  4 115  ? 25.136  2.365    -12.487 1.00 111.97 ? 115  ARG A O     1 
ATOM   4400  C  CB    . ARG I  4 115  ? 24.236  4.884    -14.096 1.00 108.28 ? 115  ARG A CB    1 
ATOM   4401  C  CG    . ARG I  4 115  ? 23.202  5.910    -14.521 1.00 105.91 ? 115  ARG A CG    1 
ATOM   4402  C  CD    . ARG I  4 115  ? 23.219  6.115    -16.022 1.00 109.45 ? 115  ARG A CD    1 
ATOM   4403  N  NE    . ARG I  4 115  ? 22.359  5.165    -16.698 1.00 111.87 ? 115  ARG A NE    1 
ATOM   4404  C  CZ    . ARG I  4 115  ? 22.124  5.172    -18.004 1.00 120.08 ? 115  ARG A CZ    1 
ATOM   4405  N  NH1   . ARG I  4 115  ? 22.700  6.075    -18.792 1.00 117.16 ? 115  ARG A NH1   1 
ATOM   4406  N  NH2   . ARG I  4 115  ? 21.318  4.254    -18.528 1.00 128.03 ? 115  ARG A NH2   1 
ATOM   4407  N  N     . ALA I  4 116  ? 26.568  3.925    -11.851 1.00 109.99 ? 116  ALA A N     1 
ATOM   4408  C  CA    . ALA I  4 116  ? 27.592  2.947    -11.523 1.00 108.58 ? 116  ALA A CA    1 
ATOM   4409  C  C     . ALA I  4 116  ? 27.130  2.113    -10.353 1.00 112.08 ? 116  ALA A C     1 
ATOM   4410  O  O     . ALA I  4 116  ? 27.255  0.902    -10.395 1.00 110.89 ? 116  ALA A O     1 
ATOM   4411  C  CB    . ALA I  4 116  ? 28.921  3.626    -11.205 1.00 105.35 ? 116  ALA A CB    1 
ATOM   4412  N  N     . TYR I  4 117  ? 26.579  2.768    -9.327  1.00 119.01 ? 117  TYR A N     1 
ATOM   4413  C  CA    . TYR I  4 117  ? 26.171  2.094    -8.097  1.00 114.60 ? 117  TYR A CA    1 
ATOM   4414  C  C     . TYR I  4 117  ? 24.802  1.464    -8.298  1.00 113.49 ? 117  TYR A C     1 
ATOM   4415  O  O     . TYR I  4 117  ? 24.605  0.286    -8.022  1.00 119.25 ? 117  TYR A O     1 
ATOM   4416  C  CB    . TYR I  4 117  ? 26.150  3.076    -6.919  1.00 115.95 ? 117  TYR A CB    1 
ATOM   4417  C  CG    . TYR I  4 117  ? 27.501  3.310    -6.243  1.00 116.38 ? 117  TYR A CG    1 
ATOM   4418  C  CD1   . TYR I  4 117  ? 28.134  4.569    -6.275  1.00 111.44 ? 117  TYR A CD1   1 
ATOM   4419  C  CD2   . TYR I  4 117  ? 28.132  2.278    -5.554  1.00 115.03 ? 117  TYR A CD2   1 
ATOM   4420  C  CE1   . TYR I  4 117  ? 29.347  4.771    -5.640  1.00 109.06 ? 117  TYR A CE1   1 
ATOM   4421  C  CE2   . TYR I  4 117  ? 29.348  2.468    -4.925  1.00 113.23 ? 117  TYR A CE2   1 
ATOM   4422  C  CZ    . TYR I  4 117  ? 29.948  3.706    -4.961  1.00 115.23 ? 117  TYR A CZ    1 
ATOM   4423  O  OH    . TYR I  4 117  ? 31.153  3.831    -4.301  1.00 123.07 ? 117  TYR A OH    1 
ATOM   4424  N  N     . LEU I  4 118  ? 23.862  2.238    -8.812  1.00 110.47 ? 118  LEU A N     1 
ATOM   4425  C  CA    . LEU I  4 118  ? 22.488  1.765    -8.918  1.00 115.09 ? 118  LEU A CA    1 
ATOM   4426  C  C     . LEU I  4 118  ? 22.360  0.592    -9.884  1.00 119.94 ? 118  LEU A C     1 
ATOM   4427  O  O     . LEU I  4 118  ? 21.825  -0.457   -9.512  1.00 131.74 ? 118  LEU A O     1 
ATOM   4428  C  CB    . LEU I  4 118  ? 21.543  2.905    -9.328  1.00 111.23 ? 118  LEU A CB    1 
ATOM   4429  C  CG    . LEU I  4 118  ? 21.419  4.032    -8.287  1.00 110.98 ? 118  LEU A CG    1 
ATOM   4430  C  CD1   . LEU I  4 118  ? 20.620  5.209    -8.839  1.00 102.61 ? 118  LEU A CD1   1 
ATOM   4431  C  CD2   . LEU I  4 118  ? 20.847  3.540    -6.957  1.00 100.90 ? 118  LEU A CD2   1 
ATOM   4432  N  N     . GLU I  4 119  ? 22.857  0.777    -11.110 1.00 120.18 ? 119  GLU A N     1 
ATOM   4433  C  CA    . GLU I  4 119  ? 22.705  -0.208   -12.203 1.00 117.81 ? 119  GLU A CA    1 
ATOM   4434  C  C     . GLU I  4 119  ? 23.883  -1.176   -12.355 1.00 118.48 ? 119  GLU A C     1 
ATOM   4435  O  O     . GLU I  4 119  ? 23.719  -2.379   -12.225 1.00 127.97 ? 119  GLU A O     1 
ATOM   4436  C  CB    . GLU I  4 119  ? 22.500  0.498    -13.538 1.00 113.64 ? 119  GLU A CB    1 
ATOM   4437  C  CG    . GLU I  4 119  ? 21.309  1.434    -13.588 1.00 111.38 ? 119  GLU A CG    1 
ATOM   4438  C  CD    . GLU I  4 119  ? 21.129  2.094    -14.952 1.00 113.30 ? 119  GLU A CD    1 
ATOM   4439  O  OE1   . GLU I  4 119  ? 21.667  1.620    -15.970 1.00 121.27 ? 119  GLU A OE1   1 
ATOM   4440  O  OE2   . GLU I  4 119  ? 20.424  3.106    -15.029 1.00 119.94 ? 119  GLU A OE2   1 
ATOM   4441  N  N     . GLY I  4 120  ? 25.068  -0.656   -12.635 1.00 119.01 ? 120  GLY A N     1 
ATOM   4442  C  CA    . GLY I  4 120  ? 26.214  -1.503   -12.926 1.00 116.18 ? 120  GLY A CA    1 
ATOM   4443  C  C     . GLY I  4 120  ? 27.135  -1.761   -11.752 1.00 113.84 ? 120  GLY A C     1 
ATOM   4444  O  O     . GLY I  4 120  ? 28.329  -1.540   -11.855 1.00 127.70 ? 120  GLY A O     1 
ATOM   4445  N  N     . PHE I  4 121  ? 26.605  -2.237   -10.636 1.00 112.12 ? 121  PHE A N     1 
ATOM   4446  C  CA    . PHE I  4 121  ? 27.447  -2.593   -9.498  1.00 112.92 ? 121  PHE A CA    1 
ATOM   4447  C  C     . PHE I  4 121  ? 27.551  -4.092   -9.458  1.00 117.55 ? 121  PHE A C     1 
ATOM   4448  O  O     . PHE I  4 121  ? 26.530  -4.749   -9.334  1.00 126.57 ? 121  PHE A O     1 
ATOM   4449  C  CB    . PHE I  4 121  ? 26.845  -2.077   -8.181  1.00 113.71 ? 121  PHE A CB    1 
ATOM   4450  C  CG    . PHE I  4 121  ? 27.753  -2.244   -6.993  1.00 113.42 ? 121  PHE A CG    1 
ATOM   4451  C  CD1   . PHE I  4 121  ? 28.578  -1.208   -6.573  1.00 123.94 ? 121  PHE A CD1   1 
ATOM   4452  C  CD2   . PHE I  4 121  ? 27.815  -3.441   -6.303  1.00 115.87 ? 121  PHE A CD2   1 
ATOM   4453  C  CE1   . PHE I  4 121  ? 29.445  -1.362   -5.481  1.00 117.95 ? 121  PHE A CE1   1 
ATOM   4454  C  CE2   . PHE I  4 121  ? 28.681  -3.602   -5.221  1.00 115.13 ? 121  PHE A CE2   1 
ATOM   4455  C  CZ    . PHE I  4 121  ? 29.492  -2.559   -4.803  1.00 110.40 ? 121  PHE A CZ    1 
ATOM   4456  N  N     . TYR I  4 122  ? 28.770  -4.627   -9.578  1.00 126.37 ? 122  TYR A N     1 
ATOM   4457  C  CA    . TYR I  4 122  ? 29.019  -6.067   -9.452  1.00 127.39 ? 122  TYR A CA    1 
ATOM   4458  C  C     . TYR I  4 122  ? 29.984  -6.299   -8.309  1.00 126.41 ? 122  TYR A C     1 
ATOM   4459  O  O     . TYR I  4 122  ? 29.581  -6.808   -7.273  1.00 148.92 ? 122  TYR A O     1 
ATOM   4460  C  CB    . TYR I  4 122  ? 29.533  -6.645   -10.772 1.00 129.49 ? 122  TYR A CB    1 
ATOM   4461  C  CG    . TYR I  4 122  ? 29.852  -8.128   -10.765 1.00 133.52 ? 122  TYR A CG    1 
ATOM   4462  C  CD1   . TYR I  4 122  ? 29.043  -9.042   -10.096 1.00 136.07 ? 122  TYR A CD1   1 
ATOM   4463  C  CD2   . TYR I  4 122  ? 30.940  -8.619   -11.477 1.00 134.72 ? 122  TYR A CD2   1 
ATOM   4464  C  CE1   . TYR I  4 122  ? 29.324  -10.391  -10.116 1.00 140.31 ? 122  TYR A CE1   1 
ATOM   4465  C  CE2   . TYR I  4 122  ? 31.228  -9.969   -11.499 1.00 138.28 ? 122  TYR A CE2   1 
ATOM   4466  C  CZ    . TYR I  4 122  ? 30.410  -10.846  -10.813 1.00 140.38 ? 122  TYR A CZ    1 
ATOM   4467  O  OH    . TYR I  4 122  ? 30.661  -12.194  -10.793 1.00 148.99 ? 122  TYR A OH    1 
ATOM   4468  N  N     . GLU I  4 123  ? 31.239  -5.896   -8.483  1.00 129.55 ? 123  GLU A N     1 
ATOM   4469  C  CA    . GLU I  4 123  ? 32.239  -5.897   -7.398  1.00 129.23 ? 123  GLU A CA    1 
ATOM   4470  C  C     . GLU I  4 123  ? 32.531  -4.453   -7.035  1.00 126.76 ? 123  GLU A C     1 
ATOM   4471  O  O     . GLU I  4 123  ? 32.465  -4.071   -5.877  1.00 122.77 ? 123  GLU A O     1 
ATOM   4472  C  CB    . GLU I  4 123  ? 33.529  -6.597   -7.848  1.00 137.23 ? 123  GLU A CB    1 
ATOM   4473  C  CG    . GLU I  4 123  ? 33.378  -8.087   -8.139  1.00 145.67 ? 123  GLU A CG    1 
ATOM   4474  C  CD    . GLU I  4 123  ? 34.644  -8.713   -8.692  1.00 149.45 ? 123  GLU A CD    1 
ATOM   4475  O  OE1   . GLU I  4 123  ? 35.300  -8.050   -9.515  1.00 153.84 ? 123  GLU A OE1   1 
ATOM   4476  O  OE2   . GLU I  4 123  ? 34.981  -9.862   -8.320  1.00 156.75 ? 123  GLU A OE2   1 
ATOM   4477  N  N     . LYS I  4 124  ? 32.865  -3.674   -8.064  1.00 131.02 ? 124  LYS A N     1 
ATOM   4478  C  CA    . LYS I  4 124  ? 32.999  -2.231   -7.993  1.00 125.53 ? 124  LYS A CA    1 
ATOM   4479  C  C     . LYS I  4 124  ? 31.765  -1.607   -8.689  1.00 123.37 ? 124  LYS A C     1 
ATOM   4480  O  O     . LYS I  4 124  ? 31.009  -2.302   -9.376  1.00 117.85 ? 124  LYS A O     1 
ATOM   4481  C  CB    . LYS I  4 124  ? 34.304  -1.818   -8.703  1.00 123.05 ? 124  LYS A CB    1 
ATOM   4482  C  CG    . LYS I  4 124  ? 35.588  -2.318   -8.029  1.00 120.71 ? 124  LYS A CG    1 
ATOM   4483  C  CD    . LYS I  4 124  ? 35.946  -1.461   -6.815  1.00 124.02 ? 124  LYS A CD    1 
ATOM   4484  C  CE    . LYS I  4 124  ? 37.341  -1.719   -6.242  1.00 115.30 ? 124  LYS A CE    1 
ATOM   4485  N  NZ    . LYS I  4 124  ? 37.409  -3.003   -5.500  1.00 112.40 ? 124  LYS A NZ    1 
ATOM   4486  N  N     . PRO I  4 125  ? 31.552  -0.298   -8.514  1.00 118.71 ? 125  PRO A N     1 
ATOM   4487  C  CA    . PRO I  4 125  ? 30.590  0.417    -9.350  1.00 115.60 ? 125  PRO A CA    1 
ATOM   4488  C  C     . PRO I  4 125  ? 31.135  0.649    -10.778 1.00 120.42 ? 125  PRO A C     1 
ATOM   4489  O  O     . PRO I  4 125  ? 31.999  1.501    -10.990 1.00 132.43 ? 125  PRO A O     1 
ATOM   4490  C  CB    . PRO I  4 125  ? 30.397  1.741    -8.602  1.00 115.00 ? 125  PRO A CB    1 
ATOM   4491  C  CG    . PRO I  4 125  ? 31.686  1.956    -7.892  1.00 118.23 ? 125  PRO A CG    1 
ATOM   4492  C  CD    . PRO I  4 125  ? 32.168  0.577    -7.503  1.00 121.10 ? 125  PRO A CD    1 
ATOM   4493  N  N     . ARG I  4 126  ? 30.619  -0.114   -11.741 1.00 120.17 ? 126  ARG A N     1 
ATOM   4494  C  CA    . ARG I  4 126  ? 31.060  -0.063   -13.146 1.00 114.96 ? 126  ARG A CA    1 
ATOM   4495  C  C     . ARG I  4 126  ? 30.135  0.691    -14.091 1.00 111.05 ? 126  ARG A C     1 
ATOM   4496  O  O     . ARG I  4 126  ? 28.943  0.710    -13.908 1.00 111.91 ? 126  ARG A O     1 
ATOM   4497  C  CB    . ARG I  4 126  ? 31.153  -1.471   -13.715 1.00 114.71 ? 126  ARG A CB    1 
ATOM   4498  C  CG    . ARG I  4 126  ? 32.050  -2.405   -12.948 1.00 118.82 ? 126  ARG A CG    1 
ATOM   4499  C  CD    . ARG I  4 126  ? 32.017  -3.769   -13.590 1.00 122.31 ? 126  ARG A CD    1 
ATOM   4500  N  NE    . ARG I  4 126  ? 30.646  -4.258   -13.702 1.00 125.15 ? 126  ARG A NE    1 
ATOM   4501  C  CZ    . ARG I  4 126  ? 30.284  -5.331   -14.398 1.00 127.63 ? 126  ARG A CZ    1 
ATOM   4502  N  NH1   . ARG I  4 126  ? 31.182  -6.062   -15.049 1.00 123.56 ? 126  ARG A NH1   1 
ATOM   4503  N  NH2   . ARG I  4 126  ? 29.008  -5.673   -14.436 1.00 137.14 ? 126  ARG A NH2   1 
ATOM   4504  N  N     . ILE I  4 127  ? 30.705  1.266    -15.144 1.00 120.34 ? 127  ILE A N     1 
ATOM   4505  C  CA    . ILE I  4 127  ? 29.924  1.939    -16.181 1.00 122.95 ? 127  ILE A CA    1 
ATOM   4506  C  C     . ILE I  4 127  ? 30.230  1.342    -17.556 1.00 124.07 ? 127  ILE A C     1 
ATOM   4507  O  O     . ILE I  4 127  ? 31.042  0.425    -17.686 1.00 124.30 ? 127  ILE A O     1 
ATOM   4508  C  CB    . ILE I  4 127  ? 30.131  3.473    -16.166 1.00 123.88 ? 127  ILE A CB    1 
ATOM   4509  C  CG1   . ILE I  4 127  ? 31.546  3.865    -16.582 1.00 120.40 ? 127  ILE A CG1   1 
ATOM   4510  C  CG2   . ILE I  4 127  ? 29.764  4.043    -14.799 1.00 132.67 ? 127  ILE A CG2   1 
ATOM   4511  C  CD1   . ILE I  4 127  ? 31.550  4.516    -17.951 1.00 126.73 ? 127  ILE A CD1   1 
ATOM   4512  N  N     . ASP I  4 128  ? 29.540  1.842    -18.573 1.00 122.63 ? 128  ASP A N     1 
ATOM   4513  C  CA    . ASP I  4 128  ? 29.631  1.304    -19.921 1.00 124.23 ? 128  ASP A CA    1 
ATOM   4514  C  C     . ASP I  4 128  ? 30.040  2.379    -20.891 1.00 130.40 ? 128  ASP A C     1 
ATOM   4515  O  O     . ASP I  4 128  ? 29.838  3.569    -20.635 1.00 143.81 ? 128  ASP A O     1 
ATOM   4516  C  CB    . ASP I  4 128  ? 28.265  0.762    -20.369 1.00 122.75 ? 128  ASP A CB    1 
ATOM   4517  C  CG    . ASP I  4 128  ? 27.987  -0.620   -19.854 1.00 129.75 ? 128  ASP A CG    1 
ATOM   4518  O  OD1   . ASP I  4 128  ? 28.855  -1.234   -19.182 1.00 140.45 ? 128  ASP A OD1   1 
ATOM   4519  O  OD2   . ASP I  4 128  ? 26.880  -1.103   -20.130 1.00 131.41 ? 128  ASP A OD2   1 
ATOM   4520  N  N     . ARG I  4 129  ? 30.571  1.948    -22.029 1.00 128.18 ? 129  ARG A N     1 
ATOM   4521  C  CA    . ARG I  4 129  ? 30.820  2.847    -23.152 1.00 135.47 ? 129  ARG A CA    1 
ATOM   4522  C  C     . ARG I  4 129  ? 29.530  3.271    -23.884 1.00 128.91 ? 129  ARG A C     1 
ATOM   4523  O  O     . ARG I  4 129  ? 29.530  4.215    -24.676 1.00 136.30 ? 129  ARG A O     1 
ATOM   4524  C  CB    . ARG I  4 129  ? 31.796  2.190    -24.132 1.00 145.29 ? 129  ARG A CB    1 
ATOM   4525  C  CG    . ARG I  4 129  ? 33.246  2.247    -23.676 1.00 139.28 ? 129  ARG A CG    1 
ATOM   4526  C  CD    . ARG I  4 129  ? 34.149  1.406    -24.550 1.00 134.34 ? 129  ARG A CD    1 
ATOM   4527  N  NE    . ARG I  4 129  ? 34.282  0.047    -24.033 1.00 136.35 ? 129  ARG A NE    1 
ATOM   4528  C  CZ    . ARG I  4 129  ? 33.685  -1.040   -24.529 1.00 135.71 ? 129  ARG A CZ    1 
ATOM   4529  N  NH1   . ARG I  4 129  ? 32.883  -0.958   -25.590 1.00 131.51 ? 129  ARG A NH1   1 
ATOM   4530  N  NH2   . ARG I  4 129  ? 33.898  -2.233   -23.961 1.00 131.50 ? 129  ARG A NH2   1 
ATOM   4531  N  N     . GLU I  4 130  ? 28.449  2.547    -23.631 1.00 125.06 ? 130  GLU A N     1 
ATOM   4532  C  CA    . GLU I  4 130  ? 27.108  2.930    -24.070 1.00 126.67 ? 130  GLU A CA    1 
ATOM   4533  C  C     . GLU I  4 130  ? 26.617  4.159    -23.329 1.00 123.38 ? 130  GLU A C     1 
ATOM   4534  O  O     . GLU I  4 130  ? 26.202  5.161    -23.926 1.00 126.48 ? 130  GLU A O     1 
ATOM   4535  C  CB    . GLU I  4 130  ? 26.137  1.775    -23.819 1.00 126.62 ? 130  GLU A CB    1 
ATOM   4536  C  CG    . GLU I  4 130  ? 24.719  1.999    -24.308 1.00 133.22 ? 130  GLU A CG    1 
ATOM   4537  C  CD    . GLU I  4 130  ? 23.819  0.812    -24.016 1.00 145.50 ? 130  GLU A CD    1 
ATOM   4538  O  OE1   . GLU I  4 130  ? 22.623  1.002    -23.675 1.00 143.15 ? 130  GLU A OE1   1 
ATOM   4539  O  OE2   . GLU I  4 130  ? 24.319  -0.329   -24.122 1.00 165.52 ? 130  GLU A OE2   1 
ATOM   4540  N  N     . ILE I  4 131  ? 26.655  4.080    -22.012 1.00 121.63 ? 131  ILE A N     1 
ATOM   4541  C  CA    . ILE I  4 131  ? 26.175  5.185    -21.205 1.00 125.93 ? 131  ILE A CA    1 
ATOM   4542  C  C     . ILE I  4 131  ? 27.201  6.317    -21.165 1.00 124.26 ? 131  ILE A C     1 
ATOM   4543  O  O     . ILE I  4 131  ? 26.826  7.481    -21.026 1.00 128.78 ? 131  ILE A O     1 
ATOM   4544  C  CB    . ILE I  4 131  ? 25.715  4.728    -19.796 1.00 124.57 ? 131  ILE A CB    1 
ATOM   4545  C  CG1   . ILE I  4 131  ? 26.889  4.253    -18.939 1.00 123.62 ? 131  ILE A CG1   1 
ATOM   4546  C  CG2   . ILE I  4 131  ? 24.678  3.621    -19.922 1.00 118.71 ? 131  ILE A CG2   1 
ATOM   4547  C  CD1   . ILE I  4 131  ? 26.485  3.798    -17.549 1.00 109.81 ? 131  ILE A CD1   1 
ATOM   4548  N  N     . LEU I  4 132  ? 28.480  5.987    -21.326 1.00 119.66 ? 132  LEU A N     1 
ATOM   4549  C  CA    . LEU I  4 132  ? 29.510  7.022    -21.448 1.00 124.99 ? 132  LEU A CA    1 
ATOM   4550  C  C     . LEU I  4 132  ? 29.230  7.897    -22.671 1.00 125.23 ? 132  LEU A C     1 
ATOM   4551  O  O     . LEU I  4 132  ? 29.380  9.114    -22.627 1.00 124.89 ? 132  LEU A O     1 
ATOM   4552  C  CB    . LEU I  4 132  ? 30.894  6.386    -21.539 1.00 127.88 ? 132  LEU A CB    1 
ATOM   4553  C  CG    . LEU I  4 132  ? 32.116  7.284    -21.423 1.00 132.98 ? 132  LEU A CG    1 
ATOM   4554  C  CD1   . LEU I  4 132  ? 32.094  8.010    -20.093 1.00 136.75 ? 132  LEU A CD1   1 
ATOM   4555  C  CD2   . LEU I  4 132  ? 33.385  6.449    -21.530 1.00 141.28 ? 132  LEU A CD2   1 
ATOM   4556  N  N     . ARG I  4 133  ? 28.795  7.260    -23.751 1.00 126.13 ? 133  ARG A N     1 
ATOM   4557  C  CA    . ARG I  4 133  ? 28.424  7.957    -24.966 1.00 129.86 ? 133  ARG A CA    1 
ATOM   4558  C  C     . ARG I  4 133  ? 27.177  8.791    -24.726 1.00 135.77 ? 133  ARG A C     1 
ATOM   4559  O  O     . ARG I  4 133  ? 26.991  9.844    -25.353 1.00 143.93 ? 133  ARG A O     1 
ATOM   4560  C  CB    . ARG I  4 133  ? 28.166  6.949    -26.092 1.00 127.52 ? 133  ARG A CB    1 
ATOM   4561  C  CG    . ARG I  4 133  ? 27.727  7.573    -27.399 1.00 127.94 ? 133  ARG A CG    1 
ATOM   4562  C  CD    . ARG I  4 133  ? 27.399  6.514    -28.434 1.00 132.99 ? 133  ARG A CD    1 
ATOM   4563  N  NE    . ARG I  4 133  ? 28.592  5.889    -29.007 1.00 133.82 ? 133  ARG A NE    1 
ATOM   4564  C  CZ    . ARG I  4 133  ? 29.346  6.419    -29.968 1.00 134.51 ? 133  ARG A CZ    1 
ATOM   4565  N  NH1   . ARG I  4 133  ? 29.070  7.612    -30.492 1.00 143.42 ? 133  ARG A NH1   1 
ATOM   4566  N  NH2   . ARG I  4 133  ? 30.402  5.754    -30.396 1.00 139.05 ? 133  ARG A NH2   1 
ATOM   4567  N  N     . GLU I  4 134  ? 26.303  8.301    -23.850 1.00 133.71 ? 134  GLU A N     1 
ATOM   4568  C  CA    . GLU I  4 134  ? 25.065  9.020    -23.532 1.00 137.07 ? 134  GLU A CA    1 
ATOM   4569  C  C     . GLU I  4 134  ? 25.324  10.286   -22.717 1.00 131.66 ? 134  GLU A C     1 
ATOM   4570  O  O     . GLU I  4 134  ? 24.665  11.327   -22.911 1.00 113.39 ? 134  GLU A O     1 
ATOM   4571  C  CB    . GLU I  4 134  ? 24.110  8.108    -22.763 1.00 141.52 ? 134  GLU A CB    1 
ATOM   4572  C  CG    . GLU I  4 134  ? 22.733  8.724    -22.537 1.00 142.12 ? 134  GLU A CG    1 
ATOM   4573  C  CD    . GLU I  4 134  ? 21.716  7.765    -21.946 1.00 135.81 ? 134  GLU A CD    1 
ATOM   4574  O  OE1   . GLU I  4 134  ? 22.100  6.669    -21.479 1.00 149.74 ? 134  GLU A OE1   1 
ATOM   4575  O  OE2   . GLU I  4 134  ? 20.520  8.120    -21.950 1.00 129.52 ? 134  GLU A OE2   1 
ATOM   4576  N  N     . HIS I  4 135  ? 26.287  10.173   -21.804 1.00 131.72 ? 135  HIS A N     1 
ATOM   4577  C  CA    . HIS I  4 135  ? 26.698  11.281   -20.949 1.00 129.15 ? 135  HIS A CA    1 
ATOM   4578  C  C     . HIS I  4 135  ? 28.116  11.698   -21.251 1.00 122.16 ? 135  HIS A C     1 
ATOM   4579  O  O     . HIS I  4 135  ? 28.902  11.930   -20.325 1.00 120.20 ? 135  HIS A O     1 
ATOM   4580  C  CB    . HIS I  4 135  ? 26.552  10.890   -19.465 1.00 132.31 ? 135  HIS A CB    1 
ATOM   4581  C  CG    . HIS I  4 135  ? 25.182  10.370   -19.098 1.00 125.72 ? 135  HIS A CG    1 
ATOM   4582  N  ND1   . HIS I  4 135  ? 24.068  11.099   -19.270 1.00 124.14 ? 135  HIS A ND1   1 
ATOM   4583  C  CD2   . HIS I  4 135  ? 24.777  9.149    -18.556 1.00 125.79 ? 135  HIS A CD2   1 
ATOM   4584  C  CE1   . HIS I  4 135  ? 23.000  10.385   -18.870 1.00 121.36 ? 135  HIS A CE1   1 
ATOM   4585  N  NE2   . HIS I  4 135  ? 23.436  9.192    -18.428 1.00 122.29 ? 135  HIS A NE2   1 
ATOM   4586  N  N     . ALA I  4 136  ? 28.461  11.800   -22.538 1.00 119.05 ? 136  ALA A N     1 
ATOM   4587  C  CA    . ALA I  4 136  ? 29.805  12.265   -22.952 1.00 119.37 ? 136  ALA A CA    1 
ATOM   4588  C  C     . ALA I  4 136  ? 29.899  13.792   -23.032 1.00 121.19 ? 136  ALA A C     1 
ATOM   4589  O  O     . ALA I  4 136  ? 31.001  14.337   -22.965 1.00 130.28 ? 136  ALA A O     1 
ATOM   4590  C  CB    . ALA I  4 136  ? 30.230  11.646   -24.281 1.00 117.41 ? 136  ALA A CB    1 
ATOM   4591  N  N     . GLN I  4 137  ? 28.758  14.475   -23.165 1.00 116.91 ? 137  GLN A N     1 
ATOM   4592  C  CA    . GLN I  4 137  ? 28.741  15.920   -23.346 1.00 117.28 ? 137  GLN A CA    1 
ATOM   4593  C  C     . GLN I  4 137  ? 29.356  16.610   -22.130 1.00 122.04 ? 137  GLN A C     1 
ATOM   4594  O  O     . GLN I  4 137  ? 28.830  16.509   -21.017 1.00 135.81 ? 137  GLN A O     1 
ATOM   4595  C  CB    . GLN I  4 137  ? 27.307  16.397   -23.562 1.00 122.04 ? 137  GLN A CB    1 
ATOM   4596  C  CG    . GLN I  4 137  ? 27.183  17.842   -24.033 1.00 126.94 ? 137  GLN A CG    1 
ATOM   4597  C  CD    . GLN I  4 137  ? 25.754  18.212   -24.420 1.00 131.18 ? 137  GLN A CD    1 
ATOM   4598  O  OE1   . GLN I  4 137  ? 24.801  17.511   -24.080 1.00 142.31 ? 137  GLN A OE1   1 
ATOM   4599  N  NE2   . GLN I  4 137  ? 25.603  19.320   -25.118 1.00 130.70 ? 137  GLN A NE2   1 
ATOM   4600  N  N     . GLY I  4 138  ? 30.481  17.288   -22.342 1.00 117.65 ? 138  GLY A N     1 
ATOM   4601  C  CA    . GLY I  4 138  ? 31.149  18.063   -21.290 1.00 113.43 ? 138  GLY A CA    1 
ATOM   4602  C  C     . GLY I  4 138  ? 32.176  17.283   -20.488 1.00 119.44 ? 138  GLY A C     1 
ATOM   4603  O  O     . GLY I  4 138  ? 32.567  17.719   -19.407 1.00 117.50 ? 138  GLY A O     1 
ATOM   4604  N  N     . LEU I  4 139  ? 32.635  16.147   -21.021 1.00 127.60 ? 139  LEU A N     1 
ATOM   4605  C  CA    . LEU I  4 139  ? 33.646  15.329   -20.353 1.00 127.40 ? 139  LEU A CA    1 
ATOM   4606  C  C     . LEU I  4 139  ? 34.933  15.252   -21.170 1.00 125.36 ? 139  LEU A C     1 
ATOM   4607  O  O     . LEU I  4 139  ? 34.909  14.836   -22.331 1.00 124.27 ? 139  LEU A O     1 
ATOM   4608  C  CB    . LEU I  4 139  ? 33.111  13.917   -20.111 1.00 133.12 ? 139  LEU A CB    1 
ATOM   4609  C  CG    . LEU I  4 139  ? 31.958  13.777   -19.123 1.00 137.96 ? 139  LEU A CG    1 
ATOM   4610  C  CD1   . LEU I  4 139  ? 31.815  12.311   -18.719 1.00 138.83 ? 139  LEU A CD1   1 
ATOM   4611  C  CD2   . LEU I  4 139  ? 32.197  14.650   -17.899 1.00 138.54 ? 139  LEU A CD2   1 
ATOM   4612  N  N     . ILE I  4 140  ? 36.039  15.672   -20.557 1.00 118.93 ? 140  ILE A N     1 
ATOM   4613  C  CA    . ILE I  4 140  ? 37.352  15.490   -21.125 1.00 118.09 ? 140  ILE A CA    1 
ATOM   4614  C  C     . ILE I  4 140  ? 37.789  14.127   -20.595 1.00 119.03 ? 140  ILE A C     1 
ATOM   4615  O  O     . ILE I  4 140  ? 37.842  13.911   -19.383 1.00 126.95 ? 140  ILE A O     1 
ATOM   4616  C  CB    . ILE I  4 140  ? 38.307  16.638   -20.719 1.00 119.48 ? 140  ILE A CB    1 
ATOM   4617  C  CG1   . ILE I  4 140  ? 37.819  17.971   -21.274 1.00 122.83 ? 140  ILE A CG1   1 
ATOM   4618  C  CG2   . ILE I  4 140  ? 39.716  16.399   -21.239 1.00 116.99 ? 140  ILE A CG2   1 
ATOM   4619  C  CD1   . ILE I  4 140  ? 38.755  19.120   -20.961 1.00 130.33 ? 140  ILE A CD1   1 
ATOM   4620  N  N     . ALA I  4 141  ? 38.040  13.190   -21.507 1.00 123.86 ? 141  ALA A N     1 
ATOM   4621  C  CA    . ALA I  4 141  ? 38.523  11.852   -21.144 1.00 123.74 ? 141  ALA A CA    1 
ATOM   4622  C  C     . ALA I  4 141  ? 40.024  11.776   -21.332 1.00 118.53 ? 141  ALA A C     1 
ATOM   4623  O  O     . ALA I  4 141  ? 40.568  12.453   -22.201 1.00 115.97 ? 141  ALA A O     1 
ATOM   4624  C  CB    . ALA I  4 141  ? 37.853  10.787   -22.008 1.00 123.47 ? 141  ALA A CB    1 
ATOM   4625  N  N     . LEU I  4 142  ? 40.684  10.953   -20.521 1.00 113.50 ? 142  LEU A N     1 
ATOM   4626  C  CA    . LEU I  4 142  ? 42.083  10.590   -20.753 1.00 113.57 ? 142  LEU A CA    1 
ATOM   4627  C  C     . LEU I  4 142  ? 42.181  9.073    -20.964 1.00 117.07 ? 142  LEU A C     1 
ATOM   4628  O  O     . LEU I  4 142  ? 41.263  8.337    -20.621 1.00 126.15 ? 142  LEU A O     1 
ATOM   4629  C  CB    . LEU I  4 142  ? 42.951  10.990   -19.566 1.00 111.83 ? 142  LEU A CB    1 
ATOM   4630  C  CG    . LEU I  4 142  ? 42.875  12.392   -18.958 1.00 107.17 ? 142  LEU A CG    1 
ATOM   4631  C  CD1   . LEU I  4 142  ? 43.846  12.425   -17.811 1.00 97.44  ? 142  LEU A CD1   1 
ATOM   4632  C  CD2   . LEU I  4 142  ? 43.236  13.513   -19.922 1.00 110.09 ? 142  LEU A CD2   1 
ATOM   4633  N  N     . SER I  4 143  ? 43.298  8.613    -21.517 1.00 119.69 ? 143  SER A N     1 
ATOM   4634  C  CA    . SER I  4 143  ? 43.487  7.185    -21.850 1.00 123.88 ? 143  SER A CA    1 
ATOM   4635  C  C     . SER I  4 143  ? 43.597  6.275    -20.625 1.00 119.86 ? 143  SER A C     1 
ATOM   4636  O  O     . SER I  4 143  ? 43.307  5.077    -20.707 1.00 116.72 ? 143  SER A O     1 
ATOM   4637  C  CB    . SER I  4 143  ? 44.717  6.976    -22.785 1.00 132.86 ? 143  SER A CB    1 
ATOM   4638  O  OG    . SER I  4 143  ? 45.979  7.242    -22.168 1.00 126.50 ? 143  SER A OG    1 
ATOM   4639  N  N     . GLY I  4 144  ? 44.035  6.840    -19.502 1.00 119.73 ? 144  GLY A N     1 
ATOM   4640  C  CA    . GLY I  4 144  ? 44.037  6.129    -18.229 1.00 123.59 ? 144  GLY A CA    1 
ATOM   4641  C  C     . GLY I  4 144  ? 45.350  5.465    -17.904 1.00 123.35 ? 144  GLY A C     1 
ATOM   4642  O  O     . GLY I  4 144  ? 46.283  5.492    -18.686 1.00 141.05 ? 144  GLY A O     1 
ATOM   4643  N  N     . CYS I  4 145  ? 45.405  4.848    -16.734 1.00 129.60 ? 145  CYS A N     1 
ATOM   4644  C  CA    . CYS I  4 145  ? 46.620  4.201    -16.234 1.00 129.06 ? 145  CYS A CA    1 
ATOM   4645  C  C     . CYS I  4 145  ? 46.806  2.839    -16.903 1.00 126.75 ? 145  CYS A C     1 
ATOM   4646  O  O     . CYS I  4 145  ? 46.118  2.532    -17.870 1.00 126.31 ? 145  CYS A O     1 
ATOM   4647  C  CB    . CYS I  4 145  ? 46.538  4.061    -14.697 1.00 133.59 ? 145  CYS A CB    1 
ATOM   4648  S  SG    . CYS I  4 145  ? 45.220  2.986    -14.056 1.00 134.16 ? 145  CYS A SG    1 
ATOM   4649  N  N     . LEU I  4 146  ? 47.734  2.028    -16.392 1.00 125.58 ? 146  LEU A N     1 
ATOM   4650  C  CA    . LEU I  4 146  ? 47.935  0.650    -16.876 1.00 121.80 ? 146  LEU A CA    1 
ATOM   4651  C  C     . LEU I  4 146  ? 46.654  -0.191   -16.776 1.00 127.28 ? 146  LEU A C     1 
ATOM   4652  O  O     . LEU I  4 146  ? 46.433  -1.105   -17.568 1.00 123.33 ? 146  LEU A O     1 
ATOM   4653  C  CB    . LEU I  4 146  ? 49.056  -0.051   -16.099 1.00 120.18 ? 146  LEU A CB    1 
ATOM   4654  C  CG    . LEU I  4 146  ? 50.476  0.487    -16.244 1.00 125.40 ? 146  LEU A CG    1 
ATOM   4655  C  CD1   . LEU I  4 146  ? 51.386  -0.114   -15.180 1.00 126.10 ? 146  LEU A CD1   1 
ATOM   4656  C  CD2   . LEU I  4 146  ? 51.023  0.203    -17.633 1.00 130.18 ? 146  LEU A CD2   1 
ATOM   4657  N  N     . GLY I  4 147  ? 45.807  0.123    -15.792 1.00 143.11 ? 147  GLY A N     1 
ATOM   4658  C  CA    . GLY I  4 147  ? 44.542  -0.597   -15.586 1.00 138.07 ? 147  GLY A CA    1 
ATOM   4659  C  C     . GLY I  4 147  ? 43.454  -0.231   -16.571 1.00 127.82 ? 147  GLY A C     1 
ATOM   4660  O  O     . GLY I  4 147  ? 42.386  -0.831   -16.553 1.00 116.74 ? 147  GLY A O     1 
ATOM   4661  N  N     . ALA I  4 148  ? 43.728  0.752    -17.429 1.00 130.62 ? 148  ALA A N     1 
ATOM   4662  C  CA    . ALA I  4 148  ? 42.781  1.194    -18.462 1.00 132.78 ? 148  ALA A CA    1 
ATOM   4663  C  C     . ALA I  4 148  ? 42.779  0.309    -19.716 1.00 124.38 ? 148  ALA A C     1 
ATOM   4664  O  O     . ALA I  4 148  ? 43.589  -0.581   -19.863 1.00 124.13 ? 148  ALA A O     1 
ATOM   4665  C  CB    . ALA I  4 148  ? 43.062  2.639    -18.848 1.00 139.02 ? 148  ALA A CB    1 
ATOM   4666  N  N     . GLU I  4 149  ? 41.862  0.594    -20.627 1.00 127.30 ? 149  GLU A N     1 
ATOM   4667  C  CA    . GLU I  4 149  ? 41.536  -0.318   -21.733 1.00 130.98 ? 149  GLU A CA    1 
ATOM   4668  C  C     . GLU I  4 149  ? 42.658  -0.402   -22.767 1.00 132.85 ? 149  GLU A C     1 
ATOM   4669  O  O     . GLU I  4 149  ? 43.213  -1.483   -22.987 1.00 132.30 ? 149  GLU A O     1 
ATOM   4670  C  CB    . GLU I  4 149  ? 40.204  0.094    -22.408 1.00 131.49 ? 149  GLU A CB    1 
ATOM   4671  C  CG    . GLU I  4 149  ? 38.989  0.088    -21.468 1.00 136.29 ? 149  GLU A CG    1 
ATOM   4672  C  CD    . GLU I  4 149  ? 37.736  0.715    -22.069 1.00 135.38 ? 149  GLU A CD    1 
ATOM   4673  O  OE1   . GLU I  4 149  ? 37.401  1.886    -21.755 1.00 137.49 ? 149  GLU A OE1   1 
ATOM   4674  O  OE2   . GLU I  4 149  ? 37.068  0.030    -22.861 1.00 139.35 ? 149  GLU A OE2   1 
ATOM   4675  N  N     . ILE I  4 150  ? 42.987  0.734    -23.392 1.00 133.09 ? 150  ILE A N     1 
ATOM   4676  C  CA    . ILE I  4 150  ? 44.009  0.794    -24.461 1.00 131.25 ? 150  ILE A CA    1 
ATOM   4677  C  C     . ILE I  4 150  ? 45.421  0.359    -24.009 1.00 131.30 ? 150  ILE A C     1 
ATOM   4678  O  O     . ILE I  4 150  ? 46.070  -0.433   -24.682 1.00 134.47 ? 150  ILE A O     1 
ATOM   4679  C  CB    . ILE I  4 150  ? 44.079  2.196    -25.115 1.00 135.24 ? 150  ILE A CB    1 
ATOM   4680  C  CG1   . ILE I  4 150  ? 42.796  2.476    -25.913 1.00 134.40 ? 150  ILE A CG1   1 
ATOM   4681  C  CG2   . ILE I  4 150  ? 45.308  2.306    -26.012 1.00 135.38 ? 150  ILE A CG2   1 
ATOM   4682  C  CD1   . ILE I  4 150  ? 42.694  3.877    -26.481 1.00 137.37 ? 150  ILE A CD1   1 
ATOM   4683  N  N     . PRO I  4 151  ? 45.916  0.885    -22.881 1.00 127.85 ? 151  PRO A N     1 
ATOM   4684  C  CA    . PRO I  4 151  ? 47.161  0.349    -22.341 1.00 128.82 ? 151  PRO A CA    1 
ATOM   4685  C  C     . PRO I  4 151  ? 47.183  -1.169   -22.023 1.00 127.40 ? 151  PRO A C     1 
ATOM   4686  O  O     . PRO I  4 151  ? 48.239  -1.778   -22.073 1.00 139.84 ? 151  PRO A O     1 
ATOM   4687  C  CB    . PRO I  4 151  ? 47.374  1.167    -21.054 1.00 129.76 ? 151  PRO A CB    1 
ATOM   4688  C  CG    . PRO I  4 151  ? 46.118  1.916    -20.814 1.00 130.53 ? 151  PRO A CG    1 
ATOM   4689  C  CD    . PRO I  4 151  ? 45.484  2.086    -22.155 1.00 132.31 ? 151  PRO A CD    1 
ATOM   4690  N  N     . GLN I  4 152  ? 46.047  -1.770   -21.694 1.00 132.52 ? 152  GLN A N     1 
ATOM   4691  C  CA    . GLN I  4 152  ? 45.994  -3.206   -21.357 1.00 134.65 ? 152  GLN A CA    1 
ATOM   4692  C  C     . GLN I  4 152  ? 46.069  -4.115   -22.598 1.00 135.01 ? 152  GLN A C     1 
ATOM   4693  O  O     . GLN I  4 152  ? 46.668  -5.214   -22.556 1.00 119.72 ? 152  GLN A O     1 
ATOM   4694  C  CB    . GLN I  4 152  ? 44.716  -3.517   -20.569 1.00 131.56 ? 152  GLN A CB    1 
ATOM   4695  C  CG    . GLN I  4 152  ? 44.715  -4.872   -19.867 1.00 135.41 ? 152  GLN A CG    1 
ATOM   4696  C  CD    . GLN I  4 152  ? 45.571  -4.907   -18.622 1.00 131.75 ? 152  GLN A CD    1 
ATOM   4697  O  OE1   . GLN I  4 152  ? 45.733  -3.900   -17.950 1.00 132.66 ? 152  GLN A OE1   1 
ATOM   4698  N  NE2   . GLN I  4 152  ? 46.112  -6.074   -18.303 1.00 138.87 ? 152  GLN A NE2   1 
ATOM   4699  N  N     . PHE I  4 153  ? 45.433  -3.656   -23.682 1.00 140.60 ? 153  PHE A N     1 
ATOM   4700  C  CA    . PHE I  4 153  ? 45.510  -4.322   -25.003 1.00 141.86 ? 153  PHE A CA    1 
ATOM   4701  C  C     . PHE I  4 153  ? 46.924  -4.275   -25.591 1.00 135.65 ? 153  PHE A C     1 
ATOM   4702  O  O     . PHE I  4 153  ? 47.303  -5.164   -26.337 1.00 135.53 ? 153  PHE A O     1 
ATOM   4703  C  CB    . PHE I  4 153  ? 44.508  -3.706   -26.012 1.00 143.89 ? 153  PHE A CB    1 
ATOM   4704  C  CG    . PHE I  4 153  ? 43.066  -3.994   -25.689 1.00 148.68 ? 153  PHE A CG    1 
ATOM   4705  C  CD1   . PHE I  4 153  ? 42.171  -2.962   -25.466 1.00 147.24 ? 153  PHE A CD1   1 
ATOM   4706  C  CD2   . PHE I  4 153  ? 42.608  -5.316   -25.586 1.00 153.20 ? 153  PHE A CD2   1 
ATOM   4707  C  CE1   . PHE I  4 153  ? 40.843  -3.240   -25.153 1.00 150.22 ? 153  PHE A CE1   1 
ATOM   4708  C  CE2   . PHE I  4 153  ? 41.286  -5.598   -25.270 1.00 143.68 ? 153  PHE A CE2   1 
ATOM   4709  C  CZ    . PHE I  4 153  ? 40.404  -4.558   -25.055 1.00 147.88 ? 153  PHE A CZ    1 
ATOM   4710  N  N     . ILE I  4 154  ? 47.690  -3.237   -25.255 1.00 132.44 ? 154  ILE A N     1 
ATOM   4711  C  CA    . ILE I  4 154  ? 49.072  -3.130   -25.684 1.00 130.37 ? 154  ILE A CA    1 
ATOM   4712  C  C     . ILE I  4 154  ? 49.915  -4.152   -24.951 1.00 134.58 ? 154  ILE A C     1 
ATOM   4713  O  O     . ILE I  4 154  ? 50.788  -4.770   -25.549 1.00 159.18 ? 154  ILE A O     1 
ATOM   4714  C  CB    . ILE I  4 154  ? 49.636  -1.727   -25.449 1.00 122.88 ? 154  ILE A CB    1 
ATOM   4715  C  CG1   . ILE I  4 154  ? 48.900  -0.732   -26.321 1.00 116.49 ? 154  ILE A CG1   1 
ATOM   4716  C  CG2   . ILE I  4 154  ? 51.101  -1.667   -25.827 1.00 132.14 ? 154  ILE A CG2   1 
ATOM   4717  C  CD1   . ILE I  4 154  ? 49.300  0.681    -26.040 1.00 113.90 ? 154  ILE A CD1   1 
ATOM   4718  N  N     . LEU I  4 155  ? 49.651  -4.345   -23.667 1.00 132.31 ? 155  LEU A N     1 
ATOM   4719  C  CA    . LEU I  4 155  ? 50.351  -5.382   -22.900 1.00 142.47 ? 155  LEU A CA    1 
ATOM   4720  C  C     . LEU I  4 155  ? 49.999  -6.830   -23.362 1.00 143.19 ? 155  LEU A C     1 
ATOM   4721  O  O     . LEU I  4 155  ? 50.772  -7.764   -23.162 1.00 137.88 ? 155  LEU A O     1 
ATOM   4722  C  CB    . LEU I  4 155  ? 50.084  -5.204   -21.390 1.00 141.36 ? 155  LEU A CB    1 
ATOM   4723  C  CG    . LEU I  4 155  ? 50.594  -3.913   -20.710 1.00 141.09 ? 155  LEU A CG    1 
ATOM   4724  C  CD1   . LEU I  4 155  ? 49.989  -3.727   -19.324 1.00 143.55 ? 155  LEU A CD1   1 
ATOM   4725  C  CD2   . LEU I  4 155  ? 52.107  -3.857   -20.593 1.00 136.77 ? 155  LEU A CD2   1 
ATOM   4726  N  N     . GLN I  4 156  ? 48.833  -7.003   -23.975 1.00 146.67 ? 156  GLN A N     1 
ATOM   4727  C  CA    . GLN I  4 156  ? 48.373  -8.313   -24.430 1.00 150.69 ? 156  GLN A CA    1 
ATOM   4728  C  C     . GLN I  4 156  ? 48.870  -8.625   -25.840 1.00 156.77 ? 156  GLN A C     1 
ATOM   4729  O  O     . GLN I  4 156  ? 48.504  -9.654   -26.414 1.00 168.72 ? 156  GLN A O     1 
ATOM   4730  C  CB    . GLN I  4 156  ? 46.842  -8.339   -24.435 1.00 161.35 ? 156  GLN A CB    1 
ATOM   4731  C  CG    . GLN I  4 156  ? 46.181  -8.245   -23.068 1.00 164.98 ? 156  GLN A CG    1 
ATOM   4732  C  CD    . GLN I  4 156  ? 45.986  -9.609   -22.444 1.00 179.65 ? 156  GLN A CD    1 
ATOM   4733  O  OE1   . GLN I  4 156  ? 46.769  -10.539  -22.688 1.00 192.26 ? 156  GLN A OE1   1 
ATOM   4734  N  NE2   . GLN I  4 156  ? 44.931  -9.746   -21.648 1.00 176.34 ? 156  GLN A NE2   1 
ATOM   4735  N  N     . ASP I  4 157  ? 49.687  -7.730   -26.399 1.00 154.76 ? 157  ASP A N     1 
ATOM   4736  C  CA    . ASP I  4 157  ? 50.179  -7.833   -27.780 1.00 147.46 ? 157  ASP A CA    1 
ATOM   4737  C  C     . ASP I  4 157  ? 49.040  -7.842   -28.793 1.00 143.77 ? 157  ASP A C     1 
ATOM   4738  O  O     . ASP I  4 157  ? 49.126  -8.490   -29.831 1.00 157.45 ? 157  ASP A O     1 
ATOM   4739  C  CB    . ASP I  4 157  ? 51.093  -9.046   -27.953 1.00 141.70 ? 157  ASP A CB    1 
ATOM   4740  C  CG    . ASP I  4 157  ? 52.330  -8.956   -27.094 1.00 144.03 ? 157  ASP A CG    1 
ATOM   4741  O  OD1   . ASP I  4 157  ? 52.491  -7.941   -26.397 1.00 144.31 ? 157  ASP A OD1   1 
ATOM   4742  O  OD2   . ASP I  4 157  ? 53.161  -9.884   -27.117 1.00 157.00 ? 157  ASP A OD2   1 
ATOM   4743  N  N     . ARG I  4 158  ? 47.983  -7.100   -28.488 1.00 137.81 ? 158  ARG A N     1 
ATOM   4744  C  CA    . ARG I  4 158  ? 46.842  -6.969   -29.375 1.00 140.31 ? 158  ARG A CA    1 
ATOM   4745  C  C     . ARG I  4 158  ? 46.671  -5.496   -29.737 1.00 139.36 ? 158  ARG A C     1 
ATOM   4746  O  O     . ARG I  4 158  ? 45.771  -4.810   -29.237 1.00 138.76 ? 158  ARG A O     1 
ATOM   4747  C  CB    . ARG I  4 158  ? 45.580  -7.521   -28.707 1.00 148.98 ? 158  ARG A CB    1 
ATOM   4748  C  CG    . ARG I  4 158  ? 45.654  -8.990   -28.282 1.00 151.88 ? 158  ARG A CG    1 
ATOM   4749  C  CD    . ARG I  4 158  ? 45.780  -9.937   -29.460 1.00 152.89 ? 158  ARG A CD    1 
ATOM   4750  N  NE    . ARG I  4 158  ? 44.686  -9.763   -30.413 1.00 161.31 ? 158  ARG A NE    1 
ATOM   4751  C  CZ    . ARG I  4 158  ? 43.447  -10.221  -30.249 1.00 172.13 ? 158  ARG A CZ    1 
ATOM   4752  N  NH1   . ARG I  4 158  ? 43.106  -10.908  -29.158 1.00 179.51 ? 158  ARG A NH1   1 
ATOM   4753  N  NH2   . ARG I  4 158  ? 42.535  -9.991   -31.188 1.00 175.74 ? 158  ARG A NH2   1 
ATOM   4754  N  N     . LEU I  4 159  ? 47.551  -5.020   -30.614 1.00 140.83 ? 159  LEU A N     1 
ATOM   4755  C  CA    . LEU I  4 159  ? 47.569  -3.617   -31.018 1.00 137.68 ? 159  LEU A CA    1 
ATOM   4756  C  C     . LEU I  4 159  ? 46.329  -3.255   -31.840 1.00 135.00 ? 159  LEU A C     1 
ATOM   4757  O  O     . LEU I  4 159  ? 45.861  -2.111   -31.775 1.00 131.14 ? 159  LEU A O     1 
ATOM   4758  C  CB    . LEU I  4 159  ? 48.857  -3.293   -31.789 1.00 139.25 ? 159  LEU A CB    1 
ATOM   4759  C  CG    . LEU I  4 159  ? 50.155  -3.268   -30.970 1.00 138.11 ? 159  LEU A CG    1 
ATOM   4760  C  CD1   . LEU I  4 159  ? 50.566  -4.663   -30.539 1.00 134.34 ? 159  LEU A CD1   1 
ATOM   4761  C  CD2   . LEU I  4 159  ? 51.287  -2.613   -31.751 1.00 135.43 ? 159  LEU A CD2   1 
ATOM   4762  N  N     . ASP I  4 160  ? 45.799  -4.237   -32.580 1.00 135.90 ? 160  ASP A N     1 
ATOM   4763  C  CA    . ASP I  4 160  ? 44.588  -4.059   -33.389 1.00 139.30 ? 160  ASP A CA    1 
ATOM   4764  C  C     . ASP I  4 160  ? 43.362  -3.717   -32.518 1.00 144.76 ? 160  ASP A C     1 
ATOM   4765  O  O     . ASP I  4 160  ? 42.538  -2.879   -32.888 1.00 156.32 ? 160  ASP A O     1 
ATOM   4766  C  CB    . ASP I  4 160  ? 44.320  -5.295   -34.275 1.00 139.67 ? 160  ASP A CB    1 
ATOM   4767  C  CG    . ASP I  4 160  ? 44.045  -6.563   -33.465 1.00 136.91 ? 160  ASP A CG    1 
ATOM   4768  O  OD1   . ASP I  4 160  ? 44.675  -6.713   -32.412 1.00 129.02 ? 160  ASP A OD1   1 
ATOM   4769  O  OD2   . ASP I  4 160  ? 43.212  -7.406   -33.878 1.00 139.11 ? 160  ASP A OD2   1 
ATOM   4770  N  N     . LEU I  4 161  ? 43.263  -4.344   -31.350 1.00 147.98 ? 161  LEU A N     1 
ATOM   4771  C  CA    . LEU I  4 161  ? 42.178  -4.059   -30.408 1.00 145.02 ? 161  LEU A CA    1 
ATOM   4772  C  C     . LEU I  4 161  ? 42.390  -2.692   -29.752 1.00 138.46 ? 161  LEU A C     1 
ATOM   4773  O  O     . LEU I  4 161  ? 41.471  -1.881   -29.652 1.00 149.67 ? 161  LEU A O     1 
ATOM   4774  C  CB    . LEU I  4 161  ? 42.080  -5.154   -29.328 1.00 144.31 ? 161  LEU A CB    1 
ATOM   4775  C  CG    . LEU I  4 161  ? 41.718  -6.561   -29.804 1.00 142.49 ? 161  LEU A CG    1 
ATOM   4776  C  CD1   . LEU I  4 161  ? 41.920  -7.552   -28.677 1.00 137.04 ? 161  LEU A CD1   1 
ATOM   4777  C  CD2   . LEU I  4 161  ? 40.287  -6.592   -30.311 1.00 145.92 ? 161  LEU A CD2   1 
ATOM   4778  N  N     . ALA I  4 162  ? 43.609  -2.433   -29.315 1.00 131.00 ? 162  ALA A N     1 
ATOM   4779  C  CA    . ALA I  4 162  ? 43.921  -1.144   -28.730 1.00 133.64 ? 162  ALA A CA    1 
ATOM   4780  C  C     . ALA I  4 162  ? 43.526  0.005    -29.649 1.00 127.84 ? 162  ALA A C     1 
ATOM   4781  O  O     . ALA I  4 162  ? 42.936  0.974    -29.209 1.00 119.72 ? 162  ALA A O     1 
ATOM   4782  C  CB    . ALA I  4 162  ? 45.405  -1.066   -28.410 1.00 139.88 ? 162  ALA A CB    1 
ATOM   4783  N  N     . GLU I  4 163  ? 43.877  -0.109   -30.923 1.00 133.77 ? 163  GLU A N     1 
ATOM   4784  C  CA    . GLU I  4 163  ? 43.587  0.942    -31.879 1.00 137.55 ? 163  GLU A CA    1 
ATOM   4785  C  C     . GLU I  4 163  ? 42.097  0.979    -32.164 1.00 129.41 ? 163  GLU A C     1 
ATOM   4786  O  O     . GLU I  4 163  ? 41.524  2.045    -32.321 1.00 128.19 ? 163  GLU A O     1 
ATOM   4787  C  CB    . GLU I  4 163  ? 44.386  0.744    -33.177 1.00 145.24 ? 163  GLU A CB    1 
ATOM   4788  C  CG    . GLU I  4 163  ? 44.439  1.989    -34.068 1.00 150.70 ? 163  GLU A CG    1 
ATOM   4789  C  CD    . GLU I  4 163  ? 45.300  1.819    -35.311 1.00 158.50 ? 163  GLU A CD    1 
ATOM   4790  O  OE1   . GLU I  4 163  ? 45.844  0.716    -35.534 1.00 173.22 ? 163  GLU A OE1   1 
ATOM   4791  O  OE2   . GLU I  4 163  ? 45.434  2.797    -36.076 1.00 158.76 ? 163  GLU A OE2   1 
ATOM   4792  N  N     . ALA I  4 164  ? 41.479  -0.193   -32.232 1.00 129.41 ? 164  ALA A N     1 
ATOM   4793  C  CA    . ALA I  4 164  ? 40.040  -0.293   -32.478 1.00 132.47 ? 164  ALA A CA    1 
ATOM   4794  C  C     . ALA I  4 164  ? 39.276  0.350    -31.327 1.00 133.07 ? 164  ALA A C     1 
ATOM   4795  O  O     . ALA I  4 164  ? 38.289  1.061    -31.528 1.00 133.18 ? 164  ALA A O     1 
ATOM   4796  C  CB    . ALA I  4 164  ? 39.623  -1.751   -32.634 1.00 131.06 ? 164  ALA A CB    1 
ATOM   4797  N  N     . ARG I  4 165  ? 39.748  0.094    -30.115 1.00 133.23 ? 165  ARG A N     1 
ATOM   4798  C  CA    . ARG I  4 165  ? 39.153  0.679    -28.928 1.00 131.12 ? 165  ARG A CA    1 
ATOM   4799  C  C     . ARG I  4 165  ? 39.384  2.190    -28.907 1.00 134.62 ? 165  ARG A C     1 
ATOM   4800  O  O     . ARG I  4 165  ? 38.525  2.942    -28.446 1.00 137.74 ? 165  ARG A O     1 
ATOM   4801  C  CB    . ARG I  4 165  ? 39.715  0.009    -27.665 1.00 126.67 ? 165  ARG A CB    1 
ATOM   4802  C  CG    . ARG I  4 165  ? 39.101  0.475    -26.345 1.00 126.30 ? 165  ARG A CG    1 
ATOM   4803  C  CD    . ARG I  4 165  ? 37.565  0.397    -26.275 1.00 126.30 ? 165  ARG A CD    1 
ATOM   4804  N  NE    . ARG I  4 165  ? 37.051  -0.928   -26.605 1.00 126.42 ? 165  ARG A NE    1 
ATOM   4805  C  CZ    . ARG I  4 165  ? 37.039  -1.970   -25.785 1.00 130.19 ? 165  ARG A CZ    1 
ATOM   4806  N  NH1   . ARG I  4 165  ? 37.497  -1.876   -24.544 1.00 132.44 ? 165  ARG A NH1   1 
ATOM   4807  N  NH2   . ARG I  4 165  ? 36.568  -3.129   -26.218 1.00 139.92 ? 165  ARG A NH2   1 
ATOM   4808  N  N     . LEU I  4 166  ? 40.536  2.628    -29.419 1.00 141.44 ? 166  LEU A N     1 
ATOM   4809  C  CA    . LEU I  4 166  ? 40.872  4.052    -29.489 1.00 134.31 ? 166  LEU A CA    1 
ATOM   4810  C  C     . LEU I  4 166  ? 39.939  4.772    -30.442 1.00 136.92 ? 166  LEU A C     1 
ATOM   4811  O  O     . LEU I  4 166  ? 39.526  5.900    -30.181 1.00 145.22 ? 166  LEU A O     1 
ATOM   4812  C  CB    . LEU I  4 166  ? 42.315  4.245    -29.948 1.00 136.80 ? 166  LEU A CB    1 
ATOM   4813  C  CG    . LEU I  4 166  ? 42.820  5.677    -30.146 1.00 138.92 ? 166  LEU A CG    1 
ATOM   4814  C  CD1   . LEU I  4 166  ? 42.702  6.496    -28.866 1.00 139.87 ? 166  LEU A CD1   1 
ATOM   4815  C  CD2   . LEU I  4 166  ? 44.258  5.645    -30.647 1.00 131.69 ? 166  LEU A CD2   1 
ATOM   4816  N  N     . ASN I  4 167  ? 39.606  4.123    -31.552 1.00 134.98 ? 167  ASN A N     1 
ATOM   4817  C  CA    . ASN I  4 167  ? 38.642  4.688    -32.493 1.00 133.86 ? 167  ASN A CA    1 
ATOM   4818  C  C     . ASN I  4 167  ? 37.234  4.828    -31.903 1.00 130.57 ? 167  ASN A C     1 
ATOM   4819  O  O     . ASN I  4 167  ? 36.526  5.784    -32.209 1.00 118.58 ? 167  ASN A O     1 
ATOM   4820  C  CB    . ASN I  4 167  ? 38.616  3.855    -33.776 1.00 136.28 ? 167  ASN A CB    1 
ATOM   4821  C  CG    . ASN I  4 167  ? 39.903  3.970    -34.562 1.00 137.29 ? 167  ASN A CG    1 
ATOM   4822  O  OD1   . ASN I  4 167  ? 40.478  2.969    -35.002 1.00 143.58 ? 167  ASN A OD1   1 
ATOM   4823  N  ND2   . ASN I  4 167  ? 40.382  5.197    -34.719 1.00 138.07 ? 167  ASN A ND2   1 
ATOM   4824  N  N     . GLU I  4 168  ? 36.853  3.877    -31.050 1.00 135.82 ? 168  GLU A N     1 
ATOM   4825  C  CA    . GLU I  4 168  ? 35.537  3.871    -30.422 1.00 137.18 ? 168  GLU A CA    1 
ATOM   4826  C  C     . GLU I  4 168  ? 35.399  5.051    -29.486 1.00 132.25 ? 168  GLU A C     1 
ATOM   4827  O  O     . GLU I  4 168  ? 34.377  5.740    -29.531 1.00 126.14 ? 168  GLU A O     1 
ATOM   4828  C  CB    . GLU I  4 168  ? 35.296  2.560    -29.660 1.00 144.51 ? 168  GLU A CB    1 
ATOM   4829  C  CG    . GLU I  4 168  ? 33.858  2.375    -29.188 1.00 151.02 ? 168  GLU A CG    1 
ATOM   4830  C  CD    . GLU I  4 168  ? 33.637  1.075    -28.439 1.00 162.61 ? 168  GLU A CD    1 
ATOM   4831  O  OE1   . GLU I  4 168  ? 32.587  0.938    -27.763 1.00 160.81 ? 168  GLU A OE1   1 
ATOM   4832  O  OE2   . GLU I  4 168  ? 34.514  0.187    -28.525 1.00 180.26 ? 168  GLU A OE2   1 
ATOM   4833  N  N     . ASP I  4 169  ? 36.427  5.272    -28.654 1.00 134.29 ? 169  ASP A N     1 
ATOM   4834  C  CA    . ASP I  4 169  ? 36.469  6.408    -27.703 1.00 138.28 ? 169  ASP A CA    1 
ATOM   4835  C  C     . ASP I  4 169  ? 36.508  7.765    -28.454 1.00 135.54 ? 169  ASP A C     1 
ATOM   4836  O  O     . ASP I  4 169  ? 35.896  8.741    -28.017 1.00 137.18 ? 169  ASP A O     1 
ATOM   4837  C  CB    . ASP I  4 169  ? 37.676  6.310    -26.725 1.00 139.54 ? 169  ASP A CB    1 
ATOM   4838  C  CG    . ASP I  4 169  ? 37.508  5.222    -25.621 1.00 140.74 ? 169  ASP A CG    1 
ATOM   4839  O  OD1   . ASP I  4 169  ? 36.417  5.126    -25.027 1.00 148.39 ? 169  ASP A OD1   1 
ATOM   4840  O  OD2   . ASP I  4 169  ? 38.485  4.496    -25.300 1.00 131.90 ? 169  ASP A OD2   1 
ATOM   4841  N  N     . LEU I  4 170  ? 37.210  7.812    -29.587 1.00 126.09 ? 170  LEU A N     1 
ATOM   4842  C  CA    . LEU I  4 170  ? 37.270  9.025    -30.406 1.00 125.50 ? 170  LEU A CA    1 
ATOM   4843  C  C     . LEU I  4 170  ? 35.932  9.375    -31.092 1.00 122.71 ? 170  LEU A C     1 
ATOM   4844  O  O     . LEU I  4 170  ? 35.723  10.514   -31.511 1.00 116.20 ? 170  LEU A O     1 
ATOM   4845  C  CB    . LEU I  4 170  ? 38.381  8.897    -31.460 1.00 127.02 ? 170  LEU A CB    1 
ATOM   4846  C  CG    . LEU I  4 170  ? 39.821  9.019    -30.949 1.00 123.91 ? 170  LEU A CG    1 
ATOM   4847  C  CD1   . LEU I  4 170  ? 40.820  8.548    -31.999 1.00 126.55 ? 170  LEU A CD1   1 
ATOM   4848  C  CD2   . LEU I  4 170  ? 40.109  10.449   -30.522 1.00 113.47 ? 170  LEU A CD2   1 
ATOM   4849  N  N     . SER I  4 171  ? 35.063  8.379    -31.247 1.00 125.09 ? 171  SER A N     1 
ATOM   4850  C  CA    . SER I  4 171  ? 33.720  8.578    -31.771 1.00 120.09 ? 171  SER A CA    1 
ATOM   4851  C  C     . SER I  4 171  ? 32.835  9.184    -30.714 1.00 123.97 ? 171  SER A C     1 
ATOM   4852  O  O     . SER I  4 171  ? 31.910  9.924    -31.027 1.00 128.63 ? 171  SER A O     1 
ATOM   4853  C  CB    . SER I  4 171  ? 33.122  7.249    -32.195 1.00 122.00 ? 171  SER A CB    1 
ATOM   4854  O  OG    . SER I  4 171  ? 31.774  7.405    -32.587 1.00 126.61 ? 171  SER A OG    1 
ATOM   4855  N  N     . ILE I  4 172  ? 33.124  8.854    -29.459 1.00 128.60 ? 172  ILE A N     1 
ATOM   4856  C  CA    . ILE I  4 172  ? 32.403  9.391    -28.314 1.00 130.30 ? 172  ILE A CA    1 
ATOM   4857  C  C     . ILE I  4 172  ? 32.808  10.847   -28.025 1.00 129.48 ? 172  ILE A C     1 
ATOM   4858  O  O     . ILE I  4 172  ? 32.005  11.771   -28.188 1.00 138.16 ? 172  ILE A O     1 
ATOM   4859  C  CB    . ILE I  4 172  ? 32.633  8.503    -27.064 1.00 126.36 ? 172  ILE A CB    1 
ATOM   4860  C  CG1   . ILE I  4 172  ? 31.967  7.142    -27.272 1.00 130.27 ? 172  ILE A CG1   1 
ATOM   4861  C  CG2   . ILE I  4 172  ? 32.084  9.161    -25.808 1.00 129.32 ? 172  ILE A CG2   1 
ATOM   4862  C  CD1   . ILE I  4 172  ? 32.138  6.158    -26.129 1.00 132.06 ? 172  ILE A CD1   1 
ATOM   4863  N  N     . PHE I  4 173  ? 34.055  11.041   -27.609 1.00 119.26 ? 173  PHE A N     1 
ATOM   4864  C  CA    . PHE I  4 173  ? 34.514  12.331   -27.099 1.00 119.87 ? 173  PHE A CA    1 
ATOM   4865  C  C     . PHE I  4 173  ? 35.032  13.297   -28.168 1.00 120.61 ? 173  PHE A C     1 
ATOM   4866  O  O     . PHE I  4 173  ? 34.960  14.513   -28.010 1.00 126.49 ? 173  PHE A O     1 
ATOM   4867  C  CB    . PHE I  4 173  ? 35.622  12.111   -26.079 1.00 126.89 ? 173  PHE A CB    1 
ATOM   4868  C  CG    . PHE I  4 173  ? 35.206  11.304   -24.878 1.00 123.20 ? 173  PHE A CG    1 
ATOM   4869  C  CD1   . PHE I  4 173  ? 35.591  9.987    -24.741 1.00 127.13 ? 173  PHE A CD1   1 
ATOM   4870  C  CD2   . PHE I  4 173  ? 34.452  11.872   -23.883 1.00 126.20 ? 173  PHE A CD2   1 
ATOM   4871  C  CE1   . PHE I  4 173  ? 35.228  9.245    -23.637 1.00 127.36 ? 173  PHE A CE1   1 
ATOM   4872  C  CE2   . PHE I  4 173  ? 34.072  11.138   -22.779 1.00 128.91 ? 173  PHE A CE2   1 
ATOM   4873  C  CZ    . PHE I  4 173  ? 34.467  9.822    -22.653 1.00 128.19 ? 173  PHE A CZ    1 
ATOM   4874  N  N     . GLY I  4 174  ? 35.594  12.756   -29.237 1.00 129.23 ? 174  GLY A N     1 
ATOM   4875  C  CA    . GLY I  4 174  ? 36.077  13.572   -30.351 1.00 127.05 ? 174  GLY A CA    1 
ATOM   4876  C  C     . GLY I  4 174  ? 37.422  14.206   -30.060 1.00 125.53 ? 174  GLY A C     1 
ATOM   4877  O  O     . GLY I  4 174  ? 38.446  13.522   -30.006 1.00 122.34 ? 174  GLY A O     1 
ATOM   4878  N  N     . ASP I  4 175  ? 37.408  15.524   -29.876 1.00 126.09 ? 175  ASP A N     1 
ATOM   4879  C  CA    . ASP I  4 175  ? 38.621  16.289   -29.624 1.00 125.84 ? 175  ASP A CA    1 
ATOM   4880  C  C     . ASP I  4 175  ? 38.899  16.449   -28.153 1.00 118.74 ? 175  ASP A C     1 
ATOM   4881  O  O     . ASP I  4 175  ? 39.894  17.051   -27.798 1.00 114.64 ? 175  ASP A O     1 
ATOM   4882  C  CB    . ASP I  4 175  ? 38.561  17.677   -30.298 1.00 136.57 ? 175  ASP A CB    1 
ATOM   4883  C  CG    . ASP I  4 175  ? 37.439  18.561   -29.770 1.00 140.78 ? 175  ASP A CG    1 
ATOM   4884  O  OD1   . ASP I  4 175  ? 36.382  18.032   -29.373 1.00 155.64 ? 175  ASP A OD1   1 
ATOM   4885  O  OD2   . ASP I  4 175  ? 37.605  19.799   -29.782 1.00 153.02 ? 175  ASP A OD2   1 
ATOM   4886  N  N     . ARG I  4 176  ? 38.014  15.924   -27.302 1.00 128.73 ? 176  ARG A N     1 
ATOM   4887  C  CA    . ARG I  4 176  ? 38.179  15.997   -25.842 1.00 129.99 ? 176  ARG A CA    1 
ATOM   4888  C  C     . ARG I  4 176  ? 39.005  14.844   -25.286 1.00 128.76 ? 176  ARG A C     1 
ATOM   4889  O  O     . ARG I  4 176  ? 39.395  14.865   -24.126 1.00 135.91 ? 176  ARG A O     1 
ATOM   4890  C  CB    . ARG I  4 176  ? 36.827  16.016   -25.131 1.00 130.80 ? 176  ARG A CB    1 
ATOM   4891  C  CG    . ARG I  4 176  ? 35.869  17.095   -25.618 1.00 141.10 ? 176  ARG A CG    1 
ATOM   4892  C  CD    . ARG I  4 176  ? 34.717  17.316   -24.641 1.00 143.61 ? 176  ARG A CD    1 
ATOM   4893  N  NE    . ARG I  4 176  ? 33.484  17.713   -25.328 1.00 145.86 ? 176  ARG A NE    1 
ATOM   4894  C  CZ    . ARG I  4 176  ? 32.612  16.871   -25.890 1.00 146.58 ? 176  ARG A CZ    1 
ATOM   4895  N  NH1   . ARG I  4 176  ? 32.804  15.554   -25.853 1.00 141.45 ? 176  ARG A NH1   1 
ATOM   4896  N  NH2   . ARG I  4 176  ? 31.527  17.350   -26.496 1.00 150.88 ? 176  ARG A NH2   1 
ATOM   4897  N  N     . PHE I  4 177  ? 39.268  13.833   -26.111 1.00 133.16 ? 177  PHE A N     1 
ATOM   4898  C  CA    . PHE I  4 177  ? 40.057  12.667   -25.696 1.00 130.60 ? 177  PHE A CA    1 
ATOM   4899  C  C     . PHE I  4 177  ? 41.568  12.939   -25.741 1.00 127.43 ? 177  PHE A C     1 
ATOM   4900  O  O     . PHE I  4 177  ? 42.063  13.646   -26.614 1.00 135.32 ? 177  PHE A O     1 
ATOM   4901  C  CB    . PHE I  4 177  ? 39.708  11.459   -26.573 1.00 127.30 ? 177  PHE A CB    1 
ATOM   4902  C  CG    . PHE I  4 177  ? 40.212  10.157   -26.031 1.00 127.17 ? 177  PHE A CG    1 
ATOM   4903  C  CD1   . PHE I  4 177  ? 39.423  9.391    -25.209 1.00 126.84 ? 177  PHE A CD1   1 
ATOM   4904  C  CD2   . PHE I  4 177  ? 41.484  9.698    -26.349 1.00 136.55 ? 177  PHE A CD2   1 
ATOM   4905  C  CE1   . PHE I  4 177  ? 39.888  8.196    -24.693 1.00 130.50 ? 177  PHE A CE1   1 
ATOM   4906  C  CE2   . PHE I  4 177  ? 41.958  8.491    -25.853 1.00 134.38 ? 177  PHE A CE2   1 
ATOM   4907  C  CZ    . PHE I  4 177  ? 41.157  7.739    -25.019 1.00 132.47 ? 177  PHE A CZ    1 
ATOM   4908  N  N     . PHE I  4 178  ? 42.297  12.367   -24.798 1.00 124.52 ? 178  PHE A N     1 
ATOM   4909  C  CA    . PHE I  4 178  ? 43.735  12.607   -24.690 1.00 126.96 ? 178  PHE A CA    1 
ATOM   4910  C  C     . PHE I  4 178  ? 44.444  11.326   -24.326 1.00 129.40 ? 178  PHE A C     1 
ATOM   4911  O  O     . PHE I  4 178  ? 43.842  10.393   -23.804 1.00 134.58 ? 178  PHE A O     1 
ATOM   4912  C  CB    . PHE I  4 178  ? 44.056  13.616   -23.584 1.00 131.78 ? 178  PHE A CB    1 
ATOM   4913  C  CG    . PHE I  4 178  ? 43.706  15.037   -23.910 1.00 126.77 ? 178  PHE A CG    1 
ATOM   4914  C  CD1   . PHE I  4 178  ? 42.541  15.608   -23.435 1.00 126.20 ? 178  PHE A CD1   1 
ATOM   4915  C  CD2   . PHE I  4 178  ? 44.563  15.807   -24.650 1.00 136.15 ? 178  PHE A CD2   1 
ATOM   4916  C  CE1   . PHE I  4 178  ? 42.227  16.921   -23.717 1.00 129.37 ? 178  PHE A CE1   1 
ATOM   4917  C  CE2   . PHE I  4 178  ? 44.258  17.122   -24.941 1.00 140.43 ? 178  PHE A CE2   1 
ATOM   4918  C  CZ    . PHE I  4 178  ? 43.087  17.683   -24.472 1.00 135.33 ? 178  PHE A CZ    1 
ATOM   4919  N  N     . ILE I  4 179  ? 45.745  11.313   -24.569 1.00 133.07 ? 179  ILE A N     1 
ATOM   4920  C  CA    . ILE I  4 179  ? 46.574  10.151   -24.290 1.00 135.31 ? 179  ILE A CA    1 
ATOM   4921  C  C     . ILE I  4 179  ? 47.299  10.400   -22.975 1.00 138.18 ? 179  ILE A C     1 
ATOM   4922  O  O     . ILE I  4 179  ? 48.200  11.234   -22.913 1.00 141.85 ? 179  ILE A O     1 
ATOM   4923  C  CB    . ILE I  4 179  ? 47.599  9.914    -25.422 1.00 129.08 ? 179  ILE A CB    1 
ATOM   4924  C  CG1   . ILE I  4 179  ? 46.900  9.813    -26.770 1.00 128.55 ? 179  ILE A CG1   1 
ATOM   4925  C  CG2   . ILE I  4 179  ? 48.375  8.639    -25.185 1.00 129.96 ? 179  ILE A CG2   1 
ATOM   4926  C  CD1   . ILE I  4 179  ? 45.790  8.788    -26.798 1.00 140.29 ? 179  ILE A CD1   1 
ATOM   4927  N  N     . GLU I  4 180  ? 46.889  9.693    -21.924 1.00 134.36 ? 180  GLU A N     1 
ATOM   4928  C  CA    . GLU I  4 180  ? 47.486  9.857    -20.596 1.00 132.78 ? 180  GLU A CA    1 
ATOM   4929  C  C     . GLU I  4 180  ? 48.821  9.144    -20.518 1.00 130.42 ? 180  GLU A C     1 
ATOM   4930  O  O     . GLU I  4 180  ? 48.909  7.947    -20.779 1.00 141.22 ? 180  GLU A O     1 
ATOM   4931  C  CB    . GLU I  4 180  ? 46.562  9.308    -19.500 1.00 135.37 ? 180  GLU A CB    1 
ATOM   4932  C  CG    . GLU I  4 180  ? 46.961  9.754    -18.103 1.00 135.62 ? 180  GLU A CG    1 
ATOM   4933  C  CD    . GLU I  4 180  ? 45.933  9.453    -17.046 1.00 134.05 ? 180  GLU A CD    1 
ATOM   4934  O  OE1   . GLU I  4 180  ? 44.734  9.427    -17.355 1.00 137.39 ? 180  GLU A OE1   1 
ATOM   4935  O  OE2   . GLU I  4 180  ? 46.331  9.268    -15.887 1.00 143.31 ? 180  GLU A OE2   1 
ATOM   4936  N  N     . ILE I  4 181  ? 49.854  9.875    -20.134 1.00 124.00 ? 181  ILE A N     1 
ATOM   4937  C  CA    . ILE I  4 181  ? 51.190  9.326    -20.083 1.00 126.93 ? 181  ILE A CA    1 
ATOM   4938  C  C     . ILE I  4 181  ? 51.686  9.520    -18.668 1.00 131.51 ? 181  ILE A C     1 
ATOM   4939  O  O     . ILE I  4 181  ? 51.735  10.653   -18.177 1.00 143.91 ? 181  ILE A O     1 
ATOM   4940  C  CB    . ILE I  4 181  ? 52.100  10.063   -21.071 1.00 127.45 ? 181  ILE A CB    1 
ATOM   4941  C  CG1   . ILE I  4 181  ? 51.655  9.771    -22.493 1.00 133.57 ? 181  ILE A CG1   1 
ATOM   4942  C  CG2   . ILE I  4 181  ? 53.546  9.659    -20.894 1.00 130.13 ? 181  ILE A CG2   1 
ATOM   4943  C  CD1   . ILE I  4 181  ? 52.356  10.638   -23.515 1.00 138.20 ? 181  ILE A CD1   1 
ATOM   4944  N  N     . GLN I  4 182  ? 52.012  8.418    -17.998 1.00 127.06 ? 182  GLN A N     1 
ATOM   4945  C  CA    . GLN I  4 182  ? 52.543  8.481    -16.647 1.00 130.04 ? 182  GLN A CA    1 
ATOM   4946  C  C     . GLN I  4 182  ? 53.684  7.500    -16.512 1.00 128.04 ? 182  GLN A C     1 
ATOM   4947  O  O     . GLN I  4 182  ? 53.628  6.414    -17.056 1.00 139.78 ? 182  GLN A O     1 
ATOM   4948  C  CB    . GLN I  4 182  ? 51.452  8.176    -15.622 1.00 140.04 ? 182  GLN A CB    1 
ATOM   4949  C  CG    . GLN I  4 182  ? 50.761  6.836    -15.806 1.00 140.26 ? 182  GLN A CG    1 
ATOM   4950  C  CD    . GLN I  4 182  ? 49.645  6.655    -14.827 1.00 137.29 ? 182  GLN A CD    1 
ATOM   4951  O  OE1   . GLN I  4 182  ? 48.868  7.577    -14.578 1.00 134.63 ? 182  GLN A OE1   1 
ATOM   4952  N  NE2   . GLN I  4 182  ? 49.565  5.467    -14.251 1.00 146.38 ? 182  GLN A NE2   1 
ATOM   4953  N  N     . ASN I  4 183  ? 54.717  7.892    -15.786 1.00 130.03 ? 183  ASN A N     1 
ATOM   4954  C  CA    . ASN I  4 183  ? 55.926  7.112    -15.691 1.00 132.92 ? 183  ASN A CA    1 
ATOM   4955  C  C     . ASN I  4 183  ? 56.370  6.997    -14.233 1.00 136.06 ? 183  ASN A C     1 
ATOM   4956  O  O     . ASN I  4 183  ? 56.583  7.993    -13.546 1.00 141.65 ? 183  ASN A O     1 
ATOM   4957  C  CB    . ASN I  4 183  ? 57.016  7.745    -16.577 1.00 133.70 ? 183  ASN A CB    1 
ATOM   4958  C  CG    . ASN I  4 183  ? 58.273  6.888    -16.689 1.00 130.63 ? 183  ASN A CG    1 
ATOM   4959  O  OD1   . ASN I  4 183  ? 58.919  6.606    -15.704 1.00 127.14 ? 183  ASN A OD1   1 
ATOM   4960  N  ND2   . ASN I  4 183  ? 58.634  6.511    -17.901 1.00 144.26 ? 183  ASN A ND2   1 
ATOM   4961  N  N     . HIS I  4 184  ? 56.469  5.759    -13.771 1.00 139.87 ? 184  HIS A N     1 
ATOM   4962  C  CA    . HIS I  4 184  ? 57.191  5.416    -12.556 1.00 142.82 ? 184  HIS A CA    1 
ATOM   4963  C  C     . HIS I  4 184  ? 58.333  4.496    -12.920 1.00 149.40 ? 184  HIS A C     1 
ATOM   4964  O  O     . HIS I  4 184  ? 58.695  4.386    -14.089 1.00 165.05 ? 184  HIS A O     1 
ATOM   4965  C  CB    . HIS I  4 184  ? 56.239  4.740    -11.595 1.00 144.26 ? 184  HIS A CB    1 
ATOM   4966  C  CG    . HIS I  4 184  ? 54.912  5.445    -11.462 1.00 145.24 ? 184  HIS A CG    1 
ATOM   4967  N  ND1   . HIS I  4 184  ? 53.778  4.958    -11.998 1.00 149.24 ? 184  HIS A ND1   1 
ATOM   4968  C  CD2   . HIS I  4 184  ? 54.567  6.633    -10.828 1.00 139.10 ? 184  HIS A CD2   1 
ATOM   4969  C  CE1   . HIS I  4 184  ? 52.757  5.793    -11.720 1.00 136.55 ? 184  HIS A CE1   1 
ATOM   4970  N  NE2   . HIS I  4 184  ? 53.241  6.817    -11.009 1.00 132.13 ? 184  HIS A NE2   1 
ATOM   4971  N  N     . GLY I  4 185  ? 58.920  3.810    -11.948 1.00 152.23 ? 185  GLY A N     1 
ATOM   4972  C  CA    . GLY I  4 185  ? 59.987  2.836    -12.251 1.00 162.71 ? 185  GLY A CA    1 
ATOM   4973  C  C     . GLY I  4 185  ? 59.526  1.459    -12.740 1.00 162.84 ? 185  GLY A C     1 
ATOM   4974  O  O     . GLY I  4 185  ? 59.923  0.420    -12.171 1.00 174.52 ? 185  GLY A O     1 
ATOM   4975  N  N     . LEU I  4 186  ? 58.733  1.439    -13.814 1.00 142.99 ? 186  LEU A N     1 
ATOM   4976  C  CA    . LEU I  4 186  ? 58.047  0.223    -14.255 1.00 142.71 ? 186  LEU A CA    1 
ATOM   4977  C  C     . LEU I  4 186  ? 58.318  -0.087   -15.719 1.00 147.14 ? 186  LEU A C     1 
ATOM   4978  O  O     . LEU I  4 186  ? 58.096  0.774    -16.581 1.00 157.94 ? 186  LEU A O     1 
ATOM   4979  C  CB    . LEU I  4 186  ? 56.532  0.363    -14.111 1.00 133.97 ? 186  LEU A CB    1 
ATOM   4980  C  CG    . LEU I  4 186  ? 55.902  0.603    -12.752 1.00 131.63 ? 186  LEU A CG    1 
ATOM   4981  C  CD1   . LEU I  4 186  ? 54.401  0.773    -12.947 1.00 128.44 ? 186  LEU A CD1   1 
ATOM   4982  C  CD2   . LEU I  4 186  ? 56.211  -0.540   -11.801 1.00 128.91 ? 186  LEU A CD2   1 
ATOM   4983  N  N     . PRO I  4 187  ? 58.731  -1.334   -16.019 1.00 145.37 ? 187  PRO A N     1 
ATOM   4984  C  CA    . PRO I  4 187  ? 59.040  -1.720   -17.398 1.00 151.58 ? 187  PRO A CA    1 
ATOM   4985  C  C     . PRO I  4 187  ? 57.821  -1.830   -18.315 1.00 154.24 ? 187  PRO A C     1 
ATOM   4986  O  O     . PRO I  4 187  ? 57.965  -1.760   -19.545 1.00 159.91 ? 187  PRO A O     1 
ATOM   4987  C  CB    . PRO I  4 187  ? 59.689  -3.089   -17.233 1.00 153.43 ? 187  PRO A CB    1 
ATOM   4988  C  CG    . PRO I  4 187  ? 59.056  -3.636   -16.004 1.00 150.05 ? 187  PRO A CG    1 
