data_4IRQ
# 
_entry.id   4IRQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IRQ         
RCSB  RCSB077125   
WWPDB D_1000077125 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4IRP 'catalytic domain of human beta1,4galactosyltransferase 7 in open conformation' unspecified 
PDB 3LW6 'Drosophila beta1,4galactosyltransferase'                                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4IRQ 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tsutsui, Y.'      1 
'Ramakrishnan, B.' 2 
'Qasba, P.K.'      3 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structures of beta-1,4-galactosyltransferase 7 enzyme reveal conformational changes and substrate binding.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            288 
_citation.page_first                31963 
_citation.page_last                 31970 
_citation.year                      2013 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24052259 
_citation.pdbx_database_id_DOI      10.1074/jbc.M113.509984 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tsutsui, Y.'      1 
primary 'Ramakrishnan, B.' 2 
primary 'Qasba, P.K.'      3 
# 
_cell.entry_id           4IRQ 
_cell.length_a           67.122 
_cell.length_b           121.532 
_cell.length_c           97.137 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.12 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IRQ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Beta-1,4-galactosyltransferase 7'       29216.273 4   '2.4.1.-, 2.4.1.133' ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'                     54.938    4   ?                    ? ? ? 
3 non-polymer syn "URIDINE-5'-DIPHOSPHATE"                 404.161   4   ?                    ? ? ? 
4 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143   4   ?                    ? ? ? 
5 water       nat water                                    18.015    289 ?                    ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Beta-1,4-GalTase 7, Beta4Gal-T7, b4Gal-T7, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7, Xylosylprotein 4-beta-galactosyltransferase, Proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I, UDP-galactose:beta-xylose beta-1,4-galactosyltransferase, XGPT, XGalT-1, Xylosylprotein beta-1,4-galactosyltransferase
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSDIPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNST
DYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIK
GAGLQLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTALSVGGAPCTVLNIMLDC
DKTATPWCTFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSDIPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNST
DYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIK
GAGLQLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTALSVGGAPCTVLNIMLDC
DKTATPWCTFS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ASP n 
1 4   ILE n 
1 5   PRO n 
1 6   GLU n 
1 7   HIS n 
1 8   TRP n 
1 9   GLU n 
1 10  GLU n 
1 11  ASP n 
1 12  ALA n 
1 13  SER n 
1 14  TRP n 
1 15  GLY n 
1 16  PRO n 
1 17  HIS n 
1 18  ARG n 
1 19  LEU n 
1 20  ALA n 
1 21  VAL n 
1 22  LEU n 
1 23  VAL n 
1 24  PRO n 
1 25  PHE n 
1 26  ARG n 
1 27  GLU n 
1 28  ARG n 
1 29  PHE n 
1 30  GLU n 
1 31  GLU n 
1 32  LEU n 
1 33  LEU n 
1 34  VAL n 
1 35  PHE n 
1 36  VAL n 
1 37  PRO n 
1 38  HIS n 
1 39  MET n 
1 40  ARG n 
1 41  ARG n 
1 42  PHE n 
1 43  LEU n 
1 44  SER n 
1 45  ARG n 
1 46  LYS n 
1 47  LYS n 
1 48  ILE n 
1 49  ARG n 
1 50  HIS n 
1 51  HIS n 
1 52  ILE n 
1 53  TYR n 
1 54  VAL n 
1 55  LEU n 
1 56  ASN n 
1 57  GLN n 
1 58  VAL n 
1 59  ASP n 
1 60  HIS n 
1 61  PHE n 
1 62  ARG n 
1 63  PHE n 
1 64  ASN n 
1 65  ARG n 
1 66  ALA n 
1 67  ALA n 
1 68  LEU n 
1 69  ILE n 
1 70  ASN n 
1 71  VAL n 
1 72  GLY n 
1 73  PHE n 
1 74  LEU n 
1 75  GLU n 
1 76  SER n 
1 77  SER n 
1 78  ASN n 
1 79  SER n 
1 80  THR n 
1 81  ASP n 
1 82  TYR n 
1 83  ILE n 
1 84  ALA n 
1 85  MET n 
1 86  HIS n 
1 87  ASP n 
1 88  VAL n 
1 89  ASP n 
1 90  LEU n 
1 91  LEU n 
1 92  PRO n 
1 93  LEU n 
1 94  ASN n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  ASP n 
1 99  TYR n 
1 100 GLY n 
1 101 PHE n 
1 102 PRO n 
1 103 GLU n 
1 104 ALA n 
1 105 GLY n 
1 106 PRO n 
1 107 PHE n 
1 108 HIS n 
1 109 VAL n 
1 110 ALA n 
1 111 SER n 
1 112 PRO n 
1 113 GLU n 
1 114 LEU n 
1 115 HIS n 
1 116 PRO n 
1 117 LEU n 
1 118 TYR n 
1 119 HIS n 
1 120 TYR n 
1 121 LYS n 
1 122 THR n 
1 123 TYR n 
1 124 VAL n 
1 125 GLY n 
1 126 GLY n 
1 127 ILE n 
1 128 LEU n 
1 129 LEU n 
1 130 LEU n 
1 131 SER n 
1 132 LYS n 
1 133 GLN n 
1 134 HIS n 
1 135 TYR n 
1 136 ARG n 
1 137 LEU n 
1 138 CYS n 
1 139 ASN n 
1 140 GLY n 
1 141 MET n 
1 142 SER n 
1 143 ASN n 
1 144 ARG n 
1 145 PHE n 
1 146 TRP n 
1 147 GLY n 
1 148 TRP n 
1 149 GLY n 
1 150 ARG n 
1 151 GLU n 
1 152 ASP n 
1 153 ASP n 
1 154 GLU n 
1 155 PHE n 
1 156 TYR n 
1 157 ARG n 
1 158 ARG n 
1 159 ILE n 
1 160 LYS n 
1 161 GLY n 
1 162 ALA n 
1 163 GLY n 
1 164 LEU n 
1 165 GLN n 
1 166 LEU n 
1 167 PHE n 
1 168 ARG n 
1 169 PRO n 
1 170 SER n 
1 171 GLY n 
1 172 ILE n 
1 173 THR n 
1 174 THR n 
1 175 GLY n 
1 176 TYR n 
1 177 LYS n 
1 178 THR n 
1 179 PHE n 
1 180 ARG n 
1 181 HIS n 
1 182 LEU n 
1 183 HIS n 
1 184 ASP n 
1 185 PRO n 
1 186 ALA n 
1 187 TRP n 
1 188 ARG n 
1 189 LYS n 
1 190 ARG n 
1 191 ASP n 
1 192 GLN n 
1 193 LYS n 
1 194 ARG n 
1 195 ILE n 
1 196 ALA n 
1 197 ALA n 
1 198 GLN n 
1 199 LYS n 
1 200 GLN n 
1 201 GLU n 
1 202 GLN n 
1 203 PHE n 
1 204 LYS n 
1 205 VAL n 
1 206 ASP n 
1 207 ARG n 
1 208 GLU n 
1 209 GLY n 
1 210 GLY n 
1 211 LEU n 
1 212 ASN n 
1 213 THR n 
1 214 VAL n 
1 215 LYS n 
1 216 TYR n 
1 217 HIS n 
1 218 VAL n 
1 219 ALA n 
1 220 SER n 
1 221 ARG n 
1 222 THR n 
1 223 ALA n 
1 224 LEU n 
1 225 SER n 
1 226 VAL n 
1 227 GLY n 
1 228 GLY n 
1 229 ALA n 
1 230 PRO n 