ATOM   4989  C  CD    . PRO I  4 187  ? 58.905  -2.464   -15.090 1.00 145.55 ? 187  PRO A CD    1 
ATOM   4990  N  N     . GLU I  4 188  ? 56.641  -2.013   -17.729 1.00 148.37 ? 188  GLU A N     1 
ATOM   4991  C  CA    . GLU I  4 188  ? 55.414  -2.114   -18.512 1.00 147.55 ? 188  GLU A CA    1 
ATOM   4992  C  C     . GLU I  4 188  ? 55.021  -0.764   -19.107 1.00 142.39 ? 188  GLU A C     1 
ATOM   4993  O  O     . GLU I  4 188  ? 54.417  -0.711   -20.180 1.00 141.36 ? 188  GLU A O     1 
ATOM   4994  C  CB    . GLU I  4 188  ? 54.259  -2.650   -17.664 1.00 148.41 ? 188  GLU A CB    1 
ATOM   4995  C  CG    . GLU I  4 188  ? 54.420  -4.096   -17.215 1.00 145.70 ? 188  GLU A CG    1 
ATOM   4996  C  CD    . GLU I  4 188  ? 55.096  -4.231   -15.875 1.00 143.26 ? 188  GLU A CD    1 
ATOM   4997  O  OE1   . GLU I  4 188  ? 55.649  -3.242   -15.382 1.00 155.28 ? 188  GLU A OE1   1 
ATOM   4998  O  OE2   . GLU I  4 188  ? 55.073  -5.328   -15.299 1.00 153.32 ? 188  GLU A OE2   1 
ATOM   4999  N  N     . GLN I  4 189  ? 55.361  0.318    -18.409 1.00 138.89 ? 189  GLN A N     1 
ATOM   5000  C  CA    . GLN I  4 189  ? 55.048  1.671    -18.886 1.00 144.10 ? 189  GLN A CA    1 
ATOM   5001  C  C     . GLN I  4 189  ? 55.874  2.086    -20.106 1.00 147.23 ? 189  GLN A C     1 
ATOM   5002  O  O     . GLN I  4 189  ? 55.402  2.857    -20.938 1.00 142.39 ? 189  GLN A O     1 
ATOM   5003  C  CB    . GLN I  4 189  ? 55.198  2.706    -17.760 1.00 143.42 ? 189  GLN A CB    1 
ATOM   5004  C  CG    . GLN I  4 189  ? 54.011  2.698    -16.793 1.00 147.38 ? 189  GLN A CG    1 
ATOM   5005  C  CD    . GLN I  4 189  ? 54.225  3.519    -15.529 1.00 142.34 ? 189  GLN A CD    1 
ATOM   5006  O  OE1   . GLN I  4 189  ? 55.345  3.721    -15.083 1.00 147.88 ? 189  GLN A OE1   1 
ATOM   5007  N  NE2   . GLN I  4 189  ? 53.139  3.980    -14.938 1.00 146.91 ? 189  GLN A NE2   1 
ATOM   5008  N  N     . LYS I  4 190  ? 57.098  1.572    -20.215 1.00 155.07 ? 190  LYS A N     1 
ATOM   5009  C  CA    . LYS I  4 190  ? 57.943  1.836    -21.385 1.00 155.26 ? 190  LYS A CA    1 
ATOM   5010  C  C     . LYS I  4 190  ? 57.365  1.272    -22.684 1.00 154.61 ? 190  LYS A C     1 
ATOM   5011  O  O     . LYS I  4 190  ? 57.419  1.925    -23.722 1.00 159.34 ? 190  LYS A O     1 
ATOM   5012  C  CB    . LYS I  4 190  ? 59.345  1.276    -21.183 1.00 165.60 ? 190  LYS A CB    1 
ATOM   5013  C  CG    . LYS I  4 190  ? 60.237  2.151    -20.313 1.00 184.75 ? 190  LYS A CG    1 
ATOM   5014  C  CD    . LYS I  4 190  ? 61.708  2.032    -20.720 1.00 193.01 ? 190  LYS A CD    1 
ATOM   5015  C  CE    . LYS I  4 190  ? 62.628  2.889    -19.851 1.00 192.87 ? 190  LYS A CE    1 
ATOM   5016  N  NZ    . LYS I  4 190  ? 62.800  2.346    -18.470 1.00 190.09 ? 190  LYS A NZ    1 
ATOM   5017  N  N     . LYS I  4 191  ? 56.836  0.053    -22.634 1.00 151.56 ? 191  LYS A N     1 
ATOM   5018  C  CA    . LYS I  4 191  ? 56.180  -0.542   -23.800 1.00 149.10 ? 191  LYS A CA    1 
ATOM   5019  C  C     . LYS I  4 191  ? 54.868  0.155    -24.128 1.00 148.20 ? 191  LYS A C     1 
ATOM   5020  O  O     . LYS I  4 191  ? 54.550  0.362    -25.299 1.00 152.44 ? 191  LYS A O     1 
ATOM   5021  C  CB    . LYS I  4 191  ? 55.894  -2.018   -23.566 1.00 152.20 ? 191  LYS A CB    1 
ATOM   5022  C  CG    . LYS I  4 191  ? 55.268  -2.718   -24.764 1.00 155.82 ? 191  LYS A CG    1 
ATOM   5023  C  CD    . LYS I  4 191  ? 54.987  -4.177   -24.454 1.00 165.67 ? 191  LYS A CD    1 
ATOM   5024  C  CE    . LYS I  4 191  ? 54.433  -4.892   -25.678 1.00 171.42 ? 191  LYS A CE    1 
ATOM   5025  N  NZ    . LYS I  4 191  ? 54.340  -6.375   -25.532 1.00 176.83 ? 191  LYS A NZ    1 
ATOM   5026  N  N     . VAL I  4 192  ? 54.098  0.494    -23.098 1.00 143.73 ? 192  VAL A N     1 
ATOM   5027  C  CA    . VAL I  4 192  ? 52.814  1.165    -23.300 1.00 143.75 ? 192  VAL A CA    1 
ATOM   5028  C  C     . VAL I  4 192  ? 53.019  2.609    -23.799 1.00 139.33 ? 192  VAL A C     1 
ATOM   5029  O  O     . VAL I  4 192  ? 52.585  2.944    -24.903 1.00 137.30 ? 192  VAL A O     1 
ATOM   5030  C  CB    . VAL I  4 192  ? 51.932  1.075    -22.040 1.00 136.00 ? 192  VAL A CB    1 
ATOM   5031  C  CG1   . VAL I  4 192  ? 50.656  1.882    -22.211 1.00 128.53 ? 192  VAL A CG1   1 
ATOM   5032  C  CG2   . VAL I  4 192  ? 51.612  -0.387   -21.788 1.00 128.88 ? 192  VAL A CG2   1 
ATOM   5033  N  N     . ASN I  4 193  ? 53.735  3.430    -23.034 1.00 133.84 ? 193  ASN A N     1 
ATOM   5034  C  CA    . ASN I  4 193  ? 53.970  4.829    -23.426 1.00 136.68 ? 193  ASN A CA    1 
ATOM   5035  C  C     . ASN I  4 193  ? 54.593  4.996    -24.822 1.00 143.79 ? 193  ASN A C     1 
ATOM   5036  O  O     . ASN I  4 193  ? 54.333  5.995    -25.489 1.00 146.79 ? 193  ASN A O     1 
ATOM   5037  C  CB    . ASN I  4 193  ? 54.822  5.551    -22.378 1.00 134.34 ? 193  ASN A CB    1 
ATOM   5038  C  CG    . ASN I  4 193  ? 54.125  5.651    -21.026 1.00 131.93 ? 193  ASN A CG    1 
ATOM   5039  O  OD1   . ASN I  4 193  ? 52.948  5.339    -20.904 1.00 139.03 ? 193  ASN A OD1   1 
ATOM   5040  N  ND2   . ASN I  4 193  ? 54.858  6.070    -20.005 1.00 122.61 ? 193  ASN A ND2   1 
ATOM   5041  N  N     . GLN I  4 194  ? 55.389  4.012    -25.254 1.00 149.32 ? 194  GLN A N     1 
ATOM   5042  C  CA    . GLN I  4 194  ? 55.955  3.957    -26.606 1.00 139.84 ? 194  GLN A CA    1 
ATOM   5043  C  C     . GLN I  4 194  ? 54.875  3.782    -27.656 1.00 131.45 ? 194  GLN A C     1 
ATOM   5044  O  O     . GLN I  4 194  ? 54.872  4.501    -28.650 1.00 121.70 ? 194  GLN A O     1 
ATOM   5045  C  CB    . GLN I  4 194  ? 56.938  2.782    -26.725 1.00 149.81 ? 194  GLN A CB    1 
ATOM   5046  C  CG    . GLN I  4 194  ? 57.602  2.656    -28.096 1.00 158.95 ? 194  GLN A CG    1 
ATOM   5047  C  CD    . GLN I  4 194  ? 58.429  1.394    -28.253 1.00 153.64 ? 194  GLN A CD    1 
ATOM   5048  O  OE1   . GLN I  4 194  ? 58.522  0.849    -29.354 1.00 150.46 ? 194  GLN A OE1   1 
ATOM   5049  N  NE2   . GLN I  4 194  ? 59.036  0.928    -27.159 1.00 147.24 ? 194  GLN A NE2   1 
ATOM   5050  N  N     . VAL I  4 195  ? 53.991  2.803    -27.438 1.00 132.43 ? 195  VAL A N     1 
ATOM   5051  C  CA    . VAL I  4 195  ? 52.898  2.490    -28.376 1.00 129.65 ? 195  VAL A CA    1 
ATOM   5052  C  C     . VAL I  4 195  ? 51.815  3.564    -28.312 1.00 126.92 ? 195  VAL A C     1 
ATOM   5053  O  O     . VAL I  4 195  ? 51.150  3.819    -29.306 1.00 122.49 ? 195  VAL A O     1 
ATOM   5054  C  CB    . VAL I  4 195  ? 52.243  1.118    -28.089 1.00 127.08 ? 195  VAL A CB    1 
ATOM   5055  C  CG1   . VAL I  4 195  ? 51.190  0.802    -29.132 1.00 126.09 ? 195  VAL A CG1   1 
ATOM   5056  C  CG2   . VAL I  4 195  ? 53.265  0.002    -28.063 1.00 124.77 ? 195  VAL A CG2   1 
ATOM   5057  N  N     . LEU I  4 196  ? 51.646  4.179    -27.139 1.00 128.06 ? 196  LEU A N     1 
ATOM   5058  C  CA    . LEU I  4 196  ? 50.714  5.314    -26.960 1.00 128.27 ? 196  LEU A CA    1 
ATOM   5059  C  C     . LEU I  4 196  ? 51.241  6.569    -27.636 1.00 126.02 ? 196  LEU A C     1 
ATOM   5060  O  O     . LEU I  4 196  ? 50.477  7.397    -28.111 1.00 132.05 ? 196  LEU A O     1 
ATOM   5061  C  CB    . LEU I  4 196  ? 50.444  5.617    -25.469 1.00 123.76 ? 196  LEU A CB    1 
ATOM   5062  C  CG    . LEU I  4 196  ? 49.532  4.639    -24.723 1.00 116.01 ? 196  LEU A CG    1 
ATOM   5063  C  CD1   . LEU I  4 196  ? 49.673  4.852    -23.237 1.00 115.51 ? 196  LEU A CD1   1 
ATOM   5064  C  CD2   . LEU I  4 196  ? 48.088  4.758    -25.168 1.00 114.75 ? 196  LEU A CD2   1 
ATOM   5065  N  N     . LYS I  4 197  ? 52.549  6.715    -27.680 1.00 126.74 ? 197  LYS A N     1 
ATOM   5066  C  CA    . LYS I  4 197  ? 53.148  7.843    -28.392 1.00 137.36 ? 197  LYS A CA    1 
ATOM   5067  C  C     . LYS I  4 197  ? 52.906  7.793    -29.917 1.00 137.64 ? 197  LYS A C     1 
ATOM   5068  O  O     . LYS I  4 197  ? 52.771  8.831    -30.572 1.00 123.68 ? 197  LYS A O     1 
ATOM   5069  C  CB    . LYS I  4 197  ? 54.645  7.881    -28.094 1.00 143.12 ? 197  LYS A CB    1 
ATOM   5070  C  CG    . LYS I  4 197  ? 55.331  9.162    -28.502 1.00 145.90 ? 197  LYS A CG    1 
ATOM   5071  C  CD    . LYS I  4 197  ? 56.690  9.295    -27.835 1.00 150.08 ? 197  LYS A CD    1 
ATOM   5072  C  CE    . LYS I  4 197  ? 57.698  8.288    -28.358 1.00 152.44 ? 197  LYS A CE    1 
ATOM   5073  N  NZ    . LYS I  4 197  ? 59.002  8.467    -27.663 1.00 150.81 ? 197  LYS A NZ    1 
ATOM   5074  N  N     . GLU I  4 198  ? 52.865  6.582    -30.468 1.00 143.55 ? 198  GLU A N     1 
ATOM   5075  C  CA    . GLU I  4 198  ? 52.557  6.378    -31.875 1.00 143.11 ? 198  GLU A CA    1 
ATOM   5076  C  C     . GLU I  4 198  ? 51.090  6.697    -32.131 1.00 143.07 ? 198  GLU A C     1 
ATOM   5077  O  O     . GLU I  4 198  ? 50.781  7.457    -33.051 1.00 137.10 ? 198  GLU A O     1 
ATOM   5078  C  CB    . GLU I  4 198  ? 52.875  4.936    -32.283 1.00 155.21 ? 198  GLU A CB    1 
ATOM   5079  C  CG    . GLU I  4 198  ? 54.356  4.574    -32.163 1.00 166.74 ? 198  GLU A CG    1 
ATOM   5080  C  CD    . GLU I  4 198  ? 54.664  3.100    -32.432 1.00 170.90 ? 198  GLU A CD    1 
ATOM   5081  O  OE1   . GLU I  4 198  ? 53.943  2.484    -33.253 1.00 182.66 ? 198  GLU A OE1   1 
ATOM   5082  O  OE2   . GLU I  4 198  ? 55.637  2.566    -31.832 1.00 159.36 ? 198  GLU A OE2   1 
ATOM   5083  N  N     . PHE I  4 199  ? 50.201  6.119    -31.309 1.00 145.34 ? 199  PHE A N     1 
ATOM   5084  C  CA    . PHE I  4 199  ? 48.751  6.358    -31.406 1.00 141.37 ? 199  PHE A CA    1 
ATOM   5085  C  C     . PHE I  4 199  ? 48.492  7.861    -31.223 1.00 132.98 ? 199  PHE A C     1 
ATOM   5086  O  O     . PHE I  4 199  ? 47.720  8.467    -31.969 1.00 129.67 ? 199  PHE A O     1 
ATOM   5087  C  CB    . PHE I  4 199  ? 47.928  5.542    -30.354 1.00 143.53 ? 199  PHE A CB    1 
ATOM   5088  C  CG    . PHE I  4 199  ? 47.779  4.060    -30.660 1.00 137.75 ? 199  PHE A CG    1 
ATOM   5089  C  CD1   . PHE I  4 199  ? 48.024  3.119    -29.684 1.00 135.81 ? 199  PHE A CD1   1 
ATOM   5090  C  CD2   . PHE I  4 199  ? 47.365  3.615    -31.908 1.00 141.60 ? 199  PHE A CD2   1 
ATOM   5091  C  CE1   . PHE I  4 199  ? 47.892  1.767    -29.951 1.00 144.67 ? 199  PHE A CE1   1 
ATOM   5092  C  CE2   . PHE I  4 199  ? 47.224  2.260    -32.176 1.00 141.63 ? 199  PHE A CE2   1 
ATOM   5093  C  CZ    . PHE I  4 199  ? 47.492  1.332    -31.196 1.00 141.03 ? 199  PHE A CZ    1 
ATOM   5094  N  N     . ALA I  4 200  ? 49.151  8.459    -30.237 1.00 128.31 ? 200  ALA A N     1 
ATOM   5095  C  CA    . ALA I  4 200  ? 49.001  9.892    -29.970 1.00 128.83 ? 200  ALA A CA    1 
ATOM   5096  C  C     . ALA I  4 200  ? 49.323  10.680   -31.206 1.00 132.44 ? 200  ALA A C     1 
ATOM   5097  O  O     . ALA I  4 200  ? 48.617  11.623   -31.517 1.00 137.11 ? 200  ALA A O     1 
ATOM   5098  C  CB    . ALA I  4 200  ? 49.906  10.349   -28.832 1.00 124.68 ? 200  ALA A CB    1 
ATOM   5099  N  N     . ARG I  4 201  ? 50.398  10.280   -31.897 1.00 140.47 ? 201  ARG A N     1 
ATOM   5100  C  CA    . ARG I  4 201  ? 50.884  10.968   -33.102 1.00 132.96 ? 201  ARG A CA    1 
ATOM   5101  C  C     . ARG I  4 201  ? 50.070  10.652   -34.373 1.00 133.70 ? 201  ARG A C     1 
ATOM   5102  O  O     . ARG I  4 201  ? 49.964  11.503   -35.273 1.00 124.20 ? 201  ARG A O     1 
ATOM   5103  C  CB    . ARG I  4 201  ? 52.356  10.654   -33.340 1.00 137.23 ? 201  ARG A CB    1 
ATOM   5104  C  CG    . ARG I  4 201  ? 53.289  11.417   -32.423 1.00 145.28 ? 201  ARG A CG    1 
ATOM   5105  C  CD    . ARG I  4 201  ? 54.740  10.966   -32.563 1.00 152.69 ? 201  ARG A CD    1 
ATOM   5106  N  NE    . ARG I  4 201  ? 55.570  11.527   -31.494 1.00 154.49 ? 201  ARG A NE    1 
ATOM   5107  C  CZ    . ARG I  4 201  ? 56.834  11.188   -31.246 1.00 159.74 ? 201  ARG A CZ    1 
ATOM   5108  N  NH1   . ARG I  4 201  ? 57.453  10.279   -31.994 1.00 171.35 ? 201  ARG A NH1   1 
ATOM   5109  N  NH2   . ARG I  4 201  ? 57.489  11.761   -30.238 1.00 158.21 ? 201  ARG A NH2   1 
ATOM   5110  N  N     . LYS I  4 202  ? 49.480  9.455    -34.440 1.00 125.58 ? 202  LYS A N     1 
ATOM   5111  C  CA    . LYS I  4 202  ? 48.764  9.027    -35.641 1.00 120.73 ? 202  LYS A CA    1 
ATOM   5112  C  C     . LYS I  4 202  ? 47.411  9.719    -35.863 1.00 123.08 ? 202  LYS A C     1 
ATOM   5113  O  O     . LYS I  4 202  ? 47.037  9.980    -37.024 1.00 114.33 ? 202  LYS A O     1 
ATOM   5114  C  CB    . LYS I  4 202  ? 48.578  7.508    -35.622 1.00 122.71 ? 202  LYS A CB    1 
ATOM   5115  C  CG    . LYS I  4 202  ? 48.038  6.907    -36.922 1.00 120.14 ? 202  LYS A CG    1 
ATOM   5116  C  CD    . LYS I  4 202  ? 48.041  5.382    -36.872 1.00 121.46 ? 202  LYS A CD    1 
ATOM   5117  C  CE    . LYS I  4 202  ? 47.285  4.786    -38.056 1.00 127.00 ? 202  LYS A CE    1 
ATOM   5118  N  NZ    . LYS I  4 202  ? 47.263  3.292    -38.157 1.00 124.79 ? 202  LYS A NZ    1 
ATOM   5119  N  N     . TYR I  4 203  ? 46.700  10.019   -34.765 1.00 123.34 ? 203  TYR A N     1 
ATOM   5120  C  CA    . TYR I  4 203  ? 45.301  10.450   -34.837 1.00 122.95 ? 203  TYR A CA    1 
ATOM   5121  C  C     . TYR I  4 203  ? 45.006  11.911   -34.491 1.00 125.88 ? 203  TYR A C     1 
ATOM   5122  O  O     . TYR I  4 203  ? 43.820  12.302   -34.355 1.00 131.81 ? 203  TYR A O     1 
ATOM   5123  C  CB    . TYR I  4 203  ? 44.462  9.536    -33.966 1.00 124.69 ? 203  TYR A CB    1 
ATOM   5124  C  CG    . TYR I  4 203  ? 44.209  8.181    -34.590 1.00 124.18 ? 203  TYR A CG    1 
ATOM   5125  C  CD1   . TYR I  4 203  ? 45.042  7.113    -34.330 1.00 124.98 ? 203  TYR A CD1   1 
ATOM   5126  C  CD2   . TYR I  4 203  ? 43.111  7.968    -35.413 1.00 120.60 ? 203  TYR A CD2   1 
ATOM   5127  C  CE1   . TYR I  4 203  ? 44.792  5.870    -34.880 1.00 130.27 ? 203  TYR A CE1   1 
ATOM   5128  C  CE2   . TYR I  4 203  ? 42.860  6.735    -35.968 1.00 119.69 ? 203  TYR A CE2   1 
ATOM   5129  C  CZ    . TYR I  4 203  ? 43.701  5.686    -35.706 1.00 125.93 ? 203  TYR A CZ    1 
ATOM   5130  O  OH    . TYR I  4 203  ? 43.456  4.444    -36.265 1.00 133.17 ? 203  TYR A OH    1 
ATOM   5131  N  N     . GLY I  4 204  ? 46.070  12.714   -34.421 1.00 123.12 ? 204  GLY A N     1 
ATOM   5132  C  CA    . GLY I  4 204  ? 45.972  14.143   -34.127 1.00 130.29 ? 204  GLY A CA    1 
ATOM   5133  C  C     . GLY I  4 204  ? 45.406  14.461   -32.769 1.00 134.19 ? 204  GLY A C     1 
ATOM   5134  O  O     . GLY I  4 204  ? 44.665  15.436   -32.624 1.00 144.62 ? 204  GLY A O     1 
ATOM   5135  N  N     . LEU I  4 205  ? 45.740  13.642   -31.773 1.00 133.69 ? 205  LEU A N     1 
ATOM   5136  C  CA    . LEU I  4 205  ? 45.060  13.710   -30.475 1.00 137.40 ? 205  LEU A CA    1 
ATOM   5137  C  C     . LEU I  4 205  ? 45.725  14.695   -29.495 1.00 142.56 ? 205  LEU A C     1 
ATOM   5138  O  O     . LEU I  4 205  ? 45.257  15.820   -29.334 1.00 179.86 ? 205  LEU A O     1 
ATOM   5139  C  CB    . LEU I  4 205  ? 44.915  12.312   -29.865 1.00 129.76 ? 205  LEU A CB    1 
ATOM   5140  C  CG    . LEU I  4 205  ? 44.197  11.297   -30.758 1.00 128.01 ? 205  LEU A CG    1 
ATOM   5141  C  CD1   . LEU I  4 205  ? 44.125  9.935    -30.087 1.00 132.52 ? 205  LEU A CD1   1 
ATOM   5142  C  CD2   . LEU I  4 205  ? 42.809  11.788   -31.120 1.00 119.84 ? 205  LEU A CD2   1 
ATOM   5143  N  N     . GLY I  4 206  ? 46.805  14.302   -28.850 1.00 127.80 ? 206  GLY A N     1 
ATOM   5144  C  CA    . GLY I  4 206  ? 47.396  15.138   -27.812 1.00 122.69 ? 206  GLY A CA    1 
ATOM   5145  C  C     . GLY I  4 206  ? 47.832  14.276   -26.644 1.00 124.05 ? 206  GLY A C     1 
ATOM   5146  O  O     . GLY I  4 206  ? 47.310  13.188   -26.440 1.00 133.23 ? 206  GLY A O     1 
ATOM   5147  N  N     . MET I  4 207  ? 48.802  14.752   -25.877 1.00 123.48 ? 207  MET A N     1 
ATOM   5148  C  CA    . MET I  4 207  ? 49.361  13.976   -24.773 1.00 131.68 ? 207  MET A CA    1 
ATOM   5149  C  C     . MET I  4 207  ? 49.380  14.789   -23.476 1.00 128.66 ? 207  MET A C     1 
ATOM   5150  O  O     . MET I  4 207  ? 49.817  15.934   -23.459 1.00 122.46 ? 207  MET A O     1 
ATOM   5151  C  CB    . MET I  4 207  ? 50.789  13.527   -25.105 1.00 140.75 ? 207  MET A CB    1 
ATOM   5152  C  CG    . MET I  4 207  ? 50.907  12.411   -26.138 1.00 143.99 ? 207  MET A CG    1 
ATOM   5153  S  SD    . MET I  4 207  ? 52.484  12.409   -27.027 1.00 149.43 ? 207  MET A SD    1 
ATOM   5154  C  CE    . MET I  4 207  ? 53.642  12.642   -25.697 1.00 143.05 ? 207  MET A CE    1 
ATOM   5155  N  N     . VAL I  4 208  ? 48.926  14.163   -22.391 1.00 129.38 ? 208  VAL A N     1 
ATOM   5156  C  CA    . VAL I  4 208  ? 48.812  14.816   -21.090 1.00 131.20 ? 208  VAL A CA    1 
ATOM   5157  C  C     . VAL I  4 208  ? 49.542  14.043   -20.003 1.00 135.06 ? 208  VAL A C     1 
ATOM   5158  O  O     . VAL I  4 208  ? 49.340  12.838   -19.838 1.00 144.61 ? 208  VAL A O     1 
ATOM   5159  C  CB    . VAL I  4 208  ? 47.354  14.922   -20.624 1.00 128.45 ? 208  VAL A CB    1 
ATOM   5160  C  CG1   . VAL I  4 208  ? 47.303  15.658   -19.301 1.00 127.98 ? 208  VAL A CG1   1 
ATOM   5161  C  CG2   . VAL I  4 208  ? 46.501  15.623   -21.667 1.00 133.45 ? 208  VAL A CG2   1 
ATOM   5162  N  N     . ALA I  4 209  ? 50.346  14.760   -19.225 1.00 134.11 ? 209  ALA A N     1 
ATOM   5163  C  CA    . ALA I  4 209  ? 51.180  14.144   -18.193 1.00 132.32 ? 209  ALA A CA    1 
ATOM   5164  C  C     . ALA I  4 209  ? 50.456  14.017   -16.845 1.00 130.10 ? 209  ALA A C     1 
ATOM   5165  O  O     . ALA I  4 209  ? 49.867  14.985   -16.328 1.00 126.98 ? 209  ALA A O     1 
ATOM   5166  C  CB    . ALA I  4 209  ? 52.477  14.935   -18.026 1.00 130.25 ? 209  ALA A CB    1 
ATOM   5167  N  N     . THR I  4 210  ? 50.500  12.815   -16.278 1.00 128.74 ? 210  THR A N     1 
ATOM   5168  C  CA    . THR I  4 210  ? 49.954  12.576   -14.934 1.00 133.96 ? 210  THR A CA    1 
ATOM   5169  C  C     . THR I  4 210  ? 50.870  11.636   -14.145 1.00 138.90 ? 210  THR A C     1 
ATOM   5170  O  O     . THR I  4 210  ? 51.877  11.141   -14.683 1.00 133.98 ? 210  THR A O     1 
ATOM   5171  C  CB    . THR I  4 210  ? 48.491  12.022   -14.950 1.00 129.39 ? 210  THR A CB    1 
ATOM   5172  O  OG1   . THR I  4 210  ? 48.439  10.726   -15.560 1.00 124.16 ? 210  THR A OG1   1 
ATOM   5173  C  CG2   . THR I  4 210  ? 47.539  12.980   -15.672 1.00 120.20 ? 210  THR A CG2   1 
ATOM   5174  N  N     . ASN I  4 211  ? 50.527  11.432   -12.866 1.00 142.62 ? 211  ASN A N     1 
ATOM   5175  C  CA    . ASN I  4 211  ? 51.284  10.549   -11.965 1.00 142.55 ? 211  ASN A CA    1 
ATOM   5176  C  C     . ASN I  4 211  ? 50.456  9.564    -11.138 1.00 136.96 ? 211  ASN A C     1 
ATOM   5177  O  O     . ASN I  4 211  ? 51.018  8.681    -10.508 1.00 144.05 ? 211  ASN A O     1 
ATOM   5178  C  CB    . ASN I  4 211  ? 52.110  11.390   -11.003 1.00 142.54 ? 211  ASN A CB    1 
ATOM   5179  C  CG    . ASN I  4 211  ? 53.283  10.641   -10.443 1.00 155.58 ? 211  ASN A CG    1 
ATOM   5180  O  OD1   . ASN I  4 211  ? 54.059  10.029   -11.187 1.00 177.82 ? 211  ASN A OD1   1 
ATOM   5181  N  ND2   . ASN I  4 211  ? 53.437  10.693   -9.126  1.00 161.41 ? 211  ASN A ND2   1 
ATOM   5182  N  N     . ASP I  4 212  ? 49.136  9.728    -11.121 1.00 136.75 ? 212  ASP A N     1 
ATOM   5183  C  CA    . ASP I  4 212  ? 48.212  8.811    -10.424 1.00 136.62 ? 212  ASP A CA    1 
ATOM   5184  C  C     . ASP I  4 212  ? 48.490  8.750    -8.933  1.00 134.71 ? 212  ASP A C     1 
ATOM   5185  O  O     . ASP I  4 212  ? 48.517  7.680    -8.339  1.00 137.77 ? 212  ASP A O     1 
ATOM   5186  C  CB    . ASP I  4 212  ? 48.246  7.399    -11.040 1.00 136.36 ? 212  ASP A CB    1 
ATOM   5187  C  CG    . ASP I  4 212  ? 46.909  6.637    -10.891 1.00 144.21 ? 212  ASP A CG    1 
ATOM   5188  O  OD1   . ASP I  4 212  ? 46.003  6.991    -10.080 1.00 137.74 ? 212  ASP A OD1   1 
ATOM   5189  O  OD2   . ASP I  4 212  ? 46.761  5.656    -11.640 1.00 153.38 ? 212  ASP A OD2   1 
ATOM   5190  N  N     . GLY I  4 213  ? 48.673  9.916    -8.328  1.00 134.71 ? 213  GLY A N     1 
ATOM   5191  C  CA    . GLY I  4 213  ? 49.077  9.984    -6.938  1.00 128.88 ? 213  GLY A CA    1 
ATOM   5192  C  C     . GLY I  4 213  ? 47.988  9.485    -6.021  1.00 122.89 ? 213  GLY A C     1 
ATOM   5193  O  O     . GLY I  4 213  ? 46.833  9.843    -6.191  1.00 128.75 ? 213  GLY A O     1 
ATOM   5194  N  N     . HIS I  4 214  ? 48.365  8.647    -5.063  1.00 123.91 ? 214  HIS A N     1 
ATOM   5195  C  CA    . HIS I  4 214  ? 47.458  8.183    -3.997  1.00 130.04 ? 214  HIS A CA    1 
ATOM   5196  C  C     . HIS I  4 214  ? 47.782  8.788    -2.630  1.00 129.17 ? 214  HIS A C     1 
ATOM   5197  O  O     . HIS I  4 214  ? 46.995  8.652    -1.682  1.00 131.42 ? 214  HIS A O     1 
ATOM   5198  C  CB    . HIS I  4 214  ? 47.476  6.655    -3.899  1.00 133.45 ? 214  HIS A CB    1 
ATOM   5199  C  CG    . HIS I  4 214  ? 46.726  5.932    -5.017  1.00 133.46 ? 214  HIS A CG    1 
ATOM   5200  N  ND1   . HIS I  4 214  ? 47.216  5.813    -6.269  1.00 127.97 ? 214  HIS A ND1   1 
ATOM   5201  C  CD2   . HIS I  4 214  ? 45.510  5.227    -5.002  1.00 139.71 ? 214  HIS A CD2   1 
ATOM   5202  C  CE1   . HIS I  4 214  ? 46.348  5.093    -7.031  1.00 127.45 ? 214  HIS A CE1   1 
ATOM   5203  N  NE2   . HIS I  4 214  ? 45.303  4.728    -6.258  1.00 127.52 ? 214  HIS A NE2   1 
ATOM   5204  N  N     . TYR I  4 215  ? 48.934  9.457    -2.514  1.00 126.82 ? 215  TYR A N     1 
ATOM   5205  C  CA    . TYR I  4 215  ? 49.319  10.174   -1.285  1.00 130.11 ? 215  TYR A CA    1 
ATOM   5206  C  C     . TYR I  4 215  ? 50.034  11.492   -1.607  1.00 130.28 ? 215  TYR A C     1 
ATOM   5207  O  O     . TYR I  4 215  ? 50.379  11.746   -2.754  1.00 122.23 ? 215  TYR A O     1 
ATOM   5208  C  CB    . TYR I  4 215  ? 50.192  9.303    -0.375  1.00 132.41 ? 215  TYR A CB    1 
ATOM   5209  C  CG    . TYR I  4 215  ? 51.124  8.359    -1.107  1.00 137.34 ? 215  TYR A CG    1 
ATOM   5210  C  CD1   . TYR I  4 215  ? 50.680  7.102    -1.523  1.00 135.80 ? 215  TYR A CD1   1 
ATOM   5211  C  CD2   . TYR I  4 215  ? 52.446  8.711    -1.379  1.00 136.20 ? 215  TYR A CD2   1 
ATOM   5212  C  CE1   . TYR I  4 215  ? 51.515  6.227    -2.195  1.00 131.62 ? 215  TYR A CE1   1 
ATOM   5213  C  CE2   . TYR I  4 215  ? 53.297  7.836    -2.043  1.00 133.92 ? 215  TYR A CE2   1 
ATOM   5214  C  CZ    . TYR I  4 215  ? 52.825  6.591    -2.454  1.00 135.18 ? 215  TYR A CZ    1 
ATOM   5215  O  OH    . TYR I  4 215  ? 53.638  5.687    -3.125  1.00 130.74 ? 215  TYR A OH    1 
ATOM   5216  N  N     . VAL I  4 216  ? 50.237  12.329   -0.588  1.00 138.29 ? 216  VAL A N     1 
ATOM   5217  C  CA    . VAL I  4 216  ? 50.718  13.707   -0.786  1.00 136.33 ? 216  VAL A CA    1 
ATOM   5218  C  C     . VAL I  4 216  ? 52.206  13.742   -1.127  1.00 129.84 ? 216  VAL A C     1 
ATOM   5219  O  O     . VAL I  4 216  ? 52.589  14.057   -2.248  1.00 115.95 ? 216  VAL A O     1 
ATOM   5220  C  CB    . VAL I  4 216  ? 50.453  14.593   0.458   1.00 137.40 ? 216  VAL A CB    1 
ATOM   5221  C  CG1   . VAL I  4 216  ? 51.091  15.965   0.286   1.00 132.21 ? 216  VAL A CG1   1 
ATOM   5222  C  CG2   . VAL I  4 216  ? 48.960  14.718   0.721   1.00 140.89 ? 216  VAL A CG2   1 
ATOM   5223  N  N     . ARG I  4 217  ? 53.033  13.403   -0.147  1.00 136.72 ? 217  ARG A N     1 
ATOM   5224  C  CA    . ARG I  4 217  ? 54.475  13.482   -0.285  1.00 141.40 ? 217  ARG A CA    1 
ATOM   5225  C  C     . ARG I  4 217  ? 55.123  12.108   -0.359  1.00 142.97 ? 217  ARG A C     1 
ATOM   5226  O  O     . ARG I  4 217  ? 54.532  11.102   0.022   1.00 149.00 ? 217  ARG A O     1 
ATOM   5227  C  CB    . ARG I  4 217  ? 55.061  14.257   0.894   1.00 147.28 ? 217  ARG A CB    1 
ATOM   5228  C  CG    . ARG I  4 217  ? 54.617  15.718   0.948   1.00 156.19 ? 217  ARG A CG    1 
ATOM   5229  C  CD    . ARG I  4 217  ? 55.548  16.579   1.804   1.00 163.06 ? 217  ARG A CD    1 
ATOM   5230  N  NE    . ARG I  4 217  ? 55.379  16.337   3.238   1.00 171.92 ? 217  ARG A NE    1 
ATOM   5231  C  CZ    . ARG I  4 217  ? 56.074  16.938   4.206   1.00 175.02 ? 217  ARG A CZ    1 
ATOM   5232  N  NH1   . ARG I  4 217  ? 57.011  17.830   3.919   1.00 178.54 ? 217  ARG A NH1   1 
ATOM   5233  N  NH2   . ARG I  4 217  ? 55.830  16.642   5.477   1.00 183.74 ? 217  ARG A NH2   1 
ATOM   5234  N  N     . LYS I  4 218  ? 56.364  12.084   -0.828  1.00 145.87 ? 218  LYS A N     1 
ATOM   5235  C  CA    . LYS I  4 218  ? 57.130  10.849   -0.941  1.00 147.48 ? 218  LYS A CA    1 
ATOM   5236  C  C     . LYS I  4 218  ? 57.276  10.115   0.404   1.00 147.28 ? 218  LYS A C     1 
ATOM   5237  O  O     . LYS I  4 218  ? 57.366  8.894    0.447   1.00 156.29 ? 218  LYS A O     1 
ATOM   5238  C  CB    . LYS I  4 218  ? 58.510  11.140   -1.545  1.00 150.61 ? 218  LYS A CB    1 
ATOM   5239  C  CG    . LYS I  4 218  ? 59.317  9.894    -1.918  1.00 152.25 ? 218  LYS A CG    1 
ATOM   5240  C  CD    . LYS I  4 218  ? 60.641  10.275   -2.558  1.00 152.38 ? 218  LYS A CD    1 
ATOM   5241  C  CE    . LYS I  4 218  ? 61.590  9.100    -2.648  1.00 151.23 ? 218  LYS A CE    1 
ATOM   5242  N  NZ    . LYS I  4 218  ? 62.960  9.543    -3.040  1.00 157.52 ? 218  LYS A NZ    1 
ATOM   5243  N  N     . GLU I  4 219  ? 57.275  10.859   1.499   1.00 146.88 ? 219  GLU A N     1 
ATOM   5244  C  CA    . GLU I  4 219  ? 57.388  10.270   2.829   1.00 147.43 ? 219  GLU A CA    1 
ATOM   5245  C  C     . GLU I  4 219  ? 56.133  9.489    3.256   1.00 143.76 ? 219  GLU A C     1 
ATOM   5246  O  O     . GLU I  4 219  ? 56.151  8.784    4.261   1.00 136.71 ? 219  GLU A O     1 
ATOM   5247  C  CB    . GLU I  4 219  ? 57.693  11.367   3.864   1.00 153.84 ? 219  GLU A CB    1 
ATOM   5248  C  CG    . GLU I  4 219  ? 59.047  12.062   3.684   1.00 155.05 ? 219  GLU A CG    1 
ATOM   5249  C  CD    . GLU I  4 219  ? 59.017  13.263   2.731   1.00 150.47 ? 219  GLU A CD    1 
ATOM   5250  O  OE1   . GLU I  4 219  ? 59.821  14.206   2.917   1.00 154.36 ? 219  GLU A OE1   1 
ATOM   5251  O  OE2   . GLU I  4 219  ? 58.201  13.279   1.789   1.00 143.01 ? 219  GLU A OE2   1 
ATOM   5252  N  N     . ASP I  4 220  ? 55.050  9.608    2.495   1.00 142.93 ? 220  ASP A N     1 
ATOM   5253  C  CA    . ASP I  4 220  ? 53.798  8.940    2.840   1.00 145.42 ? 220  ASP A CA    1 
ATOM   5254  C  C     . ASP I  4 220  ? 53.701  7.518    2.268   1.00 148.47 ? 220  ASP A C     1 
ATOM   5255  O  O     . ASP I  4 220  ? 52.642  6.879    2.345   1.00 145.42 ? 220  ASP A O     1 
ATOM   5256  C  CB    . ASP I  4 220  ? 52.623  9.790    2.351   1.00 145.25 ? 220  ASP A CB    1 
ATOM   5257  C  CG    . ASP I  4 220  ? 52.696  11.226   2.843   1.00 143.85 ? 220  ASP A CG    1 
ATOM   5258  O  OD1   . ASP I  4 220  ? 53.658  11.562   3.554   1.00 146.63 ? 220  ASP A OD1   1 
ATOM   5259  O  OD2   . ASP I  4 220  ? 51.801  12.029   2.512   1.00 148.73 ? 220  ASP A OD2   1 
ATOM   5260  N  N     . ALA I  4 221  ? 54.805  7.026    1.705   1.00 152.89 ? 221  ALA A N     1 
ATOM   5261  C  CA    . ALA I  4 221  ? 54.828  5.715    1.060   1.00 161.79 ? 221  ALA A CA    1 
ATOM   5262  C  C     . ALA I  4 221  ? 54.377  4.613    2.030   1.00 160.59 ? 221  ALA A C     1 
ATOM   5263  O  O     . ALA I  4 221  ? 53.402  3.893    1.777   1.00 148.39 ? 221  ALA A O     1 
ATOM   5264  C  CB    . ALA I  4 221  ? 56.225  5.418    0.510   1.00 156.38 ? 221  ALA A CB    1 
ATOM   5265  N  N     . ARG I  4 222  ? 55.084  4.507    3.150   1.00 167.72 ? 222  ARG A N     1 
ATOM   5266  C  CA    . ARG I  4 222  ? 54.819  3.455    4.137   1.00 168.57 ? 222  ARG A CA    1 
ATOM   5267  C  C     . ARG I  4 222  ? 53.479  3.689    4.840   1.00 156.39 ? 222  ARG A C     1 
ATOM   5268  O  O     . ARG I  4 222  ? 52.738  2.737    5.126   1.00 152.70 ? 222  ARG A O     1 
ATOM   5269  C  CB    . ARG I  4 222  ? 55.983  3.325    5.147   1.00 174.39 ? 222  ARG A CB    1 
ATOM   5270  C  CG    . ARG I  4 222  ? 57.179  2.539    4.613   1.00 179.88 ? 222  ARG A CG    1 
ATOM   5271  C  CD    . ARG I  4 222  ? 58.051  1.996    5.732   1.00 190.04 ? 222  ARG A CD    1 
ATOM   5272  N  NE    . ARG I  4 222  ? 59.116  1.122    5.233   1.00 206.03 ? 222  ARG A NE    1 
ATOM   5273  C  CZ    . ARG I  4 222  ? 60.002  0.486    6.003   1.00 213.83 ? 222  ARG A CZ    1 
ATOM   5274  N  NH1   . ARG I  4 222  ? 59.957  0.610    7.327   1.00 209.98 ? 222  ARG A NH1   1 
ATOM   5275  N  NH2   . ARG I  4 222  ? 60.937  -0.284   5.447   1.00 214.88 ? 222  ARG A NH2   1 
ATOM   5276  N  N     . ALA I  4 223  ? 53.153  4.954    5.087   1.00 145.70 ? 223  ALA A N     1 
ATOM   5277  C  CA    . ALA I  4 223  ? 51.851  5.293    5.651   1.00 139.60 ? 223  ALA A CA    1 
ATOM   5278  C  C     . ALA I  4 223  ? 50.753  4.732    4.752   1.00 136.04 ? 223  ALA A C     1 
ATOM   5279  O  O     . ALA I  4 223  ? 49.796  4.129    5.235   1.00 128.31 ? 223  ALA A O     1 
ATOM   5280  C  CB    . ALA I  4 223  ? 51.699  6.803    5.811   1.00 135.08 ? 223  ALA A CB    1 
ATOM   5281  N  N     . HIS I  4 224  ? 50.913  4.919    3.443   1.00 134.56 ? 224  HIS A N     1 
ATOM   5282  C  CA    . HIS I  4 224  ? 49.970  4.373    2.475   1.00 131.00 ? 224  HIS A CA    1 
ATOM   5283  C  C     . HIS I  4 224  ? 50.073  2.866    2.375   1.00 135.00 ? 224  HIS A C     1 
ATOM   5284  O  O     . HIS I  4 224  ? 49.065  2.171    2.150   1.00 127.67 ? 224  HIS A O     1 
ATOM   5285  C  CB    . HIS I  4 224  ? 50.196  5.001    1.111   1.00 126.41 ? 224  HIS A CB    1 
ATOM   5286  C  CG    . HIS I  4 224  ? 49.391  4.359    0.012   1.00 120.84 ? 224  HIS A CG    1 
ATOM   5287  N  ND1   . HIS I  4 224  ? 49.806  3.272    -0.640  1.00 118.40 ? 224  HIS A ND1   1 
ATOM   5288  C  CD2   . HIS I  4 224  ? 48.161  4.682    -0.517  1.00 118.39 ? 224  HIS A CD2   1 
ATOM   5289  C  CE1   . HIS I  4 224  ? 48.904  2.928    -1.557  1.00 115.41 ? 224  HIS A CE1   1 
ATOM   5290  N  NE2   . HIS I  4 224  ? 47.893  3.784    -1.476  1.00 116.47 ? 224  HIS A NE2   1 
ATOM   5291  N  N     . GLU I  4 225  ? 51.293  2.349    2.528   1.00 139.82 ? 225  GLU A N     1 
ATOM   5292  C  CA    . GLU I  4 225  ? 51.538  0.904    2.443   1.00 141.28 ? 225  GLU A CA    1 
ATOM   5293  C  C     . GLU I  4 225  ? 50.831  0.162    3.566   1.00 138.18 ? 225  GLU A C     1 
ATOM   5294  O  O     . GLU I  4 225  ? 50.238  -0.897   3.336   1.00 132.17 ? 225  GLU A O     1 
ATOM   5295  C  CB    . GLU I  4 225  ? 53.039  0.583    2.476   1.00 138.98 ? 225  GLU A CB    1 
ATOM   5296  C  CG    . GLU I  4 225  ? 53.366  -0.861   2.110   1.00 138.65 ? 225  GLU A CG    1 
ATOM   5297  C  CD    . GLU I  4 225  ? 54.860  -1.160   2.066   1.00 143.72 ? 225  GLU A CD    1 
ATOM   5298  O  OE1   . GLU I  4 225  ? 55.670  -0.378   2.611   1.00 154.66 ? 225  GLU A OE1   1 
ATOM   5299  O  OE2   . GLU I  4 225  ? 55.230  -2.200   1.488   1.00 142.64 ? 225  GLU A OE2   1 
ATOM   5300  N  N     . VAL I  4 226  ? 50.905  0.723    4.773   1.00 138.34 ? 226  VAL A N     1 
ATOM   5301  C  CA    . VAL I  4 226  ? 50.223  0.154    5.949   1.00 139.55 ? 226  VAL A CA    1 
ATOM   5302  C  C     . VAL I  4 226  ? 48.691  0.338    5.883   1.00 136.45 ? 226  VAL A C     1 
ATOM   5303  O  O     . VAL I  4 226  ? 47.938  -0.384   6.538   1.00 123.63 ? 226  VAL A O     1 
ATOM   5304  C  CB    . VAL I  4 226  ? 50.746  0.775    7.267   1.00 140.35 ? 226  VAL A CB    1 
ATOM   5305  C  CG1   . VAL I  4 226  ? 52.249  0.574    7.416   1.00 139.39 ? 226  VAL A CG1   1 
ATOM   5306  C  CG2   . VAL I  4 226  ? 50.412  2.256    7.329   1.00 145.14 ? 226  VAL A CG2   1 
ATOM   5307  N  N     . LEU I  4 227  ? 48.238  1.317    5.099   1.00 135.25 ? 227  LEU A N     1 
ATOM   5308  C  CA    . LEU I  4 227  ? 46.809  1.513    4.879   1.00 130.21 ? 227  LEU A CA    1 
ATOM   5309  C  C     . LEU I  4 227  ? 46.251  0.368    4.075   1.00 128.95 ? 227  LEU A C     1 
ATOM   5310  O  O     . LEU I  4 227  ? 45.171  -0.118   4.362   1.00 137.34 ? 227  LEU A O     1 
ATOM   5311  C  CB    . LEU I  4 227  ? 46.523  2.840    4.161   1.00 129.98 ? 227  LEU A CB    1 
ATOM   5312  C  CG    . LEU I  4 227  ? 45.051  3.185    3.858   1.00 126.32 ? 227  LEU A CG    1 
ATOM   5313  C  CD1   . LEU I  4 227  ? 44.159  3.023    5.080   1.00 127.80 ? 227  LEU A CD1   1 
ATOM   5314  C  CD2   . LEU I  4 227  ? 44.925  4.600    3.324   1.00 123.70 ? 227  LEU A CD2   1 
ATOM   5315  N  N     . LEU I  4 228  ? 46.985  -0.064   3.059   1.00 135.66 ? 228  LEU A N     1 
ATOM   5316  C  CA    . LEU I  4 228  ? 46.570  -1.226   2.266   1.00 137.06 ? 228  LEU A CA    1 
ATOM   5317  C  C     . LEU I  4 228  ? 46.508  -2.504   3.091   1.00 140.20 ? 228  LEU A C     1 
ATOM   5318  O  O     . LEU I  4 228  ? 45.696  -3.381   2.797   1.00 149.56 ? 228  LEU A O     1 
ATOM   5319  C  CB    . LEU I  4 228  ? 47.518  -1.452   1.104   1.00 132.65 ? 228  LEU A CB    1 
ATOM   5320  C  CG    . LEU I  4 228  ? 47.564  -0.314   0.107   1.00 138.02 ? 228  LEU A CG    1 
ATOM   5321  C  CD1   . LEU I  4 228  ? 48.605  -0.639   -0.955  1.00 148.13 ? 228  LEU A CD1   1 
ATOM   5322  C  CD2   . LEU I  4 228  ? 46.190  -0.094   -0.500  1.00 134.80 ? 228  LEU A CD2   1 
ATOM   5323  N  N     . ALA I  4 229  ? 47.374  -2.609   4.103   1.00 139.43 ? 229  ALA A N     1 
ATOM   5324  C  CA    . ALA I  4 229  ? 47.381  -3.751   5.032   1.00 134.14 ? 229  ALA A CA    1 
ATOM   5325  C  C     . ALA I  4 229  ? 46.164  -3.758   5.938   1.00 137.32 ? 229  ALA A C     1 
ATOM   5326  O  O     . ALA I  4 229  ? 45.788  -4.822   6.417   1.00 140.21 ? 229  ALA A O     1 
ATOM   5327  C  CB    . ALA I  4 229  ? 48.640  -3.759   5.891   1.00 124.62 ? 229  ALA A CB    1 
ATOM   5328  N  N     . ILE I  4 230  ? 45.572  -2.585   6.192   1.00 136.45 ? 230  ILE A N     1 
ATOM   5329  C  CA    . ILE I  4 230  ? 44.408  -2.479   7.076   1.00 137.49 ? 230  ILE A CA    1 
ATOM   5330  C  C     . ILE I  4 230  ? 43.154  -3.044   6.399   1.00 143.24 ? 230  ILE A C     1 
ATOM   5331  O  O     . ILE I  4 230  ? 42.316  -3.666   7.065   1.00 150.55 ? 230  ILE A O     1 
ATOM   5332  C  CB    . ILE I  4 230  ? 44.144  -1.024   7.541   1.00 144.85 ? 230  ILE A CB    1 
ATOM   5333  C  CG1   . ILE I  4 230  ? 45.243  -0.542   8.495   1.00 144.94 ? 230  ILE A CG1   1 
ATOM   5334  C  CG2   . ILE I  4 230  ? 42.797  -0.912   8.255   1.00 145.80 ? 230  ILE A CG2   1 
ATOM   5335  C  CD1   . ILE I  4 230  ? 45.140  0.926    8.874   1.00 142.86 ? 230  ILE A CD1   1 
ATOM   5336  N  N     . GLN I  4 231  ? 43.014  -2.821   5.090   1.00 144.50 ? 231  GLN A N     1 
ATOM   5337  C  CA    . GLN I  4 231  ? 41.896  -3.406   4.313   1.00 151.86 ? 231  GLN A CA    1 
ATOM   5338  C  C     . GLN I  4 231  ? 42.186  -4.820   3.837   1.00 152.49 ? 231  GLN A C     1 
ATOM   5339  O  O     . GLN I  4 231  ? 41.264  -5.613   3.608   1.00 162.33 ? 231  GLN A O     1 
ATOM   5340  C  CB    . GLN I  4 231  ? 41.557  -2.571   3.081   1.00 154.52 ? 231  GLN A CB    1 
ATOM   5341  C  CG    . GLN I  4 231  ? 40.724  -1.336   3.370   1.00 151.19 ? 231  GLN A CG    1 
ATOM   5342  C  CD    . GLN I  4 231  ? 41.554  -0.212   3.946   1.00 151.07 ? 231  GLN A CD    1 
ATOM   5343  O  OE1   . GLN I  4 231  ? 42.538  0.218    3.341   1.00 154.51 ? 231  GLN A OE1   1 
ATOM   5344  N  NE2   . GLN I  4 231  ? 41.164  0.272    5.116   1.00 152.51 ? 231  GLN A NE2   1 
ATOM   5345  N  N     . SER I  4 232  ? 43.462  -5.113   3.633   1.00 150.45 ? 232  SER A N     1 
ATOM   5346  C  CA    . SER I  4 232  ? 43.876  -6.467   3.315   1.00 157.72 ? 232  SER A CA    1 
ATOM   5347  C  C     . SER I  4 232  ? 43.929  -7.334   4.583   1.00 163.59 ? 232  SER A C     1 
ATOM   5348  O  O     . SER I  4 232  ? 43.775  -8.555   4.490   1.00 175.77 ? 232  SER A O     1 
ATOM   5349  C  CB    . SER I  4 232  ? 45.228  -6.448   2.603   1.00 155.03 ? 232  SER A CB    1 
ATOM   5350  O  OG    . SER I  4 232  ? 45.551  -7.719   2.091   1.00 158.21 ? 232  SER A OG    1 
ATOM   5351  N  N     . LYS I  4 233  ? 44.136  -6.700   5.746   1.00 157.78 ? 233  LYS A N     1 
ATOM   5352  C  CA    . LYS I  4 233  ? 44.281  -7.387   7.053   1.00 158.41 ? 233  LYS A CA    1 
ATOM   5353  C  C     . LYS I  4 233  ? 45.404  -8.442   7.118   1.00 163.92 ? 233  LYS A C     1 
ATOM   5354  O  O     . LYS I  4 233  ? 45.142  -9.655   7.236   1.00 150.03 ? 233  LYS A O     1 
ATOM   5355  C  CB    . LYS I  4 233  ? 42.951  -7.989   7.478   1.00 161.44 ? 233  LYS A CB    1 
ATOM   5356  C  CG    . LYS I  4 233  ? 41.950  -6.931   7.883   1.00 164.64 ? 233  LYS A CG    1 
ATOM   5357  C  CD    . LYS I  4 233  ? 40.565  -7.237   7.359   1.00 169.39 ? 233  LYS A CD    1 
ATOM   5358  C  CE    . LYS I  4 233  ? 39.710  -5.981   7.344   1.00 176.13 ? 233  LYS A CE    1 
ATOM   5359  N  NZ    . LYS I  4 233  ? 38.604  -6.087   6.351   1.00 177.51 ? 233  LYS A NZ    1 
ATOM   5360  N  N     . THR I  4 234  ? 46.645  -7.951   7.051   1.00 164.70 ? 234  THR A N     1 
ATOM   5361  C  CA    . THR I  4 234  ? 47.855  -8.777   7.065   1.00 162.82 ? 234  THR A CA    1 
ATOM   5362  C  C     . THR I  4 234  ? 48.967  -8.060   7.842   1.00 165.95 ? 234  THR A C     1 
ATOM   5363  O  O     . THR I  4 234  ? 48.837  -6.872   8.185   1.00 160.43 ? 234  THR A O     1 
ATOM   5364  C  CB    . THR I  4 234  ? 48.357  -9.076   5.630   1.00 169.74 ? 234  THR A CB    1 
ATOM   5365  O  OG1   . THR I  4 234  ? 48.440  -7.854   4.881   1.00 174.79 ? 234  THR A OG1   1 
ATOM   5366  C  CG2   . THR I  4 234  ? 47.426  -10.050  4.897   1.00 162.29 ? 234  THR A CG2   1 
ATOM   5367  N  N     . THR I  4 235  ? 50.053  -8.792   8.115   1.00 173.16 ? 235  THR A N     1 
ATOM   5368  C  CA    . THR I  4 235  ? 51.216  -8.249   8.829   1.00 172.94 ? 235  THR A CA    1 
ATOM   5369  C  C     . THR I  4 235  ? 51.963  -7.293   7.904   1.00 178.25 ? 235  THR A C     1 
ATOM   5370  O  O     . THR I  4 235  ? 51.638  -7.182   6.713   1.00 170.84 ? 235  THR A O     1 
ATOM   5371  C  CB    . THR I  4 235  ? 52.206  -9.358   9.288   1.00 171.25 ? 235  THR A CB    1 
ATOM   5372  O  OG1   . THR I  4 235  ? 51.503  -10.568  9.583   1.00 172.81 ? 235  THR A OG1   1 
ATOM   5373  C  CG2   . THR I  4 235  ? 52.983  -8.917   10.526  1.00 169.31 ? 235  THR A CG2   1 
ATOM   5374  N  N     . LEU I  4 236  ? 52.961  -6.606   8.455   1.00 178.59 ? 236  LEU A N     1 
ATOM   5375  C  CA    . LEU I  4 236  ? 53.870  -5.796   7.648   1.00 176.98 ? 236  LEU A CA    1 
ATOM   5376  C  C     . LEU I  4 236  ? 54.722  -6.665   6.715   1.00 173.18 ? 236  LEU A C     1 
ATOM   5377  O  O     . LEU I  4 236  ? 55.227  -6.176   5.708   1.00 174.01 ? 236  LEU A O     1 
ATOM   5378  C  CB    . LEU I  4 236  ? 54.768  -4.946   8.552   1.00 180.99 ? 236  LEU A CB    1 
ATOM   5379  C  CG    . LEU I  4 236  ? 55.612  -3.840   7.903   1.00 178.94 ? 236  LEU A CG    1 
ATOM   5380  C  CD1   . LEU I  4 236  ? 54.772  -2.910   7.031   1.00 173.60 ? 236  LEU A CD1   1 
ATOM   5381  C  CD2   . LEU I  4 236  ? 56.329  -3.049   8.996   1.00 176.08 ? 236  LEU A CD2   1 
ATOM   5382  N  N     . ASP I  4 237  ? 54.881  -7.941   7.059   1.00 168.48 ? 237  ASP A N     1 
ATOM   5383  C  CA    . ASP I  4 237  ? 55.507  -8.909   6.175   1.00 178.65 ? 237  ASP A CA    1 
ATOM   5384  C  C     . ASP I  4 237  ? 54.725  -10.214  6.291   1.00 184.56 ? 237  ASP A C     1 
ATOM   5385  O  O     . ASP I  4 237  ? 54.831  -10.932  7.295   1.00 189.83 ? 237  ASP A O     1 
ATOM   5386  C  CB    . ASP I  4 237  ? 56.990  -9.095   6.522   1.00 184.51 ? 237  ASP A CB    1 
ATOM   5387  C  CG    . ASP I  4 237  ? 57.225  -9.339   8.001   1.00 190.89 ? 237  ASP A CG    1 
ATOM   5388  O  OD1   . ASP I  4 237  ? 56.315  -9.051   8.821   1.00 186.81 ? 237  ASP A OD1   1 
ATOM   5389  O  OD2   . ASP I  4 237  ? 58.328  -9.822   8.333   1.00 189.95 ? 237  ASP A OD2   1 
ATOM   5390  N  N     . ASP I  4 238  ? 53.905  -10.487  5.273   1.00 183.67 ? 238  ASP A N     1 
ATOM   5391  C  CA    . ASP I  4 238  ? 53.019  -11.662  5.265   1.00 181.93 ? 238  ASP A CA    1 
ATOM   5392  C  C     . ASP I  4 238  ? 53.672  -12.934  4.658   1.00 178.73 ? 238  ASP A C     1 
ATOM   5393  O  O     . ASP I  4 238  ? 53.817  -13.931  5.371   1.00 175.91 ? 238  ASP A O     1 
ATOM   5394  C  CB    . ASP I  4 238  ? 51.679  -11.299  4.595   1.00 181.18 ? 238  ASP A CB    1 
ATOM   5395  C  CG    . ASP I  4 238  ? 50.623  -12.378  4.734   1.00 176.65 ? 238  ASP A CG    1 
ATOM   5396  O  OD1   . ASP I  4 238  ? 50.815  -13.330  5.524   1.00 185.65 ? 238  ASP A OD1   1 
ATOM   5397  O  OD2   . ASP I  4 238  ? 49.577  -12.245  4.055   1.00 171.66 ? 238  ASP A OD2   1 
ATOM   5398  N  N     . PRO I  4 239  ? 54.044  -12.930  3.352   1.00 173.72 ? 239  PRO A N     1 
ATOM   5399  C  CA    . PRO I  4 239  ? 53.824  -11.983  2.257   1.00 166.52 ? 239  PRO A CA    1 
ATOM   5400  C  C     . PRO I  4 239  ? 52.569  -12.348  1.467   1.00 173.39 ? 239  PRO A C     1 
ATOM   5401  O  O     . PRO I  4 239  ? 51.782  -13.194  1.913   1.00 176.77 ? 239  PRO A O     1 
ATOM   5402  C  CB    . PRO I  4 239  ? 55.064  -12.172  1.396   1.00 159.35 ? 239  PRO A CB    1 
ATOM   5403  C  CG    . PRO I  4 239  ? 55.371  -13.619  1.541   1.00 163.61 ? 239  PRO A CG    1 
ATOM   5404  C  CD    . PRO I  4 239  ? 54.870  -14.064  2.893   1.00 163.95 ? 239  PRO A CD    1 
ATOM   5405  N  N     . GLU I  4 240  ? 52.399  -11.715  0.307   1.00 179.22 ? 240  GLU A N     1 
ATOM   5406  C  CA    . GLU I  4 240  ? 51.170  -11.802  -0.510  1.00 178.56 ? 240  GLU A CA    1 
ATOM   5407  C  C     . GLU I  4 240  ? 50.176  -10.702  -0.107  1.00 170.86 ? 240  GLU A C     1 
ATOM   5408  O  O     . GLU I  4 240  ? 49.054  -10.664  -0.613  1.00 171.53 ? 240  GLU A O     1 
ATOM   5409  C  CB    . GLU I  4 240  ? 50.511  -13.198  -0.462  1.00 172.64 ? 240  GLU A CB    1 
ATOM   5410  C  CG    . GLU I  4 240  ? 49.633  -13.510  -1.665  1.00 171.40 ? 240  GLU A CG    1 
ATOM   5411  C  CD    . GLU I  4 240  ? 48.939  -14.860  -1.569  1.00 170.69 ? 240  GLU A CD    1 
ATOM   5412  O  OE1   . GLU I  4 240  ? 49.535  -15.809  -1.024  1.00 174.36 ? 240  GLU A OE1   1 
ATOM   5413  O  OE2   . GLU I  4 240  ? 47.797  -14.976  -2.054  1.00 168.07 ? 240  GLU A OE2   1 
ATOM   5414  N  N     . ARG I  4 241  ? 50.607  -9.807   0.787   1.00 161.01 ? 241  ARG A N     1 
ATOM   5415  C  CA    . ARG I  4 241  ? 49.806  -8.652   1.202   1.00 158.79 ? 241  ARG A CA    1 
ATOM   5416  C  C     . ARG I  4 241  ? 49.716  -7.604   0.098   1.00 152.42 ? 241  ARG A C     1 
ATOM   5417  O  O     . ARG I  4 241  ? 50.656  -7.444   -0.684  1.00 153.14 ? 241  ARG A O     1 
ATOM   5418  C  CB    . ARG I  4 241  ? 50.410  -8.003   2.446   1.00 157.20 ? 241  ARG A CB    1 
ATOM   5419  C  CG    . ARG I  4 241  ? 51.800  -7.424   2.237   1.00 155.89 ? 241  ARG A CG    1 
ATOM   5420  C  CD    . ARG I  4 241  ? 52.408  -7.018   3.561   1.00 158.12 ? 241  ARG A CD    1 
ATOM   5421  N  NE    . ARG I  4 241  ? 53.796  -6.585   3.424   1.00 152.24 ? 241  ARG A NE    1 
ATOM   5422  C  CZ    . ARG I  4 241  ? 54.179  -5.396   2.974   1.00 145.14 ? 241  ARG A CZ    1 
ATOM   5423  N  NH1   . ARG I  4 241  ? 53.287  -4.486   2.589   1.00 147.46 ? 241  ARG A NH1   1 
ATOM   5424  N  NH2   . ARG I  4 241  ? 55.469  -5.119   2.915   1.00 139.27 ? 241  ARG A NH2   1 
ATOM   5425  N  N     . TRP I  4 242  ? 48.609  -6.865   0.068   1.00 143.19 ? 242  TRP A N     1 
ATOM   5426  C  CA    . TRP I  4 242  ? 48.368  -5.884   -0.994  1.00 144.63 ? 242  TRP A CA    1 
ATOM   5427  C  C     . TRP I  4 242  ? 49.365  -4.756   -0.964  1.00 143.82 ? 242  TRP A C     1 
ATOM   5428  O  O     . TRP I  4 242  ? 49.389  -3.971   -0.030  1.00 151.33 ? 242  TRP A O     1 
ATOM   5429  C  CB    . TRP I  4 242  ? 46.947  -5.336   -0.902  1.00 144.15 ? 242  TRP A CB    1 
ATOM   5430  C  CG    . TRP I  4 242  ? 46.509  -4.491   -2.081  1.00 140.96 ? 242  TRP A CG    1 
ATOM   5431  C  CD1   . TRP I  4 242  ? 47.029  -4.486   -3.371  1.00 143.48 ? 242  TRP A CD1   1 
ATOM   5432  C  CD2   . TRP I  4 242  ? 45.392  -3.535   -2.120  1.00 140.06 ? 242  TRP A CD2   1 
ATOM   5433  N  NE1   . TRP I  4 242  ? 46.346  -3.606   -4.169  1.00 147.13 ? 242  TRP A NE1   1 
ATOM   5434  C  CE2   . TRP I  4 242  ? 45.354  -3.007   -3.480  1.00 142.90 ? 242  TRP A CE2   1 
ATOM   5435  C  CE3   . TRP I  4 242  ? 44.465  -3.074   -1.191  1.00 140.38 ? 242  TRP A CE3   1 
ATOM   5436  C  CZ2   . TRP I  4 242  ? 44.425  -2.061   -3.872  1.00 147.97 ? 242  TRP A CZ2   1 
ATOM   5437  C  CZ3   . TRP I  4 242  ? 43.532  -2.120   -1.594  1.00 139.48 ? 242  TRP A CZ3   1 
ATOM   5438  C  CH2   . TRP I  4 242  ? 43.516  -1.622   -2.903  1.00 144.35 ? 242  TRP A CH2   1 
ATOM   5439  N  N     . ARG I  4 243  ? 50.187  -4.671   -2.007  1.00 148.55 ? 243  ARG A N     1 
ATOM   5440  C  CA    . ARG I  4 243  ? 51.256  -3.680   -2.125  1.00 136.83 ? 243  ARG A CA    1 
ATOM   5441  C  C     . ARG I  4 243  ? 51.126  -2.923   -3.426  1.00 129.41 ? 243  ARG A C     1 
ATOM   5442  O  O     . ARG I  4 243  ? 50.444  -3.379   -4.343  1.00 132.64 ? 243  ARG A O     1 
ATOM   5443  C  CB    . ARG I  4 243  ? 52.597  -4.393   -2.151  1.00 145.84 ? 243  ARG A CB    1 
ATOM   5444  C  CG    . ARG I  4 243  ? 53.160  -4.746   -0.791  1.00 152.67 ? 243  ARG A CG    1 
ATOM   5445  C  CD    . ARG I  4 243  ? 54.184  -5.873   -0.912  1.00 157.14 ? 243  ARG A CD    1 
ATOM   5446  N  NE    . ARG I  4 243  ? 55.367  -5.676   -0.073  1.00 155.17 ? 243  ARG A NE    1 
ATOM   5447  C  CZ    . ARG I  4 243  ? 56.327  -6.581   0.100   1.00 159.79 ? 243  ARG A CZ    1 
ATOM   5448  N  NH1   . ARG I  4 243  ? 56.261  -7.767   -0.499  1.00 161.82 ? 243  ARG A NH1   1 
ATOM   5449  N  NH2   . ARG I  4 243  ? 57.367  -6.305   0.877   1.00 164.98 ? 243  ARG A NH2   1 
ATOM   5450  N  N     . PHE I  4 244  ? 51.805  -1.780   -3.500  1.00 128.47 ? 244  PHE A N     1 
ATOM   5451  C  CA    . PHE I  4 244  ? 51.936  -0.987   -4.731  1.00 127.84 ? 244  PHE A CA    1 
ATOM   5452  C  C     . PHE I  4 244  ? 53.315  -1.258   -5.320  1.00 128.87 ? 244  PHE A C     1 
ATOM   5453  O  O     . PHE I  4 244  ? 54.246  -1.562   -4.580  1.00 127.02 ? 244  PHE A O     1 
ATOM   5454  C  CB    . PHE I  4 244  ? 51.774  0.514    -4.428  1.00 130.86 ? 244  PHE A CB    1 
ATOM   5455  C  CG    . PHE I  4 244  ? 50.368  1.044    -4.629  1.00 128.34 ? 244  PHE A CG    1 
ATOM   5456  C  CD1   . PHE I  4 244  ? 49.267  0.348    -4.163  1.00 125.29 ? 244  PHE A CD1   1 
ATOM   5457  C  CD2   . PHE I  4 244  ? 50.156  2.259    -5.276  1.00 128.10 ? 244  PHE A CD2   1 
ATOM   5458  C  CE1   . PHE I  4 244  ? 47.990  0.837    -4.358  1.00 124.75 ? 244  PHE A CE1   1 
ATOM   5459  C  CE2   . PHE I  4 244  ? 48.882  2.752    -5.471  1.00 122.71 ? 244  PHE A CE2   1 
ATOM   5460  C  CZ    . PHE I  4 244  ? 47.799  2.041    -5.005  1.00 122.75 ? 244  PHE A CZ    1 
ATOM   5461  N  N     . PRO I  4 245  ? 53.457  -1.151   -6.653  1.00 135.26 ? 245  PRO A N     1 
ATOM   5462  C  CA    . PRO I  4 245  ? 54.686  -1.584   -7.321  1.00 137.66 ? 245  PRO A CA    1 
ATOM   5463  C  C     . PRO I  4 245  ? 55.911  -0.754   -6.965  1.00 137.81 ? 245  PRO A C     1 
ATOM   5464  O  O     . PRO I  4 245  ? 57.025  -1.255   -7.079  1.00 141.68 ? 245  PRO A O     1 
ATOM   5465  C  CB    . PRO I  4 245  ? 54.360  -1.433   -8.814  1.00 135.49 ? 245  PRO A CB    1 
ATOM   5466  C  CG    . PRO I  4 245  ? 53.331  -0.375   -8.864  1.00 138.45 ? 245  PRO A CG    1 
ATOM   5467  C  CD    . PRO I  4 245  ? 52.516  -0.534   -7.601  1.00 140.92 ? 245  PRO A CD    1 
ATOM   5468  N  N     . CYS I  4 246  ? 55.711  0.496    -6.554  1.00 135.88 ? 246  CYS A N     1 
ATOM   5469  C  CA    . CYS I  4 246  ? 56.823  1.355    -6.147  1.00 140.59 ? 246  CYS A CA    1 
ATOM   5470  C  C     . CYS I  4 246  ? 56.316  2.501    -5.268  1.00 144.83 ? 246  CYS A C     1 
ATOM   5471  O  O     . CYS I  4 246  ? 55.112  2.618    -5.024  1.00 146.39 ? 246  CYS A O     1 
ATOM   5472  C  CB    . CYS I  4 246  ? 57.599  1.871    -7.375  1.00 141.16 ? 246  CYS A CB    1 
ATOM   5473  S  SG    . CYS I  4 246  ? 56.590  2.554    -8.711  1.00 152.64 ? 246  CYS A SG    1 
ATOM   5474  N  N     . ASP I  4 247  ? 57.238  3.321    -4.772  1.00 148.92 ? 247  ASP A N     1 
ATOM   5475  C  CA    . ASP I  4 247  ? 56.898  4.462    -3.925  1.00 149.82 ? 247  ASP A CA    1 
ATOM   5476  C  C     . ASP I  4 247  ? 56.943  5.763    -4.710  1.00 151.41 ? 247  ASP A C     1 
ATOM   5477  O  O     . ASP I  4 247  ? 57.500  6.749    -4.222  1.00 159.41 ? 247  ASP A O     1 
ATOM   5478  C  CB    . ASP I  4 247  ? 57.872  4.543    -2.746  1.00 153.01 ? 247  ASP A CB    1 
ATOM   5479  C  CG    . ASP I  4 247  ? 57.961  3.246    -1.979  1.00 162.48 ? 247  ASP A CG    1 
ATOM   5480  O  OD1   . ASP I  4 247  ? 58.905  3.086    -1.173  1.00 165.31 ? 247  ASP A OD1   1 
ATOM   5481  O  OD2   . ASP I  4 247  ? 57.089  2.377    -2.192  1.00 172.25 ? 247  ASP A OD2   1 
ATOM   5482  N  N     . GLU I  4 248  ? 56.344  5.772    -5.907  1.00 149.33 ? 248  GLU A N     1 
ATOM   5483  C  CA    . GLU I  4 248  ? 56.368  6.949    -6.811  1.00 147.75 ? 248  GLU A CA    1 
ATOM   5484  C  C     . GLU I  4 248  ? 54.973  7.594    -7.016  1.00 140.93 ? 248  GLU A C     1 
ATOM   5485  O  O     . GLU I  4 248  ? 54.807  8.540    -7.787  1.00 133.37 ? 248  GLU A O     1 
ATOM   5486  C  CB    . GLU I  4 248  ? 56.980  6.563    -8.173  1.00 139.95 ? 248  GLU A CB    1 
ATOM   5487  C  CG    . GLU I  4 248  ? 58.377  5.951    -8.106  1.00 136.77 ? 248  GLU A CG    1 
ATOM   5488  C  CD    . GLU I  4 248  ? 59.466  6.932    -7.704  1.00 135.15 ? 248  GLU A CD    1 
ATOM   5489  O  OE1   . GLU I  4 248  ? 59.228  8.165    -7.759  1.00 125.21 ? 248  GLU A OE1   1 
ATOM   5490  O  OE2   . GLU I  4 248  ? 60.573  6.452    -7.342  1.00 136.93 ? 248  GLU A OE2   1 
ATOM   5491  N  N     . PHE I  4 249  ? 53.976  7.097    -6.301  1.00 134.52 ? 249  PHE A N     1 
ATOM   5492  C  CA    . PHE I  4 249  ? 52.624  7.582    -6.468  1.00 130.34 ? 249  PHE A CA    1 
ATOM   5493  C  C     . PHE I  4 249  ? 52.359  8.715    -5.477  1.00 135.41 ? 249  PHE A C     1 
ATOM   5494  O  O     . PHE I  4 249  ? 51.588  8.549    -4.529  1.00 137.13 ? 249  PHE A O     1 
ATOM   5495  C  CB    . PHE I  4 249  ? 51.635  6.440    -6.252  1.00 124.83 ? 249  PHE A CB    1 
ATOM   5496  C  CG    . PHE I  4 249  ? 51.831  5.287    -7.183  1.00 123.66 ? 249  PHE A CG    1 
ATOM   5497  C  CD1   . PHE I  4 249  ? 52.754  4.291    -6.892  1.00 132.99 ? 249  PHE A CD1   1 
ATOM   5498  C  CD2   . PHE I  4 249  ? 51.093  5.185    -8.343  1.00 119.25 ? 249  PHE A CD2   1 
ATOM   5499  C  CE1   . PHE I  4 249  ? 52.929  3.207    -7.745  1.00 132.70 ? 249  PHE A CE1   1 
ATOM   5500  C  CE2   . PHE I  4 249  ? 51.264  4.112    -9.202  1.00 124.29 ? 249  PHE A CE2   1 
ATOM   5501  C  CZ    . PHE I  4 249  ? 52.176  3.117    -8.902  1.00 129.50 ? 249  PHE A CZ    1 
ATOM   5502  N  N     . TYR I  4 250  ? 53.009  9.861    -5.687  1.00 136.04 ? 250  TYR A N     1 
ATOM   5503  C  CA    . TYR I  4 250  ? 52.781  11.034   -4.839  1.00 135.23 ? 250  TYR A CA    1 
ATOM   5504  C  C     . TYR I  4 250  ? 52.784  12.294   -5.650  1.00 130.99 ? 250  TYR A C     1 
ATOM   5505  O  O     . TYR I  4 250  ? 53.287  12.306   -6.761  1.00 129.49 ? 250  TYR A O     1 
ATOM   5506  C  CB    . TYR I  4 250  ? 53.841  11.150   -3.749  1.00 145.46 ? 250  TYR A CB    1 
ATOM   5507  C  CG    . TYR I  4 250  ? 55.243  11.359   -4.272  1.00 153.03 ? 250  TYR A CG    1 
ATOM   5508  C  CD1   . TYR I  4 250  ? 55.838  12.620   -4.251  1.00 155.50 ? 250  TYR A CD1   1 
ATOM   5509  C  CD2   . TYR I  4 250  ? 55.982  10.289   -4.788  1.00 157.37 ? 250  TYR A CD2   1 
ATOM   5510  C  CE1   . TYR I  4 250  ? 57.134  12.811   -4.727  1.00 158.62 ? 250  TYR A CE1   1 
ATOM   5511  C  CE2   . TYR I  4 250  ? 57.274  10.470   -5.266  1.00 160.66 ? 250  TYR A CE2   1 
ATOM   5512  C  CZ    . TYR I  4 250  ? 57.851  11.732   -5.235  1.00 156.61 ? 250  TYR A CZ    1 
ATOM   5513  O  OH    . TYR I  4 250  ? 59.129  11.917   -5.720  1.00 143.91 ? 250  TYR A OH    1 
ATOM   5514  N  N     . VAL I  4 251  ? 52.233  13.360   -5.070  1.00 140.03 ? 251  VAL A N     1 
ATOM   5515  C  CA    . VAL I  4 251  ? 52.113  14.649   -5.757  1.00 139.82 ? 251  VAL A CA    1 
ATOM   5516  C  C     . VAL I  4 251  ? 53.504  15.235   -5.991  1.00 143.24 ? 251  VAL A C     1 
ATOM   5517  O  O     . VAL I  4 251  ? 54.061  15.918   -5.135  1.00 142.69 ? 251  VAL A O     1 
ATOM   5518  C  CB    . VAL I  4 251  ? 51.226  15.647   -4.990  1.00 135.97 ? 251  VAL A CB    1 
ATOM   5519  C  CG1   . VAL I  4 251  ? 51.245  17.008   -5.670  1.00 140.91 ? 251  VAL A CG1   1 
ATOM   5520  C  CG2   . VAL I  4 251  ? 49.797  15.124   -4.920  1.00 138.24 ? 251  VAL A CG2   1 
ATOM   5521  N  N     . LYS I  4 252  ? 54.050  14.933   -7.169  1.00 148.52 ? 252  LYS A N     1 
ATOM   5522  C  CA    . LYS I  4 252  ? 55.408  15.329   -7.558  1.00 144.65 ? 252  LYS A CA    1 
ATOM   5523  C  C     . LYS I  4 252  ? 55.511  16.767   -8.061  1.00 141.25 ? 252  LYS A C     1 
ATOM   5524  O  O     . LYS I  4 252  ? 54.659  17.246   -8.814  1.00 135.62 ? 252  LYS A O     1 
ATOM   5525  C  CB    . LYS I  4 252  ? 55.952  14.393   -8.656  1.00 140.61 ? 252  LYS A CB    1 
ATOM   5526  C  CG    . LYS I  4 252  ? 56.498  13.071   -8.139  1.00 132.96 ? 252  LYS A CG    1 
ATOM   5527  C  CD    . LYS I  4 252  ? 56.803  12.140   -9.280  1.00 124.93 ? 252  LYS A CD    1 
ATOM   5528  C  CE    . LYS I  4 252  ? 57.341  10.827   -8.781  1.00 125.46 ? 252  LYS A CE    1 
ATOM   5529  N  NZ    . LYS I  4 252  ? 57.426  9.880    -9.930  1.00 130.64 ? 252  LYS A NZ    1 
ATOM   5530  N  N     . THR I  4 253  ? 56.591  17.428   -7.649  1.00 143.45 ? 253  THR A N     1 
ATOM   5531  C  CA    . THR I  4 253  ? 56.959  18.745   -8.152  1.00 141.01 ? 253  THR A CA    1 
ATOM   5532  C  C     . THR I  4 253  ? 57.309  18.631   -9.627  1.00 138.05 ? 253  THR A C     1 
ATOM   5533  O  O     . THR I  4 253  ? 57.866  17.620   -10.035 1.00 140.40 ? 253  THR A O     1 
ATOM   5534  C  CB    . THR I  4 253  ? 58.201  19.281   -7.422  1.00 140.09 ? 253  THR A CB    1 
ATOM   5535  O  OG1   . THR I  4 253  ? 57.998  19.192   -6.003  1.00 139.73 ? 253  THR A OG1   1 
ATOM   5536  C  CG2   . THR I  4 253  ? 58.494  20.726   -7.845  1.00 135.80 ? 253  THR A CG2   1 
ATOM   5537  N  N     . PRO I  4 254  ? 56.990  19.663   -10.433 1.00 136.77 ? 254  PRO A N     1 
ATOM   5538  C  CA    . PRO I  4 254  ? 57.302  19.627   -11.852 1.00 142.03 ? 254  PRO A CA    1 
ATOM   5539  C  C     . PRO I  4 254  ? 58.684  19.038   -12.146 1.00 151.98 ? 254  PRO A C     1 
ATOM   5540  O  O     . PRO I  4 254  ? 58.820  18.207   -13.042 1.00 163.34 ? 254  PRO A O     1 
ATOM   5541  C  CB    . PRO I  4 254  ? 57.231  21.104   -12.249 1.00 139.25 ? 254  PRO A CB    1 
ATOM   5542  C  CG    . PRO I  4 254  ? 56.232  21.707   -11.329 1.00 133.88 ? 254  PRO A CG    1 
ATOM   5543  C  CD    . PRO I  4 254  ? 56.147  20.829   -10.108 1.00 139.48 ? 254  PRO A CD    1 
ATOM   5544  N  N     . GLU I  4 255  ? 59.682  19.450   -11.370 1.00 151.66 ? 255  GLU A N     1 
ATOM   5545  C  CA    . GLU I  4 255  ? 61.036  18.921   -11.478 1.00 149.77 ? 255  GLU A CA    1 
ATOM   5546  C  C     . GLU I  4 255  ? 61.072  17.392   -11.460 1.00 146.38 ? 255  GLU A C     1 
ATOM   5547  O  O     . GLU I  4 255  ? 61.745  16.781   -12.284 1.00 157.39 ? 255  GLU A O     1 
ATOM   5548  C  CB    . GLU I  4 255  ? 61.894  19.442   -10.319 1.00 158.81 ? 255  GLU A CB    1 
ATOM   5549  C  CG    . GLU I  4 255  ? 62.099  20.953   -10.290 1.00 159.45 ? 255  GLU A CG    1 
ATOM   5550  C  CD    . GLU I  4 255  ? 62.880  21.422   -9.071  1.00 159.34 ? 255  GLU A CD    1 
ATOM   5551  O  OE1   . GLU I  4 255  ? 62.588  20.962   -7.949  1.00 156.60 ? 255  GLU A OE1   1 
ATOM   5552  O  OE2   . GLU I  4 255  ? 63.792  22.259   -9.233  1.00 169.44 ? 255  GLU A OE2   1 
ATOM   5553  N  N     . GLU I  4 256  ? 60.342  16.789   -10.525 1.00 140.17 ? 256  GLU A N     1 
ATOM   5554  C  CA    . GLU I  4 256  ? 60.371  15.338   -10.301 1.00 140.16 ? 256  GLU A CA    1 
ATOM   5555  C  C     . GLU I  4 256  ? 59.707  14.537   -11.426 1.00 138.11 ? 256  GLU A C     1 
ATOM   5556  O  O     . GLU I  4 256  ? 60.021  13.358   -11.637 1.00 129.86 ? 256  GLU A O     1 
ATOM   5557  C  CB    . GLU I  4 256  ? 59.717  15.008   -8.946  1.00 142.69 ? 256  GLU A CB    1 
ATOM   5558  C  CG    . GLU I  4 256  ? 60.452  15.630   -7.761  1.00 142.98 ? 256  GLU A CG    1 
ATOM   5559  C  CD    . GLU I  4 256  ? 59.818  15.340   -6.420  1.00 138.23 ? 256  GLU A CD    1 
ATOM   5560  O  OE1   . GLU I  4 256  ? 58.578  15.395   -6.328  1.00 138.36 ? 256  GLU A OE1   1 
ATOM   5561  O  OE2   . GLU I  4 256  ? 60.573  15.075   -5.454  1.00 139.76 ? 256  GLU A OE2   1 
ATOM   5562  N  N     . MET I  4 257  ? 58.788  15.191   -12.136 1.00 142.97 ? 257  MET A N     1 
ATOM   5563  C  CA    . MET I  4 257  ? 58.056  14.573   -13.238 1.00 142.68 ? 257  MET A CA    1 
ATOM   5564  C  C     . MET I  4 257  ? 58.966  14.349   -14.433 1.00 143.34 ? 257  MET A C     1 
ATOM   5565  O  O     . MET I  4 257  ? 58.849  13.332   -15.124 1.00 140.65 ? 257  MET A O     1 
ATOM   5566  C  CB    . MET I  4 257  ? 56.884  15.467   -13.666 1.00 143.05 ? 257  MET A CB    1 
ATOM   5567  C  CG    . MET I  4 257  ? 55.700  15.463   -12.720 1.00 143.32 ? 257  MET A CG    1 
ATOM   5568  S  SD    . MET I  4 257  ? 54.489  14.216   -13.163 1.00 133.84 ? 257  MET A SD    1 
ATOM   5569  C  CE    . MET I  4 257  ? 55.306  12.748   -12.564 1.00 135.54 ? 257  MET A CE    1 
ATOM   5570  N  N     . ARG I  4 258  ? 59.861  15.313   -14.671 1.00 145.69 ? 258  ARG A N     1 
ATOM   5571  C  CA    . ARG I  4 258  ? 60.798  15.266   -15.800 1.00 143.70 ? 258  ARG A CA    1 
ATOM   5572  C  C     . ARG I  4 258  ? 61.973  14.327   -15.602 1.00 142.62 ? 258  ARG A C     1 
ATOM   5573  O  O     . ARG I  4 258  ? 62.625  13.941   -16.567 1.00 151.79 ? 258  ARG A O     1 
ATOM   5574  C  CB    . ARG I  4 258  ? 61.324  16.649   -16.110 1.00 145.91 ? 258  ARG A CB    1 
ATOM   5575  C  CG    . ARG I  4 258  ? 60.306  17.488   -16.852 1.00 159.35 ? 258  ARG A CG    1 
ATOM   5576  C  CD    . ARG I  4 258  ? 60.338  17.255   -18.360 1.00 161.97 ? 258  ARG A CD    1 
ATOM   5577  N  NE    . ARG I  4 258  ? 60.091  18.486   -19.111 1.00 159.74 ? 258  ARG A NE    1 