1 231 CYS n 
1 232 THR n 
1 233 VAL n 
1 234 LEU n 
1 235 ASN n 
1 236 ILE n 
1 237 MET n 
1 238 LEU n 
1 239 ASP n 
1 240 CYS n 
1 241 ASP n 
1 242 LYS n 
1 243 THR n 
1 244 ALA n 
1 245 THR n 
1 246 PRO n 
1 247 TRP n 
1 248 CYS n 
1 249 THR n 
1 250 PHE n 
1 251 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 '4galactosyltransferase, B4GALT7, beta1, UNQ748/PRO1478, XGALT1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'human Galectin-1 as fusion protein' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET23a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B4GT7_HUMAN 
_struct_ref.pdbx_db_accession          Q9UBV7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIA
MHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTALSVGGAPCTVLNIMLDCDKTA
TPWCTFS
;
_struct_ref.pdbx_align_begin           81 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IRQ A 5 ? 251 ? Q9UBV7 81 ? 327 ? 81 327 
2 1 4IRQ B 5 ? 251 ? Q9UBV7 81 ? 327 ? 81 327 
3 1 4IRQ C 5 ? 251 ? Q9UBV7 81 ? 327 ? 81 327 
4 1 4IRQ D 5 ? 251 ? Q9UBV7 81 ? 327 ? 81 327 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IRQ GLY A 1 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 77 1  
1 4IRQ SER A 2 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 78 2  
1 4IRQ ASP A 3 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 79 3  
1 4IRQ ILE A 4 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 80 4  
2 4IRQ GLY B 1 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 77 5  
2 4IRQ SER B 2 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 78 6  
2 4IRQ ASP B 3 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 79 7  
2 4IRQ ILE B 4 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 80 8  
3 4IRQ GLY C 1 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 77 9  
3 4IRQ SER C 2 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 78 10 
3 4IRQ ASP C 3 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 79 11 
3 4IRQ ILE C 4 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 80 12 
4 4IRQ GLY D 1 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 77 13 
4 4IRQ SER D 2 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 78 14 
4 4IRQ ASP D 3 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 79 15 
4 4IRQ ILE D 4 ? UNP Q9UBV7 ? ? 'EXPRESSION TAG' 80 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?             'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                 ?             'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?             'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?             'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?             'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ?             'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?             'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                  ?             'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?             'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                    ?             'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?             'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?             'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                   ?             'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                               ?             'C5 H11 N O2 S'    149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                     ?             'Mn 2'             54.938  
PHE 'L-peptide linking' y PHENYLALANINE                            ?             'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                  ?             'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                   ?             'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                ?             'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?             'C11 H12 N2 O2'    204.225 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1'    122.143 
TYR 'L-peptide linking' y TYROSINE                                 ?             'C9 H11 N O3'      181.189 
UDP 'RNA linking'       . "URIDINE-5'-DIPHOSPHATE"                 ?             'C9 H14 N2 O12 P2' 404.161 
VAL 'L-peptide linking' y VALINE                                   ?             'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4IRQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.38 
_exptl_crystal.density_percent_sol   63.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'100mM Tri.HCl, pH 8.5, 8% PEG 8000 as precipitating agent, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2012-08-27 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     4IRQ 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   ? 
_reflns.number_all                   66815 
_reflns.percent_possible_obs         94 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.091 
_reflns.pdbx_netI_over_sigmaI        13.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   83.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.523 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5725 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4IRQ 
_refine.ls_number_reflns_obs                     66540 
_refine.ls_number_reflns_all                     66815 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.847 
_refine.ls_d_res_high                            2.300 
_refine.ls_percent_reflns_obs                    96.60 
_refine.ls_R_factor_obs                          0.1873 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1846 
_refine.ls_R_factor_R_free                       0.2371 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.11 
_refine.ls_number_reflns_R_free                  3400 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3LW6 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.27 