ATOM   5578  C  CZ    . ARG I  4 258  ? 59.847  18.535   -20.414 1.00 153.91 ? 258  ARG A CZ    1 
ATOM   5579  N  NH1   . ARG I  4 258  ? 59.812  17.415   -21.133 1.00 151.77 ? 258  ARG A NH1   1 
ATOM   5580  N  NH2   . ARG I  4 258  ? 59.624  19.709   -20.994 1.00 156.64 ? 258  ARG A NH2   1 
ATOM   5581  N  N     . ALA I  4 259  ? 62.245  13.964   -14.358 1.00 139.72 ? 259  ALA A N     1 
ATOM   5582  C  CA    . ALA I  4 259  ? 63.139  12.858   -14.078 1.00 136.52 ? 259  ALA A CA    1 
ATOM   5583  C  C     . ALA I  4 259  ? 62.576  11.550   -14.660 1.00 136.54 ? 259  ALA A C     1 
ATOM   5584  O  O     . ALA I  4 259  ? 63.337  10.685   -15.067 1.00 152.34 ? 259  ALA A O     1 
ATOM   5585  C  CB    . ALA I  4 259  ? 63.361  12.739   -12.577 1.00 134.35 ? 259  ALA A CB    1 
ATOM   5586  N  N     . MET I  4 260  ? 61.247  11.423   -14.687 1.00 141.13 ? 260  MET A N     1 
ATOM   5587  C  CA    . MET I  4 260  ? 60.544  10.257   -15.242 1.00 144.54 ? 260  MET A CA    1 
ATOM   5588  C  C     . MET I  4 260  ? 60.219  10.462   -16.738 1.00 148.50 ? 260  MET A C     1 
ATOM   5589  O  O     . MET I  4 260  ? 60.142  9.498    -17.521 1.00 149.60 ? 260  MET A O     1 
ATOM   5590  C  CB    . MET I  4 260  ? 59.241  9.991    -14.459 1.00 145.03 ? 260  MET A CB    1 
ATOM   5591  C  CG    . MET I  4 260  ? 59.377  9.963    -12.935 1.00 147.51 ? 260  MET A CG    1 
ATOM   5592  S  SD    . MET I  4 260  ? 60.436  8.634    -12.312 1.00 159.96 ? 260  MET A SD    1 
ATOM   5593  C  CE    . MET I  4 260  ? 60.704  9.143    -10.612 1.00 141.28 ? 260  MET A CE    1 
ATOM   5594  N  N     . LEU I  4 261  ? 60.027  11.721   -17.126 1.00 145.32 ? 261  LEU A N     1 
ATOM   5595  C  CA    . LEU I  4 261  ? 59.725  12.083   -18.507 1.00 142.75 ? 261  LEU A CA    1 
ATOM   5596  C  C     . LEU I  4 261  ? 60.761  13.097   -19.030 1.00 146.35 ? 261  LEU A C     1 
ATOM   5597  O  O     . LEU I  4 261  ? 60.532  14.305   -18.996 1.00 144.41 ? 261  LEU A O     1 
ATOM   5598  C  CB    . LEU I  4 261  ? 58.303  12.662   -18.605 1.00 134.76 ? 261  LEU A CB    1 
ATOM   5599  C  CG    . LEU I  4 261  ? 57.120  11.767   -18.206 1.00 133.48 ? 261  LEU A CG    1 
ATOM   5600  C  CD1   . LEU I  4 261  ? 55.793  12.485   -18.381 1.00 124.64 ? 261  LEU A CD1   1 
ATOM   5601  C  CD2   . LEU I  4 261  ? 57.075  10.485   -19.018 1.00 139.88 ? 261  LEU A CD2   1 
ATOM   5602  N  N     . PRO I  4 262  ? 61.913  12.607   -19.512 1.00 146.71 ? 262  PRO A N     1 
ATOM   5603  C  CA    . PRO I  4 262  ? 62.933  13.459   -20.144 1.00 148.66 ? 262  PRO A CA    1 
ATOM   5604  C  C     . PRO I  4 262  ? 62.443  14.390   -21.294 1.00 153.38 ? 262  PRO A C     1 
ATOM   5605  O  O     . PRO I  4 262  ? 61.460  14.097   -21.979 1.00 150.27 ? 262  PRO A O     1 
ATOM   5606  C  CB    . PRO I  4 262  ? 63.930  12.443   -20.692 1.00 153.17 ? 262  PRO A CB    1 
ATOM   5607  C  CG    . PRO I  4 262  ? 63.793  11.267   -19.780 1.00 154.03 ? 262  PRO A CG    1 
ATOM   5608  C  CD    . PRO I  4 262  ? 62.361  11.211   -19.372 1.00 147.38 ? 262  PRO A CD    1 
ATOM   5609  N  N     . GLU I  4 263  ? 63.163  15.492   -21.507 1.00 152.96 ? 263  GLU A N     1 
ATOM   5610  C  CA    . GLU I  4 263  ? 62.768  16.532   -22.465 1.00 148.45 ? 263  GLU A CA    1 
ATOM   5611  C  C     . GLU I  4 263  ? 63.102  16.175   -23.910 1.00 152.98 ? 263  GLU A C     1 
ATOM   5612  O  O     . GLU I  4 263  ? 62.305  16.448   -24.822 1.00 155.13 ? 263  GLU A O     1 
ATOM   5613  C  CB    . GLU I  4 263  ? 63.438  17.859   -22.097 1.00 145.79 ? 263  GLU A CB    1 
ATOM   5614  C  CG    . GLU I  4 263  ? 62.996  19.034   -22.949 1.00 152.82 ? 263  GLU A CG    1 
ATOM   5615  C  CD    . GLU I  4 263  ? 63.547  20.366   -22.464 1.00 158.21 ? 263  GLU A CD    1 
ATOM   5616  O  OE1   . GLU I  4 263  ? 63.437  20.663   -21.246 1.00 146.97 ? 263  GLU A OE1   1 
ATOM   5617  O  OE2   . GLU I  4 263  ? 64.072  21.131   -23.316 1.00 173.34 ? 263  GLU A OE2   1 
ATOM   5618  N  N     . ALA I  4 264  ? 64.284  15.580   -24.103 1.00 147.24 ? 264  ALA A N     1 
ATOM   5619  C  CA    . ALA I  4 264  ? 64.761  15.149   -25.418 1.00 135.78 ? 264  ALA A CA    1 
ATOM   5620  C  C     . ALA I  4 264  ? 63.925  14.018   -26.006 1.00 139.86 ? 264  ALA A C     1 
ATOM   5621  O  O     . ALA I  4 264  ? 63.952  13.792   -27.219 1.00 156.42 ? 264  ALA A O     1 
ATOM   5622  C  CB    . ALA I  4 264  ? 66.203  14.703   -25.325 1.00 134.59 ? 264  ALA A CB    1 
ATOM   5623  N  N     . GLU I  4 265  ? 63.202  13.298   -25.150 1.00 139.40 ? 265  GLU A N     1 
ATOM   5624  C  CA    . GLU I  4 265  ? 62.374  12.172   -25.566 1.00 135.15 ? 265  GLU A CA    1 
ATOM   5625  C  C     . GLU I  4 265  ? 60.890  12.499   -25.608 1.00 133.37 ? 265  GLU A C     1 
ATOM   5626  O  O     . GLU I  4 265  ? 60.149  11.871   -26.353 1.00 137.52 ? 265  GLU A O     1 
ATOM   5627  C  CB    . GLU I  4 265  ? 62.604  10.989   -24.628 1.00 137.40 ? 265  GLU A CB    1 
ATOM   5628  C  CG    . GLU I  4 265  ? 62.039  9.666    -25.124 1.00 142.87 ? 265  GLU A CG    1 
ATOM   5629  C  CD    . GLU I  4 265  ? 60.700  9.317    -24.493 1.00 145.08 ? 265  GLU A CD    1 
ATOM   5630  O  OE1   . GLU I  4 265  ? 60.670  9.149    -23.254 1.00 138.00 ? 265  GLU A OE1   1 
ATOM   5631  O  OE2   . GLU I  4 265  ? 59.689  9.192    -25.231 1.00 147.50 ? 265  GLU A OE2   1 
ATOM   5632  N  N     . TRP I  4 266  ? 60.445  13.458   -24.804 1.00 138.06 ? 266  TRP A N     1 
ATOM   5633  C  CA    . TRP I  4 266  ? 59.017  13.796   -24.740 1.00 140.04 ? 266  TRP A CA    1 
ATOM   5634  C  C     . TRP I  4 266  ? 58.708  15.187   -25.202 1.00 144.95 ? 266  TRP A C     1 
ATOM   5635  O  O     . TRP I  4 266  ? 57.800  15.388   -26.008 1.00 153.75 ? 266  TRP A O     1 
ATOM   5636  C  CB    . TRP I  4 266  ? 58.493  13.652   -23.320 1.00 141.35 ? 266  TRP A CB    1 
ATOM   5637  C  CG    . TRP I  4 266  ? 58.341  12.224   -22.867 1.00 137.44 ? 266  TRP A CG    1 
ATOM   5638  C  CD1   . TRP I  4 266  ? 59.103  11.546   -21.921 1.00 135.94 ? 266  TRP A CD1   1 
ATOM   5639  C  CD2   . TRP I  4 266  ? 57.357  11.251   -23.332 1.00 130.86 ? 266  TRP A CD2   1 
ATOM   5640  N  NE1   . TRP I  4 266  ? 58.671  10.257   -21.784 1.00 135.44 ? 266  TRP A NE1   1 
ATOM   5641  C  CE2   . TRP I  4 266  ? 57.622  10.019   -22.601 1.00 132.42 ? 266  TRP A CE2   1 
ATOM   5642  C  CE3   . TRP I  4 266  ? 56.323  11.280   -24.244 1.00 135.79 ? 266  TRP A CE3   1 
ATOM   5643  C  CZ2   . TRP I  4 266  ? 56.861  8.880    -22.789 1.00 135.43 ? 266  TRP A CZ2   1 
ATOM   5644  C  CZ3   . TRP I  4 266  ? 55.565  10.123   -24.440 1.00 134.72 ? 266  TRP A CZ3   1 
ATOM   5645  C  CH2   . TRP I  4 266  ? 55.824  8.956    -23.726 1.00 135.91 ? 266  TRP A CH2   1 
ATOM   5646  N  N     . GLY I  4 267  ? 59.423  16.168   -24.662 1.00 146.90 ? 267  GLY A N     1 
ATOM   5647  C  CA    . GLY I  4 267  ? 59.210  17.561   -25.042 1.00 148.86 ? 267  GLY A CA    1 
ATOM   5648  C  C     . GLY I  4 267  ? 58.298  18.262   -24.066 1.00 143.31 ? 267  GLY A C     1 
ATOM   5649  O  O     . GLY I  4 267  ? 58.038  17.742   -22.997 1.00 135.60 ? 267  GLY A O     1 
ATOM   5650  N  N     . ASP I  4 268  ? 57.821  19.447   -24.432 1.00 148.70 ? 268  ASP A N     1 
ATOM   5651  C  CA    . ASP I  4 268  ? 57.023  20.279   -23.529 1.00 148.08 ? 268  ASP A CA    1 
ATOM   5652  C  C     . ASP I  4 268  ? 55.513  19.997   -23.594 1.00 144.36 ? 268  ASP A C     1 
ATOM   5653  O  O     . ASP I  4 268  ? 54.743  20.548   -22.817 1.00 147.90 ? 268  ASP A O     1 
ATOM   5654  C  CB    . ASP I  4 268  ? 57.292  21.753   -23.838 1.00 152.76 ? 268  ASP A CB    1 
ATOM   5655  C  CG    . ASP I  4 268  ? 58.733  22.108   -23.661 1.00 160.46 ? 268  ASP A CG    1 
ATOM   5656  O  OD1   . ASP I  4 268  ? 59.381  22.479   -24.671 1.00 173.91 ? 268  ASP A OD1   1 
ATOM   5657  O  OD2   . ASP I  4 268  ? 59.225  21.978   -22.513 1.00 167.69 ? 268  ASP A OD2   1 
ATOM   5658  N  N     . GLU I  4 269  ? 55.088  19.130   -24.503 1.00 146.64 ? 269  GLU A N     1 
ATOM   5659  C  CA    . GLU I  4 269  ? 53.668  18.971   -24.793 1.00 148.47 ? 269  GLU A CA    1 
ATOM   5660  C  C     . GLU I  4 269  ? 52.875  18.336   -23.657 1.00 151.42 ? 269  GLU A C     1 
ATOM   5661  O  O     . GLU I  4 269  ? 51.774  18.788   -23.351 1.00 171.77 ? 269  GLU A O     1 
ATOM   5662  C  CB    . GLU I  4 269  ? 53.469  18.170   -26.074 1.00 155.04 ? 269  GLU A CB    1 
ATOM   5663  C  CG    . GLU I  4 269  ? 52.099  18.343   -26.696 1.00 159.15 ? 269  GLU A CG    1 
ATOM   5664  C  CD    . GLU I  4 269  ? 51.804  17.261   -27.713 1.00 173.86 ? 269  GLU A CD    1 
ATOM   5665  O  OE1   . GLU I  4 269  ? 50.626  16.854   -27.810 1.00 190.59 ? 269  GLU A OE1   1 
ATOM   5666  O  OE2   . GLU I  4 269  ? 52.750  16.811   -28.408 1.00 176.70 ? 269  GLU A OE2   1 
ATOM   5667  N  N     . PRO I  4 270  ? 53.410  17.280   -23.033 1.00 146.83 ? 270  PRO A N     1 
ATOM   5668  C  CA    . PRO I  4 270  ? 52.706  16.721   -21.875 1.00 145.91 ? 270  PRO A CA    1 
ATOM   5669  C  C     . PRO I  4 270  ? 52.520  17.708   -20.710 1.00 142.30 ? 270  PRO A C     1 
ATOM   5670  O  O     . PRO I  4 270  ? 51.554  17.599   -19.964 1.00 137.48 ? 270  PRO A O     1 
ATOM   5671  C  CB    . PRO I  4 270  ? 53.614  15.559   -21.452 1.00 149.12 ? 270  PRO A CB    1 
ATOM   5672  C  CG    . PRO I  4 270  ? 54.383  15.200   -22.689 1.00 143.58 ? 270  PRO A CG    1 
ATOM   5673  C  CD    . PRO I  4 270  ? 54.619  16.509   -23.364 1.00 145.37 ? 270  PRO A CD    1 
ATOM   5674  N  N     . PHE I  4 271  ? 53.437  18.664   -20.576 1.00 143.95 ? 271  PHE A N     1 
ATOM   5675  C  CA    . PHE I  4 271  ? 53.437  19.608   -19.468 1.00 139.56 ? 271  PHE A CA    1 
ATOM   5676  C  C     . PHE I  4 271  ? 52.612  20.844   -19.793 1.00 134.10 ? 271  PHE A C     1 
ATOM   5677  O  O     . PHE I  4 271  ? 51.879  21.345   -18.943 1.00 145.69 ? 271  PHE A O     1 
ATOM   5678  C  CB    . PHE I  4 271  ? 54.880  19.977   -19.094 1.00 139.37 ? 271  PHE A CB    1 
ATOM   5679  C  CG    . PHE I  4 271  ? 55.665  18.834   -18.480 1.00 141.63 ? 271  PHE A CG    1 
ATOM   5680  C  CD1   . PHE I  4 271  ? 56.130  17.793   -19.267 1.00 138.60 ? 271  PHE A CD1   1 
ATOM   5681  C  CD2   . PHE I  4 271  ? 55.937  18.799   -17.112 1.00 147.06 ? 271  PHE A CD2   1 
ATOM   5682  C  CE1   . PHE I  4 271  ? 56.850  16.747   -18.711 1.00 138.03 ? 271  PHE A CE1   1 
ATOM   5683  C  CE2   . PHE I  4 271  ? 56.664  17.757   -16.552 1.00 146.35 ? 271  PHE A CE2   1 
ATOM   5684  C  CZ    . PHE I  4 271  ? 57.119  16.728   -17.355 1.00 138.62 ? 271  PHE A CZ    1 
ATOM   5685  N  N     . ASP I  4 272  ? 52.716  21.325   -21.024 1.00 135.46 ? 272  ASP A N     1 
ATOM   5686  C  CA    . ASP I  4 272  ? 51.948  22.500   -21.457 1.00 139.30 ? 272  ASP A CA    1 
ATOM   5687  C  C     . ASP I  4 272  ? 50.452  22.187   -21.600 1.00 138.22 ? 272  ASP A C     1 
ATOM   5688  O  O     . ASP I  4 272  ? 49.617  23.018   -21.270 1.00 137.12 ? 272  ASP A O     1 
ATOM   5689  C  CB    . ASP I  4 272  ? 52.534  23.091   -22.754 1.00 139.09 ? 272  ASP A CB    1 
ATOM   5690  C  CG    . ASP I  4 272  ? 53.905  23.781   -22.527 1.00 139.37 ? 272  ASP A CG    1 
ATOM   5691  O  OD1   . ASP I  4 272  ? 54.477  23.629   -21.425 1.00 133.95 ? 272  ASP A OD1   1 
ATOM   5692  O  OD2   . ASP I  4 272  ? 54.424  24.473   -23.437 1.00 137.28 ? 272  ASP A OD2   1 
ATOM   5693  N  N     . ASN I  4 273  ? 50.119  20.986   -22.066 1.00 142.17 ? 273  ASN A N     1 
ATOM   5694  C  CA    . ASN I  4 273  ? 48.716  20.563   -22.164 1.00 138.27 ? 273  ASN A CA    1 
ATOM   5695  C  C     . ASN I  4 273  ? 48.065  20.486   -20.802 1.00 132.69 ? 273  ASN A C     1 
ATOM   5696  O  O     . ASN I  4 273  ? 46.889  20.803   -20.653 1.00 140.40 ? 273  ASN A O     1 
ATOM   5697  C  CB    . ASN I  4 273  ? 48.579  19.210   -22.865 1.00 135.57 ? 273  ASN A CB    1 
ATOM   5698  C  CG    . ASN I  4 273  ? 48.630  19.327   -24.366 1.00 139.35 ? 273  ASN A CG    1 
ATOM   5699  O  OD1   . ASN I  4 273  ? 48.319  18.378   -25.078 1.00 156.81 ? 273  ASN A OD1   1 
ATOM   5700  N  ND2   . ASN I  4 273  ? 49.010  20.495   -24.857 1.00 144.62 ? 273  ASN A ND2   1 
ATOM   5701  N  N     . THR I  4 274  ? 48.843  20.072   -19.813 1.00 133.98 ? 274  THR A N     1 
ATOM   5702  C  CA    . THR I  4 274  ? 48.366  19.939   -18.437 1.00 133.46 ? 274  THR A CA    1 
ATOM   5703  C  C     . THR I  4 274  ? 47.823  21.256   -17.907 1.00 131.73 ? 274  THR A C     1 
ATOM   5704  O  O     . THR I  4 274  ? 46.732  21.315   -17.346 1.00 137.65 ? 274  THR A O     1 
ATOM   5705  C  CB    . THR I  4 274  ? 49.490  19.453   -17.509 1.00 127.72 ? 274  THR A CB    1 
ATOM   5706  O  OG1   . THR I  4 274  ? 49.772  18.081   -17.793 1.00 136.63 ? 274  THR A OG1   1 
ATOM   5707  C  CG2   . THR I  4 274  ? 49.094  19.572   -16.094 1.00 130.20 ? 274  THR A CG2   1 
ATOM   5708  N  N     . VAL I  4 275  ? 48.580  22.318   -18.110 1.00 132.88 ? 275  VAL A N     1 
ATOM   5709  C  CA    . VAL I  4 275  ? 48.163  23.639   -17.662 1.00 132.96 ? 275  VAL A CA    1 
ATOM   5710  C  C     . VAL I  4 275  ? 46.978  24.158   -18.486 1.00 136.65 ? 275  VAL A C     1 
ATOM   5711  O  O     . VAL I  4 275  ? 46.064  24.776   -17.940 1.00 138.53 ? 275  VAL A O     1 
ATOM   5712  C  CB    . VAL I  4 275  ? 49.321  24.657   -17.739 1.00 131.78 ? 275  VAL A CB    1 
ATOM   5713  C  CG1   . VAL I  4 275  ? 48.887  25.991   -17.148 1.00 124.88 ? 275  VAL A CG1   1 
ATOM   5714  C  CG2   . VAL I  4 275  ? 50.562  24.131   -17.022 1.00 131.15 ? 275  VAL A CG2   1 
ATOM   5715  N  N     . GLU I  4 276  ? 46.996  23.896   -19.792 1.00 144.71 ? 276  GLU A N     1 
ATOM   5716  C  CA    . GLU I  4 276  ? 45.961  24.387   -20.706 1.00 148.69 ? 276  GLU A CA    1 
ATOM   5717  C  C     . GLU I  4 276  ? 44.611  23.706   -20.497 1.00 144.63 ? 276  GLU A C     1 
ATOM   5718  O  O     . GLU I  4 276  ? 43.569  24.351   -20.596 1.00 154.52 ? 276  GLU A O     1 
ATOM   5719  C  CB    . GLU I  4 276  ? 46.398  24.210   -22.170 1.00 158.57 ? 276  GLU A CB    1 
ATOM   5720  C  CG    . GLU I  4 276  ? 45.438  24.811   -23.193 1.00 162.00 ? 276  GLU A CG    1 
ATOM   5721  C  CD    . GLU I  4 276  ? 45.129  26.266   -22.903 1.00 163.47 ? 276  GLU A CD    1 
ATOM   5722  O  OE1   . GLU I  4 276  ? 46.018  26.995   -22.414 1.00 186.02 ? 276  GLU A OE1   1 
ATOM   5723  O  OE2   . GLU I  4 276  ? 43.989  26.683   -23.146 1.00 162.80 ? 276  GLU A OE2   1 
ATOM   5724  N  N     . ILE I  4 277  ? 44.621  22.406   -20.231 1.00 136.21 ? 277  ILE A N     1 
ATOM   5725  C  CA    . ILE I  4 277  ? 43.379  21.705   -19.884 1.00 140.22 ? 277  ILE A CA    1 
ATOM   5726  C  C     . ILE I  4 277  ? 42.809  22.176   -18.543 1.00 138.23 ? 277  ILE A C     1 
ATOM   5727  O  O     . ILE I  4 277  ? 41.598  22.379   -18.434 1.00 125.56 ? 277  ILE A O     1 
ATOM   5728  C  CB    . ILE I  4 277  ? 43.560  20.180   -19.828 1.00 138.29 ? 277  ILE A CB    1 
ATOM   5729  C  CG1   . ILE I  4 277  ? 43.826  19.632   -21.224 1.00 133.39 ? 277  ILE A CG1   1 
ATOM   5730  C  CG2   . ILE I  4 277  ? 42.304  19.527   -19.273 1.00 135.07 ? 277  ILE A CG2   1 
ATOM   5731  C  CD1   . ILE I  4 277  ? 44.148  18.163   -21.233 1.00 127.47 ? 277  ILE A CD1   1 
ATOM   5732  N  N     . ALA I  4 278  ? 43.688  22.351   -17.547 1.00 139.66 ? 278  ALA A N     1 
ATOM   5733  C  CA    . ALA I  4 278  ? 43.295  22.864   -16.223 1.00 140.17 ? 278  ALA A CA    1 
ATOM   5734  C  C     . ALA I  4 278  ? 42.699  24.264   -16.285 1.00 145.64 ? 278  ALA A C     1 
ATOM   5735  O  O     . ALA I  4 278  ? 41.839  24.602   -15.458 1.00 155.88 ? 278  ALA A O     1 
ATOM   5736  C  CB    . ALA I  4 278  ? 44.468  22.846   -15.260 1.00 131.71 ? 278  ALA A CB    1 
ATOM   5737  N  N     . ARG I  4 279  ? 43.158  25.063   -17.254 1.00 142.40 ? 279  ARG A N     1 
ATOM   5738  C  CA    . ARG I  4 279  ? 42.632  26.407   -17.477 1.00 145.00 ? 279  ARG A CA    1 
ATOM   5739  C  C     . ARG I  4 279  ? 41.185  26.371   -17.971 1.00 146.88 ? 279  ARG A C     1 
ATOM   5740  O  O     . ARG I  4 279  ? 40.351  27.173   -17.538 1.00 155.42 ? 279  ARG A O     1 
ATOM   5741  C  CB    . ARG I  4 279  ? 43.507  27.163   -18.484 1.00 151.99 ? 279  ARG A CB    1 
ATOM   5742  C  CG    . ARG I  4 279  ? 43.082  28.607   -18.744 1.00 157.17 ? 279  ARG A CG    1 
ATOM   5743  C  CD    . ARG I  4 279  ? 43.838  29.234   -19.901 1.00 155.71 ? 279  ARG A CD    1 
ATOM   5744  N  NE    . ARG I  4 279  ? 43.274  30.529   -20.280 1.00 155.76 ? 279  ARG A NE    1 
ATOM   5745  C  CZ    . ARG I  4 279  ? 43.708  31.272   -21.300 1.00 173.11 ? 279  ARG A CZ    1 
ATOM   5746  N  NH1   . ARG I  4 279  ? 44.720  30.850   -22.061 1.00 186.26 ? 279  ARG A NH1   1 
ATOM   5747  N  NH2   . ARG I  4 279  ? 43.130  32.443   -21.569 1.00 167.75 ? 279  ARG A NH2   1 
ATOM   5748  N  N     . MET I  4 280  ? 40.889  25.433   -18.864 1.00 140.85 ? 280  MET A N     1 
ATOM   5749  C  CA    . MET I  4 280  ? 39.586  25.383   -19.518 1.00 145.03 ? 280  MET A CA    1 
ATOM   5750  C  C     . MET I  4 280  ? 38.629  24.371   -18.887 1.00 143.86 ? 280  MET A C     1 
ATOM   5751  O  O     . MET I  4 280  ? 37.805  23.776   -19.587 1.00 141.46 ? 280  MET A O     1 
ATOM   5752  C  CB    . MET I  4 280  ? 39.761  25.076   -21.004 1.00 159.32 ? 280  MET A CB    1 
ATOM   5753  C  CG    . MET I  4 280  ? 40.271  23.670   -21.306 1.00 176.04 ? 280  MET A CG    1 
ATOM   5754  S  SD    . MET I  4 280  ? 40.540  23.345   -23.067 1.00 195.95 ? 280  MET A SD    1 
ATOM   5755  C  CE    . MET I  4 280  ? 41.718  24.631   -23.474 1.00 188.81 ? 280  MET A CE    1 
ATOM   5756  N  N     . CYS I  4 281  ? 38.741  24.173   -17.571 1.00 144.27 ? 281  CYS A N     1 
ATOM   5757  C  CA    . CYS I  4 281  ? 37.765  23.387   -16.800 1.00 133.91 ? 281  CYS A CA    1 
ATOM   5758  C  C     . CYS I  4 281  ? 36.978  24.314   -15.885 1.00 130.94 ? 281  CYS A C     1 
ATOM   5759  O  O     . CYS I  4 281  ? 37.213  24.355   -14.680 1.00 143.13 ? 281  CYS A O     1 
ATOM   5760  C  CB    . CYS I  4 281  ? 38.461  22.304   -15.956 1.00 130.56 ? 281  CYS A CB    1 
ATOM   5761  S  SG    . CYS I  4 281  ? 38.878  20.792   -16.847 1.00 132.43 ? 281  CYS A SG    1 
ATOM   5762  N  N     . ASP I  4 282  ? 36.038  25.053   -16.455 1.00 130.77 ? 282  ASP A N     1 
ATOM   5763  C  CA    . ASP I  4 282  ? 35.251  26.010   -15.679 1.00 138.61 ? 282  ASP A CA    1 
ATOM   5764  C  C     . ASP I  4 282  ? 33.994  25.349   -15.112 1.00 137.76 ? 282  ASP A C     1 
ATOM   5765  O  O     . ASP I  4 282  ? 32.958  25.302   -15.777 1.00 140.17 ? 282  ASP A O     1 
ATOM   5766  C  CB    . ASP I  4 282  ? 34.881  27.218   -16.548 1.00 141.75 ? 282  ASP A CB    1 
ATOM   5767  C  CG    . ASP I  4 282  ? 34.033  28.236   -15.809 1.00 145.24 ? 282  ASP A CG    1 
ATOM   5768  O  OD1   . ASP I  4 282  ? 34.239  28.452   -14.593 1.00 148.54 ? 282  ASP A OD1   1 
ATOM   5769  O  OD2   . ASP I  4 282  ? 33.149  28.825   -16.457 1.00 161.58 ? 282  ASP A OD2   1 
ATOM   5770  N  N     . VAL I  4 283  ? 34.090  24.843   -13.883 1.00 134.05 ? 283  VAL A N     1 
ATOM   5771  C  CA    . VAL I  4 283  ? 32.954  24.180   -13.224 1.00 129.85 ? 283  VAL A CA    1 
ATOM   5772  C  C     . VAL I  4 283  ? 32.610  24.823   -11.879 1.00 121.44 ? 283  VAL A C     1 
ATOM   5773  O  O     . VAL I  4 283  ? 33.308  24.649   -10.891 1.00 118.24 ? 283  VAL A O     1 
ATOM   5774  C  CB    . VAL I  4 283  ? 33.224  22.677   -13.003 1.00 133.40 ? 283  VAL A CB    1 
ATOM   5775  C  CG1   . VAL I  4 283  ? 32.012  22.002   -12.382 1.00 126.76 ? 283  VAL A CG1   1 
ATOM   5776  C  CG2   . VAL I  4 283  ? 33.593  21.993   -14.314 1.00 133.47 ? 283  VAL A CG2   1 
ATOM   5777  N  N     . ASP I  4 284  ? 31.514  25.566   -11.852 1.00 125.54 ? 284  ASP A N     1 
ATOM   5778  C  CA    . ASP I  4 284  ? 31.074  26.257   -10.652 1.00 127.44 ? 284  ASP A CA    1 
ATOM   5779  C  C     . ASP I  4 284  ? 29.825  25.551   -10.139 1.00 123.39 ? 284  ASP A C     1 
ATOM   5780  O  O     . ASP I  4 284  ? 28.835  25.430   -10.852 1.00 124.57 ? 284  ASP A O     1 
ATOM   5781  C  CB    . ASP I  4 284  ? 30.757  27.738   -10.953 1.00 129.85 ? 284  ASP A CB    1 
ATOM   5782  C  CG    . ASP I  4 284  ? 32.007  28.593   -11.171 1.00 132.75 ? 284  ASP A CG    1 
ATOM   5783  O  OD1   . ASP I  4 284  ? 33.020  28.384   -10.468 1.00 142.06 ? 284  ASP A OD1   1 
ATOM   5784  O  OD2   . ASP I  4 284  ? 31.967  29.503   -12.028 1.00 140.02 ? 284  ASP A OD2   1 
ATOM   5785  N  N     . LEU I  4 285  ? 29.885  25.086   -8.900  1.00 125.35 ? 285  LEU A N     1 
ATOM   5786  C  CA    . LEU I  4 285  ? 28.726  24.486   -8.232  1.00 126.24 ? 285  LEU A CA    1 
ATOM   5787  C  C     . LEU I  4 285  ? 27.908  25.594   -7.551  1.00 122.79 ? 285  LEU A C     1 
ATOM   5788  O  O     . LEU I  4 285  ? 28.467  26.623   -7.166  1.00 121.64 ? 285  LEU A O     1 
ATOM   5789  C  CB    . LEU I  4 285  ? 29.172  23.420   -7.199  1.00 118.26 ? 285  LEU A CB    1 
ATOM   5790  C  CG    . LEU I  4 285  ? 30.161  22.355   -7.693  1.00 109.81 ? 285  LEU A CG    1 
ATOM   5791  C  CD1   . LEU I  4 285  ? 30.561  21.460   -6.553  1.00 111.71 ? 285  LEU A CD1   1 
ATOM   5792  C  CD2   . LEU I  4 285  ? 29.605  21.517   -8.831  1.00 112.90 ? 285  LEU A CD2   1 
ATOM   5793  N  N     . PRO I  4 286  ? 26.587  25.387   -7.410  1.00 121.96 ? 286  PRO A N     1 
ATOM   5794  C  CA    . PRO I  4 286  ? 25.774  26.323   -6.630  1.00 127.13 ? 286  PRO A CA    1 
ATOM   5795  C  C     . PRO I  4 286  ? 26.096  26.310   -5.137  1.00 125.22 ? 286  PRO A C     1 
ATOM   5796  O  O     . PRO I  4 286  ? 25.470  25.576   -4.384  1.00 140.31 ? 286  PRO A O     1 
ATOM   5797  C  CB    . PRO I  4 286  ? 24.331  25.833   -6.871  1.00 127.89 ? 286  PRO A CB    1 
ATOM   5798  C  CG    . PRO I  4 286  ? 24.405  24.936   -8.059  1.00 125.11 ? 286  PRO A CG    1 
ATOM   5799  C  CD    . PRO I  4 286  ? 25.767  24.339   -8.044  1.00 118.70 ? 286  PRO A CD    1 
ATOM   5800  N  N     . ILE I  4 287  ? 27.058  27.116   -4.710  1.00 122.67 ? 287  ILE A N     1 
ATOM   5801  C  CA    . ILE I  4 287  ? 27.459  27.132   -3.313  1.00 123.33 ? 287  ILE A CA    1 
ATOM   5802  C  C     . ILE I  4 287  ? 27.715  28.550   -2.876  1.00 122.49 ? 287  ILE A C     1 
ATOM   5803  O  O     . ILE I  4 287  ? 28.335  29.308   -3.611  1.00 135.85 ? 287  ILE A O     1 
ATOM   5804  C  CB    . ILE I  4 287  ? 28.731  26.300   -3.104  1.00 126.00 ? 287  ILE A CB    1 
ATOM   5805  C  CG1   . ILE I  4 287  ? 28.415  24.809   -3.252  1.00 136.34 ? 287  ILE A CG1   1 
ATOM   5806  C  CG2   . ILE I  4 287  ? 29.311  26.546   -1.730  1.00 130.68 ? 287  ILE A CG2   1 
ATOM   5807  C  CD1   . ILE I  4 287  ? 29.600  23.898   -2.986  1.00 139.83 ? 287  ILE A CD1   1 
ATOM   5808  N  N     . GLY I  4 288  ? 27.234  28.905   -1.687  1.00 120.04 ? 288  GLY A N     1 
ATOM   5809  C  CA    . GLY I  4 288  ? 27.560  30.188   -1.068  1.00 124.84 ? 288  GLY A CA    1 
ATOM   5810  C  C     . GLY I  4 288  ? 26.853  31.370   -1.699  1.00 121.39 ? 288  GLY A C     1 
ATOM   5811  O  O     . GLY I  4 288  ? 25.663  31.589   -1.462  1.00 117.13 ? 288  GLY A O     1 
ATOM   5812  N  N     . ASP I  4 289  ? 27.592  32.131   -2.507  1.00 123.44 ? 289  ASP A N     1 
ATOM   5813  C  CA    . ASP I  4 289  ? 27.038  33.305   -3.180  1.00 128.27 ? 289  ASP A CA    1 
ATOM   5814  C  C     . ASP I  4 289  ? 25.905  32.895   -4.129  1.00 128.28 ? 289  ASP A C     1 
ATOM   5815  O  O     . ASP I  4 289  ? 24.955  33.660   -4.355  1.00 119.19 ? 289  ASP A O     1 
ATOM   5816  C  CB    . ASP I  4 289  ? 28.137  34.064   -3.939  1.00 131.11 ? 289  ASP A CB    1 
ATOM   5817  C  CG    . ASP I  4 289  ? 29.208  34.632   -3.016  1.00 136.55 ? 289  ASP A CG    1 
ATOM   5818  O  OD1   . ASP I  4 289  ? 29.278  34.224   -1.845  1.00 148.39 ? 289  ASP A OD1   1 
ATOM   5819  O  OD2   . ASP I  4 289  ? 29.993  35.490   -3.454  1.00 146.04 ? 289  ASP A OD2   1 
ATOM   5820  N  N     . LYS I  4 290  ? 26.023  31.681   -4.672  1.00 131.65 ? 290  LYS A N     1 
ATOM   5821  C  CA    . LYS I  4 290  ? 24.969  31.051   -5.468  1.00 138.97 ? 290  LYS A CA    1 
ATOM   5822  C  C     . LYS I  4 290  ? 23.927  30.462   -4.496  1.00 145.94 ? 290  LYS A C     1 
ATOM   5823  O  O     . LYS I  4 290  ? 23.285  31.216   -3.761  1.00 156.54 ? 290  LYS A O     1 
ATOM   5824  C  CB    . LYS I  4 290  ? 25.580  29.985   -6.392  1.00 138.16 ? 290  LYS A CB    1 
ATOM   5825  C  CG    . LYS I  4 290  ? 26.676  30.492   -7.341  1.00 144.22 ? 290  LYS A CG    1 
ATOM   5826  C  CD    . LYS I  4 290  ? 26.150  31.494   -8.380  1.00 150.79 ? 290  LYS A CD    1 
ATOM   5827  C  CE    . LYS I  4 290  ? 27.232  31.935   -9.365  1.00 150.91 ? 290  LYS A CE    1 
ATOM   5828  N  NZ    . LYS I  4 290  ? 26.725  32.865   -10.420 1.00 146.78 ? 290  LYS A NZ    1 
ATOM   5829  N  N     . MET I  4 291  ? 23.767  29.138   -4.464  1.00 144.94 ? 291  MET A N     1 
ATOM   5830  C  CA    . MET I  4 291  ? 23.026  28.470   -3.387  1.00 145.06 ? 291  MET A CA    1 
ATOM   5831  C  C     . MET I  4 291  ? 21.606  28.973   -3.302  1.00 139.42 ? 291  MET A C     1 
ATOM   5832  O  O     . MET I  4 291  ? 21.054  29.099   -2.212  1.00 152.48 ? 291  MET A O     1 
ATOM   5833  C  CB    . MET I  4 291  ? 23.711  28.695   -2.024  1.00 153.55 ? 291  MET A CB    1 
ATOM   5834  C  CG    . MET I  4 291  ? 23.078  27.942   -0.843  1.00 153.24 ? 291  MET A CG    1 
ATOM   5835  S  SD    . MET I  4 291  ? 24.108  27.936   0.637   1.00 179.31 ? 291  MET A SD    1 
ATOM   5836  C  CE    . MET I  4 291  ? 22.955  27.302   1.850   1.00 166.05 ? 291  MET A CE    1 
ATOM   5837  N  N     . VAL I  4 292  ? 21.010  29.288   -4.439  1.00 134.73 ? 292  VAL A N     1 
ATOM   5838  C  CA    . VAL I  4 292  ? 19.617  29.717   -4.409  1.00 140.17 ? 292  VAL A CA    1 
ATOM   5839  C  C     . VAL I  4 292  ? 18.819  28.519   -3.883  1.00 139.96 ? 292  VAL A C     1 
ATOM   5840  O  O     . VAL I  4 292  ? 19.032  27.385   -4.316  1.00 152.85 ? 292  VAL A O     1 
ATOM   5841  C  CB    . VAL I  4 292  ? 19.110  30.216   -5.784  1.00 129.32 ? 292  VAL A CB    1 
ATOM   5842  C  CG1   . VAL I  4 292  ? 19.864  31.474   -6.184  1.00 125.09 ? 292  VAL A CG1   1 
ATOM   5843  C  CG2   . VAL I  4 292  ? 19.236  29.128   -6.845  1.00 124.61 ? 292  VAL A CG2   1 
ATOM   5844  N  N     . TYR I  4 293  ? 17.952  28.761   -2.908  1.00 126.68 ? 293  TYR A N     1 
ATOM   5845  C  CA    . TYR I  4 293  ? 17.216  27.682   -2.287  1.00 128.90 ? 293  TYR A CA    1 
ATOM   5846  C  C     . TYR I  4 293  ? 16.269  26.997   -3.276  1.00 129.55 ? 293  TYR A C     1 
ATOM   5847  O  O     . TYR I  4 293  ? 15.347  27.637   -3.800  1.00 129.23 ? 293  TYR A O     1 
ATOM   5848  C  CB    . TYR I  4 293  ? 16.444  28.196   -1.071  1.00 130.99 ? 293  TYR A CB    1 
ATOM   5849  C  CG    . TYR I  4 293  ? 17.336  28.634   0.068   1.00 125.20 ? 293  TYR A CG    1 
ATOM   5850  C  CD1   . TYR I  4 293  ? 18.109  27.708   0.766   1.00 125.26 ? 293  TYR A CD1   1 
ATOM   5851  C  CD2   . TYR I  4 293  ? 17.380  29.965   0.470   1.00 125.77 ? 293  TYR A CD2   1 
ATOM   5852  C  CE1   . TYR I  4 293  ? 18.925  28.101   1.815   1.00 126.44 ? 293  TYR A CE1   1 
ATOM   5853  C  CE2   . TYR I  4 293  ? 18.187  30.369   1.521   1.00 126.83 ? 293  TYR A CE2   1 
ATOM   5854  C  CZ    . TYR I  4 293  ? 18.964  29.438   2.187   1.00 125.13 ? 293  TYR A CZ    1 
ATOM   5855  O  OH    . TYR I  4 293  ? 19.771  29.837   3.228   1.00 120.52 ? 293  TYR A OH    1 
ATOM   5856  N  N     . ARG I  4 294  ? 16.531  25.706   -3.528  1.00 126.30 ? 294  ARG A N     1 
ATOM   5857  C  CA    . ARG I  4 294  ? 15.684  24.863   -4.362  1.00 129.54 ? 294  ARG A CA    1 
ATOM   5858  C  C     . ARG I  4 294  ? 14.609  24.155   -3.518  1.00 129.57 ? 294  ARG A C     1 
ATOM   5859  O  O     . ARG I  4 294  ? 14.882  23.124   -2.881  1.00 118.17 ? 294  ARG A O     1 
ATOM   5860  C  CB    . ARG I  4 294  ? 16.533  23.828   -5.112  1.00 135.50 ? 294  ARG A CB    1 
ATOM   5861  C  CG    . ARG I  4 294  ? 17.573  24.408   -6.063  1.00 140.76 ? 294  ARG A CG    1 
ATOM   5862  C  CD    . ARG I  4 294  ? 17.826  23.490   -7.263  1.00 141.02 ? 294  ARG A CD    1 
ATOM   5863  N  NE    . ARG I  4 294  ? 18.869  24.015   -8.145  1.00 143.56 ? 294  ARG A NE    1 
ATOM   5864  C  CZ    . ARG I  4 294  ? 19.110  23.597   -9.387  1.00 143.37 ? 294  ARG A CZ    1 
ATOM   5865  N  NH1   . ARG I  4 294  ? 18.382  22.628   -9.932  1.00 144.39 ? 294  ARG A NH1   1 
ATOM   5866  N  NH2   . ARG I  4 294  ? 20.088  24.164   -10.094 1.00 144.46 ? 294  ARG A NH2   1 
ATOM   5867  N  N     . ILE I  4 295  ? 13.392  24.714   -3.529  1.00 130.27 ? 295  ILE A N     1 
ATOM   5868  C  CA    . ILE I  4 295  ? 12.273  24.191   -2.732  1.00 123.32 ? 295  ILE A CA    1 
ATOM   5869  C  C     . ILE I  4 295  ? 11.375  23.272   -3.547  1.00 117.83 ? 295  ILE A C     1 
ATOM   5870  O  O     . ILE I  4 295  ? 10.955  23.630   -4.643  1.00 123.80 ? 295  ILE A O     1 
ATOM   5871  C  CB    . ILE I  4 295  ? 11.360  25.302   -2.199  1.00 124.31 ? 295  ILE A CB    1 
ATOM   5872  C  CG1   . ILE I  4 295  ? 12.176  26.395   -1.494  1.00 122.24 ? 295  ILE A CG1   1 
ATOM   5873  C  CG2   . ILE I  4 295  ? 10.284  24.686   -1.298  1.00 118.12 ? 295  ILE A CG2   1 
ATOM   5874  C  CD1   . ILE I  4 295  ? 11.349  27.597   -1.089  1.00 128.10 ? 295  ILE A CD1   1 
ATOM   5875  N  N     . PRO I  4 296  ? 11.051  22.102   -3.004  1.00 113.22 ? 296  PRO A N     1 
ATOM   5876  C  CA    . PRO I  4 296  ? 10.221  21.152   -3.730  1.00 116.76 ? 296  PRO A CA    1 
ATOM   5877  C  C     . PRO I  4 296  ? 8.806   21.629   -3.843  1.00 118.32 ? 296  PRO A C     1 
ATOM   5878  O  O     . PRO I  4 296  ? 8.453   22.633   -3.241  1.00 119.35 ? 296  PRO A O     1 
ATOM   5879  C  CB    . PRO I  4 296  ? 10.299  19.869   -2.887  1.00 118.29 ? 296  PRO A CB    1 
ATOM   5880  C  CG    . PRO I  4 296  ? 10.767  20.291   -1.543  1.00 115.66 ? 296  PRO A CG    1 
ATOM   5881  C  CD    . PRO I  4 296  ? 11.556  21.553   -1.737  1.00 118.54 ? 296  PRO A CD    1 
ATOM   5882  N  N     . ARG I  4 297  ? 8.017   20.899   -4.622  1.00 128.30 ? 297  ARG A N     1 
ATOM   5883  C  CA    . ARG I  4 297  ? 6.653   21.291   -4.959  1.00 132.49 ? 297  ARG A CA    1 
ATOM   5884  C  C     . ARG I  4 297  ? 5.629   20.436   -4.229  1.00 128.90 ? 297  ARG A C     1 
ATOM   5885  O  O     . ARG I  4 297  ? 5.844   19.233   -4.016  1.00 129.67 ? 297  ARG A O     1 
ATOM   5886  C  CB    . ARG I  4 297  ? 6.438   21.150   -6.468  1.00 145.49 ? 297  ARG A CB    1 
ATOM   5887  C  CG    . ARG I  4 297  ? 7.404   21.962   -7.311  1.00 149.17 ? 297  ARG A CG    1 
ATOM   5888  C  CD    . ARG I  4 297  ? 7.259   21.622   -8.779  1.00 158.12 ? 297  ARG A CD    1 
ATOM   5889  N  NE    . ARG I  4 297  ? 8.156   22.432   -9.597  1.00 165.85 ? 297  ARG A NE    1 
ATOM   5890  C  CZ    . ARG I  4 297  ? 9.468   22.235   -9.707  1.00 166.26 ? 297  ARG A CZ    1 
ATOM   5891  N  NH1   . ARG I  4 297  ? 10.074  21.242   -9.049  1.00 172.58 ? 297  ARG A NH1   1 
ATOM   5892  N  NH2   . ARG I  4 297  ? 10.181  23.038   -10.486 1.00 158.08 ? 297  ARG A NH2   1 
ATOM   5893  N  N     . PHE I  4 298  ? 4.510   21.064   -3.872  1.00 124.34 ? 298  PHE A N     1 
ATOM   5894  C  CA    . PHE I  4 298  ? 3.436   20.411   -3.144  1.00 124.97 ? 298  PHE A CA    1 
ATOM   5895  C  C     . PHE I  4 298  ? 2.119   20.609   -3.901  1.00 126.14 ? 298  PHE A C     1 
ATOM   5896  O  O     . PHE I  4 298  ? 1.607   21.729   -3.965  1.00 115.78 ? 298  PHE A O     1 
ATOM   5897  C  CB    . PHE I  4 298  ? 3.334   20.970   -1.717  1.00 125.01 ? 298  PHE A CB    1 
ATOM   5898  C  CG    . PHE I  4 298  ? 2.427   20.163   -0.820  1.00 133.44 ? 298  PHE A CG    1 
ATOM   5899  C  CD1   . PHE I  4 298  ? 2.827   18.903   -0.355  1.00 132.97 ? 298  PHE A CD1   1 
ATOM   5900  C  CD2   . PHE I  4 298  ? 1.161   20.636   -0.463  1.00 128.10 ? 298  PHE A CD2   1 
ATOM   5901  C  CE1   . PHE I  4 298  ? 1.995   18.143   0.455   1.00 128.09 ? 298  PHE A CE1   1 
ATOM   5902  C  CE2   . PHE I  4 298  ? 0.334   19.879   0.347   1.00 130.70 ? 298  PHE A CE2   1 
ATOM   5903  C  CZ    . PHE I  4 298  ? 0.754   18.634   0.810   1.00 130.61 ? 298  PHE A CZ    1 
ATOM   5904  N  N     . PRO I  4 299  ? 1.563   19.524   -4.475  1.00 129.45 ? 299  PRO A N     1 
ATOM   5905  C  CA    . PRO I  4 299  ? 0.344   19.662   -5.271  1.00 133.03 ? 299  PRO A CA    1 
ATOM   5906  C  C     . PRO I  4 299  ? -0.931  19.269   -4.529  1.00 128.70 ? 299  PRO A C     1 
ATOM   5907  O  O     . PRO I  4 299  ? -1.160  18.082   -4.287  1.00 135.00 ? 299  PRO A O     1 
ATOM   5908  C  CB    . PRO I  4 299  ? 0.601   18.694   -6.426  1.00 140.92 ? 299  PRO A CB    1 
ATOM   5909  C  CG    . PRO I  4 299  ? 1.418   17.594   -5.791  1.00 140.65 ? 299  PRO A CG    1 
ATOM   5910  C  CD    . PRO I  4 299  ? 2.111   18.158   -4.576  1.00 126.73 ? 299  PRO A CD    1 
ATOM   5911  N  N     . LEU I  4 300  ? -1.731  20.259   -4.142  1.00 121.43 ? 300  LEU A N     1 
ATOM   5912  C  CA    . LEU I  4 300  ? -3.128  20.016   -3.752  1.00 129.44 ? 300  LEU A CA    1 
ATOM   5913  C  C     . LEU I  4 300  ? -4.194  20.886   -4.480  1.00 136.44 ? 300  LEU A C     1 
ATOM   5914  O  O     . LEU I  4 300  ? -5.386  20.782   -4.185  1.00 132.34 ? 300  LEU A O     1 
ATOM   5915  C  CB    . LEU I  4 300  ? -3.295  20.167   -2.229  1.00 129.62 ? 300  LEU A CB    1 
ATOM   5916  C  CG    . LEU I  4 300  ? -4.470  19.381   -1.595  1.00 125.08 ? 300  LEU A CG    1 
ATOM   5917  C  CD1   . LEU I  4 300  ? -4.102  17.908   -1.488  1.00 124.45 ? 300  LEU A CD1   1 
ATOM   5918  C  CD2   . LEU I  4 300  ? -4.908  19.930   -0.241  1.00 118.71 ? 300  LEU A CD2   1 
ATOM   5919  N  N     . PRO I  4 301  ? -3.789  21.735   -5.440  1.00 145.78 ? 301  PRO A N     1 
ATOM   5920  C  CA    . PRO I  4 301  ? -4.847  22.562   -6.040  1.00 149.81 ? 301  PRO A CA    1 
ATOM   5921  C  C     . PRO I  4 301  ? -5.752  21.795   -7.015  1.00 148.51 ? 301  PRO A C     1 
ATOM   5922  O  O     . PRO I  4 301  ? -5.232  20.945   -7.745  1.00 150.44 ? 301  PRO A O     1 
ATOM   5923  C  CB    . PRO I  4 301  ? -4.049  23.624   -6.804  1.00 152.70 ? 301  PRO A CB    1 
ATOM   5924  C  CG    . PRO I  4 301  ? -2.802  22.916   -7.216  1.00 154.63 ? 301  PRO A CG    1 
ATOM   5925  C  CD    . PRO I  4 301  ? -2.481  21.971   -6.085  1.00 150.06 ? 301  PRO A CD    1 
ATOM   5926  N  N     . GLU I  4 302  ? -7.068  22.045   -7.074  1.00 149.50 ? 302  GLU A N     1 
ATOM   5927  C  CA    . GLU I  4 302  ? -7.880  22.937   -6.212  1.00 146.24 ? 302  GLU A CA    1 
ATOM   5928  C  C     . GLU I  4 302  ? -7.506  24.418   -6.249  1.00 146.06 ? 302  GLU A C     1 
ATOM   5929  O  O     . GLU I  4 302  ? -6.407  24.801   -5.854  1.00 151.22 ? 302  GLU A O     1 
ATOM   5930  C  CB    . GLU I  4 302  ? -7.981  22.376   -4.783  1.00 150.04 ? 302  GLU A CB    1 
ATOM   5931  C  CG    . GLU I  4 302  ? -7.279  23.116   -3.643  1.00 151.76 ? 302  GLU A CG    1 
ATOM   5932  C  CD    . GLU I  4 302  ? -7.304  22.319   -2.337  1.00 155.59 ? 302  GLU A CD    1 
ATOM   5933  O  OE1   . GLU I  4 302  ? -6.520  22.614   -1.414  1.00 146.69 ? 302  GLU A OE1   1 
ATOM   5934  O  OE2   . GLU I  4 302  ? -8.116  21.379   -2.218  1.00 175.62 ? 302  GLU A OE2   1 
ATOM   5935  N  N     . GLY I  4 303  ? -8.435  25.249   -6.728  1.00 144.20 ? 303  GLY A N     1 
ATOM   5936  C  CA    . GLY I  4 303  ? -8.166  26.683   -6.954  1.00 152.52 ? 303  GLY A CA    1 
ATOM   5937  C  C     . GLY I  4 303  ? -7.686  27.453   -5.724  1.00 153.59 ? 303  GLY A C     1 
ATOM   5938  O  O     . GLY I  4 303  ? -8.431  28.239   -5.144  1.00 160.00 ? 303  GLY A O     1 
ATOM   5939  N  N     . ARG I  4 304  ? -6.433  27.232   -5.335  1.00 148.76 ? 304  ARG A N     1 
ATOM   5940  C  CA    . ARG I  4 304  ? -5.873  27.835   -4.130  1.00 144.71 ? 304  ARG A CA    1 
ATOM   5941  C  C     . ARG I  4 304  ? -4.363  28.046   -4.273  1.00 137.32 ? 304  ARG A C     1 
ATOM   5942  O  O     . ARG I  4 304  ? -3.656  27.239   -4.884  1.00 119.45 ? 304  ARG A O     1 
ATOM   5943  C  CB    . ARG I  4 304  ? -6.190  26.975   -2.891  1.00 144.05 ? 304  ARG A CB    1 
ATOM   5944  C  CG    . ARG I  4 304  ? -7.617  27.149   -2.392  1.00 146.28 ? 304  ARG A CG    1 
ATOM   5945  C  CD    . ARG I  4 304  ? -7.843  26.527   -1.026  1.00 150.63 ? 304  ARG A CD    1 
ATOM   5946  N  NE    . ARG I  4 304  ? -8.530  25.235   -1.099  1.00 157.89 ? 304  ARG A NE    1 
ATOM   5947  C  CZ    . ARG I  4 304  ? -9.833  25.072   -1.346  1.00 160.65 ? 304  ARG A CZ    1 
ATOM   5948  N  NH1   . ARG I  4 304  ? -10.630 26.121   -1.556  1.00 169.71 ? 304  ARG A NH1   1 
ATOM   5949  N  NH2   . ARG I  4 304  ? -10.351 23.847   -1.390  1.00 153.09 ? 304  ARG A NH2   1 
ATOM   5950  N  N     . THR I  4 305  ? -3.893  29.155   -3.713  1.00 129.42 ? 305  THR A N     1 
ATOM   5951  C  CA    . THR I  4 305  ? -2.487  29.480   -3.715  1.00 127.27 ? 305  THR A CA    1 
ATOM   5952  C  C     . THR I  4 305  ? -1.764  28.645   -2.681  1.00 117.64 ? 305  THR A C     1 
ATOM   5953  O  O     . THR I  4 305  ? -2.362  28.145   -1.761  1.00 113.82 ? 305  THR A O     1 
ATOM   5954  C  CB    . THR I  4 305  ? -2.281  30.967   -3.384  1.00 130.21 ? 305  THR A CB    1 
ATOM   5955  O  OG1   . THR I  4 305  ? -3.270  31.730   -4.071  1.00 139.00 ? 305  THR A OG1   1 
ATOM   5956  C  CG2   . THR I  4 305  ? -0.896  31.436   -3.807  1.00 132.55 ? 305  THR A CG2   1 
ATOM   5957  N  N     . GLU I  4 306  ? -0.461  28.508   -2.849  1.00 124.06 ? 306  GLU A N     1 
ATOM   5958  C  CA    . GLU I  4 306  ? 0.383   27.794   -1.898  1.00 123.04 ? 306  GLU A CA    1 
ATOM   5959  C  C     . GLU I  4 306  ? 0.337   28.454   -0.533  1.00 115.45 ? 306  GLU A C     1 
ATOM   5960  O  O     . GLU I  4 306  ? 0.291   27.771   0.471   1.00 116.76 ? 306  GLU A O     1 
ATOM   5961  C  CB    . GLU I  4 306  ? 1.829   27.736   -2.423  1.00 127.02 ? 306  GLU A CB    1 
ATOM   5962  C  CG    . GLU I  4 306  ? 2.742   26.747   -1.718  1.00 125.50 ? 306  GLU A CG    1 
ATOM   5963  C  CD    . GLU I  4 306  ? 4.085   26.580   -2.429  1.00 131.11 ? 306  GLU A CD    1 
ATOM   5964  O  OE1   . GLU I  4 306  ? 4.799   27.594   -2.659  1.00 138.03 ? 306  GLU A OE1   1 
ATOM   5965  O  OE2   . GLU I  4 306  ? 4.439   25.424   -2.745  1.00 124.84 ? 306  GLU A OE2   1 
ATOM   5966  N  N     . ALA I  4 307  ? 0.335   29.782   -0.503  1.00 119.39 ? 307  ALA A N     1 
ATOM   5967  C  CA    . ALA I  4 307  ? 0.335   30.535   0.766   1.00 123.55 ? 307  ALA A CA    1 
ATOM   5968  C  C     . ALA I  4 307  ? -1.050  30.580   1.368   1.00 125.77 ? 307  ALA A C     1 
ATOM   5969  O  O     . ALA I  4 307  ? -1.201  30.684   2.573   1.00 132.84 ? 307  ALA A O     1 
ATOM   5970  C  CB    . ALA I  4 307  ? 0.845   31.954   0.559   1.00 126.08 ? 307  ALA A CB    1 
ATOM   5971  N  N     . GLN I  4 308  ? -2.059  30.516   0.508   1.00 132.30 ? 308  GLN A N     1 
ATOM   5972  C  CA    . GLN I  4 308  ? -3.461  30.579   0.912   1.00 125.39 ? 308  GLN A CA    1 
ATOM   5973  C  C     . GLN I  4 308  ? -3.896  29.295   1.597   1.00 114.58 ? 308  GLN A C     1 
ATOM   5974  O  O     . GLN I  4 308  ? -4.716  29.321   2.493   1.00 118.41 ? 308  GLN A O     1 
ATOM   5975  C  CB    . GLN I  4 308  ? -4.325  30.841   -0.330  1.00 134.45 ? 308  GLN A CB    1 
ATOM   5976  C  CG    . GLN I  4 308  ? -5.822  30.917   -0.104  1.00 138.78 ? 308  GLN A CG    1 
ATOM   5977  C  CD    . GLN I  4 308  ? -6.559  31.379   -1.351  1.00 139.38 ? 308  GLN A CD    1 
ATOM   5978  O  OE1   . GLN I  4 308  ? -6.169  32.355   -1.988  1.00 143.85 ? 308  GLN A OE1   1 
ATOM   5979  N  NE2   . GLN I  4 308  ? -7.623  30.673   -1.710  1.00 142.46 ? 308  GLN A NE2   1 
ATOM   5980  N  N     . TYR I  4 309  ? -3.358  28.164   1.165   1.00 119.73 ? 309  TYR A N     1 
ATOM   5981  C  CA    . TYR I  4 309  ? -3.720  26.872   1.761   1.00 125.50 ? 309  TYR A CA    1 
ATOM   5982  C  C     . TYR I  4 309  ? -3.082  26.693   3.144   1.00 119.76 ? 309  TYR A C     1 
ATOM   5983  O  O     . TYR I  4 309  ? -3.643  26.013   4.014   1.00 113.12 ? 309  TYR A O     1 
ATOM   5984  C  CB    . TYR I  4 309  ? -3.362  25.705   0.814   1.00 126.85 ? 309  TYR A CB    1 
ATOM   5985  C  CG    . TYR I  4 309  ? -3.789  24.349   1.333   1.00 127.83 ? 309  TYR A CG    1 
ATOM   5986  C  CD1   . TYR I  4 309  ? -5.113  24.110   1.687   1.00 122.75 ? 309  TYR A CD1   1 
ATOM   5987  C  CD2   . TYR I  4 309  ? -2.865  23.312   1.483   1.00 128.67 ? 309  TYR A CD2   1 
ATOM   5988  C  CE1   . TYR I  4 309  ? -5.507  22.886   2.182   1.00 126.06 ? 309  TYR A CE1   1 
ATOM   5989  C  CE2   . TYR I  4 309  ? -3.256  22.078   1.964   1.00 127.72 ? 309  TYR A CE2   1 
ATOM   5990  C  CZ    . TYR I  4 309  ? -4.582  21.874   2.314   1.00 127.21 ? 309  TYR A CZ    1 
ATOM   5991  O  OH    . TYR I  4 309  ? -5.008  20.669   2.813   1.00 128.56 ? 309  TYR A OH    1 
ATOM   5992  N  N     . LEU I  4 310  ? -1.920  27.318   3.337   1.00 119.40 ? 310  LEU A N     1 
ATOM   5993  C  CA    . LEU I  4 310  ? -1.268  27.344   4.638   1.00 117.34 ? 310  LEU A CA    1 
ATOM   5994  C  C     . LEU I  4 310  ? -2.137  28.129   5.623   1.00 122.64 ? 310  LEU A C     1 
ATOM   5995  O  O     . LEU I  4 310  ? -2.256  27.741   6.792   1.00 133.43 ? 310  LEU A O     1 
ATOM   5996  C  CB    . LEU I  4 310  ? 0.138   27.957   4.556   1.00 112.30 ? 310  LEU A CB    1 
ATOM   5997  C  CG    . LEU I  4 310  ? 0.943   27.957   5.873   1.00 111.67 ? 310  LEU A CG    1 
ATOM   5998  C  CD1   . LEU I  4 310  ? 1.050   26.551   6.437   1.00 106.72 ? 310  LEU A CD1   1 
ATOM   5999  C  CD2   . LEU I  4 310  ? 2.331   28.559   5.721   1.00 113.98 ? 310  LEU A CD2   1 
ATOM   6000  N  N     . ARG I  4 311  ? -2.747  29.217   5.147   1.00 122.06 ? 311  ARG A N     1 
ATOM   6001  C  CA    . ARG I  4 311  ? -3.659  30.029   5.964   1.00 124.79 ? 311  ARG A CA    1 
ATOM   6002  C  C     . ARG I  4 311  ? -4.913  29.257   6.372   1.00 129.61 ? 311  ARG A C     1 
ATOM   6003  O  O     . ARG I  4 311  ? -5.341  29.331   7.519   1.00 147.63 ? 311  ARG A O     1 
ATOM   6004  C  CB    . ARG I  4 311  ? -4.065  31.318   5.235   1.00 122.56 ? 311  ARG A CB    1 
ATOM   6005  C  CG    . ARG I  4 311  ? -3.032  32.436   5.308   1.00 124.17 ? 311  ARG A CG    1 
ATOM   6006  C  CD    . ARG I  4 311  ? -3.646  33.821   5.123   1.00 126.87 ? 311  ARG A CD    1 
ATOM   6007  N  NE    . ARG I  4 311  ? -2.858  34.860   5.806   1.00 131.84 ? 311  ARG A NE    1 
ATOM   6008  C  CZ    . ARG I  4 311  ? -2.125  35.800   5.208   1.00 137.85 ? 311  ARG A CZ    1 
ATOM   6009  N  NH1   . ARG I  4 311  ? -2.055  35.877   3.891   1.00 147.45 ? 311  ARG A NH1   1 
ATOM   6010  N  NH2   . ARG I  4 311  ? -1.455  36.685   5.932   1.00 142.13 ? 311  ARG A NH2   1 
ATOM   6011  N  N     . GLU I  4 312  ? -5.500  28.532   5.431   1.00 126.83 ? 312  GLU A N     1 
ATOM   6012  C  CA    . GLU I  4 312  ? -6.628  27.657   5.726   1.00 127.76 ? 312  GLU A CA    1 
ATOM   6013  C  C     . GLU I  4 312  ? -6.345  26.699   6.879   1.00 128.19 ? 312  GLU A C     1 
ATOM   6014  O  O     . GLU I  4 312  ? -7.100  26.670   7.859   1.00 127.49 ? 312  GLU A O     1 
ATOM   6015  C  CB    . GLU I  4 312  ? -6.997  26.842   4.489   1.00 130.22 ? 312  GLU A CB    1 
ATOM   6016  C  CG    . GLU I  4 312  ? -8.059  27.489   3.638   1.00 128.83 ? 312  GLU A CG    1 
ATOM   6017  C  CD    . GLU I  4 312  ? -8.717  26.495   2.729   1.00 126.43 ? 312  GLU A CD    1 
ATOM   6018  O  OE1   . GLU I  4 312  ? -9.920  26.255   2.903   1.00 147.98 ? 312  GLU A OE1   1 
ATOM   6019  O  OE2   . GLU I  4 312  ? -8.031  25.931   1.870   1.00 121.46 ? 312  GLU A OE2   1 
ATOM   6020  N  N     . LEU I  4 313  ? -5.261  25.929   6.746   1.00 122.95 ? 313  LEU A N     1 
ATOM   6021  C  CA    . LEU I  4 313  ? -4.877  24.926   7.738   1.00 121.89 ? 313  LEU A CA    1 
ATOM   6022  C  C     . LEU I  4 313  ? -4.565  25.547   9.103   1.00 124.15 ? 313  LEU A C     1 
ATOM   6023  O  O     . LEU I  4 313  ? -4.775  24.920   10.132  1.00 137.09 ? 313  LEU A O     1 
ATOM   6024  C  CB    . LEU I  4 313  ? -3.668  24.120   7.248   1.00 119.56 ? 313  LEU A CB    1 
ATOM   6025  C  CG    . LEU I  4 313  ? -3.869  23.323   5.961   1.00 113.17 ? 313  LEU A CG    1 
ATOM   6026  C  CD1   . LEU I  4 313  ? -2.539  22.765   5.498   1.00 108.47 ? 313  LEU A CD1   1 
ATOM   6027  C  CD2   . LEU I  4 313  ? -4.886  22.213   6.132   1.00 117.79 ? 313  LEU A CD2   1 
ATOM   6028  N  N     . THR I  4 314  ? -4.045  26.765   9.111   1.00 124.40 ? 314  THR A N     1 
ATOM   6029  C  CA    . THR I  4 314  ? -3.749  27.459   10.356  1.00 122.54 ? 314  THR A CA    1 
ATOM   6030  C  C     . THR I  4 314  ? -5.029  27.847   11.063  1.00 124.38 ? 314  THR A C     1 
ATOM   6031  O  O     . THR I  4 314  ? -5.129  27.669   12.271  1.00 131.07 ? 314  THR A O     1 
ATOM   6032  C  CB    . THR I  4 314  ? -2.927  28.735   10.102  1.00 124.80 ? 314  THR A CB    1 
ATOM   6033  O  OG1   . THR I  4 314  ? -1.709  28.389   9.419   1.00 116.00 ? 314  THR A OG1   1 
ATOM   6034  C  CG2   . THR I  4 314  ? -2.628  29.466   11.430  1.00 123.36 ? 314  THR A CG2   1 
ATOM   6035  N  N     . PHE I  4 315  ? -5.997  28.385   10.313  1.00 128.38 ? 315  PHE A N     1 
ATOM   6036  C  CA    . PHE I  4 315  ? -7.271  28.859   10.890  1.00 127.29 ? 315  PHE A CA    1 
ATOM   6037  C  C     . PHE I  4 315  ? -8.169  27.712   11.304  1.00 123.66 ? 315  PHE A C     1 
ATOM   6038  O  O     . PHE I  4 315  ? -8.904  27.858   12.276  1.00 137.86 ? 315  PHE A O     1 
ATOM   6039  C  CB    . PHE I  4 315  ? -8.051  29.790   9.944   1.00 126.61 ? 315  PHE A CB    1 
ATOM   6040  C  CG    . PHE I  4 315  ? -7.308  31.043   9.555   1.00 123.31 ? 315  PHE A CG    1 
ATOM   6041  C  CD1   . PHE I  4 315  ? -7.247  31.436   8.223   1.00 120.71 ? 315  PHE A CD1   1 
ATOM   6042  C  CD2   . PHE I  4 315  ? -6.675  31.830   10.514  1.00 122.30 ? 315  PHE A CD2   1 
ATOM   6043  C  CE1   . PHE I  4 315  ? -6.561  32.578   7.849   1.00 117.75 ? 315  PHE A CE1   1 
ATOM   6044  C  CE2   . PHE I  4 315  ? -5.988  32.975   10.146  1.00 122.10 ? 315  PHE A CE2   1 
ATOM   6045  C  CZ    . PHE I  4 315  ? -5.928  33.348   8.811   1.00 119.24 ? 315  PHE A CZ    1 
ATOM   6046  N  N     . LEU I  4 316  ? -8.128  26.593   10.572  1.00 115.71 ? 316  LEU A N     1 
ATOM   6047  C  CA    . LEU I  4 316  ? -8.828  25.351   10.991  1.00 113.84 ? 316  LEU A CA    1 
ATOM   6048  C  C     . LEU I  4 316  ? -8.197  24.703   12.237  1.00 111.01 ? 316  LEU A C     1 
ATOM   6049  O  O     . LEU I  4 316  ? -8.884  24.083   13.035  1.00 118.75 ? 316  LEU A O     1 
ATOM   6050  C  CB    . LEU I  4 316  ? -8.860  24.316   9.863   1.00 112.46 ? 316  LEU A CB    1 
ATOM   6051  C  CG    . LEU I  4 316  ? -9.776  24.638   8.679   1.00 110.87 ? 316  LEU A CG    1 
ATOM   6052  C  CD1   . LEU I  4 316  ? -9.392  23.908   7.400   1.00 109.13 ? 316  LEU A CD1   1 
ATOM   6053  C  CD2   . LEU I  4 316  ? -11.190 24.282   9.075   1.00 108.20 ? 316  LEU A CD2   1 
ATOM   6054  N  N     . GLY I  4 317  ? -6.895  24.857   12.399  1.00 109.49 ? 317  GLY A N     1 
ATOM   6055  C  CA    . GLY I  4 317  ? -6.197  24.339   13.555  1.00 111.89 ? 317  GLY A CA    1 
ATOM   6056  C  C     . GLY I  4 317  ? -6.465  25.135   14.815  1.00 122.76 ? 317  GLY A C     1 
ATOM   6057  O  O     . GLY I  4 317  ? -6.508  24.567   15.908  1.00 139.86 ? 317  GLY A O     1 
ATOM   6058  N  N     . LEU I  4 318  ? -6.645  26.447   14.685  1.00 124.23 ? 318  LEU A N     1 
ATOM   6059  C  CA    . LEU I  4 318  ? -6.851  27.300   15.863  1.00 131.93 ? 318  LEU A CA    1 
ATOM   6060  C  C     . LEU I  4 318  ? -8.164  26.974   16.588  1.00 130.86 ? 318  LEU A C     1 
ATOM   6061  O  O     . LEU I  4 318  ? -8.222  26.971   17.826  1.00 135.06 ? 318  LEU A O     1 
ATOM   6062  C  CB    . LEU I  4 318  ? -6.789  28.788   15.483  1.00 131.78 ? 318  LEU A CB    1 
ATOM   6063  C  CG    . LEU I  4 318  ? -5.397  29.386   15.224  1.00 123.12 ? 318  LEU A CG    1 
ATOM   6064  C  CD1   . LEU I  4 318  ? -5.525  30.745   14.556  1.00 117.03 ? 318  LEU A CD1   1 
ATOM   6065  C  CD2   . LEU I  4 318  ? -4.617  29.508   16.521  1.00 123.12 ? 318  LEU A CD2   1 
ATOM   6066  N  N     . LEU I  4 319  ? -9.202  26.681   15.817  1.00 125.02 ? 319  LEU A N     1 
ATOM   6067  C  CA    . LEU I  4 319  ? -10.465 26.249   16.395  1.00 135.17 ? 319  LEU A CA    1 
ATOM   6068  C  C     . LEU I  4 319  ? -10.286 24.927   17.148  1.00 137.02 ? 319  LEU A C     1 
ATOM   6069  O  O     . LEU I  4 319  ? -10.852 24.707   18.227  1.00 129.30 ? 319  LEU A O     1 
ATOM   6070  C  CB    . LEU I  4 319  ? -11.504 26.077   15.294  1.00 134.99 ? 319  LEU A CB    1 
ATOM   6071  C  CG    . LEU I  4 319  ? -11.882 27.347   14.546  1.00 137.49 ? 319  LEU A CG    1 
ATOM   6072  C  CD1   . LEU I  4 319  ? -12.623 27.020   13.261  1.00 138.42 ? 319  LEU A CD1   1 
ATOM   6073  C  CD2   . LEU I  4 319  ? -12.728 28.229   15.443  1.00 142.44 ? 319  LEU A CD2   1 
ATOM   6074  N  N     . ARG I  4 320  ? -9.468  24.065   16.558  1.00 144.22 ? 320  ARG A N     1 
ATOM   6075  C  CA    . ARG I  4 320  ? -9.276  22.703   17.026  1.00 150.29 ? 320  ARG A CA    1 
ATOM   6076  C  C     . ARG I  4 320  ? -8.450  22.659   18.320  1.00 146.53 ? 320  ARG A C     1 
ATOM   6077  O  O     . ARG I  4 320  ? -8.670  21.780   19.158  1.00 142.50 ? 320  ARG A O     1 
ATOM   6078  C  CB    . ARG I  4 320  ? -8.622  21.879   15.899  1.00 154.09 ? 320  ARG A CB    1 
ATOM   6079  C  CG    . ARG I  4 320  ? -8.607  20.365   16.097  1.00 168.07 ? 320  ARG A CG    1 
ATOM   6080  C  CD    . ARG I  4 320  ? -8.731  19.613   14.769  1.00 171.01 ? 320  ARG A CD    1 
ATOM   6081  N  NE    . ARG I  4 320  ? -8.053  18.304   14.762  1.00 175.09 ? 320  ARG A NE    1 
ATOM   6082  C  CZ    . ARG I  4 320  ? -6.770  18.101   14.440  1.00 162.22 ? 320  ARG A CZ    1 
ATOM   6083  N  NH1   . ARG I  4 320  ? -5.989  19.127   14.098  1.00 153.92 ? 320  ARG A NH1   1 
ATOM   6084  N  NH2   . ARG I  4 320  ? -6.263  16.862   14.454  1.00 143.24 ? 320  ARG A NH2   1 
ATOM   6085  N  N     . ARG I  4 321  ? -7.535  23.620   18.485  1.00 142.13 ? 321  ARG A N     1 
ATOM   6086  C  CA    . ARG I  4 321  ? -6.602  23.639   19.623  1.00 142.56 ? 321  ARG A CA    1 
ATOM   6087  C  C     . ARG I  4 321  ? -6.882  24.693   20.670  1.00 134.80 ? 321  ARG A C     1 
ATOM   6088  O  O     . ARG I  4 321  ? -6.321  24.635   21.757  1.00 142.94 ? 321  ARG A O     1 
ATOM   6089  C  CB    . ARG I  4 321  ? -5.169  23.826   19.139  1.00 149.35 ? 321  ARG A CB    1 
ATOM   6090  C  CG    . ARG I  4 321  ? -4.633  22.627   18.383  1.00 150.42 ? 321  ARG A CG    1 
ATOM   6091  C  CD    . ARG I  4 321  ? -3.226  22.877   17.889  1.00 148.31 ? 321  ARG A CD    1 
ATOM   6092  N  NE    . ARG I  4 321  ? -2.748  21.740   17.105  1.00 159.32 ? 321  ARG A NE    1 
ATOM   6093  C  CZ    . ARG I  4 321  ? -2.272  20.610   17.622  1.00 151.61 ? 321  ARG A CZ    1 
ATOM   6094  N  NH1   . ARG I  4 321  ? -2.194  20.456   18.937  1.00 137.14 ? 321  ARG A NH1   1 
ATOM   6095  N  NH2   . ARG I  4 321  ? -1.872  19.629   16.813  1.00 152.21 ? 321  ARG A NH2   1 
ATOM   6096  N  N     . TYR I  4 322  ? -7.715  25.673   20.341  1.00 139.00 ? 322  TYR A N     1 
ATOM   6097  C  CA    . TYR I  4 322  ? -8.246  26.615   21.344  1.00 134.68 ? 322  TYR A CA    1 
ATOM   6098  C  C     . TYR I  4 322  ? -9.778  26.634   21.266  1.00 134.56 ? 322  TYR A C     1 
ATOM   6099  O  O     . TYR I  4 322  ? -10.358 27.549   20.683  1.00 122.91 ? 322  TYR A O     1 
ATOM   6100  C  CB    . TYR I  4 322  ? -7.691  28.010   21.109  1.00 129.61 ? 322  TYR A CB    1 
ATOM   6101  C  CG    . TYR I  4 322  ? -6.192  28.062   21.114  1.00 130.41 ? 322  TYR A CG    1 
ATOM   6102  C  CD1   . TYR I  4 322  ? -5.476  28.344   19.954  1.00 135.33 ? 322  TYR A CD1   1 
ATOM   6103  C  CD2   . TYR I  4 322  ? -5.484  27.812   22.267  1.00 129.65 ? 322  TYR A CD2   1 
ATOM   6104  C  CE1   . TYR I  4 322  ? -4.088  28.382   19.958  1.00 134.21 ? 322  TYR A CE1   1 
ATOM   6105  C  CE2   . TYR I  4 322  ? -4.099  27.850   22.285  1.00 128.75 ? 322  TYR A CE2   1 
ATOM   6106  C  CZ    . TYR I  4 322  ? -3.402  28.131   21.135  1.00 129.48 ? 322  TYR A CZ    1 
ATOM   6107  O  OH    . TYR I  4 322  ? -2.024  28.146   21.177  1.00 126.65 ? 322  TYR A OH    1 
ATOM   6108  N  N     . PRO I  4 323  ? -10.435 25.609   21.845  1.00 133.10 ? 323  PRO A N     1 
ATOM   6109  C  CA    . PRO I  4 323  ? -11.866 25.446   21.644  1.00 136.66 ? 323  PRO A CA    1 
ATOM   6110  C  C     . PRO I  4 323  ? -12.708 26.401   22.484  1.00 137.41 ? 323  PRO A C     1 
ATOM   6111  O  O     . PRO I  4 323  ? -13.821 26.741   22.082  1.00 134.46 ? 323  PRO A O     1 
ATOM   6112  C  CB    . PRO I  4 323  ? -12.102 24.000   22.065  1.00 138.49 ? 323  PRO A CB    1 
ATOM   6113  C  CG    . PRO I  4 323  ? -11.061 23.755   23.100  1.00 135.13 ? 323  PRO A CG    1 
ATOM   6114  C  CD    . PRO I  4 323  ? -9.871  24.545   22.693  1.00 125.08 ? 323  PRO A CD    1 
ATOM   6115  N  N     . ASP I  4 324  ? -12.179 26.831   23.629  1.00 143.96 ? 324  ASP A N     1 
ATOM   6116  C  CA    . ASP I  4 324  ? -12.931 27.661   24.583  1.00 150.55 ? 324  ASP A CA    1 
ATOM   6117  C  C     . ASP I  4 324  ? -12.941 29.141   24.187  1.00 147.74 ? 324  ASP A C     1 
ATOM   6118  O  O     . ASP I  4 324  ? -13.653 29.950   24.797  1.00 149.25 ? 324  ASP A O     1 
ATOM   6119  C  CB    . ASP I  4 324  ? -12.379 27.496   26.019  1.00 152.46 ? 324  ASP A CB    1 
ATOM   6120  C  CG    . ASP I  4 324  ? -12.537 26.075   26.560  1.00 160.64 ? 324  ASP A CG    1 
ATOM   6121  O  OD1   . ASP I  4 324  ? -11.592 25.577   27.220  1.00 167.72 ? 324  ASP A OD1   1 
ATOM   6122  O  OD2   . ASP I  4 324  ? -13.602 25.456   26.325  1.00 167.58 ? 324  ASP A OD2   1 
ATOM   6123  N  N     . ARG I  4 325  ? -12.197 29.493   23.138  1.00 148.80 ? 325  ARG A N     1 
ATOM   6124  C  CA    . ARG I  4 325  ? -12.017 30.909   22.766  1.00 147.70 ? 325  ARG A CA    1 
ATOM   6125  C  C     . ARG I  4 325  ? -12.060 31.178   21.254  1.00 142.16 ? 325  ARG A C     1 
ATOM   6126  O  O     . ARG I  4 325  ? -12.777 32.067   20.812  1.00 157.87 ? 325  ARG A O     1 
ATOM   6127  C  CB    . ARG I  4 325  ? -10.729 31.454   23.382  1.00 139.00 ? 325  ARG A CB    1 
ATOM   6128  C  CG    . ARG I  4 325  ? -9.534  30.537   23.231  1.00 147.30 ? 325  ARG A CG    1 
ATOM   6129  C  CD    . ARG I  4 325  ? -8.492  30.700   24.328  1.00 156.28 ? 325  ARG A CD    1 
ATOM   6130  N  NE    . ARG I  4 325  ? -8.176  32.103   24.576  1.00 168.62 ? 325  ARG A NE    1 
ATOM   6131  C  CZ    . ARG I  4 325  ? -8.674  32.841   25.572  1.00 181.24 ? 325  ARG A CZ    1 
ATOM   6132  N  NH1   . ARG I  4 325  ? -9.523  32.332   26.465  1.00 178.30 ? 325  ARG A NH1   1 
ATOM   6133  N  NH2   . ARG I  4 325  ? -8.313  34.112   25.677  1.00 191.45 ? 325  ARG A NH2   1 
ATOM   6134  N  N     . ILE I  4 326  ? -11.304 30.417   20.470  1.00 133.13 ? 326  ILE A N     1 
ATOM   6135  C  CA    . ILE I  4 326  ? -11.376 30.494   19.004  1.00 129.79 ? 326  ILE A CA    1 
ATOM   6136  C  C     . ILE I  4 326  ? -12.543 29.630   18.494  1.00 130.01 ? 326  ILE A C     1 
ATOM   6137  O  O     . ILE I  4 326  ? -12.411 28.417   18.308  1.00 129.15 ? 326  ILE A O     1 
ATOM   6138  C  CB    . ILE I  4 326  ? -10.060 30.025   18.337  1.00 130.18 ? 326  ILE A CB    1 
ATOM   6139  C  CG1   . ILE I  4 326  ? -8.864  30.888   18.769  1.00 127.48 ? 326  ILE A CG1   1 
ATOM   6140  C  CG2   . ILE I  4 326  ? -10.168 30.074   16.823  1.00 129.21 ? 326  ILE A CG2   1 
ATOM   6141  C  CD1   . ILE I  4 326  ? -8.798  32.262   18.110  1.00 119.64 ? 326  ILE A CD1   1 
ATOM   6142  N  N     . THR I  4 327  ? -13.679 30.280   18.254  1.00 133.45 ? 327  THR A N     1 
ATOM   6143  C  CA    . THR I  4 327  ? -14.934 29.607   17.907  1.00 134.63 ? 327  THR A CA    1 
ATOM   6144  C  C     . THR I  4 327  ? -15.521 30.123   16.584  1.00 134.22 ? 327  THR A C     1 
ATOM   6145  O  O     . THR I  4 327  ? -14.980 31.052   15.980  1.00 139.49 ? 327  THR A O     1 
ATOM   6146  C  CB    . THR I  4 327  ? -15.971 29.809   19.028  1.00 134.25 ? 327  THR A CB    1 
ATOM   6147  O  OG1   . THR I  4 327  ? -16.182 31.211   19.248  1.00 135.28 ? 327  THR A OG1   1 
ATOM   6148  C  CG2   . THR I  4 327  ? -15.482 29.182   20.302  1.00 131.92 ? 327  THR A CG2   1 
ATOM   6149  N  N     . GLU I  4 328  ? -16.625 29.519   16.139  1.00 129.86 ? 328  GLU A N     1 
ATOM   6150  C  CA    . GLU I  4 328  ? -17.290 29.946   14.910  1.00 134.05 ? 328  GLU A CA    1 
ATOM   6151  C  C     . GLU I  4 328  ? -17.785 31.404   15.042  1.00 138.32 ? 328  GLU A C     1 
ATOM   6152  O  O     . GLU I  4 328  ? -17.672 32.214   14.120  1.00 134.28 ? 328  GLU A O     1 
ATOM   6153  C  CB    . GLU I  4 328  ? -18.447 29.001   14.551  1.00 134.13 ? 328  GLU A CB    1 
ATOM   6154  C  CG    . GLU I  4 328  ? -18.026 27.718   13.870  1.00 139.12 ? 328  GLU A CG    1 
ATOM   6155  C  CD    . GLU I  4 328  ? -17.307 26.762   14.799  1.00 153.73 ? 328  GLU A CD    1 
ATOM   6156  O  OE1   . GLU I  4 328  ? -17.713 26.660   15.979  1.00 159.76 ? 328  GLU A OE1   1 
ATOM   6157  O  OE2   . GLU I  4 328  ? -16.334 26.112   14.344  1.00 165.29 ? 328  GLU A OE2   1 
ATOM   6158  N  N     . ALA I  4 329  ? -18.315 31.736   16.211  1.00 145.02 ? 329  ALA A N     1 
ATOM   6159  C  CA    . ALA I  4 329  ? -18.802 33.085   16.480  1.00 145.10 ? 329  ALA A CA    1 
ATOM   6160  C  C     . ALA I  4 329  ? -17.699 34.140   16.370  1.00 138.39 ? 329  ALA A C     1 
ATOM   6161  O  O     . ALA I  4 329  ? -17.945 35.268   15.960  1.00 133.82 ? 329  ALA A O     1 
ATOM   6162  C  CB    . ALA I  4 329  ? -19.444 33.139   17.861  1.00 143.88 ? 329  ALA A CB    1 
ATOM   6163  N  N     . PHE I  4 330  ? -16.487 33.773   16.747  1.00 138.09 ? 330  PHE A N     1 
ATOM   6164  C  CA    . PHE I  4 330  ? -15.380 34.711   16.710  1.00 141.08 ? 330  PHE A CA    1 
ATOM   6165  C  C     . PHE I  4 330  ? -14.896 34.968   15.284  1.00 139.94 ? 330  PHE A C     1 
ATOM   6166  O  O     . PHE I  4 330  ? -14.580 36.100   14.948  1.00 139.18 ? 330  PHE A O     1 
ATOM   6167  C  CB    . PHE I  4 330  ? -14.222 34.216   17.571  1.00 137.79 ? 330  PHE A CB    1 
ATOM   6168  C  CG    . PHE I  4 330  ? -13.063 35.165   17.621  1.00 132.38 ? 330  PHE A CG    1 
ATOM   6169  C  CD1   . PHE I  4 330  ? -13.157 36.343   18.316  1.00 133.52 ? 330  PHE A CD1   1 
ATOM   6170  C  CD2   . PHE I  4 330  ? -11.885 34.886   16.957  1.00 138.61 ? 330  PHE A CD2   1 
ATOM   6171  C  CE1   . PHE I  4 330  ? -12.092 37.223   18.367  1.00 134.26 ? 330  PHE A CE1   1 
ATOM   6172  C  CE2   . PHE I  4 330  ? -10.810 35.758   16.999  1.00 132.41 ? 330  PHE A CE2   1 
ATOM   6173  C  CZ    . PHE I  4 330  ? -10.913 36.927   17.710  1.00 133.98 ? 330  PHE A CZ    1 
ATOM   6174  N  N     . TYR I  4 331  ? -14.827 33.923   14.461  1.00 140.82 ? 331  TYR A N     1 
ATOM   6175  C  CA    . TYR I  4 331  ? -14.378 34.072   13.071  1.00 145.12 ? 331  TYR A CA    1 
ATOM   6176  C  C     . TYR I  4 331  ? -15.380 34.843   12.204  1.00 151.01 ? 331  TYR A C     1 
ATOM   6177  O  O     . TYR I  4 331  ? -14.984 35.556   11.267  1.00 147.28 ? 331  TYR A O     1 
ATOM   6178  C  CB    . TYR I  4 331  ? -14.107 32.712   12.422  1.00 141.65 ? 331  TYR A CB    1 
ATOM   6179  C  CG    . TYR I  4 331  ? -12.741 32.111   12.676  1.00 140.78 ? 331  TYR A CG    1 
ATOM   6180  C  CD1   . TYR I  4 331  ? -12.543 30.744   12.541  1.00 141.17 ? 331  TYR A CD1   1 
ATOM   6181  C  CD2   . TYR I  4 331  ? -11.649 32.894   13.031  1.00 139.60 ? 331  TYR A CD2   1 
ATOM   6182  C  CE1   . TYR I  4 331  ? -11.306 30.174   12.745  1.00 139.25 ? 331  TYR A CE1   1 
ATOM   6183  C  CE2   . TYR I  4 331  ? -10.407 32.329   13.244  1.00 140.54 ? 331  TYR A CE2   1 
ATOM   6184  C  CZ    . TYR I  4 331  ? -10.242 30.970   13.096  1.00 141.42 ? 331  TYR A CZ    1 
ATOM   6185  O  OH    . TYR I  4 331  ? -9.005  30.410   13.299  1.00 140.70 ? 331  TYR A OH    1 
ATOM   6186  N  N     . ARG I  4 332  ? -16.668 34.684   12.506  1.00 147.22 ? 332  ARG A N     1 
ATOM   6187  C  CA    . ARG I  4 332  ? -17.702 35.429   11.809  1.00 142.28 ? 332  ARG A CA    1 
ATOM   6188  C  C     . ARG I  4 332  ? -17.543 36.912   12.080  1.00 144.09 ? 332  ARG A C     1 
ATOM   6189  O  O     . ARG I  4 332  ? -17.705 37.707   11.166  1.00 147.68 ? 332  ARG A O     1 
ATOM   6190  C  CB    . ARG I  4 332  ? -19.092 34.958   12.217  1.00 149.10 ? 332  ARG A CB    1 
ATOM   6191  C  CG    . ARG I  4 332  ? -19.464 33.592   11.656  1.00 153.05 ? 332  ARG A CG    1 
ATOM   6192  C  CD    . ARG I  4 332  ? -20.771 33.085   12.239  1.00 158.91 ? 332  ARG A CD    1 
ATOM   6193  N  NE    . ARG I  4 332  ? -20.930 31.645   12.066  1.00 158.56 ? 332  ARG A NE    1 
ATOM   6194  C  CZ    . ARG I  4 332  ? -21.281 31.046   10.928  1.00 161.10 ? 332  ARG A CZ    1 
ATOM   6195  N  NH1   . ARG I  4 332  ? -21.503 31.745   9.810   1.00 155.34 ? 332  ARG A NH1   1 
ATOM   6196  N  NH2   . ARG I  4 332  ? -21.408 29.725   10.910  1.00 163.65 ? 332  ARG A NH2   1 
ATOM   6197  N  N     . GLU I  4 333  ? -17.207 37.276   13.322  1.00 148.90 ? 333  GLU A N     1 
ATOM   6198  C  CA    . GLU I  4 333  ? -16.983 38.689   13.706  1.00 148.22 ? 333  GLU A CA    1 
ATOM   6199  C  C     . GLU I  4 333  ? -15.844 39.314   12.924  1.00 144.29 ? 333  GLU A C     1 
ATOM   6200  O  O     . GLU I  4 333  ? -15.935 40.475   12.533  1.00 133.89 ? 333  GLU A O     1 
ATOM   6201  C  CB    . GLU I  4 333  ? -16.686 38.841   15.209  1.00 148.29 ? 333  GLU A CB    1 
ATOM   6202  C  CG    . GLU I  4 333  ? -17.911 38.761   16.105  1.00 153.41 ? 333  GLU A CG    1 
ATOM   6203  C  CD    . GLU I  4 333  ? -18.790 39.998   16.041  1.00 159.89 ? 333  GLU A CD    1 
ATOM   6204  O  OE1   . GLU I  4 333  ? -18.334 41.045   15.549  1.00 160.93 ? 333  GLU A OE1   1 
ATOM   6205  O  OE2   . GLU I  4 333  ? -19.950 39.928   16.498  1.00 171.41 ? 333  GLU A OE2   1 
ATOM   6206  N  N     . VAL I  4 334  ? -14.776 38.541   12.714  1.00 151.22 ? 334  VAL A N     1 
ATOM   6207  C  CA    . VAL I  4 334  ? -13.577 39.015   11.993  1.00 155.69 ? 334  VAL A CA    1 
ATOM   6208  C  C     . VAL I  4 334  ? -13.857 39.211   10.503  1.00 147.45 ? 334  VAL A C     1 
ATOM   6209  O  O     . VAL I  4 334  ? -13.479 40.234   9.924   1.00 139.18 ? 334  VAL A O     1 
ATOM   6210  C  CB    . VAL I  4 334  ? -12.373 38.050   12.159  1.00 162.50 ? 334  VAL A CB    1 
ATOM   6211  C  CG1   . VAL I  4 334  ? -11.203 38.485   11.285  1.00 162.69 ? 334  VAL A CG1   1 
ATOM   6212  C  CG2   . VAL I  4 334  ? -11.933 37.985   13.616  1.00 165.34 ? 334  VAL A CG2   1 
ATOM   6213  N  N     . LEU I  4 335  ? -14.510 38.220   9.896   1.00 142.69 ? 335  LEU A N     1 
ATOM   6214  C  CA    . LEU I  4 335  ? -14.971 38.327   8.512   1.00 139.35 ? 335  LEU A CA    1 
ATOM   6215  C  C     . LEU I  4 335  ? -15.998 39.465   8.358   1.00 140.35 ? 335  LEU A C     1 
ATOM   6216  O  O     . LEU I  4 335  ? -15.919 40.279   7.428   1.00 136.78 ? 335  LEU A O     1 
ATOM   6217  C  CB    . LEU I  4 335  ? -15.593 37.004   8.047   1.00 132.93 ? 335  LEU A CB    1 
ATOM   6218  C  CG    . LEU I  4 335  ? -14.678 35.801   7.881   1.00 130.05 ? 335  LEU A CG    1 
ATOM   6219  C  CD1   . LEU I  4 335  ? -15.537 34.570   7.644   1.00 126.28 ? 335  LEU A CD1   1 
ATOM   6220  C  CD2   . LEU I  4 335  ? -13.692 36.011   6.737   1.00 127.92 ? 335  LEU A CD2   1 
ATOM   6221  N  N     . ARG I  4 336  ? -16.955 39.514   9.281   1.00 141.88 ? 336  ARG A N     1 
ATOM   6222  C  CA    . ARG I  4 336  ? -17.989 40.550   9.279   1.00 147.29 ? 336  ARG A CA    1 
ATOM   6223  C  C     . ARG I  4 336  ? -17.415 41.952   9.553   1.00 145.58 ? 336  ARG A C     1 
ATOM   6224  O  O     . ARG I  4 336  ? -17.967 42.954   9.107   1.00 138.82 ? 336  ARG A O     1 
ATOM   6225  C  CB    . ARG I  4 336  ? -19.086 40.180   10.283  1.00 150.04 ? 336  ARG A CB    1 
ATOM   6226  C  CG    . ARG I  4 336  ? -20.176 41.213   10.499  1.00 155.69 ? 336  ARG A CG    1 
ATOM   6227  C  CD    . ARG I  4 336  ? -19.862 42.082   11.708  1.00 168.16 ? 336  ARG A CD    1 
ATOM   6228  N  NE    . ARG I  4 336  ? -21.044 42.744   12.249  1.00 180.72 ? 336  ARG A NE    1 
ATOM   6229  C  CZ    . ARG I  4 336  ? -21.048 43.495   13.350  1.00 194.08 ? 336  ARG A CZ    1 
ATOM   6230  N  NH1   . ARG I  4 336  ? -19.926 43.686   14.040  1.00 187.03 ? 336  ARG A NH1   1 
ATOM   6231  N  NH2   . ARG I  4 336  ? -22.182 44.058   13.765  1.00 203.73 ? 336  ARG A NH2   1 
ATOM   6232  N  N     . LEU I  4 337  ? -16.307 42.021   10.280  1.00 150.54 ? 337  LEU A N     1 
ATOM   6233  C  CA    . LEU I  4 337  ? -15.590 43.289   10.467  1.00 155.60 ? 337  LEU A CA    1 
ATOM   6234  C  C     . LEU I  4 337  ? -14.923 43.770   9.179   1.00 153.82 ? 337  LEU A C     1 
ATOM   6235  O  O     . LEU I  4 337  ? -14.615 44.956   9.040   1.00 165.35 ? 337  LEU A O     1 
ATOM   6236  C  CB    . LEU I  4 337  ? -14.537 43.170   11.577  1.00 161.54 ? 337  LEU A CB    1 
ATOM   6237  C  CG    . LEU I  4 337  ? -15.043 43.375   13.018  1.00 158.09 ? 337  LEU A CG    1 
ATOM   6238  C  CD1   . LEU I  4 337  ? -14.095 42.761   14.046  1.00 145.90 ? 337  LEU A CD1   1 
ATOM   6239  C  CD2   . LEU I  4 337  ? -15.272 44.860   13.302  1.00 156.72 ? 337  LEU A CD2   1 
ATOM   6240  N  N     . LEU I  4 338  ? -14.686 42.840   8.256   1.00 150.35 ? 338  LEU A N     1 
ATOM   6241  C  CA    . LEU I  4 338  ? -14.305 43.162   6.876   1.00 146.55 ? 338  LEU A CA    1 
ATOM   6242  C  C     . LEU I  4 338  ? -15.492 42.913   5.937   1.00 134.78 ? 338  LEU A C     1 
ATOM   6243  O  O     . LEU I  4 338  ? -15.640 43.575   4.911   1.00 133.12 ? 338  LEU A O     1 
ATOM   6244  C  CB    . LEU I  4 338  ? -13.130 42.289   6.450   1.00 140.00 ? 338  LEU A CB    1 
ATOM   6245  C  CG    . LEU I  4 338  ? -11.951 42.316   7.422   1.00 142.39 ? 338  LEU A CG    1 
ATOM   6246  C  CD1   . LEU I  4 338  ? -11.064 41.087   7.258   1.00 127.16 ? 338  LEU A CD1   1 
ATOM   6247  C  CD2   . LEU I  4 338  ? -11.177 43.623   7.262   1.00 152.79 ? 338  LEU A CD2   1 
ATOM   6248  N  N     . ASP I  4 346  ? -21.275 26.229   8.114   1.00 149.54 ? 346  ASP A N     1 
ATOM   6249  C  CA    . ASP I  4 346  ? -20.152 25.305   8.094   1.00 154.24 ? 346  ASP A CA    1 
ATOM   6250  C  C     . ASP I  4 346  ? -18.869 25.997   8.583   1.00 159.22 ? 346  ASP A C     1 
ATOM   6251  O  O     . ASP I  4 346  ? -18.549 27.107   8.147   1.00 161.94 ? 346  ASP A O     1 
ATOM   6252  C  CB    . ASP I  4 346  ? -19.958 24.730   6.688   1.00 145.92 ? 346  ASP A CB    1 
ATOM   6253  C  CG    . ASP I  4 346  ? -18.823 23.720   6.626   1.00 153.80 ? 346  ASP A CG    1 
ATOM   6254  O  OD1   . ASP I  4 346  ? -18.581 22.993   7.621   1.00 153.96 ? 346  ASP A OD1   1 
ATOM   6255  O  OD2   . ASP I  4 346  ? -18.164 23.660   5.572   1.00 161.97 ? 346  ASP A OD2   1 
ATOM   6256  N  N     . GLU I  4 347  ? -18.147 25.336   9.490   1.00 154.00 ? 347  GLU A N     1 
ATOM   6257  C  CA    . GLU I  4 347  ? -16.935 25.900   10.076  1.00 152.10 ? 347  GLU A CA    1 
ATOM   6258  C  C     . GLU I  4 347  ? -15.768 25.974   9.087   1.00 148.12 ? 347  GLU A C     1 
ATOM   6259  O  O     . GLU I  4 347  ? -14.914 26.854   9.211   1.00 152.48 ? 347  GLU A O     1 
ATOM   6260  C  CB    . GLU I  4 347  ? -16.515 25.131   11.345  1.00 157.71 ? 347  GLU A CB    1 
ATOM   6261  C  CG    . GLU I  4 347  ? -15.967 23.716   11.145  1.00 158.29 ? 347  GLU A CG    1 
ATOM   6262  C  CD    . GLU I  4 347  ? -17.049 22.649   11.086  1.00 166.84 ? 347  GLU A CD    1 
ATOM   6263  O  OE1   . GLU I  4 347  ? -18.197 22.966   10.688  1.00 171.74 ? 347  GLU A OE1   1 
ATOM   6264  O  OE2   . GLU I  4 347  ? -16.745 21.485   11.431  1.00 164.22 ? 347  GLU A OE2   1 
ATOM   6265  N  N     . ARG I  4 348  ? -15.728 25.062   8.119   1.00 137.81 ? 348  ARG A N     1 
ATOM   6266  C  CA    . ARG I  4 348  ? -14.667 25.071   7.099   1.00 150.60 ? 348  ARG A CA    1 
ATOM   6267  C  C     . ARG I  4 348  ? -14.808 26.249   6.093   1.00 155.16 ? 348  ARG A C     1 
ATOM   6268  O  O     . ARG I  4 348  ? -13.818 26.719   5.484   1.00 138.98 ? 348  ARG A O     1 
ATOM   6269  C  CB    . ARG I  4 348  ? -14.637 23.728   6.350   1.00 147.01 ? 348  ARG A CB    1 
ATOM   6270  C  CG    . ARG I  4 348  ? -13.503 23.598   5.342   1.00 145.93 ? 348  ARG A CG    1 
ATOM   6271  C  CD    . ARG I  4 348  ? -13.401 22.188   4.798   1.00 151.74 ? 348  ARG A CD    1 
ATOM   6272  N  NE    . ARG I  4 348  ? -12.765 21.276   5.740   1.00 158.91 ? 348  ARG A NE    1 
ATOM   6273  C  CZ    . ARG I  4 348  ? -12.544 19.979   5.514   1.00 165.28 ? 348  ARG A CZ    1 
ATOM   6274  N  NH1   . ARG I  4 348  ? -12.908 19.411   4.361   1.00 157.17 ? 348  ARG A NH1   1 
ATOM   6275  N  NH2   . ARG I  4 348  ? -11.953 19.242   6.456   1.00 169.63 ? 348  ARG A NH2   1 
ATOM   6276  N  N     . ALA I  4 349  ? -16.047 26.711   5.924   1.00 153.08 ? 349  ALA A N     1 
ATOM   6277  C  CA    . ALA I  4 349  ? -16.347 27.811   5.023   1.00 146.84 ? 349  ALA A CA    1 
ATOM   6278  C  C     . ALA I  4 349  ? -15.737 29.108   5.540   1.00 148.74 ? 349  ALA A C     1 
ATOM   6279  O  O     . ALA I  4 349  ? -15.366 29.982   4.742   1.00 153.34 ? 349  ALA A O     1 
ATOM   6280  C  CB    . ALA I  4 349  ? -17.855 27.957   4.852   1.00 140.43 ? 349  ALA A CB    1 
ATOM   6281  N  N     . LEU I  4 350  ? -15.630 29.226   6.867   1.00 140.72 ? 350  LEU A N     1 
ATOM   6282  C  CA    . LEU I  4 350  ? -15.077 30.426   7.496   1.00 139.47 ? 350  LEU A CA    1 
ATOM   6283  C  C     . LEU I  4 350  ? -13.575 30.494   7.294   1.00 138.83 ? 350  LEU A C     1 
ATOM   6284  O  O     . LEU I  4 350  ? -13.056 31.532   6.878   1.00 148.00 ? 350  LEU A O     1 
ATOM   6285  C  CB    . LEU I  4 350  ? -15.405 30.471   8.990   1.00 141.04 ? 350  LEU A CB    1 
ATOM   6286  C  CG    . LEU I  4 350  ? -16.839 30.877   9.349   1.00 136.76 ? 350  LEU A CG    1 
ATOM   6287  C  CD1   . LEU I  4 350  ? -17.786 29.746   9.042   1.00 141.46 ? 350  LEU A CD1   1 
ATOM   6288  C  CD2   . LEU I  4 350  ? -16.960 31.246   10.812  1.00 131.47 ? 350  LEU A CD2   1 
ATOM   6289  N  N     . ALA I  4 351  ? -12.891 29.387   7.589   1.00 136.27 ? 351  ALA A N     1 
ATOM   6290  C  CA    . ALA I  4 351  ? -11.443 29.274   7.376   1.00 136.43 ? 351  ALA A CA    1 
ATOM   6291  C  C     . ALA I  4 351  ? -11.049 29.507   5.908   1.00 133.53 ? 351  ALA A C     1 
ATOM   6292  O  O     . ALA I  4 351  ? -10.083 30.218   5.612   1.00 124.74 ? 351  ALA A O     1 
ATOM   6293  C  CB    . ALA I  4 351  ? -10.954 27.914   7.850   1.00 135.26 ? 351  ALA A CB    1 
ATOM   6294  N  N     . GLU I  4 352  ? -11.828 28.914   5.005   1.00 136.83 ? 352  GLU A N     1 
ATOM   6295  C  CA    . GLU I  4 352  ? -11.615 29.048   3.570   1.00 130.98 ? 352  GLU A CA    1 
ATOM   6296  C  C     . GLU I  4 352  ? -11.703 30.514   3.154   1.00 138.08 ? 352  GLU A C     1 
ATOM   6297  O  O     . GLU I  4 352  ? -10.899 30.987   2.345   1.00 153.45 ? 352  GLU A O     1 
ATOM   6298  C  CB    . GLU I  4 352  ? -12.640 28.196   2.808   1.00 129.57 ? 352  GLU A CB    1 
ATOM   6299  C  CG    . GLU I  4 352  ? -12.358 28.069   1.315   1.00 135.22 ? 352  GLU A CG    1 
ATOM   6300  C  CD    . GLU I  4 352  ? -13.393 27.240   0.552   1.00 139.79 ? 352  GLU A CD    1 
ATOM   6301  O  OE1   . GLU I  4 352  ? -13.545 27.450   -0.676  1.00 137.67 ? 352  GLU A OE1   1 
ATOM   6302  O  OE2   . GLU I  4 352  ? -14.049 26.377   1.174   1.00 146.22 ? 352  GLU A OE2   1 
ATOM   6303  N  N     . ALA I  4 353  ? -12.668 31.229   3.728   1.00 143.62 ? 353  ALA A N     1 
ATOM   6304  C  CA    . ALA I  4 353  ? -12.869 32.657   3.448   1.00 143.98 ? 353  ALA A CA    1 
ATOM   6305  C  C     . ALA I  4 353  ? -11.751 33.498   4.043   1.00 139.86 ? 353  ALA A C     1 
ATOM   6306  O  O     . ALA I  4 353  ? -11.302 34.460   3.423   1.00 142.40 ? 353  ALA A O     1 
ATOM   6307  C  CB    . ALA I  4 353  ? -14.219 33.126   3.988   1.00 145.48 ? 353  ALA A CB    1 
ATOM   6308  N  N     . LEU I  4 354  ? -11.311 33.131   5.245   1.00 136.54 ? 354  LEU A N     1 
ATOM   6309  C  CA    . LEU I  4 354  ? -10.259 33.869   5.942   1.00 135.31 ? 354  LEU A CA    1 
ATOM   6310  C  C     . LEU I  4 354  ? -8.929  33.785   5.186   1.00 133.10 ? 354  LEU A C     1 
ATOM   6311  O  O     . LEU I  4 354  ? -8.114  34.701   5.221   1.00 133.66 ? 354  LEU A O     1 
ATOM   6312  C  CB    . LEU I  4 354  ? -10.112 33.362   7.388   1.00 127.93 ? 354  LEU A CB    1 
ATOM   6313  C  CG    . LEU I  4 354  ? -11.153 33.890   8.380   1.00 121.25 ? 354  LEU A CG    1 
ATOM   6314  C  CD1   . LEU I  4 354  ? -11.214 33.039   9.641   1.00 125.99 ? 354  LEU A CD1   1 
ATOM   6315  C  CD2   . LEU I  4 354  ? -10.844 35.331   8.735   1.00 121.55 ? 354  LEU A CD2   1 
ATOM   6316  N  N     . ALA I  4 355  ? -8.731  32.686   4.477   1.00 137.50 ? 355  ALA A N     1 
ATOM   6317  C  CA    . ALA I  4 355  ? -7.513  32.479   3.700   1.00 141.89 ? 355  ALA A CA    1 
ATOM   6318  C  C     . ALA I  4 355  ? -7.397  33.461   2.536   1.00 142.76 ? 355  ALA A C     1 
ATOM   6319  O  O     . ALA I  4 355  ? -6.290  33.779   2.075   1.00 139.93 ? 355  ALA A O     1 
ATOM   6320  C  CB    . ALA I  4 355  ? -7.480  31.049   3.178   1.00 136.02 ? 355  ALA A CB    1 
ATOM   6321  N  N     . ARG I  4 356  ? -8.546  33.929   2.059   1.00 145.09 ? 356  ARG A N     1 
ATOM   6322  C  CA    . ARG I  4 356  ? -8.600  34.828   0.910   1.00 142.60 ? 356  ARG A CA    1 
ATOM   6323  C  C     . ARG I  4 356  ? -8.246  36.266   1.294   1.00 138.46 ? 356  ARG A C     1 
ATOM   6324  O  O     . ARG I  4 356  ? -7.900  37.073   0.432   1.00 137.50 ? 356  ARG A O     1 
ATOM   6325  C  CB    . ARG I  4 356  ? -9.982  34.778   0.255   1.00 142.06 ? 356  ARG A CB    1 
ATOM   6326  C  CG    . ARG I  4 356  ? -10.435 33.383   -0.157  1.00 148.66 ? 356  ARG A CG    1 
ATOM   6327  C  CD    . ARG I  4 356  ? -11.903 33.397   -0.573  1.00 159.81 ? 356  ARG A CD    1 
ATOM   6328  N  NE    . ARG I  4 356  ? -12.502 32.062   -0.598  1.00 155.81 ? 356  ARG A NE    1 
ATOM   6329  C  CZ    . ARG I  4 356  ? -12.264 31.142   -1.534  1.00 157.39 ? 356  ARG A CZ    1 
ATOM   6330  N  NH1   . ARG I  4 356  ? -11.419 31.387   -2.538  1.00 158.08 ? 356  ARG A NH1   1 
ATOM   6331  N  NH2   . ARG I  4 356  ? -12.875 29.961   -1.468  1.00 155.68 ? 356  ARG A NH2   1 
ATOM   6332  N  N     . VAL I  4 357  ? -8.318  36.583   2.582   1.00 133.64 ? 357  VAL A N     1 
ATOM   6333  C  CA    . VAL I  4 357  ? -8.070  37.947   3.041   1.00 141.74 ? 357  VAL A CA    1 
ATOM   6334  C  C     . VAL I  4 357  ? -6.607  38.357   2.832   1.00 147.98 ? 357  VAL A C     1 
ATOM   6335  O  O     . VAL I  4 357  ? -5.687  37.627   3.225   1.00 152.39 ? 357  VAL A O     1 
ATOM   6336  C  CB    . VAL I  4 357  ? -8.449  38.115   4.528   1.00 138.69 ? 357  VAL A CB    1 
ATOM   6337  C  CG1   . VAL I  4 357  ? -8.139  39.531   5.011   1.00 132.92 ? 357  VAL A CG1   1 
ATOM   6338  C  CG2   . VAL I  4 357  ? -9.918  37.751   4.735   1.00 130.90 ? 357  VAL A CG2   1 
ATOM   6339  N  N     . GLU I  4 358  ? -6.408  39.528   2.221   1.00 151.92 ? 358  GLU A N     1 
ATOM   6340  C  CA    . GLU I  4 358  ? -5.069  40.021   1.878   1.00 159.03 ? 358  GLU A CA    1 
ATOM   6341  C  C     . GLU I  4 358  ? -4.408  40.782   3.018   1.00 163.26 ? 358  GLU A C     1 
ATOM   6342  O  O     . GLU I  4 358  ? -5.082  41.211   3.959   1.00 167.57 ? 358  GLU A O     1 
ATOM   6343  C  CB    . GLU I  4 358  ? -5.131  40.942   0.673   1.00 156.48 ? 358  GLU A CB    1 
ATOM   6344  C  CG    . GLU I  4 358  ? -5.637  40.277   -0.585  1.00 152.29 ? 358  GLU A CG    1 
ATOM   6345  C  CD    . GLU I  4 358  ? -5.539  41.208   -1.766  1.00 164.31 ? 358  GLU A CD    1 
ATOM   6346  O  OE1   . GLU I  4 358  ? -5.302  42.421   -1.550  1.00 178.48 ? 358  GLU A OE1   1 
ATOM   6347  O  OE2   . GLU I  4 358  ? -5.687  40.732   -2.908  1.00 175.79 ? 358  GLU A OE2   1 
ATOM   6348  N  N     . GLU I  4 359  ? -3.091  40.968   2.903   1.00 155.64 ? 359  GLU A N     1 
ATOM   6349  C  CA    . GLU I  4 359  ? -2.291  41.555   3.974   1.00 152.61 ? 359  GLU A CA    1 
ATOM   6350  C  C     . GLU I  4 359  ? -2.560  43.037   4.169   1.00 152.75 ? 359  GLU A C     1 
ATOM   6351  O  O     . GLU I  4 359  ? -2.295  43.577   5.246   1.00 151.57 ? 359  GLU A O     1 
ATOM   6352  C  CB    . GLU I  4 359  ? -0.804  41.332   3.718   1.00 153.89 ? 359  GLU A CB    1 
ATOM   6353  C  CG    . GLU I  4 359  ? -0.398  39.869   3.759   1.00 159.72 ? 359  GLU A CG    1 
ATOM   6354  C  CD    . GLU I  4 359  ? 1.105   39.661   3.681   1.00 166.43 ? 359  GLU A CD    1 
ATOM   6355  O  OE1   . GLU I  4 359  ? 1.844   40.619   3.372   1.00 177.18 ? 359  GLU A OE1   1 
ATOM   6356  O  OE2   . GLU I  4 359  ? 1.550   38.525   3.932   1.00 177.16 ? 359  GLU A OE2   1 
ATOM   6357  N  N     . LYS I  4 360  ? -3.078  43.695   3.131   1.00 154.76 ? 360  LYS A N     1 
ATOM   6358  C  CA    . LYS I  4 360  ? -3.496  45.106   3.237   1.00 153.54 ? 360  LYS A CA    1 
ATOM   6359  C  C     . LYS I  4 360  ? -4.767  45.284   4.089   1.00 148.82 ? 360  LYS A C     1 
ATOM   6360  O  O     . LYS I  4 360  ? -4.919  46.271   4.801   1.00 152.33 ? 360  LYS A O     1 
ATOM   6361  C  CB    . LYS I  4 360  ? -3.704  45.703   1.851   1.00 147.52 ? 360  LYS A CB    1 
ATOM   6362  C  CG    . LYS I  4 360  ? -2.422  45.816   1.045   1.00 151.16 ? 360  LYS A CG    1 
ATOM   6363  C  CD    . LYS I  4 360  ? -2.687  46.473   -0.295  1.00 154.93 ? 360  LYS A CD    1 
ATOM   6364  C  CE    . LYS I  4 360  ? -1.414  46.654   -1.104  1.00 154.83 ? 360  LYS A CE    1 
ATOM   6365  N  NZ    . LYS I  4 360  ? -1.690  47.188   -2.470  1.00 154.68 ? 360  LYS A NZ    1 
ATOM   6366  N  N     . ALA I  4 361  ? -5.664  44.311   4.027   1.00 143.35 ? 361  ALA A N     1 
ATOM   6367  C  CA    . ALA I  4 361  ? -6.848  44.304   4.863   1.00 139.10 ? 361  ALA A CA    1 
ATOM   6368  C  C     . ALA I  4 361  ? -6.515  44.005   6.327   1.00 143.28 ? 361  ALA A C     1 
ATOM   6369  O  O     . ALA I  4 361  ? -7.121  44.586   7.214   1.00 159.32 ? 361  ALA A O     1 
ATOM   6370  C  CB    . ALA I  4 361  ? -7.854  43.287   4.339   1.00 130.29 ? 361  ALA A CB    1 
ATOM   6371  N  N     . TRP I  4 362  ? -5.569  43.106   6.586   1.00 142.42 ? 362  TRP A N     1 
ATOM   6372  C  CA    . TRP I  4 362  ? -5.298  42.659   7.958   1.00 146.26 ? 362  TRP A CA    1 
ATOM   6373  C  C     . TRP I  4 362  ? -4.765  43.767   8.832   1.00 147.00 ? 362  TRP A C     1 
ATOM   6374  O  O     . TRP I  4 362  ? -5.061  43.817   10.026  1.00 147.20 ? 362  TRP A O     1 
ATOM   6375  C  CB    . TRP I  4 362  ? -4.340  41.457   7.974   1.00 151.59 ? 362  TRP A CB    1 
ATOM   6376  C  CG    . TRP I  4 362  ? -4.991  40.128   7.634   1.00 152.89 ? 362  TRP A CG    1 
ATOM   6377  C  CD1   . TRP I  4 362  ? -4.714  39.291   6.546   1.00 155.38 ? 362  TRP A CD1   1 
ATOM   6378  C  CD2   . TRP I  4 362  ? -6.051  39.439   8.379   1.00 151.11 ? 362  TRP A CD2   1 
ATOM   6379  N  NE1   . TRP I  4 362  ? -5.514  38.174   6.567   1.00 152.59 ? 362  TRP A NE1   1 
ATOM   6380  C  CE2   . TRP I  4 362  ? -6.337  38.199   7.643   1.00 154.51 ? 362  TRP A CE2   1 
ATOM   6381  C  CE3   . TRP I  4 362  ? -6.762  39.709   9.529   1.00 149.40 ? 362  TRP A CE3   1 
ATOM   6382  C  CZ2   . TRP I  4 362  ? -7.298  37.291   8.077   1.00 146.71 ? 362  TRP A CZ2   1 
ATOM   6383  C  CZ3   . TRP I  4 362  ? -7.727  38.787   9.953   1.00 151.11 ? 362  TRP A CZ3   1 
ATOM   6384  C  CH2   . TRP I  4 362  ? -7.988  37.610   9.244   1.00 143.45 ? 362  TRP A CH2   1 
ATOM   6385  N  N     . GLU I  4 363  ? -3.990  44.683   8.253   1.00 145.81 ? 363  GLU A N     1 
ATOM   6386  C  CA    . GLU I  4 363  ? -3.406  45.770   9.033   1.00 151.71 ? 363  GLU A CA    1 
ATOM   6387  C  C     . GLU I  4 363  ? -4.473  46.783   9.415   1.00 157.64 ? 363  GLU A C     1 
ATOM   6388  O  O     . GLU I  4 363  ? -4.229  47.677   10.222  1.00 150.69 ? 363  GLU A O     1 
ATOM   6389  C  CB    . GLU I  4 363  ? -2.264  46.445   8.279   1.00 162.09 ? 363  GLU A CB    1 
ATOM   6390  C  CG    . GLU I  4 363  ? -0.993  45.606   8.210   1.00 162.93 ? 363  GLU A CG    1 
ATOM   6391  C  CD    . GLU I  4 363  ? 0.139   46.287   7.452   1.00 171.66 ? 363  GLU A CD    1 
ATOM   6392  O  OE1   . GLU I  4 363  ? -0.060  47.407   6.918   1.00 180.14 ? 363  GLU A OE1   1 
ATOM   6393  O  OE2   . GLU I  4 363  ? 1.239   45.694   7.390   1.00 172.17 ? 363  GLU A OE2   1 
ATOM   6394  N  N     . GLU I  4 364  ? -5.661  46.641   8.832   1.00 173.24 ? 364  GLU A N     1 
ATOM   6395  C  CA    . GLU I  4 364  ? -6.847  47.364   9.301   1.00 182.47 ? 364  GLU A CA    1 
ATOM   6396  C  C     . GLU I  4 364  ? -7.619  46.520   10.319  1.00 180.94 ? 364  GLU A C     1 
ATOM   6397  O  O     . GLU I  4 364  ? -8.832  46.675   10.464  1.00 183.48 ? 364  GLU A O     1 
ATOM   6398  C  CB    . GLU I  4 364  ? -7.764  47.742   8.124   1.00 192.26 ? 364  GLU A CB    1 
ATOM   6399  C  CG    . GLU I  4 364  ? -7.105  48.589   7.040   1.00 193.67 ? 364  GLU A CG    1 
ATOM   6400  C  CD    . GLU I  4 364  ? -8.077  49.005   5.948   1.00 191.56 ? 364  GLU A CD    1 
ATOM   6401  O  OE1   . GLU I  4 364  ? -8.958  48.194   5.593   1.00 191.77 ? 364  GLU A OE1   1 
ATOM   6402  O  OE2   . GLU I  4 364  ? -7.962  50.143   5.442   1.00 196.19 ? 364  GLU A OE2   1 
ATOM   6403  N  N     . LEU I  4 365  ? -6.911  45.610   10.991  1.00 182.79 ? 365  LEU A N     1 
ATOM   6404  C  CA    . LEU I  4 365  ? -7.439  44.877   12.150  1.00 184.62 ? 365  LEU A CA    1 
ATOM   6405  C  C     . LEU I  4 365  ? -6.432  44.889   13.317  1.00 189.41 ? 365  LEU A C     1 
ATOM   6406  O  O     . LEU I  4 365  ? -6.831  44.969   14.488  1.00 182.90 ? 365  LEU A O     1 
ATOM   6407  C  CB    . LEU I  4 365  ? -7.824  43.439   11.758  1.00 174.30 ? 365  LEU A CB    1 
ATOM   6408  C  CG    . LEU I  4 365  ? -8.980  43.313   10.762  1.00 170.30 ? 365  LEU A CG    1 
ATOM   6409  C  CD1   . LEU I  4 365  ? -9.194  41.861   10.377  1.00 172.50 ? 365  LEU A CD1   1 
ATOM   6410  C  CD2   . LEU I  4 365  ? -10.268 43.894   11.321  1.00 174.09 ? 365  LEU A CD2   1 
ATOM   6411  N  N     . ARG I  4 366  ? -5.137  44.821   12.985  1.00 195.02 ? 366  ARG A N     1 
ATOM   6412  C  CA    . ARG I  4 366  ? -4.051  44.957   13.967  1.00 204.55 ? 366  ARG A CA    1 
ATOM   6413  C  C     . ARG I  4 366  ? -4.166  46.276   14.743  1.00 203.84 ? 366  ARG A C     1 
ATOM   6414  O  O     . ARG I  4 366  ? -4.353  46.274   15.968  1.00 198.43 ? 366  ARG A O     1 
ATOM   6415  C  CB    . ARG I  4 366  ? -2.679  44.812   13.262  1.00 209.40 ? 366  ARG A CB    1 
ATOM   6416  C  CG    . ARG I  4 366  ? -1.500  45.613   13.820  1.00 218.53 ? 366  ARG A CG    1 
ATOM   6417  C  CD    . ARG I  4 366  ? -1.208  45.360   15.297  1.00 224.66 ? 366  ARG A CD    1 
ATOM   6418  N  NE    . ARG I  4 366  ? 0.194   45.618   15.631  1.00 222.82 ? 366  ARG A NE    1 
ATOM   6419  C  CZ    . ARG I  4 366  ? 0.741   45.419   16.830  1.00 218.37 ? 366  ARG A CZ    1 
ATOM   6420  N  NH1   . ARG I  4 366  ? 0.017   44.945   17.844  1.00 213.64 ? 366  ARG A NH1   1 
ATOM   6421  N  NH2   . ARG I  4 366  ? 2.027   45.696   17.014  1.00 218.94 ? 366  ARG A NH2   1 
ATOM   6422  N  N     . LYS I  4 367  ? -4.102  47.389   14.014  1.00 203.53 ? 367  LYS A N     1 
ATOM   6423  C  CA    . LYS I  4 367  ? -4.085  48.740   14.593  1.00 204.35 ? 367  LYS A CA    1 
ATOM   6424  C  C     . LYS I  4 367  ? -5.426  49.058   15.275  1.00 198.62 ? 367  LYS A C     1 
ATOM   6425  O  O     . LYS I  4 367  ? -5.915  50.183   15.210  1.00 205.30 ? 367  LYS A O     1 
ATOM   6426  C  CB    . LYS I  4 367  ? -3.779  49.752   13.468  1.00 202.53 ? 367  LYS A CB    1 
ATOM   6427  C  CG    . LYS I  4 367  ? -3.258  51.120   13.889  1.00 206.87 ? 367  LYS A CG    1 
ATOM   6428  C  CD    . LYS I  4 367  ? -2.759  51.898   12.671  1.00 208.76 ? 367  LYS A CD    1 
ATOM   6429  C  CE    . LYS I  4 367  ? -2.548  53.380   12.968  1.00 209.17 ? 367  LYS A CE    1 
ATOM   6430  N  NZ    . LYS I  4 367  ? -1.858  54.108   11.864  1.00 196.99 ? 367  LYS A NZ    1 
ATOM   6431  N  N     . ARG I  4 368  ? -5.991  48.068   15.964  1.00 188.36 ? 368  ARG A N     1 
ATOM   6432  C  CA    . ARG I  4 368  ? -7.391  48.084   16.350  1.00 192.72 ? 368  ARG A CA    1 
ATOM   6433  C  C     . ARG I  4 368  ? -7.640  47.127   17.515  1.00 193.21 ? 368  ARG A C     1 
ATOM   6434  O  O     . ARG I  4 368  ? -6.986  47.213   18.556  1.00 182.15 ? 368  ARG A O     1 
ATOM   6435  C  CB    . ARG I  4 368  ? -8.248  47.673   15.153  1.00 192.70 ? 368  ARG A CB    1 
ATOM   6436  C  CG    . ARG I  4 368  ? -8.355  48.732   14.068  1.00 201.17 ? 368  ARG A CG    1 
ATOM   6437  C  CD    . ARG I  4 368  ? -9.208  48.279   12.895  1.00 201.99 ? 368  ARG A CD    1 
ATOM   6438  N  NE    . ARG I  4 368  ? -10.644 48.301   13.165  1.00 199.00 ? 368  ARG A NE    1 
ATOM   6439  C  CZ    . ARG I  4 368  ? -11.585 47.978   12.281  1.00 190.91 ? 368  ARG A CZ    1 
ATOM   6440  N  NH1   . ARG I  4 368  ? -11.257 47.607   11.049  1.00 188.68 ? 368  ARG A NH1   1 
ATOM   6441  N  NH2   . ARG I  4 368  ? -12.865 48.028   12.628  1.00 184.57 ? 368  ARG A NH2   1 
ATOM   6442  N  N     . GLU I  4 377  ? -2.148  37.997   29.825  1.00 139.46 ? 377  GLU A N     1 
ATOM   6443  C  CA    . GLU I  4 377  ? -3.092  36.988   29.327  1.00 144.79 ? 377  GLU A CA    1 
ATOM   6444  C  C     . GLU I  4 377  ? -3.173  36.950   27.780  1.00 141.58 ? 377  GLU A C     1 
ATOM   6445  O  O     . GLU I  4 377  ? -2.996  37.971   27.101  1.00 138.20 ? 377  GLU A O     1 
ATOM   6446  C  CB    . GLU I  4 377  ? -4.474  37.244   29.936  1.00 152.56 ? 377  GLU A CB    1 
ATOM   6447  C  CG    . GLU I  4 377  ? -5.523  36.164   29.672  1.00 160.24 ? 377  GLU A CG    1 
ATOM   6448  C  CD    . GLU I  4 377  ? -6.844  36.384   30.428  1.00 171.42 ? 377  GLU A CD    1 
ATOM   6449  O  OE1   . GLU I  4 377  ? -7.071  37.481   31.005  1.00 169.09 ? 377  GLU A OE1   1 
ATOM   6450  O  OE2   . GLU I  4 377  ? -7.677  35.446   30.440  1.00 173.93 ? 377  GLU A OE2   1 
ATOM   6451  N  N     . TRP I  4 378  ? -3.447  35.763   27.238  1.00 134.16 ? 378  TRP A N     1 
ATOM   6452  C  CA    . TRP I  4 378  ? -3.590  35.566   25.790  1.00 129.49 ? 378  TRP A CA    1 
ATOM   6453  C  C     . TRP I  4 378  ? -5.012  35.613   25.303  1.00 126.62 ? 378  TRP A C     1 
ATOM   6454  O  O     . TRP I  4 378  ? -5.652  34.559   25.144  1.00 118.90 ? 378  TRP A O     1 
ATOM   6455  C  CB    . TRP I  4 378  ? -2.979  34.231   25.370  1.00 128.32 ? 378  TRP A CB    1 
ATOM   6456  C  CG    . TRP I  4 378  ? -1.494  34.268   25.437  1.00 125.72 ? 378  TRP A CG    1 
ATOM   6457  C  CD1   . TRP I  4 378  ? -0.687  33.859   26.487  1.00 129.40 ? 378  TRP A CD1   1 
ATOM   6458  C  CD2   . TRP I  4 378  ? -0.577  34.801   24.427  1.00 123.18 ? 378  TRP A CD2   1 
ATOM   6459  N  NE1   . TRP I  4 378  ? 0.637   34.080   26.199  1.00 133.47 ? 378  TRP A NE1   1 
ATOM   6460  C  CE2   . TRP I  4 378  ? 0.768   34.644   24.980  1.00 125.44 ? 378  TRP A CE2   1 
ATOM   6461  C  CE3   . TRP I  4 378  ? -0.732  35.365   23.175  1.00 114.87 ? 378  TRP A CE3   1 
ATOM   6462  C  CZ2   . TRP I  4 378  ? 1.879   35.035   24.295  1.00 126.99 ? 378  TRP A CZ2   1 
ATOM   6463  C  CZ3   . TRP I  4 378  ? 0.402   35.750   22.490  1.00 120.11 ? 378  TRP A CZ3   1 
ATOM   6464  C  CH2   . TRP I  4 378  ? 1.676   35.589   23.035  1.00 128.96 ? 378  TRP A CH2   1 
ATOM   6465  N  N     . THR I  4 379  ? -5.491  36.826   25.012  1.00 126.48 ? 379  THR A N     1 
ATOM   6466  C  CA    . THR I  4 379  ? -6.858  37.033   24.533  1.00 129.93 ? 379  THR A CA    1 
ATOM   6467  C  C     . THR I  4 379  ? -7.092  36.373   23.161  1.00 132.53 ? 379  THR A C     1 
ATOM   6468  O  O     . THR I  4 379  ? -6.148  35.919   22.522  1.00 132.25 ? 379  THR A O     1 
ATOM   6469  C  CB    . THR I  4 379  ? -7.234  38.532   24.513  1.00 131.87 ? 379  THR A CB    1 
ATOM   6470  O  OG1   . THR I  4 379  ? -8.547  38.680   23.955  1.00 145.01 ? 379  THR A OG1   1 
ATOM   6471  C  CG2   . THR I  4 379  ? -6.240  39.363   23.708  1.00 135.24 ? 379  THR A CG2   1 
ATOM   6472  N  N     . ALA I  4 380  ? -8.351  36.301   22.724  1.00 136.78 ? 380  ALA A N     1 
ATOM   6473  C  CA    . ALA I  4 380  ? -8.678  35.733   21.399  1.00 132.75 ? 380  ALA A CA    1 
ATOM   6474  C  C     . ALA I  4 380  ? -8.156  36.574   20.248  1.00 134.64 ? 380  ALA A C     1 
ATOM   6475  O  O     . ALA I  4 380  ? -7.834  36.037   19.201  1.00 140.82 ? 380  ALA A O     1 
ATOM   6476  C  CB    . ALA I  4 380  ? -10.173 35.531   21.227  1.00 131.76 ? 380  ALA A CB    1 
ATOM   6477  N  N     . GLU I  4 381  ? -8.078  37.887   20.433  1.00 141.49 ? 381  GLU A N     1 
ATOM   6478  C  CA    . GLU I  4 381  ? -7.526  38.778   19.403  1.00 143.48 ? 381  GLU A CA    1 
ATOM   6479  C  C     . GLU I  4 381  ? -6.013  38.568   19.267  1.00 141.35 ? 381  GLU A C     1 
ATOM   6480  O  O     . GLU I  4 381  ? -5.462  38.649   18.165  1.00 144.48 ? 381  GLU A O     1 
ATOM   6481  C  CB    . GLU I  4 381  ? -7.844  40.248   19.715  1.00 145.27 ? 381  GLU A CB    1 
ATOM   6482  C  CG    . GLU I  4 381  ? -9.334  40.582   19.678  1.00 157.73 ? 381  GLU A CG    1 
ATOM   6483  C  CD    . GLU I  4 381  ? -10.100 40.146   20.938  1.00 169.14 ? 381  GLU A CD    1 
ATOM   6484  O  OE1   . GLU I  4 381  ? -9.695  40.546   22.060  1.00 166.61 ? 381  GLU A OE1   1 
ATOM   6485  O  OE2   . GLU I  4 381  ? -11.109 39.401   20.811  1.00 172.10 ? 381  GLU A OE2   1 
ATOM   6486  N  N     . ALA I  4 382  ? -5.365  38.277   20.395  1.00 138.05 ? 382  ALA A N     1 
ATOM   6487  C  CA    . ALA I  4 382  ? -3.921  38.043   20.458  1.00 135.70 ? 382  ALA A CA    1 
ATOM   6488  C  C     . ALA I  4 382  ? -3.525  36.816   19.669  1.00 133.89 ? 382  ALA A C     1 
ATOM   6489  O  O     . ALA I  4 382  ? -2.484  36.791   19.017  1.00 133.84 ? 382  ALA A O     1 
ATOM   6490  C  CB    . ALA I  4 382  ? -3.478  37.877   21.904  1.00 128.02 ? 382  ALA A CB    1 
ATOM   6491  N  N     . ILE I  4 383  ? -4.362  35.791   19.742  1.00 135.30 ? 383  ILE A N     1 
ATOM   6492  C  CA    . ILE I  4 383  ? -4.076  34.542   19.071  1.00 130.43 ? 383  ILE A CA    1 
ATOM   6493  C  C     . ILE I  4 383  ? -4.084  34.791   17.564  1.00 129.81 ? 383  ILE A C     1 
ATOM   6494  O  O     . ILE I  4 383  ? -3.200  34.310   16.844  1.00 134.49 ? 383  ILE A O     1 
ATOM   6495  C  CB    . ILE I  4 383  ? -5.060  33.433   19.492  1.00 126.40 ? 383  ILE A CB    1 
ATOM   6496  C  CG1   . ILE I  4 383  ? -4.825  33.047   20.958  1.00 123.75 ? 383  ILE A CG1   1 
ATOM   6497  C  CG2   . ILE I  4 383  ? -4.875  32.207   18.622  1.00 130.03 ? 383  ILE A CG2   1 
ATOM   6498  C  CD1   . ILE I  4 383  ? -5.785  32.000   21.470  1.00 123.61 ? 383  ILE A CD1   1 
ATOM   6499  N  N     . LEU I  4 384  ? -5.047  35.576   17.088  1.00 126.36 ? 384  LEU A N     1 
ATOM   6500  C  CA    . LEU I  4 384  ? -5.126  35.884   15.652  1.00 124.09 ? 384  LEU A CA    1 
ATOM   6501  C  C     . LEU I  4 384  ? -3.886  36.607   15.194  1.00 131.27 ? 384  LEU A C     1 
ATOM   6502  O  O     . LEU I  4 384  ? -3.254  36.206   14.223  1.00 136.94 ? 384  LEU A O     1 
ATOM   6503  C  CB    . LEU I  4 384  ? -6.330  36.761   15.313  1.00 119.16 ? 384  LEU A CB    1 
ATOM   6504  C  CG    . LEU I  4 384  ? -7.517  36.036   14.696  1.00 122.05 ? 384  LEU A CG    1 
ATOM   6505  C  CD1   . LEU I  4 384  ? -8.699  36.972   14.492  1.00 128.00 ? 384  LEU A CD1   1 
ATOM   6506  C  CD2   . LEU I  4 384  ? -7.118  35.402   13.381  1.00 119.31 ? 384  LEU A CD2   1 
ATOM   6507  N  N     . HIS I  4 385  ? -3.553  37.684   15.898  1.00 134.16 ? 385  HIS A N     1 
ATOM   6508  C  CA    . HIS I  4 385  ? -2.401  38.515   15.552  1.00 130.23 ? 385  HIS A CA    1 
ATOM   6509  C  C     . HIS I  4 385  ? -1.111  37.759   15.668  1.00 130.06 ? 385  HIS A C     1 
ATOM   6510  O  O     . HIS I  4 385  ? -0.163  38.051   14.953  1.00 135.81 ? 385  HIS A O     1 
ATOM   6511  C  CB    . HIS I  4 385  ? -2.363  39.750   16.439  1.00 133.69 ? 385  HIS A CB    1 
ATOM   6512  C  CG    . HIS I  4 385  ? -1.417  40.821   15.964  1.00 133.23 ? 385  HIS A CG    1 
ATOM   6513  N  ND1   . HIS I  4 385  ? -0.216  41.027   16.532  1.00 138.02 ? 385  HIS A ND1   1 
ATOM   6514  C  CD2   . HIS I  4 385  ? -1.547  41.770   14.959  1.00 131.24 ? 385  HIS A CD2   1 
ATOM   6515  C  CE1   . HIS I  4 385  ? 0.397   42.046   15.913  1.00 140.89 ? 385  HIS A CE1   1 
ATOM   6516  N  NE2   . HIS I  4 385  ? -0.419  42.495   14.944  1.00 138.53 ? 385  HIS A NE2   1 
ATOM   6517  N  N     . ARG I  4 386  ? -1.056  36.777   16.564  1.00 132.22 ? 386  ARG A N     1 
ATOM   6518  C  CA    . ARG I  4 386  ? 0.119   35.917   16.661  1.00 133.68 ? 386  ARG A CA    1 
ATOM   6519  C  C     . ARG I  4 386  ? 0.236   35.133   15.365  1.00 129.93 ? 386  ARG A C     1 
ATOM   6520  O  O     . ARG I  4 386  ? 1.239   35.211   14.677  1.00 128.74 ? 386  ARG A O     1 
ATOM   6521  C  CB    . ARG I  4 386  ? 0.015   34.972   17.867  1.00 134.48 ? 386  ARG A CB    1 
ATOM   6522  C  CG    . ARG I  4 386  ? 1.257   34.124   18.138  1.00 137.60 ? 386  ARG A CG    1 
ATOM   6523  C  CD    . ARG I  4 386  ? 2.478   34.963   18.495  1.00 141.13 ? 386  ARG A CD    1 
ATOM   6524  N  NE    . ARG I  4 386  ? 3.347   34.301   19.479  1.00 142.38 ? 386  ARG A NE    1 
ATOM   6525  C  CZ    . ARG I  4 386  ? 4.162   33.292   19.208  1.00 131.28 ? 386  ARG A CZ    1 
ATOM   6526  N  NH1   . ARG I  4 386  ? 4.222   32.812   17.985  1.00 142.07 ? 386  ARG A NH1   1 
ATOM   6527  N  NH2   . ARG I  4 386  ? 4.912   32.757   20.156  1.00 131.28 ? 386  ARG A NH2   1 
ATOM   6528  N  N     . ALA I  4 387  ? -0.814  34.396   15.026  1.00 128.61 ? 387  ALA A N     1 
ATOM   6529  C  CA    . ALA I  4 387  ? -0.784  33.543   13.851  1.00 128.21 ? 387  ALA A CA    1 
ATOM   6530  C  C     . ALA I  4 387  ? -0.721  34.353   12.546  1.00 130.54 ? 387  ALA A C     1 
ATOM   6531  O  O     . ALA I  4 387  ? -0.097  33.915   11.569  1.00 139.00 ? 387  ALA A O     1 
ATOM   6532  C  CB    . ALA I  4 387  ? -1.980  32.606   13.855  1.00 121.89 ? 387  ALA A CB    1 
ATOM   6533  N  N     . LEU I  4 388  ? -1.357  35.523   12.537  1.00 125.40 ? 388  LEU A N     1 
ATOM   6534  C  CA    . LEU I  4 388  ? -1.397  36.379   11.349  1.00 129.48 ? 388  LEU A CA    1 
ATOM   6535  C  C     . LEU I  4 388  ? -0.042  37.008   11.039  1.00 132.64 ? 388  LEU A C     1 
ATOM   6536  O  O     . LEU I  4 388  ? 0.291   37.200   9.859   1.00 126.20 ? 388  LEU A O     1 
ATOM   6537  C  CB    . LEU I  4 388  ? -2.432  37.502   11.510  1.00 129.57 ? 388  LEU A CB    1 
ATOM   6538  C  CG    . LEU I  4 388  ? -3.914  37.169   11.319  1.00 125.54 ? 388  LEU A CG    1 
ATOM   6539  C  CD1   . LEU I  4 388  ? -4.766  38.317   11.824  1.00 120.60 ? 388  LEU A CD1   1 
ATOM   6540  C  CD2   . LEU I  4 388  ? -4.235  36.898   9.860   1.00 126.42 ? 388  LEU A CD2   1 
ATOM   6541  N  N     . TYR I  4 389  ? 0.701   37.358   12.098  1.00 131.42 ? 389  TYR A N     1 
ATOM   6542  C  CA    . TYR I  4 389  ? 2.074   37.874   11.982  1.00 123.85 ? 389  TYR A CA    1 
ATOM   6543  C  C     . TYR I  4 389  ? 3.024   36.799   11.469  1.00 124.88 ? 389  TYR A C     1 
ATOM   6544  O  O     . TYR I  4 389  ? 3.843   37.065   10.602  1.00 134.85 ? 389  TYR A O     1 
ATOM   6545  C  CB    . TYR I  4 389  ? 2.567   38.390   13.328  1.00 123.87 ? 389  TYR A CB    1 
ATOM   6546  C  CG    . TYR I  4 389  ? 4.021   38.798   13.351  1.00 127.40 ? 389  TYR A CG    1 
ATOM   6547  C  CD1   . TYR I  4 389  ? 4.488   39.867   12.564  1.00 126.56 ? 389  TYR A CD1   1 
ATOM   6548  C  CD2   . TYR I  4 389  ? 4.931   38.138   14.176  1.00 127.93 ? 389  TYR A CD2   1 
ATOM   6549  C  CE1   . TYR I  4 389  ? 5.825   40.249   12.586  1.00 124.79 ? 389  TYR A CE1   1 
ATOM   6550  C  CE2   . TYR I  4 389  ? 6.265   38.518   14.218  1.00 135.01 ? 389  TYR A CE2   1 
ATOM   6551  C  CZ    . TYR I  4 389  ? 6.717   39.564   13.424  1.00 134.28 ? 389  TYR A CZ    1 
ATOM   6552  O  OH    . TYR I  4 389  ? 8.060   39.899   13.502  1.00 127.52 ? 389  TYR A OH    1 
ATOM   6553  N  N     . GLU I  4 390  ? 2.905   35.587   11.997  1.00 122.19 ? 390  GLU A N     1 
ATOM   6554  C  CA    . GLU I  4 390  ? 3.738   34.488   11.564  1.00 121.81 ? 390  GLU A CA    1 
ATOM   6555  C  C     . GLU I  4 390  ? 3.560   34.200   10.089  1.00 122.95 ? 390  GLU A C     1 
ATOM   6556  O  O     . GLU I  4 390  ? 4.527   34.157   9.341   1.00 129.18 ? 390  GLU A O     1 
ATOM   6557  C  CB    . GLU I  4 390  ? 3.426   33.245   12.382  1.00 121.97 ? 390  GLU A CB    1 
ATOM   6558  C  CG    . GLU I  4 390  ? 3.991   33.320   13.792  1.00 121.51 ? 390  GLU A CG    1 
ATOM   6559  C  CD    . GLU I  4 390  ? 3.926   32.000   14.530  1.00 125.41 ? 390  GLU A CD    1 
ATOM   6560  O  OE1   . GLU I  4 390  ? 3.880   32.055   15.754  1.00 130.94 ? 390  GLU A OE1   1 
ATOM   6561  O  OE2   . GLU I  4 390  ? 3.905   30.909   13.919  1.00 133.72 ? 390  GLU A OE2   1 
ATOM   6562  N  N     . LEU I  4 391  ? 2.319   34.002   9.684   1.00 125.07 ? 391  LEU A N     1 
ATOM   6563  C  CA    . LEU I  4 391  ? 2.009   33.671   8.304   1.00 127.31 ? 391  LEU A CA    1 
ATOM   6564  C  C     . LEU I  4 391  ? 2.507   34.738   7.338   1.00 123.41 ? 391  LEU A C     1 
ATOM   6565  O  O     . LEU I  4 391  ? 2.920   34.422   6.241   1.00 126.12 ? 391  LEU A O     1 
ATOM   6566  C  CB    . LEU I  4 391  ? 0.499   33.483   8.144   1.00 132.68 ? 391  LEU A CB    1 
ATOM   6567  C  CG    . LEU I  4 391  ? -0.085  32.233   8.796   1.00 128.59 ? 391  LEU A CG    1 
ATOM   6568  C  CD1   . LEU I  4 391  ? -1.588  32.398   8.893   1.00 129.43 ? 391  LEU A CD1   1 
ATOM   6569  C  CD2   . LEU I  4 391  ? 0.287   30.983   8.002   1.00 127.38 ? 391  LEU A CD2   1 
ATOM   6570  N  N     . SER I  4 392  ? 2.450   35.998   7.749   1.00 130.52 ? 392  SER A N     1 
ATOM   6571  C  CA    . SER I  4 392  ? 2.898   37.113   6.919   1.00 132.31 ? 392  SER A CA    1 
ATOM   6572  C  C     . SER I  4 392  ? 4.401   37.008   6.693   1.00 130.32 ? 392  SER A C     1 
ATOM   6573  O  O     . SER I  4 392  ? 4.883   37.228   5.587   1.00 128.58 ? 392  SER A O     1 
ATOM   6574  C  CB    . SER I  4 392  ? 2.549   38.448   7.595   1.00 140.26 ? 392  SER A CB    1 
ATOM   6575  O  OG    . SER I  4 392  ? 3.000   39.555   6.835   1.00 149.32 ? 392  SER A OG    1 
ATOM   6576  N  N     . VAL I  4 393  ? 5.129   36.655   7.750   1.00 131.72 ? 393  VAL A N     1 
ATOM   6577  C  CA    . VAL I  4 393  ? 6.582   36.475   7.681   1.00 124.50 ? 393  VAL A CA    1 
ATOM   6578  C  C     . VAL I  4 393  ? 6.911   35.257   6.834   1.00 119.64 ? 393  VAL A C     1 
ATOM   6579  O  O     . VAL I  4 393  ? 7.821   35.296   6.031   1.00 129.34 ? 393  VAL A O     1 
ATOM   6580  C  CB    . VAL I  4 393  ? 7.211   36.281   9.082   1.00 124.73 ? 393  VAL A CB    1 
ATOM   6581  C  CG1   . VAL I  4 393  ? 8.705   36.036   8.964   1.00 114.58 ? 393  VAL A CG1   1 
ATOM   6582  C  CG2   . VAL I  4 393  ? 6.922   37.469   9.997   1.00 125.33 ? 393  VAL A CG2   1 
ATOM   6583  N  N     . ILE I  4 394  ? 6.159   34.182   7.025   1.00 118.56 ? 394  ILE A N     1 
ATOM   6584  C  CA    . ILE I  4 394  ? 6.328   32.942   6.271   1.00 118.27 ? 394  ILE A CA    1 
ATOM   6585  C  C     . ILE I  4 394  ? 6.059   33.150   4.787   1.00 121.38 ? 394  ILE A C     1 
ATOM   6586  O  O     . ILE I  4 394  ? 6.780   32.616   3.946   1.00 130.21 ? 394  ILE A O     1 
ATOM   6587  C  CB    . ILE I  4 394  ? 5.377   31.849   6.813   1.00 118.94 ? 394  ILE A CB    1 
ATOM   6588  C  CG1   . ILE I  4 394  ? 5.873   31.352   8.163   1.00 121.69 ? 394  ILE A CG1   1 
ATOM   6589  C  CG2   . ILE I  4 394  ? 5.258   30.674   5.863   1.00 118.32 ? 394  ILE A CG2   1 
ATOM   6590  C  CD1   . ILE I  4 394  ? 4.858   30.504   8.878   1.00 123.02 ? 394  ILE A CD1   1 
ATOM   6591  N  N     . GLU I  4 395  ? 5.023   33.918   4.472   1.00 123.89 ? 395  GLU A N     1 
ATOM   6592  C  CA    . GLU I  4 395  ? 4.655   34.193   3.087   1.00 128.21 ? 395  GLU A CA    1 
ATOM   6593  C  C     . GLU I  4 395  ? 5.693   35.081   2.404   1.00 137.64 ? 395  GLU A C     1 
ATOM   6594  O  O     . GLU I  4 395  ? 6.103   34.803   1.263   1.00 144.63 ? 395  GLU A O     1 
ATOM   6595  C  CB    . GLU I  4 395  ? 3.268   34.846   3.001   1.00 129.96 ? 395  GLU A CB    1 
ATOM   6596  C  CG    . GLU I  4 395  ? 2.124   33.852   3.172   1.00 138.85 ? 395  GLU A CG    1 
ATOM   6597  C  CD    . GLU I  4 395  ? 0.742   34.498   3.178   1.00 140.94 ? 395  GLU A CD    1 
ATOM   6598  O  OE1   . GLU I  4 395  ? 0.607   35.690   2.794   1.00 134.68 ? 395  GLU A OE1   1 
ATOM   6599  O  OE2   . GLU I  4 395  ? -0.214  33.792   3.572   1.00 140.17 ? 395  GLU A OE2   1 
ATOM   6600  N  N     . ARG I  4 396  ? 6.122   36.136   3.097   1.00 136.33 ? 396  ARG A N     1 
ATOM   6601  C  CA    . ARG I  4 396  ? 7.062   37.092   2.522   1.00 133.82 ? 396  ARG A CA    1 
ATOM   6602  C  C     . ARG I  4 396  ? 8.419   36.469   2.244   1.00 127.51 ? 396  ARG A C     1 
ATOM   6603  O  O     . ARG I  4 396  ? 9.036   36.711   1.200   1.00 131.50 ? 396  ARG A O     1 
ATOM   6604  C  CB    . ARG I  4 396  ? 7.259   38.284   3.440   1.00 137.95 ? 396  ARG A CB    1 
ATOM   6605  C  CG    . ARG I  4 396  ? 7.973   39.450   2.759   1.00 148.92 ? 396  ARG A CG    1 
ATOM   6606  C  CD    . ARG I  4 396  ? 9.014   40.059   3.678   1.00 155.21 ? 396  ARG A CD    1 
ATOM   6607  N  NE    . ARG I  4 396  ? 8.402   40.647   4.867   1.00 165.59 ? 396  ARG A NE    1 
ATOM   6608  C  CZ    . ARG I  4 396  ? 9.065   41.037   5.952   1.00 166.19 ? 396  ARG A CZ    1 
ATOM   6609  N  NH1   . ARG I  4 396  ? 10.385  40.892   6.031   1.00 167.68 ? 396  ARG A NH1   1 
ATOM   6610  N  NH2   . ARG I  4 396  ? 8.398   41.571   6.968   1.00 171.24 ? 396  ARG A NH2   1 
ATOM   6611  N  N     . MET I  4 397  ? 8.896   35.685   3.192   1.00 119.02 ? 397  MET A N     1 
ATOM   6612  C  CA    . MET I  4 397  ? 10.163  34.987   3.020   1.00 123.12 ? 397  MET A CA    1 
ATOM   6613  C  C     . MET I  4 397  ? 10.078  33.874   1.951   1.00 121.68 ? 397  MET A C     1 
ATOM   6614  O  O     . MET I  4 397  ? 11.081  33.461   1.358   1.00 116.99 ? 397  MET A O     1 
ATOM   6615  C  CB    . MET I  4 397  ? 10.621  34.418   4.365   1.00 118.37 ? 397  MET A CB    1 
ATOM   6616  C  CG    . MET I  4 397  ? 11.062  35.491   5.332   1.00 119.93 ? 397  MET A CG    1 
ATOM   6617  S  SD    . MET I  4 397  ? 11.495  34.863   6.960   1.00 131.54 ? 397  MET A SD    1 
ATOM   6618  C  CE    . MET I  4 397  ? 13.195  34.340   6.831   1.00 116.39 ? 397  MET A CE    1 
ATOM   6619  N  N     . GLY I  4 398  ? 8.866   33.387   1.724   1.00 122.35 ? 398  GLY A N     1 
ATOM   6620  C  CA    . GLY I  4 398  ? 8.595   32.437   0.659   1.00 123.56 ? 398  GLY A CA    1 
ATOM   6621  C  C     . GLY I  4 398  ? 8.734   31.004   1.107   1.00 127.11 ? 398  GLY A C     1 
ATOM   6622  O  O     . GLY I  4 398  ? 9.336   30.204   0.387   1.00 132.85 ? 398  GLY A O     1 
ATOM   6623  N  N     . PHE I  4 399  ? 8.176   30.675   2.284   1.00 127.62 ? 399  PHE A N     1 
ATOM   6624  C  CA    . PHE I  4 399  ? 8.274   29.313   2.833   1.00 125.86 ? 399  PHE A CA    1 
ATOM   6625  C  C     . PHE I  4 399  ? 6.947   28.615   3.042   1.00 122.89 ? 399  PHE A C     1 
ATOM   6626  O  O     . PHE I  4 399  ? 6.888   27.601   3.722   1.00 126.87 ? 399  PHE A O     1 
ATOM   6627  C  CB    . PHE I  4 399  ? 9.088   29.288   4.138   1.00 119.82 ? 399  PHE A CB    1 
ATOM   6628  C  CG    . PHE I  4 399  ? 10.481  29.832   3.991   1.00 122.09 ? 399  PHE A CG    1 
ATOM   6629  C  CD1   . PHE I  4 399  ? 10.955  30.765   4.885   1.00 128.50 ? 399  PHE A CD1   1 
ATOM   6630  C  CD2   . PHE I  4 399  ? 11.307  29.433   2.934   1.00 121.95 ? 399  PHE A CD2   1 
ATOM   6631  C  CE1   . PHE I  4 399  ? 12.232  31.286   4.748   1.00 135.00 ? 399  PHE A CE1   1 
ATOM   6632  C  CE2   . PHE I  4 399  ? 12.580  29.952   2.787   1.00 122.64 ? 399  PHE A CE2   1 
ATOM   6633  C  CZ    . PHE I  4 399  ? 13.045  30.879   3.698   1.00 133.09 ? 399  PHE A CZ    1 
ATOM   6634  N  N     . PRO I  4 400  ? 5.885   29.097   2.400   1.00 126.81 ? 400  PRO A N     1 
ATOM   6635  C  CA    . PRO I  4 400  ? 4.624   28.428   2.693   1.00 129.25 ? 400  PRO A CA    1 
ATOM   6636  C  C     . PRO I  4 400  ? 4.627   26.968   2.239   1.00 124.27 ? 400  PRO A C     1 
ATOM   6637  O  O     . PRO I  4 400  ? 4.006   26.117   2.885   1.00 133.55 ? 400  PRO A O     1 
ATOM   6638  C  CB    . PRO I  4 400  ? 3.603   29.255   1.909   1.00 133.17 ? 400  PRO A CB    1 
ATOM   6639  C  CG    . PRO I  4 400  ? 4.375   29.783   0.756   1.00 136.76 ? 400  PRO A CG    1 
ATOM   6640  C  CD    . PRO I  4 400  ? 5.774   30.014   1.255   1.00 132.09 ? 400  PRO A CD    1 
ATOM   6641  N  N     . GLY I  4 401  ? 5.327   26.677   1.152   1.00 112.15 ? 401  GLY A N     1 
ATOM   6642  C  CA    . GLY I  4 401  ? 5.386   25.320   0.639   1.00 117.85 ? 401  GLY A CA    1 
ATOM   6643  C  C     . GLY I  4 401  ? 6.137   24.410   1.588   1.00 123.49 ? 401  GLY A C     1 
ATOM   6644  O  O     . GLY I  4 401  ? 5.851   23.192   1.678   1.00 121.08 ? 401  GLY A O     1 
ATOM   6645  N  N     . TYR I  4 402  ? 7.086   25.001   2.315   1.00 120.76 ? 402  TYR A N     1 
ATOM   6646  C  CA    . TYR I  4 402  ? 7.903   24.236   3.254   1.00 120.66 ? 402  TYR A CA    1 
ATOM   6647  C  C     . TYR I  4 402  ? 7.098   23.610   4.390   1.00 126.50 ? 402  TYR A C     1 
ATOM   6648  O  O     . TYR I  4 402  ? 7.272   22.431   4.701   1.00 128.51 ? 402  TYR A O     1 
ATOM   6649  C  CB    . TYR I  4 402  ? 8.971   25.114   3.847   1.00 116.79 ? 402  TYR A CB    1 
ATOM   6650  C  CG    . TYR I  4 402  ? 9.878   24.389   4.793   1.00 117.23 ? 402  TYR A CG    1 
ATOM   6651  C  CD1   . TYR I  4 402  ? 10.853  23.528   4.324   1.00 127.65 ? 402  TYR A CD1   1 
ATOM   6652  C  CD2   . TYR I  4 402  ? 9.783   24.580   6.154   1.00 121.87 ? 402  TYR A CD2   1 
ATOM   6653  C  CE1   . TYR I  4 402  ? 11.707  22.865   5.194   1.00 129.14 ? 402  TYR A CE1   1 
ATOM   6654  C  CE2   . TYR I  4 402  ? 10.638  23.936   7.034   1.00 121.46 ? 402  TYR A CE2   1 
ATOM   6655  C  CZ    . TYR I  4 402  ? 11.592  23.077   6.550   1.00 125.94 ? 402  TYR A CZ    1 
ATOM   6656  O  OH    . TYR I  4 402  ? 12.440  22.438   7.419   1.00 135.75 ? 402  TYR A OH    1 
ATOM   6657  N  N     . PHE I  4 403  ? 6.222   24.403   4.999   1.00 120.91 ? 403  PHE A N     1 
ATOM   6658  C  CA    . PHE I  4 403  ? 5.362   23.918   6.052   1.00 112.55 ? 403  PHE A CA    1 
ATOM   6659  C  C     . PHE I  4 403  ? 4.351   22.902   5.535   1.00 111.36 ? 403  PHE A C     1 
ATOM   6660  O  O     . PHE I  4 403  ? 4.165   21.862   6.152   1.00 115.24 ? 403  PHE A O     1 
ATOM   6661  C  CB    . PHE I  4 403  ? 4.642   25.081   6.701   1.00 122.18 ? 403  PHE A CB    1 
ATOM   6662  C  CG    . PHE I  4 403  ? 5.548   26.014   7.451   1.00 122.11 ? 403  PHE A CG    1 
ATOM   6663  C  CD1   . PHE I  4 403  ? 5.848   25.793   8.776   1.00 120.75 ? 403  PHE A CD1   1 
ATOM   6664  C  CD2   . PHE I  4 403  ? 6.077   27.127   6.833   1.00 122.12 ? 403  PHE A CD2   1 
ATOM   6665  C  CE1   . PHE I  4 403  ? 6.676   26.656   9.454   1.00 122.07 ? 403  PHE A CE1   1 
ATOM   6666  C  CE2   . PHE I  4 403  ? 6.902   28.000   7.510   1.00 113.70 ? 403  PHE A CE2   1 
ATOM   6667  C  CZ    . PHE I  4 403  ? 7.203   27.766   8.817   1.00 116.40 ? 403  PHE A CZ    1 
ATOM   6668  N  N     . LEU I  4 404  ? 3.721   23.184   4.397   1.00 113.49 ? 404  LEU A N     1 
ATOM   6669  C  CA    . LEU I  4 404  ? 2.784   22.233   3.770   1.00 118.42 ? 404  LEU A CA    1 
ATOM   6670  C  C     . LEU I  4 404  ? 3.397   20.851   3.482   1.00 117.38 ? 404  LEU A C     1 
ATOM   6671  O  O     . LEU I  4 404  ? 2.708   19.833   3.610   1.00 122.15 ? 404  LEU A O     1 
ATOM   6672  C  CB    . LEU I  4 404  ? 2.242   22.794   2.456   1.00 116.40 ? 404  LEU A CB    1 
ATOM   6673  C  CG    . LEU I  4 404  ? 1.395   24.043   2.553   1.00 108.25 ? 404  LEU A CG    1 
ATOM   6674  C  CD1   . LEU I  4 404  ? 1.188   24.557   1.161   1.00 100.85 ? 404  LEU A CD1   1 
ATOM   6675  C  CD2   . LEU I  4 404  ? 0.062   23.728   3.212   1.00 118.65 ? 404  LEU A CD2   1 
ATOM   6676  N  N     . ILE I  4 405  ? 4.666   20.822   3.080   1.00 108.20 ? 405  ILE A N     1 
ATOM   6677  C  CA    . ILE I  4 405  ? 5.362   19.553   2.871   1.00 113.42 ? 405  ILE A CA    1 
ATOM   6678  C  C     . ILE I  4 405  ? 5.653   18.850   4.188   1.00 113.55 ? 405  ILE A C     1 
ATOM   6679  O  O     . ILE I  4 405  ? 5.571   17.624   4.261   1.00 107.85 ? 405  ILE A O     1 
ATOM   6680  C  CB    . ILE I  4 405  ? 6.675   19.740   2.073   1.00 117.50 ? 405  ILE A CB    1 
ATOM   6681  C  CG1   . ILE I  4 405  ? 6.367   20.069   0.620   1.00 122.07 ? 405  ILE A CG1   1 
ATOM   6682  C  CG2   . ILE I  4 405  ? 7.512   18.471   2.043   1.00 111.71 ? 405  ILE A CG2   1 
ATOM   6683  C  CD1   . ILE I  4 405  ? 7.581   20.523   -0.153  1.00 117.13 ? 405  ILE A CD1   1 
ATOM   6684  N  N     . VAL I  4 406  ? 5.995   19.636   5.212   1.00 120.39 ? 406  VAL A N     1 
ATOM   6685  C  CA    . VAL I  4 406  ? 6.406   19.103   6.519   1.00 118.53 ? 406  VAL A CA    1 
ATOM   6686  C  C     . VAL I  4 406  ? 5.226   18.541   7.273   1.00 115.72 ? 406  VAL A C     1 
ATOM   6687  O  O     . VAL I  4 406  ? 5.304   17.438   7.834   1.00 120.47 ? 406  VAL A O     1 
ATOM   6688  C  CB    . VAL I  4 406  ? 7.095   20.169   7.399   1.00 118.70 ? 406  VAL A CB    1 
ATOM   6689  C  CG1   . VAL I  4 406  ? 7.306   19.655   8.817   1.00 116.48 ? 406  VAL A CG1   1 
ATOM   6690  C  CG2   . VAL I  4 406  ? 8.426   20.567   6.780   1.00 120.32 ? 406  VAL A CG2   1 
ATOM   6691  N  N     . GLN I  4 407  ? 4.130   19.289   7.274   1.00 107.91 ? 407  GLN A N     1 
ATOM   6692  C  CA    . GLN I  4 407  ? 2.956   18.878   8.014   1.00 111.66 ? 407  GLN A CA    1 
ATOM   6693  C  C     . GLN I  4 407  ? 2.228   17.726   7.335   1.00 111.48 ? 407  GLN A C     1 
ATOM   6694  O  O     . GLN I  4 407  ? 1.506   16.974   7.981   1.00 127.05 ? 407  GLN A O     1 
ATOM   6695  C  CB    . GLN I  4 407  ? 2.022   20.063   8.243   1.00 113.71 ? 407  GLN A CB    1 
ATOM   6696  C  CG    . GLN I  4 407  ? 1.305   20.555   6.992   1.00 117.78 ? 407  GLN A CG    1 
ATOM   6697  C  CD    . GLN I  4 407  ? -0.032  19.892   6.747   1.00 118.75 ? 407  GLN A CD    1 
ATOM   6698  O  OE1   . GLN I  4 407  ? -0.601  19.257   7.638   1.00 131.50 ? 407  GLN A OE1   1 
ATOM   6699  N  NE2   . GLN I  4 407  ? -0.544  20.037   5.530   1.00 111.66 ? 407  GLN A NE2   1 
ATOM   6700  N  N     . ASP I  4 408  ? 2.436   17.560   6.044   1.00 109.84 ? 408  ASP A N     1 
ATOM   6701  C  CA    . ASP I  4 408  ? 1.786   16.476   5.327   1.00 116.52 ? 408  ASP A CA    1 
ATOM   6702  C  C     . ASP I  4 408  ? 2.132   15.106   5.904   1.00 109.94 ? 408  ASP A C     1 
ATOM   6703  O  O     . ASP I  4 408  ? 1.268   14.350   6.308   1.00 105.18 ? 408  ASP A O     1 
ATOM   6704  C  CB    . ASP I  4 408  ? 2.175   16.516   3.851   1.00 117.68 ? 408  ASP A CB    1 
ATOM   6705  C  CG    . ASP I  4 408  ? 1.539   15.415   3.071   1.00 122.45 ? 408  ASP A CG    1 
ATOM   6706  O  OD1   . ASP I  4 408  ? 0.325   15.158   3.278   1.00 124.58 ? 408  ASP A OD1   1 
ATOM   6707  O  OD2   . ASP I  4 408  ? 2.260   14.796   2.268   1.00 136.61 ? 408  ASP A OD2   1 
ATOM   6708  N  N     . TYR I  4 409  ? 3.409   14.788   5.928   1.00 111.40 ? 409  TYR A N     1 
ATOM   6709  C  CA    . TYR I  4 409  ? 3.820   13.467   6.353   1.00 115.57 ? 409  TYR A CA    1 
ATOM   6710  C  C     . TYR I  4 409  ? 3.680   13.301   7.850   1.00 120.48 ? 409  TYR A C     1 
ATOM   6711  O  O     . TYR I  4 409  ? 3.554   12.183   8.347   1.00 128.37 ? 409  TYR A O     1 
ATOM   6712  C  CB    . TYR I  4 409  ? 5.238   13.128   5.870   1.00 110.33 ? 409  TYR A CB    1 
ATOM   6713  C  CG    . TYR I  4 409  ? 6.339   14.078   6.261   1.00 110.56 ? 409  TYR A CG    1 
ATOM   6714  C  CD1   . TYR I  4 409  ? 6.850   14.100   7.557   1.00 112.93 ? 409  TYR A CD1   1 
ATOM   6715  C  CD2   . TYR I  4 409  ? 6.921   14.918   5.318   1.00 111.30 ? 409  TYR A CD2   1 
ATOM   6716  C  CE1   . TYR I  4 409  ? 7.899   14.946   7.904   1.00 109.63 ? 409  TYR A CE1   1 
ATOM   6717  C  CE2   . TYR I  4 409  ? 7.959   15.773   5.657   1.00 109.22 ? 409  TYR A CE2   1 
ATOM   6718  C  CZ    . TYR I  4 409  ? 8.458   15.781   6.950   1.00 108.85 ? 409  TYR A CZ    1 
ATOM   6719  O  OH    . TYR I  4 409  ? 9.500   16.635   7.288   1.00 103.13 ? 409  TYR A OH    1 
ATOM   6720  N  N     . ILE I  4 410  ? 3.688   14.413   8.575   1.00 123.90 ? 410  ILE A N     1 
ATOM   6721  C  CA    . ILE I  4 410  ? 3.424   14.364   10.013  1.00 122.93 ? 410  ILE A CA    1 
ATOM   6722  C  C     . ILE I  4 410  ? 1.972   13.963   10.270  1.00 121.13 ? 410  ILE A C     1 
ATOM   6723  O  O     . ILE I  4 410  ? 1.717   13.033   11.031  1.00 113.44 ? 410  ILE A O     1 
ATOM   6724  C  CB    . ILE I  4 410  ? 3.724   15.711   10.680  1.00 122.40 ? 410  ILE A CB    1 
ATOM   6725  C  CG1   . ILE I  4 410  ? 5.231   15.955   10.701  1.00 124.94 ? 410  ILE A CG1   1 
ATOM   6726  C  CG2   . ILE I  4 410  ? 3.207   15.719   12.099  1.00 119.32 ? 410  ILE A CG2   1 
ATOM   6727  C  CD1   . ILE I  4 410  ? 5.611   17.254   11.385  1.00 123.50 ? 410  ILE A CD1   1 
ATOM   6728  N  N     . ASN I  4 411  ? 1.046   14.645   9.595   1.00 121.92 ? 411  ASN A N     1 
ATOM   6729  C  CA    . ASN I  4 411  ? -0.377  14.308   9.653   1.00 123.10 ? 411  ASN A CA    1 
ATOM   6730  C  C     . ASN I  4 411  ? -0.655  12.907   9.144   1.00 124.43 ? 411  ASN A C     1 
ATOM   6731  O  O     . ASN I  4 411  ? -1.548  12.229   9.638   1.00 142.24 ? 411  ASN A O     1 
ATOM   6732  C  CB    . ASN I  4 411  ? -1.221  15.315   8.864   1.00 127.79 ? 411  ASN A CB    1 
ATOM   6733  C  CG    . ASN I  4 411  ? -1.418  16.633   9.604   1.00 135.50 ? 411  ASN A CG    1 
ATOM   6734  O  OD1   . ASN I  4 411  ? -2.535  17.160   9.673   1.00 147.51 ? 411  ASN A OD1   1 
ATOM   6735  N  ND2   . ASN I  4 411  ? -0.341  17.163   10.173  1.00 134.06 ? 411  ASN A ND2   1 
ATOM   6736  N  N     . TRP I  4 412  ? 0.119   12.481   8.154   1.00 132.67 ? 412  TRP A N     1 
ATOM   6737  C  CA    . TRP I  4 412  ? 0.062   11.110   7.637   1.00 127.94 ? 412  TRP A CA    1 
ATOM   6738  C  C     . TRP I  4 412  ? 0.464   10.142   8.710   1.00 125.03 ? 412  TRP A C     1 
ATOM   6739  O  O     . TRP I  4 412  ? -0.176  9.105    8.889   1.00 124.65 ? 412  TRP A O     1 
ATOM   6740  C  CB    . TRP I  4 412  ? 0.986   10.966   6.421   1.00 121.97 ? 412  TRP A CB    1 
ATOM   6741  C  CG    . TRP I  4 412  ? 0.886   9.635    5.729   1.00 123.41 ? 412  TRP A CG    1 
ATOM   6742  C  CD1   . TRP I  4 412  ? 0.037   9.278    4.693   1.00 125.86 ? 412  TRP A CD1   1 
ATOM   6743  C  CD2   . TRP I  4 412  ? 1.665   8.433    6.009   1.00 122.51 ? 412  TRP A CD2   1 
ATOM   6744  N  NE1   . TRP I  4 412  ? 0.234   7.974    4.331   1.00 127.60 ? 412  TRP A NE1   1 
ATOM   6745  C  CE2   . TRP I  4 412  ? 1.190   7.410    5.089   1.00 127.08 ? 412  TRP A CE2   1 
ATOM   6746  C  CE3   . TRP I  4 412  ? 2.658   8.115    6.899   1.00 124.05 ? 412  TRP A CE3   1 
ATOM   6747  C  CZ2   . TRP I  4 412  ? 1.714   6.131    5.080   1.00 133.69 ? 412  TRP A CZ2   1 
ATOM   6748  C  CZ3   . TRP I  4 412  ? 3.183   6.827    6.881   1.00 127.41 ? 412  TRP A CZ3   1 
ATOM   6749  C  CH2   . TRP I  4 412  ? 2.725   5.860    5.988   1.00 128.32 ? 412  TRP A CH2   1 
ATOM   6750  N  N     . ALA I  4 413  ? 1.526   10.481   9.439   1.00 119.88 ? 413  ALA A N     1 
ATOM   6751  C  CA    . ALA I  4 413  ? 2.057   9.603    10.472  1.00 121.33 ? 413  ALA A CA    1 
ATOM   6752  C  C     . ALA I  4 413  ? 1.011   9.341    11.566  1.00 121.22 ? 413  ALA A C     1 
ATOM   6753  O  O     . ALA I  4 413  ? 0.777   8.195    11.982  1.00 115.50 ? 413  ALA A O     1 
ATOM   6754  C  CB    . ALA I  4 413  ? 3.321   10.202   11.058  1.00 120.32 ? 413  ALA A CB    1 
ATOM   6755  N  N     . ARG I  4 414  ? 0.365   10.411   12.003  1.00 120.63 ? 414  ARG A N     1 
ATOM   6756  C  CA    . ARG I  4 414  ? -0.693  10.314   12.994  1.00 120.15 ? 414  ARG A CA    1 