_refine.pdbx_overall_phase_error                 27.95 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8059 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         136 
_refine_hist.number_atoms_solvent             289 
_refine_hist.number_atoms_total               8484 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        37.847 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 8504  ? 'X-RAY DIFFRACTION' 
f_angle_d          1.230  ? ? 11534 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 15.404 ? ? 3158  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.083  ? ? 1175  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 1480  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.3000 2.3329  2180 0.2823 81.00  0.3585 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 2.3329 2.3677  2300 0.2721 85.00  0.2920 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.3677 2.4047  2327 0.2571 86.00  0.3173 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 2.4047 2.4441  2388 0.2498 90.00  0.3102 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 2.4441 2.4862  2500 0.2408 92.00  0.2489 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 2.4862 2.5314  2521 0.2474 94.00  0.3164 . . 133 . . . . 'X-RAY DIFFRACTION' 
. 2.5314 2.5801  2662 0.2379 96.00  0.3330 . . 121 . . . . 'X-RAY DIFFRACTION' 
. 2.5801 2.6327  2661 0.2365 98.00  0.3141 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.6327 2.6900  2701 0.2307 99.00  0.2792 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.6900 2.7525  2665 0.2193 100.00 0.3182 . . 161 . . . . 'X-RAY DIFFRACTION' 
. 2.7525 2.8214  2724 0.2197 100.00 0.2820 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 2.8214 2.8976  2733 0.2228 100.00 0.3173 . . 129 . . . . 'X-RAY DIFFRACTION' 
. 2.8976 2.9828  2707 0.2228 100.00 0.2929 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 2.9828 3.0791  2732 0.2128 100.00 0.3108 . . 133 . . . . 'X-RAY DIFFRACTION' 
. 3.0791 3.1891  2719 0.2080 100.00 0.2672 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 3.1891 3.3167  2713 0.1987 100.00 0.2091 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 3.3167 3.4675  2713 0.1938 100.00 0.2296 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 3.4675 3.6502  2711 0.1814 100.00 0.2183 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 3.6502 3.8787  2739 0.1623 100.00 0.2238 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 3.8787 4.1778  2725 0.1598 100.00 0.2064 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 4.1778 4.5976  2730 0.1332 100.00 0.1840 . . 150 . . . . 'X-RAY DIFFRACTION' 
. 4.5976 5.2614  2745 0.1389 100.00 0.1870 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 5.2614 6.6230  2758 0.1645 100.00 0.2116 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 6.6230 37.8516 2786 0.1448 100.00 0.1741 . . 146 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IRQ 
_struct.title                     
;Crystal structure of catalytic domain of human beta1,4galactosyltransferase 7 in closed conformation in complex with manganese and UDP
;
_struct.pdbx_descriptor           'Beta-1,4-galactosyltransferase 7 (E.C.2.4.1.-, 2.4.1.133)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IRQ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'GT-A fold, closed conformation, manganese and UDP complex, glycosyltransferase, Golgi, transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 28  ? LYS A 46  ? ARG A 104 LYS A 122 1 ? 19 
HELX_P HELX_P2  2  ASN A 64  ? SER A 76  ? ASN A 140 SER A 152 1 ? 13 
HELX_P HELX_P3  3  LYS A 132 ? CYS A 138 ? LYS A 208 CYS A 214 1 ? 7  
HELX_P HELX_P4  4  ARG A 150 ? ALA A 162 ? ARG A 226 ALA A 238 1 ? 13 
HELX_P HELX_P5  5  THR A 174 ? LYS A 177 ? THR A 250 LYS A 253 5 ? 4  
HELX_P HELX_P6  6  ALA A 197 ? GLN A 202 ? ALA A 273 GLN A 278 1 ? 6  
HELX_P HELX_P7  7  THR A 245 ? THR A 249 ? THR A 321 THR A 325 5 ? 5  
HELX_P HELX_P8  8  ARG B 28  ? LYS B 46  ? ARG B 104 LYS B 122 1 ? 19 
HELX_P HELX_P9  9  ASN B 64  ? SER B 76  ? ASN B 140 SER B 152 1 ? 13 
HELX_P HELX_P10 10 LYS B 132 ? CYS B 138 ? LYS B 208 CYS B 214 1 ? 7  
HELX_P HELX_P11 11 ARG B 150 ? ALA B 162 ? ARG B 226 ALA B 238 1 ? 13 
HELX_P HELX_P12 12 ALA B 197 ? GLN B 202 ? ALA B 273 GLN B 278 1 ? 6  
HELX_P HELX_P13 13 THR B 245 ? THR B 249 ? THR B 321 THR B 325 5 ? 5  
HELX_P HELX_P14 14 ARG C 28  ? LYS C 46  ? ARG C 104 LYS C 122 1 ? 19 
HELX_P HELX_P15 15 ASN C 64  ? SER C 76  ? ASN C 140 SER C 152 1 ? 13 
HELX_P HELX_P16 16 LYS C 132 ? CYS C 138 ? LYS C 208 CYS C 214 1 ? 7  
HELX_P HELX_P17 17 ARG C 150 ? GLY C 161 ? ARG C 226 GLY C 237 1 ? 12 
HELX_P HELX_P18 18 THR C 174 ? LYS C 177 ? THR C 250 LYS C 253 5 ? 4  
HELX_P HELX_P19 19 ILE C 195 ? GLN C 200 ? ILE C 271 GLN C 276 5 ? 6  
HELX_P HELX_P20 20 THR C 245 ? THR C 249 ? THR C 321 THR C 325 5 ? 5  
HELX_P HELX_P21 21 ARG D 28  ? LYS D 46  ? ARG D 104 LYS D 122 1 ? 19 
HELX_P HELX_P22 22 ASN D 64  ? SER D 76  ? ASN D 140 SER D 152 1 ? 13 
HELX_P HELX_P23 23 LYS D 132 ? CYS D 138 ? LYS D 208 CYS D 214 1 ? 7  
HELX_P HELX_P24 24 ARG D 150 ? ALA D 162 ? ARG D 226 ALA D 238 1 ? 13 
HELX_P HELX_P25 25 THR D 174 ? LYS D 177 ? THR D 250 LYS D 253 5 ? 4  
HELX_P HELX_P26 26 ALA D 197 ? GLN D 202 ? ALA D 273 GLN D 278 1 ? 6  
HELX_P HELX_P27 27 THR D 245 ? THR D 249 ? THR D 321 THR D 325 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 240 SG  ? ? ? 1_555 A CYS 248 SG  ? ? A CYS 316 A CYS 324 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf2  disulf ? ? B CYS 240 SG  ? ? ? 1_555 B CYS 248 SG  ? ? B CYS 316 B CYS 324 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf3  disulf ? ? C CYS 240 SG  ? ? ? 1_555 C CYS 248 SG  ? ? C CYS 316 C CYS 324 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf4  disulf ? ? D CYS 240 SG  ? ? ? 1_555 D CYS 248 SG  ? ? D CYS 316 D CYS 324 1_555 ? ? ? ? ? ? ? 2.026 ? 
metalc1  metalc ? ? E MN  .   MN  ? ? ? 1_555 F UDP .   O1B ? ? A MN  401 A UDP 402 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc2  metalc ? ? K MN  .   MN  ? ? ? 1_555 L UDP .   O1B ? ? C MN  401 C UDP 402 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc3  metalc ? ? E MN  .   MN  ? ? ? 1_555 F UDP .   O1A ? ? A MN  401 A UDP 402 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc4  metalc ? ? K MN  .   MN  ? ? ? 1_555 L UDP .   O1A ? ? C MN  401 C UDP 402 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc5  metalc ? ? N MN  .   MN  ? ? ? 1_555 O UDP .   O1A ? ? D MN  401 D UDP 402 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc6  metalc ? ? N MN  .   MN  ? ? ? 1_555 O UDP .   O1B ? ? D MN  401 D UDP 402 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc7  metalc ? ? H MN  .   MN  ? ? ? 1_555 I UDP .   O1A ? ? B MN  401 B UDP 402 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc8  metalc ? ? H MN  .   MN  ? ? ? 1_555 I UDP .   O1B ? ? B MN  401 B UDP 402 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc9  metalc ? ? D HIS 181 NE2 ? ? ? 1_555 N MN  .   MN  ? ? D HIS 257 D MN  401 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc10 metalc ? ? H MN  .   MN  ? ? ? 1_555 R HOH .   O   ? ? B MN  401 B HOH 501 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc11 metalc ? ? B HIS 183 ND1 ? ? ? 1_555 H MN  .   MN  ? ? B HIS 259 B MN  401 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc12 metalc ? ? E MN  .   MN  ? ? ? 1_555 Q HOH .   O   ? ? A MN  401 A HOH 501 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc13 metalc ? ? C ASP 89  OD2 ? ? ? 1_555 K MN  .   MN  ? ? C ASP 165 C MN  401 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc14 metalc ? ? A HIS 181 NE2 ? ? ? 1_555 E MN  .   MN  ? ? A HIS 257 A MN  401 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc15 metalc ? ? A ASP 89  OD2 ? ? ? 1_555 E MN  .   MN  ? ? A ASP 165 A MN  401 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc16 metalc ? ? D HIS 183 ND1 ? ? ? 1_555 N MN  .   MN  ? ? D HIS 259 D MN  401 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc17 metalc ? ? B HIS 181 NE2 ? ? ? 1_555 H MN  .   MN  ? ? B HIS 257 B MN  401 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc18 metalc ? ? C HIS 183 ND1 ? ? ? 1_555 K MN  .   MN  ? ? C HIS 259 C MN  401 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc19 metalc ? ? C HIS 181 NE2 ? ? ? 1_555 K MN  .   MN  ? ? C HIS 257 C MN  401 1_555 ? ? ? ? ? ? ? 2.349 ? 
metalc20 metalc ? ? A HIS 183 ND1 ? ? ? 1_555 E MN  .   MN  ? ? A HIS 259 A MN  401 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc21 metalc ? ? B ASP 89  OD2 ? ? ? 1_555 H MN  .   MN  ? ? B ASP 165 B MN  401 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc22 metalc ? ? D ASP 89  OD2 ? ? ? 1_555 N MN  .   MN  ? ? D ASP 165 D MN  401 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc23 metalc ? ? N MN  .   MN  ? ? ? 1_555 T HOH .   O   ? ? D MN  401 D HOH 501 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc24 metalc ? ? K MN  .   MN  ? ? ? 1_555 S HOH .   O   ? ? C MN  401 C HOH 501 1_555 ? ? ? ? ? ? ? 2.517 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 14 ? 
B ? 2  ? 
C ? 7  ? 
D ? 2  ? 
E ? 7  ? 
F ? 2  ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? parallel      
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
A 12 13 ? anti-parallel 
A 13 14 ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? parallel      
C 4  5  ? parallel      
C 5  6  ? parallel      
C 6  7  ? anti-parallel 
D 1  2  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? parallel      
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? anti-parallel 
F 1  2  ? anti-parallel 
G 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  PHE A 107 ? HIS A 108 ? PHE A 183 HIS A 184 
A 2  ILE A 127 ? SER A 131 ? ILE A 203 SER A 207 
A 3  TYR A 82  ? HIS A 86  ? TYR A 158 HIS A 162 
A 4  ARG A 18  ? PHE A 25  ? ARG A 94  PHE A 101 
A 5  ARG A 49  ? GLN A 57  ? ARG A 125 GLN A 133 
A 6  ALA A 229 ? LEU A 238 ? ALA A 305 LEU A 314 
A 7  TYR A 216 ? VAL A 226 ? TYR A 292 VAL A 302 