ATOM   6757  C  C     . ARG I  4 414  ? -1.856  9.428    12.483  1.00 126.76 ? 414  ARG A C     1 
ATOM   6758  O  O     . ARG I  4 414  ? -2.347  8.556    13.198  1.00 125.65 ? 414  ARG A O     1 
ATOM   6759  C  CB    . ARG I  4 414  ? -1.180  11.726   13.357  1.00 115.04 ? 414  ARG A CB    1 
ATOM   6760  C  CG    . ARG I  4 414  ? -0.152  12.576   14.105  1.00 112.11 ? 414  ARG A CG    1 
ATOM   6761  C  CD    . ARG I  4 414  ? -0.802  13.716   14.890  1.00 108.13 ? 414  ARG A CD    1 
ATOM   6762  N  NE    . ARG I  4 414  ? 0.192   14.518   15.597  1.00 107.83 ? 414  ARG A NE    1 
ATOM   6763  C  CZ    . ARG I  4 414  ? 0.816   15.584   15.084  1.00 113.54 ? 414  ARG A CZ    1 
ATOM   6764  N  NH1   . ARG I  4 414  ? 0.535   15.995   13.855  1.00 117.40 ? 414  ARG A NH1   1 
ATOM   6765  N  NH2   . ARG I  4 414  ? 1.726   16.259   15.795  1.00 112.28 ? 414  ARG A NH2   1 
ATOM   6766  N  N     . GLY I  4 415  ? -2.262  9.630    11.229  1.00 129.60 ? 415  GLY A N     1 
ATOM   6767  C  CA    . GLY I  4 415  ? -3.392  8.891    10.630  1.00 130.47 ? 415  GLY A CA    1 
ATOM   6768  C  C     . GLY I  4 415  ? -3.077  7.508    10.048  1.00 136.97 ? 415  GLY A C     1 
ATOM   6769  O  O     . GLY I  4 415  ? -3.927  6.898    9.353   1.00 116.90 ? 415  GLY A O     1 
ATOM   6770  N  N     . HIS I  4 416  ? -1.851  7.029    10.301  1.00 140.34 ? 416  HIS A N     1 
ATOM   6771  C  CA    . HIS I  4 416  ? -1.420  5.683    9.901   1.00 138.36 ? 416  HIS A CA    1 
ATOM   6772  C  C     . HIS I  4 416  ? -0.556  5.021    10.965  1.00 144.91 ? 416  HIS A C     1 
ATOM   6773  O  O     . HIS I  4 416  ? 0.411   4.307    10.651  1.00 136.61 ? 416  HIS A O     1 
ATOM   6774  C  CB    . HIS I  4 416  ? -0.684  5.728    8.565   1.00 133.05 ? 416  HIS A CB    1 
ATOM   6775  C  CG    . HIS I  4 416  ? -1.570  6.029    7.392   1.00 124.23 ? 416  HIS A CG    1 
ATOM   6776  N  ND1   . HIS I  4 416  ? -2.233  5.070    6.726   1.00 126.34 ? 416  HIS A ND1   1 
ATOM   6777  C  CD2   . HIS I  4 416  ? -1.886  7.227    6.772   1.00 122.16 ? 416  HIS A CD2   1 
ATOM   6778  C  CE1   . HIS I  4 416  ? -2.941  5.622    5.728   1.00 120.66 ? 416  HIS A CE1   1 
ATOM   6779  N  NE2   . HIS I  4 416  ? -2.728  6.944    5.757   1.00 123.82 ? 416  HIS A NE2   1 
ATOM   6780  N  N     . GLY I  4 417  ? -0.913  5.243    12.234  1.00 149.68 ? 417  GLY A N     1 
ATOM   6781  C  CA    . GLY I  4 417  ? -0.327  4.513    13.368  1.00 142.27 ? 417  GLY A CA    1 
ATOM   6782  C  C     . GLY I  4 417  ? 1.170   4.707    13.551  1.00 131.91 ? 417  GLY A C     1 
ATOM   6783  O  O     . GLY I  4 417  ? 1.891   3.778    13.918  1.00 137.20 ? 417  GLY A O     1 
ATOM   6784  N  N     . VAL I  4 418  ? 1.645   5.916    13.299  1.00 123.65 ? 418  VAL A N     1 
ATOM   6785  C  CA    . VAL I  4 418  ? 3.047   6.249    13.528  1.00 125.33 ? 418  VAL A CA    1 
ATOM   6786  C  C     . VAL I  4 418  ? 3.145   7.395    14.522  1.00 124.99 ? 418  VAL A C     1 
ATOM   6787  O  O     . VAL I  4 418  ? 2.823   8.527    14.184  1.00 119.37 ? 418  VAL A O     1 
ATOM   6788  C  CB    . VAL I  4 418  ? 3.743   6.662    12.216  1.00 127.40 ? 418  VAL A CB    1 
ATOM   6789  C  CG1   . VAL I  4 418  ? 5.190   7.074    12.465  1.00 119.51 ? 418  VAL A CG1   1 
ATOM   6790  C  CG2   . VAL I  4 418  ? 3.677   5.519    11.208  1.00 130.34 ? 418  VAL A CG2   1 
ATOM   6791  N  N     . SER I  4 419  ? 3.596   7.088    15.738  1.00 133.91 ? 419  SER A N     1 
ATOM   6792  C  CA    . SER I  4 419  ? 3.680   8.071    16.816  1.00 137.74 ? 419  SER A CA    1 
ATOM   6793  C  C     . SER I  4 419  ? 4.586   9.236    16.439  1.00 129.66 ? 419  SER A C     1 
ATOM   6794  O  O     . SER I  4 419  ? 5.656   9.021    15.866  1.00 132.03 ? 419  SER A O     1 
ATOM   6795  C  CB    . SER I  4 419  ? 4.225   7.418    18.090  1.00 151.50 ? 419  SER A CB    1 
ATOM   6796  O  OG    . SER I  4 419  ? 4.322   8.369    19.148  1.00 167.28 ? 419  SER A OG    1 
ATOM   6797  N  N     . VAL I  4 420  ? 4.147   10.452   16.777  1.00 118.84 ? 420  VAL A N     1 
ATOM   6798  C  CA    . VAL I  4 420  ? 4.870   11.691   16.477  1.00 112.19 ? 420  VAL A CA    1 
ATOM   6799  C  C     . VAL I  4 420  ? 5.176   12.459   17.746  1.00 112.01 ? 420  VAL A C     1 
ATOM   6800  O  O     . VAL I  4 420  ? 4.277   12.745   18.537  1.00 122.67 ? 420  VAL A O     1 
ATOM   6801  C  CB    . VAL I  4 420  ? 4.031   12.650   15.615  1.00 110.30 ? 420  VAL A CB    1 
ATOM   6802  C  CG1   . VAL I  4 420  ? 4.811   13.930   15.345  1.00 108.34 ? 420  VAL A CG1   1 
ATOM   6803  C  CG2   . VAL I  4 420  ? 3.594   11.982   14.325  1.00 110.95 ? 420  VAL A CG2   1 
ATOM   6804  N  N     . GLY I  4 421  ? 6.439   12.836   17.915  1.00 116.50 ? 421  GLY A N     1 
ATOM   6805  C  CA    . GLY I  4 421  ? 6.879   13.634   19.067  1.00 117.17 ? 421  GLY A CA    1 
ATOM   6806  C  C     . GLY I  4 421  ? 6.342   15.065   19.047  1.00 118.20 ? 421  GLY A C     1 
ATOM   6807  O  O     . GLY I  4 421  ? 5.997   15.589   17.991  1.00 115.45 ? 421  GLY A O     1 
ATOM   6808  N  N     . PRO I  4 422  ? 6.261   15.706   20.225  1.00 119.19 ? 422  PRO A N     1 
ATOM   6809  C  CA    . PRO I  4 422  ? 5.677   17.031   20.306  1.00 117.07 ? 422  PRO A CA    1 
ATOM   6810  C  C     . PRO I  4 422  ? 6.541   18.077   19.631  1.00 118.59 ? 422  PRO A C     1 
ATOM   6811  O  O     . PRO I  4 422  ? 6.055   19.167   19.332  1.00 114.12 ? 422  PRO A O     1 
ATOM   6812  C  CB    . PRO I  4 422  ? 5.610   17.296   21.815  1.00 118.48 ? 422  PRO A CB    1 
ATOM   6813  C  CG    . PRO I  4 422  ? 6.672   16.449   22.405  1.00 117.03 ? 422  PRO A CG    1 
ATOM   6814  C  CD    . PRO I  4 422  ? 6.701   15.223   21.547  1.00 123.06 ? 422  PRO A CD    1 
ATOM   6815  N  N     . GLY I  4 423  ? 7.818   17.769   19.421  1.00 122.61 ? 423  GLY A N     1 
ATOM   6816  C  CA    . GLY I  4 423  ? 8.694   18.675   18.675  1.00 126.86 ? 423  GLY A CA    1 
ATOM   6817  C  C     . GLY I  4 423  ? 10.085  18.761   19.245  1.00 127.72 ? 423  GLY A C     1 
ATOM   6818  O  O     . GLY I  4 423  ? 10.314  18.373   20.409  1.00 120.32 ? 423  GLY A O     1 
ATOM   6819  N  N     . ARG I  4 424  ? 11.016  19.243   18.415  1.00 127.44 ? 424  ARG A N     1 
ATOM   6820  C  CA    . ARG I  4 424  ? 12.387  19.516   18.869  1.00 129.95 ? 424  ARG A CA    1 
ATOM   6821  C  C     . ARG I  4 424  ? 12.973  20.740   18.185  1.00 130.81 ? 424  ARG A C     1 
ATOM   6822  O  O     . ARG I  4 424  ? 12.446  21.201   17.170  1.00 136.72 ? 424  ARG A O     1 
ATOM   6823  C  CB    . ARG I  4 424  ? 13.305  18.300   18.685  1.00 124.90 ? 424  ARG A CB    1 
ATOM   6824  C  CG    . ARG I  4 424  ? 13.283  17.672   17.306  1.00 125.89 ? 424  ARG A CG    1 
ATOM   6825  C  CD    . ARG I  4 424  ? 14.647  17.087   16.960  1.00 133.63 ? 424  ARG A CD    1 
ATOM   6826  N  NE    . ARG I  4 424  ? 15.235  16.288   18.039  1.00 128.37 ? 424  ARG A NE    1 
ATOM   6827  C  CZ    . ARG I  4 424  ? 16.517  15.921   18.101  1.00 126.90 ? 424  ARG A CZ    1 
ATOM   6828  N  NH1   . ARG I  4 424  ? 17.397  16.260   17.155  1.00 119.75 ? 424  ARG A NH1   1 
ATOM   6829  N  NH2   . ARG I  4 424  ? 16.931  15.205   19.136  1.00 134.42 ? 424  ARG A NH2   1 
ATOM   6830  N  N     . GLY I  4 425  ? 14.056  21.264   18.764  1.00 129.98 ? 425  GLY A N     1 
ATOM   6831  C  CA    . GLY I  4 425  ? 14.703  22.472   18.266  1.00 124.85 ? 425  GLY A CA    1 
ATOM   6832  C  C     . GLY I  4 425  ? 13.783  23.663   18.466  1.00 128.06 ? 425  GLY A C     1 
ATOM   6833  O  O     . GLY I  4 425  ? 12.915  23.669   19.356  1.00 127.42 ? 425  GLY A O     1 
ATOM   6834  N  N     . SER I  4 426  ? 13.942  24.655   17.601  1.00 126.63 ? 426  SER A N     1 
ATOM   6835  C  CA    . SER I  4 426  ? 13.163  25.885   17.685  1.00 132.47 ? 426  SER A CA    1 
ATOM   6836  C  C     . SER I  4 426  ? 11.731  25.745   17.134  1.00 129.45 ? 426  SER A C     1 
ATOM   6837  O  O     . SER I  4 426  ? 10.889  26.626   17.324  1.00 119.92 ? 426  SER A O     1 
ATOM   6838  C  CB    . SER I  4 426  ? 13.917  27.019   16.962  1.00 136.40 ? 426  SER A CB    1 
ATOM   6839  O  OG    . SER I  4 426  ? 14.211  26.699   15.604  1.00 125.37 ? 426  SER A OG    1 
ATOM   6840  N  N     . ALA I  4 427  ? 11.466  24.624   16.471  1.00 132.79 ? 427  ALA A N     1 
ATOM   6841  C  CA    . ALA I  4 427  ? 10.240  24.429   15.699  1.00 130.21 ? 427  ALA A CA    1 
ATOM   6842  C  C     . ALA I  4 427  ? 8.981   24.546   16.535  1.00 121.98 ? 427  ALA A C     1 
ATOM   6843  O  O     . ALA I  4 427  ? 7.934   24.898   16.011  1.00 124.85 ? 427  ALA A O     1 
ATOM   6844  C  CB    . ALA I  4 427  ? 10.272  23.076   14.984  1.00 132.02 ? 427  ALA A CB    1 
ATOM   6845  N  N     . ALA I  4 428  ? 9.073   24.240   17.824  1.00 121.40 ? 428  ALA A N     1 
ATOM   6846  C  CA    . ALA I  4 428  ? 7.877   24.246   18.694  1.00 118.95 ? 428  ALA A CA    1 
ATOM   6847  C  C     . ALA I  4 428  ? 7.352   25.646   18.937  1.00 120.11 ? 428  ALA A C     1 
ATOM   6848  O  O     . ALA I  4 428  ? 6.167   25.808   19.224  1.00 122.13 ? 428  ALA A O     1 
ATOM   6849  C  CB    . ALA I  4 428  ? 8.139   23.578   20.042  1.00 114.58 ? 428  ALA A CB    1 
ATOM   6850  N  N     . GLY I  4 429  ? 8.223   26.649   18.831  1.00 117.69 ? 429  GLY A N     1 
ATOM   6851  C  CA    . GLY I  4 429  ? 7.863   28.024   19.156  1.00 116.81 ? 429  GLY A CA    1 
ATOM   6852  C  C     . GLY I  4 429  ? 6.935   28.705   18.163  1.00 120.80 ? 429  GLY A C     1 
ATOM   6853  O  O     . GLY I  4 429  ? 6.332   29.731   18.481  1.00 123.51 ? 429  GLY A O     1 
ATOM   6854  N  N     . SER I  4 430  ? 6.819   28.150   16.959  1.00 120.23 ? 430  SER A N     1 
ATOM   6855  C  CA    . SER I  4 430  ? 5.885   28.668   15.962  1.00 117.71 ? 430  SER A CA    1 
ATOM   6856  C  C     . SER I  4 430  ? 4.458   28.201   16.220  1.00 120.99 ? 430  SER A C     1 
ATOM   6857  O  O     . SER I  4 430  ? 4.182   26.988   16.215  1.00 112.36 ? 430  SER A O     1 
ATOM   6858  C  CB    . SER I  4 430  ? 6.288   28.220   14.562  1.00 116.91 ? 430  SER A CB    1 
ATOM   6859  O  OG    . SER I  4 430  ? 5.439   28.821   13.598  1.00 112.37 ? 430  SER A OG    1 
ATOM   6860  N  N     . LEU I  4 431  ? 3.563   29.176   16.431  1.00 125.63 ? 431  LEU A N     1 
ATOM   6861  C  CA    . LEU I  4 431  ? 2.126   28.925   16.594  1.00 126.18 ? 431  LEU A CA    1 
ATOM   6862  C  C     . LEU I  4 431  ? 1.515   28.332   15.319  1.00 126.24 ? 431  LEU A C     1 
ATOM   6863  O  O     . LEU I  4 431  ? 0.608   27.497   15.383  1.00 127.97 ? 431  LEU A O     1 
ATOM   6864  C  CB    . LEU I  4 431  ? 1.384   30.213   16.993  1.00 125.13 ? 431  LEU A CB    1 
ATOM   6865  C  CG    . LEU I  4 431  ? -0.147  30.141   17.233  1.00 126.92 ? 431  LEU A CG    1 
ATOM   6866  C  CD1   . LEU I  4 431  ? -0.570  29.049   18.210  1.00 127.14 ? 431  LEU A CD1   1 
ATOM   6867  C  CD2   . LEU I  4 431  ? -0.682  31.482   17.717  1.00 126.11 ? 431  LEU A CD2   1 
ATOM   6868  N  N     . VAL I  4 432  ? 2.016   28.754   14.166  1.00 125.09 ? 432  VAL A N     1 
ATOM   6869  C  CA    . VAL I  4 432  ? 1.540   28.205   12.903  1.00 128.52 ? 432  VAL A CA    1 
ATOM   6870  C  C     . VAL I  4 432  ? 1.867   26.699   12.841  1.00 126.81 ? 432  VAL A C     1 
ATOM   6871  O  O     . VAL I  4 432  ? 1.060   25.871   12.367  1.00 125.76 ? 432  VAL A O     1 
ATOM   6872  C  CB    . VAL I  4 432  ? 2.139   28.980   11.703  1.00 125.15 ? 432  VAL A CB    1 
ATOM   6873  C  CG1   . VAL I  4 432  ? 1.781   28.293   10.392  1.00 127.19 ? 432  VAL A CG1   1 
ATOM   6874  C  CG2   . VAL I  4 432  ? 1.663   30.438   11.713  1.00 120.38 ? 432  VAL A CG2   1 
ATOM   6875  N  N     . ALA I  4 433  ? 3.044   26.343   13.344  1.00 120.74 ? 433  ALA A N     1 
ATOM   6876  C  CA    . ALA I  4 433  ? 3.483   24.965   13.272  1.00 124.15 ? 433  ALA A CA    1 
ATOM   6877  C  C     . ALA I  4 433  ? 2.622   24.168   14.223  1.00 124.60 ? 433  ALA A C     1 
ATOM   6878  O  O     . ALA I  4 433  ? 2.279   23.024   13.940  1.00 126.99 ? 433  ALA A O     1 
ATOM   6879  C  CB    . ALA I  4 433  ? 4.963   24.836   13.617  1.00 120.79 ? 433  ALA A CB    1 
ATOM   6880  N  N     . TYR I  4 434  ? 2.261   24.789   15.342  1.00 125.85 ? 434  TYR A N     1 
ATOM   6881  C  CA    . TYR I  4 434  ? 1.380   24.156   16.326  1.00 125.97 ? 434  TYR A CA    1 
ATOM   6882  C  C     . TYR I  4 434  ? -0.024  23.997   15.757  1.00 121.26 ? 434  TYR A C     1 
ATOM   6883  O  O     . TYR I  4 434  ? -0.617  22.920   15.818  1.00 128.56 ? 434  TYR A O     1 
ATOM   6884  C  CB    . TYR I  4 434  ? 1.342   24.986   17.603  1.00 126.68 ? 434  TYR A CB    1 
ATOM   6885  C  CG    . TYR I  4 434  ? 0.490   24.426   18.720  1.00 130.10 ? 434  TYR A CG    1 
ATOM   6886  C  CD1   . TYR I  4 434  ? 0.770   23.198   19.300  1.00 131.57 ? 434  TYR A CD1   1 
ATOM   6887  C  CD2   . TYR I  4 434  ? -0.572  25.155   19.230  1.00 139.20 ? 434  TYR A CD2   1 
ATOM   6888  C  CE1   . TYR I  4 434  ? -0.003  22.705   20.341  1.00 133.01 ? 434  TYR A CE1   1 
ATOM   6889  C  CE2   . TYR I  4 434  ? -1.346  24.671   20.268  1.00 141.06 ? 434  TYR A CE2   1 
ATOM   6890  C  CZ    . TYR I  4 434  ? -1.058  23.451   20.822  1.00 135.79 ? 434  TYR A CZ    1 
ATOM   6891  O  OH    . TYR I  4 434  ? -1.846  23.009   21.857  1.00 137.41 ? 434  TYR A OH    1 
ATOM   6892  N  N     . ALA I  4 435  ? -0.525  25.066   15.164  1.00 110.66 ? 435  ALA A N     1 
ATOM   6893  C  CA    . ALA I  4 435  ? -1.857  25.083   14.629  1.00 110.28 ? 435  ALA A CA    1 
ATOM   6894  C  C     . ALA I  4 435  ? -2.062  23.994   13.612  1.00 114.17 ? 435  ALA A C     1 
ATOM   6895  O  O     . ALA I  4 435  ? -2.989  23.197   13.753  1.00 116.84 ? 435  ALA A O     1 
ATOM   6896  C  CB    . ALA I  4 435  ? -2.131  26.428   13.992  1.00 117.53 ? 435  ALA A CB    1 
ATOM   6897  N  N     . VAL I  4 436  ? -1.195  23.977   12.593  1.00 121.08 ? 436  VAL A N     1 
ATOM   6898  C  CA    . VAL I  4 436  ? -1.328  23.076   11.436  1.00 118.11 ? 436  VAL A CA    1 
ATOM   6899  C  C     . VAL I  4 436  ? -1.023  21.620   11.779  1.00 115.32 ? 436  VAL A C     1 
ATOM   6900  O  O     . VAL I  4 436  ? -1.602  20.712   11.207  1.00 116.63 ? 436  VAL A O     1 
ATOM   6901  C  CB    . VAL I  4 436  ? -0.412  23.503   10.282  1.00 119.69 ? 436  VAL A CB    1 
ATOM   6902  C  CG1   . VAL I  4 436  ? -0.527  22.514   9.134   1.00 130.10 ? 436  VAL A CG1   1 
ATOM   6903  C  CG2   . VAL I  4 436  ? -0.777  24.890   9.789   1.00 116.62 ? 436  VAL A CG2   1 
ATOM   6904  N  N     . GLY I  4 437  ? -0.114  21.398   12.712  1.00 117.42 ? 437  GLY A N     1 
ATOM   6905  C  CA    . GLY I  4 437  ? 0.102   20.057   13.273  1.00 116.52 ? 437  GLY A CA    1 
ATOM   6906  C  C     . GLY I  4 437  ? 1.511   19.503   13.155  1.00 111.23 ? 437  GLY A C     1 
ATOM   6907  O  O     . GLY I  4 437  ? 1.693   18.298   13.195  1.00 111.21 ? 437  GLY A O     1 
ATOM   6908  N  N     . ILE I  4 438  ? 2.499   20.388   13.033  1.00 108.37 ? 438  ILE A N     1 
ATOM   6909  C  CA    . ILE I  4 438  ? 3.904   20.017   12.964  1.00 109.72 ? 438  ILE A CA    1 
ATOM   6910  C  C     . ILE I  4 438  ? 4.413   19.772   14.375  1.00 114.35 ? 438  ILE A C     1 
ATOM   6911  O  O     . ILE I  4 438  ? 5.066   18.777   14.644  1.00 124.64 ? 438  ILE A O     1 
ATOM   6912  C  CB    . ILE I  4 438  ? 4.742   21.160   12.343  1.00 108.92 ? 438  ILE A CB    1 
ATOM   6913  C  CG1   . ILE I  4 438  ? 4.303   21.406   10.910  1.00 109.85 ? 438  ILE A CG1   1 
ATOM   6914  C  CG2   . ILE I  4 438  ? 6.243   20.881   12.414  1.00 104.28 ? 438  ILE A CG2   1 
ATOM   6915  C  CD1   . ILE I  4 438  ? 5.039   22.564   10.285  1.00 113.52 ? 438  ILE A CD1   1 
ATOM   6916  N  N     . THR I  4 439  ? 4.146   20.720   15.265  1.00 117.29 ? 439  THR A N     1 
ATOM   6917  C  CA    . THR I  4 439  ? 4.487   20.575   16.668  1.00 124.56 ? 439  THR A CA    1 
ATOM   6918  C  C     . THR I  4 439  ? 3.196   20.367   17.476  1.00 133.87 ? 439  THR A C     1 
ATOM   6919  O  O     . THR I  4 439  ? 2.098   20.705   17.019  1.00 133.98 ? 439  THR A O     1 
ATOM   6920  C  CB    . THR I  4 439  ? 5.258   21.805   17.182  1.00 124.79 ? 439  THR A CB    1 
ATOM   6921  O  OG1   . THR I  4 439  ? 5.695   21.572   18.526  1.00 132.95 ? 439  THR A OG1   1 
ATOM   6922  C  CG2   . THR I  4 439  ? 4.377   23.037   17.140  1.00 121.62 ? 439  THR A CG2   1 
ATOM   6923  N  N     . ASN I  4 440  ? 3.331   19.793   18.668  1.00 134.55 ? 440  ASN A N     1 
ATOM   6924  C  CA    . ASN I  4 440  ? 2.176   19.490   19.510  1.00 130.46 ? 440  ASN A CA    1 
ATOM   6925  C  C     . ASN I  4 440  ? 2.397   19.898   20.972  1.00 130.42 ? 440  ASN A C     1 
ATOM   6926  O  O     . ASN I  4 440  ? 2.200   19.100   21.898  1.00 127.34 ? 440  ASN A O     1 
ATOM   6927  C  CB    . ASN I  4 440  ? 1.819   18.008   19.420  1.00 130.39 ? 440  ASN A CB    1 
ATOM   6928  C  CG    . ASN I  4 440  ? 0.433   17.720   19.954  1.00 133.47 ? 440  ASN A CG    1 
ATOM   6929  O  OD1   . ASN I  4 440  ? -0.551  18.255   19.449  1.00 133.69 ? 440  ASN A OD1   1 
ATOM   6930  N  ND2   . ASN I  4 440  ? 0.347   16.889   20.991  1.00 133.87 ? 440  ASN A ND2   1 
ATOM   6931  N  N     . ILE I  4 441  ? 2.809   21.149   21.161  1.00 123.15 ? 441  ILE A N     1 
ATOM   6932  C  CA    . ILE I  4 441  ? 2.893   21.754   22.482  1.00 120.60 ? 441  ILE A CA    1 
ATOM   6933  C  C     . ILE I  4 441  ? 2.475   23.232   22.321  1.00 133.89 ? 441  ILE A C     1 
ATOM   6934  O  O     . ILE I  4 441  ? 2.860   23.883   21.339  1.00 134.31 ? 441  ILE A O     1 
ATOM   6935  C  CB    . ILE I  4 441  ? 4.306   21.588   23.093  1.00 110.25 ? 441  ILE A CB    1 
ATOM   6936  C  CG1   . ILE I  4 441  ? 4.342   22.027   24.559  1.00 109.44 ? 441  ILE A CG1   1 
ATOM   6937  C  CG2   . ILE I  4 441  ? 5.328   22.407   22.329  1.00 115.55 ? 441  ILE A CG2   1 
ATOM   6938  C  CD1   . ILE I  4 441  ? 5.665   21.785   25.279  1.00 102.35 ? 441  ILE A CD1   1 
ATOM   6939  N  N     . ASP I  4 442  ? 1.662   23.731   23.261  1.00 137.28 ? 442  ASP A N     1 
ATOM   6940  C  CA    . ASP I  4 442  ? 1.111   25.092   23.209  1.00 136.50 ? 442  ASP A CA    1 
ATOM   6941  C  C     . ASP I  4 442  ? 2.212   26.147   23.383  1.00 130.39 ? 442  ASP A C     1 
ATOM   6942  O  O     . ASP I  4 442  ? 2.753   26.278   24.478  1.00 128.28 ? 442  ASP A O     1 
ATOM   6943  C  CB    . ASP I  4 442  ? 0.055   25.259   24.309  1.00 147.28 ? 442  ASP A CB    1 
ATOM   6944  C  CG    . ASP I  4 442  ? -0.778  26.541   24.156  1.00 151.63 ? 442  ASP A CG    1 
ATOM   6945  O  OD1   . ASP I  4 442  ? -0.465  27.374   23.276  1.00 146.42 ? 442  ASP A OD1   1 
ATOM   6946  O  OD2   . ASP I  4 442  ? -1.749  26.711   24.932  1.00 147.78 ? 442  ASP A OD2   1 
ATOM   6947  N  N     . PRO I  4 443  ? 2.543   26.900   22.309  1.00 125.24 ? 443  PRO A N     1 
ATOM   6948  C  CA    . PRO I  4 443  ? 3.706   27.807   22.352  1.00 123.14 ? 443  PRO A CA    1 
ATOM   6949  C  C     . PRO I  4 443  ? 3.425   29.146   23.039  1.00 117.67 ? 443  PRO A C     1 
ATOM   6950  O  O     . PRO I  4 443  ? 4.338   29.913   23.300  1.00 117.86 ? 443  PRO A O     1 
ATOM   6951  C  CB    . PRO I  4 443  ? 4.062   27.998   20.870  1.00 122.45 ? 443  PRO A CB    1 
ATOM   6952  C  CG    . PRO I  4 443  ? 2.773   27.801   20.139  1.00 128.12 ? 443  PRO A CG    1 
ATOM   6953  C  CD    . PRO I  4 443  ? 1.871   26.936   20.996  1.00 126.40 ? 443  PRO A CD    1 
ATOM   6954  N  N     . LEU I  4 444  ? 2.167   29.419   23.325  1.00 120.90 ? 444  LEU A N     1 
ATOM   6955  C  CA    . LEU I  4 444  ? 1.783   30.670   23.951  1.00 122.27 ? 444  LEU A CA    1 
ATOM   6956  C  C     . LEU I  4 444  ? 1.462   30.414   25.424  1.00 123.98 ? 444  LEU A C     1 
ATOM   6957  O  O     . LEU I  4 444  ? 1.514   31.322   26.236  1.00 128.31 ? 444  LEU A O     1 
ATOM   6958  C  CB    . LEU I  4 444  ? 0.626   31.330   23.169  1.00 125.69 ? 444  LEU A CB    1 
ATOM   6959  C  CG    . LEU I  4 444  ? -0.541  30.466   22.683  1.00 126.61 ? 444  LEU A CG    1 
ATOM   6960  C  CD1   . LEU I  4 444  ? -1.430  30.089   23.866  1.00 144.53 ? 444  LEU A CD1   1 
ATOM   6961  C  CD2   . LEU I  4 444  ? -1.314  31.198   21.608  1.00 131.93 ? 444  LEU A CD2   1 
ATOM   6962  N  N     . ARG I  4 445  ? 1.147   29.169   25.770  1.00 130.58 ? 445  ARG A N     1 
ATOM   6963  C  CA    . ARG I  4 445  ? 1.032   28.775   27.165  1.00 134.11 ? 445  ARG A CA    1 
ATOM   6964  C  C     . ARG I  4 445  ? 2.402   28.912   27.816  1.00 129.82 ? 445  ARG A C     1 
ATOM   6965  O  O     . ARG I  4 445  ? 2.562   29.637   28.789  1.00 128.27 ? 445  ARG A O     1 
ATOM   6966  C  CB    . ARG I  4 445  ? 0.528   27.332   27.275  1.00 145.00 ? 445  ARG A CB    1 
ATOM   6967  C  CG    . ARG I  4 445  ? 0.268   26.845   28.700  1.00 159.61 ? 445  ARG A CG    1 
ATOM   6968  C  CD    . ARG I  4 445  ? -0.162  25.378   28.730  1.00 169.63 ? 445  ARG A CD    1 
ATOM   6969  N  NE    . ARG I  4 445  ? -0.677  24.942   30.037  1.00 177.01 ? 445  ARG A NE    1 
ATOM   6970  C  CZ    . ARG I  4 445  ? -1.898  25.208   30.511  1.00 197.09 ? 445  ARG A CZ    1 
ATOM   6971  N  NH1   . ARG I  4 445  ? -2.771  25.929   29.805  1.00 208.99 ? 445  ARG A NH1   1 
ATOM   6972  N  NH2   . ARG I  4 445  ? -2.253  24.759   31.711  1.00 206.73 ? 445  ARG A NH2   1 
ATOM   6973  N  N     . PHE I  4 446  ? 3.384   28.214   27.252  1.00 128.43 ? 446  PHE A N     1 
ATOM   6974  C  CA    . PHE I  4 446  ? 4.777   28.340   27.669  1.00 125.32 ? 446  PHE A CA    1 
ATOM   6975  C  C     . PHE I  4 446  ? 5.393   29.495   26.901  1.00 122.35 ? 446  PHE A C     1 
ATOM   6976  O  O     . PHE I  4 446  ? 4.872   29.892   25.869  1.00 116.17 ? 446  PHE A O     1 
ATOM   6977  C  CB    . PHE I  4 446  ? 5.550   27.058   27.385  1.00 123.81 ? 446  PHE A CB    1 
ATOM   6978  C  CG    . PHE I  4 446  ? 4.911   25.823   27.959  1.00 124.01 ? 446  PHE A CG    1 
ATOM   6979  C  CD1   . PHE I  4 446  ? 4.099   25.012   27.177  1.00 123.52 ? 446  PHE A CD1   1 
ATOM   6980  C  CD2   . PHE I  4 446  ? 5.126   25.467   29.276  1.00 127.05 ? 446  PHE A CD2   1 
ATOM   6981  C  CE1   . PHE I  4 446  ? 3.512   23.872   27.698  1.00 120.79 ? 446  PHE A CE1   1 
ATOM   6982  C  CE2   . PHE I  4 446  ? 4.542   24.327   29.804  1.00 129.96 ? 446  PHE A CE2   1 
ATOM   6983  C  CZ    . PHE I  4 446  ? 3.732   23.528   29.013  1.00 123.64 ? 446  PHE A CZ    1 
ATOM   6984  N  N     . GLY I  4 447  ? 6.499   30.030   27.409  1.00 129.22 ? 447  GLY A N     1 
ATOM   6985  C  CA    . GLY I  4 447  ? 7.147   31.207   26.805  1.00 130.84 ? 447  GLY A CA    1 
ATOM   6986  C  C     . GLY I  4 447  ? 8.025   30.881   25.609  1.00 128.89 ? 447  GLY A C     1 
ATOM   6987  O  O     . GLY I  4 447  ? 9.251   31.006   25.677  1.00 135.61 ? 447  GLY A O     1 
ATOM   6988  N  N     . LEU I  4 448  ? 7.390   30.474   24.512  1.00 120.50 ? 448  LEU A N     1 
ATOM   6989  C  CA    . LEU I  4 448  ? 8.092   30.041   23.307  1.00 117.38 ? 448  LEU A CA    1 
ATOM   6990  C  C     . LEU I  4 448  ? 7.909   31.087   22.221  1.00 117.39 ? 448  LEU A C     1 
ATOM   6991  O  O     . LEU I  4 448  ? 6.847   31.678   22.113  1.00 114.59 ? 448  LEU A O     1 
ATOM   6992  C  CB    . LEU I  4 448  ? 7.543   28.696   22.833  1.00 118.80 ? 448  LEU A CB    1 
ATOM   6993  C  CG    . LEU I  4 448  ? 7.336   27.641   23.923  1.00 116.50 ? 448  LEU A CG    1 
ATOM   6994  C  CD1   . LEU I  4 448  ? 6.834   26.330   23.331  1.00 113.59 ? 448  LEU A CD1   1 
ATOM   6995  C  CD2   . LEU I  4 448  ? 8.627   27.451   24.711  1.00 120.80 ? 448  LEU A CD2   1 
ATOM   6996  N  N     . LEU I  4 449  ? 8.946   31.318   21.424  1.00 117.89 ? 449  LEU A N     1 
ATOM   6997  C  CA    . LEU I  4 449  ? 8.953   32.441   20.495  1.00 120.55 ? 449  LEU A CA    1 
ATOM   6998  C  C     . LEU I  4 449  ? 9.133   32.000   19.049  1.00 126.20 ? 449  LEU A C     1 
ATOM   6999  O  O     . LEU I  4 449  ? 9.934   31.114   18.753  1.00 136.77 ? 449  LEU A O     1 
ATOM   7000  C  CB    . LEU I  4 449  ? 10.085  33.399   20.857  1.00 116.77 ? 449  LEU A CB    1 
ATOM   7001  C  CG    . LEU I  4 449  ? 10.101  33.926   22.284  1.00 110.60 ? 449  LEU A CG    1 
ATOM   7002  C  CD1   . LEU I  4 449  ? 11.239  34.924   22.457  1.00 109.77 ? 449  LEU A CD1   1 
ATOM   7003  C  CD2   . LEU I  4 449  ? 8.755   34.555   22.582  1.00 113.24 ? 449  LEU A CD2   1 
ATOM   7004  N  N     . PHE I  4 450  ? 8.399   32.647   18.154  1.00 123.50 ? 450  PHE A N     1 
ATOM   7005  C  CA    . PHE I  4 450  ? 8.493   32.394   16.724  1.00 122.14 ? 450  PHE A CA    1 
ATOM   7006  C  C     . PHE I  4 450  ? 9.747   33.022   16.149  1.00 122.38 ? 450  PHE A C     1 
ATOM   7007  O  O     . PHE I  4 450  ? 10.277  32.537   15.161  1.00 127.27 ? 450  PHE A O     1 
ATOM   7008  C  CB    . PHE I  4 450  ? 7.261   32.967   15.997  1.00 124.48 ? 450  PHE A CB    1 
ATOM   7009  C  CG    . PHE I  4 450  ? 7.397   33.018   14.498  1.00 125.09 ? 450  PHE A CG    1 
ATOM   7010  C  CD1   . PHE I  4 450  ? 7.170   31.885   13.733  1.00 124.45 ? 450  PHE A CD1   1 
ATOM   7011  C  CD2   . PHE I  4 450  ? 7.753   34.196   13.852  1.00 126.02 ? 450  PHE A CD2   1 
ATOM   7012  C  CE1   . PHE I  4 450  ? 7.289   31.925   12.359  1.00 120.29 ? 450  PHE A CE1   1 
ATOM   7013  C  CE2   . PHE I  4 450  ? 7.873   34.242   12.473  1.00 121.31 ? 450  PHE A CE2   1 
ATOM   7014  C  CZ    . PHE I  4 450  ? 7.632   33.106   11.727  1.00 121.31 ? 450  PHE A CZ    1 
ATOM   7015  N  N     . GLU I  4 451  ? 10.206  34.116   16.746  1.00 129.42 ? 451  GLU A N     1 
ATOM   7016  C  CA    . GLU I  4 451  ? 11.419  34.799   16.265  1.00 133.30 ? 451  GLU A CA    1 
ATOM   7017  C  C     . GLU I  4 451  ? 12.695  33.982   16.514  1.00 130.83 ? 451  GLU A C     1 
ATOM   7018  O  O     . GLU I  4 451  ? 13.695  34.174   15.825  1.00 138.94 ? 451  GLU A O     1 
ATOM   7019  C  CB    . GLU I  4 451  ? 11.566  36.195   16.882  1.00 130.84 ? 451  GLU A CB    1 
ATOM   7020  C  CG    . GLU I  4 451  ? 10.628  37.238   16.296  1.00 129.76 ? 451  GLU A CG    1 
ATOM   7021  C  CD    . GLU I  4 451  ? 9.221   37.188   16.874  1.00 131.40 ? 451  GLU A CD    1 
ATOM   7022  O  OE1   . GLU I  4 451  ? 8.892   36.213   17.590  1.00 125.27 ? 451  GLU A OE1   1 
ATOM   7023  O  OE2   . GLU I  4 451  ? 8.440   38.133   16.608  1.00 136.32 ? 451  GLU A OE2   1 
ATOM   7024  N  N     . ARG I  4 452  ? 12.654  33.082   17.492  1.00 126.98 ? 452  ARG A N     1 
ATOM   7025  C  CA    . ARG I  4 452  ? 13.725  32.102   17.693  1.00 128.62 ? 452  ARG A CA    1 
ATOM   7026  C  C     . ARG I  4 452  ? 13.759  31.081   16.548  1.00 125.18 ? 452  ARG A C     1 
ATOM   7027  O  O     . ARG I  4 452  ? 14.834  30.687   16.108  1.00 118.69 ? 452  ARG A O     1 
ATOM   7028  C  CB    . ARG I  4 452  ? 13.535  31.387   19.031  1.00 135.58 ? 452  ARG A CB    1 
ATOM   7029  C  CG    . ARG I  4 452  ? 14.567  30.324   19.372  1.00 136.21 ? 452  ARG A CG    1 
ATOM   7030  C  CD    . ARG I  4 452  ? 15.930  30.917   19.655  1.00 137.86 ? 452  ARG A CD    1 
ATOM   7031  N  NE    . ARG I  4 452  ? 16.948  29.894   19.937  1.00 137.92 ? 452  ARG A NE    1 
ATOM   7032  C  CZ    . ARG I  4 452  ? 17.506  29.092   19.022  1.00 139.37 ? 452  ARG A CZ    1 
ATOM   7033  N  NH1   . ARG I  4 452  ? 17.141  29.143   17.744  1.00 140.65 ? 452  ARG A NH1   1 
ATOM   7034  N  NH2   . ARG I  4 452  ? 18.435  28.214   19.381  1.00 142.14 ? 452  ARG A NH2   1 
ATOM   7035  N  N     . PHE I  4 453  ? 12.582  30.668   16.074  1.00 127.91 ? 453  PHE A N     1 
ATOM   7036  C  CA    . PHE I  4 453  ? 12.451  29.744   14.929  1.00 129.31 ? 453  PHE A CA    1 
ATOM   7037  C  C     . PHE I  4 453  ? 12.803  30.419   13.600  1.00 129.70 ? 453  PHE A C     1 
ATOM   7038  O  O     . PHE I  4 453  ? 13.769  30.038   12.936  1.00 134.81 ? 453  PHE A O     1 
ATOM   7039  C  CB    . PHE I  4 453  ? 11.022  29.176   14.876  1.00 128.20 ? 453  PHE A CB    1 
ATOM   7040  C  CG    . PHE I  4 453  ? 10.778  28.231   13.740  1.00 127.02 ? 453  PHE A CG    1 
ATOM   7041  C  CD1   . PHE I  4 453  ? 11.542  27.079   13.594  1.00 127.20 ? 453  PHE A CD1   1 
ATOM   7042  C  CD2   . PHE I  4 453  ? 9.761   28.475   12.826  1.00 131.19 ? 453  PHE A CD2   1 
ATOM   7043  C  CE1   . PHE I  4 453  ? 11.311  26.197   12.543  1.00 129.48 ? 453  PHE A CE1   1 
ATOM   7044  C  CE2   . PHE I  4 453  ? 9.522   27.595   11.773  1.00 134.59 ? 453  PHE A CE2   1 
ATOM   7045  C  CZ    . PHE I  4 453  ? 10.297  26.454   11.630  1.00 131.57 ? 453  PHE A CZ    1 
ATOM   7046  N  N     . LEU I  4 454  ? 12.009  31.412   13.215  1.00 129.59 ? 454  LEU A N     1 
ATOM   7047  C  CA    . LEU I  4 454  ? 12.236  32.171   11.985  1.00 131.02 ? 454  LEU A CA    1 
ATOM   7048  C  C     . LEU I  4 454  ? 12.470  33.627   12.344  1.00 127.71 ? 454  LEU A C     1 
ATOM   7049  O  O     . LEU I  4 454  ? 11.534  34.350   12.682  1.00 137.20 ? 454  LEU A O     1 
ATOM   7050  C  CB    . LEU I  4 454  ? 11.038  32.081   11.022  1.00 129.71 ? 454  LEU A CB    1 
ATOM   7051  C  CG    . LEU I  4 454  ? 10.962  30.938   10.023  1.00 136.60 ? 454  LEU A CG    1 
ATOM   7052  C  CD1   . LEU I  4 454  ? 9.613   30.984   9.321   1.00 136.51 ? 454  LEU A CD1   1 
ATOM   7053  C  CD2   . LEU I  4 454  ? 12.071  31.075   9.000   1.00 149.64 ? 454  LEU A CD2   1 
ATOM   7054  N  N     . ASN I  4 455  ? 13.722  34.056   12.263  1.00 130.09 ? 455  ASN A N     1 
ATOM   7055  C  CA    . ASN I  4 455  ? 14.050  35.468   12.366  1.00 128.94 ? 455  ASN A CA    1 
ATOM   7056  C  C     . ASN I  4 455  ? 13.477  36.206   11.151  1.00 133.82 ? 455  ASN A C     1 
ATOM   7057  O  O     . ASN I  4 455  ? 13.823  35.906   10.003  1.00 138.84 ? 455  ASN A O     1 
ATOM   7058  C  CB    . ASN I  4 455  ? 15.560  35.677   12.473  1.00 126.95 ? 455  ASN A CB    1 
ATOM   7059  C  CG    . ASN I  4 455  ? 15.925  36.980   13.178  1.00 129.88 ? 455  ASN A CG    1 
ATOM   7060  O  OD1   . ASN I  4 455  ? 15.259  38.004   13.030  1.00 130.22 ? 455  ASN A OD1   1 
ATOM   7061  N  ND2   . ASN I  4 455  ? 16.998  36.944   13.943  1.00 134.41 ? 455  ASN A ND2   1 
ATOM   7062  N  N     . PRO I  4 456  ? 12.567  37.156   11.395  1.00 137.83 ? 456  PRO A N     1 
ATOM   7063  C  CA    . PRO I  4 456  ? 11.930  37.871   10.285  1.00 142.37 ? 456  PRO A CA    1 
ATOM   7064  C  C     . PRO I  4 456  ? 12.852  38.871   9.552   1.00 142.79 ? 456  PRO A C     1 
ATOM   7065  O  O     . PRO I  4 456  ? 12.527  39.310   8.442   1.00 141.44 ? 456  PRO A O     1 
ATOM   7066  C  CB    . PRO I  4 456  ? 10.768  38.592   10.971  1.00 141.25 ? 456  PRO A CB    1 
ATOM   7067  C  CG    . PRO I  4 456  ? 11.235  38.797   12.370  1.00 142.85 ? 456  PRO A CG    1 
ATOM   7068  C  CD    . PRO I  4 456  ? 12.081  37.614   12.708  1.00 136.19 ? 456  PRO A CD    1 
ATOM   7069  N  N     . GLU I  4 457  ? 13.975  39.224   10.179  1.00 145.66 ? 457  GLU A N     1 
ATOM   7070  C  CA    . GLU I  4 457  ? 14.942  40.154   9.608   1.00 153.09 ? 457  GLU A CA    1 
ATOM   7071  C  C     . GLU I  4 457  ? 16.154  39.421   9.010   1.00 150.05 ? 457  GLU A C     1 
ATOM   7072  O  O     . GLU I  4 457  ? 17.264  39.958   9.003   1.00 157.89 ? 457  GLU A O     1 
ATOM   7073  C  CB    . GLU I  4 457  ? 15.399  41.156   10.680  1.00 157.23 ? 457  GLU A CB    1 
ATOM   7074  C  CG    . GLU I  4 457  ? 14.255  41.928   11.333  1.00 168.14 ? 457  GLU A CG    1 
ATOM   7075  C  CD    . GLU I  4 457  ? 14.708  42.864   12.444  1.00 171.95 ? 457  GLU A CD    1 
ATOM   7076  O  OE1   . GLU I  4 457  ? 15.886  43.276   12.455  1.00 179.95 ? 457  GLU A OE1   1 
ATOM   7077  O  OE2   . GLU I  4 457  ? 13.875  43.194   13.311  1.00 167.96 ? 457  GLU A OE2   1 
ATOM   7078  N  N     . ARG I  4 458  ? 15.942  38.200   8.516   1.00 138.17 ? 458  ARG A N     1 
ATOM   7079  C  CA    . ARG I  4 458  ? 17.001  37.445   7.843   1.00 146.57 ? 458  ARG A CA    1 
ATOM   7080  C  C     . ARG I  4 458  ? 16.504  36.212   7.043   1.00 140.61 ? 458  ARG A C     1 
ATOM   7081  O  O     . ARG I  4 458  ? 16.159  35.176   7.605   1.00 136.88 ? 458  ARG A O     1 
ATOM   7082  C  CB    . ARG I  4 458  ? 18.073  37.021   8.843   1.00 155.01 ? 458  ARG A CB    1 
ATOM   7083  C  CG    . ARG I  4 458  ? 19.257  36.345   8.175   1.00 175.04 ? 458  ARG A CG    1 
ATOM   7084  C  CD    . ARG I  4 458  ? 20.432  36.201   9.125   1.00 190.82 ? 458  ARG A CD    1 
ATOM   7085  N  NE    . ARG I  4 458  ? 20.155  35.263   10.217  1.00 200.71 ? 458  ARG A NE    1 
ATOM   7086  C  CZ    . ARG I  4 458  ? 21.038  34.903   11.148  1.00 203.53 ? 458  ARG A CZ    1 
ATOM   7087  N  NH1   . ARG I  4 458  ? 22.276  35.403   11.137  1.00 202.28 ? 458  ARG A NH1   1 
ATOM   7088  N  NH2   . ARG I  4 458  ? 20.683  34.041   12.097  1.00 200.10 ? 458  ARG A NH2   1 
ATOM   7089  N  N     . VAL I  4 459  ? 16.515  36.327   5.718   1.00 146.21 ? 459  VAL A N     1 
ATOM   7090  C  CA    . VAL I  4 459  ? 16.021  35.269   4.844   1.00 151.44 ? 459  VAL A CA    1 
ATOM   7091  C  C     . VAL I  4 459  ? 16.928  34.026   4.878   1.00 162.64 ? 459  VAL A C     1 
ATOM   7092  O  O     . VAL I  4 459  ? 17.888  33.912   4.104   1.00 167.92 ? 459  VAL A O     1 
ATOM   7093  C  CB    . VAL I  4 459  ? 15.828  35.765   3.382   1.00 149.93 ? 459  VAL A CB    1 
ATOM   7094  C  CG1   . VAL I  4 459  ? 17.146  36.227   2.754   1.00 145.98 ? 459  VAL A CG1   1 
ATOM   7095  C  CG2   . VAL I  4 459  ? 15.170  34.678   2.532   1.00 150.85 ? 459  VAL A CG2   1 
ATOM   7096  N  N     . SER I  4 460  ? 16.607  33.100   5.782   1.00 163.57 ? 460  SER A N     1 
ATOM   7097  C  CA    . SER I  4 460  ? 17.300  31.805   5.880   1.00 159.40 ? 460  SER A CA    1 
ATOM   7098  C  C     . SER I  4 460  ? 16.288  30.670   6.019   1.00 153.83 ? 460  SER A C     1 
ATOM   7099  O  O     . SER I  4 460  ? 15.236  30.839   6.631   1.00 152.42 ? 460  SER A O     1 
ATOM   7100  C  CB    . SER I  4 460  ? 18.248  31.790   7.080   1.00 160.16 ? 460  SER A CB    1 
ATOM   7101  O  OG    . SER I  4 460  ? 18.811  30.497   7.258   1.00 156.66 ? 460  SER A OG    1 
ATOM   7102  N  N     . MET I  4 461  ? 16.611  29.510   5.461   1.00 152.86 ? 461  MET A N     1 
ATOM   7103  C  CA    . MET I  4 461  ? 15.684  28.378   5.476   1.00 156.02 ? 461  MET A CA    1 
ATOM   7104  C  C     . MET I  4 461  ? 15.647  27.699   6.856   1.00 157.46 ? 461  MET A C     1 
ATOM   7105  O  O     . MET I  4 461  ? 16.690  27.280   7.372   1.00 155.65 ? 461  MET A O     1 
ATOM   7106  C  CB    . MET I  4 461  ? 16.068  27.360   4.402   1.00 160.19 ? 461  MET A CB    1 
ATOM   7107  C  CG    . MET I  4 461  ? 15.004  26.309   4.123   1.00 163.48 ? 461  MET A CG    1 
ATOM   7108  S  SD    . MET I  4 461  ? 15.515  25.086   2.896   1.00 175.43 ? 461  MET A SD    1 
ATOM   7109  C  CE    . MET I  4 461  ? 16.831  24.220   3.756   1.00 174.18 ? 461  MET A CE    1 
ATOM   7110  N  N     . PRO I  4 462  ? 14.441  27.574   7.451   1.00 151.98 ? 462  PRO A N     1 
ATOM   7111  C  CA    . PRO I  4 462  ? 14.304  26.969   8.766   1.00 144.99 ? 462  PRO A CA    1 
ATOM   7112  C  C     . PRO I  4 462  ? 14.378  25.450   8.714   1.00 140.64 ? 462  PRO A C     1 
ATOM   7113  O  O     . PRO I  4 462  ? 13.793  24.842   7.813   1.00 125.48 ? 462  PRO A O     1 
ATOM   7114  C  CB    . PRO I  4 462  ? 12.907  27.403   9.199   1.00 145.79 ? 462  PRO A CB    1 
ATOM   7115  C  CG    . PRO I  4 462  ? 12.145  27.504   7.931   1.00 148.45 ? 462  PRO A CG    1 
ATOM   7116  C  CD    . PRO I  4 462  ? 13.128  27.957   6.893   1.00 155.49 ? 462  PRO A CD    1 
ATOM   7117  N  N     . ASP I  4 463  ? 15.070  24.859   9.696   1.00 142.25 ? 463  ASP A N     1 
ATOM   7118  C  CA    . ASP I  4 463  ? 15.293  23.405   9.775   1.00 137.46 ? 463  ASP A CA    1 
ATOM   7119  C  C     . ASP I  4 463  ? 14.345  22.791   10.794  1.00 132.91 ? 463  ASP A C     1 
ATOM   7120  O  O     . ASP I  4 463  ? 14.548  22.950   11.994  1.00 152.34 ? 463  ASP A O     1 
ATOM   7121  C  CB    . ASP I  4 463  ? 16.759  23.109   10.159  1.00 138.34 ? 463  ASP A CB    1 
ATOM   7122  C  CG    . ASP I  4 463  ? 17.103  21.599   10.161  1.00 137.27 ? 463  ASP A CG    1 
ATOM   7123  O  OD1   . ASP I  4 463  ? 16.474  20.788   9.448   1.00 128.52 ? 463  ASP A OD1   1 
ATOM   7124  O  OD2   . ASP I  4 463  ? 18.039  21.213   10.883  1.00 141.88 ? 463  ASP A OD2   1 
ATOM   7125  N  N     . ILE I  4 464  ? 13.309  22.102   10.315  1.00 124.29 ? 464  ILE A N     1 
ATOM   7126  C  CA    . ILE I  4 464  ? 12.307  21.475   11.183  1.00 120.65 ? 464  ILE A CA    1 
ATOM   7127  C  C     . ILE I  4 464  ? 12.614  19.997   11.344  1.00 122.21 ? 464  ILE A C     1 
ATOM   7128  O  O     . ILE I  4 464  ? 12.420  19.206   10.420  1.00 130.13 ? 464  ILE A O     1 
ATOM   7129  C  CB    . ILE I  4 464  ? 10.879  21.633   10.624  1.00 119.08 ? 464  ILE A CB    1 
ATOM   7130  C  CG1   . ILE I  4 464  ? 10.424  23.084   10.751  1.00 123.49 ? 464  ILE A CG1   1 
ATOM   7131  C  CG2   . ILE I  4 464  ? 9.896   20.741   11.358  1.00 121.73 ? 464  ILE A CG2   1 
ATOM   7132  C  CD1   . ILE I  4 464  ? 9.017   23.353   10.248  1.00 118.13 ? 464  ILE A CD1   1 
ATOM   7133  N  N     . ASP I  4 465  ? 13.108  19.636   12.519  1.00 120.04 ? 465  ASP A N     1 
ATOM   7134  C  CA    . ASP I  4 465  ? 13.437  18.261   12.804  1.00 126.39 ? 465  ASP A CA    1 
ATOM   7135  C  C     . ASP I  4 465  ? 12.221  17.674   13.466  1.00 119.51 ? 465  ASP A C     1 
ATOM   7136  O  O     . ASP I  4 465  ? 11.517  18.384   14.161  1.00 120.24 ? 465  ASP A O     1 
ATOM   7137  C  CB    . ASP I  4 465  ? 14.668  18.164   13.719  1.00 133.84 ? 465  ASP A CB    1 
ATOM   7138  C  CG    . ASP I  4 465  ? 15.945  18.721   13.073  1.00 136.75 ? 465  ASP A CG    1 
ATOM   7139  O  OD1   . ASP I  4 465  ? 15.950  19.093   11.871  1.00 140.37 ? 465  ASP A OD1   1 
ATOM   7140  O  OD2   . ASP I  4 465  ? 16.962  18.782   13.790  1.00 139.71 ? 465  ASP A OD2   1 
ATOM   7141  N  N     . THR I  4 466  ? 11.978  16.385   13.227  1.00 121.99 ? 466  THR A N     1 
ATOM   7142  C  CA    . THR I  4 466  ? 10.815  15.676   13.761  1.00 117.38 ? 466  THR A CA    1 
ATOM   7143  C  C     . THR I  4 466  ? 11.229  14.347   14.368  1.00 119.80 ? 466  THR A C     1 
ATOM   7144  O  O     . THR I  4 466  ? 12.121  13.682   13.834  1.00 124.87 ? 466  THR A O     1 
ATOM   7145  C  CB    . THR I  4 466  ? 9.788   15.389   12.662  1.00 114.46 ? 466  THR A CB    1 
ATOM   7146  O  OG1   . THR I  4 466  ? 9.611   16.566   11.852  1.00 117.87 ? 466  THR A OG1   1 
ATOM   7147  C  CG2   . THR I  4 466  ? 8.457   14.948   13.292  1.00 114.82 ? 466  THR A CG2   1 
ATOM   7148  N  N     . ASP I  4 467  ? 10.582  13.971   15.478  1.00 121.17 ? 467  ASP A N     1 
ATOM   7149  C  CA    . ASP I  4 467  ? 10.830  12.693   16.163  1.00 114.26 ? 467  ASP A CA    1 
ATOM   7150  C  C     . ASP I  4 467  ? 9.664   11.766   15.840  1.00 116.17 ? 467  ASP A C     1 
ATOM   7151  O  O     . ASP I  4 467  ? 8.519   12.205   15.766  1.00 123.38 ? 467  ASP A O     1 
ATOM   7152  C  CB    . ASP I  4 467  ? 10.940  12.879   17.677  1.00 115.72 ? 467  ASP A CB    1 
ATOM   7153  C  CG    . ASP I  4 467  ? 12.085  13.789   18.088  1.00 117.04 ? 467  ASP A CG    1 
ATOM   7154  O  OD1   . ASP I  4 467  ? 13.068  13.912   17.342  1.00 112.19 ? 467  ASP A OD1   1 
ATOM   7155  O  OD2   . ASP I  4 467  ? 12.003  14.384   19.185  1.00 127.56 ? 467  ASP A OD2   1 
ATOM   7156  N  N     . PHE I  4 468  ? 9.967   10.493   15.609  1.00 120.61 ? 468  PHE A N     1 
ATOM   7157  C  CA    . PHE I  4 468  ? 8.957   9.468    15.326  1.00 116.69 ? 468  PHE A CA    1 
ATOM   7158  C  C     . PHE I  4 468  ? 9.257   8.193    16.093  1.00 114.84 ? 468  PHE A C     1 
ATOM   7159  O  O     . PHE I  4 468  ? 10.297  8.073    16.742  1.00 115.17 ? 468  PHE A O     1 
ATOM   7160  C  CB    . PHE I  4 468  ? 8.938   9.136    13.837  1.00 117.69 ? 468  PHE A CB    1 
ATOM   7161  C  CG    . PHE I  4 468  ? 8.462   10.258   12.970  1.00 116.11 ? 468  PHE A CG    1 
ATOM   7162  C  CD1   . PHE I  4 468  ? 9.368   11.042   12.263  1.00 113.13 ? 468  PHE A CD1   1 
ATOM   7163  C  CD2   . PHE I  4 468  ? 7.104   10.525   12.853  1.00 112.72 ? 468  PHE A CD2   1 
ATOM   7164  C  CE1   . PHE I  4 468  ? 8.922   12.078   11.456  1.00 113.09 ? 468  PHE A CE1   1 
ATOM   7165  C  CE2   . PHE I  4 468  ? 6.655   11.554   12.052  1.00 113.22 ? 468  PHE A CE2   1 
ATOM   7166  C  CZ    . PHE I  4 468  ? 7.564   12.334   11.350  1.00 114.96 ? 468  PHE A CZ    1 
ATOM   7167  N  N     . SER I  4 469  ? 8.350   7.232    16.012  1.00 114.84 ? 469  SER A N     1 
ATOM   7168  C  CA    . SER I  4 469  ? 8.587   5.947    16.626  1.00 116.41 ? 469  SER A CA    1 
ATOM   7169  C  C     . SER I  4 469  ? 9.713   5.278    15.846  1.00 120.07 ? 469  SER A C     1 
ATOM   7170  O  O     . SER I  4 469  ? 9.681   5.248    14.612  1.00 115.84 ? 469  SER A O     1 
ATOM   7171  C  CB    . SER I  4 469  ? 7.319   5.105    16.602  1.00 116.74 ? 469  SER A CB    1 
ATOM   7172  O  OG    . SER I  4 469  ? 7.572   3.798    17.092  1.00 123.57 ? 469  SER A OG    1 
ATOM   7173  N  N     . ASP I  4 470  ? 10.717  4.771    16.566  1.00 125.92 ? 470  ASP A N     1 
ATOM   7174  C  CA    . ASP I  4 470  ? 11.883  4.125    15.942  1.00 127.06 ? 470  ASP A CA    1 
ATOM   7175  C  C     . ASP I  4 470  ? 11.499  2.935    15.062  1.00 130.37 ? 470  ASP A C     1 
ATOM   7176  O  O     . ASP I  4 470  ? 12.151  2.674    14.057  1.00 141.85 ? 470  ASP A O     1 
ATOM   7177  C  CB    . ASP I  4 470  ? 12.950  3.720    16.988  1.00 126.45 ? 470  ASP A CB    1 
ATOM   7178  C  CG    . ASP I  4 470  ? 12.477  2.631    17.964  1.00 127.64 ? 470  ASP A CG    1 
ATOM   7179  O  OD1   . ASP I  4 470  ? 12.118  1.503    17.543  1.00 136.10 ? 470  ASP A OD1   1 
ATOM   7180  O  OD2   . ASP I  4 470  ? 12.515  2.896    19.182  1.00 127.87 ? 470  ASP A OD2   1 
ATOM   7181  N  N     . ARG I  4 471  ? 10.444  2.223    15.439  1.00 128.58 ? 471  ARG A N     1 
ATOM   7182  C  CA    . ARG I  4 471  ? 9.960   1.110    14.644  1.00 134.86 ? 471  ARG A CA    1 
ATOM   7183  C  C     . ARG I  4 471  ? 9.292   1.580    13.356  1.00 132.24 ? 471  ARG A C     1 
ATOM   7184  O  O     . ARG I  4 471  ? 9.541   1.025    12.277  1.00 147.88 ? 471  ARG A O     1 
ATOM   7185  C  CB    . ARG I  4 471  ? 8.985   0.262    15.460  1.00 141.67 ? 471  ARG A CB    1 
ATOM   7186  C  CG    . ARG I  4 471  ? 9.645   -0.543   16.568  1.00 141.07 ? 471  ARG A CG    1 
ATOM   7187  C  CD    . ARG I  4 471  ? 8.620   -1.332   17.358  1.00 134.68 ? 471  ARG A CD    1 
ATOM   7188  N  NE    . ARG I  4 471  ? 9.259   -2.231   18.312  1.00 137.17 ? 471  ARG A NE    1 
ATOM   7189  C  CZ    . ARG I  4 471  ? 8.620   -2.872   19.283  1.00 138.43 ? 471  ARG A CZ    1 
ATOM   7190  N  NH1   . ARG I  4 471  ? 7.305   -2.711   19.452  1.00 140.39 ? 471  ARG A NH1   1 
ATOM   7191  N  NH2   . ARG I  4 471  ? 9.302   -3.674   20.094  1.00 134.61 ? 471  ARG A NH2   1 
ATOM   7192  N  N     . GLU I  4 472  ? 8.465   2.610    13.466  1.00 126.17 ? 472  GLU A N     1 
ATOM   7193  C  CA    . GLU I  4 472  ? 7.650   3.057    12.337  1.00 128.84 ? 472  GLU A CA    1 
ATOM   7194  C  C     . GLU I  4 472  ? 8.298   4.198    11.544  1.00 118.12 ? 472  GLU A C     1 
ATOM   7195  O  O     . GLU I  4 472  ? 7.655   4.783    10.677  1.00 117.13 ? 472  GLU A O     1 
ATOM   7196  C  CB    . GLU I  4 472  ? 6.245   3.471    12.830  1.00 133.67 ? 472  GLU A CB    1 
ATOM   7197  C  CG    . GLU I  4 472  ? 5.571   2.496    13.791  1.00 134.75 ? 472  GLU A CG    1 
ATOM   7198  C  CD    . GLU I  4 472  ? 5.296   1.122    13.182  1.00 139.47 ? 472  GLU A CD    1 
ATOM   7199  O  OE1   . GLU I  4 472  ? 4.112   0.716    13.136  1.00 139.56 ? 472  GLU A OE1   1 
ATOM   7200  O  OE2   . GLU I  4 472  ? 6.251   0.433    12.757  1.00 138.17 ? 472  GLU A OE2   1 
ATOM   7201  N  N     . ARG I  4 473  ? 9.565   4.499    11.831  1.00 114.07 ? 473  ARG A N     1 
ATOM   7202  C  CA    . ARG I  4 473  ? 10.237  5.663    11.236  1.00 120.20 ? 473  ARG A CA    1 
ATOM   7203  C  C     . ARG I  4 473  ? 10.407  5.486    9.753   1.00 122.74 ? 473  ARG A C     1 
ATOM   7204  O  O     . ARG I  4 473  ? 10.349  6.458    9.011   1.00 126.73 ? 473  ARG A O     1 
ATOM   7205  C  CB    . ARG I  4 473  ? 11.614  5.883    11.862  1.00 120.29 ? 473  ARG A CB    1 
ATOM   7206  C  CG    . ARG I  4 473  ? 12.339  7.143    11.414  1.00 115.84 ? 473  ARG A CG    1 
ATOM   7207  C  CD    . ARG I  4 473  ? 13.748  7.152    11.987  1.00 125.90 ? 473  ARG A CD    1 
ATOM   7208  N  NE    . ARG I  4 473  ? 14.618  6.202    11.296  1.00 126.21 ? 473  ARG A NE    1 
ATOM   7209  C  CZ    . ARG I  4 473  ? 15.249  6.455    10.153  1.00 129.82 ? 473  ARG A CZ    1 
ATOM   7210  N  NH1   . ARG I  4 473  ? 15.134  7.642    9.554   1.00 131.22 ? 473  ARG A NH1   1 
ATOM   7211  N  NH2   . ARG I  4 473  ? 16.008  5.516    9.603   1.00 132.23 ? 473  ARG A NH2   1 
ATOM   7212  N  N     . ASP I  4 474  ? 10.624  4.239    9.343   1.00 122.89 ? 474  ASP A N     1 
ATOM   7213  C  CA    . ASP I  4 474  ? 10.926  3.915    7.967   1.00 121.14 ? 474  ASP A CA    1 
ATOM   7214  C  C     . ASP I  4 474  ? 9.700   4.092    7.073   1.00 117.53 ? 474  ASP A C     1 
ATOM   7215  O  O     . ASP I  4 474  ? 9.829   4.479    5.915   1.00 127.58 ? 474  ASP A O     1 
ATOM   7216  C  CB    . ASP I  4 474  ? 11.485  2.489    7.874   1.00 127.14 ? 474  ASP A CB    1 
ATOM   7217  C  CG    . ASP I  4 474  ? 12.860  2.346    8.538   1.00 126.22 ? 474  ASP A CG    1 
ATOM   7218  O  OD1   . ASP I  4 474  ? 13.305  3.285    9.224   1.00 119.80 ? 474  ASP A OD1   1 
ATOM   7219  O  OD2   . ASP I  4 474  ? 13.510  1.292    8.370   1.00 137.10 ? 474  ASP A OD2   1 
ATOM   7220  N  N     . ARG I  4 475  ? 8.517   3.828    7.614   1.00 116.31 ? 475  ARG A N     1 
ATOM   7221  C  CA    . ARG I  4 475  ? 7.265   3.993    6.868   1.00 115.35 ? 475  ARG A CA    1 
ATOM   7222  C  C     . ARG I  4 475  ? 6.977   5.455    6.482   1.00 116.76 ? 475  ARG A C     1 
ATOM   7223  O  O     . ARG I  4 475  ? 6.402   5.722    5.422   1.00 111.83 ? 475  ARG A O     1 
ATOM   7224  C  CB    . ARG I  4 475  ? 6.097   3.439    7.678   1.00 115.13 ? 475  ARG A CB    1 
ATOM   7225  C  CG    . ARG I  4 475  ? 6.087   1.920    7.780   1.00 118.73 ? 475  ARG A CG    1 
ATOM   7226  C  CD    . ARG I  4 475  ? 5.117   1.412    8.832   1.00 118.03 ? 475  ARG A CD    1 
ATOM   7227  N  NE    . ARG I  4 475  ? 3.780   1.970    8.654   1.00 120.82 ? 475  ARG A NE    1 
ATOM   7228  C  CZ    . ARG I  4 475  ? 2.788   1.866    9.532   1.00 129.26 ? 475  ARG A CZ    1 
ATOM   7229  N  NH1   . ARG I  4 475  ? 2.949   1.192    10.666  1.00 145.68 ? 475  ARG A NH1   1 
ATOM   7230  N  NH2   . ARG I  4 475  ? 1.622   2.434    9.273   1.00 135.27 ? 475  ARG A NH2   1 
ATOM   7231  N  N     . VAL I  4 476  ? 7.377   6.395    7.337   1.00 115.03 ? 476  VAL A N     1 
ATOM   7232  C  CA    . VAL I  4 476  ? 7.234   7.822    7.034   1.00 117.40 ? 476  VAL A CA    1 
ATOM   7233  C  C     . VAL I  4 476  ? 8.181   8.225    5.865   1.00 122.09 ? 476  VAL A C     1 
ATOM   7234  O  O     . VAL I  4 476  ? 7.819   9.005    4.973   1.00 118.35 ? 476  VAL A O     1 
ATOM   7235  C  CB    . VAL I  4 476  ? 7.487   8.695    8.295   1.00 121.96 ? 476  VAL A CB    1 
ATOM   7236  C  CG1   . VAL I  4 476  ? 7.272   10.171   7.997   1.00 120.85 ? 476  VAL A CG1   1 
ATOM   7237  C  CG2   . VAL I  4 476  ? 6.565   8.295    9.437   1.00 127.03 ? 476  VAL A CG2   1 
ATOM   7238  N  N     . ILE I  4 477  ? 9.395   7.684    5.861   1.00 118.98 ? 477  ILE A N     1 
ATOM   7239  C  CA    . ILE I  4 477  ? 10.313  7.922    4.759   1.00 114.18 ? 477  ILE A CA    1 
ATOM   7240  C  C     . ILE I  4 477  ? 9.755   7.291    3.501   1.00 114.34 ? 477  ILE A C     1 
ATOM   7241  O  O     . ILE I  4 477  ? 9.785   7.896    2.438   1.00 112.33 ? 477  ILE A O     1 
ATOM   7242  C  CB    . ILE I  4 477  ? 11.700  7.343    5.054   1.00 114.05 ? 477  ILE A CB    1 
ATOM   7243  C  CG1   . ILE I  4 477  ? 12.370  8.148    6.160   1.00 111.80 ? 477  ILE A CG1   1 
ATOM   7244  C  CG2   . ILE I  4 477  ? 12.577  7.407    3.818   1.00 121.61 ? 477  ILE A CG2   1 
ATOM   7245  C  CD1   . ILE I  4 477  ? 13.683  7.581    6.641   1.00 114.80 ? 477  ILE A CD1   1 
ATOM   7246  N  N     . GLN I  4 478  ? 9.243   6.074    3.636   1.00 119.84 ? 478  GLN A N     1 
ATOM   7247  C  CA    . GLN I  4 478  ? 8.650   5.369    2.516   1.00 123.46 ? 478  GLN A CA    1 
ATOM   7248  C  C     . GLN I  4 478  ? 7.546   6.219    1.911   1.00 124.99 ? 478  GLN A C     1 
ATOM   7249  O  O     . GLN I  4 478  ? 7.468   6.357    0.691   1.00 138.42 ? 478  GLN A O     1 
ATOM   7250  C  CB    . GLN I  4 478  ? 8.118   3.996    2.952   1.00 124.05 ? 478  GLN A CB    1 
ATOM   7251  C  CG    . GLN I  4 478  ? 7.524   3.159    1.830   1.00 126.56 ? 478  GLN A CG    1 
ATOM   7252  C  CD    . GLN I  4 478  ? 8.496   2.979    0.683   1.00 123.06 ? 478  GLN A CD    1 
ATOM   7253  O  OE1   . GLN I  4 478  ? 9.696   2.901    0.897   1.00 117.82 ? 478  GLN A OE1   1 
ATOM   7254  N  NE2   . GLN I  4 478  ? 7.980   2.914    -0.536  1.00 121.52 ? 478  GLN A NE2   1 
ATOM   7255  N  N     . TYR I  4 479  ? 6.721   6.818    2.760   1.00 121.70 ? 479  TYR A N     1 
ATOM   7256  C  CA    . TYR I  4 479  ? 5.600   7.615    2.270   1.00 122.82 ? 479  TYR A CA    1 
ATOM   7257  C  C     . TYR I  4 479  ? 6.111   8.718    1.398   1.00 115.02 ? 479  TYR A C     1 
ATOM   7258  O  O     . TYR I  4 479  ? 5.601   8.910    0.316   1.00 115.39 ? 479  TYR A O     1 
ATOM   7259  C  CB    . TYR I  4 479  ? 4.777   8.194    3.424   1.00 126.91 ? 479  TYR A CB    1 
ATOM   7260  C  CG    . TYR I  4 479  ? 3.822   9.299    3.024   1.00 123.31 ? 479  TYR A CG    1 
ATOM   7261  C  CD1   . TYR I  4 479  ? 2.626   9.021    2.363   1.00 126.50 ? 479  TYR A CD1   1 
ATOM   7262  C  CD2   . TYR I  4 479  ? 4.107   10.624   3.322   1.00 117.71 ? 479  TYR A CD2   1 
ATOM   7263  C  CE1   . TYR I  4 479  ? 1.753   10.044   2.008   1.00 123.93 ? 479  TYR A CE1   1 
ATOM   7264  C  CE2   . TYR I  4 479  ? 3.240   11.650   2.967   1.00 115.33 ? 479  TYR A CE2   1 
ATOM   7265  C  CZ    . TYR I  4 479  ? 2.072   11.358   2.314   1.00 114.22 ? 479  TYR A CZ    1 
ATOM   7266  O  OH    . TYR I  4 479  ? 1.234   12.386   1.981   1.00 111.92 ? 479  TYR A OH    1 
ATOM   7267  N  N     . VAL I  4 480  ? 7.133   9.417    1.881   1.00 126.61 ? 480  VAL A N     1 
ATOM   7268  C  CA    . VAL I  4 480  ? 7.719   10.580   1.188   1.00 122.46 ? 480  VAL A CA    1 
ATOM   7269  C  C     . VAL I  4 480  ? 8.299   10.175   -0.162  1.00 129.19 ? 480  VAL A C     1 
ATOM   7270  O  O     . VAL I  4 480  ? 8.126   10.896   -1.150  1.00 135.06 ? 480  VAL A O     1 
ATOM   7271  C  CB    . VAL I  4 480  ? 8.817   11.230   2.045   1.00 115.99 ? 480  VAL A CB    1 
ATOM   7272  C  CG1   . VAL I  4 480  ? 9.464   12.383   1.311   1.00 109.67 ? 480  VAL A CG1   1 
ATOM   7273  C  CG2   . VAL I  4 480  ? 8.226   11.680   3.372   1.00 116.19 ? 480  VAL A CG2   1 
ATOM   7274  N  N     . ARG I  4 481  ? 8.959   9.010    -0.208  1.00 133.27 ? 481  ARG A N     1 
ATOM   7275  C  CA    . ARG I  4 481  ? 9.484   8.464    -1.471  1.00 126.25 ? 481  ARG A CA    1 
ATOM   7276  C  C     . ARG I  4 481  ? 8.350   8.268    -2.459  1.00 122.74 ? 481  ARG A C     1 
ATOM   7277  O  O     . ARG I  4 481  ? 8.467   8.651    -3.599  1.00 127.96 ? 481  ARG A O     1 
ATOM   7278  C  CB    . ARG I  4 481  ? 10.242  7.143    -1.254  1.00 124.71 ? 481  ARG A CB    1 
ATOM   7279  C  CG    . ARG I  4 481  ? 11.573  7.325    -0.530  1.00 129.88 ? 481  ARG A CG    1 
ATOM   7280  C  CD    . ARG I  4 481  ? 12.554  6.181    -0.747  1.00 130.71 ? 481  ARG A CD    1 
ATOM   7281  N  NE    . ARG I  4 481  ? 12.232  4.983    0.019   1.00 131.58 ? 481  ARG A NE    1 
ATOM   7282  C  CZ    . ARG I  4 481  ? 12.817  3.794    -0.152  1.00 142.92 ? 481  ARG A CZ    1 
ATOM   7283  N  NH1   . ARG I  4 481  ? 13.770  3.622    -1.060  1.00 146.69 ? 481  ARG A NH1   1 
ATOM   7284  N  NH2   . ARG I  4 481  ? 12.445  2.755    0.584   1.00 153.54 ? 481  ARG A NH2   1 
ATOM   7285  N  N     . GLU I  4 482  ? 7.241   7.697    -2.010  1.00 124.87 ? 482  GLU A N     1 
ATOM   7286  C  CA    . GLU I  4 482  ? 6.095   7.499    -2.874  1.00 123.00 ? 482  GLU A CA    1 
ATOM   7287  C  C     . GLU I  4 482  ? 5.396   8.809    -3.185  1.00 121.30 ? 482  GLU A C     1 
ATOM   7288  O  O     . GLU I  4 482  ? 4.807   8.949    -4.245  1.00 136.92 ? 482  GLU A O     1 
ATOM   7289  C  CB    . GLU I  4 482  ? 5.098   6.523    -2.243  1.00 122.96 ? 482  GLU A CB    1 
ATOM   7290  C  CG    . GLU I  4 482  ? 5.604   5.094    -2.205  1.00 121.71 ? 482  GLU A CG    1 
ATOM   7291  C  CD    . GLU I  4 482  ? 4.596   4.141    -1.611  1.00 122.79 ? 482  GLU A CD    1 
ATOM   7292  O  OE1   . GLU I  4 482  ? 3.486   4.590    -1.277  1.00 117.40 ? 482  GLU A OE1   1 
ATOM   7293  O  OE2   . GLU I  4 482  ? 4.918   2.943    -1.474  1.00 135.66 ? 482  GLU A OE2   1 
ATOM   7294  N  N     . ARG I  4 483  ? 5.450   9.761    -2.265  1.00 120.20 ? 483  ARG A N     1 
ATOM   7295  C  CA    . ARG I  4 483  ? 4.694   11.005   -2.392  1.00 122.28 ? 483  ARG A CA    1 
ATOM   7296  C  C     . ARG I  4 483  ? 5.340   11.936   -3.390  1.00 120.44 ? 483  ARG A C     1 
ATOM   7297  O  O     . ARG I  4 483  ? 4.666   12.449   -4.281  1.00 129.56 ? 483  ARG A O     1 
ATOM   7298  C  CB    . ARG I  4 483  ? 4.611   11.722   -1.040  1.00 129.10 ? 483  ARG A CB    1 
ATOM   7299  C  CG    . ARG I  4 483  ? 3.876   13.059   -1.057  1.00 133.41 ? 483  ARG A CG    1 
ATOM   7300  C  CD    . ARG I  4 483  ? 2.380   12.872   -1.200  1.00 138.14 ? 483  ARG A CD    1 
ATOM   7301  N  NE    . ARG I  4 483  ? 1.651   14.119   -0.965  1.00 139.81 ? 483  ARG A NE    1 
ATOM   7302  C  CZ    . ARG I  4 483  ? 0.325   14.221   -0.862  1.00 144.53 ? 483  ARG A CZ    1 
ATOM   7303  N  NH1   . ARG I  4 483  ? -0.458  13.143   -0.977  1.00 150.04 ? 483  ARG A NH1   1 
ATOM   7304  N  NH2   . ARG I  4 483  ? -0.226  15.419   -0.651  1.00 144.00 ? 483  ARG A NH2   1 
ATOM   7305  N  N     . TYR I  4 484  ? 6.634   12.181   -3.216  1.00 114.87 ? 484  TYR A N     1 
ATOM   7306  C  CA    . TYR I  4 484  ? 7.331   13.182   -4.021  1.00 123.90 ? 484  TYR A CA    1 
ATOM   7307  C  C     . TYR I  4 484  ? 8.091   12.584   -5.214  1.00 133.21 ? 484  TYR A C     1 
ATOM   7308  O  O     . TYR I  4 484  ? 8.052   13.153   -6.310  1.00 132.53 ? 484  TYR A O     1 
ATOM   7309  C  CB    . TYR I  4 484  ? 8.236   14.044   -3.132  1.00 123.22 ? 484  TYR A CB    1 
ATOM   7310  C  CG    . TYR I  4 484  ? 7.427   14.800   -2.103  1.00 125.77 ? 484  TYR A CG    1 
ATOM   7311  C  CD1   . TYR I  4 484  ? 7.257   14.275   -0.828  1.00 134.15 ? 484  TYR A CD1   1 
ATOM   7312  C  CD2   . TYR I  4 484  ? 6.775   15.996   -2.418  1.00 124.39 ? 484  TYR A CD2   1 
ATOM   7313  C  CE1   . TYR I  4 484  ? 6.496   14.928   0.123   1.00 137.05 ? 484  TYR A CE1   1 
ATOM   7314  C  CE2   . TYR I  4 484  ? 6.013   16.660   -1.473  1.00 134.21 ? 484  TYR A CE2   1 
ATOM   7315  C  CZ    . TYR I  4 484  ? 5.875   16.120   -0.200  1.00 139.05 ? 484  TYR A CZ    1 
ATOM   7316  O  OH    . TYR I  4 484  ? 5.126   16.754   0.765   1.00 138.39 ? 484  TYR A OH    1 
ATOM   7317  N  N     . GLY I  4 485  ? 8.760   11.446   -5.002  1.00 136.95 ? 485  GLY A N     1 
ATOM   7318  C  CA    . GLY I  4 485  ? 9.430   10.704   -6.083  1.00 121.89 ? 485  GLY A CA    1 
ATOM   7319  C  C     . GLY I  4 485  ? 10.655  9.959    -5.602  1.00 129.15 ? 485  GLY A C     1 
ATOM   7320  O  O     . GLY I  4 485  ? 11.535  10.572   -4.986  1.00 136.03 ? 485  GLY A O     1 
ATOM   7321  N  N     . GLU I  4 486  ? 10.714  8.644    -5.872  1.00 128.33 ? 486  GLU A N     1 
ATOM   7322  C  CA    . GLU I  4 486  ? 11.876  7.808    -5.516  1.00 130.16 ? 486  GLU A CA    1 
ATOM   7323  C  C     . GLU I  4 486  ? 13.181  8.429    -6.048  1.00 131.61 ? 486  GLU A C     1 
ATOM   7324  O  O     . GLU I  4 486  ? 14.210  8.430    -5.362  1.00 134.23 ? 486  GLU A O     1 
ATOM   7325  C  CB    . GLU I  4 486  ? 11.706  6.385    -6.052  1.00 126.61 ? 486  GLU A CB    1 
ATOM   7326  C  CG    . GLU I  4 486  ? 12.302  5.292    -5.169  1.00 132.97 ? 486  GLU A CG    1 
ATOM   7327  C  CD    . GLU I  4 486  ? 11.268  4.622    -4.281  1.00 136.64 ? 486  GLU A CD    1 
ATOM   7328  O  OE1   . GLU I  4 486  ? 11.649  3.820    -3.404  1.00 150.57 ? 486  GLU A OE1   1 
ATOM   7329  O  OE2   . GLU I  4 486  ? 10.064  4.881    -4.465  1.00 144.77 ? 486  GLU A OE2   1 
ATOM   7330  N  N     . ASP I  4 487  ? 13.108  8.972    -7.263  1.00 127.83 ? 487  ASP A N     1 
ATOM   7331  C  CA    . ASP I  4 487  ? 14.226  9.694    -7.887  1.00 133.43 ? 487  ASP A CA    1 
ATOM   7332  C  C     . ASP I  4 487  ? 14.570  11.032   -7.230  1.00 127.16 ? 487  ASP A C     1 
ATOM   7333  O  O     . ASP I  4 487  ? 15.691  11.527   -7.371  1.00 128.22 ? 487  ASP A O     1 
ATOM   7334  C  CB    . ASP I  4 487  ? 13.937  9.967    -9.364  1.00 134.69 ? 487  ASP A CB    1 
ATOM   7335  C  CG    . ASP I  4 487  ? 12.804  10.935   -9.562  1.00 133.81 ? 487  ASP A CG    1 
ATOM   7336  O  OD1   . ASP I  4 487  ? 12.885  11.775   -10.480 1.00 131.36 ? 487  ASP A OD1   1 
ATOM   7337  O  OD2   . ASP I  4 487  ? 11.827  10.854   -8.792  1.00 147.44 ? 487  ASP A OD2   1 
ATOM   7338  N  N     . LYS I  4 488  ? 13.596  11.629   -6.549  1.00 125.68 ? 488  LYS A N     1 
ATOM   7339  C  CA    . LYS I  4 488  ? 13.792  12.929   -5.889  1.00 121.51 ? 488  LYS A CA    1 
ATOM   7340  C  C     . LYS I  4 488  ? 14.047  12.819   -4.399  1.00 116.19 ? 488  LYS A C     1 
ATOM   7341  O  O     . LYS I  4 488  ? 14.480  13.788   -3.794  1.00 118.61 ? 488  LYS A O     1 
ATOM   7342  C  CB    . LYS I  4 488  ? 12.603  13.855   -6.141  1.00 114.06 ? 488  LYS A CB    1 
ATOM   7343  C  CG    . LYS I  4 488  ? 12.484  14.285   -7.597  1.00 114.86 ? 488  LYS A CG    1 
ATOM   7344  C  CD    . LYS I  4 488  ? 11.115  14.835   -7.926  1.00 111.32 ? 488  LYS A CD    1 
ATOM   7345  C  CE    . LYS I  4 488  ? 10.939  15.043   -9.424  1.00 111.82 ? 488  LYS A CE    1 
ATOM   7346  N  NZ    . LYS I  4 488  ? 9.610   15.599   -9.825  1.00 115.89 ? 488  LYS A NZ    1 
ATOM   7347  N  N     . VAL I  4 489  ? 13.800  11.643   -3.819  1.00 119.11 ? 489  VAL A N     1 
ATOM   7348  C  CA    . VAL I  4 489  ? 13.946  11.442   -2.379  1.00 120.32 ? 489  VAL A CA    1 
ATOM   7349  C  C     . VAL I  4 489  ? 14.987  10.377   -2.069  1.00 122.95 ? 489  VAL A C     1 
ATOM   7350  O  O     . VAL I  4 489  ? 14.889  9.238    -2.542  1.00 129.20 ? 489  VAL A O     1 
ATOM   7351  C  CB    . VAL I  4 489  ? 12.608  11.040   -1.713  1.00 125.27 ? 489  VAL A CB    1 
ATOM   7352  C  CG1   . VAL I  4 489  ? 12.819  10.729   -0.235  1.00 127.74 ? 489  VAL A CG1   1 
ATOM   7353  C  CG2   . VAL I  4 489  ? 11.572  12.154   -1.870  1.00 128.09 ? 489  VAL A CG2   1 
ATOM   7354  N  N     . ALA I  4 490  ? 15.964  10.753   -1.247  1.00 120.85 ? 490  ALA A N     1 
ATOM   7355  C  CA    . ALA I  4 490  ? 17.030  9.852    -0.827  1.00 115.48 ? 490  ALA A CA    1 
ATOM   7356  C  C     . ALA I  4 490  ? 17.671  10.328   0.465   1.00 114.45 ? 490  ALA A C     1 
ATOM   7357  O  O     . ALA I  4 490  ? 17.739  11.529   0.749   1.00 111.29 ? 490  ALA A O     1 
ATOM   7358  C  CB    . ALA I  4 490  ? 18.085  9.757    -1.910  1.00 120.67 ? 490  ALA A CB    1 
ATOM   7359  N  N     . GLN I  4 491  ? 18.168  9.375    1.238   1.00 116.82 ? 491  GLN A N     1 
ATOM   7360  C  CA    . GLN I  4 491  ? 18.756  9.685    2.531   1.00 122.78 ? 491  GLN A CA    1 
ATOM   7361  C  C     . GLN I  4 491  ? 20.183  10.217   2.387   1.00 114.70 ? 491  GLN A C     1 
ATOM   7362  O  O     . GLN I  4 491  ? 20.784  10.088   1.347   1.00 117.06 ? 491  GLN A O     1 
ATOM   7363  C  CB    . GLN I  4 491  ? 18.724  8.441    3.436   1.00 129.85 ? 491  GLN A CB    1 
ATOM   7364  C  CG    . GLN I  4 491  ? 17.318  7.996    3.830   1.00 128.07 ? 491  GLN A CG    1 
ATOM   7365  C  CD    . GLN I  4 491  ? 17.300  6.891    4.877   1.00 128.46 ? 491  GLN A CD    1 
ATOM   7366  O  OE1   . GLN I  4 491  ? 16.683  5.840    4.677   1.00 119.96 ? 491  GLN A OE1   1 
ATOM   7367  N  NE2   . GLN I  4 491  ? 17.963  7.133    6.010   1.00 126.43 ? 491  GLN A NE2   1 
ATOM   7368  N  N     . ILE I  4 492  ? 20.704  10.813   3.451   1.00 115.01 ? 492  ILE A N     1 
ATOM   7369  C  CA    . ILE I  4 492  ? 22.037  11.400   3.464   1.00 118.46 ? 492  ILE A CA    1 
ATOM   7370  C  C     . ILE I  4 492  ? 23.090  10.439   4.050   1.00 121.19 ? 492  ILE A C     1 
ATOM   7371  O  O     . ILE I  4 492  ? 22.817  9.734    5.022   1.00 130.17 ? 492  ILE A O     1 
ATOM   7372  C  CB    . ILE I  4 492  ? 22.011  12.730   4.259   1.00 119.28 ? 492  ILE A CB    1 
ATOM   7373  C  CG1   . ILE I  4 492  ? 21.043  13.715   3.577   1.00 117.68 ? 492  ILE A CG1   1 
ATOM   7374  C  CG2   . ILE I  4 492  ? 23.407  13.331   4.385   1.00 122.75 ? 492  ILE A CG2   1 
ATOM   7375  C  CD1   . ILE I  4 492  ? 20.930  15.093   4.206   1.00 109.90 ? 492  ILE A CD1   1 
ATOM   7376  N  N     . GLY I  4 493  ? 24.283  10.424   3.446   1.00 118.38 ? 493  GLY A N     1 
ATOM   7377  C  CA    . GLY I  4 493  ? 25.414  9.629    3.923   1.00 117.90 ? 493  GLY A CA    1 
ATOM   7378  C  C     . GLY I  4 493  ? 26.135  10.359   5.034   1.00 119.71 ? 493  GLY A C     1 
ATOM   7379  O  O     . GLY I  4 493  ? 25.986  11.578   5.163   1.00 109.08 ? 493  GLY A O     1 
ATOM   7380  N  N     . THR I  4 494  ? 26.907  9.608    5.829   1.00 122.18 ? 494  THR A N     1 
ATOM   7381  C  CA    . THR I  4 494  ? 27.630  10.147   6.972   1.00 123.82 ? 494  THR A CA    1 
ATOM   7382  C  C     . THR I  4 494  ? 29.035  9.592    6.983   1.00 123.86 ? 494  THR A C     1 
ATOM   7383  O  O     . THR I  4 494  ? 29.225  8.380    6.924   1.00 136.20 ? 494  THR A O     1 
ATOM   7384  C  CB    . THR I  4 494  ? 26.952  9.767    8.314   1.00 128.95 ? 494  THR A CB    1 
ATOM   7385  O  OG1   . THR I  4 494  ? 25.604  10.240   8.328   1.00 141.31 ? 494  THR A OG1   1 
ATOM   7386  C  CG2   . THR I  4 494  ? 27.692  10.370   9.520   1.00 133.62 ? 494  THR A CG2   1 
ATOM   7387  N  N     . PHE I  4 495  ? 30.011  10.484   7.059   1.00 117.41 ? 495  PHE A N     1 
ATOM   7388  C  CA    . PHE I  4 495  ? 31.362  10.114   7.400   1.00 118.93 ? 495  PHE A CA    1 
ATOM   7389  C  C     . PHE I  4 495  ? 32.158  11.401   7.699   1.00 130.60 ? 495  PHE A C     1 
ATOM   7390  O  O     . PHE I  4 495  ? 31.930  12.426   7.030   1.00 127.39 ? 495  PHE A O     1 
ATOM   7391  C  CB    . PHE I  4 495  ? 31.992  9.291    6.268   1.00 117.90 ? 495  PHE A CB    1 
ATOM   7392  C  CG    . PHE I  4 495  ? 31.544  9.689    4.882   1.00 119.87 ? 495  PHE A CG    1 
ATOM   7393  C  CD1   . PHE I  4 495  ? 32.173  10.724   4.195   1.00 122.88 ? 495  PHE A CD1   1 
ATOM   7394  C  CD2   . PHE I  4 495  ? 30.521  8.998    4.241   1.00 123.29 ? 495  PHE A CD2   1 
ATOM   7395  C  CE1   . PHE I  4 495  ? 31.763  11.075   2.912   1.00 123.78 ? 495  PHE A CE1   1 
ATOM   7396  C  CE2   . PHE I  4 495  ? 30.112  9.335    2.958   1.00 119.66 ? 495  PHE A CE2   1 
ATOM   7397  C  CZ    . PHE I  4 495  ? 30.729  10.377   2.294   1.00 121.26 ? 495  PHE A CZ    1 
ATOM   7398  N  N     . GLY I  4 496  ? 33.079  11.393   8.678   1.00 135.02 ? 496  GLY A N     1 
ATOM   7399  C  CA    . GLY I  4 496  ? 33.441  10.222   9.501   1.00 136.36 ? 496  GLY A CA    1 
ATOM   7400  C  C     . GLY I  4 496  ? 34.073  9.065    8.743   1.00 135.17 ? 496  GLY A C     1 
ATOM   7401  O  O     . GLY I  4 496  ? 33.378  8.106    8.446   1.00 136.46 ? 496  GLY A O     1 
ATOM   7402  N  N     . SER I  4 497  ? 35.376  9.074    8.462   1.00 139.40 ? 497  SER A N     1 
ATOM   7403  C  CA    . SER I  4 497  ? 36.412  9.949    9.054   1.00 145.61 ? 497  SER A CA    1 
ATOM   7404  C  C     . SER I  4 497  ? 36.686  9.646    10.543  1.00 136.38 ? 497  SER A C     1 
ATOM   7405  O  O     . SER I  4 497  ? 36.000  8.829    11.156  1.00 129.95 ? 497  SER A O     1 
ATOM   7406  C  CB    . SER I  4 497  ? 36.171  11.449   8.766   1.00 146.95 ? 497  SER A CB    1 
ATOM   7407  O  OG    . SER I  4 497  ? 35.536  12.126   9.833   1.00 144.81 ? 497  SER A OG    1 
ATOM   7408  N  N     . LEU I  4 498  ? 37.724  10.280   11.083  1.00 135.71 ? 498  LEU A N     1 
ATOM   7409  C  CA    . LEU I  4 498  ? 38.259  9.971    12.415  1.00 140.18 ? 498  LEU A CA    1 
ATOM   7410  C  C     . LEU I  4 498  ? 39.026  8.652    12.319  1.00 132.47 ? 498  LEU A C     1 
ATOM   7411  O  O     . LEU I  4 498  ? 38.982  8.002    11.262  1.00 119.55 ? 498  LEU A O     1 
ATOM   7412  C  CB    . LEU I  4 498  ? 37.149  9.949    13.492  1.00 139.58 ? 498  LEU A CB    1 
ATOM   7413  C  CG    . LEU I  4 498  ? 36.394  11.262   13.691  1.00 137.10 ? 498  LEU A CG    1 
ATOM   7414  C  CD1   . LEU I  4 498  ? 35.202  11.058   14.616  1.00 133.82 ? 498  LEU A CD1   1 
ATOM   7415  C  CD2   . LEU I  4 498  ? 37.344  12.318   14.245  1.00 133.68 ? 498  LEU A CD2   1 
ATOM   7416  N  N     . ALA I  4 499  ? 39.756  8.250    13.369  1.00 138.63 ? 499  ALA A N     1 
ATOM   7417  C  CA    . ALA I  4 499  ? 39.930  8.967    14.651  1.00 133.54 ? 499  ALA A CA    1 
ATOM   7418  C  C     . ALA I  4 499  ? 41.410  8.894    15.078  1.00 140.26 ? 499  ALA A C     1 
ATOM   7419  O  O     . ALA I  4 499  ? 42.278  8.595    14.261  1.00 150.95 ? 499  ALA A O     1 
ATOM   7420  C  CB    . ALA I  4 499  ? 39.026  8.352    15.724  1.00 121.46 ? 499  ALA A CB    1 
ATOM   7421  N  N     . SER I  4 500  ? 41.699  9.156    16.353  1.00 138.01 ? 500  SER A N     1 
ATOM   7422  C  CA    . SER I  4 500  ? 43.071  9.098    16.862  1.00 133.30 ? 500  SER A CA    1 
ATOM   7423  C  C     . SER I  4 500  ? 43.373  7.768    17.526  1.00 134.75 ? 500  SER A C     1 
ATOM   7424  O  O     . SER I  4 500  ? 44.371  7.125    17.214  1.00 131.10 ? 500  SER A O     1 
ATOM   7425  C  CB    . SER I  4 500  ? 43.320  10.223   17.864  1.00 136.76 ? 500  SER A CB    1 
ATOM   7426  O  OG    . SER I  4 500  ? 44.685  10.252   18.270  1.00 131.29 ? 500  SER A OG    1 
ATOM   7427  N  N     . LYS I  4 501  ? 42.505  7.363    18.451  1.00 143.81 ? 501  LYS A N     1 
ATOM   7428  C  CA    . LYS I  4 501  ? 42.717  6.145    19.250  1.00 142.30 ? 501  LYS A CA    1 
ATOM   7429  C  C     . LYS I  4 501  ? 42.746  4.880    18.403  1.00 135.16 ? 501  LYS A C     1 
ATOM   7430  O  O     . LYS I  4 501  ? 43.564  4.011    18.644  1.00 127.29 ? 501  LYS A O     1 
ATOM   7431  C  CB    . LYS I  4 501  ? 41.644  6.006    20.342  1.00 150.57 ? 501  LYS A CB    1 
ATOM   7432  C  CG    . LYS I  4 501  ? 41.818  6.960    21.519  1.00 157.98 ? 501  LYS A CG    1 
ATOM   7433  C  CD    . LYS I  4 501  ? 40.893  6.628    22.688  1.00 155.28 ? 501  LYS A CD    1 
ATOM   7434  C  CE    . LYS I  4 501  ? 41.261  7.438    23.927  1.00 156.49 ? 501  LYS A CE    1 
ATOM   7435  N  NZ    . LYS I  4 501  ? 40.301  7.208    25.041  1.00 163.25 ? 501  LYS A NZ    1 
ATOM   7436  N  N     . ALA I  4 502  ? 41.850  4.777    17.422  1.00 137.89 ? 502  ALA A N     1 
ATOM   7437  C  CA    . ALA I  4 502  ? 41.814  3.604    16.529  1.00 137.71 ? 502  ALA A CA    1 
ATOM   7438  C  C     . ALA I  4 502  ? 43.002  3.628    15.572  1.00 141.08 ? 502  ALA A C     1 
ATOM   7439  O  O     . ALA I  4 502  ? 43.447  2.591    15.067  1.00 131.47 ? 502  ALA A O     1 
ATOM   7440  C  CB    . ALA I  4 502  ? 40.515  3.556    15.737  1.00 133.96 ? 502  ALA A CB    1 
ATOM   7441  N  N     . ALA I  4 503  ? 43.507  4.826    15.316  1.00 142.27 ? 503  ALA A N     1 
ATOM   7442  C  CA    . ALA I  4 503  ? 44.618  5.000    14.402  1.00 146.22 ? 503  ALA A CA    1 
ATOM   7443  C  C     . ALA I  4 503  ? 45.861  4.280    14.897  1.00 139.66 ? 503  ALA A C     1 
ATOM   7444  O  O     . ALA I  4 503  ? 46.522  3.579    14.148  1.00 136.20 ? 503  ALA A O     1 
ATOM   7445  C  CB    . ALA I  4 503  ? 44.904  6.489    14.228  1.00 148.66 ? 503  ALA A CB    1 
ATOM   7446  N  N     . LEU I  4 504  ? 46.171  4.476    16.172  1.00 143.30 ? 504  LEU A N     1 
ATOM   7447  C  CA    . LEU I  4 504  ? 47.383  3.922    16.776  1.00 142.59 ? 504  LEU A CA    1 
ATOM   7448  C  C     . LEU I  4 504  ? 47.347  2.416    16.832  1.00 140.47 ? 504  LEU A C     1 
ATOM   7449  O  O     . LEU I  4 504  ? 48.380  1.763    16.652  1.00 140.82 ? 504  LEU A O     1 
ATOM   7450  C  CB    . LEU I  4 504  ? 47.559  4.434    18.202  1.00 140.80 ? 504  LEU A CB    1 
ATOM   7451  C  CG    . LEU I  4 504  ? 48.171  5.813    18.321  1.00 137.69 ? 504  LEU A CG    1 
ATOM   7452  C  CD1   . LEU I  4 504  ? 47.999  6.323    19.737  1.00 133.33 ? 504  LEU A CD1   1 
ATOM   7453  C  CD2   . LEU I  4 504  ? 49.641  5.708    17.950  1.00 131.39 ? 504  LEU A CD2   1 
ATOM   7454  N  N     . LYS I  4 505  ? 46.159  1.879    17.091  1.00 134.09 ? 505  LYS A N     1 
ATOM   7455  C  CA    . LYS I  4 505  ? 45.981  0.445    17.243  1.00 141.78 ? 505  LYS A CA    1 
ATOM   7456  C  C     . LYS I  4 505  ? 45.967  -0.300   15.897  1.00 144.65 ? 505  LYS A C     1 
ATOM   7457  O  O     . LYS I  4 505  ? 46.424  -1.430   15.818  1.00 142.33 ? 505  LYS A O     1 
ATOM   7458  C  CB    . LYS I  4 505  ? 44.697  0.172    18.032  1.00 145.97 ? 505  LYS A CB    1 
ATOM   7459  C  CG    . LYS I  4 505  ? 44.668  0.846    19.400  1.00 153.32 ? 505  LYS A CG    1 
ATOM   7460  C  CD    . LYS I  4 505  ? 43.375  0.568    20.163  1.00 150.81 ? 505  LYS A CD    1 
ATOM   7461  C  CE    . LYS I  4 505  ? 43.315  1.363    21.470  1.00 151.76 ? 505  LYS A CE    1 
ATOM   7462  N  NZ    . LYS I  4 505  ? 42.076  1.130    22.271  1.00 139.40 ? 505  LYS A NZ    1 
ATOM   7463  N  N     . ASP I  4 506  ? 45.485  0.361    14.845  1.00 151.09 ? 506  ASP A N     1 
ATOM   7464  C  CA    . ASP I  4 506  ? 45.189  -0.253   13.527  1.00 145.50 ? 506  ASP A CA    1 
ATOM   7465  C  C     . ASP I  4 506  ? 45.631  -1.695   13.218  1.00 142.13 ? 506  ASP A C     1 
ATOM   7466  O  O     . ASP I  4 506  ? 44.794  -2.606   13.172  1.00 137.00 ? 506  ASP A O     1 
ATOM   7467  C  CB    . ASP I  4 506  ? 45.696  0.663    12.422  1.00 144.78 ? 506  ASP A CB    1 
ATOM   7468  C  CG    . ASP I  4 506  ? 44.787  1.842    12.192  1.00 150.30 ? 506  ASP A CG    1 
ATOM   7469  O  OD1   . ASP I  4 506  ? 43.592  1.757    12.517  1.00 148.37 ? 506  ASP A OD1   1 
ATOM   7470  O  OD2   . ASP I  4 506  ? 45.262  2.867    11.677  1.00 175.72 ? 506  ASP A OD2   1 
ATOM   7471  N  N     . VAL I  4 507  ? 46.923  -1.898   12.967  1.00 142.93 ? 507  VAL A N     1 
ATOM   7472  C  CA    . VAL I  4 507  ? 47.401  -3.207   12.476  1.00 141.63 ? 507  VAL A CA    1 
ATOM   7473  C  C     . VAL I  4 507  ? 47.372  -4.298   13.576  1.00 136.16 ? 507  VAL A C     1 
ATOM   7474  O  O     . VAL I  4 507  ? 46.867  -5.403   13.332  1.00 132.67 ? 507  VAL A O     1 
ATOM   7475  C  CB    . VAL I  4 507  ? 48.796  -3.119   11.785  1.00 142.53 ? 507  VAL A CB    1 
ATOM   7476  C  CG1   . VAL I  4 507  ? 49.899  -2.728   12.779  1.00 149.77 ? 507  VAL A CG1   1 
ATOM   7477  C  CG2   . VAL I  4 507  ? 49.113  -4.444   11.082  1.00 130.34 ? 507  VAL A CG2   1 
ATOM   7478  N  N     . ALA I  4 508  ? 47.874  -3.990   14.777  1.00 126.36 ? 508  ALA A N     1 
ATOM   7479  C  CA    . ALA I  4 508  ? 47.773  -4.933   15.905  1.00 128.76 ? 508  ALA A CA    1 
ATOM   7480  C  C     . ALA I  4 508  ? 46.318  -5.116   16.456  1.00 135.31 ? 508  ALA A C     1 
ATOM   7481  O  O     . ALA I  4 508  ? 46.079  -6.042   17.223  1.00 131.70 ? 508  ALA A O     1 
ATOM   7482  C  CB    . ALA I  4 508  ? 48.716  -4.519   17.030  1.00 131.43 ? 508  ALA A CB    1 
ATOM   7483  N  N     . ARG I  4 509  ? 45.386  -4.217   16.091  1.00 137.43 ? 509  ARG A N     1 
ATOM   7484  C  CA    . ARG I  4 509  ? 43.955  -4.330   16.392  1.00 138.11 ? 509  ARG A CA    1 
ATOM   7485  C  C     . ARG I  4 509  ? 43.264  -5.158   15.292  1.00 141.39 ? 509  ARG A C     1 
ATOM   7486  O  O     . ARG I  4 509  ? 43.638  -6.312   15.102  1.00 143.14 ? 509  ARG A O     1 
ATOM   7487  C  CB    . ARG I  4 509  ? 43.330  -2.927   16.538  1.00 151.80 ? 509  ARG A CB    1 
ATOM   7488  C  CG    . ARG I  4 509  ? 41.913  -2.874   17.130  1.00 156.39 ? 509  ARG A CG    1 
ATOM   7489  C  CD    . ARG I  4 509  ? 41.327  -1.464   17.046  1.00 166.17 ? 509  ARG A CD    1 
ATOM   7490  N  NE    . ARG I  4 509  ? 41.264  -0.927   15.678  1.00 170.46 ? 509  ARG A NE    1 
ATOM   7491  C  CZ    . ARG I  4 509  ? 40.263  -1.124   14.817  1.00 168.64 ? 509  ARG A CZ    1 
ATOM   7492  N  NH1   . ARG I  4 509  ? 39.206  -1.860   15.159  1.00 158.25 ? 509  ARG A NH1   1 
ATOM   7493  N  NH2   . ARG I  4 509  ? 40.323  -0.585   13.597  1.00 168.22 ? 509  ARG A NH2   1 
ATOM   7494  N  N     . VAL I  4 510  ? 42.279  -4.582   14.579  1.00 145.85 ? 510  VAL A N     1 
ATOM   7495  C  CA    . VAL I  4 510  ? 41.430  -5.268   13.564  1.00 143.59 ? 510  VAL A CA    1 
ATOM   7496  C  C     . VAL I  4 510  ? 40.982  -6.677   13.967  1.00 142.58 ? 510  VAL A C     1 
ATOM   7497  O  O     . VAL I  4 510  ? 40.534  -7.456   13.124  1.00 144.65 ? 510  VAL A O     1 
ATOM   7498  C  CB    . VAL I  4 510  ? 42.086  -5.256   12.137  1.00 148.14 ? 510  VAL A CB    1 
ATOM   7499  C  CG1   . VAL I  4 510  ? 43.189  -6.313   11.992  1.00 150.76 ? 510  VAL A CG1   1 
ATOM   7500  C  CG2   . VAL I  4 510  ? 41.032  -5.410   11.042  1.00 134.07 ? 510  VAL A CG2   1 
ATOM   7501  N  N     . TYR I  4 511  ? 41.079  -6.977   15.263  1.00 145.52 ? 511  TYR A N     1 
ATOM   7502  C  CA    . TYR I  4 511  ? 40.767  -8.316   15.819  1.00 157.51 ? 511  TYR A CA    1 
ATOM   7503  C  C     . TYR I  4 511  ? 40.923  -8.384   17.367  1.00 155.81 ? 511  TYR A C     1 
ATOM   7504  O  O     . TYR I  4 511  ? 40.195  -9.134   18.035  1.00 151.73 ? 511  TYR A O     1 
ATOM   7505  C  CB    . TYR I  4 511  ? 41.565  -9.459   15.124  1.00 154.12 ? 511  TYR A CB    1 
ATOM   7506  C  CG    . TYR I  4 511  ? 41.006  -10.845  15.390  1.00 147.61 ? 511  TYR A CG    1 
ATOM   7507  C  CD1   . TYR I  4 511  ? 39.645  -11.109  15.234  1.00 144.22 ? 511  TYR A CD1   1 
ATOM   7508  C  CD2   . TYR I  4 511  ? 41.833  -11.890  15.790  1.00 154.01 ? 511  TYR A CD2   1 
ATOM   7509  C  CE1   . TYR I  4 511  ? 39.120  -12.362  15.476  1.00 148.30 ? 511  TYR A CE1   1 
ATOM   7510  C  CE2   . TYR I  4 511  ? 41.314  -13.159  16.028  1.00 166.02 ? 511  TYR A CE2   1 
ATOM   7511  C  CZ    . TYR I  4 511  ? 39.946  -13.389  15.865  1.00 160.48 ? 511  TYR A CZ    1 
ATOM   7512  O  OH    . TYR I  4 511  ? 39.372  -14.633  16.088  1.00 159.54 ? 511  TYR A OH    1 
ATOM   7513  N  N     . GLY I  4 512  ? 41.856  -7.606   17.926  1.00 144.61 ? 512  GLY A N     1 
ATOM   7514  C  CA    . GLY I  4 512  ? 42.082  -7.584   19.365  1.00 140.33 ? 512  GLY A CA    1 
ATOM   7515  C  C     . GLY I  4 512  ? 43.149  -8.576   19.763  1.00 144.87 ? 512  GLY A C     1 
ATOM   7516  O  O     . GLY I  4 512  ? 42.854  -9.645   20.305  1.00 144.85 ? 512  GLY A O     1 
ATOM   7517  N  N     . ILE I  4 513  ? 44.395  -8.211   19.478  1.00 151.81 ? 513  ILE A N     1 
ATOM   7518  C  CA    . ILE I  4 513  ? 45.567  -9.019   19.825  1.00 158.50 ? 513  ILE A CA    1 
ATOM   7519  C  C     . ILE I  4 513  ? 46.260  -8.210   20.947  1.00 160.29 ? 513  ILE A C     1 
ATOM   7520  O  O     . ILE I  4 513  ? 45.590  -7.386   21.598  1.00 157.08 ? 513  ILE A O     1 
ATOM   7521  C  CB    . ILE I  4 513  ? 46.462  -9.292   18.580  1.00 159.42 ? 513  ILE A CB    1 
ATOM   7522  C  CG1   . ILE I  4 513  ? 45.659  -9.224   17.276  1.00 162.75 ? 513  ILE A CG1   1 
ATOM   7523  C  CG2   . ILE I  4 513  ? 47.064  -10.692  18.637  1.00 159.35 ? 513  ILE A CG2   1 
ATOM   7524  C  CD1   . ILE I  4 513  ? 44.555  -10.257  17.188  1.00 167.99 ? 513  ILE A CD1   1 
ATOM   7525  N  N     . PRO I  4 514  ? 47.573  -8.425   21.200  1.00 156.45 ? 514  PRO A N     1 
ATOM   7526  C  CA    . PRO I  4 514  ? 48.134  -7.626   22.292  1.00 154.00 ? 514  PRO A CA    1 
ATOM   7527  C  C     . PRO I  4 514  ? 47.964  -6.117   22.159  1.00 147.26 ? 514  PRO A C     1 
ATOM   7528  O  O     . PRO I  4 514  ? 48.649  -5.466   21.378  1.00 143.51 ? 514  PRO A O     1 
ATOM   7529  C  CB    . PRO I  4 514  ? 49.615  -8.001   22.272  1.00 160.87 ? 514  PRO A CB    1 
ATOM   7530  C  CG    . PRO I  4 514  ? 49.632  -9.399   21.767  1.00 160.84 ? 514  PRO A CG    1 
ATOM   7531  C  CD    . PRO I  4 514  ? 48.521  -9.473   20.765  1.00 158.44 ? 514  PRO A CD    1 
ATOM   7532  N  N     . HIS I  4 515  ? 47.035  -5.583   22.932  1.00 148.84 ? 515  HIS A N     1 
ATOM   7533  C  CA    . HIS I  4 515  ? 46.962  -4.155   23.172  1.00 160.22 ? 515  HIS A CA    1 
ATOM   7534  C  C     . HIS I  4 515  ? 47.578  -3.871   24.514  1.00 167.14 ? 515  HIS A C     1 
ATOM   7535  O  O     . HIS I  4 515  ? 46.981  -3.181   25.343  1.00 172.42 ? 515  HIS A O     1 
ATOM   7536  C  CB    . HIS I  4 515  ? 45.515  -3.676   23.151  1.00 164.66 ? 515  HIS A CB    1 
ATOM   7537  C  CG    . HIS I  4 515  ? 44.846  -3.811   21.805  1.00 174.89 ? 515  HIS A CG    1 
ATOM   7538  N  ND1   . HIS I  4 515  ? 43.584  -4.246   21.668  1.00 183.31 ? 515  HIS A ND1   1 
ATOM   7539  C  CD2   . HIS I  4 515  ? 45.313  -3.547   20.516  1.00 183.04 ? 515  HIS A CD2   1 
ATOM   7540  C  CE1   . HIS I  4 515  ? 43.252  -4.253   20.361  1.00 179.28 ? 515  HIS A CE1   1 
ATOM   7541  N  NE2   . HIS I  4 515  ? 44.312  -3.827   19.658  1.00 177.40 ? 515  HIS A NE2   1 
ATOM   7542  N  N     . LYS I  4 516  ? 48.778  -4.401   24.746  1.00 165.05 ? 516  LYS A N     1 
ATOM   7543  C  CA    . LYS I  4 516  ? 49.437  -4.253   26.034  1.00 167.51 ? 516  LYS A CA    1 
ATOM   7544  C  C     . LYS I  4 516  ? 50.081  -2.873   26.146  1.00 168.16 ? 516  LYS A C     1 
ATOM   7545  O  O     . LYS I  4 516  ? 49.753  -2.104   27.050  1.00 177.70 ? 516  LYS A O     1 
ATOM   7546  C  CB    . LYS I  4 516  ? 50.467  -5.371   26.242  1.00 175.35 ? 516  LYS A CB    1 
ATOM   7547  C  CG    . LYS I  4 516  ? 49.853  -6.769   26.246  1.00 177.00 ? 516  LYS A CG    1 
ATOM   7548  C  CD    . LYS I  4 516  ? 50.819  -7.836   26.751  1.00 181.44 ? 516  LYS A CD    1 
ATOM   7549  C  CE    . LYS I  4 516  ? 51.971  -8.092   25.780  1.00 180.18 ? 516  LYS A CE    1 
ATOM   7550  N  NZ    . LYS I  4 516  ? 52.795  -9.275   26.179  1.00 174.32 ? 516  LYS A NZ    1 
ATOM   7551  N  N     . LYS I  4 517  ? 50.984  -2.560   25.222  1.00 171.79 ? 517  LYS A N     1 
ATOM   7552  C  CA    . LYS I  4 517  ? 51.606  -1.232   25.167  1.00 175.76 ? 517  LYS A CA    1 
ATOM   7553  C  C     . LYS I  4 517  ? 50.716  -0.251   24.384  1.00 173.86 ? 517  LYS A C     1 
ATOM   7554  O  O     . LYS I  4 517  ? 50.832  0.965    24.537  1.00 177.28 ? 517  LYS A O     1 
ATOM   7555  C  CB    . LYS I  4 517  ? 53.004  -1.307   24.532  1.00 175.97 ? 517  LYS A CB    1 
ATOM   7556  C  CG    . LYS I  4 517  ? 54.091  -0.557   25.294  1.00 184.69 ? 517  LYS A CG    1 
ATOM   7557  C  CD    . LYS I  4 517  ? 53.793  0.930    25.468  1.00 186.46 ? 517  LYS A CD    1 
ATOM   7558  C  CE    . LYS I  4 517  ? 54.880  1.629    26.275  1.00 185.46 ? 517  LYS A CE    1 
ATOM   7559  N  NZ    . LYS I  4 517  ? 54.455  2.995    26.708  1.00 181.37 ? 517  LYS A NZ    1 
ATOM   7560  N  N     . ALA I  4 518  ? 49.832  -0.790   23.548  1.00 166.08 ? 518  ALA A N     1 
ATOM   7561  C  CA    . ALA I  4 518  ? 48.939  0.026    22.735  1.00 161.04 ? 518  ALA A CA    1 
ATOM   7562  C  C     . ALA I  4 518  ? 47.919  0.770    23.590  1.00 165.47 ? 518  ALA A C     1 
ATOM   7563  O  O     . ALA I  4 518  ? 47.677  1.960    23.368  1.00 162.51 ? 518  ALA A O     1 
ATOM   7564  C  CB    . ALA I  4 518  ? 48.227  -0.842   21.715  1.00 163.28 ? 518  ALA A CB    1 
ATOM   7565  N  N     . GLU I  4 519  ? 47.327  0.067    24.561  1.00 162.90 ? 519  GLU A N     1 
ATOM   7566  C  CA    . GLU I  4 519  ? 46.334  0.662    25.450  1.00 155.88 ? 519  GLU A CA    1 
ATOM   7567  C  C     . GLU I  4 519  ? 46.975  1.753    26.303  1.00 158.26 ? 519  GLU A C     1 
ATOM   7568  O  O     . GLU I  4 519  ? 46.334  2.771    26.588  1.00 158.13 ? 519  GLU A O     1 
ATOM   7569  C  CB    . GLU I  4 519  ? 45.660  -0.406   26.327  1.00 156.27 ? 519  GLU A CB    1 
ATOM   7570  C  CG    . GLU I  4 519  ? 46.515  -0.997   27.458  1.00 157.40 ? 519  GLU A CG    1 
ATOM   7571  C  CD    . GLU I  4 519  ? 45.894  -2.241   28.129  1.00 149.35 ? 519  GLU A CD    1 
ATOM   7572  O  OE1   . GLU I  4 519  ? 44.648  -2.337   28.219  1.00 137.47 ? 519  GLU A OE1   1 
ATOM   7573  O  OE2   . GLU I  4 519  ? 46.649  -3.135   28.586  1.00 140.43 ? 519  GLU A OE2   1 
ATOM   7574  N  N     . GLU I  4 520  ? 48.234  1.534    26.695  1.00 157.89 ? 520  GLU A N     1 
ATOM   7575  C  CA    . GLU I  4 520  ? 49.022  2.531    27.430  1.00 159.08 ? 520  GLU A CA    1 
ATOM   7576  C  C     . GLU I  4 520  ? 49.292  3.758    26.559  1.00 156.75 ? 520  GLU A C     1 
ATOM   7577  O  O     . GLU I  4 520  ? 49.224  4.896    27.036  1.00 157.46 ? 520  GLU A O     1 
ATOM   7578  C  CB    . GLU I  4 520  ? 50.346  1.929    27.927  1.00 160.74 ? 520  GLU A CB    1 
ATOM   7579  C  CG    . GLU I  4 520  ? 50.174  0.883    29.024  1.00 160.17 ? 520  GLU A CG    1 
ATOM   7580  C  CD    . GLU I  4 520  ? 51.488  0.315    29.543  1.00 164.69 ? 520  GLU A CD    1 
ATOM   7581  O  OE1   . GLU I  4 520  ? 52.490  0.293    28.783  1.00 161.18 ? 520  GLU A OE1   1 
ATOM   7582  O  OE2   . GLU I  4 520  ? 51.505  -0.122   30.719  1.00 161.89 ? 520  GLU A OE2   1 
ATOM   7583  N  N     . LEU I  4 521  ? 49.594  3.514    25.285  1.00 151.98 ? 521  LEU A N     1 
ATOM   7584  C  CA    . LEU I  4 521  ? 49.835  4.586    24.319  1.00 148.66 ? 521  LEU A CA    1 
ATOM   7585  C  C     . LEU I  4 521  ? 48.528  5.261    23.947  1.00 143.43 ? 521  LEU A C     1 
ATOM   7586  O  O     . LEU I  4 521  ? 48.497  6.458    23.692  1.00 143.23 ? 521  LEU A O     1 
ATOM   7587  C  CB    . LEU I  4 521  ? 50.531  4.046    23.057  1.00 150.95 ? 521  LEU A CB    1 
ATOM   7588  C  CG    . LEU I  4 521  ? 52.028  3.698    23.167  1.00 151.23 ? 521  LEU A CG    1 
ATOM   7589  C  CD1   . LEU I  4 521  ? 52.485  2.763    22.054  1.00 152.59 ? 521  LEU A CD1   1 
ATOM   7590  C  CD2   . LEU I  4 521  ? 52.887  4.956    23.170  1.00 149.04 ? 521  LEU A CD2   1 
ATOM   7591  N  N     . ALA I  4 522  ? 47.455  4.481    23.918  1.00 143.24 ? 522  ALA A N     1 
ATOM   7592  C  CA    . ALA I  4 522  ? 46.134  4.993    23.581  1.00 151.07 ? 522  ALA A CA    1 
ATOM   7593  C  C     . ALA I  4 522  ? 45.550  5.864    24.691  1.00 153.48 ? 522  ALA A C     1 
ATOM   7594  O  O     . ALA I  4 522  ? 44.793  6.803    24.409  1.00 153.23 ? 522  ALA A O     1 
ATOM   7595  C  CB    . ALA I  4 522  ? 45.187  3.841    23.274  1.00 156.37 ? 522  ALA A CB    1 
ATOM   7596  N  N     . LYS I  4 523  ? 45.885  5.536    25.943  1.00 155.57 ? 523  LYS A N     1 
ATOM   7597  C  CA    . LYS I  4 523  ? 45.359  6.263    27.114  1.00 163.20 ? 523  LYS A CA    1 
ATOM   7598  C  C     . LYS I  4 523  ? 46.062  7.594    27.390  1.00 171.45 ? 523  LYS A C     1 
ATOM   7599  O  O     . LYS I  4 523  ? 45.561  8.415    28.190  1.00 163.13 ? 523  LYS A O     1 
ATOM   7600  C  CB    . LYS I  4 523  ? 45.407  5.387    28.365  1.00 160.00 ? 523  LYS A CB    1 
ATOM   7601  C  CG    . LYS I  4 523  ? 44.281  4.371    28.436  1.00 160.42 ? 523  LYS A CG    1 
ATOM   7602  C  CD    . LYS I  4 523  ? 44.504  3.394    29.577  1.00 162.62 ? 523  LYS A CD    1 
ATOM   7603  C  CE    . LYS I  4 523  ? 43.416  2.336    29.640  1.00 154.68 ? 523  LYS A CE    1 
ATOM   7604  N  NZ    . LYS I  4 523  ? 43.626  1.422    30.797  1.00 152.17 ? 523  LYS A NZ    1 
ATOM   7605  N  N     . LEU I  4 524  ? 47.211  7.795    26.734  1.00 174.71 ? 524  LEU A N     1 
ATOM   7606  C  CA    . LEU I  4 524  ? 47.923  9.080    26.759  1.00 170.02 ? 524  LEU A CA    1 
ATOM   7607  C  C     . LEU I  4 524  ? 47.163  10.187   26.017  1.00 164.82 ? 524  LEU A C     1 
ATOM   7608  O  O     . LEU I  4 524  ? 47.296  11.356   26.368  1.00 165.05 ? 524  LEU A O     1 
ATOM   7609  C  CB    . LEU I  4 524  ? 49.333  8.935    26.175  1.00 167.04 ? 524  LEU A CB    1 
ATOM   7610  C  CG    . LEU I  4 524  ? 50.344  8.178    27.036  1.00 164.57 ? 524  LEU A CG    1 
ATOM   7611  C  CD1   . LEU I  4 524  ? 51.633  7.944    26.252  1.00 171.77 ? 524  LEU A CD1   1 
ATOM   7612  C  CD2   . LEU I  4 524  ? 50.622  8.938    28.323  1.00 153.98 ? 524  LEU A CD2   1 
ATOM   7613  N  N     . ILE I  4 525  ? 46.361  9.820    25.014  1.00 162.91 ? 525  ILE A N     1 
ATOM   7614  C  CA    . ILE I  4 525  ? 45.597  10.804   24.241  1.00 162.12 ? 525  ILE A CA    1 
ATOM   7615  C  C     . ILE I  4 525  ? 44.521  11.399   25.135  1.00 144.83 ? 525  ILE A C     1 
ATOM   7616  O  O     . ILE I  4 525  ? 43.827  10.643   25.803  1.00 129.71 ? 525  ILE A O     1 
ATOM   7617  C  CB    . ILE I  4 525  ? 44.900  10.201   22.993  1.00 164.99 ? 525  ILE A CB    1 
ATOM   7618  C  CG1   . ILE I  4 525  ? 45.923  9.651    22.010  1.00 154.51 ? 525  ILE A CG1   1 
ATOM   7619  C  CG2   . ILE I  4 525  ? 44.086  11.271   22.262  1.00 172.19 ? 525  ILE A CG2   1 
ATOM   7620  C  CD1   . ILE I  4 525  ? 46.361  8.248    22.352  1.00 145.63 ? 525  ILE A CD1   1 
ATOM   7621  N  N     . PRO I  4 526  ? 44.384  12.747   25.139  1.00 141.83 ? 526  PRO A N     1 
ATOM   7622  C  CA    . PRO I  4 526  ? 43.331  13.397   25.932  1.00 140.71 ? 526  PRO A CA    1 
ATOM   7623  C  C     . PRO I  4 526  ? 41.917  13.068   25.449  1.00 140.35 ? 526  PRO A C     1 
ATOM   7624  O  O     . PRO I  4 526  ? 41.673  13.008   24.241  1.00 143.73 ? 526  PRO A O     1 
ATOM   7625  C  CB    . PRO I  4 526  ? 43.630  14.899   25.763  1.00 138.31 ? 526  PRO A CB    1 
ATOM   7626  C  CG    . PRO I  4 526  ? 45.059  14.969   25.343  1.00 140.23 ? 526  PRO A CG    1 
ATOM   7627  C  CD    . PRO I  4 526  ? 45.286  13.739   24.516  1.00 138.94 ? 526  PRO A CD    1 
ATOM   7628  N  N     . LYS I  4 533  ? 41.501  13.709   21.472  1.00 147.23 ? 533  LYS A N     1 
ATOM   7629  C  CA    . LYS I  4 533  ? 42.008  14.758   20.580  1.00 148.81 ? 533  LYS A CA    1 
ATOM   7630  C  C     . LYS I  4 533  ? 42.837  14.181   19.419  1.00 145.30 ? 533  LYS A C     1 
ATOM   7631  O  O     . LYS I  4 533  ? 43.287  13.035   19.477  1.00 144.28 ? 533  LYS A O     1 
ATOM   7632  C  CB    . LYS I  4 533  ? 42.865  15.759   21.371  1.00 157.22 ? 533  LYS A CB    1 
ATOM   7633  C  CG    . LYS I  4 533  ? 42.087  16.615   22.366  1.00 164.55 ? 533  LYS A CG    1 
ATOM   7634  C  CD    . LYS I  4 533  ? 42.981  17.614   23.090  1.00 167.76 ? 533  LYS A CD    1 
ATOM   7635  C  CE    . LYS I  4 533  ? 42.168  18.505   24.022  1.00 174.61 ? 533  LYS A CE    1 
ATOM   7636  N  NZ    . LYS I  4 533  ? 42.989  19.443   24.842  1.00 176.55 ? 533  LYS A NZ    1 
ATOM   7637  N  N     . PRO I  4 534  ? 43.050  14.982   18.359  1.00 145.68 ? 534  PRO A N     1 
ATOM   7638  C  CA    . PRO I  4 534  ? 43.972  14.562   17.293  1.00 146.02 ? 534  PRO A CA    1 
ATOM   7639  C  C     . PRO I  4 534  ? 45.428  14.459   17.756  1.00 146.03 ? 534  PRO A C     1 
ATOM   7640  O  O     . PRO I  4 534  ? 45.818  15.140   18.703  1.00 152.95 ? 534  PRO A O     1 
ATOM   7641  C  CB    . PRO I  4 534  ? 43.842  15.686   16.243  1.00 144.70 ? 534  PRO A CB    1 
ATOM   7642  C  CG    . PRO I  4 534  ? 42.557  16.381   16.551  1.00 144.31 ? 534  PRO A CG    1 
ATOM   7643  C  CD    . PRO I  4 534  ? 42.375  16.255   18.036  1.00 147.66 ? 534  PRO A CD    1 
ATOM   7644  N  N     . LEU I  4 535  ? 46.223  13.641   17.066  1.00 145.99 ? 535  LEU A N     1 
ATOM   7645  C  CA    . LEU I  4 535  ? 47.668  13.521   17.338  1.00 147.79 ? 535  LEU A CA    1 
ATOM   7646  C  C     . LEU I  4 535  ? 48.465  14.791   16.975  1.00 148.75 ? 535  LEU A C     1 
ATOM   7647  O  O     . LEU I  4 535  ? 49.631  14.917   17.357  1.00 135.68 ? 535  LEU A O     1 
ATOM   7648  C  CB    . LEU I  4 535  ? 48.265  12.318   16.587  1.00 147.93 ? 535  LEU A CB    1 
ATOM   7649  C  CG    . LEU I  4 535  ? 47.747  10.913   16.946  1.00 148.80 ? 535  LEU A CG    1 
ATOM   7650  C  CD1   . LEU I  4 535  ? 48.214  9.881    15.922  1.00 139.80 ? 535  LEU A CD1   1 
ATOM   7651  C  CD2   . LEU I  4 535  ? 48.167  10.479   18.347  1.00 143.03 ? 535  LEU A CD2   1 
ATOM   7652  N  N     . GLN I  4 536  ? 47.846  15.714   16.234  1.00 153.02 ? 536  GLN A N     1 
ATOM   7653  C  CA    . GLN I  4 536  ? 48.488  16.980   15.866  1.00 155.13 ? 536  GLN A CA    1 
ATOM   7654  C  C     . GLN I  4 536  ? 48.860  17.809   17.097  1.00 159.67 ? 536  GLN A C     1 
ATOM   7655  O  O     . GLN I  4 536  ? 49.927  18.430   17.115  1.00 172.83 ? 536  GLN A O     1 
ATOM   7656  C  CB    . GLN I  4 536  ? 47.583  17.808   14.946  1.00 154.20 ? 536  GLN A CB    1 
ATOM   7657  C  CG    . GLN I  4 536  ? 48.306  18.913   14.178  1.00 152.46 ? 536  GLN A CG    1 
ATOM   7658  C  CD    . GLN I  4 536  ? 49.039  18.401   12.951  1.00 150.54 ? 536  GLN A CD    1 
ATOM   7659  O  OE1   . GLN I  4 536  ? 49.253  17.198   12.795  1.00 148.24 ? 536  GLN A OE1   1 
ATOM   7660  N  NE2   . GLN I  4 536  ? 49.415  19.315   12.065  1.00 151.30 ? 536  GLN A NE2   1 
ATOM   7661  N  N     . GLU I  4 537  ? 47.985  17.828   18.106  1.00 152.63 ? 537  GLU A N     1 
ATOM   7662  C  CA    . GLU I  4 537  ? 48.277  18.494   19.379  1.00 146.87 ? 537  GLU A CA    1 
ATOM   7663  C  C     . GLU I  4 537  ? 48.950  17.499   20.316  1.00 140.84 ? 537  GLU A C     1 
ATOM   7664  O  O     . GLU I  4 537  ? 50.028  17.781   20.831  1.00 134.39 ? 537  GLU A O     1 
ATOM   7665  C  CB    . GLU I  4 537  ? 47.008  19.082   20.016  1.00 156.84 ? 537  GLU A CB    1 
ATOM   7666  C  CG    . GLU I  4 537  ? 46.450  20.313   19.306  1.00 165.22 ? 537  GLU A CG    1 
ATOM   7667  C  CD    . GLU I  4 537  ? 45.685  19.980   18.039  1.00 177.54 ? 537  GLU A CD    1 
ATOM   7668  O  OE1   . GLU I  4 537  ? 45.923  20.649   17.002  1.00 182.24 ? 537  GLU A OE1   1 
ATOM   7669  O  OE2   . GLU I  4 537  ? 44.842  19.051   18.093  1.00 176.50 ? 537  GLU A OE2   1 
ATOM   7670  N  N     . ALA I  4 538  ? 48.330  16.327   20.503  1.00 143.70 ? 538  ALA A N     1 
ATOM   7671  C  CA    . ALA I  4 538  ? 48.867  15.279   21.395  1.00 142.37 ? 538  ALA A CA    1 
ATOM   7672  C  C     . ALA I  4 538  ? 50.052  14.557   20.758  1.00 134.36 ? 538  ALA A C     1 
ATOM   7673  O  O     . ALA I  4 538  ? 51.179  14.609   21.276  1.00 126.57 ? 538  ALA A O     1 
ATOM   7674  C  CB    . ALA I  4 538  ? 47.783  14.272   21.790  1.00 145.15 ? 538  ALA A CB    1 
ATOM   7675  N  N     . GLU I  4 544  ? 50.045  16.539   25.243  1.00 142.67 ? 544  GLU A N     1 
ATOM   7676  C  CA    . GLU I  4 544  ? 51.430  17.020   25.274  1.00 149.40 ? 544  GLU A CA    1 
ATOM   7677  C  C     . GLU I  4 544  ? 52.480  16.015   25.759  1.00 161.75 ? 544  GLU A C     1 
ATOM   7678  O  O     . GLU I  4 544  ? 53.665  16.364   25.810  1.00 171.82 ? 544  GLU A O     1 
ATOM   7679  C  CB    . GLU I  4 544  ? 51.557  18.271   26.144  1.00 148.96 ? 544  GLU A CB    1 
ATOM   7680  C  CG    . GLU I  4 544  ? 51.192  19.565   25.452  1.00 146.88 ? 544  GLU A CG    1 
ATOM   7681  C  CD    . GLU I  4 544  ? 51.568  20.779   26.279  1.00 145.31 ? 544  GLU A CD    1 
ATOM   7682  O  OE1   . GLU I  4 544  ? 51.284  20.788   27.494  1.00 139.63 ? 544  GLU A OE1   1 
ATOM   7683  O  OE2   . GLU I  4 544  ? 52.151  21.731   25.709  1.00 158.08 ? 544  GLU A OE2   1 
ATOM   7684  N  N     . LEU I  4 545  ? 52.076  14.794   26.118  1.00 164.05 ? 545  LEU A N     1 
ATOM   7685  C  CA    . LEU I  4 545  ? 53.037  13.734   26.477  1.00 169.13 ? 545  LEU A CA    1 
ATOM   7686  C  C     . LEU I  4 545  ? 53.679  13.075   25.238  1.00 170.08 ? 545  LEU A C     1 
ATOM   7687  O  O     . LEU I  4 545  ? 53.381  11.926   24.898  1.00 169.56 ? 545  LEU A O     1 
ATOM   7688  C  CB    . LEU I  4 545  ? 52.374  12.673   27.368  1.00 169.89 ? 545  LEU A CB    1 
ATOM   7689  C  CG    . LEU I  4 545  ? 52.141  13.060   28.836  1.00 165.53 ? 545  LEU A CG    1 
ATOM   7690  C  CD1   . LEU I  4 545  ? 50.987  14.044   28.989  1.00 170.29 ? 545  LEU A CD1   1 
ATOM   7691  C  CD2   . LEU I  4 545  ? 51.876  11.815   29.667  1.00 165.98 ? 545  LEU A CD2   1 
ATOM   7692  N  N     . ARG I  4 546  ? 54.567  13.821   24.582  1.00 172.28 ? 546  ARG A N     1 
ATOM   7693  C  CA    . ARG I  4 546  ? 55.337  13.337   23.432  1.00 168.51 ? 546  ARG A CA    1 
ATOM   7694  C  C     . ARG I  4 546  ? 56.722  12.811   23.841  1.00 163.77 ? 546  ARG A C     1 
ATOM   7695  O  O     . ARG I  4 546  ? 57.452  12.282   23.002  1.00 148.42 ? 546  ARG A O     1 
ATOM   7696  C  CB    . ARG I  4 546  ? 55.504  14.456   22.400  1.00 173.41 ? 546  ARG A CB    1 
ATOM   7697  C  CG    . ARG I  4 546  ? 54.281  14.702   21.531  1.00 179.23 ? 546  ARG A CG    1 
ATOM   7698  C  CD    . ARG I  4 546  ? 54.667  15.499   20.292  1.00 188.81 ? 546  ARG A CD    1 
ATOM   7699  N  NE    . ARG I  4 546  ? 53.551  15.662   19.368  1.00 186.92 ? 546  ARG A NE    1 
ATOM   7700  C  CZ    . ARG I  4 546  ? 52.561  16.543   19.512  1.00 193.41 ? 546  ARG A CZ    1 
ATOM   7701  N  NH1   . ARG I  4 546  ? 52.508  17.363   20.559  1.00 197.08 ? 546  ARG A NH1   1 
ATOM   7702  N  NH2   . ARG I  4 546  ? 51.598  16.593   18.603  1.00 198.85 ? 546  ARG A NH2   1 
ATOM   7703  N  N     . ALA I  4 547  ? 57.074  12.958   25.122  1.00 163.88 ? 547  ALA A N     1 
ATOM   7704  C  CA    . ALA I  4 547  ? 58.350  12.463   25.649  1.00 162.72 ? 547  ALA A CA    1 
ATOM   7705  C  C     . ALA I  4 547  ? 58.481  10.925   25.511  1.00 159.59 ? 547  ALA A C     1 
ATOM   7706  O  O     . ALA I  4 547  ? 59.591  10.385   25.475  1.00 141.33 ? 547  ALA A O     1 
ATOM   7707  C  CB    . ALA I  4 547  ? 58.517  12.905   27.097  1.00 162.11 ? 547  ALA A CB    1 
ATOM   7708  N  N     . GLU I  4 548  ? 57.337  10.241   25.433  1.00 161.73 ? 548  GLU A N     1 
ATOM   7709  C  CA    . GLU I  4 548  ? 57.264  8.809    25.095  1.00 164.30 ? 548  GLU A CA    1 
ATOM   7710  C  C     . GLU I  4 548  ? 57.806  8.467    23.687  1.00 158.16 ? 548  GLU A C     1 
ATOM   7711  O  O     . GLU I  4 548  ? 58.173  7.321    23.411  1.00 152.31 ? 548  GLU A O     1 
ATOM   7712  C  CB    . GLU I  4 548  ? 55.800  8.339    25.198  1.00 161.82 ? 548  GLU A CB    1 
ATOM   7713  C  CG    . GLU I  4 548  ? 55.549  6.870    24.873  1.00 153.86 ? 548  GLU A CG    1 
ATOM   7714  C  CD    . GLU I  4 548  ? 56.245  5.938    25.829  1.00 151.11 ? 548  GLU A CD    1 
ATOM   7715  O  OE1   . GLU I  4 548  ? 56.319  6.267    27.031  1.00 152.31 ? 548  GLU A OE1   1 
ATOM   7716  O  OE2   . GLU I  4 548  ? 56.711  4.876    25.377  1.00 155.08 ? 548  GLU A OE2   1 
ATOM   7717  N  N     . MET I  4 549  ? 57.817  9.447    22.792  1.00 160.43 ? 549  MET A N     1 
ATOM   7718  C  CA    . MET I  4 549  ? 58.318  9.239    21.432  1.00 169.09 ? 549  MET A CA    1 
ATOM   7719  C  C     . MET I  4 549  ? 59.862  9.121    21.366  1.00 162.04 ? 549  MET A C     1 
ATOM   7720  O  O     . MET I  4 549  ? 60.404  8.364    20.555  1.00 143.97 ? 549  MET A O     1 
ATOM   7721  C  CB    . MET I  4 549  ? 57.817  10.366   20.516  1.00 173.08 ? 549  MET A CB    1 
ATOM   7722  C  CG    . MET I  4 549  ? 57.973  10.075   19.037  1.00 176.73 ? 549  MET A CG    1 
ATOM   7723  S  SD    . MET I  4 549  ? 56.906  11.118   18.012  1.00 191.07 ? 549  MET A SD    1 
ATOM   7724  C  CE    . MET I  4 549  ? 57.506  10.677   16.370  1.00 176.77 ? 549  MET A CE    1 
ATOM   7725  N  N     . GLU I  4 550  ? 60.556  9.867    22.226  1.00 160.25 ? 550  GLU A N     1 
ATOM   7726  C  CA    . GLU I  4 550  ? 62.022  9.908    22.216  1.00 158.22 ? 550  GLU A CA    1 
ATOM   7727  C  C     . GLU I  4 550  ? 62.642  8.636    22.786  1.00 161.91 ? 550  GLU A C     1 
ATOM   7728  O  O     . GLU I  4 550  ? 63.790  8.302    22.458  1.00 160.05 ? 550  GLU A O     1 
ATOM   7729  C  CB    . GLU I  4 550  ? 62.546  11.137   22.984  1.00 155.70 ? 550  GLU A CB    1 
ATOM   7730  C  CG    . GLU I  4 550  ? 62.631  12.421   22.160  1.00 157.85 ? 550  GLU A CG    1 
ATOM   7731  C  CD    . GLU I  4 550  ? 61.280  13.040   21.819  1.00 157.89 ? 550  GLU A CD    1 
ATOM   7732  O  OE1   . GLU I  4 550  ? 60.266  12.652   22.434  1.00 164.68 ? 550  GLU A OE1   1 
ATOM   7733  O  OE2   . GLU I  4 550  ? 61.230  13.933   20.942  1.00 153.37 ? 550  GLU A OE2   1 
ATOM   7734  N  N     . LYS I  4 551  ? 61.882  7.924    23.621  1.00 167.25 ? 551  LYS A N     1 
ATOM   7735  C  CA    . LYS I  4 551  ? 62.376  6.708    24.274  1.00 174.07 ? 551  LYS A CA    1 
ATOM   7736  C  C     . LYS I  4 551  ? 62.781  5.650    23.228  1.00 180.78 ? 551  LYS A C     1 
ATOM   7737  O  O     . LYS I  4 551  ? 63.974  5.443    22.969  1.00 175.30 ? 551  LYS A O     1 
ATOM   7738  C  CB    . LYS I  4 551  ? 61.332  6.144    25.256  1.00 175.24 ? 551  LYS A CB    1 
ATOM   7739  C  CG    . LYS I  4 551  ? 61.009  7.063    26.426  1.00 179.79 ? 551  LYS A CG    1 
ATOM   7740  C  CD    . LYS I  4 551  ? 59.856  6.544    27.279  1.00 178.80 ? 551  LYS A CD    1 
ATOM   7741  C  CE    . LYS I  4 551  ? 59.436  7.573    28.323  1.00 180.09 ? 551  LYS A CE    1 
ATOM   7742  N  NZ    . LYS I  4 551  ? 58.292  7.108    29.153  1.00 185.12 ? 551  LYS A NZ    1 
ATOM   7743  N  N     . ASP I  4 552  ? 61.792  5.026    22.588  1.00 184.86 ? 552  ASP A N     1 
ATOM   7744  C  CA    . ASP I  4 552  ? 62.060  3.926    21.665  1.00 189.73 ? 552  ASP A CA    1 
ATOM   7745  C  C     . ASP I  4 552  ? 61.963  4.406    20.209  1.00 188.26 ? 552  ASP A C     1 
ATOM   7746  O  O     . ASP I  4 552  ? 61.251  5.369    19.895  1.00 174.83 ? 552  ASP A O     1 
ATOM   7747  C  CB    . ASP I  4 552  ? 61.103  2.749    21.953  1.00 190.62 ? 552  ASP A CB    1 
ATOM   7748  C  CG    . ASP I  4 552  ? 61.538  1.425    21.282  1.00 189.85 ? 552  ASP A CG    1 
ATOM   7749  O  OD1   . ASP I  4 552  ? 62.693  1.306    20.785  1.00 172.76 ? 552  ASP A OD1   1 
ATOM   7750  O  OD2   . ASP I  4 552  ? 60.706  0.490    21.267  1.00 185.09 ? 552  ASP A OD2   1 
ATOM   7751  N  N     . GLU I  4 553  ? 62.705  3.727    19.335  1.00 187.78 ? 553  GLU A N     1 
ATOM   7752  C  CA    . GLU I  4 553  ? 62.743  4.041    17.907  1.00 180.55 ? 553  GLU A CA    1 
ATOM   7753  C  C     . GLU I  4 553  ? 61.562  3.413    17.150  1.00 174.37 ? 553  GLU A C     1 
ATOM   7754  O  O     . GLU I  4 553  ? 61.131  3.942    16.127  1.00 167.67 ? 553  GLU A O     1 
ATOM   7755  C  CB    . GLU I  4 553  ? 64.074  3.556    17.313  1.00 183.44 ? 553  GLU A CB    1 
ATOM   7756  C  CG    . GLU I  4 553  ? 64.458  4.207    15.995  1.00 185.72 ? 553  GLU A CG    1 
ATOM   7757  C  CD    . GLU I  4 553  ? 64.850  5.674    16.130  1.00 185.48 ? 553  GLU A CD    1 
ATOM   7758  O  OE1   . GLU I  4 553  ? 65.045  6.161    17.269  1.00 169.95 ? 553  GLU A OE1   1 
ATOM   7759  O  OE2   . GLU I  4 553  ? 64.970  6.347    15.081  1.00 188.17 ? 553  GLU A OE2   1 
ATOM   7760  N  N     . ARG I  4 554  ? 61.047  2.293    17.657  1.00 168.19 ? 554  ARG A N     1 
ATOM   7761  C  CA    . ARG I  4 554  ? 59.900  1.619    17.045  1.00 167.17 ? 554  ARG A CA    1 
ATOM   7762  C  C     . ARG I  4 554  ? 58.655  2.526    17.042  1.00 159.60 ? 554  ARG A C     1 
ATOM   7763  O  O     . ARG I  4 554  ? 58.020  2.728    16.004  1.00 155.04 ? 554  ARG A O     1 
ATOM   7764  C  CB    . ARG I  4 554  ? 59.607  0.281    17.766  1.00 171.73 ? 554  ARG A CB    1 
ATOM   7765  C  CG    . ARG I  4 554  ? 60.379  -0.932   17.240  1.00 167.75 ? 554  ARG A CG    1 
ATOM   7766  C  CD    . ARG I  4 554  ? 59.606  -1.659   16.145  1.00 169.02 ? 554  ARG A CD    1 
ATOM   7767  N  NE    . ARG I  4 554  ? 60.331  -2.806   15.586  1.00 170.85 ? 554  ARG A NE    1 
ATOM   7768  C  CZ    . ARG I  4 554  ? 59.810  -3.707   14.745  1.00 172.58 ? 554  ARG A CZ    1 
ATOM   7769  N  NH1   . ARG I  4 554  ? 58.544  -3.626   14.347  1.00 183.35 ? 554  ARG A NH1   1 
ATOM   7770  N  NH2   . ARG I  4 554  ? 60.554  -4.708   14.296  1.00 170.76 ? 554  ARG A NH2   1 
ATOM   7771  N  N     . ILE I  4 555  ? 58.335  3.091    18.204  1.00 160.06 ? 555  ILE A N     1 
ATOM   7772  C  CA    . ILE I  4 555  ? 57.103  3.880    18.383  1.00 164.03 ? 555  ILE A CA    1 
ATOM   7773  C  C     . ILE I  4 555  ? 57.107  5.281    17.737  1.00 168.10 ? 555  ILE A C     1 
ATOM   7774  O  O     . ILE I  4 555  ? 56.104  6.013    17.834  1.00 151.58 ? 555  ILE A O     1 
ATOM   7775  C  CB    . ILE I  4 555  ? 56.712  4.013    19.876  1.00 162.26 ? 555  ILE A CB    1 
ATOM   7776  C  CG1   . ILE I  4 555  ? 57.824  4.663    20.706  1.00 172.05 ? 555  ILE A CG1   1 
ATOM   7777  C  CG2   . ILE I  4 555  ? 56.384  2.648    20.447  1.00 163.76 ? 555  ILE A CG2   1 
ATOM   7778  C  CD1   . ILE I  4 555  ? 58.160  6.081    20.311  1.00 183.40 ? 555  ILE A CD1   1 
ATOM   7779  N  N     . ARG I  4 556  ? 58.223  5.661    17.104  1.00 165.85 ? 556  ARG A N     1 
ATOM   7780  C  CA    . ARG I  4 556  ? 58.281  6.913    16.362  1.00 157.15 ? 556  ARG A CA    1 
ATOM   7781  C  C     . ARG I  4 556  ? 57.440  6.784    15.092  1.00 151.21 ? 556  ARG A C     1 
ATOM   7782  O  O     . ARG I  4 556  ? 56.711  7.702    14.730  1.00 149.08 ? 556  ARG A O     1 
ATOM   7783  C  CB    . ARG I  4 556  ? 59.730  7.309    16.041  1.00 162.98 ? 556  ARG A CB    1 
ATOM   7784  C  CG    . ARG I  4 556  ? 60.361  6.570    14.866  1.00 174.97 ? 556  ARG A CG    1 
ATOM   7785  C  CD    . ARG I  4 556  ? 61.782  7.034    14.574  1.00 180.29 ? 556  ARG A CD    1 
ATOM   7786  N  NE    . ARG I  4 556  ? 61.819  8.117    13.585  1.00 185.41 ? 556  ARG A NE    1 
ATOM   7787  C  CZ    . ARG I  4 556  ? 62.917  8.548    12.959  1.00 185.86 ? 556  ARG A CZ    1 
ATOM   7788  N  NH1   . ARG I  4 556  ? 64.107  8.000    13.203  1.00 182.10 ? 556  ARG A NH1   1 
ATOM   7789  N  NH2   . ARG I  4 556  ? 62.827  9.538    12.075  1.00 183.74 ? 556  ARG A NH2   1 
ATOM   7790  N  N     . GLN I  4 557  ? 57.536  5.632    14.431  1.00 149.77 ? 557  GLN A N     1 
ATOM   7791  C  CA    . GLN I  4 557  ? 56.831  5.399    13.173  1.00 147.55 ? 557  GLN A CA    1 
ATOM   7792  C  C     . GLN I  4 557  ? 55.365  5.111    13.392  1.00 144.24 ? 557  GLN A C     1 
ATOM   7793  O  O     . GLN I  4 557  ? 54.530  5.504    12.580  1.00 147.48 ? 557  GLN A O     1 
ATOM   7794  C  CB    . GLN I  4 557  ? 57.457  4.238    12.406  1.00 145.74 ? 557  GLN A CB    1 
ATOM   7795  C  CG    . GLN I  4 557  ? 58.882  4.503    11.958  1.00 143.01 ? 557  GLN A CG    1 
ATOM   7796  C  CD    . GLN I  4 557  ? 59.370  3.473    10.963  1.00 144.87 ? 557  GLN A CD    1 
ATOM   7797  O  OE1   . GLN I  4 557  ? 58.719  3.218    9.948   1.00 141.60 ? 557  GLN A OE1   1 
ATOM   7798  N  NE2   . GLN I  4 557  ? 60.526  2.877    11.244  1.00 155.63 ? 557  GLN A NE2   1 
ATOM   7799  N  N     . VAL I  4 558  ? 55.060  4.418    14.485  1.00 142.71 ? 558  VAL A N     1 
ATOM   7800  C  CA    . VAL I  4 558  ? 53.672  4.083    14.831  1.00 139.06 ? 558  VAL A CA    1 
ATOM   7801  C  C     . VAL I  4 558  ? 52.810  5.346    14.948  1.00 136.16 ? 558  VAL A C     1 
ATOM   7802  O  O     . VAL I  4 558  ? 51.742  5.433    14.354  1.00 136.12 ? 558  VAL A O     1 
ATOM   7803  C  CB    . VAL I  4 558  ? 53.607  3.267    16.138  1.00 136.30 ? 558  VAL A CB    1 
ATOM   7804  C  CG1   . VAL I  4 558  ? 52.163  2.930    16.482  1.00 134.68 ? 558  VAL A CG1   1 
ATOM   7805  C  CG2   . VAL I  4 558  ? 54.452  2.001    16.012  1.00 134.70 ? 558  VAL A CG2   1 
ATOM   7806  N  N     . ILE I  4 559  ? 53.308  6.331    15.684  1.00 137.28 ? 559  ILE A N     1 
ATOM   7807  C  CA    . ILE I  4 559  ? 52.611  7.595    15.870  1.00 137.08 ? 559  ILE A CA    1 
ATOM   7808  C  C     . ILE I  4 559  ? 52.582  8.395    14.562  1.00 138.92 ? 559  ILE A C     1 
ATOM   7809  O  O     . ILE I  4 559  ? 51.514  8.833    14.124  1.00 137.45 ? 559  ILE A O     1 
ATOM   7810  C  CB    . ILE I  4 559  ? 53.283  8.427    16.996  1.00 144.36 ? 559  ILE A CB    1 
ATOM   7811  C  CG1   . ILE I  4 559  ? 53.148  7.702    18.336  1.00 145.06 ? 559  ILE A CG1   1 
ATOM   7812  C  CG2   . ILE I  4 559  ? 52.684  9.829    17.104  1.00 146.27 ? 559  ILE A CG2   1 
ATOM   7813  C  CD1   . ILE I  4 559  ? 53.668  8.500    19.515  1.00 146.10 ? 559  ILE A CD1   1 
ATOM   7814  N  N     . GLU I  4 560  ? 53.754  8.575    13.946  1.00 142.04 ? 560  GLU A N     1 
ATOM   7815  C  CA    . GLU I  4 560  ? 53.892  9.337    12.693  1.00 139.91 ? 560  GLU A CA    1 
ATOM   7816  C  C     . GLU I  4 560  ? 53.026  8.777    11.556  1.00 135.84 ? 560  GLU A C     1 
ATOM   7817  O  O     . GLU I  4 560  ? 52.395  9.533    10.813  1.00 135.63 ? 560  GLU A O     1 
ATOM   7818  C  CB    . GLU I  4 560  ? 55.360  9.400    12.262  1.00 146.88 ? 560  GLU A CB    1 
ATOM   7819  C  CG    . GLU I  4 560  ? 56.174  10.367   13.111  1.00 157.53 ? 560  GLU A CG    1 
ATOM   7820  C  CD    . GLU I  4 560  ? 57.682  10.255   12.934  1.00 164.12 ? 560  GLU A CD    1 
ATOM   7821  O  OE1   . GLU I  4 560  ? 58.168  9.281    12.312  1.00 175.12 ? 560  GLU A OE1   1 
ATOM   7822  O  OE2   . GLU I  4 560  ? 58.386  11.154   13.445  1.00 162.84 ? 560  GLU A OE2   1 
ATOM   7823  N  N     . VAL I  4 561  ? 52.985  7.457    11.433  1.00 126.26 ? 561  VAL A N     1 
ATOM   7824  C  CA    . VAL I  4 561  ? 52.071  6.821    10.508  1.00 125.31 ? 561  VAL A CA    1 
ATOM   7825  C  C     . VAL I  4 561  ? 50.613  7.010    10.957  1.00 133.31 ? 561  VAL A C     1 
ATOM   7826  O  O     . VAL I  4 561  ? 49.741  7.318    10.129  1.00 143.22 ? 561  VAL A O     1 
ATOM   7827  C  CB    . VAL I  4 561  ? 52.399  5.324    10.367  1.00 124.05 ? 561  VAL A CB    1 
ATOM   7828  C  CG1   . VAL I  4 561  ? 51.369  4.602    9.501   1.00 120.12 ? 561  VAL A CG1   1 
ATOM   7829  C  CG2   . VAL I  4 561  ? 53.803  5.163    9.814   1.00 124.51 ? 561  VAL A CG2   1 
ATOM   7830  N  N     . ALA I  4 562  ? 50.346  6.847    12.259  1.00 127.87 ? 562  ALA A N     1 
ATOM   7831  C  CA    . ALA I  4 562  ? 48.979  6.967    12.767  1.00 125.85 ? 562  ALA A CA    1 
ATOM   7832  C  C     . ALA I  4 562  ? 48.397  8.351    12.457  1.00 126.88 ? 562  ALA A C     1 
ATOM   7833  O  O     . ALA I  4 562  ? 47.287  8.466    11.939  1.00 129.98 ? 562  ALA A O     1 
ATOM   7834  C  CB    . ALA I  4 562  ? 48.920  6.679    14.256  1.00 125.19 ? 562  ALA A CB    1 
ATOM   7835  N  N     . MET I  4 563  ? 49.156  9.400    12.738  1.00 125.94 ? 563  MET A N     1 
ATOM   7836  C  CA    . MET I  4 563  ? 48.688  10.752   12.461  1.00 129.43 ? 563  MET A CA    1 
ATOM   7837  C  C     . MET I  4 563  ? 48.583  11.053   10.955  1.00 130.32 ? 563  MET A C     1 
ATOM   7838  O  O     . MET I  4 563  ? 47.890  11.981   10.537  1.00 129.93 ? 563  MET A O     1 
ATOM   7839  C  CB    . MET I  4 563  ? 49.596  11.762   13.138  1.00 131.93 ? 563  MET A CB    1 
ATOM   7840  C  CG    . MET I  4 563  ? 50.976  11.843   12.530  1.00 139.94 ? 563  MET A CG    1 
ATOM   7841  S  SD    . MET I  4 563  ? 51.946  13.110   13.354  1.00 156.61 ? 563  MET A SD    1 
ATOM   7842  C  CE    . MET I  4 563  ? 52.010  12.415   15.008  1.00 142.38 ? 563  MET A CE    1 
ATOM   7843  N  N     . ARG I  4 564  ? 49.288  10.282   10.142  1.00 131.07 ? 564  ARG A N     1 
ATOM   7844  C  CA    . ARG I  4 564  ? 49.146  10.384   8.704   1.00 133.18 ? 564  ARG A CA    1 
ATOM   7845  C  C     . ARG I  4 564  ? 47.876  9.657    8.232   1.00 132.09 ? 564  ARG A C     1 
ATOM   7846  O  O     . ARG I  4 564  ? 47.342  9.965    7.173   1.00 131.55 ? 564  ARG A O     1 
ATOM   7847  C  CB    . ARG I  4 564  ? 50.382  9.801    8.018   1.00 141.74 ? 564  ARG A CB    1 
ATOM   7848  C  CG    . ARG I  4 564  ? 50.665  10.386   6.642   1.00 148.02 ? 564  ARG A CG    1 
ATOM   7849  C  CD    . ARG I  4 564  ? 51.414  11.712   6.733   1.00 145.77 ? 564  ARG A CD    1 
ATOM   7850  N  NE    . ARG I  4 564  ? 51.294  12.497   5.500   1.00 154.24 ? 564  ARG A NE    1 
ATOM   7851  C  CZ    . ARG I  4 564  ? 51.952  13.630   5.237   1.00 162.72 ? 564  ARG A CZ    1 
ATOM   7852  N  NH1   . ARG I  4 564  ? 52.813  14.143   6.111   1.00 172.05 ? 564  ARG A NH1   1 
ATOM   7853  N  NH2   . ARG I  4 564  ? 51.757  14.256   4.080   1.00 157.47 ? 564  ARG A NH2   1 
ATOM   7854  N  N     . LEU I  4 565  ? 47.400  8.696    9.020   1.00 130.31 ? 565  LEU A N     1 
ATOM   7855  C  CA    . LEU I  4 565  ? 46.195  7.947    8.686   1.00 129.39 ? 565  LEU A CA    1 
ATOM   7856  C  C     . LEU I  4 565  ? 45.023  8.362    9.576   1.00 132.16 ? 565  LEU A C     1 
ATOM   7857  O  O     . LEU I  4 565  ? 44.067  7.603    9.767   1.00 146.25 ? 565  LEU A O     1 
ATOM   7858  C  CB    . LEU I  4 565  ? 46.474  6.444    8.855   1.00 134.70 ? 565  LEU A CB    1 
ATOM   7859  C  CG    . LEU I  4 565  ? 47.261  5.688    7.785   1.00 137.04 ? 565  LEU A CG    1 
ATOM   7860  C  CD1   . LEU I  4 565  ? 48.649  6.278    7.602   1.00 141.83 ? 565  LEU A CD1   1 
ATOM   7861  C  CD2   . LEU I  4 565  ? 47.352  4.222    8.187   1.00 132.94 ? 565  LEU A CD2   1 
ATOM   7862  N  N     . GLU I  4 566  ? 45.079  9.571    10.118  1.00 131.30 ? 566  GLU A N     1 
ATOM   7863  C  CA    . GLU I  4 566  ? 44.126  9.986    11.137  1.00 129.73 ? 566  GLU A CA    1 
ATOM   7864  C  C     . GLU I  4 566  ? 42.759  10.374   10.551  1.00 134.02 ? 566  GLU A C     1 
ATOM   7865  O  O     . GLU I  4 566  ? 41.744  9.703    10.797  1.00 142.46 ? 566  GLU A O     1 
ATOM   7866  C  CB    . GLU I  4 566  ? 44.717  11.132   11.949  1.00 128.21 ? 566  GLU A CB    1 
ATOM   7867  C  CG    . GLU I  4 566  ? 43.973  11.408   13.244  1.00 134.36 ? 566  GLU A CG    1 
ATOM   7868  C  CD    . GLU I  4 566  ? 44.671  12.445   14.089  1.00 133.11 ? 566  GLU A CD    1 
ATOM   7869  O  OE1   . GLU I  4 566  ? 44.921  13.552   13.567  1.00 138.19 ? 566  GLU A OE1   1 
ATOM   7870  O  OE2   . GLU I  4 566  ? 44.964  12.154   15.268  1.00 130.41 ? 566  GLU A OE2   1 
ATOM   7871  N  N     . GLY I  4 567  ? 42.739  11.439   9.755   1.00 134.83 ? 567  GLY A N     1 
ATOM   7872  C  CA    . GLY I  4 567  ? 41.487  11.989   9.227   1.00 132.41 ? 567  GLY A CA    1 
ATOM   7873  C  C     . GLY I  4 567  ? 40.869  11.204   8.083   1.00 125.72 ? 567  GLY A C     1 
ATOM   7874  O  O     . GLY I  4 567  ? 39.765  11.521   7.641   1.00 117.79 ? 567  GLY A O     1 
ATOM   7875  N  N     . LEU I  4 568  ? 41.570  10.175   7.612   1.00 128.99 ? 568  LEU A N     1 
ATOM   7876  C  CA    . LEU I  4 568  ? 41.144  9.433    6.430   1.00 136.81 ? 568  LEU A CA    1 
ATOM   7877  C  C     . LEU I  4 568  ? 39.920  8.597    6.740   1.00 141.18 ? 568  LEU A C     1 
ATOM   7878  O  O     . LEU I  4 568  ? 39.796  8.053    7.827   1.00 152.81 ? 568  LEU A O     1 
ATOM   7879  C  CB    . LEU I  4 568  ? 42.255  8.508    5.929   1.00 132.27 ? 568  LEU A CB    1 
ATOM   7880  C  CG    . LEU I  4 568  ? 43.608  9.132    5.623   1.00 133.30 ? 568  LEU A CG    1 
ATOM   7881  C  CD1   . LEU I  4 568  ? 44.582  8.017    5.309   1.00 136.84 ? 568  LEU A CD1   1 
ATOM   7882  C  CD2   . LEU I  4 568  ? 43.524  10.117   4.469   1.00 142.48 ? 568  LEU A CD2   1 
ATOM   7883  N  N     . ASN I  4 569  ? 39.018  8.506    5.777   1.00 141.56 ? 569  ASN A N     1 
ATOM   7884  C  CA    . ASN I  4 569  ? 37.932  7.552    5.842   1.00 145.08 ? 569  ASN A CA    1 
ATOM   7885  C  C     . ASN I  4 569  ? 38.542  6.194    5.537   1.00 142.33 ? 569  ASN A C     1 
ATOM   7886  O  O     . ASN I  4 569  ? 39.307  6.101    4.579   1.00 147.02 ? 569  ASN A O     1 
ATOM   7887  C  CB    . ASN I  4 569  ? 36.858  7.925    4.821   1.00 150.86 ? 569  ASN A CB    1 
ATOM   7888  C  CG    . ASN I  4 569  ? 36.404  9.368    4.971   1.00 148.78 ? 569  ASN A CG    1 
ATOM   7889  O  OD1   . ASN I  4 569  ? 36.714  10.014   5.969   1.00 132.76 ? 569  ASN A OD1   1 
ATOM   7890  N  ND2   . ASN I  4 569  ? 35.690  9.884    3.975   1.00 155.96 ? 569  ASN A ND2   1 
ATOM   7891  N  N     . ARG I  4 570  ? 38.261  5.135    6.298   1.00 145.72 ? 570  ARG A N     1 
ATOM   7892  C  CA    . ARG I  4 570  ? 37.311  5.048    7.426   1.00 149.61 ? 570  ARG A CA    1 
ATOM   7893  C  C     . ARG I  4 570  ? 35.825  5.001    7.033   1.00 144.94 ? 570  ARG A C     1 
ATOM   7894  O  O     . ARG I  4 570  ? 34.957  5.028    7.904   1.00 148.80 ? 570  ARG A O     1 
ATOM   7895  C  CB    . ARG I  4 570  ? 37.607  6.088    8.540   1.00 153.62 ? 570  ARG A CB    1 
ATOM   7896  C  CG    . ARG I  4 570  ? 36.891  5.877    9.874   1.00 161.90 ? 570  ARG A CG    1 
ATOM   7897  C  CD    . ARG I  4 570  ? 37.212  4.531    10.526  1.00 172.54 ? 570  ARG A CD    1 
ATOM   7898  N  NE    . ARG I  4 570  ? 38.611  4.445    10.970  1.00 166.86 ? 570  ARG A NE    1 
ATOM   7899  C  CZ    . ARG I  4 570  ? 39.076  4.894    12.140  1.00 161.71 ? 570  ARG A CZ    1 
ATOM   7900  N  NH1   . ARG I  4 570  ? 38.273  5.481    13.031  1.00 169.80 ? 570  ARG A NH1   1 
ATOM   7901  N  NH2   . ARG I  4 570  ? 40.359  4.754    12.428  1.00 151.26 ? 570  ARG A NH2   1 
ATOM   7902  N  N     . HIS I  4 571  ? 35.563  4.875    5.752   1.00 146.76 ? 571  HIS A N     1 
ATOM   7903  C  CA    . HIS I  4 571  ? 34.407  4.158    5.306   1.00 154.80 ? 571  HIS A CA    1 
ATOM   7904  C  C     . HIS I  4 571  ? 33.089  4.856    5.463   1.00 154.35 ? 571  HIS A C     1 
ATOM   7905  O  O     . HIS I  4 571  ? 33.043  6.063    5.604   1.00 150.77 ? 571  HIS A O     1 
ATOM   7906  C  CB    . HIS I  4 571  ? 34.367  2.864    6.088   1.00 154.45 ? 571  HIS A CB    1 
ATOM   7907  C  CG    . HIS I  4 571  ? 35.464  1.937    5.724   1.00 160.62 ? 571  HIS A CG    1 
ATOM   7908  N  ND1   . HIS I  4 571  ? 36.141  2.038    4.536   1.00 154.97 ? 571  HIS A ND1   1 
ATOM   7909  C  CD2   . HIS I  4 571  ? 36.013  0.900    6.388   1.00 160.00 ? 571  HIS A CD2   1 
ATOM   7910  C  CE1   . HIS I  4 571  ? 37.059  1.097    4.478   1.00 148.00 ? 571  HIS A CE1   1 
ATOM   7911  N  NE2   . HIS I  4 571  ? 37.003  0.393    5.590   1.00 152.78 ? 571  HIS A NE2   1 
ATOM   7912  N  N     . ALA I  4 572  ? 32.036  4.031    5.406   1.00 153.93 ? 572  ALA A N     1 
ATOM   7913  C  CA    . ALA I  4 572  ? 30.650  4.347    5.749   1.00 146.42 ? 572  ALA A CA    1 
ATOM   7914  C  C     . ALA I  4 572  ? 30.065  5.039    4.595   1.00 154.40 ? 572  ALA A C     1 
ATOM   7915  O  O     . ALA I  4 572  ? 30.792  5.240    3.650   1.00 154.33 ? 572  ALA A O     1 
ATOM   7916  C  CB    . ALA I  4 572  ? 30.593  5.247    6.953   1.00 147.70 ? 572  ALA A CB    1 
ATOM   7917  N  N     . SER I  4 573  ? 28.821  5.530    4.666   1.00 151.44 ? 573  SER A N     1 
ATOM   7918  C  CA    . SER I  4 573  ? 27.679  5.072    5.456   1.00 149.52 ? 573  SER A CA    1 
ATOM   7919  C  C     . SER I  4 573  ? 26.537  6.064    5.489   1.00 145.50 ? 573  SER A C     1 
ATOM   7920  O  O     . SER I  4 573  ? 26.566  7.062    4.805   1.00 132.05 ? 573  SER A O     1 
ATOM   7921  C  CB    . SER I  4 573  ? 28.022  4.681    6.860   1.00 153.67 ? 573  SER A CB    1 
ATOM   7922  O  OG    . SER I  4 573  ? 27.104  3.710    7.290   1.00 163.65 ? 573  SER A OG    1 
ATOM   7923  N  N     . VAL I  4 574  ? 25.552  5.802    6.336   1.00 139.97 ? 574  VAL A N     1 
ATOM   7924  C  CA    . VAL I  4 574  ? 24.278  6.490    6.278   1.00 138.10 ? 574  VAL A CA    1 
ATOM   7925  C  C     . VAL I  4 574  ? 23.905  7.299    7.483   1.00 138.13 ? 574  VAL A C     1 
ATOM   7926  O  O     . VAL I  4 574  ? 24.438  7.112    8.550   1.00 146.03 ? 574  VAL A O     1 
ATOM   7927  C  CB    . VAL I  4 574  ? 23.150  5.510    6.090   1.00 136.38 ? 574  VAL A CB    1 
ATOM   7928  C  CG1   . VAL I  4 574  ? 21.875  6.248    5.768   1.00 128.56 ? 574  VAL A CG1   1 
ATOM   7929  C  CG2   . VAL I  4 574  ? 23.504  4.574    4.978   1.00 135.53 ? 574  VAL A CG2   1 
ATOM   7930  N  N     . HIS I  4 575  ? 22.977  8.219    7.298   1.00 143.18 ? 575  HIS A N     1 
ATOM   7931  C  CA    . HIS I  4 575  ? 22.586  9.075    8.384   1.00 145.46 ? 575  HIS A CA    1 
ATOM   7932  C  C     . HIS I  4 575  ? 21.290  8.679    9.025   1.00 147.14 ? 575  HIS A C     1 
ATOM   7933  O  O     . HIS I  4 575  ? 20.318  8.409    8.355   1.00 150.21 ? 575  HIS A O     1 
ATOM   7934  C  CB    . HIS I  4 575  ? 22.488  10.510   7.950   1.00 142.87 ? 575  HIS A CB    1 