A 8  TYR D 216 ? VAL D 226 ? TYR D 292 VAL D 302 
A 9  ALA D 229 ? LEU D 238 ? ALA D 305 LEU D 314 
A 10 ARG D 49  ? GLN D 57  ? ARG D 125 GLN D 133 
A 11 ARG D 18  ? PHE D 25  ? ARG D 94  PHE D 101 
A 12 TYR D 82  ? HIS D 86  ? TYR D 158 HIS D 162 
A 13 ILE D 127 ? SER D 131 ? ILE D 203 SER D 207 
A 14 PHE D 107 ? HIS D 108 ? PHE D 183 HIS D 184 
B 1  LEU A 90  ? PRO A 92  ? LEU A 166 PRO A 168 
B 2  PHE A 179 ? HIS A 181 ? PHE A 255 HIS A 257 
C 1  PHE B 107 ? HIS B 108 ? PHE B 183 HIS B 184 
C 2  ILE B 127 ? SER B 131 ? ILE B 203 SER B 207 
C 3  TYR B 82  ? HIS B 86  ? TYR B 158 HIS B 162 
C 4  ARG B 18  ? PHE B 25  ? ARG B 94  PHE B 101 
C 5  ARG B 49  ? GLN B 57  ? ARG B 125 GLN B 133 
C 6  ALA B 229 ? LEU B 238 ? ALA B 305 LEU B 314 
C 7  TYR B 216 ? VAL B 226 ? TYR B 292 VAL B 302 
D 1  LEU B 91  ? PRO B 92  ? LEU B 167 PRO B 168 
D 2  PHE B 179 ? ARG B 180 ? PHE B 255 ARG B 256 
E 1  PHE C 107 ? HIS C 108 ? PHE C 183 HIS C 184 
E 2  ILE C 127 ? SER C 131 ? ILE C 203 SER C 207 
E 3  TYR C 82  ? HIS C 86  ? TYR C 158 HIS C 162 
E 4  ARG C 18  ? PHE C 25  ? ARG C 94  PHE C 101 
E 5  ARG C 49  ? GLN C 57  ? ARG C 125 GLN C 133 
E 6  ALA C 229 ? LEU C 238 ? ALA C 305 LEU C 314 
E 7  TYR C 216 ? VAL C 226 ? TYR C 292 VAL C 302 
F 1  LEU C 90  ? PRO C 92  ? LEU C 166 PRO C 168 
F 2  PHE C 179 ? HIS C 181 ? PHE C 255 HIS C 257 
G 1  LEU D 90  ? PRO D 92  ? LEU D 166 PRO D 168 
G 2  PHE D 179 ? HIS D 181 ? PHE D 255 HIS D 257 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N PHE A 107 ? N PHE A 183 O LEU A 129 ? O LEU A 205 
A 2  3  O LEU A 130 ? O LEU A 206 N ILE A 83  ? N ILE A 159 
A 3  4  O TYR A 82  ? O TYR A 158 N ALA A 20  ? N ALA A 96  
A 4  5  N LEU A 19  ? N LEU A 95  O ARG A 49  ? O ARG A 125 
A 5  6  N VAL A 54  ? N VAL A 130 O LEU A 234 ? O LEU A 310 
A 6  7  O ALA A 229 ? O ALA A 305 N VAL A 226 ? N VAL A 302 
A 7  8  N SER A 225 ? N SER A 301 O SER D 225 ? O SER D 301 
A 8  9  N THR D 222 ? N THR D 298 O VAL D 233 ? O VAL D 309 
A 9  10 O ILE D 236 ? O ILE D 312 N ASN D 56  ? N ASN D 132 
A 10 11 O ARG D 49  ? O ARG D 125 N LEU D 19  ? N LEU D 95  
A 11 12 N ALA D 20  ? N ALA D 96  O TYR D 82  ? O TYR D 158 
A 12 13 N ILE D 83  ? N ILE D 159 O LEU D 130 ? O LEU D 206 
A 13 14 O LEU D 129 ? O LEU D 205 N PHE D 107 ? N PHE D 183 
B 1  2  N LEU A 91  ? N LEU A 167 O ARG A 180 ? O ARG A 256 
C 1  2  N PHE B 107 ? N PHE B 183 O LEU B 129 ? O LEU B 205 
C 2  3  O LEU B 130 ? O LEU B 206 N ILE B 83  ? N ILE B 159 
C 3  4  O HIS B 86  ? O HIS B 162 N LEU B 22  ? N LEU B 98  
C 4  5  N LEU B 19  ? N LEU B 95  O ARG B 49  ? O ARG B 125 
C 5  6  N ASN B 56  ? N ASN B 132 O ILE B 236 ? O ILE B 312 
C 6  7  O MET B 237 ? O MET B 313 N HIS B 217 ? N HIS B 293 
D 1  2  N LEU B 91  ? N LEU B 167 O ARG B 180 ? O ARG B 256 
E 1  2  N PHE C 107 ? N PHE C 183 O LEU C 129 ? O LEU C 205 
E 2  3  O LEU C 128 ? O LEU C 204 N MET C 85  ? N MET C 161 
E 3  4  O ALA C 84  ? O ALA C 160 N LEU C 22  ? N LEU C 98  
E 4  5  N VAL C 21  ? N VAL C 97  O TYR C 53  ? O TYR C 129 
E 5  6  N VAL C 54  ? N VAL C 130 O THR C 232 ? O THR C 308 
E 6  7  O ALA C 229 ? O ALA C 305 N VAL C 226 ? N VAL C 302 
F 1  2  N LEU C 91  ? N LEU C 167 O ARG C 180 ? O ARG C 256 
G 1  2  N LEU D 91  ? N LEU D 167 O ARG D 180 ? O ARG D 256 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 401'  
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE UDP A 402' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE TRS A 403' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN B 401'  
AC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE UDP B 402' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE TRS B 403' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN C 401'  
AC8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE UDP C 402' 
AC9 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE TRS C 403' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN D 401'  
BC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE UDP D 402' 
BC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE TRS D 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ASP A 89  ? ASP A 165 . ? 1_555 ? 