ATOM   7935  C  CG    . HIS I  4 575  ? 22.707  11.451   9.074   1.00 140.35 ? 575  HIS A CG    1 
ATOM   7936  N  ND1   . HIS I  4 575  ? 23.883  11.481   9.780   1.00 136.51 ? 575  HIS A ND1   1 
ATOM   7937  C  CD2   . HIS I  4 575  ? 21.886  12.338   9.666   1.00 139.47 ? 575  HIS A CD2   1 
ATOM   7938  C  CE1   . HIS I  4 575  ? 23.790  12.375   10.741  1.00 141.05 ? 575  HIS A CE1   1 
ATOM   7939  N  NE2   . HIS I  4 575  ? 22.587  12.908   10.694  1.00 141.57 ? 575  HIS A NE2   1 
ATOM   7940  N  N     . ALA I  4 576  ? 21.287  8.640    10.342  1.00 139.47 ? 576  ALA A N     1 
ATOM   7941  C  CA    . ALA I  4 576  ? 20.116  8.151    11.063  1.00 130.95 ? 576  ALA A CA    1 
ATOM   7942  C  C     . ALA I  4 576  ? 18.836  8.867    10.641  1.00 136.15 ? 576  ALA A C     1 
ATOM   7943  O  O     . ALA I  4 576  ? 17.828  8.219    10.365  1.00 142.00 ? 576  ALA A O     1 
ATOM   7944  C  CB    . ALA I  4 576  ? 20.329  8.318    12.550  1.00 121.96 ? 576  ALA A CB    1 
ATOM   7945  N  N     . ALA I  4 577  ? 18.888  10.201   10.599  1.00 138.64 ? 577  ALA A N     1 
ATOM   7946  C  CA    . ALA I  4 577  ? 17.709  11.045   10.333  1.00 136.89 ? 577  ALA A CA    1 
ATOM   7947  C  C     . ALA I  4 577  ? 17.733  11.744   8.978   1.00 138.44 ? 577  ALA A C     1 
ATOM   7948  O  O     . ALA I  4 577  ? 16.764  12.404   8.597   1.00 133.60 ? 577  ALA A O     1 
ATOM   7949  C  CB    . ALA I  4 577  ? 17.581  12.095   11.422  1.00 132.23 ? 577  ALA A CB    1 
ATOM   7950  N  N     . GLY I  4 578  ? 18.840  11.613   8.255   1.00 142.39 ? 578  GLY A N     1 
ATOM   7951  C  CA    . GLY I  4 578  ? 19.054  12.386   7.032   1.00 135.56 ? 578  GLY A CA    1 
ATOM   7952  C  C     . GLY I  4 578  ? 18.121  11.994   5.904   1.00 130.95 ? 578  GLY A C     1 
ATOM   7953  O  O     . GLY I  4 578  ? 18.122  10.850   5.455   1.00 138.86 ? 578  GLY A O     1 
ATOM   7954  N  N     . VAL I  4 579  ? 17.302  12.938   5.462   1.00 122.04 ? 579  VAL A N     1 
ATOM   7955  C  CA    . VAL I  4 579  ? 16.442  12.726   4.307   1.00 116.28 ? 579  VAL A CA    1 
ATOM   7956  C  C     . VAL I  4 579  ? 16.418  13.969   3.410   1.00 117.41 ? 579  VAL A C     1 
ATOM   7957  O  O     . VAL I  4 579  ? 16.346  15.097   3.889   1.00 114.96 ? 579  VAL A O     1 
ATOM   7958  C  CB    . VAL I  4 579  ? 15.024  12.394   4.737   1.00 111.07 ? 579  VAL A CB    1 
ATOM   7959  C  CG1   . VAL I  4 579  ? 14.198  12.080   3.499   1.00 113.50 ? 579  VAL A CG1   1 
ATOM   7960  C  CG2   . VAL I  4 579  ? 15.038  11.231   5.702   1.00 107.36 ? 579  VAL A CG2   1 
ATOM   7961  N  N     . VAL I  4 580  ? 16.494  13.763   2.104   1.00 118.37 ? 580  VAL A N     1 
ATOM   7962  C  CA    . VAL I  4 580  ? 16.547  14.884   1.164   1.00 120.22 ? 580  VAL A CA    1 
ATOM   7963  C  C     . VAL I  4 580  ? 15.310  14.832   0.285   1.00 121.60 ? 580  VAL A C     1 
ATOM   7964  O  O     . VAL I  4 580  ? 14.900  13.750   -0.123  1.00 134.84 ? 580  VAL A O     1 
ATOM   7965  C  CB    . VAL I  4 580  ? 17.812  14.814   0.267   1.00 119.16 ? 580  VAL A CB    1 
ATOM   7966  C  CG1   . VAL I  4 580  ? 17.940  16.054   -0.616  1.00 116.68 ? 580  VAL A CG1   1 
ATOM   7967  C  CG2   . VAL I  4 580  ? 19.065  14.645   1.107   1.00 117.82 ? 580  VAL A CG2   1 
ATOM   7968  N  N     . ILE I  4 581  ? 14.708  15.986   0.007   1.00 117.41 ? 581  ILE A N     1 
ATOM   7969  C  CA    . ILE I  4 581  ? 13.586  16.074   -0.927  1.00 117.44 ? 581  ILE A CA    1 
ATOM   7970  C  C     . ILE I  4 581  ? 13.875  17.168   -1.959  1.00 120.86 ? 581  ILE A C     1 
ATOM   7971  O  O     . ILE I  4 581  ? 13.622  18.350   -1.721  1.00 126.89 ? 581  ILE A O     1 
ATOM   7972  C  CB    . ILE I  4 581  ? 12.259  16.386   -0.211  1.00 117.80 ? 581  ILE A CB    1 
ATOM   7973  C  CG1   . ILE I  4 581  ? 11.968  15.335   0.870   1.00 123.71 ? 581  ILE A CG1   1 
ATOM   7974  C  CG2   . ILE I  4 581  ? 11.132  16.457   -1.232  1.00 116.57 ? 581  ILE A CG2   1 
ATOM   7975  C  CD1   . ILE I  4 581  ? 10.692  15.561   1.666   1.00 119.16 ? 581  ILE A CD1   1 
ATOM   7976  N  N     . ALA I  4 582  ? 14.422  16.772   -3.100  1.00 114.60 ? 582  ALA A N     1 
ATOM   7977  C  CA    . ALA I  4 582  ? 14.749  17.724   -4.143  1.00 113.26 ? 582  ALA A CA    1 
ATOM   7978  C  C     . ALA I  4 582  ? 13.547  18.033   -5.014  1.00 108.91 ? 582  ALA A C     1 
ATOM   7979  O  O     . ALA I  4 582  ? 12.662  17.214   -5.145  1.00 109.05 ? 582  ALA A O     1 
ATOM   7980  C  CB    . ALA I  4 582  ? 15.883  17.194   -4.997  1.00 120.47 ? 582  ALA A CB    1 
ATOM   7981  N  N     . ALA I  4 583  ? 13.548  19.217   -5.625  1.00 114.63 ? 583  ALA A N     1 
ATOM   7982  C  CA    . ALA I  4 583  ? 12.501  19.651   -6.568  1.00 120.46 ? 583  ALA A CA    1 
ATOM   7983  C  C     . ALA I  4 583  ? 12.612  18.967   -7.945  1.00 122.99 ? 583  ALA A C     1 
ATOM   7984  O  O     . ALA I  4 583  ? 11.655  18.379   -8.460  1.00 124.37 ? 583  ALA A O     1 
ATOM   7985  C  CB    . ALA I  4 583  ? 12.568  21.158   -6.737  1.00 117.30 ? 583  ALA A CB    1 
ATOM   7986  N  N     . GLU I  4 584  ? 13.788  19.080   -8.543  1.00 126.50 ? 584  GLU A N     1 
ATOM   7987  C  CA    . GLU I  4 584  ? 14.141  18.316   -9.735  1.00 132.17 ? 584  GLU A CA    1 
ATOM   7988  C  C     . GLU I  4 584  ? 14.878  17.041   -9.328  1.00 131.02 ? 584  GLU A C     1 
ATOM   7989  O  O     . GLU I  4 584  ? 15.346  16.928   -8.190  1.00 138.54 ? 584  GLU A O     1 
ATOM   7990  C  CB    . GLU I  4 584  ? 15.050  19.144   -10.626 1.00 141.08 ? 584  GLU A CB    1 
ATOM   7991  C  CG    . GLU I  4 584  ? 14.426  20.435   -11.124 1.00 146.23 ? 584  GLU A CG    1 
ATOM   7992  C  CD    . GLU I  4 584  ? 15.404  21.287   -11.923 1.00 153.26 ? 584  GLU A CD    1 
ATOM   7993  O  OE1   . GLU I  4 584  ? 16.280  20.736   -12.622 1.00 165.62 ? 584  GLU A OE1   1 
ATOM   7994  O  OE2   . GLU I  4 584  ? 15.302  22.524   -11.859 1.00 167.22 ? 584  GLU A OE2   1 
ATOM   7995  N  N     . PRO I  4 585  ? 15.003  16.081   -10.256 1.00 124.53 ? 585  PRO A N     1 
ATOM   7996  C  CA    . PRO I  4 585  ? 15.614  14.792   -9.912  1.00 127.78 ? 585  PRO A CA    1 
ATOM   7997  C  C     . PRO I  4 585  ? 16.958  14.932   -9.202  1.00 126.91 ? 585  PRO A C     1 
ATOM   7998  O  O     . PRO I  4 585  ? 17.782  15.733   -9.621  1.00 127.07 ? 585  PRO A O     1 
ATOM   7999  C  CB    . PRO I  4 585  ? 15.801  14.135   -11.277 1.00 125.32 ? 585  PRO A CB    1 
ATOM   8000  C  CG    . PRO I  4 585  ? 14.664  14.666   -12.077 1.00 123.31 ? 585  PRO A CG    1 
ATOM   8001  C  CD    . PRO I  4 585  ? 14.443  16.078   -11.618 1.00 119.24 ? 585  PRO A CD    1 
ATOM   8002  N  N     . LEU I  4 586  ? 17.168  14.166   -8.136  1.00 121.24 ? 586  LEU A N     1 
ATOM   8003  C  CA    . LEU I  4 586  ? 18.448  14.177   -7.443  1.00 118.19 ? 586  LEU A CA    1 
ATOM   8004  C  C     . LEU I  4 586  ? 19.628  13.924   -8.394  1.00 121.02 ? 586  LEU A C     1 
ATOM   8005  O  O     . LEU I  4 586  ? 20.633  14.637   -8.338  1.00 121.55 ? 586  LEU A O     1 
ATOM   8006  C  CB    . LEU I  4 586  ? 18.461  13.132   -6.324  1.00 119.11 ? 586  LEU A CB    1 
ATOM   8007  C  CG    . LEU I  4 586  ? 17.635  13.449   -5.081  1.00 122.98 ? 586  LEU A CG    1 
ATOM   8008  C  CD1   . LEU I  4 586  ? 17.593  12.255   -4.140  1.00 123.28 ? 586  LEU A CD1   1 
ATOM   8009  C  CD2   . LEU I  4 586  ? 18.206  14.659   -4.355  1.00 129.00 ? 586  LEU A CD2   1 
ATOM   8010  N  N     . THR I  4 587  ? 19.498  12.932   -9.277  1.00 125.98 ? 587  THR A N     1 
ATOM   8011  C  CA    . THR I  4 587  ? 20.594  12.513   -10.187 1.00 130.12 ? 587  THR A CA    1 
ATOM   8012  C  C     . THR I  4 587  ? 21.150  13.610   -11.111 1.00 126.37 ? 587  THR A C     1 
ATOM   8013  O  O     . THR I  4 587  ? 22.239  13.460   -11.669 1.00 115.67 ? 587  THR A O     1 
ATOM   8014  C  CB    . THR I  4 587  ? 20.147  11.345   -11.069 1.00 132.70 ? 587  THR A CB    1 
ATOM   8015  O  OG1   . THR I  4 587  ? 19.464  10.389   -10.249 1.00 148.15 ? 587  THR A OG1   1 
ATOM   8016  C  CG2   . THR I  4 587  ? 21.339  10.685   -11.725 1.00 131.64 ? 587  THR A CG2   1 
ATOM   8017  N  N     . ASP I  4 588  ? 20.394  14.698   -11.268 1.00 121.59 ? 588  ASP A N     1 
ATOM   8018  C  CA    . ASP I  4 588  ? 20.845  15.873   -11.997 1.00 115.09 ? 588  ASP A CA    1 
ATOM   8019  C  C     . ASP I  4 588  ? 21.901  16.681   -11.244 1.00 119.07 ? 588  ASP A C     1 
ATOM   8020  O  O     . ASP I  4 588  ? 22.804  17.240   -11.864 1.00 132.03 ? 588  ASP A O     1 
ATOM   8021  C  CB    . ASP I  4 588  ? 19.676  16.796   -12.290 1.00 115.74 ? 588  ASP A CB    1 
ATOM   8022  C  CG    . ASP I  4 588  ? 18.620  16.166   -13.194 1.00 122.75 ? 588  ASP A CG    1 
ATOM   8023  O  OD1   . ASP I  4 588  ? 18.918  15.179   -13.924 1.00 122.41 ? 588  ASP A OD1   1 
ATOM   8024  O  OD2   . ASP I  4 588  ? 17.481  16.688   -13.178 1.00 123.68 ? 588  ASP A OD2   1 
ATOM   8025  N  N     . LEU I  4 589  ? 21.787  16.754   -9.918  1.00 122.90 ? 589  LEU A N     1 
ATOM   8026  C  CA    . LEU I  4 589  ? 22.688  17.585   -9.100  1.00 124.31 ? 589  LEU A CA    1 
ATOM   8027  C  C     . LEU I  4 589  ? 23.475  16.845   -8.003  1.00 122.67 ? 589  LEU A C     1 
ATOM   8028  O  O     . LEU I  4 589  ? 24.536  17.311   -7.567  1.00 128.95 ? 589  LEU A O     1 
ATOM   8029  C  CB    . LEU I  4 589  ? 21.890  18.705   -8.430  1.00 128.88 ? 589  LEU A CB    1 
ATOM   8030  C  CG    . LEU I  4 589  ? 22.740  19.857   -7.901  1.00 132.35 ? 589  LEU A CG    1 
ATOM   8031  C  CD1   . LEU I  4 589  ? 23.383  20.575   -9.087  1.00 129.03 ? 589  LEU A CD1   1 
ATOM   8032  C  CD2   . LEU I  4 589  ? 21.899  20.788   -7.035  1.00 128.17 ? 589  LEU A CD2   1 
ATOM   8033  N  N     . VAL I  4 590  ? 22.947  15.730   -7.511  1.00 117.07 ? 590  VAL A N     1 
ATOM   8034  C  CA    . VAL I  4 590  ? 23.630  14.981   -6.451  1.00 114.86 ? 590  VAL A CA    1 
ATOM   8035  C  C     . VAL I  4 590  ? 23.729  13.504   -6.787  1.00 110.08 ? 590  VAL A C     1 
ATOM   8036  O  O     . VAL I  4 590  ? 22.738  12.892   -7.114  1.00 110.83 ? 590  VAL A O     1 
ATOM   8037  C  CB    . VAL I  4 590  ? 22.880  15.098   -5.127  1.00 115.31 ? 590  VAL A CB    1 
ATOM   8038  C  CG1   . VAL I  4 590  ? 23.484  14.174   -4.088  1.00 117.14 ? 590  VAL A CG1   1 
ATOM   8039  C  CG2   . VAL I  4 590  ? 22.911  16.535   -4.636  1.00 115.61 ? 590  VAL A CG2   1 
ATOM   8040  N  N     . PRO I  4 591  ? 24.932  12.927   -6.709  1.00 116.02 ? 591  PRO A N     1 
ATOM   8041  C  CA    . PRO I  4 591  ? 25.087  11.499   -7.036  1.00 120.72 ? 591  PRO A CA    1 
ATOM   8042  C  C     . PRO I  4 591  ? 24.592  10.589   -5.925  1.00 119.36 ? 591  PRO A C     1 
ATOM   8043  O  O     . PRO I  4 591  ? 24.578  11.006   -4.762  1.00 120.21 ? 591  PRO A O     1 
ATOM   8044  C  CB    . PRO I  4 591  ? 26.602  11.341   -7.235  1.00 124.47 ? 591  PRO A CB    1 
ATOM   8045  C  CG    . PRO I  4 591  ? 27.222  12.461   -6.455  1.00 121.39 ? 591  PRO A CG    1 
ATOM   8046  C  CD    . PRO I  4 591  ? 26.204  13.562   -6.323  1.00 117.66 ? 591  PRO A CD    1 
ATOM   8047  N  N     . LEU I  4 592  ? 24.215  9.360    -6.281  1.00 117.72 ? 592  LEU A N     1 
ATOM   8048  C  CA    . LEU I  4 592  ? 23.578  8.430    -5.330  1.00 125.46 ? 592  LEU A CA    1 
ATOM   8049  C  C     . LEU I  4 592  ? 24.338  7.101    -5.046  1.00 126.32 ? 592  LEU A C     1 
ATOM   8050  O  O     . LEU I  4 592  ? 25.301  6.744    -5.734  1.00 125.77 ? 592  LEU A O     1 
ATOM   8051  C  CB    . LEU I  4 592  ? 22.155  8.114    -5.797  1.00 124.87 ? 592  LEU A CB    1 
ATOM   8052  C  CG    . LEU I  4 592  ? 21.073  9.099    -5.394  1.00 123.89 ? 592  LEU A CG    1 
ATOM   8053  C  CD1   . LEU I  4 592  ? 21.337  10.443   -6.025  1.00 133.04 ? 592  LEU A CD1   1 
ATOM   8054  C  CD2   . LEU I  4 592  ? 19.724  8.568    -5.839  1.00 137.50 ? 592  LEU A CD2   1 
ATOM   8055  N  N     . MET I  4 593  ? 23.869  6.402    -4.007  1.00 121.80 ? 593  MET A N     1 
ATOM   8056  C  CA    . MET I  4 593  ? 24.363  5.095    -3.571  1.00 120.52 ? 593  MET A CA    1 
ATOM   8057  C  C     . MET I  4 593  ? 23.188  4.232    -3.127  1.00 118.81 ? 593  MET A C     1 
ATOM   8058  O  O     . MET I  4 593  ? 22.038  4.646    -3.178  1.00 124.44 ? 593  MET A O     1 
ATOM   8059  C  CB    . MET I  4 593  ? 25.296  5.236    -2.370  1.00 122.08 ? 593  MET A CB    1 
ATOM   8060  C  CG    . MET I  4 593  ? 26.713  5.669    -2.672  1.00 127.21 ? 593  MET A CG    1 
ATOM   8061  S  SD    . MET I  4 593  ? 27.668  5.794    -1.132  1.00 122.42 ? 593  MET A SD    1 
ATOM   8062  C  CE    . MET I  4 593  ? 27.631  4.100    -0.588  1.00 116.64 ? 593  MET A CE    1 
ATOM   8063  N  N     . ARG I  4 594  ? 23.487  3.017    -2.702  1.00 120.72 ? 594  ARG A N     1 
ATOM   8064  C  CA    . ARG I  4 594  ? 22.489  2.160    -2.100  1.00 128.08 ? 594  ARG A CA    1 
ATOM   8065  C  C     . ARG I  4 594  ? 23.162  1.314    -1.047  1.00 125.83 ? 594  ARG A C     1 
ATOM   8066  O  O     . ARG I  4 594  ? 24.051  0.521    -1.366  1.00 139.21 ? 594  ARG A O     1 
ATOM   8067  C  CB    . ARG I  4 594  ? 21.822  1.255    -3.142  1.00 136.51 ? 594  ARG A CB    1 
ATOM   8068  C  CG    . ARG I  4 594  ? 20.686  0.418    -2.544  1.00 145.34 ? 594  ARG A CG    1 
ATOM   8069  C  CD    . ARG I  4 594  ? 19.847  -0.290   -3.609  1.00 153.36 ? 594  ARG A CD    1 
ATOM   8070  N  NE    . ARG I  4 594  ? 19.052  0.638    -4.404  1.00 155.47 ? 594  ARG A NE    1 
ATOM   8071  C  CZ    . ARG I  4 594  ? 17.956  1.257    -3.975  1.00 156.02 ? 594  ARG A CZ    1 
ATOM   8072  N  NH1   . ARG I  4 594  ? 17.495  1.053    -2.741  1.00 153.73 ? 594  ARG A NH1   1 
ATOM   8073  N  NH2   . ARG I  4 594  ? 17.319  2.096    -4.787  1.00 155.24 ? 594  ARG A NH2   1 
ATOM   8074  N  N     . ASP I  4 595  ? 22.729  1.462    0.192   1.00 118.78 ? 595  ASP A N     1 
ATOM   8075  C  CA    . ASP I  4 595  ? 23.360  0.759    1.298   1.00 133.62 ? 595  ASP A CA    1 
ATOM   8076  C  C     . ASP I  4 595  ? 22.959  -0.736   1.363   1.00 141.19 ? 595  ASP A C     1 
ATOM   8077  O  O     . ASP I  4 595  ? 22.214  -1.241   0.501   1.00 137.31 ? 595  ASP A O     1 
ATOM   8078  C  CB    . ASP I  4 595  ? 23.014  1.451    2.620   1.00 137.47 ? 595  ASP A CB    1 
ATOM   8079  C  CG    . ASP I  4 595  ? 21.645  1.060    3.135   1.00 140.34 ? 595  ASP A CG    1 
ATOM   8080  O  OD1   . ASP I  4 595  ? 20.731  0.847    2.313   1.00 152.69 ? 595  ASP A OD1   1 
ATOM   8081  O  OD2   . ASP I  4 595  ? 21.481  0.947    4.358   1.00 143.43 ? 595  ASP A OD2   1 
ATOM   8082  N  N     . GLN I  4 596  ? 23.443  -1.410   2.412   1.00 135.00 ? 596  GLN A N     1 
ATOM   8083  C  CA    . GLN I  4 596  ? 23.295  -2.843   2.570   1.00 128.72 ? 596  GLN A CA    1 
ATOM   8084  C  C     . GLN I  4 596  ? 21.834  -3.223   2.705   1.00 126.55 ? 596  GLN A C     1 
ATOM   8085  O  O     . GLN I  4 596  ? 21.385  -4.210   2.119   1.00 119.56 ? 596  GLN A O     1 
ATOM   8086  C  CB    . GLN I  4 596  ? 24.101  -3.324   3.787   1.00 134.68 ? 596  GLN A CB    1 
ATOM   8087  C  CG    . GLN I  4 596  ? 24.426  -4.819   3.768   1.00 147.86 ? 596  GLN A CG    1 
ATOM   8088  C  CD    . GLN I  4 596  ? 25.549  -5.207   4.729   1.00 151.06 ? 596  GLN A CD    1 
ATOM   8089  O  OE1   . GLN I  4 596  ? 25.948  -4.412   5.590   1.00 162.15 ? 596  GLN A OE1   1 
ATOM   8090  N  NE2   . GLN I  4 596  ? 26.065  -6.433   4.583   1.00 145.65 ? 596  GLN A NE2   1 
ATOM   8091  N  N     . GLU I  4 597  ? 21.088  -2.425   3.466   1.00 133.57 ? 597  GLU A N     1 
ATOM   8092  C  CA    . GLU I  4 597  ? 19.664  -2.702   3.725   1.00 135.33 ? 597  GLU A CA    1 
ATOM   8093  C  C     . GLU I  4 597  ? 18.736  -2.228   2.595   1.00 132.51 ? 597  GLU A C     1 
ATOM   8094  O  O     . GLU I  4 597  ? 17.525  -2.441   2.647   1.00 119.84 ? 597  GLU A O     1 
ATOM   8095  C  CB    . GLU I  4 597  ? 19.210  -2.061   5.040   1.00 135.44 ? 597  GLU A CB    1 
ATOM   8096  C  CG    . GLU I  4 597  ? 19.885  -2.578   6.305   1.00 136.82 ? 597  GLU A CG    1 
ATOM   8097  C  CD    . GLU I  4 597  ? 19.206  -2.072   7.581   1.00 141.12 ? 597  GLU A CD    1 
ATOM   8098  O  OE1   . GLU I  4 597  ? 18.522  -1.024   7.540   1.00 143.88 ? 597  GLU A OE1   1 
ATOM   8099  O  OE2   . GLU I  4 597  ? 19.345  -2.719   8.640   1.00 143.87 ? 597  GLU A OE2   1 
ATOM   8100  N  N     . GLY I  4 598  ? 19.293  -1.569   1.585   1.00 141.24 ? 598  GLY A N     1 
ATOM   8101  C  CA    . GLY I  4 598  ? 18.508  -1.173   0.417   1.00 148.72 ? 598  GLY A CA    1 
ATOM   8102  C  C     . GLY I  4 598  ? 17.847  0.184    0.599   1.00 152.33 ? 598  GLY A C     1 
ATOM   8103  O  O     . GLY I  4 598  ? 16.637  0.338    0.404   1.00 153.12 ? 598  GLY A O     1 
ATOM   8104  N  N     . ARG I  4 599  ? 18.655  1.165    0.984   1.00 149.54 ? 599  ARG A N     1 
ATOM   8105  C  CA    . ARG I  4 599  ? 18.222  2.546    1.097   1.00 148.15 ? 599  ARG A CA    1 
ATOM   8106  C  C     . ARG I  4 599  ? 18.997  3.361    0.049   1.00 149.54 ? 599  ARG A C     1 
ATOM   8107  O  O     . ARG I  4 599  ? 20.220  3.179    -0.077  1.00 138.85 ? 599  ARG A O     1 
ATOM   8108  C  CB    . ARG I  4 599  ? 18.507  3.093    2.507   1.00 143.35 ? 599  ARG A CB    1 
ATOM   8109  C  CG    . ARG I  4 599  ? 17.884  2.308    3.652   1.00 143.72 ? 599  ARG A CG    1 
ATOM   8110  C  CD    . ARG I  4 599  ? 18.501  2.725    4.981   1.00 146.80 ? 599  ARG A CD    1 
ATOM   8111  N  NE    . ARG I  4 599  ? 17.841  2.121    6.142   1.00 144.10 ? 599  ARG A NE    1 
ATOM   8112  C  CZ    . ARG I  4 599  ? 16.759  2.613    6.756   1.00 157.45 ? 599  ARG A CZ    1 
ATOM   8113  N  NH1   . ARG I  4 599  ? 16.164  3.736    6.335   1.00 157.70 ? 599  ARG A NH1   1 
ATOM   8114  N  NH2   . ARG I  4 599  ? 16.261  1.974    7.811   1.00 160.29 ? 599  ARG A NH2   1 
ATOM   8115  N  N     . PRO I  4 600  ? 18.301  4.260    -0.699  1.00 146.40 ? 600  PRO A N     1 
ATOM   8116  C  CA    . PRO I  4 600  ? 19.006  5.175    -1.612  1.00 144.72 ? 600  PRO A CA    1 
ATOM   8117  C  C     . PRO I  4 600  ? 19.732  6.278    -0.824  1.00 137.66 ? 600  PRO A C     1 
ATOM   8118  O  O     . PRO I  4 600  ? 19.086  7.169    -0.245  1.00 142.62 ? 600  PRO A O     1 
ATOM   8119  C  CB    . PRO I  4 600  ? 17.878  5.765    -2.459  1.00 150.24 ? 600  PRO A CB    1 
ATOM   8120  C  CG    . PRO I  4 600  ? 16.688  5.759    -1.535  1.00 148.77 ? 600  PRO A CG    1 
ATOM   8121  C  CD    . PRO I  4 600  ? 16.852  4.555    -0.644  1.00 142.46 ? 600  PRO A CD    1 
ATOM   8122  N  N     . VAL I  4 601  ? 21.058  6.190    -0.775  1.00 119.33 ? 601  VAL A N     1 
ATOM   8123  C  CA    . VAL I  4 601  ? 21.864  7.092    0.048   1.00 117.66 ? 601  VAL A CA    1 
ATOM   8124  C  C     . VAL I  4 601  ? 22.507  8.157    -0.832  1.00 110.31 ? 601  VAL A C     1 
ATOM   8125  O  O     . VAL I  4 601  ? 22.834  7.895    -1.963  1.00 121.88 ? 601  VAL A O     1 
ATOM   8126  C  CB    . VAL I  4 601  ? 22.937  6.315    0.860   1.00 116.16 ? 601  VAL A CB    1 
ATOM   8127  C  CG1   . VAL I  4 601  ? 23.725  7.234    1.785   1.00 110.93 ? 601  VAL A CG1   1 
ATOM   8128  C  CG2   . VAL I  4 601  ? 22.276  5.209    1.675   1.00 115.21 ? 601  VAL A CG2   1 
ATOM   8129  N  N     . THR I  4 602  ? 22.652  9.364    -0.304  1.00 108.96 ? 602  THR A N     1 
ATOM   8130  C  CA    . THR I  4 602  ? 23.298  10.464   -0.992  1.00 108.76 ? 602  THR A CA    1 
ATOM   8131  C  C     . THR I  4 602  ? 24.789  10.365   -0.766  1.00 113.98 ? 602  THR A C     1 
ATOM   8132  O  O     . THR I  4 602  ? 25.210  10.092   0.344   1.00 122.12 ? 602  THR A O     1 
ATOM   8133  C  CB    . THR I  4 602  ? 22.791  11.808   -0.447  1.00 106.93 ? 602  THR A CB    1 
ATOM   8134  O  OG1   . THR I  4 602  ? 21.407  11.947   -0.785  1.00 111.10 ? 602  THR A OG1   1 
ATOM   8135  C  CG2   . THR I  4 602  ? 23.557  12.973   -1.010  1.00 108.50 ? 602  THR A CG2   1 
ATOM   8136  N  N     . GLN I  4 603  ? 25.577  10.583   -1.820  1.00 122.51 ? 603  GLN A N     1 
ATOM   8137  C  CA    . GLN I  4 603  ? 27.046  10.560   -1.739  1.00 123.20 ? 603  GLN A CA    1 
ATOM   8138  C  C     . GLN I  4 603  ? 27.649  11.760   -1.004  1.00 121.35 ? 603  GLN A C     1 
ATOM   8139  O  O     . GLN I  4 603  ? 28.695  11.626   -0.371  1.00 115.81 ? 603  GLN A O     1 
ATOM   8140  C  CB    . GLN I  4 603  ? 27.657  10.502   -3.130  1.00 128.82 ? 603  GLN A CB    1 
ATOM   8141  C  CG    . GLN I  4 603  ? 27.584  9.129    -3.784  1.00 127.64 ? 603  GLN A CG    1 
ATOM   8142  C  CD    . GLN I  4 603  ? 28.502  8.997    -5.000  1.00 123.67 ? 603  GLN A CD    1 
ATOM   8143  O  OE1   . GLN I  4 603  ? 29.275  9.905    -5.310  1.00 112.50 ? 603  GLN A OE1   1 
ATOM   8144  N  NE2   . GLN I  4 603  ? 28.414  7.859    -5.693  1.00 120.68 ? 603  GLN A NE2   1 
ATOM   8145  N  N     . TYR I  4 604  ? 27.004  12.922   -1.104  1.00 120.34 ? 604  TYR A N     1 
ATOM   8146  C  CA    . TYR I  4 604  ? 27.388  14.085   -0.301  1.00 121.91 ? 604  TYR A CA    1 
ATOM   8147  C  C     . TYR I  4 604  ? 26.878  13.980   1.145   1.00 122.96 ? 604  TYR A C     1 
ATOM   8148  O  O     . TYR I  4 604  ? 25.931  13.246   1.423   1.00 120.66 ? 604  TYR A O     1 
ATOM   8149  C  CB    . TYR I  4 604  ? 26.885  15.388   -0.940  1.00 118.51 ? 604  TYR A CB    1 
ATOM   8150  C  CG    . TYR I  4 604  ? 27.335  15.603   -2.367  1.00 115.58 ? 604  TYR A CG    1 
ATOM   8151  C  CD1   . TYR I  4 604  ? 26.462  16.123   -3.306  1.00 116.15 ? 604  TYR A CD1   1 
ATOM   8152  C  CD2   . TYR I  4 604  ? 28.631  15.270   -2.787  1.00 116.73 ? 604  TYR A CD2   1 
ATOM   8153  C  CE1   . TYR I  4 604  ? 26.854  16.315   -4.621  1.00 116.43 ? 604  TYR A CE1   1 
ATOM   8154  C  CE2   . TYR I  4 604  ? 29.030  15.460   -4.100  1.00 108.73 ? 604  TYR A CE2   1 
ATOM   8155  C  CZ    . TYR I  4 604  ? 28.131  15.981   -5.003  1.00 110.84 ? 604  TYR A CZ    1 
ATOM   8156  O  OH    . TYR I  4 604  ? 28.483  16.180   -6.294  1.00 111.76 ? 604  TYR A OH    1 
ATOM   8157  N  N     . ASP I  4 605  ? 27.526  14.725   2.044   1.00 125.18 ? 605  ASP A N     1 
ATOM   8158  C  CA    . ASP I  4 605  ? 27.202  14.733   3.471   1.00 127.82 ? 605  ASP A CA    1 
ATOM   8159  C  C     . ASP I  4 605  ? 26.186  15.824   3.810   1.00 126.91 ? 605  ASP A C     1 
ATOM   8160  O  O     . ASP I  4 605  ? 25.684  16.505   2.917   1.00 122.69 ? 605  ASP A O     1 
ATOM   8161  C  CB    . ASP I  4 605  ? 28.487  14.926   4.303   1.00 134.47 ? 605  ASP A CB    1 
ATOM   8162  C  CG    . ASP I  4 605  ? 29.040  16.358   4.235   1.00 134.47 ? 605  ASP A CG    1 
ATOM   8163  O  OD1   . ASP I  4 605  ? 29.123  16.940   3.129   1.00 136.92 ? 605  ASP A OD1   1 
ATOM   8164  O  OD2   . ASP I  4 605  ? 29.404  16.897   5.295   1.00 128.93 ? 605  ASP A OD2   1 
ATOM   8165  N  N     . MET I  4 606  ? 25.896  15.970   5.105   1.00 135.37 ? 606  MET A N     1 
ATOM   8166  C  CA    . MET I  4 606  ? 25.011  17.021   5.631   1.00 133.08 ? 606  MET A CA    1 
ATOM   8167  C  C     . MET I  4 606  ? 25.312  18.383   5.039   1.00 130.73 ? 606  MET A C     1 
ATOM   8168  O  O     . MET I  4 606  ? 24.433  18.985   4.424   1.00 121.30 ? 606  MET A O     1 
ATOM   8169  C  CB    . MET I  4 606  ? 25.131  17.114   7.159   1.00 141.05 ? 606  MET A CB    1 
ATOM   8170  C  CG    . MET I  4 606  ? 24.216  16.166   7.914   1.00 149.33 ? 606  MET A CG    1 
ATOM   8171  S  SD    . MET I  4 606  ? 22.519  16.788   7.975   1.00 156.70 ? 606  MET A SD    1 
ATOM   8172  C  CE    . MET I  4 606  ? 21.664  15.393   8.716   1.00 162.55 ? 606  MET A CE    1 
ATOM   8173  N  N     . GLY I  4 607  ? 26.551  18.853   5.223   1.00 126.49 ? 607  GLY A N     1 
ATOM   8174  C  CA    . GLY I  4 607  ? 26.934  20.203   4.813   1.00 132.59 ? 607  GLY A CA    1 
ATOM   8175  C  C     . GLY I  4 607  ? 26.910  20.413   3.308   1.00 136.08 ? 607  GLY A C     1 
ATOM   8176  O  O     . GLY I  4 607  ? 26.489  21.464   2.806   1.00 143.01 ? 607  GLY A O     1 
ATOM   8177  N  N     . ALA I  4 608  ? 27.375  19.414   2.578   1.00 129.63 ? 608  ALA A N     1 
ATOM   8178  C  CA    . ALA I  4 608  ? 27.448  19.544   1.145   1.00 128.92 ? 608  ALA A CA    1 
ATOM   8179  C  C     . ALA I  4 608  ? 26.053  19.583   0.538   1.00 124.12 ? 608  ALA A C     1 
ATOM   8180  O  O     . ALA I  4 608  ? 25.812  20.356   -0.373  1.00 136.31 ? 608  ALA A O     1 
ATOM   8181  C  CB    . ALA I  4 608  ? 28.283  18.423   0.553   1.00 135.43 ? 608  ALA A CB    1 
ATOM   8182  N  N     . VAL I  4 609  ? 25.130  18.773   1.053   1.00 123.91 ? 609  VAL A N     1 
ATOM   8183  C  CA    . VAL I  4 609  ? 23.739  18.753   0.547   1.00 122.14 ? 609  VAL A CA    1 
ATOM   8184  C  C     . VAL I  4 609  ? 22.995  20.084   0.788   1.00 122.44 ? 609  VAL A C     1 
ATOM   8185  O  O     . VAL I  4 609  ? 22.307  20.581   -0.095  1.00 115.07 ? 609  VAL A O     1 
ATOM   8186  C  CB    . VAL I  4 609  ? 22.944  17.582   1.161   1.00 115.43 ? 609  VAL A CB    1 
ATOM   8187  C  CG1   . VAL I  4 609  ? 21.480  17.642   0.772   1.00 116.41 ? 609  VAL A CG1   1 
ATOM   8188  C  CG2   . VAL I  4 609  ? 23.537  16.257   0.717   1.00 113.33 ? 609  VAL A CG2   1 
ATOM   8189  N  N     . GLU I  4 610  ? 23.146  20.648   1.981   1.00 123.54 ? 610  GLU A N     1 
ATOM   8190  C  CA    . GLU I  4 610  ? 22.600  21.958   2.291   1.00 123.99 ? 610  GLU A CA    1 
ATOM   8191  C  C     . GLU I  4 610  ? 23.277  23.085   1.507   1.00 125.29 ? 610  GLU A C     1 
ATOM   8192  O  O     . GLU I  4 610  ? 22.653  24.102   1.199   1.00 119.74 ? 610  GLU A O     1 
ATOM   8193  C  CB    . GLU I  4 610  ? 22.739  22.228   3.789   1.00 132.69 ? 610  GLU A CB    1 
ATOM   8194  C  CG    . GLU I  4 610  ? 21.763  21.439   4.640   1.00 135.24 ? 610  GLU A CG    1 
ATOM   8195  C  CD    . GLU I  4 610  ? 21.691  21.967   6.047   1.00 135.69 ? 610  GLU A CD    1 
ATOM   8196  O  OE1   . GLU I  4 610  ? 22.754  22.059   6.706   1.00 141.45 ? 610  GLU A OE1   1 
ATOM   8197  O  OE2   . GLU I  4 610  ? 20.568  22.300   6.474   1.00 150.22 ? 610  GLU A OE2   1 
ATOM   8198  N  N     . ALA I  4 611  ? 24.557  22.905   1.190   1.00 132.33 ? 611  ALA A N     1 
ATOM   8199  C  CA    . ALA I  4 611  ? 25.330  23.932   0.494   1.00 127.38 ? 611  ALA A CA    1 
ATOM   8200  C  C     . ALA I  4 611  ? 24.780  24.157   -0.909  1.00 123.52 ? 611  ALA A C     1 
ATOM   8201  O  O     . ALA I  4 611  ? 24.932  25.235   -1.474  1.00 122.57 ? 611  ALA A O     1 
ATOM   8202  C  CB    . ALA I  4 611  ? 26.798  23.530   0.436   1.00 132.99 ? 611  ALA A CB    1 
ATOM   8203  N  N     . LEU I  4 612  ? 24.137  23.133   -1.463  1.00 119.75 ? 612  LEU A N     1 
ATOM   8204  C  CA    . LEU I  4 612  ? 23.559  23.216   -2.795  1.00 121.54 ? 612  LEU A CA    1 
ATOM   8205  C  C     . LEU I  4 612  ? 22.178  23.874   -2.781  1.00 121.44 ? 612  LEU A C     1 
ATOM   8206  O  O     . LEU I  4 612  ? 21.596  24.108   -3.839  1.00 124.11 ? 612  LEU A O     1 
ATOM   8207  C  CB    . LEU I  4 612  ? 23.496  21.818   -3.424  1.00 123.18 ? 612  LEU A CB    1 
ATOM   8208  C  CG    . LEU I  4 612  ? 24.856  21.127   -3.637  1.00 116.41 ? 612  LEU A CG    1 
ATOM   8209  C  CD1   . LEU I  4 612  ? 24.722  19.672   -4.058  1.00 112.53 ? 612  LEU A CD1   1 
ATOM   8210  C  CD2   . LEU I  4 612  ? 25.664  21.896   -4.653  1.00 119.43 ? 612  LEU A CD2   1 
ATOM   8211  N  N     . GLY I  4 613  ? 21.669  24.175   -1.583  1.00 126.60 ? 613  GLY A N     1 
ATOM   8212  C  CA    . GLY I  4 613  ? 20.364  24.812   -1.405  1.00 122.64 ? 613  GLY A CA    1 
ATOM   8213  C  C     . GLY I  4 613  ? 19.202  23.862   -1.636  1.00 129.36 ? 613  GLY A C     1 
ATOM   8214  O  O     . GLY I  4 613  ? 18.228  24.216   -2.307  1.00 146.05 ? 613  GLY A O     1 
ATOM   8215  N  N     . LEU I  4 614  ? 19.304  22.654   -1.079  1.00 127.24 ? 614  LEU A N     1 
ATOM   8216  C  CA    . LEU I  4 614  ? 18.263  21.635   -1.206  1.00 122.72 ? 614  LEU A CA    1 
ATOM   8217  C  C     . LEU I  4 614  ? 17.551  21.429   0.118   1.00 127.97 ? 614  LEU A C     1 
ATOM   8218  O  O     . LEU I  4 614  ? 18.147  21.575   1.186   1.00 124.75 ? 614  LEU A O     1 
ATOM   8219  C  CB    . LEU I  4 614  ? 18.877  20.323   -1.664  1.00 123.48 ? 614  LEU A CB    1 
ATOM   8220  C  CG    . LEU I  4 614  ? 19.463  20.324   -3.088  1.00 128.69 ? 614  LEU A CG    1 
ATOM   8221  C  CD1   . LEU I  4 614  ? 20.249  19.050   -3.345  1.00 124.24 ? 614  LEU A CD1   1 
ATOM   8222  C  CD2   . LEU I  4 614  ? 18.390  20.471   -4.161  1.00 126.27 ? 614  LEU A CD2   1 
ATOM   8223  N  N     . LEU I  4 615  ? 16.269  21.086   0.049   1.00 139.19 ? 615  LEU A N     1 
ATOM   8224  C  CA    . LEU I  4 615  ? 15.459  20.868   1.260   1.00 136.22 ? 615  LEU A CA    1 
ATOM   8225  C  C     . LEU I  4 615  ? 15.892  19.597   1.988   1.00 127.42 ? 615  LEU A C     1 
ATOM   8226  O  O     . LEU I  4 615  ? 16.021  18.547   1.383   1.00 129.55 ? 615  LEU A O     1 
ATOM   8227  C  CB    . LEU I  4 615  ? 13.968  20.787   0.906   1.00 137.85 ? 615  LEU A CB    1 
ATOM   8228  C  CG    . LEU I  4 615  ? 12.953  20.834   2.056   1.00 139.30 ? 615  LEU A CG    1 
ATOM   8229  C  CD1   . LEU I  4 615  ? 11.602  21.322   1.565   1.00 130.36 ? 615  LEU A CD1   1 
ATOM   8230  C  CD2   . LEU I  4 615  ? 12.812  19.483   2.746   1.00 155.93 ? 615  LEU A CD2   1 
ATOM   8231  N  N     . LYS I  4 616  ? 16.092  19.702   3.291   1.00 122.99 ? 616  LYS A N     1 
ATOM   8232  C  CA    . LYS I  4 616  ? 16.600  18.600   4.082   1.00 129.30 ? 616  LYS A CA    1 
ATOM   8233  C  C     . LYS I  4 616  ? 15.790  18.429   5.350   1.00 127.98 ? 616  LYS A C     1 
ATOM   8234  O  O     . LYS I  4 616  ? 15.693  19.339   6.154   1.00 136.35 ? 616  LYS A O     1 
ATOM   8235  C  CB    . LYS I  4 616  ? 18.053  18.852   4.455   1.00 137.84 ? 616  LYS A CB    1 
ATOM   8236  C  CG    . LYS I  4 616  ? 18.723  17.697   5.187   1.00 144.11 ? 616  LYS A CG    1 
ATOM   8237  C  CD    . LYS I  4 616  ? 20.111  18.086   5.671   1.00 156.84 ? 616  LYS A CD    1 
ATOM   8238  C  CE    . LYS I  4 616  ? 20.077  18.934   6.935   1.00 156.48 ? 616  LYS A CE    1 
ATOM   8239  N  NZ    . LYS I  4 616  ? 19.643  18.130   8.104   1.00 164.72 ? 616  LYS A NZ    1 
ATOM   8240  N  N     . MET I  4 617  ? 15.242  17.237   5.524   1.00 128.87 ? 617  MET A N     1 
ATOM   8241  C  CA    . MET I  4 617  ? 14.455  16.885   6.682   1.00 122.94 ? 617  MET A CA    1 
ATOM   8242  C  C     . MET I  4 617  ? 15.240  15.999   7.643   1.00 115.88 ? 617  MET A C     1 
ATOM   8243  O  O     . MET I  4 617  ? 16.215  15.373   7.272   1.00 109.09 ? 617  MET A O     1 
ATOM   8244  C  CB    . MET I  4 617  ? 13.207  16.153   6.206   1.00 128.27 ? 617  MET A CB    1 
ATOM   8245  C  CG    . MET I  4 617  ? 12.335  16.962   5.268   1.00 129.49 ? 617  MET A CG    1 
ATOM   8246  S  SD    . MET I  4 617  ? 11.475  18.259   6.178   1.00 151.29 ? 617  MET A SD    1 
ATOM   8247  C  CE    . MET I  4 617  ? 12.725  19.545   6.217   1.00 148.16 ? 617  MET A CE    1 
ATOM   8248  N  N     . ASP I  4 618  ? 14.791  15.943   8.890   1.00 126.66 ? 618  ASP A N     1 
ATOM   8249  C  CA    . ASP I  4 618  ? 15.410  15.078   9.891   1.00 133.50 ? 618  ASP A CA    1 
ATOM   8250  C  C     . ASP I  4 618  ? 14.368  14.286   10.677  1.00 130.33 ? 618  ASP A C     1 
ATOM   8251  O  O     . ASP I  4 618  ? 13.681  14.852   11.518  1.00 134.69 ? 618  ASP A O     1 
ATOM   8252  C  CB    . ASP I  4 618  ? 16.250  15.909   10.856  1.00 137.67 ? 618  ASP A CB    1 
ATOM   8253  C  CG    . ASP I  4 618  ? 17.501  16.480   10.206  1.00 144.48 ? 618  ASP A CG    1 
ATOM   8254  O  OD1   . ASP I  4 618  ? 18.210  15.738   9.472   1.00 141.45 ? 618  ASP A OD1   1 
ATOM   8255  O  OD2   . ASP I  4 618  ? 17.772  17.678   10.446  1.00 144.81 ? 618  ASP A OD2   1 
ATOM   8256  N  N     . PHE I  4 619  ? 14.264  12.986   10.401  1.00 126.09 ? 619  PHE A N     1 
ATOM   8257  C  CA    . PHE I  4 619  ? 13.334  12.103   11.109  1.00 124.66 ? 619  PHE A CA    1 
ATOM   8258  C  C     . PHE I  4 619  ? 14.074  11.226   12.116  1.00 128.82 ? 619  PHE A C     1 
ATOM   8259  O  O     . PHE I  4 619  ? 14.790  10.287   11.736  1.00 130.62 ? 619  PHE A O     1 
ATOM   8260  C  CB    . PHE I  4 619  ? 12.571  11.195   10.138  1.00 121.26 ? 619  PHE A CB    1 
ATOM   8261  C  CG    . PHE I  4 619  ? 11.996  11.900   8.955   1.00 120.06 ? 619  PHE A CG    1 
ATOM   8262  C  CD1   . PHE I  4 619  ? 11.560  13.205   9.043   1.00 135.19 ? 619  PHE A CD1   1 
ATOM   8263  C  CD2   . PHE I  4 619  ? 11.862  11.244   7.760   1.00 122.84 ? 619  PHE A CD2   1 
ATOM   8264  C  CE1   . PHE I  4 619  ? 11.016  13.850   7.943   1.00 138.86 ? 619  PHE A CE1   1 
ATOM   8265  C  CE2   . PHE I  4 619  ? 11.337  11.881   6.651   1.00 133.17 ? 619  PHE A CE2   1 
ATOM   8266  C  CZ    . PHE I  4 619  ? 10.904  13.187   6.740   1.00 133.29 ? 619  PHE A CZ    1 
ATOM   8267  N  N     . LEU I  4 620  ? 13.879  11.509   13.398  1.00 126.14 ? 620  LEU A N     1 
ATOM   8268  C  CA    . LEU I  4 620  ? 14.612  10.811   14.445  1.00 129.42 ? 620  LEU A CA    1 
ATOM   8269  C  C     . LEU I  4 620  ? 13.751  9.716    15.075  1.00 127.25 ? 620  LEU A C     1 
ATOM   8270  O  O     . LEU I  4 620  ? 12.637  9.971    15.495  1.00 133.33 ? 620  LEU A O     1 
ATOM   8271  C  CB    . LEU I  4 620  ? 15.099  11.814   15.500  1.00 128.28 ? 620  LEU A CB    1 
ATOM   8272  C  CG    . LEU I  4 620  ? 16.109  12.863   14.999  1.00 123.41 ? 620  LEU A CG    1 
ATOM   8273  C  CD1   . LEU I  4 620  ? 15.425  13.921   14.146  1.00 123.16 ? 620  LEU A CD1   1 
ATOM   8274  C  CD2   . LEU I  4 620  ? 16.836  13.551   16.138  1.00 124.83 ? 620  LEU A CD2   1 
ATOM   8275  N  N     . GLY I  4 621  ? 14.270  8.496    15.118  1.00 123.38 ? 621  GLY A N     1 
ATOM   8276  C  CA    . GLY I  4 621  ? 13.587  7.400    15.767  1.00 118.55 ? 621  GLY A CA    1 
ATOM   8277  C  C     . GLY I  4 621  ? 13.943  7.453    17.225  1.00 118.05 ? 621  GLY A C     1 
ATOM   8278  O  O     . GLY I  4 621  ? 15.123  7.484    17.562  1.00 128.28 ? 621  GLY A O     1 
ATOM   8279  N  N     . LEU I  4 622  ? 12.926  7.457    18.082  1.00 117.48 ? 622  LEU A N     1 
ATOM   8280  C  CA    . LEU I  4 622  ? 13.116  7.559    19.526  1.00 120.52 ? 622  LEU A CA    1 
ATOM   8281  C  C     . LEU I  4 622  ? 12.472  6.370    20.232  1.00 123.09 ? 622  LEU A C     1 
ATOM   8282  O  O     . LEU I  4 622  ? 11.443  5.865    19.781  1.00 119.20 ? 622  LEU A O     1 
ATOM   8283  C  CB    . LEU I  4 622  ? 12.513  8.876    20.025  1.00 125.85 ? 622  LEU A CB    1 
ATOM   8284  C  CG    . LEU I  4 622  ? 12.908  9.433    21.396  1.00 129.28 ? 622  LEU A CG    1 
ATOM   8285  C  CD1   . LEU I  4 622  ? 14.408  9.627    21.552  1.00 128.70 ? 622  LEU A CD1   1 
ATOM   8286  C  CD2   . LEU I  4 622  ? 12.215  10.772   21.552  1.00 124.26 ? 622  LEU A CD2   1 
ATOM   8287  N  N     . ARG I  4 623  ? 13.082  5.939    21.340  1.00 133.35 ? 623  ARG A N     1 
ATOM   8288  C  CA    . ARG I  4 623  ? 12.609  4.769    22.119  1.00 139.55 ? 623  ARG A CA    1 
ATOM   8289  C  C     . ARG I  4 623  ? 11.307  5.064    22.876  1.00 135.42 ? 623  ARG A C     1 
ATOM   8290  O  O     . ARG I  4 623  ? 10.370  4.259    22.869  1.00 125.71 ? 623  ARG A O     1 
ATOM   8291  C  CB    . ARG I  4 623  ? 13.691  4.289    23.112  1.00 145.96 ? 623  ARG A CB    1 
ATOM   8292  C  CG    . ARG I  4 623  ? 14.563  3.143    22.610  1.00 149.57 ? 623  ARG A CG    1 
ATOM   8293  C  CD    . ARG I  4 623  ? 13.945  1.777    22.892  1.00 152.70 ? 623  ARG A CD    1 
ATOM   8294  N  NE    . ARG I  4 623  ? 14.901  0.692    22.677  1.00 170.02 ? 623  ARG A NE    1 
ATOM   8295  C  CZ    . ARG I  4 623  ? 15.183  0.135    21.496  1.00 184.88 ? 623  ARG A CZ    1 
ATOM   8296  N  NH1   . ARG I  4 623  ? 14.569  0.539    20.382  1.00 190.43 ? 623  ARG A NH1   1 
ATOM   8297  N  NH2   . ARG I  4 623  ? 16.087  -0.841   21.426  1.00 185.35 ? 623  ARG A NH2   1 
ATOM   8298  N  N     . THR I  4 624  ? 11.268  6.222    23.528  1.00 129.69 ? 624  THR A N     1 
ATOM   8299  C  CA    . THR I  4 624  ? 10.123  6.632    24.321  1.00 123.95 ? 624  THR A CA    1 
ATOM   8300  C  C     . THR I  4 624  ? 8.844   6.554    23.518  1.00 124.96 ? 624  THR A C     1 
ATOM   8301  O  O     . THR I  4 624  ? 7.827   6.086    24.026  1.00 125.19 ? 624  THR A O     1 
ATOM   8302  C  CB    . THR I  4 624  ? 10.284  8.083    24.809  1.00 125.33 ? 624  THR A CB    1 
ATOM   8303  O  OG1   . THR I  4 624  ? 11.519  8.214    25.516  1.00 134.21 ? 624  THR A OG1   1 
ATOM   8304  C  CG2   . THR I  4 624  ? 9.153   8.473    25.716  1.00 124.96 ? 624  THR A CG2   1 
ATOM   8305  N  N     . LEU I  4 625  ? 8.884   7.029    22.272  1.00 123.73 ? 625  LEU A N     1 
ATOM   8306  C  CA    . LEU I  4 625  ? 7.685   7.028    21.445  1.00 122.39 ? 625  LEU A CA    1 
ATOM   8307  C  C     . LEU I  4 625  ? 7.182   5.596    21.234  1.00 122.44 ? 625  LEU A C     1 
ATOM   8308  O  O     . LEU I  4 625  ? 6.004   5.304    21.440  1.00 128.18 ? 625  LEU A O     1 
ATOM   8309  C  CB    . LEU I  4 625  ? 7.928   7.750    20.125  1.00 115.09 ? 625  LEU A CB    1 
ATOM   8310  C  CG    . LEU I  4 625  ? 8.068   9.258    20.269  1.00 109.92 ? 625  LEU A CG    1 
ATOM   8311  C  CD1   . LEU I  4 625  ? 8.435   9.903    18.941  1.00 116.48 ? 625  LEU A CD1   1 
ATOM   8312  C  CD2   . LEU I  4 625  ? 6.759   9.829    20.758  1.00 108.22 ? 625  LEU A CD2   1 
ATOM   8313  N  N     . THR I  4 626  ? 8.086   4.696    20.886  1.00 122.01 ? 626  THR A N     1 
ATOM   8314  C  CA    . THR I  4 626  ? 7.707   3.298    20.707  1.00 125.31 ? 626  THR A CA    1 
ATOM   8315  C  C     . THR I  4 626  ? 7.175   2.706    22.009  1.00 124.67 ? 626  THR A C     1 
ATOM   8316  O  O     . THR I  4 626  ? 6.180   1.984    22.024  1.00 120.30 ? 626  THR A O     1 
ATOM   8317  C  CB    . THR I  4 626  ? 8.892   2.459    20.198  1.00 127.03 ? 626  THR A CB    1 
ATOM   8318  O  OG1   . THR I  4 626  ? 9.205   2.853    18.850  1.00 137.95 ? 626  THR A OG1   1 
ATOM   8319  C  CG2   . THR I  4 626  ? 8.545   0.994    20.201  1.00 124.17 ? 626  THR A CG2   1 
ATOM   8320  N  N     . PHE I  4 627  ? 7.849   3.029    23.103  1.00 129.04 ? 627  PHE A N     1 
ATOM   8321  C  CA    . PHE I  4 627  ? 7.465   2.526    24.414  1.00 128.89 ? 627  PHE A CA    1 
ATOM   8322  C  C     . PHE I  4 627  ? 6.053   2.974    24.800  1.00 130.11 ? 627  PHE A C     1 
ATOM   8323  O  O     . PHE I  4 627  ? 5.264   2.185    25.301  1.00 133.04 ? 627  PHE A O     1 
ATOM   8324  C  CB    . PHE I  4 627  ? 8.472   2.993    25.473  1.00 130.94 ? 627  PHE A CB    1 
ATOM   8325  C  CG    . PHE I  4 627  ? 7.993   2.800    26.882  1.00 128.84 ? 627  PHE A CG    1 
ATOM   8326  C  CD1   . PHE I  4 627  ? 7.938   1.536    27.429  1.00 124.76 ? 627  PHE A CD1   1 
ATOM   8327  C  CD2   . PHE I  4 627  ? 7.591   3.879    27.649  1.00 129.19 ? 627  PHE A CD2   1 
ATOM   8328  C  CE1   . PHE I  4 627  ? 7.499   1.348    28.711  1.00 123.02 ? 627  PHE A CE1   1 
ATOM   8329  C  CE2   . PHE I  4 627  ? 7.151   3.695    28.941  1.00 130.36 ? 627  PHE A CE2   1 
ATOM   8330  C  CZ    . PHE I  4 627  ? 7.101   2.426    29.470  1.00 127.31 ? 627  PHE A CZ    1 
ATOM   8331  N  N     . LEU I  4 628  ? 5.748   4.246    24.565  1.00 131.23 ? 628  LEU A N     1 
ATOM   8332  C  CA    . LEU I  4 628  ? 4.443   4.806    24.890  1.00 124.67 ? 628  LEU A CA    1 
ATOM   8333  C  C     . LEU I  4 628  ? 3.310   4.128    24.128  1.00 122.83 ? 628  LEU A C     1 
ATOM   8334  O  O     . LEU I  4 628  ? 2.214   3.983    24.664  1.00 112.15 ? 628  LEU A O     1 
ATOM   8335  C  CB    . LEU I  4 628  ? 4.438   6.303    24.589  1.00 130.48 ? 628  LEU A CB    1 
ATOM   8336  C  CG    . LEU I  4 628  ? 5.202   7.165    25.596  1.00 129.40 ? 628  LEU A CG    1 
ATOM   8337  C  CD1   . LEU I  4 628  ? 5.522   8.517    24.972  1.00 128.91 ? 628  LEU A CD1   1 
ATOM   8338  C  CD2   . LEU I  4 628  ? 4.434   7.316    26.908  1.00 122.57 ? 628  LEU A CD2   1 
ATOM   8339  N  N     . ASP I  4 629  ? 3.580   3.729    22.885  1.00 125.00 ? 629  ASP A N     1 
ATOM   8340  C  CA    . ASP I  4 629  ? 2.620   2.984    22.080  1.00 121.03 ? 629  ASP A CA    1 
ATOM   8341  C  C     . ASP I  4 629  ? 2.297   1.642    22.721  1.00 122.71 ? 629  ASP A C     1 
ATOM   8342  O  O     . ASP I  4 629  ? 1.116   1.286    22.867  1.00 109.64 ? 629  ASP A O     1 
ATOM   8343  C  CB    . ASP I  4 629  ? 3.168   2.790    20.662  1.00 124.79 ? 629  ASP A CB    1 
ATOM   8344  C  CG    . ASP I  4 629  ? 3.164   4.080    19.868  1.00 132.27 ? 629  ASP A CG    1 
ATOM   8345  O  OD1   . ASP I  4 629  ? 2.982   5.159    20.504  1.00 132.40 ? 629  ASP A OD1   1 
ATOM   8346  O  OD2   . ASP I  4 629  ? 3.323   4.016    18.625  1.00 129.47 ? 629  ASP A OD2   1 
ATOM   8347  N  N     . GLU I  4 630  ? 3.349   0.913    23.108  1.00 123.51 ? 630  GLU A N     1 
ATOM   8348  C  CA    . GLU I  4 630  ? 3.183   -0.380   23.752  1.00 121.88 ? 630  GLU A CA    1 
ATOM   8349  C  C     . GLU I  4 630  ? 2.422   -0.195   25.042  1.00 113.48 ? 630  GLU A C     1 
ATOM   8350  O  O     . GLU I  4 630  ? 1.567   -1.004   25.370  1.00 122.56 ? 630  GLU A O     1 
ATOM   8351  C  CB    . GLU I  4 630  ? 4.531   -1.064   24.008  1.00 133.22 ? 630  GLU A CB    1 
ATOM   8352  C  CG    . GLU I  4 630  ? 5.254   -1.495   22.734  1.00 150.76 ? 630  GLU A CG    1 
ATOM   8353  C  CD    . GLU I  4 630  ? 4.489   -2.550   21.940  1.00 149.08 ? 630  GLU A CD    1 
ATOM   8354  O  OE1   . GLU I  4 630  ? 3.880   -3.418   22.584  1.00 139.84 ? 630  GLU A OE1   1 
ATOM   8355  O  OE2   . GLU I  4 630  ? 4.493   -2.517   20.684  1.00 151.75 ? 630  GLU A OE2   1 
ATOM   8356  N  N     . ALA I  4 631  ? 2.710   0.873    25.770  1.00 110.79 ? 631  ALA A N     1 
ATOM   8357  C  CA    . ALA I  4 631  ? 1.975   1.146    27.009  1.00 117.07 ? 631  ALA A CA    1 
ATOM   8358  C  C     . ALA I  4 631  ? 0.468   1.279    26.743  1.00 120.44 ? 631  ALA A C     1 
ATOM   8359  O  O     . ALA I  4 631  ? -0.344  0.589    27.361  1.00 119.44 ? 631  ALA A O     1 
ATOM   8360  C  CB    . ALA I  4 631  ? 2.501   2.395    27.700  1.00 114.02 ? 631  ALA A CB    1 
ATOM   8361  N  N     . ARG I  4 632  ? 0.108   2.160    25.814  1.00 119.50 ? 632  ARG A N     1 
ATOM   8362  C  CA    . ARG I  4 632  ? -1.280  2.337    25.398  1.00 120.44 ? 632  ARG A CA    1 
ATOM   8363  C  C     . ARG I  4 632  ? -1.921  1.030    24.935  1.00 121.62 ? 632  ARG A C     1 
ATOM   8364  O  O     . ARG I  4 632  ? -3.062  0.747    25.274  1.00 120.09 ? 632  ARG A O     1 
ATOM   8365  C  CB    . ARG I  4 632  ? -1.345  3.347    24.256  1.00 133.13 ? 632  ARG A CB    1 
ATOM   8366  C  CG    . ARG I  4 632  ? -2.738  3.602    23.707  1.00 142.06 ? 632  ARG A CG    1 
ATOM   8367  C  CD    . ARG I  4 632  ? -2.683  4.352    22.382  1.00 146.66 ? 632  ARG A CD    1 
ATOM   8368  N  NE    . ARG I  4 632  ? -2.359  5.766    22.552  1.00 151.69 ? 632  ARG A NE    1 
ATOM   8369  C  CZ    . ARG I  4 632  ? -2.415  6.669    21.576  1.00 164.13 ? 632  ARG A CZ    1 
ATOM   8370  N  NH1   . ARG I  4 632  ? -2.766  6.313    20.341  1.00 165.37 ? 632  ARG A NH1   1 
ATOM   8371  N  NH2   . ARG I  4 632  ? -2.114  7.938    21.834  1.00 170.69 ? 632  ARG A NH2   1 
ATOM   8372  N  N     . ARG I  4 633  ? -1.186  0.247    24.145  1.00 123.36 ? 633  ARG A N     1 
ATOM   8373  C  CA    . ARG I  4 633  ? -1.697  -1.013   23.629  1.00 114.55 ? 633  ARG A CA    1 
ATOM   8374  C  C     . ARG I  4 633  ? -2.073  -1.919   24.775  1.00 116.45 ? 633  ARG A C     1 
ATOM   8375  O  O     . ARG I  4 633  ? -3.178  -2.440   24.786  1.00 117.87 ? 633  ARG A O     1 
ATOM   8376  C  CB    . ARG I  4 633  ? -0.657  -1.698   22.750  1.00 117.72 ? 633  ARG A CB    1 
ATOM   8377  C  CG    . ARG I  4 633  ? -1.175  -2.905   21.981  1.00 121.31 ? 633  ARG A CG    1 
ATOM   8378  C  CD    . ARG I  4 633  ? -0.081  -3.558   21.163  1.00 121.89 ? 633  ARG A CD    1 
ATOM   8379  N  NE    . ARG I  4 633  ? 1.046   -3.955   22.004  1.00 130.64 ? 633  ARG A NE    1 
ATOM   8380  C  CZ    . ARG I  4 633  ? 1.079   -5.040   22.785  1.00 134.90 ? 633  ARG A CZ    1 
ATOM   8381  N  NH1   . ARG I  4 633  ? 0.035   -5.863   22.856  1.00 138.92 ? 633  ARG A NH1   1 
ATOM   8382  N  NH2   . ARG I  4 633  ? 2.167   -5.310   23.506  1.00 132.13 ? 633  ARG A NH2   1 
ATOM   8383  N  N     . ILE I  4 634  ? -1.157  -2.094   25.737  1.00 119.55 ? 634  ILE A N     1 
ATOM   8384  C  CA    . ILE I  4 634  ? -1.396  -2.965   26.909  1.00 117.97 ? 634  ILE A CA    1 
ATOM   8385  C  C     . ILE I  4 634  ? -2.482  -2.346   27.806  1.00 115.45 ? 634  ILE A C     1 
ATOM   8386  O  O     . ILE I  4 634  ? -3.363  -3.047   28.302  1.00 109.45 ? 634  ILE A O     1 
ATOM   8387  C  CB    . ILE I  4 634  ? -0.086  -3.256   27.705  1.00 114.94 ? 634  ILE A CB    1 
ATOM   8388  C  CG1   . ILE I  4 634  ? 0.960   -3.931   26.806  1.00 115.09 ? 634  ILE A CG1   1 
ATOM   8389  C  CG2   . ILE I  4 634  ? -0.359  -4.202   28.866  1.00 111.13 ? 634  ILE A CG2   1 
ATOM   8390  C  CD1   . ILE I  4 634  ? 2.342   -4.041   27.420  1.00 114.02 ? 634  ILE A CD1   1 
ATOM   8391  N  N     . VAL I  4 635  ? -2.423  -1.026   27.968  1.00 114.43 ? 635  VAL A N     1 
ATOM   8392  C  CA    . VAL I  4 635  ? -3.368  -0.298   28.800  1.00 115.72 ? 635  VAL A CA    1 
ATOM   8393  C  C     . VAL I  4 635  ? -4.799  -0.475   28.303  1.00 119.15 ? 635  VAL A C     1 
ATOM   8394  O  O     . VAL I  4 635  ? -5.717  -0.661   29.106  1.00 117.42 ? 635  VAL A O     1 
ATOM   8395  C  CB    . VAL I  4 635  ? -3.040  1.207    28.825  1.00 115.08 ? 635  VAL A CB    1 
ATOM   8396  C  CG1   . VAL I  4 635  ? -4.178  1.998    29.441  1.00 111.51 ? 635  VAL A CG1   1 
ATOM   8397  C  CG2   . VAL I  4 635  ? -1.751  1.471    29.585  1.00 116.23 ? 635  VAL A CG2   1 
ATOM   8398  N  N     . LYS I  4 636  ? -4.991  -0.415   26.983  1.00 127.92 ? 636  LYS A N     1 
ATOM   8399  C  CA    . LYS I  4 636  ? -6.335  -0.572   26.402  1.00 131.27 ? 636  LYS A CA    1 
ATOM   8400  C  C     . LYS I  4 636  ? -6.810  -2.004   26.490  1.00 126.28 ? 636  LYS A C     1 
ATOM   8401  O  O     . LYS I  4 636  ? -7.994  -2.244   26.580  1.00 134.79 ? 636  LYS A O     1 
ATOM   8402  C  CB    . LYS I  4 636  ? -6.426  -0.077   24.953  1.00 134.28 ? 636  LYS A CB    1 
ATOM   8403  C  CG    . LYS I  4 636  ? -5.703  -0.929   23.916  1.00 150.54 ? 636  LYS A CG    1 
ATOM   8404  C  CD    . LYS I  4 636  ? -5.834  -0.337   22.501  1.00 160.58 ? 636  LYS A CD    1 
ATOM   8405  C  CE    . LYS I  4 636  ? -5.127  -1.161   21.417  1.00 152.15 ? 636  LYS A CE    1 
ATOM   8406  N  NZ    . LYS I  4 636  ? -5.005  -0.387   20.143  1.00 136.69 ? 636  LYS A NZ    1 
ATOM   8407  N  N     . GLU I  4 637  ? -5.887  -2.950   26.480  1.00 124.54 ? 637  GLU A N     1 
ATOM   8408  C  CA    . GLU I  4 637  ? -6.239  -4.360   26.572  1.00 126.52 ? 637  GLU A CA    1 
ATOM   8409  C  C     . GLU I  4 637  ? -6.554  -4.712   28.013  1.00 128.52 ? 637  GLU A C     1 
ATOM   8410  O  O     . GLU I  4 637  ? -7.544  -5.389   28.301  1.00 125.06 ? 637  GLU A O     1 
ATOM   8411  C  CB    . GLU I  4 637  ? -5.070  -5.217   26.066  1.00 131.01 ? 637  GLU A CB    1 
ATOM   8412  C  CG    . GLU I  4 637  ? -5.290  -6.718   26.066  1.00 127.56 ? 637  GLU A CG    1 
ATOM   8413  C  CD    . GLU I  4 637  ? -3.979  -7.454   26.074  1.00 136.98 ? 637  GLU A CD    1 
ATOM   8414  O  OE1   . GLU I  4 637  ? -3.342  -7.520   25.006  1.00 163.33 ? 637  GLU A OE1   1 
ATOM   8415  O  OE2   . GLU I  4 637  ? -3.567  -7.942   27.147  1.00 138.76 ? 637  GLU A OE2   1 
ATOM   8416  N  N     . SER I  4 638  ? -5.694  -4.246   28.914  1.00 133.29 ? 638  SER A N     1 
ATOM   8417  C  CA    . SER I  4 638  ? -5.748  -4.620   30.325  1.00 135.14 ? 638  SER A CA    1 
ATOM   8418  C  C     . SER I  4 638  ? -7.103  -4.319   30.938  1.00 142.95 ? 638  SER A C     1 
ATOM   8419  O  O     . SER I  4 638  ? -7.666  -5.153   31.652  1.00 159.92 ? 638  SER A O     1 
ATOM   8420  C  CB    . SER I  4 638  ? -4.651  -3.876   31.094  1.00 128.44 ? 638  SER A CB    1 
ATOM   8421  O  OG    . SER I  4 638  ? -4.580  -4.280   32.439  1.00 131.94 ? 638  SER A OG    1 
ATOM   8422  N  N     . LYS I  4 639  ? -7.629  -3.135   30.639  1.00 146.40 ? 639  LYS A N     1 
ATOM   8423  C  CA    . LYS I  4 639  ? -8.888  -2.680   31.216  1.00 142.87 ? 639  LYS A CA    1 
ATOM   8424  C  C     . LYS I  4 639  ? -9.530  -1.552   30.391  1.00 137.22 ? 639  LYS A C     1 
ATOM   8425  O  O     . LYS I  4 639  ? -9.938  -0.524   30.931  1.00 135.85 ? 639  LYS A O     1 
ATOM   8426  C  CB    . LYS I  4 639  ? -8.637  -2.237   32.659  1.00 143.26 ? 639  LYS A CB    1 
ATOM   8427  C  CG    . LYS I  4 639  ? -7.560  -1.174   32.786  1.00 143.06 ? 639  LYS A CG    1 
ATOM   8428  C  CD    . LYS I  4 639  ? -7.015  -1.082   34.202  1.00 149.78 ? 639  LYS A CD    1 
ATOM   8429  C  CE    . LYS I  4 639  ? -5.938  -2.128   34.468  1.00 149.53 ? 639  LYS A CE    1 
ATOM   8430  N  NZ    . LYS I  4 639  ? -5.179  -1.900   35.736  1.00 141.74 ? 639  LYS A NZ    1 
ATOM   8431  N  N     . GLY I  4 640  ? -9.605  -1.760   29.078  1.00 135.18 ? 640  GLY A N     1 
ATOM   8432  C  CA    . GLY I  4 640  ? -10.382 -0.904   28.162  1.00 145.49 ? 640  GLY A CA    1 
ATOM   8433  C  C     . GLY I  4 640  ? -10.071 0.585    28.152  1.00 146.32 ? 640  GLY A C     1 
ATOM   8434  O  O     . GLY I  4 640  ? -10.914 1.405    27.751  1.00 146.08 ? 640  GLY A O     1 
ATOM   8435  N  N     . VAL I  4 641  ? -8.857  0.928    28.579  1.00 144.26 ? 641  VAL A N     1 
ATOM   8436  C  CA    . VAL I  4 641  ? -8.457  2.324    28.785  1.00 139.17 ? 641  VAL A CA    1 
ATOM   8437  C  C     . VAL I  4 641  ? -7.707  2.906    27.561  1.00 142.17 ? 641  VAL A C     1 
ATOM   8438  O  O     . VAL I  4 641  ? -6.547  2.585    27.278  1.00 145.89 ? 641  VAL A O     1 
ATOM   8439  C  CB    . VAL I  4 641  ? -7.602  2.437    30.052  1.00 133.97 ? 641  VAL A CB    1 
ATOM   8440  C  CG1   . VAL I  4 641  ? -7.180  3.858    30.289  1.00 129.52 ? 641  VAL A CG1   1 
ATOM   8441  C  CG2   . VAL I  4 641  ? -8.388  1.959    31.241  1.00 135.44 ? 641  VAL A CG2   1 
ATOM   8442  N  N     . GLU I  4 642  ? -8.393  3.773    26.837  1.00 143.57 ? 642  GLU A N     1 
ATOM   8443  C  CA    . GLU I  4 642  ? -7.831  4.430    25.667  1.00 143.37 ? 642  GLU A CA    1 
ATOM   8444  C  C     . GLU I  4 642  ? -7.012  5.651    26.074  1.00 141.75 ? 642  GLU A C     1 
ATOM   8445  O  O     . GLU I  4 642  ? -7.564  6.733    26.312  1.00 130.58 ? 642  GLU A O     1 
ATOM   8446  C  CB    . GLU I  4 642  ? -8.957  4.857    24.728  1.00 146.90 ? 642  GLU A CB    1 
ATOM   8447  C  CG    . GLU I  4 642  ? -9.460  3.747    23.827  1.00 142.36 ? 642  GLU A CG    1 
ATOM   8448  C  CD    . GLU I  4 642  ? -8.660  3.659    22.541  1.00 149.24 ? 642  GLU A CD    1 
ATOM   8449  O  OE1   . GLU I  4 642  ? -7.506  4.153    22.499  1.00 143.53 ? 642  GLU A OE1   1 
ATOM   8450  O  OE2   . GLU I  4 642  ? -9.196  3.105    21.560  1.00 160.67 ? 642  GLU A OE2   1 
ATOM   8451  N  N     . LEU I  4 643  ? -5.697  5.470    26.149  1.00 136.32 ? 643  LEU A N     1 
ATOM   8452  C  CA    . LEU I  4 643  ? -4.809  6.553    26.535  1.00 133.79 ? 643  LEU A CA    1 
ATOM   8453  C  C     . LEU I  4 643  ? -4.613  7.515    25.377  1.00 127.48 ? 643  LEU A C     1 
ATOM   8454  O  O     . LEU I  4 643  ? -4.208  7.085    24.300  1.00 135.55 ? 643  LEU A O     1 
ATOM   8455  C  CB    . LEU I  4 643  ? -3.453  5.998    26.973  1.00 130.64 ? 643  LEU A CB    1 
ATOM   8456  C  CG    . LEU I  4 643  ? -3.370  5.516    28.412  1.00 128.67 ? 643  LEU A CG    1 
ATOM   8457  C  CD1   . LEU I  4 643  ? -2.071  4.759    28.613  1.00 130.85 ? 643  LEU A CD1   1 
ATOM   8458  C  CD2   . LEU I  4 643  ? -3.442  6.706    29.354  1.00 132.52 ? 643  LEU A CD2   1 
ATOM   8459  N  N     . ASP I  4 644  ? -4.896  8.801    25.604  1.00 121.42 ? 644  ASP A N     1 
ATOM   8460  C  CA    . ASP I  4 644  ? -4.652  9.864    24.612  1.00 123.63 ? 644  ASP A CA    1 
ATOM   8461  C  C     . ASP I  4 644  ? -3.582  10.828   25.118  1.00 123.53 ? 644  ASP A C     1 
ATOM   8462  O  O     . ASP I  4 644  ? -3.879  11.813   25.786  1.00 120.00 ? 644  ASP A O     1 
ATOM   8463  C  CB    . ASP I  4 644  ? -5.948  10.627   24.287  1.00 124.36 ? 644  ASP A CB    1 
ATOM   8464  C  CG    . ASP I  4 644  ? -5.840  11.483   23.015  1.00 127.91 ? 644  ASP A CG    1 
ATOM   8465  O  OD1   . ASP I  4 644  ? -4.707  11.842   22.620  1.00 143.05 ? 644  ASP A OD1   1 
ATOM   8466  O  OD2   . ASP I  4 644  ? -6.890  11.798   22.400  1.00 122.32 ? 644  ASP A OD2   1 
ATOM   8467  N  N     . TYR I  4 645  ? -2.333  10.554   24.765  1.00 129.73 ? 645  TYR A N     1 
ATOM   8468  C  CA    . TYR I  4 645  ? -1.213  11.321   25.298  1.00 129.21 ? 645  TYR A CA    1 
ATOM   8469  C  C     . TYR I  4 645  ? -1.337  12.809   25.005  1.00 125.99 ? 645  TYR A C     1 
ATOM   8470  O  O     . TYR I  4 645  ? -0.893  13.616   25.807  1.00 122.49 ? 645  TYR A O     1 
ATOM   8471  C  CB    . TYR I  4 645  ? 0.114   10.794   24.750  1.00 135.29 ? 645  TYR A CB    1 
ATOM   8472  C  CG    . TYR I  4 645  ? 0.468   9.399    25.203  1.00 127.83 ? 645  TYR A CG    1 
ATOM   8473  C  CD1   . TYR I  4 645  ? 0.478   8.341    24.305  1.00 123.52 ? 645  TYR A CD1   1 
ATOM   8474  C  CD2   . TYR I  4 645  ? 0.790   9.146    26.522  1.00 125.52 ? 645  TYR A CD2   1 
ATOM   8475  C  CE1   . TYR I  4 645  ? 0.797   7.072    24.712  1.00 125.35 ? 645  TYR A CE1   1 
ATOM   8476  C  CE2   . TYR I  4 645  ? 1.116   7.871    26.935  1.00 127.04 ? 645  TYR A CE2   1 
ATOM   8477  C  CZ    . TYR I  4 645  ? 1.120   6.842    26.009  1.00 124.53 ? 645  TYR A CZ    1 
ATOM   8478  O  OH    . TYR I  4 645  ? 1.428   5.549    26.326  1.00 134.57 ? 645  TYR A OH    1 
ATOM   8479  N  N     . ASP I  4 646  ? -1.956  13.154   23.872  1.00 138.05 ? 646  ASP A N     1 
ATOM   8480  C  CA    . ASP I  4 646  ? -2.067  14.545   23.407  1.00 142.97 ? 646  ASP A CA    1 
ATOM   8481  C  C     . ASP I  4 646  ? -3.261  15.250   24.032  1.00 139.06 ? 646  ASP A C     1 
ATOM   8482  O  O     . ASP I  4 646  ? -3.618  16.346   23.616  1.00 154.40 ? 646  ASP A O     1 
ATOM   8483  C  CB    . ASP I  4 646  ? -2.196  14.608   21.869  1.00 153.23 ? 646  ASP A CB    1 
ATOM   8484  C  CG    . ASP I  4 646  ? -1.015  13.944   21.126  1.00 163.05 ? 646  ASP A CG    1 
ATOM   8485  O  OD1   . ASP I  4 646  ? -0.030  13.520   21.779  1.00 167.57 ? 646  ASP A OD1   1 
ATOM   8486  O  OD2   . ASP I  4 646  ? -1.072  13.857   19.875  1.00 161.78 ? 646  ASP A OD2   1 
ATOM   8487  N  N     . ARG I  4 647  ? -3.875  14.622   25.031  1.00 141.50 ? 647  ARG A N     1 
ATOM   8488  C  CA    . ARG I  4 647  ? -5.069  15.169   25.693  1.00 139.13 ? 647  ARG A CA    1 
ATOM   8489  C  C     . ARG I  4 647  ? -5.073  14.921   27.222  1.00 138.77 ? 647  ARG A C     1 
ATOM   8490  O  O     . ARG I  4 647  ? -6.128  14.944   27.859  1.00 134.84 ? 647  ARG A O     1 
ATOM   8491  C  CB    . ARG I  4 647  ? -6.293  14.509   25.073  1.00 138.93 ? 647  ARG A CB    1 
ATOM   8492  C  CG    . ARG I  4 647  ? -7.514  15.385   24.977  1.00 140.72 ? 647  ARG A CG    1 
ATOM   8493  C  CD    . ARG I  4 647  ? -8.694  14.558   24.482  1.00 151.28 ? 647  ARG A CD    1 
ATOM   8494  N  NE    . ARG I  4 647  ? -9.639  15.357   23.697  1.00 157.60 ? 647  ARG A NE    1 
ATOM   8495  C  CZ    . ARG I  4 647  ? -10.746 14.876   23.129  1.00 159.29 ? 647  ARG A CZ    1 
ATOM   8496  N  NH1   . ARG I  4 647  ? -11.078 13.589   23.247  1.00 159.08 ? 647  ARG A NH1   1 
ATOM   8497  N  NH2   . ARG I  4 647  ? -11.528 15.688   22.434  1.00 162.69 ? 647  ARG A NH2   1 
ATOM   8498  N  N     . LEU I  4 648  ? -3.896  14.676   27.799  1.00 135.55 ? 648  LEU A N     1 
ATOM   8499  C  CA    . LEU I  4 648  ? -3.756  14.467   29.232  1.00 135.23 ? 648  LEU A CA    1 
ATOM   8500  C  C     . LEU I  4 648  ? -3.691  15.801   29.992  1.00 137.28 ? 648  LEU A C     1 
ATOM   8501  O  O     . LEU I  4 648  ? -3.220  16.789   29.459  1.00 148.98 ? 648  LEU A O     1 
ATOM   8502  C  CB    . LEU I  4 648  ? -2.462  13.710   29.520  1.00 133.51 ? 648  LEU A CB    1 
ATOM   8503  C  CG    . LEU I  4 648  ? -2.283  12.337   28.906  1.00 128.75 ? 648  LEU A CG    1 
ATOM   8504  C  CD1   . LEU I  4 648  ? -0.966  11.774   29.417  1.00 123.41 ? 648  LEU A CD1   1 
ATOM   8505  C  CD2   . LEU I  4 648  ? -3.455  11.438   29.258  1.00 127.04 ? 648  LEU A CD2   1 
ATOM   8506  N  N     . PRO I  4 649  ? -4.143  15.822   31.253  1.00 137.00 ? 649  PRO A N     1 
ATOM   8507  C  CA    . PRO I  4 649  ? -3.966  17.023   32.050  1.00 131.80 ? 649  PRO A CA    1 
ATOM   8508  C  C     . PRO I  4 649  ? -2.518  17.131   32.481  1.00 133.86 ? 649  PRO A C     1 
ATOM   8509  O  O     . PRO I  4 649  ? -1.937  16.122   32.880  1.00 144.86 ? 649  PRO A O     1 
ATOM   8510  C  CB    . PRO I  4 649  ? -4.890  16.785   33.248  1.00 136.94 ? 649  PRO A CB    1 
ATOM   8511  C  CG    . PRO I  4 649  ? -4.997  15.302   33.369  1.00 137.05 ? 649  PRO A CG    1 
ATOM   8512  C  CD    . PRO I  4 649  ? -4.847  14.749   31.987  1.00 138.32 ? 649  PRO A CD    1 
ATOM   8513  N  N     . LEU I  4 650  ? -1.942  18.331   32.405  1.00 131.47 ? 650  LEU A N     1 
ATOM   8514  C  CA    . LEU I  4 650  ? -0.524  18.526   32.745  1.00 134.18 ? 650  LEU A CA    1 
ATOM   8515  C  C     . LEU I  4 650  ? -0.280  18.998   34.179  1.00 133.51 ? 650  LEU A C     1 
ATOM   8516  O  O     . LEU I  4 650  ? 0.830   19.420   34.503  1.00 130.00 ? 650  LEU A O     1 
ATOM   8517  C  CB    . LEU I  4 650  ? 0.147   19.478   31.745  1.00 142.02 ? 650  LEU A CB    1 
ATOM   8518  C  CG    . LEU I  4 650  ? -0.423  20.884   31.472  1.00 154.92 ? 650  LEU A CG    1 
ATOM   8519  C  CD1   . LEU I  4 650  ? -0.294  21.865   32.644  1.00 152.54 ? 650  LEU A CD1   1 
ATOM   8520  C  CD2   . LEU I  4 650  ? 0.250   21.443   30.215  1.00 154.31 ? 650  LEU A CD2   1 
ATOM   8521  N  N     . ASP I  4 651  ? -1.306  18.898   35.028  1.00 139.11 ? 651  ASP A N     1 
ATOM   8522  C  CA    . ASP I  4 651  ? -1.231  19.283   36.449  1.00 139.48 ? 651  ASP A CA    1 
ATOM   8523  C  C     . ASP I  4 651  ? -1.729  18.167   37.387  1.00 140.73 ? 651  ASP A C     1 
ATOM   8524  O  O     . ASP I  4 651  ? -2.302  18.433   38.442  1.00 138.19 ? 651  ASP A O     1 