2   AC1 5  HIS A 181 ? HIS A 257 . ? 1_555 ? 
3   AC1 5  HIS A 183 ? HIS A 259 . ? 1_555 ? 
4   AC1 5  UDP F .   ? UDP A 402 . ? 1_555 ? 
5   AC1 5  HOH Q .   ? HOH A 501 . ? 1_555 ? 
6   AC2 17 PRO A 24  ? PRO A 100 . ? 1_555 ? 
7   AC2 17 PHE A 25  ? PHE A 101 . ? 1_555 ? 
8   AC2 17 ARG A 26  ? ARG A 102 . ? 1_555 ? 
9   AC2 17 ARG A 28  ? ARG A 104 . ? 1_555 ? 
10  AC2 17 PHE A 63  ? PHE A 139 . ? 1_555 ? 
11  AC2 17 ASP A 87  ? ASP A 163 . ? 1_555 ? 
12  AC2 17 VAL A 88  ? VAL A 164 . ? 1_555 ? 
13  AC2 17 ASP A 89  ? ASP A 165 . ? 1_555 ? 
14  AC2 17 TYR A 118 ? TYR A 194 . ? 1_555 ? 
15  AC2 17 TRP A 148 ? TRP A 224 . ? 1_555 ? 
16  AC2 17 HIS A 181 ? HIS A 257 . ? 1_555 ? 
17  AC2 17 HIS A 183 ? HIS A 259 . ? 1_555 ? 
18  AC2 17 ARG A 190 ? ARG A 266 . ? 1_555 ? 
19  AC2 17 MN  E .   ? MN  A 401 . ? 1_555 ? 
20  AC2 17 TRS G .   ? TRS A 403 . ? 1_555 ? 
21  AC2 17 HOH Q .   ? HOH A 501 . ? 1_555 ? 
22  AC2 17 HOH Q .   ? HOH A 531 . ? 1_555 ? 
23  AC3 7  TYR A 123 ? TYR A 199 . ? 1_555 ? 
24  AC3 7  TRP A 148 ? TRP A 224 . ? 1_555 ? 
25  AC3 7  GLY A 149 ? GLY A 225 . ? 1_555 ? 
26  AC3 7  GLU A 151 ? GLU A 227 . ? 1_555 ? 
27  AC3 7  ASP A 152 ? ASP A 228 . ? 1_555 ? 
28  AC3 7  UDP F .   ? UDP A 402 . ? 1_555 ? 
29  AC3 7  HOH Q .   ? HOH A 514 . ? 1_555 ? 
30  AC4 5  ASP B 89  ? ASP B 165 . ? 1_555 ? 
31  AC4 5  HIS B 181 ? HIS B 257 . ? 1_555 ? 
32  AC4 5  HIS B 183 ? HIS B 259 . ? 1_555 ? 
33  AC4 5  UDP I .   ? UDP B 402 . ? 1_555 ? 
34  AC4 5  HOH R .   ? HOH B 501 . ? 1_555 ? 
35  AC5 18 PRO B 24  ? PRO B 100 . ? 1_555 ? 
36  AC5 18 PHE B 25  ? PHE B 101 . ? 1_555 ? 
37  AC5 18 ARG B 26  ? ARG B 102 . ? 1_555 ? 
38  AC5 18 ARG B 28  ? ARG B 104 . ? 1_555 ? 
39  AC5 18 PHE B 63  ? PHE B 139 . ? 1_555 ? 
40  AC5 18 ASP B 87  ? ASP B 163 . ? 1_555 ? 
41  AC5 18 VAL B 88  ? VAL B 164 . ? 1_555 ? 
42  AC5 18 ASP B 89  ? ASP B 165 . ? 1_555 ? 
43  AC5 18 TYR B 118 ? TYR B 194 . ? 1_555 ? 
44  AC5 18 TRP B 148 ? TRP B 224 . ? 1_555 ? 
45  AC5 18 HIS B 181 ? HIS B 257 . ? 1_555 ? 
46  AC5 18 HIS B 183 ? HIS B 259 . ? 1_555 ? 
47  AC5 18 ARG B 190 ? ARG B 266 . ? 1_555 ? 
48  AC5 18 MN  H .   ? MN  B 401 . ? 1_555 ? 
49  AC5 18 TRS J .   ? TRS B 403 . ? 1_555 ? 
50  AC5 18 HOH R .   ? HOH B 501 . ? 1_555 ? 
51  AC5 18 HOH R .   ? HOH B 505 . ? 1_555 ? 
52  AC5 18 HOH R .   ? HOH B 524 . ? 1_555 ? 
53  AC6 8  TYR B 118 ? TYR B 194 . ? 1_555 ? 
54  AC6 8  TYR B 123 ? TYR B 199 . ? 1_555 ? 
55  AC6 8  TRP B 148 ? TRP B 224 . ? 1_555 ? 
56  AC6 8  GLY B 149 ? GLY B 225 . ? 1_555 ? 
57  AC6 8  GLU B 151 ? GLU B 227 . ? 1_555 ? 
58  AC6 8  ASP B 152 ? ASP B 228 . ? 1_555 ? 
59  AC6 8  UDP I .   ? UDP B 402 . ? 1_555 ? 
60  AC6 8  HOH R .   ? HOH B 532 . ? 1_555 ? 
61  AC7 5  ASP C 89  ? ASP C 165 . ? 1_555 ? 
62  AC7 5  HIS C 181 ? HIS C 257 . ? 1_555 ? 
63  AC7 5  HIS C 183 ? HIS C 259 . ? 1_555 ? 
64  AC7 5  UDP L .   ? UDP C 402 . ? 1_555 ? 
65  AC7 5  HOH S .   ? HOH C 501 . ? 1_555 ? 
66  AC8 17 PRO C 24  ? PRO C 100 . ? 1_555 ? 
67  AC8 17 PHE C 25  ? PHE C 101 . ? 1_555 ? 
68  AC8 17 ARG C 26  ? ARG C 102 . ? 1_555 ? 
69  AC8 17 ARG C 28  ? ARG C 104 . ? 1_555 ? 
70  AC8 17 PHE C 63  ? PHE C 139 . ? 1_555 ? 
71  AC8 17 ASP C 87  ? ASP C 163 . ? 1_555 ? 
72  AC8 17 VAL C 88  ? VAL C 164 . ? 1_555 ? 
73  AC8 17 ASP C 89  ? ASP C 165 . ? 1_555 ? 
74  AC8 17 TYR C 118 ? TYR C 194 . ? 1_555 ? 
75  AC8 17 TRP C 148 ? TRP C 224 . ? 1_555 ? 
76  AC8 17 HIS C 181 ? HIS C 257 . ? 1_555 ? 
77  AC8 17 HIS C 183 ? HIS C 259 . ? 1_555 ? 
78  AC8 17 ARG C 190 ? ARG C 266 . ? 1_555 ? 
79  AC8 17 MN  K .   ? MN  C 401 . ? 1_555 ? 
80  AC8 17 TRS M .   ? TRS C 403 . ? 1_555 ? 
81  AC8 17 HOH S .   ? HOH C 517 . ? 1_555 ? 
82  AC8 17 HOH S .   ? HOH C 563 . ? 1_555 ? 
83  AC9 7  ARG C 65  ? ARG C 141 . ? 1_555 ? 
84  AC9 7  TYR C 123 ? TYR C 199 . ? 1_555 ? 
85  AC9 7  GLY C 149 ? GLY C 225 . ? 1_555 ? 
86  AC9 7  GLU C 151 ? GLU C 227 . ? 1_555 ? 
87  AC9 7  ASP C 152 ? ASP C 228 . ? 1_555 ? 
88  AC9 7  UDP L .   ? UDP C 402 . ? 1_555 ? 
89  AC9 7  HOH S .   ? HOH C 526 . ? 1_555 ? 
90  BC1 5  ASP D 89  ? ASP D 165 . ? 1_555 ? 
91  BC1 5  HIS D 181 ? HIS D 257 . ? 1_555 ? 
92  BC1 5  HIS D 183 ? HIS D 259 . ? 1_555 ? 
93  BC1 5  UDP O .   ? UDP D 402 . ? 1_555 ? 
94  BC1 5  HOH T .   ? HOH D 501 . ? 1_555 ? 
95  BC2 18 PRO D 24  ? PRO D 100 . ? 1_555 ? 
96  BC2 18 PHE D 25  ? PHE D 101 . ? 1_555 ? 
97  BC2 18 ARG D 26  ? ARG D 102 . ? 1_555 ? 
98  BC2 18 ARG D 28  ? ARG D 104 . ? 1_555 ? 