ATOM   8525  C  CB    . ASP I  4 651  ? -2.058  20.543   36.676  1.00 142.43 ? 651  ASP A CB    1 
ATOM   8526  C  CG    . ASP I  4 651  ? -3.524  20.332   36.364  1.00 148.12 ? 651  ASP A CG    1 
ATOM   8527  O  OD1   . ASP I  4 651  ? -3.825  19.493   35.490  1.00 140.29 ? 651  ASP A OD1   1 
ATOM   8528  O  OD2   . ASP I  4 651  ? -4.376  20.992   36.997  1.00 168.66 ? 651  ASP A OD2   1 
ATOM   8529  N  N     . ASP I  4 652  ? -1.484  16.920   36.998  1.00 140.79 ? 652  ASP A N     1 
ATOM   8530  C  CA    . ASP I  4 652  ? -1.965  15.755   37.731  1.00 138.55 ? 652  ASP A CA    1 
ATOM   8531  C  C     . ASP I  4 652  ? -1.108  15.571   38.983  1.00 140.37 ? 652  ASP A C     1 
ATOM   8532  O  O     . ASP I  4 652  ? 0.114   15.511   38.889  1.00 151.09 ? 652  ASP A O     1 
ATOM   8533  C  CB    . ASP I  4 652  ? -1.853  14.533   36.811  1.00 139.84 ? 652  ASP A CB    1 
ATOM   8534  C  CG    . ASP I  4 652  ? -2.447  13.275   37.399  1.00 140.20 ? 652  ASP A CG    1 
ATOM   8535  O  OD1   . ASP I  4 652  ? -3.678  13.248   37.613  1.00 150.65 ? 652  ASP A OD1   1 
ATOM   8536  O  OD2   . ASP I  4 652  ? -1.682  12.298   37.592  1.00 130.35 ? 652  ASP A OD2   1 
ATOM   8537  N  N     . PRO I  4 653  ? -1.738  15.476   40.162  1.00 139.03 ? 653  PRO A N     1 
ATOM   8538  C  CA    . PRO I  4 653  ? -0.947  15.326   41.395  1.00 139.97 ? 653  PRO A CA    1 
ATOM   8539  C  C     . PRO I  4 653  ? -0.123  14.037   41.480  1.00 138.57 ? 653  PRO A C     1 
ATOM   8540  O  O     . PRO I  4 653  ? 1.057   14.084   41.831  1.00 144.04 ? 653  PRO A O     1 
ATOM   8541  C  CB    . PRO I  4 653  ? -2.011  15.368   42.506  1.00 141.90 ? 653  PRO A CB    1 
ATOM   8542  C  CG    . PRO I  4 653  ? -3.291  14.990   41.838  1.00 139.87 ? 653  PRO A CG    1 
ATOM   8543  C  CD    . PRO I  4 653  ? -3.190  15.485   40.423  1.00 136.26 ? 653  PRO A CD    1 
ATOM   8544  N  N     . LYS I  4 654  ? -0.737  12.905   41.145  1.00 137.60 ? 654  LYS A N     1 
ATOM   8545  C  CA    . LYS I  4 654  ? -0.084  11.596   41.295  1.00 136.79 ? 654  LYS A CA    1 
ATOM   8546  C  C     . LYS I  4 654  ? 1.256   11.501   40.555  1.00 139.62 ? 654  LYS A C     1 
ATOM   8547  O  O     . LYS I  4 654  ? 2.180   10.828   41.018  1.00 134.05 ? 654  LYS A O     1 
ATOM   8548  C  CB    . LYS I  4 654  ? -1.011  10.481   40.814  1.00 134.62 ? 654  LYS A CB    1 
ATOM   8549  C  CG    . LYS I  4 654  ? -2.252  10.282   41.661  1.00 141.38 ? 654  LYS A CG    1 
ATOM   8550  C  CD    . LYS I  4 654  ? -1.915  9.590    42.970  1.00 140.51 ? 654  LYS A CD    1 
ATOM   8551  C  CE    . LYS I  4 654  ? -3.155  9.308    43.795  1.00 138.37 ? 654  LYS A CE    1 
ATOM   8552  N  NZ    . LYS I  4 654  ? -2.756  8.735    45.105  1.00 149.42 ? 654  LYS A NZ    1 
ATOM   8553  N  N     . THR I  4 655  ? 1.344   12.174   39.408  1.00 141.31 ? 655  THR A N     1 
ATOM   8554  C  CA    . THR I  4 655  ? 2.535   12.141   38.565  1.00 137.33 ? 655  THR A CA    1 
ATOM   8555  C  C     . THR I  4 655  ? 3.692   12.870   39.213  1.00 131.18 ? 655  THR A C     1 
ATOM   8556  O  O     . THR I  4 655  ? 4.825   12.411   39.176  1.00 123.32 ? 655  THR A O     1 
ATOM   8557  C  CB    . THR I  4 655  ? 2.272   12.821   37.213  1.00 138.65 ? 655  THR A CB    1 
ATOM   8558  O  OG1   . THR I  4 655  ? 1.145   12.198   36.580  1.00 142.66 ? 655  THR A OG1   1 
ATOM   8559  C  CG2   . THR I  4 655  ? 3.501   12.738   36.326  1.00 132.57 ? 655  THR A CG2   1 
ATOM   8560  N  N     . PHE I  4 656  ? 3.407   14.026   39.789  1.00 132.91 ? 656  PHE A N     1 
ATOM   8561  C  CA    . PHE I  4 656  ? 4.457   14.843   40.388  1.00 134.13 ? 656  PHE A CA    1 
ATOM   8562  C  C     . PHE I  4 656  ? 4.897   14.264   41.742  1.00 138.25 ? 656  PHE A C     1 
ATOM   8563  O  O     . PHE I  4 656  ? 6.052   14.437   42.158  1.00 133.49 ? 656  PHE A O     1 
ATOM   8564  C  CB    . PHE I  4 656  ? 4.001   16.304   40.508  1.00 130.63 ? 656  PHE A CB    1 
ATOM   8565  C  CG    . PHE I  4 656  ? 3.961   17.040   39.193  1.00 129.45 ? 656  PHE A CG    1 
ATOM   8566  C  CD1   . PHE I  4 656  ? 2.758   17.438   38.645  1.00 130.76 ? 656  PHE A CD1   1 
ATOM   8567  C  CD2   . PHE I  4 656  ? 5.132   17.338   38.504  1.00 132.24 ? 656  PHE A CD2   1 
ATOM   8568  C  CE1   . PHE I  4 656  ? 2.719   18.123   37.440  1.00 134.22 ? 656  PHE A CE1   1 
ATOM   8569  C  CE2   . PHE I  4 656  ? 5.100   18.015   37.294  1.00 131.34 ? 656  PHE A CE2   1 
ATOM   8570  C  CZ    . PHE I  4 656  ? 3.890   18.410   36.762  1.00 132.87 ? 656  PHE A CZ    1 
ATOM   8571  N  N     . GLU I  4 657  ? 3.980   13.565   42.411  1.00 137.44 ? 657  GLU A N     1 
ATOM   8572  C  CA    . GLU I  4 657  ? 4.285   12.910   43.673  1.00 134.49 ? 657  GLU A CA    1 
ATOM   8573  C  C     . GLU I  4 657  ? 5.191   11.716   43.453  1.00 135.70 ? 657  GLU A C     1 
ATOM   8574  O  O     . GLU I  4 657  ? 5.963   11.353   44.337  1.00 139.56 ? 657  GLU A O     1 
ATOM   8575  C  CB    . GLU I  4 657  ? 3.004   12.445   44.346  1.00 143.01 ? 657  GLU A CB    1 
ATOM   8576  C  CG    . GLU I  4 657  ? 2.195   13.566   44.973  1.00 152.00 ? 657  GLU A CG    1 
ATOM   8577  C  CD    . GLU I  4 657  ? 0.833   13.104   45.454  1.00 159.51 ? 657  GLU A CD    1 
ATOM   8578  O  OE1   . GLU I  4 657  ? 0.556   11.880   45.413  1.00 169.02 ? 657  GLU A OE1   1 
ATOM   8579  O  OE2   . GLU I  4 657  ? 0.035   13.965   45.884  1.00 169.07 ? 657  GLU A OE2   1 
ATOM   8580  N  N     . LEU I  4 658  ? 5.075   11.097   42.279  1.00 135.01 ? 658  LEU A N     1 
ATOM   8581  C  CA    . LEU I  4 658  ? 5.963   10.008   41.872  1.00 130.02 ? 658  LEU A CA    1 
ATOM   8582  C  C     . LEU I  4 658  ? 7.378   10.515   41.568  1.00 126.97 ? 658  LEU A C     1 
ATOM   8583  O  O     . LEU I  4 658  ? 8.361   9.895    41.967  1.00 127.14 ? 658  LEU A O     1 
ATOM   8584  C  CB    . LEU I  4 658  ? 5.378   9.278    40.662  1.00 129.67 ? 658  LEU A CB    1 
ATOM   8585  C  CG    . LEU I  4 658  ? 6.203   8.119    40.111  1.00 132.93 ? 658  LEU A CG    1 
ATOM   8586  C  CD1   . LEU I  4 658  ? 5.325   7.056    39.456  1.00 136.28 ? 658  LEU A CD1   1 
ATOM   8587  C  CD2   . LEU I  4 658  ? 7.227   8.665    39.128  1.00 136.74 ? 658  LEU A CD2   1 
ATOM   8588  N  N     . LEU I  4 659  ? 7.481   11.643   40.874  1.00 126.01 ? 659  LEU A N     1 
ATOM   8589  C  CA    . LEU I  4 659  ? 8.785   12.264   40.612  1.00 129.29 ? 659  LEU A CA    1 
ATOM   8590  C  C     . LEU I  4 659  ? 9.397   12.818   41.894  1.00 133.15 ? 659  LEU A C     1 
ATOM   8591  O  O     . LEU I  4 659  ? 10.609  12.753   42.070  1.00 139.43 ? 659  LEU A O     1 
ATOM   8592  C  CB    . LEU I  4 659  ? 8.663   13.403   39.596  1.00 130.64 ? 659  LEU A CB    1 
ATOM   8593  C  CG    . LEU I  4 659  ? 8.169   13.072   38.186  1.00 129.41 ? 659  LEU A CG    1 
ATOM   8594  C  CD1   . LEU I  4 659  ? 7.797   14.340   37.418  1.00 115.25 ? 659  LEU A CD1   1 
ATOM   8595  C  CD2   . LEU I  4 659  ? 9.236   12.265   37.460  1.00 137.88 ? 659  LEU A CD2   1 
ATOM   8596  N  N     . SER I  4 660  ? 8.559   13.371   42.773  1.00 133.11 ? 660  SER A N     1 
ATOM   8597  C  CA    . SER I  4 660  ? 9.006   13.866   44.082  1.00 135.62 ? 660  SER A CA    1 
ATOM   8598  C  C     . SER I  4 660  ? 9.647   12.770   44.951  1.00 140.28 ? 660  SER A C     1 
ATOM   8599  O  O     . SER I  4 660  ? 10.571  13.054   45.715  1.00 137.00 ? 660  SER A O     1 
ATOM   8600  C  CB    . SER I  4 660  ? 7.830   14.492   44.846  1.00 135.36 ? 660  SER A CB    1 
ATOM   8601  O  OG    . SER I  4 660  ? 7.281   15.601   44.154  1.00 136.44 ? 660  SER A OG    1 
ATOM   8602  N  N     . ARG I  4 661  ? 9.143   11.533   44.828  1.00 150.47 ? 661  ARG A N     1 
ATOM   8603  C  CA    . ARG I  4 661  ? 9.663   10.359   45.567  1.00 149.46 ? 661  ARG A CA    1 
ATOM   8604  C  C     . ARG I  4 661  ? 10.869  9.682    44.889  1.00 142.39 ? 661  ARG A C     1 
ATOM   8605  O  O     . ARG I  4 661  ? 11.390  8.686    45.391  1.00 132.71 ? 661  ARG A O     1 
ATOM   8606  C  CB    . ARG I  4 661  ? 8.547   9.331    45.800  1.00 148.95 ? 661  ARG A CB    1 
ATOM   8607  C  CG    . ARG I  4 661  ? 7.660   9.655    46.992  1.00 152.69 ? 661  ARG A CG    1 
ATOM   8608  C  CD    . ARG I  4 661  ? 6.565   8.613    47.209  1.00 157.75 ? 661  ARG A CD    1 
ATOM   8609  N  NE    . ARG I  4 661  ? 5.375   8.900    46.405  1.00 155.44 ? 661  ARG A NE    1 
ATOM   8610  C  CZ    . ARG I  4 661  ? 5.125   8.411    45.190  1.00 158.85 ? 661  ARG A CZ    1 
ATOM   8611  N  NH1   . ARG I  4 661  ? 5.970   7.568    44.597  1.00 158.75 ? 661  ARG A NH1   1 
ATOM   8612  N  NH2   . ARG I  4 661  ? 4.008   8.763    44.562  1.00 163.12 ? 661  ARG A NH2   1 
ATOM   8613  N  N     . GLY I  4 662  ? 11.305  10.231   43.757  1.00 147.78 ? 662  GLY A N     1 
ATOM   8614  C  CA    . GLY I  4 662  ? 12.539  9.801    43.083  1.00 149.00 ? 662  GLY A CA    1 
ATOM   8615  C  C     . GLY I  4 662  ? 12.431  8.505    42.288  1.00 145.49 ? 662  GLY A C     1 
ATOM   8616  O  O     . GLY I  4 662  ? 13.446  7.861    41.993  1.00 139.98 ? 662  GLY A O     1 
ATOM   8617  N  N     . GLU I  4 663  ? 11.207  8.132    41.922  1.00 140.24 ? 663  GLU A N     1 
ATOM   8618  C  CA    . GLU I  4 663  ? 10.961  6.874    41.241  1.00 139.37 ? 663  GLU A CA    1 
ATOM   8619  C  C     . GLU I  4 663  ? 11.041  7.087    39.751  1.00 138.15 ? 663  GLU A C     1 
ATOM   8620  O  O     . GLU I  4 663  ? 10.037  6.961    39.053  1.00 134.99 ? 663  GLU A O     1 
ATOM   8621  C  CB    . GLU I  4 663  ? 9.586   6.325    41.621  1.00 145.58 ? 663  GLU A CB    1 
ATOM   8622  C  CG    . GLU I  4 663  ? 9.457   5.958    43.089  1.00 149.93 ? 663  GLU A CG    1 
ATOM   8623  C  CD    . GLU I  4 663  ? 8.064   5.501    43.453  1.00 153.73 ? 663  GLU A CD    1 
ATOM   8624  O  OE1   . GLU I  4 663  ? 7.187   5.525    42.558  1.00 161.31 ? 663  GLU A OE1   1 
ATOM   8625  O  OE2   . GLU I  4 663  ? 7.847   5.137    44.632  1.00 150.78 ? 663  GLU A OE2   1 
ATOM   8626  N  N     . THR I  4 664  ? 12.244  7.407    39.270  1.00 148.91 ? 664  THR A N     1 
ATOM   8627  C  CA    . THR I  4 664  ? 12.505  7.662    37.835  1.00 146.33 ? 664  THR A CA    1 
ATOM   8628  C  C     . THR I  4 664  ? 13.333  6.532    37.210  1.00 146.32 ? 664  THR A C     1 
ATOM   8629  O  O     . THR I  4 664  ? 14.439  6.742    36.696  1.00 147.47 ? 664  THR A O     1 
ATOM   8630  C  CB    . THR I  4 664  ? 13.232  9.016    37.619  1.00 139.53 ? 664  THR A CB    1 
ATOM   8631  O  OG1   . THR I  4 664  ? 14.460  9.051    38.367  1.00 126.83 ? 664  THR A OG1   1 
ATOM   8632  C  CG2   . THR I  4 664  ? 12.358  10.172   38.053  1.00 146.23 ? 664  THR A CG2   1 
ATOM   8633  N  N     . LYS I  4 665  ? 12.788  5.328    37.270  1.00 146.50 ? 665  LYS A N     1 
ATOM   8634  C  CA    . LYS I  4 665  ? 13.514  4.135    36.846  1.00 157.69 ? 665  LYS A CA    1 
ATOM   8635  C  C     . LYS I  4 665  ? 13.515  3.996    35.319  1.00 157.50 ? 665  LYS A C     1 
ATOM   8636  O  O     . LYS I  4 665  ? 14.525  3.601    34.704  1.00 152.20 ? 665  LYS A O     1 
ATOM   8637  C  CB    . LYS I  4 665  ? 12.888  2.893    37.486  1.00 154.26 ? 665  LYS A CB    1 
ATOM   8638  C  CG    . LYS I  4 665  ? 12.913  2.910    39.005  1.00 155.31 ? 665  LYS A CG    1 
ATOM   8639  C  CD    . LYS I  4 665  ? 11.689  2.223    39.594  1.00 155.63 ? 665  LYS A CD    1 
ATOM   8640  C  CE    . LYS I  4 665  ? 11.424  2.686    41.016  1.00 151.32 ? 665  LYS A CE    1 
ATOM   8641  N  NZ    . LYS I  4 665  ? 10.029  2.386    41.423  1.00 148.94 ? 665  LYS A NZ    1 
ATOM   8642  N  N     . GLY I  4 666  ? 12.361  4.298    34.727  1.00 153.50 ? 666  GLY A N     1 
ATOM   8643  C  CA    . GLY I  4 666  ? 12.185  4.255    33.280  1.00 146.50 ? 666  GLY A CA    1 
ATOM   8644  C  C     . GLY I  4 666  ? 11.462  5.487    32.777  1.00 142.37 ? 666  GLY A C     1 
ATOM   8645  O  O     . GLY I  4 666  ? 10.696  5.416    31.811  1.00 139.16 ? 666  GLY A O     1 
ATOM   8646  N  N     . VAL I  4 667  ? 11.699  6.614    33.445  1.00 142.53 ? 667  VAL A N     1 
ATOM   8647  C  CA    . VAL I  4 667  ? 11.103  7.895    33.058  1.00 142.12 ? 667  VAL A CA    1 
ATOM   8648  C  C     . VAL I  4 667  ? 12.075  8.658    32.154  1.00 137.30 ? 667  VAL A C     1 
ATOM   8649  O  O     . VAL I  4 667  ? 13.207  8.920    32.548  1.00 146.88 ? 667  VAL A O     1 
ATOM   8650  C  CB    . VAL I  4 667  ? 10.752  8.757    34.296  1.00 139.62 ? 667  VAL A CB    1 
ATOM   8651  C  CG1   . VAL I  4 667  ? 10.084  10.059   33.882  1.00 137.63 ? 667  VAL A CG1   1 
ATOM   8652  C  CG2   . VAL I  4 667  ? 9.833   7.994    35.226  1.00 132.04 ? 667  VAL A CG2   1 
ATOM   8653  N  N     . PHE I  4 668  ? 11.614  9.024    30.958  1.00 128.29 ? 668  PHE A N     1 
ATOM   8654  C  CA    . PHE I  4 668  ? 12.457  9.645    29.919  1.00 125.56 ? 668  PHE A CA    1 
ATOM   8655  C  C     . PHE I  4 668  ? 13.314  10.829   30.383  1.00 122.34 ? 668  PHE A C     1 
ATOM   8656  O  O     . PHE I  4 668  ? 12.836  11.725   31.060  1.00 125.74 ? 668  PHE A O     1 
ATOM   8657  C  CB    . PHE I  4 668  ? 11.567  10.102   28.765  1.00 124.47 ? 668  PHE A CB    1 
ATOM   8658  C  CG    . PHE I  4 668  ? 12.307  10.761   27.628  1.00 126.90 ? 668  PHE A CG    1 
ATOM   8659  C  CD1   . PHE I  4 668  ? 13.424  10.155   27.049  1.00 130.42 ? 668  PHE A CD1   1 
ATOM   8660  C  CD2   . PHE I  4 668  ? 11.851  11.958   27.087  1.00 126.38 ? 668  PHE A CD2   1 
ATOM   8661  C  CE1   . PHE I  4 668  ? 14.086  10.751   25.987  1.00 122.84 ? 668  PHE A CE1   1 
ATOM   8662  C  CE2   . PHE I  4 668  ? 12.513  12.559   26.020  1.00 121.62 ? 668  PHE A CE2   1 
ATOM   8663  C  CZ    . PHE I  4 668  ? 13.628  11.952   25.475  1.00 121.24 ? 668  PHE A CZ    1 
ATOM   8664  N  N     . GLN I  4 669  ? 14.605  10.753   30.178  1.00 128.63 ? 669  GLN A N     1 
ATOM   8665  C  CA    . GLN I  4 669  ? 15.437  11.911   30.351  1.00 134.30 ? 669  GLN A CA    1 
ATOM   8666  C  C     . GLN I  4 669  ? 16.050  12.170   31.688  1.00 127.47 ? 669  GLN A C     1 
ATOM   8667  O  O     . GLN I  4 669  ? 16.928  12.974   31.815  1.00 133.44 ? 669  GLN A O     1 
ATOM   8668  C  CB    . GLN I  4 669  ? 14.567  13.092   30.079  1.00 132.41 ? 669  GLN A CB    1 
ATOM   8669  C  CG    . GLN I  4 669  ? 15.239  14.134   29.237  1.00 140.33 ? 669  GLN A CG    1 
ATOM   8670  C  CD    . GLN I  4 669  ? 14.244  15.017   28.566  1.00 136.79 ? 669  GLN A CD    1 
ATOM   8671  O  OE1   . GLN I  4 669  ? 13.085  15.034   28.926  1.00 132.39 ? 669  GLN A OE1   1 
ATOM   8672  N  NE2   . GLN I  4 669  ? 14.687  15.753   27.578  1.00 142.37 ? 669  GLN A NE2   1 
ATOM   8673  N  N     . LEU I  4 670  ? 15.613  11.468   32.686  1.00 131.46 ? 670  LEU A N     1 
ATOM   8674  C  CA    . LEU I  4 670  ? 15.945  11.776   34.067  1.00 142.97 ? 670  LEU A CA    1 
ATOM   8675  C  C     . LEU I  4 670  ? 16.015  10.395   34.752  1.00 141.66 ? 670  LEU A C     1 
ATOM   8676  O  O     . LEU I  4 670  ? 15.427  10.176   35.809  1.00 139.00 ? 670  LEU A O     1 
ATOM   8677  C  CB    . LEU I  4 670  ? 15.137  12.792   34.892  1.00 145.75 ? 670  LEU A CB    1 
ATOM   8678  C  CG    . LEU I  4 670  ? 13.622  12.837   34.676  1.00 145.84 ? 670  LEU A CG    1 
ATOM   8679  C  CD1   . LEU I  4 670  ? 12.969  11.483   34.936  1.00 148.56 ? 670  LEU A CD1   1 
ATOM   8680  C  CD2   . LEU I  4 670  ? 13.028  13.909   35.561  1.00 147.94 ? 670  LEU A CD2   1 
ATOM   8681  N  N     . GLU I  4 671  ? 16.759  9.480    34.141  1.00 141.25 ? 671  GLU A N     1 
ATOM   8682  C  CA    . GLU I  4 671  ? 17.018  8.164    34.722  1.00 142.37 ? 671  GLU A CA    1 
ATOM   8683  C  C     . GLU I  4 671  ? 18.378  8.100    35.433  1.00 140.26 ? 671  GLU A C     1 
ATOM   8684  O  O     . GLU I  4 671  ? 18.655  7.141    36.158  1.00 134.52 ? 671  GLU A O     1 
ATOM   8685  C  CB    . GLU I  4 671  ? 16.966  7.094    33.623  1.00 151.29 ? 671  GLU A CB    1 
ATOM   8686  C  CG    . GLU I  4 671  ? 15.655  7.062    32.849  1.00 150.47 ? 671  GLU A CG    1 
ATOM   8687  C  CD    . GLU I  4 671  ? 15.537  5.868    31.927  1.00 155.95 ? 671  GLU A CD    1 
ATOM   8688  O  OE1   . GLU I  4 671  ? 14.505  5.769    31.223  1.00 166.51 ? 671  GLU A OE1   1 
ATOM   8689  O  OE2   . GLU I  4 671  ? 16.466  5.028    31.909  1.00 155.14 ? 671  GLU A OE2   1 
ATOM   8690  N  N     . SER I  4 672  ? 19.214  9.117    35.208  1.00 145.00 ? 672  SER A N     1 
ATOM   8691  C  CA    . SER I  4 672  ? 20.595  9.140    35.695  1.00 147.12 ? 672  SER A CA    1 
ATOM   8692  C  C     . SER I  4 672  ? 20.637  9.216    37.206  1.00 137.66 ? 672  SER A C     1 
ATOM   8693  O  O     . SER I  4 672  ? 19.784  9.833    37.825  1.00 130.20 ? 672  SER A O     1 
ATOM   8694  C  CB    . SER I  4 672  ? 21.364  10.335   35.101  1.00 151.57 ? 672  SER A CB    1 
ATOM   8695  O  OG    . SER I  4 672  ? 21.246  10.388   33.680  1.00 150.12 ? 672  SER A OG    1 
ATOM   8696  N  N     . GLY I  4 673  ? 21.646  8.586    37.790  1.00 139.35 ? 673  GLY A N     1 
ATOM   8697  C  CA    . GLY I  4 673  ? 21.751  8.486    39.237  1.00 142.50 ? 673  GLY A CA    1 
ATOM   8698  C  C     . GLY I  4 673  ? 21.788  9.844    39.904  1.00 137.62 ? 673  GLY A C     1 
ATOM   8699  O  O     . GLY I  4 673  ? 21.111  10.075   40.907  1.00 147.64 ? 673  GLY A O     1 
ATOM   8700  N  N     . GLY I  4 674  ? 22.591  10.742   39.356  1.00 130.13 ? 674  GLY A N     1 
ATOM   8701  C  CA    . GLY I  4 674  ? 22.688  12.083   39.901  1.00 137.28 ? 674  GLY A CA    1 
ATOM   8702  C  C     . GLY I  4 674  ? 21.405  12.850   39.654  1.00 135.50 ? 674  GLY A C     1 
ATOM   8703  O  O     . GLY I  4 674  ? 20.957  13.629   40.499  1.00 142.39 ? 674  GLY A O     1 
ATOM   8704  N  N     . MET I  4 675  ? 20.804  12.611   38.494  1.00 133.59 ? 675  MET A N     1 
ATOM   8705  C  CA    . MET I  4 675  ? 19.612  13.338   38.075  1.00 134.80 ? 675  MET A CA    1 
ATOM   8706  C  C     . MET I  4 675  ? 18.386  12.904   38.874  1.00 134.35 ? 675  MET A C     1 
ATOM   8707  O  O     . MET I  4 675  ? 17.518  13.721   39.167  1.00 131.33 ? 675  MET A O     1 
ATOM   8708  C  CB    . MET I  4 675  ? 19.371  13.129   36.575  1.00 137.30 ? 675  MET A CB    1 
ATOM   8709  C  CG    . MET I  4 675  ? 18.168  13.870   36.005  1.00 141.21 ? 675  MET A CG    1 
ATOM   8710  S  SD    . MET I  4 675  ? 18.210  15.673   36.146  1.00 148.29 ? 675  MET A SD    1 
ATOM   8711  C  CE    . MET I  4 675  ? 16.798  16.127   35.138  1.00 141.43 ? 675  MET A CE    1 
ATOM   8712  N  N     . THR I  4 676  ? 18.315  11.621   39.221  1.00 135.73 ? 676  THR A N     1 
ATOM   8713  C  CA    . THR I  4 676  ? 17.210  11.102   40.034  1.00 131.18 ? 676  THR A CA    1 
ATOM   8714  C  C     . THR I  4 676  ? 17.229  11.730   41.433  1.00 129.43 ? 676  THR A C     1 
ATOM   8715  O  O     . THR I  4 676  ? 16.173  12.069   41.971  1.00 127.56 ? 676  THR A O     1 
ATOM   8716  C  CB    . THR I  4 676  ? 17.256  9.556    40.157  1.00 129.60 ? 676  THR A CB    1 
ATOM   8717  O  OG1   . THR I  4 676  ? 17.197  8.958    38.863  1.00 131.51 ? 676  THR A OG1   1 
ATOM   8718  C  CG2   . THR I  4 676  ? 16.079  9.029    40.967  1.00 132.01 ? 676  THR A CG2   1 
ATOM   8719  N  N     . ALA I  4 677  ? 18.430  11.892   41.997  1.00 128.72 ? 677  ALA A N     1 
ATOM   8720  C  CA    . ALA I  4 677  ? 18.613  12.482   43.327  1.00 127.09 ? 677  ALA A CA    1 
ATOM   8721  C  C     . ALA I  4 677  ? 18.131  13.916   43.383  1.00 128.36 ? 677  ALA A C     1 
ATOM   8722  O  O     . ALA I  4 677  ? 17.460  14.311   44.341  1.00 126.36 ? 677  ALA A O     1 
ATOM   8723  C  CB    . ALA I  4 677  ? 20.075  12.424   43.726  1.00 125.74 ? 677  ALA A CB    1 
ATOM   8724  N  N     . THR I  4 678  ? 18.470  14.685   42.348  1.00 133.93 ? 678  THR A N     1 
ATOM   8725  C  CA    . THR I  4 678  ? 18.074  16.097   42.248  1.00 133.63 ? 678  THR A CA    1 
ATOM   8726  C  C     . THR I  4 678  ? 16.552  16.275   42.099  1.00 130.05 ? 678  THR A C     1 
ATOM   8727  O  O     . THR I  4 678  ? 16.002  17.302   42.503  1.00 128.09 ? 678  THR A O     1 
ATOM   8728  C  CB    . THR I  4 678  ? 18.784  16.803   41.070  1.00 130.57 ? 678  THR A CB    1 
ATOM   8729  O  OG1   . THR I  4 678  ? 18.528  16.074   39.867  1.00 141.15 ? 678  THR A OG1   1 
ATOM   8730  C  CG2   . THR I  4 678  ? 20.297  16.893   41.303  1.00 125.76 ? 678  THR A CG2   1 
ATOM   8731  N  N     . VAL I  4 679  ? 15.882  15.283   41.515  1.00 131.47 ? 679  VAL A N     1 
ATOM   8732  C  CA    . VAL I  4 679  ? 14.426  15.337   41.344  1.00 131.67 ? 679  VAL A CA    1 
ATOM   8733  C  C     . VAL I  4 679  ? 13.748  15.098   42.684  1.00 134.32 ? 679  VAL A C     1 
ATOM   8734  O  O     . VAL I  4 679  ? 12.700  15.676   42.969  1.00 138.56 ? 679  VAL A O     1 
ATOM   8735  C  CB    . VAL I  4 679  ? 13.911  14.324   40.299  1.00 126.39 ? 679  VAL A CB    1 
ATOM   8736  C  CG1   . VAL I  4 679  ? 12.415  14.439   40.154  1.00 128.49 ? 679  VAL A CG1   1 
ATOM   8737  C  CG2   . VAL I  4 679  ? 14.519  14.615   38.950  1.00 133.32 ? 679  VAL A CG2   1 
ATOM   8738  N  N     . ARG I  4 680  ? 14.350  14.244   43.507  1.00 139.39 ? 680  ARG A N     1 
ATOM   8739  C  CA    . ARG I  4 680  ? 13.848  14.010   44.856  1.00 139.32 ? 680  ARG A CA    1 
ATOM   8740  C  C     . ARG I  4 680  ? 14.099  15.249   45.732  1.00 141.09 ? 680  ARG A C     1 
ATOM   8741  O  O     . ARG I  4 680  ? 13.274  15.608   46.582  1.00 143.02 ? 680  ARG A O     1 
ATOM   8742  C  CB    . ARG I  4 680  ? 14.505  12.768   45.458  1.00 138.63 ? 680  ARG A CB    1 
ATOM   8743  C  CG    . ARG I  4 680  ? 13.975  12.420   46.836  1.00 149.10 ? 680  ARG A CG    1 
ATOM   8744  C  CD    . ARG I  4 680  ? 14.719  11.262   47.478  1.00 151.44 ? 680  ARG A CD    1 
ATOM   8745  N  NE    . ARG I  4 680  ? 14.166  9.966    47.085  1.00 155.23 ? 680  ARG A NE    1 
ATOM   8746  C  CZ    . ARG I  4 680  ? 14.714  9.114    46.218  1.00 154.59 ? 680  ARG A CZ    1 
ATOM   8747  N  NH1   . ARG I  4 680  ? 15.868  9.393    45.617  1.00 154.99 ? 680  ARG A NH1   1 
ATOM   8748  N  NH2   . ARG I  4 680  ? 14.097  7.959    45.959  1.00 152.29 ? 680  ARG A NH2   1 
ATOM   8749  N  N     . GLY I  4 681  ? 15.237  15.901   45.512  1.00 136.61 ? 681  GLY A N     1 
ATOM   8750  C  CA    . GLY I  4 681  ? 15.589  17.102   46.255  1.00 131.02 ? 681  GLY A CA    1 
ATOM   8751  C  C     . GLY I  4 681  ? 14.741  18.304   45.909  1.00 123.05 ? 681  GLY A C     1 
ATOM   8752  O  O     . GLY I  4 681  ? 14.510  19.165   46.754  1.00 126.99 ? 681  GLY A O     1 
ATOM   8753  N  N     . LEU I  4 682  ? 14.268  18.355   44.671  1.00 119.69 ? 682  LEU A N     1 
ATOM   8754  C  CA    . LEU I  4 682  ? 13.562  19.531   44.160  1.00 130.44 ? 682  LEU A CA    1 
ATOM   8755  C  C     . LEU I  4 682  ? 12.102  19.531   44.535  1.00 131.84 ? 682  LEU A C     1 
ATOM   8756  O  O     . LEU I  4 682  ? 11.555  20.581   44.870  1.00 136.68 ? 682  LEU A O     1 
ATOM   8757  C  CB    . LEU I  4 682  ? 13.676  19.621   42.628  1.00 135.59 ? 682  LEU A CB    1 
ATOM   8758  C  CG    . LEU I  4 682  ? 12.981  20.788   41.902  1.00 135.25 ? 682  LEU A CG    1 
ATOM   8759  C  CD1   . LEU I  4 682  ? 13.252  22.166   42.516  1.00 129.77 ? 682  LEU A CD1   1 
ATOM   8760  C  CD2   . LEU I  4 682  ? 13.424  20.761   40.445  1.00 136.41 ? 682  LEU A CD2   1 
ATOM   8761  N  N     . LYS I  4 683  ? 11.483  18.353   44.476  1.00 128.41 ? 683  LYS A N     1 
ATOM   8762  C  CA    . LYS I  4 683  ? 10.052  18.211   44.692  1.00 128.09 ? 683  LYS A CA    1 
ATOM   8763  C  C     . LYS I  4 683  ? 9.264   19.035   43.691  1.00 130.55 ? 683  LYS A C     1 
ATOM   8764  O  O     . LYS I  4 683  ? 8.744   20.087   44.040  1.00 134.77 ? 683  LYS A O     1 
ATOM   8765  C  CB    . LYS I  4 683  ? 9.671   18.595   46.126  1.00 132.84 ? 683  LYS A CB    1 
ATOM   8766  C  CG    . LYS I  4 683  ? 9.340   17.400   46.997  1.00 138.10 ? 683  LYS A CG    1 
ATOM   8767  C  CD    . LYS I  4 683  ? 10.514  16.454   47.157  1.00 134.91 ? 683  LYS A CD    1 
ATOM   8768  C  CE    . LYS I  4 683  ? 10.143  15.276   48.051  1.00 136.23 ? 683  LYS A CE    1 
ATOM   8769  N  NZ    . LYS I  4 683  ? 11.255  14.287   48.145  1.00 133.15 ? 683  LYS A NZ    1 
ATOM   8770  N  N     . PRO I  4 684  ? 9.170   18.556   42.436  1.00 136.86 ? 684  PRO A N     1 
ATOM   8771  C  CA    . PRO I  4 684  ? 8.467   19.301   41.384  1.00 134.96 ? 684  PRO A CA    1 
ATOM   8772  C  C     . PRO I  4 684  ? 6.954   19.167   41.515  1.00 128.07 ? 684  PRO A C     1 
ATOM   8773  O  O     . PRO I  4 684  ? 6.481   18.079   41.812  1.00 126.73 ? 684  PRO A O     1 
ATOM   8774  C  CB    . PRO I  4 684  ? 8.964   18.636   40.099  1.00 130.66 ? 684  PRO A CB    1 
ATOM   8775  C  CG    . PRO I  4 684  ? 9.245   17.231   40.503  1.00 133.06 ? 684  PRO A CG    1 
ATOM   8776  C  CD    . PRO I  4 684  ? 9.702   17.274   41.936  1.00 134.90 ? 684  PRO A CD    1 
ATOM   8777  N  N     . ARG I  4 685  ? 6.229   20.272   41.305  1.00 126.52 ? 685  ARG A N     1 
ATOM   8778  C  CA    . ARG I  4 685  ? 4.763   20.301   41.338  1.00 126.96 ? 685  ARG A CA    1 
ATOM   8779  C  C     . ARG I  4 685  ? 4.097   20.688   40.013  1.00 129.08 ? 685  ARG A C     1 
ATOM   8780  O  O     . ARG I  4 685  ? 2.908   20.480   39.848  1.00 128.52 ? 685  ARG A O     1 
ATOM   8781  C  CB    . ARG I  4 685  ? 4.301   21.269   42.395  1.00 129.68 ? 685  ARG A CB    1 
ATOM   8782  C  CG    . ARG I  4 685  ? 5.170   21.242   43.626  1.00 144.18 ? 685  ARG A CG    1 
ATOM   8783  C  CD    . ARG I  4 685  ? 4.445   21.829   44.818  1.00 154.98 ? 685  ARG A CD    1 
ATOM   8784  N  NE    . ARG I  4 685  ? 5.377   22.414   45.782  1.00 161.35 ? 685  ARG A NE    1 
ATOM   8785  C  CZ    . ARG I  4 685  ? 5.900   23.640   45.700  1.00 168.04 ? 685  ARG A CZ    1 
ATOM   8786  N  NH1   . ARG I  4 685  ? 5.605   24.449   44.681  1.00 161.08 ? 685  ARG A NH1   1 
ATOM   8787  N  NH2   . ARG I  4 685  ? 6.732   24.063   46.651  1.00 176.20 ? 685  ARG A NH2   1 
ATOM   8788  N  N     . ARG I  4 686  ? 4.848   21.275   39.087  1.00 138.69 ? 686  ARG A N     1 
ATOM   8789  C  CA    . ARG I  4 686  ? 4.325   21.615   37.765  1.00 141.73 ? 686  ARG A CA    1 
ATOM   8790  C  C     . ARG I  4 686  ? 5.346   21.310   36.674  1.00 141.51 ? 686  ARG A C     1 
ATOM   8791  O  O     . ARG I  4 686  ? 6.522   21.065   36.969  1.00 136.41 ? 686  ARG A O     1 
ATOM   8792  C  CB    . ARG I  4 686  ? 3.898   23.083   37.712  1.00 146.33 ? 686  ARG A CB    1 
ATOM   8793  C  CG    . ARG I  4 686  ? 5.014   24.108   37.845  1.00 148.00 ? 686  ARG A CG    1 
ATOM   8794  C  CD    . ARG I  4 686  ? 4.518   25.375   38.559  1.00 157.67 ? 686  ARG A CD    1 
ATOM   8795  N  NE    . ARG I  4 686  ? 5.359   26.545   38.292  1.00 156.73 ? 686  ARG A NE    1 
ATOM   8796  C  CZ    . ARG I  4 686  ? 5.050   27.559   37.482  1.00 155.72 ? 686  ARG A CZ    1 
ATOM   8797  N  NH1   . ARG I  4 686  ? 3.889   27.610   36.837  1.00 156.96 ? 686  ARG A NH1   1 
ATOM   8798  N  NH2   . ARG I  4 686  ? 5.918   28.549   37.323  1.00 160.38 ? 686  ARG A NH2   1 
ATOM   8799  N  N     . LEU I  4 687  ? 4.880   21.322   35.420  1.00 138.14 ? 687  LEU A N     1 
ATOM   8800  C  CA    . LEU I  4 687  ? 5.691   20.912   34.260  1.00 130.40 ? 687  LEU A CA    1 
ATOM   8801  C  C     . LEU I  4 687  ? 6.892   21.830   34.026  1.00 134.02 ? 687  LEU A C     1 
ATOM   8802  O  O     . LEU I  4 687  ? 7.933   21.382   33.548  1.00 142.97 ? 687  LEU A O     1 
ATOM   8803  C  CB    . LEU I  4 687  ? 4.829   20.865   32.993  1.00 128.35 ? 687  LEU A CB    1 
ATOM   8804  C  CG    . LEU I  4 687  ? 5.432   20.155   31.781  1.00 125.37 ? 687  LEU A CG    1 
ATOM   8805  C  CD1   . LEU I  4 687  ? 5.562   18.683   32.127  1.00 120.91 ? 687  LEU A CD1   1 
ATOM   8806  C  CD2   . LEU I  4 687  ? 4.610   20.336   30.512  1.00 120.66 ? 687  LEU A CD2   1 
ATOM   8807  N  N     . GLU I  4 688  ? 6.753   23.106   34.377  1.00 130.13 ? 688  GLU A N     1 
ATOM   8808  C  CA    . GLU I  4 688  ? 7.826   24.078   34.213  1.00 124.41 ? 688  GLU A CA    1 
ATOM   8809  C  C     . GLU I  4 688  ? 9.045   23.749   35.060  1.00 125.45 ? 688  GLU A C     1 
ATOM   8810  O  O     . GLU I  4 688  ? 10.158  24.159   34.716  1.00 129.26 ? 688  GLU A O     1 
ATOM   8811  C  CB    . GLU I  4 688  ? 7.327   25.479   34.548  1.00 131.00 ? 688  GLU A CB    1 
ATOM   8812  C  CG    . GLU I  4 688  ? 6.450   26.102   33.470  1.00 138.57 ? 688  GLU A CG    1 
ATOM   8813  C  CD    . GLU I  4 688  ? 5.024   25.553   33.417  1.00 139.65 ? 688  GLU A CD    1 
ATOM   8814  O  OE1   . GLU I  4 688  ? 4.728   24.540   34.070  1.00 146.87 ? 688  GLU A OE1   1 
ATOM   8815  O  OE2   . GLU I  4 688  ? 4.180   26.131   32.705  1.00 145.32 ? 688  GLU A OE2   1 
ATOM   8816  N  N     . ASP I  4 689  ? 8.833   23.016   36.156  1.00 131.05 ? 689  ASP A N     1 
ATOM   8817  C  CA    . ASP I  4 689  ? 9.920   22.590   37.054  1.00 136.44 ? 689  ASP A CA    1 
ATOM   8818  C  C     . ASP I  4 689  ? 10.837  21.567   36.379  1.00 132.42 ? 689  ASP A C     1 
ATOM   8819  O  O     . ASP I  4 689  ? 12.062  21.579   36.565  1.00 127.60 ? 689  ASP A O     1 
ATOM   8820  C  CB    . ASP I  4 689  ? 9.352   21.979   38.346  1.00 138.96 ? 689  ASP A CB    1 
ATOM   8821  C  CG    . ASP I  4 689  ? 8.513   22.961   39.149  1.00 139.29 ? 689  ASP A CG    1 
ATOM   8822  O  OD1   . ASP I  4 689  ? 8.898   24.148   39.238  1.00 140.75 ? 689  ASP A OD1   1 
ATOM   8823  O  OD2   . ASP I  4 689  ? 7.478   22.544   39.705  1.00 138.00 ? 689  ASP A OD2   1 
ATOM   8824  N  N     . ILE I  4 690  ? 10.229  20.672   35.611  1.00 127.83 ? 690  ILE A N     1 
ATOM   8825  C  CA    . ILE I  4 690  ? 10.983  19.667   34.894  1.00 132.16 ? 690  ILE A CA    1 
ATOM   8826  C  C     . ILE I  4 690  ? 11.765  20.352   33.777  1.00 133.70 ? 690  ILE A C     1 
ATOM   8827  O  O     . ILE I  4 690  ? 12.966  20.114   33.610  1.00 139.96 ? 690  ILE A O     1 
ATOM   8828  C  CB    . ILE I  4 690  ? 10.055  18.566   34.346  1.00 134.37 ? 690  ILE A CB    1 
ATOM   8829  C  CG1   . ILE I  4 690  ? 9.403   17.815   35.503  1.00 136.73 ? 690  ILE A CG1   1 
ATOM   8830  C  CG2   . ILE I  4 690  ? 10.817  17.579   33.475  1.00 133.87 ? 690  ILE A CG2   1 
ATOM   8831  C  CD1   . ILE I  4 690  ? 8.443   16.734   35.052  1.00 150.71 ? 690  ILE A CD1   1 
ATOM   8832  N  N     . ILE I  4 691  ? 11.088  21.237   33.047  1.00 132.59 ? 691  ILE A N     1 
ATOM   8833  C  CA    . ILE I  4 691  ? 11.710  21.964   31.942  1.00 130.67 ? 691  ILE A CA    1 
ATOM   8834  C  C     . ILE I  4 691  ? 12.971  22.682   32.437  1.00 137.13 ? 691  ILE A C     1 
ATOM   8835  O  O     . ILE I  4 691  ? 14.046  22.586   31.818  1.00 135.64 ? 691  ILE A O     1 
ATOM   8836  C  CB    . ILE I  4 691  ? 10.727  22.979   31.328  1.00 120.09 ? 691  ILE A CB    1 
ATOM   8837  C  CG1   . ILE I  4 691  ? 9.525   22.263   30.732  1.00 116.47 ? 691  ILE A CG1   1 
ATOM   8838  C  CG2   . ILE I  4 691  ? 11.388  23.782   30.228  1.00 125.97 ? 691  ILE A CG2   1 
ATOM   8839  C  CD1   . ILE I  4 691  ? 8.460   23.206   30.205  1.00 113.12 ? 691  ILE A CD1   1 
ATOM   8840  N  N     . ALA I  4 692  ? 12.821  23.370   33.571  1.00 132.95 ? 692  ALA A N     1 
ATOM   8841  C  CA    . ALA I  4 692  ? 13.909  24.080   34.225  1.00 130.50 ? 692  ALA A CA    1 
ATOM   8842  C  C     . ALA I  4 692  ? 15.029  23.136   34.645  1.00 128.87 ? 692  ALA A C     1 
ATOM   8843  O  O     . ALA I  4 692  ? 16.204  23.439   34.464  1.00 126.86 ? 692  ALA A O     1 
ATOM   8844  C  CB    . ALA I  4 692  ? 13.371  24.819   35.441  1.00 128.60 ? 692  ALA A CB    1 
ATOM   8845  N  N     . LEU I  4 693  ? 14.648  21.992   35.207  1.00 132.52 ? 693  LEU A N     1 
ATOM   8846  C  CA    . LEU I  4 693  ? 15.608  21.039   35.774  1.00 131.16 ? 693  LEU A CA    1 
ATOM   8847  C  C     . LEU I  4 693  ? 16.450  20.372   34.665  1.00 133.30 ? 693  LEU A C     1 
ATOM   8848  O  O     . LEU I  4 693  ? 17.667  20.219   34.797  1.00 128.92 ? 693  LEU A O     1 
ATOM   8849  C  CB    . LEU I  4 693  ? 14.869  19.990   36.631  1.00 124.14 ? 693  LEU A CB    1 
ATOM   8850  C  CG    . LEU I  4 693  ? 15.702  18.954   37.396  1.00 118.09 ? 693  LEU A CG    1 
ATOM   8851  C  CD1   . LEU I  4 693  ? 16.549  19.615   38.463  1.00 119.91 ? 693  LEU A CD1   1 
ATOM   8852  C  CD2   . LEU I  4 693  ? 14.826  17.870   38.006  1.00 113.04 ? 693  LEU A CD2   1 
ATOM   8853  N  N     . VAL I  4 694  ? 15.797  19.991   33.571  1.00 135.27 ? 694  VAL A N     1 
ATOM   8854  C  CA    . VAL I  4 694  ? 16.485  19.307   32.470  1.00 133.70 ? 694  VAL A CA    1 
ATOM   8855  C  C     . VAL I  4 694  ? 17.459  20.254   31.765  1.00 140.04 ? 694  VAL A C     1 
ATOM   8856  O  O     . VAL I  4 694  ? 18.523  19.835   31.279  1.00 137.93 ? 694  VAL A O     1 
ATOM   8857  C  CB    . VAL I  4 694  ? 15.495  18.738   31.432  1.00 122.55 ? 694  VAL A CB    1 
ATOM   8858  C  CG1   . VAL I  4 694  ? 14.607  17.673   32.048  1.00 122.26 ? 694  VAL A CG1   1 
ATOM   8859  C  CG2   . VAL I  4 694  ? 14.636  19.850   30.879  1.00 126.46 ? 694  VAL A CG2   1 
ATOM   8860  N  N     . SER I  4 695  ? 17.092  21.531   31.713  1.00 140.99 ? 695  SER A N     1 
ATOM   8861  C  CA    . SER I  4 695  ? 17.934  22.535   31.075  1.00 137.93 ? 695  SER A CA    1 
ATOM   8862  C  C     . SER I  4 695  ? 19.145  22.867   31.934  1.00 134.51 ? 695  SER A C     1 
ATOM   8863  O  O     . SER I  4 695  ? 20.215  23.138   31.406  1.00 139.96 ? 695  SER A O     1 
ATOM   8864  C  CB    . SER I  4 695  ? 17.133  23.808   30.796  1.00 141.37 ? 695  SER A CB    1 
ATOM   8865  O  OG    . SER I  4 695  ? 16.072  23.572   29.883  1.00 144.08 ? 695  SER A OG    1 
ATOM   8866  N  N     . LEU I  4 696  ? 18.969  22.843   33.253  1.00 134.87 ? 696  LEU A N     1 
ATOM   8867  C  CA    . LEU I  4 696  ? 20.016  23.260   34.197  1.00 136.06 ? 696  LEU A CA    1 
ATOM   8868  C  C     . LEU I  4 696  ? 20.971  22.123   34.560  1.00 137.32 ? 696  LEU A C     1 
ATOM   8869  O  O     . LEU I  4 696  ? 22.129  22.363   34.915  1.00 139.51 ? 696  LEU A O     1 
ATOM   8870  C  CB    . LEU I  4 696  ? 19.388  23.841   35.486  1.00 137.64 ? 696  LEU A CB    1 
ATOM   8871  C  CG    . LEU I  4 696  ? 18.763  25.248   35.390  1.00 134.68 ? 696  LEU A CG    1 
ATOM   8872  C  CD1   . LEU I  4 696  ? 17.924  25.599   36.622  1.00 120.27 ? 696  LEU A CD1   1 
ATOM   8873  C  CD2   . LEU I  4 696  ? 19.850  26.291   35.132  1.00 130.56 ? 696  LEU A CD2   1 
ATOM   8874  N  N     . TYR I  4 697  ? 20.495  20.887   34.489  1.00 138.98 ? 697  TYR A N     1 
ATOM   8875  C  CA    . TYR I  4 697  ? 21.341  19.747   34.834  1.00 143.49 ? 697  TYR A CA    1 
ATOM   8876  C  C     . TYR I  4 697  ? 22.311  19.417   33.706  1.00 146.61 ? 697  TYR A C     1 
ATOM   8877  O  O     . TYR I  4 697  ? 22.036  18.557   32.858  1.00 139.57 ? 697  TYR A O     1 
ATOM   8878  C  CB    . TYR I  4 697  ? 20.506  18.517   35.174  1.00 153.33 ? 697  TYR A CB    1 
ATOM   8879  C  CG    . TYR I  4 697  ? 21.315  17.421   35.833  1.00 156.82 ? 697  TYR A CG    1 
ATOM   8880  C  CD1   . TYR I  4 697  ? 21.473  17.393   37.225  1.00 159.45 ? 697  TYR A CD1   1 
ATOM   8881  C  CD2   . TYR I  4 697  ? 21.931  16.417   35.073  1.00 152.20 ? 697  TYR A CD2   1 
ATOM   8882  C  CE1   . TYR I  4 697  ? 22.213  16.397   37.845  1.00 160.30 ? 697  TYR A CE1   1 
ATOM   8883  C  CE2   . TYR I  4 697  ? 22.674  15.414   35.681  1.00 157.00 ? 697  TYR A CE2   1 
ATOM   8884  C  CZ    . TYR I  4 697  ? 22.814  15.403   37.068  1.00 164.82 ? 697  TYR A CZ    1 
ATOM   8885  O  OH    . TYR I  4 697  ? 23.561  14.405   37.676  1.00 161.23 ? 697  TYR A OH    1 
ATOM   8886  N  N     . ARG I  4 698  ? 23.444  20.117   33.716  1.00 148.05 ? 698  ARG A N     1 
ATOM   8887  C  CA    . ARG I  4 698  ? 24.530  19.894   32.774  1.00 140.07 ? 698  ARG A CA    1 
ATOM   8888  C  C     . ARG I  4 698  ? 25.802  20.591   33.311  1.00 141.43 ? 698  ARG A C     1 
ATOM   8889  O  O     . ARG I  4 698  ? 25.722  21.408   34.229  1.00 129.56 ? 698  ARG A O     1 
ATOM   8890  C  CB    . ARG I  4 698  ? 24.118  20.394   31.373  1.00 137.75 ? 698  ARG A CB    1 
ATOM   8891  C  CG    . ARG I  4 698  ? 23.787  21.878   31.286  1.00 141.34 ? 698  ARG A CG    1 
ATOM   8892  C  CD    . ARG I  4 698  ? 23.382  22.326   29.882  1.00 144.47 ? 698  ARG A CD    1 
ATOM   8893  N  NE    . ARG I  4 698  ? 22.136  21.708   29.445  1.00 143.24 ? 698  ARG A NE    1 
ATOM   8894  C  CZ    . ARG I  4 698  ? 22.037  20.584   28.736  1.00 149.09 ? 698  ARG A CZ    1 
ATOM   8895  N  NH1   . ARG I  4 698  ? 23.124  19.919   28.342  1.00 148.29 ? 698  ARG A NH1   1 
ATOM   8896  N  NH2   . ARG I  4 698  ? 20.828  20.116   28.416  1.00 156.74 ? 698  ARG A NH2   1 
ATOM   8897  N  N     . PRO I  4 699  ? 26.982  20.262   32.754  1.00 152.22 ? 699  PRO A N     1 
ATOM   8898  C  CA    . PRO I  4 699  ? 28.167  20.995   33.183  1.00 150.86 ? 699  PRO A CA    1 
ATOM   8899  C  C     . PRO I  4 699  ? 28.066  22.481   32.851  1.00 151.68 ? 699  PRO A C     1 
ATOM   8900  O  O     . PRO I  4 699  ? 28.051  22.859   31.677  1.00 147.19 ? 699  PRO A O     1 
ATOM   8901  C  CB    . PRO I  4 699  ? 29.301  20.332   32.390  1.00 154.87 ? 699  PRO A CB    1 
ATOM   8902  C  CG    . PRO I  4 699  ? 28.643  19.713   31.209  1.00 151.91 ? 699  PRO A CG    1 
ATOM   8903  C  CD    . PRO I  4 699  ? 27.305  19.259   31.721  1.00 154.20 ? 699  PRO A CD    1 
ATOM   8904  N  N     . GLY I  4 700  ? 27.959  23.294   33.899  1.00 160.35 ? 700  GLY A N     1 
ATOM   8905  C  CA    . GLY I  4 700  ? 27.957  24.754   33.790  1.00 157.89 ? 700  GLY A CA    1 
ATOM   8906  C  C     . GLY I  4 700  ? 26.880  25.332   34.689  1.00 151.97 ? 700  GLY A C     1 
ATOM   8907  O  O     . GLY I  4 700  ? 27.166  25.842   35.777  1.00 149.18 ? 700  GLY A O     1 
ATOM   8908  N  N     . PRO I  4 701  ? 25.620  25.224   34.253  1.00 146.45 ? 701  PRO A N     1 
ATOM   8909  C  CA    . PRO I  4 701  ? 24.492  25.780   34.993  1.00 146.26 ? 701  PRO A CA    1 
ATOM   8910  C  C     . PRO I  4 701  ? 24.023  24.916   36.177  1.00 145.97 ? 701  PRO A C     1 
ATOM   8911  O  O     . PRO I  4 701  ? 23.064  25.281   36.865  1.00 145.00 ? 701  PRO A O     1 
ATOM   8912  C  CB    . PRO I  4 701  ? 23.407  25.898   33.919  1.00 150.22 ? 701  PRO A CB    1 
ATOM   8913  C  CG    . PRO I  4 701  ? 23.725  24.824   32.934  1.00 148.52 ? 701  PRO A CG    1 
ATOM   8914  C  CD    . PRO I  4 701  ? 25.213  24.625   32.968  1.00 147.79 ? 701  PRO A CD    1 
ATOM   8915  N  N     . MET I  4 702  ? 24.707  23.800   36.422  1.00 145.37 ? 702  MET A N     1 
ATOM   8916  C  CA    . MET I  4 702  ? 24.402  22.929   37.556  1.00 144.02 ? 702  MET A CA    1 
ATOM   8917  C  C     . MET I  4 702  ? 24.520  23.653   38.891  1.00 149.04 ? 702  MET A C     1 
ATOM   8918  O  O     . MET I  4 702  ? 23.878  23.251   39.867  1.00 162.97 ? 702  MET A O     1 
ATOM   8919  C  CB    . MET I  4 702  ? 25.337  21.721   37.559  1.00 143.73 ? 702  MET A CB    1 
ATOM   8920  C  CG    . MET I  4 702  ? 25.068  20.697   38.648  1.00 144.73 ? 702  MET A CG    1 
ATOM   8921  S  SD    . MET I  4 702  ? 25.919  19.141   38.309  1.00 139.42 ? 702  MET A SD    1 
ATOM   8922  C  CE    . MET I  4 702  ? 25.504  18.167   39.766  1.00 153.40 ? 702  MET A CE    1 
ATOM   8923  N  N     . GLU I  4 703  ? 25.341  24.705   38.935  1.00 148.60 ? 703  GLU A N     1 
ATOM   8924  C  CA    . GLU I  4 703  ? 25.530  25.507   40.156  1.00 152.70 ? 703  GLU A CA    1 
ATOM   8925  C  C     . GLU I  4 703  ? 24.333  26.400   40.500  1.00 148.50 ? 703  GLU A C     1 
ATOM   8926  O  O     . GLU I  4 703  ? 24.253  26.934   41.612  1.00 148.75 ? 703  GLU A O     1 
ATOM   8927  C  CB    . GLU I  4 703  ? 26.801  26.366   40.063  1.00 157.35 ? 703  GLU A CB    1 
ATOM   8928  C  CG    . GLU I  4 703  ? 26.751  27.481   39.020  1.00 159.77 ? 703  GLU A CG    1 
ATOM   8929  C  CD    . GLU I  4 703  ? 27.959  28.401   39.081  1.00 155.96 ? 703  GLU A CD    1 
ATOM   8930  O  OE1   . GLU I  4 703  ? 29.066  27.935   39.431  1.00 157.62 ? 703  GLU A OE1   1 
ATOM   8931  O  OE2   . GLU I  4 703  ? 27.798  29.602   38.777  1.00 157.39 ? 703  GLU A OE2   1 
ATOM   8932  N  N     . HIS I  4 704  ? 23.416  26.569   39.553  1.00 142.15 ? 704  HIS A N     1 
ATOM   8933  C  CA    . HIS I  4 704  ? 22.198  27.321   39.807  1.00 148.07 ? 704  HIS A CA    1 
ATOM   8934  C  C     . HIS I  4 704  ? 21.071  26.466   40.343  1.00 151.39 ? 704  HIS A C     1 
ATOM   8935  O  O     . HIS I  4 704  ? 20.020  26.997   40.728  1.00 155.23 ? 704  HIS A O     1 
ATOM   8936  C  CB    . HIS I  4 704  ? 21.750  28.012   38.533  1.00 154.51 ? 704  HIS A CB    1 
ATOM   8937  C  CG    . HIS I  4 704  ? 22.787  28.931   37.946  1.00 158.37 ? 704  HIS A CG    1 
ATOM   8938  N  ND1   . HIS I  4 704  ? 23.379  29.899   38.664  1.00 166.24 ? 704  HIS A ND1   1 
ATOM   8939  C  CD2   . HIS I  4 704  ? 23.322  29.009   36.660  1.00 160.02 ? 704  HIS A CD2   1 
ATOM   8940  C  CE1   . HIS I  4 704  ? 24.256  30.565   37.883  1.00 168.44 ? 704  HIS A CE1   1 
ATOM   8941  N  NE2   . HIS I  4 704  ? 24.220  30.019   36.656  1.00 162.93 ? 704  HIS A NE2   1 
ATOM   8942  N  N     . ILE I  4 705  ? 21.268  25.144   40.382  1.00 146.61 ? 705  ILE A N     1 
ATOM   8943  C  CA    . ILE I  4 705  ? 20.228  24.220   40.865  1.00 142.94 ? 705  ILE A CA    1 
ATOM   8944  C  C     . ILE I  4 705  ? 19.914  24.381   42.355  1.00 135.93 ? 705  ILE A C     1 
ATOM   8945  O  O     . ILE I  4 705  ? 18.746  24.442   42.715  1.00 131.47 ? 705  ILE A O     1 
ATOM   8946  C  CB    . ILE I  4 705  ? 20.562  22.739   40.555  1.00 138.32 ? 705  ILE A CB    1 
ATOM   8947  C  CG1   . ILE I  4 705  ? 20.574  22.510   39.052  1.00 133.22 ? 705  ILE A CG1   1 
ATOM   8948  C  CG2   . ILE I  4 705  ? 19.525  21.808   41.179  1.00 140.26 ? 705  ILE A CG2   1 
ATOM   8949  C  CD1   . ILE I  4 705  ? 20.786  21.066   38.687  1.00 132.26 ? 705  ILE A CD1   1 
ATOM   8950  N  N     . PRO I  4 706  ? 20.951  24.450   43.217  1.00 134.90 ? 706  PRO A N     1 
ATOM   8951  C  CA    . PRO I  4 706  ? 20.706  24.682   44.649  1.00 138.95 ? 706  PRO A CA    1 
ATOM   8952  C  C     . PRO I  4 706  ? 19.919  25.973   44.937  1.00 144.65 ? 706  PRO A C     1 
ATOM   8953  O  O     . PRO I  4 706  ? 19.049  25.984   45.820  1.00 150.29 ? 706  PRO A O     1 
ATOM   8954  C  CB    . PRO I  4 706  ? 22.120  24.772   45.240  1.00 134.91 ? 706  PRO A CB    1 
ATOM   8955  C  CG    . PRO I  4 706  ? 22.975  24.019   44.281  1.00 132.74 ? 706  PRO A CG    1 
ATOM   8956  C  CD    . PRO I  4 706  ? 22.392  24.303   42.933  1.00 130.36 ? 706  PRO A CD    1 
ATOM   8957  N  N     . THR I  4 707  ? 20.223  27.035   44.187  1.00 141.40 ? 707  THR A N     1 
ATOM   8958  C  CA    . THR I  4 707  ? 19.496  28.312   44.277  1.00 143.10 ? 707  THR A CA    1 
ATOM   8959  C  C     . THR I  4 707  ? 18.008  28.145   43.879  1.00 142.84 ? 707  THR A C     1 
ATOM   8960  O  O     . THR I  4 707  ? 17.087  28.713   44.504  1.00 130.53 ? 707  THR A O     1 
ATOM   8961  C  CB    . THR I  4 707  ? 20.172  29.384   43.374  1.00 137.51 ? 707  THR A CB    1 
ATOM   8962  O  OG1   . THR I  4 707  ? 21.598  29.343   43.549  1.00 128.41 ? 707  THR A OG1   1 
ATOM   8963  C  CG2   . THR I  4 707  ? 19.658  30.792   43.692  1.00 137.88 ? 707  THR A CG2   1 
ATOM   8964  N  N     . TYR I  4 708  ? 17.789  27.351   42.834  1.00 143.81 ? 708  TYR A N     1 
ATOM   8965  C  CA    . TYR I  4 708  ? 16.441  27.088   42.343  1.00 145.66 ? 708  TYR A CA    1 
ATOM   8966  C  C     . TYR I  4 708  ? 15.618  26.310   43.402  1.00 144.29 ? 708  TYR A C     1 
ATOM   8967  O  O     . TYR I  4 708  ? 14.468  26.666   43.695  1.00 138.24 ? 708  TYR A O     1 
ATOM   8968  C  CB    . TYR I  4 708  ? 16.518  26.335   41.006  1.00 138.17 ? 708  TYR A CB    1 
ATOM   8969  C  CG    . TYR I  4 708  ? 15.201  26.205   40.268  1.00 134.50 ? 708  TYR A CG    1 
ATOM   8970  C  CD1   . TYR I  4 708  ? 14.865  27.075   39.242  1.00 132.26 ? 708  TYR A CD1   1 
ATOM   8971  C  CD2   . TYR I  4 708  ? 14.301  25.190   40.583  1.00 139.02 ? 708  TYR A CD2   1 
ATOM   8972  C  CE1   . TYR I  4 708  ? 13.669  26.942   38.548  1.00 132.72 ? 708  TYR A CE1   1 
ATOM   8973  C  CE2   . TYR I  4 708  ? 13.097  25.054   39.902  1.00 140.70 ? 708  TYR A CE2   1 
ATOM   8974  C  CZ    . TYR I  4 708  ? 12.781  25.933   38.880  1.00 135.02 ? 708  TYR A CZ    1 
ATOM   8975  O  OH    . TYR I  4 708  ? 11.581  25.789   38.200  1.00 125.35 ? 708  TYR A OH    1 
ATOM   8976  N  N     . ILE I  4 709  ? 16.234  25.281   43.988  1.00 139.86 ? 709  ILE A N     1 
ATOM   8977  C  CA    . ILE I  4 709  ? 15.562  24.390   44.938  1.00 144.11 ? 709  ILE A CA    1 
ATOM   8978  C  C     . ILE I  4 709  ? 15.088  25.123   46.199  1.00 146.92 ? 709  ILE A C     1 
ATOM   8979  O  O     . ILE I  4 709  ? 13.974  24.890   46.691  1.00 146.73 ? 709  ILE A O     1 
ATOM   8980  C  CB    . ILE I  4 709  ? 16.473  23.204   45.346  1.00 144.06 ? 709  ILE A CB    1 
ATOM   8981  C  CG1   . ILE I  4 709  ? 16.656  22.241   44.173  1.00 142.49 ? 709  ILE A CG1   1 
ATOM   8982  C  CG2   . ILE I  4 709  ? 15.884  22.427   46.519  1.00 144.42 ? 709  ILE A CG2   1 
ATOM   8983  C  CD1   . ILE I  4 709  ? 17.650  21.139   44.450  1.00 141.86 ? 709  ILE A CD1   1 
ATOM   8984  N  N     . ARG I  4 710  ? 15.936  26.000   46.726  1.00 148.63 ? 710  ARG A N     1 
ATOM   8985  C  CA    . ARG I  4 710  ? 15.595  26.761   47.934  1.00 145.21 ? 710  ARG A CA    1 
ATOM   8986  C  C     . ARG I  4 710  ? 14.569  27.852   47.629  1.00 142.96 ? 710  ARG A C     1 
ATOM   8987  O  O     . ARG I  4 710  ? 13.733  28.165   48.462  1.00 142.82 ? 710  ARG A O     1 
ATOM   8988  C  CB    . ARG I  4 710  ? 16.855  27.350   48.572  1.00 146.56 ? 710  ARG A CB    1 
ATOM   8989  C  CG    . ARG I  4 710  ? 17.650  26.327   49.381  1.00 148.95 ? 710  ARG A CG    1 
ATOM   8990  C  CD    . ARG I  4 710  ? 18.934  26.904   49.956  1.00 149.97 ? 710  ARG A CD    1 
ATOM   8991  N  NE    . ARG I  4 710  ? 20.024  26.860   48.986  1.00 147.46 ? 710  ARG A NE    1 
ATOM   8992  C  CZ    . ARG I  4 710  ? 20.371  27.852   48.166  1.00 144.74 ? 710  ARG A CZ    1 
ATOM   8993  N  NH1   . ARG I  4 710  ? 19.727  29.018   48.175  1.00 149.52 ? 710  ARG A NH1   1 
ATOM   8994  N  NH2   . ARG I  4 710  ? 21.378  27.669   47.317  1.00 140.25 ? 710  ARG A NH2   1 
ATOM   8995  N  N     . ARG I  4 711  ? 14.630  28.416   46.426  1.00 146.06 ? 711  ARG A N     1 
ATOM   8996  C  CA    . ARG I  4 711  ? 13.617  29.367   45.970  1.00 141.99 ? 711  ARG A CA    1 
ATOM   8997  C  C     . ARG I  4 711  ? 12.284  28.689   45.623  1.00 138.63 ? 711  ARG A C     1 
ATOM   8998  O  O     . ARG I  4 711  ? 11.222  29.303   45.739  1.00 127.33 ? 711  ARG A O     1 
ATOM   8999  C  CB    . ARG I  4 711  ? 14.141  30.147   44.763  1.00 140.57 ? 711  ARG A CB    1 
ATOM   9000  C  CG    . ARG I  4 711  ? 15.162  31.202   45.142  1.00 144.08 ? 711  ARG A CG    1 
ATOM   9001  C  CD    . ARG I  4 711  ? 15.624  32.000   43.936  1.00 147.57 ? 711  ARG A CD    1 
ATOM   9002  N  NE    . ARG I  4 711  ? 16.791  32.838   44.235  1.00 150.07 ? 711  ARG A NE    1 
ATOM   9003  C  CZ    . ARG I  4 711  ? 17.455  33.573   43.339  1.00 145.39 ? 711  ARG A CZ    1 
ATOM   9004  N  NH1   . ARG I  4 711  ? 17.073  33.606   42.065  1.00 141.58 ? 711  ARG A NH1   1 
ATOM   9005  N  NH2   . ARG I  4 711  ? 18.507  34.284   43.722  1.00 143.78 ? 711  ARG A NH2   1 
ATOM   9006  N  N     . HIS I  4 712  ? 12.354  27.433   45.183  1.00 140.02 ? 712  HIS A N     1 
ATOM   9007  C  CA    . HIS I  4 712  ? 11.159  26.653   44.862  1.00 146.13 ? 712  HIS A CA    1 
ATOM   9008  C  C     . HIS I  4 712  ? 10.421  26.180   46.095  1.00 147.30 ? 712  HIS A C     1 
ATOM   9009  O  O     . HIS I  4 712  ? 9.179   26.193   46.139  1.00 141.83 ? 712  HIS A O     1 
ATOM   9010  C  CB    . HIS I  4 712  ? 11.512  25.457   43.977  1.00 146.60 ? 712  HIS A CB    1 
ATOM   9011  C  CG    . HIS I  4 712  ? 10.318  24.591   43.619  1.00 150.73 ? 712  HIS A CG    1 
ATOM   9012  N  ND1   . HIS I  4 712  ? 9.468   24.900   42.614  1.00 154.21 ? 712  HIS A ND1   1 
ATOM   9013  C  CD2   . HIS I  4 712  ? 9.840   23.413   44.187  1.00 148.28 ? 712  HIS A CD2   1 
ATOM   9014  C  CE1   . HIS I  4 712  ? 8.503   23.961   42.538  1.00 153.17 ? 712  HIS A CE1   1 
ATOM   9015  N  NE2   . HIS I  4 712  ? 8.731   23.052   43.501  1.00 148.63 ? 712  HIS A NE2   1 
ATOM   9016  N  N     . HIS I  4 713  ? 11.168  25.741   47.102  1.00 150.28 ? 713  HIS A N     1 
ATOM   9017  C  CA    . HIS I  4 713  ? 10.558  25.310   48.368  1.00 161.06 ? 713  HIS A CA    1 
ATOM   9018  C  C     . HIS I  4 713  ? 9.894   26.436   49.114  1.00 166.59 ? 713  HIS A C     1 
ATOM   9019  O  O     . HIS I  4 713  ? 9.006   26.192   49.946  1.00 174.07 ? 713  HIS A O     1 
ATOM   9020  C  CB    . HIS I  4 713  ? 11.579  24.636   49.281  1.00 161.88 ? 713  HIS A CB    1 
ATOM   9021  C  CG    . HIS I  4 713  ? 11.749  23.159   49.025  1.00 160.59 ? 713  HIS A CG    1 
ATOM   9022  N  ND1   . HIS I  4 713  ? 10.754  22.270   49.216  1.00 158.74 ? 713  HIS A ND1   1 
ATOM   9023  C  CD2   . HIS I  4 713  ? 12.853  22.428   48.597  1.00 160.69 ? 713  HIS A CD2   1 
ATOM   9024  C  CE1   . HIS I  4 713  ? 11.195  21.036   48.911  1.00 161.19 ? 713  HIS A CE1   1 
ATOM   9025  N  NE2   . HIS I  4 713  ? 12.482  21.134   48.534  1.00 161.21 ? 713  HIS A NE2   1 
ATOM   9026  N  N     . GLY I  4 714  ? 10.317  27.670   48.836  1.00 161.27 ? 714  GLY A N     1 
ATOM   9027  C  CA    . GLY I  4 714  ? 9.716   28.855   49.446  1.00 159.73 ? 714  GLY A CA    1 
ATOM   9028  C  C     . GLY I  4 714  ? 10.420  29.240   50.731  1.00 151.98 ? 714  GLY A C     1 
ATOM   9029  O  O     . GLY I  4 714  ? 9.775   29.562   51.742  1.00 143.54 ? 714  GLY A O     1 
ATOM   9030  N  N     . GLN I  4 715  ? 11.750  29.215   50.676  1.00 148.47 ? 715  GLN A N     1 
ATOM   9031  C  CA    . GLN I  4 715  ? 12.597  29.590   51.809  1.00 154.28 ? 715  GLN A CA    1 
ATOM   9032  C  C     . GLN I  4 715  ? 13.693  30.618   51.433  1.00 145.86 ? 715  GLN A C     1 
ATOM   9033  O  O     . GLN I  4 715  ? 14.697  30.741   52.143  1.00 134.82 ? 715  GLN A O     1 
ATOM   9034  C  CB    . GLN I  4 715  ? 13.213  28.324   52.426  1.00 157.89 ? 715  GLN A CB    1 
ATOM   9035  C  CG    . GLN I  4 715  ? 12.184  27.304   52.919  1.00 155.01 ? 715  GLN A CG    1 
ATOM   9036  C  CD    . GLN I  4 715  ? 12.820  26.074   53.553  1.00 158.83 ? 715  GLN A CD    1 
ATOM   9037  O  OE1   . GLN I  4 715  ? 13.854  25.585   53.096  1.00 171.17 ? 715  GLN A OE1   1 
ATOM   9038  N  NE2   . GLN I  4 715  ? 12.194  25.561   54.605  1.00 157.08 ? 715  GLN A NE2   1 
ATOM   9039  N  N     . GLU I  4 716  ? 13.477  31.351   50.332  1.00 146.71 ? 716  GLU A N     1 
ATOM   9040  C  CA    . GLU I  4 716  ? 14.393  32.408   49.863  1.00 148.86 ? 716  GLU A CA    1 
ATOM   9041  C  C     . GLU I  4 716  ? 13.683  33.344   48.863  1.00 148.83 ? 716  GLU A C     1 
ATOM   9042  O  O     . GLU I  4 716  ? 13.237  32.895   47.803  1.00 151.70 ? 716  GLU A O     1 
ATOM   9043  C  CB    . GLU I  4 716  ? 15.645  31.809   49.214  1.00 146.73 ? 716  GLU A CB    1 
ATOM   9044  C  CG    . GLU I  4 716  ? 16.710  32.841   48.839  1.00 152.60 ? 716  GLU A CG    1 
ATOM   9045  C  CD    . GLU I  4 716  ? 18.055  32.229   48.430  1.00 158.74 ? 716  GLU A CD    1 
ATOM   9046  O  OE1   . GLU I  4 716  ? 18.612  31.431   49.224  1.00 169.01 ? 716  GLU A OE1   1 
ATOM   9047  O  OE2   . GLU I  4 716  ? 18.576  32.556   47.331  1.00 143.61 ? 716  GLU A OE2   1 
ATOM   9048  N  N     . PRO I  4 717  ? 13.577  34.646   49.193  1.00 143.40 ? 717  PRO A N     1 
ATOM   9049  C  CA    . PRO I  4 717  ? 12.890  35.569   48.295  1.00 144.81 ? 717  PRO A CA    1 
ATOM   9050  C  C     . PRO I  4 717  ? 13.586  35.728   46.949  1.00 148.11 ? 717  PRO A C     1 
ATOM   9051  O  O     . PRO I  4 717  ? 14.806  35.848   46.897  1.00 160.14 ? 717  PRO A O     1 
ATOM   9052  C  CB    . PRO I  4 717  ? 12.937  36.901   49.051  1.00 147.63 ? 717  PRO A CB    1 
ATOM   9053  C  CG    . PRO I  4 717  ? 13.176  36.544   50.470  1.00 147.52 ? 717  PRO A CG    1 
ATOM   9054  C  CD    . PRO I  4 717  ? 14.001  35.303   50.440  1.00 143.32 ? 717  PRO A CD    1 
ATOM   9055  N  N     . VAL I  4 718  ? 12.800  35.752   45.877  1.00 150.30 ? 718  VAL A N     1 
ATOM   9056  C  CA    . VAL I  4 718  ? 13.308  36.038   44.530  1.00 153.49 ? 718  VAL A CA    1 
ATOM   9057  C  C     . VAL I  4 718  ? 13.355  37.568   44.301  1.00 157.30 ? 718  VAL A C     1 
ATOM   9058  O  O     . VAL I  4 718  ? 12.390  38.175   43.804  1.00 148.22 ? 718  VAL A O     1 
ATOM   9059  C  CB    . VAL I  4 718  ? 12.440  35.346   43.447  1.00 148.03 ? 718  VAL A CB    1 
ATOM   9060  C  CG1   . VAL I  4 718  ? 13.144  35.374   42.096  1.00 143.22 ? 718  VAL A CG1   1 
ATOM   9061  C  CG2   . VAL I  4 718  ? 12.128  33.913   43.842  1.00 142.08 ? 718  VAL A CG2   1 
ATOM   9062  N  N     . SER I  4 719  ? 14.480  38.181   44.675  1.00 164.16 ? 719  SER A N     1 
ATOM   9063  C  CA    . SER I  4 719  ? 14.627  39.652   44.654  1.00 174.16 ? 719  SER A CA    1 
ATOM   9064  C  C     . SER I  4 719  ? 15.374  40.188   43.416  1.00 158.89 ? 719  SER A C     1 
ATOM   9065  O  O     . SER I  4 719  ? 16.213  39.503   42.843  1.00 150.17 ? 719  SER A O     1 
ATOM   9066  C  CB    . SER I  4 719  ? 15.320  40.140   45.940  1.00 181.81 ? 719  SER A CB    1 
ATOM   9067  O  OG    . SER I  4 719  ? 16.621  39.595   46.078  1.00 192.58 ? 719  SER A OG    1 
ATOM   9068  N  N     . TYR I  4 720  ? 15.043  41.414   43.019  1.00 151.60 ? 720  TYR A N     1 
ATOM   9069  C  CA    . TYR I  4 720  ? 15.672  42.081   41.883  1.00 155.15 ? 720  TYR A CA    1 
ATOM   9070  C  C     . TYR I  4 720  ? 16.148  43.488   42.301  1.00 161.87 ? 720  TYR A C     1 
ATOM   9071  O  O     . TYR I  4 720  ? 16.013  44.467   41.549  1.00 152.30 ? 720  TYR A O     1 
ATOM   9072  C  CB    . TYR I  4 720  ? 14.683  42.181   40.716  1.00 156.66 ? 720  TYR A CB    1 
ATOM   9073  C  CG    . TYR I  4 720  ? 14.065  40.870   40.267  1.00 154.62 ? 720  TYR A CG    1 
ATOM   9074  C  CD1   . TYR I  4 720  ? 12.867  40.414   40.820  1.00 157.05 ? 720  TYR A CD1   1 
ATOM   9075  C  CD2   . TYR I  4 720  ? 14.658  40.103   39.269  1.00 155.19 ? 720  TYR A CD2   1 
ATOM   9076  C  CE1   . TYR I  4 720  ? 12.287  39.227   40.401  1.00 155.60 ? 720  TYR A CE1   1 
ATOM   9077  C  CE2   . TYR I  4 720  ? 14.084  38.914   38.840  1.00 157.09 ? 720  TYR A CE2   1 
ATOM   9078  C  CZ    . TYR I  4 720  ? 12.896  38.484   39.412  1.00 160.45 ? 720  TYR A CZ    1 
ATOM   9079  O  OH    . TYR I  4 720  ? 12.307  37.310   39.009  1.00 167.26 ? 720  TYR A OH    1 
ATOM   9080  N  N     . ALA I  4 721  ? 16.727  43.569   43.503  1.00 170.25 ? 721  ALA A N     1 
ATOM   9081  C  CA    . ALA I  4 721  ? 17.111  44.849   44.127  1.00 165.66 ? 721  ALA A CA    1 
ATOM   9082  C  C     . ALA I  4 721  ? 18.341  45.483   43.479  1.00 172.20 ? 721  ALA A C     1 
ATOM   9083  O  O     . ALA I  4 721  ? 18.672  46.636   43.762  1.00 176.04 ? 721  ALA A O     1 
ATOM   9084  C  CB    . ALA I  4 721  ? 17.348  44.657   45.617  1.00 158.73 ? 721  ALA A CB    1 
ATOM   9085  N  N     . GLU I  4 722  ? 19.035  44.722   42.634  1.00 176.80 ? 722  GLU A N     1 
ATOM   9086  C  CA    . GLU I  4 722  ? 20.168  45.240   41.871  1.00 172.97 ? 722  GLU A CA    1 
ATOM   9087  C  C     . GLU I  4 722  ? 19.694  46.025   40.659  1.00 165.66 ? 722  GLU A C     1 
ATOM   9088  O  O     . GLU I  4 722  ? 20.366  46.939   40.207  1.00 164.82 ? 722  GLU A O     1 
ATOM   9089  C  CB    . GLU I  4 722  ? 21.088  44.094   41.436  1.00 172.31 ? 722  GLU A CB    1 
ATOM   9090  C  CG    . GLU I  4 722  ? 21.749  43.377   42.608  1.00 174.56 ? 722  GLU A CG    1 
ATOM   9091  C  CD    . GLU I  4 722  ? 22.490  42.126   42.199  1.00 182.77 ? 722  GLU A CD    1 
ATOM   9092  O  OE1   . GLU I  4 722  ? 22.729  41.935   40.986  1.00 200.61 ? 722  GLU A OE1   1 
ATOM   9093  O  OE2   . GLU I  4 722  ? 22.828  41.327   43.100  1.00 184.58 ? 722  GLU A OE2   1 
ATOM   9094  N  N     . PHE I  4 723  ? 18.528  45.659   40.142  1.00 165.87 ? 723  PHE A N     1 
ATOM   9095  C  CA    . PHE I  4 723  ? 17.948  46.329   38.988  1.00 165.63 ? 723  PHE A CA    1 
ATOM   9096  C  C     . PHE I  4 723  ? 16.496  46.715   39.295  1.00 169.72 ? 723  PHE A C     1 
ATOM   9097  O  O     . PHE I  4 723  ? 15.563  46.088   38.785  1.00 169.38 ? 723  PHE A O     1 
ATOM   9098  C  CB    . PHE I  4 723  ? 18.013  45.398   37.780  1.00 167.36 ? 723  PHE A CB    1 
ATOM   9099  C  CG    . PHE I  4 723  ? 19.345  44.728   37.602  1.00 165.76 ? 723  PHE A CG    1 
ATOM   9100  C  CD1   . PHE I  4 723  ? 19.552  43.432   38.056  1.00 159.73 ? 723  PHE A CD1   1 
ATOM   9101  C  CD2   . PHE I  4 723  ? 20.392  45.392   36.976  1.00 170.35 ? 723  PHE A CD2   1 
ATOM   9102  C  CE1   . PHE I  4 723  ? 20.778  42.813   37.890  1.00 158.56 ? 723  PHE A CE1   1 
ATOM   9103  C  CE2   . PHE I  4 723  ? 21.621  44.777   36.802  1.00 165.26 ? 723  PHE A CE2   1 
ATOM   9104  C  CZ    . PHE I  4 723  ? 21.814  43.487   37.266  1.00 161.32 ? 723  PHE A CZ    1 
ATOM   9105  N  N     . PRO I  4 724  ? 16.298  47.738   40.153  1.00 173.63 ? 724  PRO A N     1 
ATOM   9106  C  CA    . PRO I  4 724  ? 14.948  48.164   40.577  1.00 170.82 ? 724  PRO A CA    1 
ATOM   9107  C  C     . PRO I  4 724  ? 14.090  48.784   39.469  1.00 166.86 ? 724  PRO A C     1 
ATOM   9108  O  O     . PRO I  4 724  ? 12.868  48.588   39.453  1.00 165.03 ? 724  PRO A O     1 
ATOM   9109  C  CB    . PRO I  4 724  ? 15.228  49.199   41.673  1.00 169.39 ? 724  PRO A CB    1 
ATOM   9110  C  CG    . PRO I  4 724  ? 16.618  49.665   41.412  1.00 172.55 ? 724  PRO A CG    1 
ATOM   9111  C  CD    . PRO I  4 724  ? 17.348  48.470   40.885  1.00 173.03 ? 724  PRO A CD    1 
ATOM   9112  N  N     . HIS I  4 725  ? 14.720  49.535   38.571  1.00 159.67 ? 725  HIS A N     1 
ATOM   9113  C  CA    . HIS I  4 725  ? 14.015  50.099   37.421  1.00 162.22 ? 725  HIS A CA    1 
ATOM