99  BC2 18 PHE D 63  ? PHE D 139 . ? 1_555 ? 
100 BC2 18 ASP D 87  ? ASP D 163 . ? 1_555 ? 
101 BC2 18 VAL D 88  ? VAL D 164 . ? 1_555 ? 
102 BC2 18 ASP D 89  ? ASP D 165 . ? 1_555 ? 
103 BC2 18 TYR D 118 ? TYR D 194 . ? 1_555 ? 
104 BC2 18 TRP D 148 ? TRP D 224 . ? 1_555 ? 
105 BC2 18 HIS D 181 ? HIS D 257 . ? 1_555 ? 
106 BC2 18 HIS D 183 ? HIS D 259 . ? 1_555 ? 
107 BC2 18 ARG D 190 ? ARG D 266 . ? 1_555 ? 
108 BC2 18 MN  N .   ? MN  D 401 . ? 1_555 ? 
109 BC2 18 TRS P .   ? TRS D 403 . ? 1_555 ? 
110 BC2 18 HOH T .   ? HOH D 533 . ? 1_555 ? 
111 BC2 18 HOH T .   ? HOH D 536 . ? 1_555 ? 
112 BC2 18 HOH T .   ? HOH D 574 . ? 1_555 ? 
113 BC3 9  ARG D 65  ? ARG D 141 . ? 1_555 ? 
114 BC3 9  TYR D 118 ? TYR D 194 . ? 1_555 ? 
115 BC3 9  TYR D 123 ? TYR D 199 . ? 1_555 ? 
116 BC3 9  TRP D 148 ? TRP D 224 . ? 1_555 ? 
117 BC3 9  GLY D 149 ? GLY D 225 . ? 1_555 ? 
118 BC3 9  GLU D 151 ? GLU D 227 . ? 1_555 ? 
119 BC3 9  ASP D 152 ? ASP D 228 . ? 1_555 ? 
120 BC3 9  UDP O .   ? UDP D 402 . ? 1_555 ? 
121 BC3 9  HOH T .   ? HOH D 544 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4IRQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4IRQ 
_atom_sites.fract_transf_matrix[1][1]   0.014898 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001335 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008228 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010336 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 6   ? -2.269  -16.646 -52.375 1.00 67.71  ? 82  GLU A N     1 
ATOM   2    C  CA    . GLU A 1 6   ? -2.232  -15.229 -52.744 1.00 69.50  ? 82  GLU A CA    1 
ATOM   3    C  C     . GLU A 1 6   ? -2.054  -14.306 -51.534 1.00 59.34  ? 82  GLU A C     1 
ATOM   4    O  O     . GLU A 1 6   ? -0.923  -13.947 -51.182 1.00 50.23  ? 82  GLU A O     1 
ATOM   5    C  CB    . GLU A 1 6   ? -3.505  -14.853 -53.502 1.00 74.83  ? 82  GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 6   ? -4.721  -15.681 -53.084 1.00 76.64  ? 82  GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 6   ? -6.010  -14.891 -53.159 1.00 79.80  ? 82  GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 6   ? -6.558  -14.766 -54.278 1.00 83.86  ? 82  GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 6   ? -6.466  -14.392 -52.102 1.00 70.68  ? 82  GLU A OE2   1 
ATOM   10   N  N     . HIS A 1 7   ? -3.174  -13.938 -50.906 1.00 52.87  ? 83  HIS A N     1 
ATOM   11   C  CA    . HIS A 1 7   ? -3.197  -12.942 -49.825 1.00 56.18  ? 83  HIS A CA    1 
ATOM   12   C  C     . HIS A 1 7   ? -2.211  -13.255 -48.717 1.00 54.60  ? 83  HIS A C     1 
ATOM   13   O  O     . HIS A 1 7   ? -1.464  -12.383 -48.274 1.00 49.47  ? 83  HIS A O     1 
ATOM   14   C  CB    . HIS A 1 7   ? -4.599  -12.821 -49.219 1.00 55.08  ? 83  HIS A CB    1 
ATOM   15   C  CG    . HIS A 1 7   ? -4.729  -11.712 -48.216 1.00 54.99  ? 83  HIS A CG    1 
ATOM   16   N  ND1   . HIS A 1 7   ? -4.456  -10.394 -48.521 1.00 50.35  ? 83  HIS A ND1   1 
ATOM   17   C  CD2   . HIS A 1 7   ? -5.116  -11.723 -46.915 1.00 53.05  ? 83  HIS A CD2   1 
ATOM   18   C  CE1   . HIS A 1 7   ? -4.665  -9.643  -47.454 1.00 50.43  ? 83  HIS A CE1   1 
ATOM   19   N  NE2   . HIS A 1 7   ? -5.070  -10.423 -46.467 1.00 56.77  ? 83  HIS A NE2   1 
ATOM   20   N  N     . TRP A 1 8   ? -2.218  -14.514 -48.284 1.00 51.94  ? 84  TRP A N     1 
ATOM   21   C  CA    . TRP A 1 8   ? -1.322  -14.985 -47.240 1.00 46.38  ? 84  TRP A CA    1 
ATOM   22   C  C     . TRP A 1 8   ? 0.004   -15.450 -47.803 1.00 41.58  ? 84  TRP A C     1 
ATOM   23   O  O     . TRP A 1 8   ? 0.044   -16.194 -48.782 1.00 53.89  ? 84  TRP A O     1 
ATOM   24   C  CB    . TRP A 1 8   ? -1.976  -16.138 -46.458 1.00 44.84  ? 84  TRP A CB    1 
ATOM   25   C  CG    . TRP A 1 8   ? -3.226  -15.729 -45.775 1.00 44.41  ? 84  TRP A CG    1 
ATOM   26   C  CD1   . TRP A 1 8   ? -4.502  -16.032 -46.144 1.00 45.97  ? 84  TRP A CD1   1 
ATOM   27   C  CD2   . TRP A 1 8   ? -3.328  -14.901 -44.606 1.00 43.73  ? 84  TRP A CD2   1 
ATOM   28   N  NE1   . TRP A 1 8   ? -5.398  -15.460 -45.258 1.00 50.69  ? 84  TRP A NE1   1 
ATOM   29   C  CE2   . TRP A 1 8   ? -4.699  -14.760 -44.308 1.00 43.98  ? 84  TRP A CE2   1 
ATOM   30   C  CE3   . TRP A 1 8   ? -2.392  -14.277 -43.777 1.00 40.45  ? 84  TRP A CE3   1 
ATOM   31   C  CZ2   . TRP A 1 8   ? -5.155  -14.012 -43.223 1.00 44.46  ? 84  TRP A CZ2   1 
ATOM   32   C  CZ3   . TRP A 1 8   ? -2.849  -13.537 -42.698 1.00 41.62  ? 84  TRP A CZ3   1 
ATOM   33   C  CH2   . TRP A 1 8   ? -4.214  -13.416 -42.431 1.00 40.22  ? 84  TRP A CH2   1 
ATOM   34   N  N     . GLU A 1 9   ? 1.095   -15.010 -47.188 1.00 41.92  ? 85  GLU A N     1 
ATOM   35   C  CA    . GLU A 1 9   ? 2.380   -15.628 -47.443 1.00 42.04  ? 85  GLU A CA    1 
ATOM   36   C  C     . GLU A 1 9   ? 2.344   -16.945 -46.677 1.00 53.73  ? 85  GLU A C     1 
ATOM   37   O  O     . GLU A 1 9   ? 2.241   -16.938 -45.440 1.00 45.77  ? 85  GLU A O     1 
ATOM   38   C  CB    . GLU A 1 9   ? 3.534   -14.756 -46.949 1.00 42.36  ? 85  GLU A CB    1 
ATOM   39   C  CG    . GLU A 1 9   ? 4.930   -15.389 -47.162 1.00 50.59  ? 85  GLU A CG    1 
ATOM   40   C  CD    . GLU A 1 9   ? 5.308   -15.529 -48.638 1.00 57.32  ? 85  GLU A CD    1 
ATOM   41   O  OE1   . GLU A 1 9   ? 4.853   -14.682 -49.440 1.00 63.97  ? 85  GLU A OE1   1 
ATOM   42   O  OE2   . GLU A 1 9   ? 6.062   -16.470 -48.993 1.00 57.02  ? 85  GLU A OE2   1 
ATOM   43   N  N     . GLU A 1 10  ? 2.401   -18.067 -47.399 1.00 42.70  ? 86  GLU A N     1 
ATOM   44   C  CA    . GLU A 1 10  ? 2.225   -19.381 -46.768 1.00 44.57  ? 86  GLU A CA    1 
ATOM   45   C  C     . GLU A 1 10  ? 2.749   -20.506 -47.646 1.00 44.92  ? 86  GLU A C     1 
ATOM   46   O  O     . GLU A 1 10  ? 2.698   -20.432 -48.868 1.00 47.94  ? 86  GLU A O     1 
ATOM   47   C  CB    . GLU A 1 10  ? 0.741   -19.633 -46.439 1.00 39.03  ? 86  GLU A CB    1 
ATOM   48   C  CG    . GLU A 1 10  ? -0.174  -19.609 -47.664 1.00 42.23  ? 86  GLU A CG    1 
ATOM   49   C  CD    . GLU A 1 10  ? -1.652  -19.669 -47.326 1.00 41.59  ? 86  GLU A CD    1 
ATOM   50   O  OE1   . GLU A 1 10  ? -2.014  -19.657 -46.128 1.00 40.99  ? 86  GLU A OE1   1 
ATOM   51   O  OE2   . GLU A 1 10  ? -2.461  -19.743 -48.276 1.00 47.95  ? 86  GLU A OE2   1 
ATOM   52   N  N     . ASP A 1 11  ? 3.266   -21.544 -47.005 1.00 49.41  ? 87  ASP A N     1 
ATOM   53   C  CA    . ASP A 1 11  ? 3.601   -22.790 -47.672 1.00 35.63  ? 87  ASP A CA    1 
ATOM   54   C  C     . ASP A 1 11  ? 2.703   -23.899 -47.079 1.00 46.33  ? 87  ASP A C     1 
ATOM   55   O  O     . ASP A 1 11  ? 2.168   -23.746 -45.970 1.00 43.52  ? 87  ASP A O     1 
ATOM   56   C  CB    . ASP A 1 11  ? 5.078   -23.109 -47.459 1.00 32.12  ? 87  ASP A CB    1 
ATOM   57   C  CG    . ASP A 1 11  ? 5.496   -24.404 -48.134 1.00 45.53  ? 87  ASP A CG    1 
ATOM   58   O  OD1   . ASP A 1 11  ? 5.813   -24.365 -49.336 1.00 45.56  ? 87  ASP A OD1   1 
ATOM   59   O  OD2   . ASP A 1 11  ? 5.504   -25.463 -47.465 1.00 42.41  ? 87  ASP A OD2   1 
ATOM   60   N  N     . ALA A 1 12  ? 2.533   -25.003 -47.812 1.00 41.80  ? 88  ALA A N     1 
ATOM   61   C  CA    . ALA A 1 12  ? 1.622   -26.061 -47.396 1.00 39.69  ? 88  ALA A CA    1 
ATOM   62   C  C     . ALA A 1 12  ? 2.071   -26.719 -46.096 1.00 34.46  ? 88  ALA A C     1 
ATOM   63   O  O     . ALA A 1 12  ? 1.248   -27.191 -45.335 1.00 37.15  ? 88  ALA A O     1 
ATOM   64   C  CB    . ALA A 1 12  ? 1.463   -27.110 -48.502 1.00 40.94  ? 88  ALA A CB    1 
ATOM   65   N  N     . SER A 1 13  ? 3.377   -26.722 -45.846 1.00 36.64  ? 89  SER A N     1 
ATOM   66   C  CA    . SER A 1 13  ? 3.967   -27.372 -44.677 1.00 43.54  ? 89  SER A CA    1 
ATOM   67   C  C     . SER A 1 13  ? 3.926   -26.553 -43.376 1.00 42.70  ? 89  SER A C     1 
ATOM   68   O  O     . SER A 1 13  ? 4.362   -27.026 -42.316 1.00 41.26  ? 89  SER A O     1 
ATOM   69   C  CB    . SER A 1 13  ? 5.427   -27.720 -44.983 1.00 40.37  ? 89  SER A CB    1 
ATOM   70   O  OG    . SER A 1 13  ? 6.216   -26.535 -45.054 1.00 44.21  ? 89  SER A OG    1 
ATOM   71   N  N     . TRP A 1 14  ? 3.470   -25.306 -43.464 1.00 43.50  ? 90  TRP A N     1 
ATOM   72   C  CA    . TRP A 1 14  ? 3.459   -24.437 -42.290 1.00 41.62  ? 90  TRP A CA    1 
ATOM   73   C  C     . TRP A 1 14  ? 2.207   -24.686 -41.449 1.00 38.16  ? 90  TRP A C     1 
ATOM   74   O  O     . TRP A 1 14  ? 1.143   -25.038 -41.984 1.00 33.00  ? 90  TRP A O     1 
ATOM   75   C  CB    . TRP A 1 14  ? 3.536   -22.950 -42.682 1.00 36.87  ? 90  TRP A CB    1 
ATOM   76   C  CG    . TRP A 1 14  ? 4.768   -22.570 -43.472 1.00 40.65  ? 90  TRP A CG    1 
ATOM   77   C  CD1   . TRP A 1 14  ? 5.789   -23.396 -43.861 1.00 48.19  ? 90  TRP A CD1   1 
ATOM   78   C  CD2   . TRP A 1 14  ? 5.101   -21.267 -43.964 1.00 41.13  ? 90  TRP A CD2   1 
ATOM   79   N  NE1   . TRP A 1 14  ? 6.736   -22.689 -44.566 1.00 38.06  ? 90  TRP A NE1   1 
ATOM   80   C  CE2   . TRP A 1 14  ? 6.336   -21.380 -44.648 1.00 44.04  ? 90  TRP A CE2   1 
ATOM   81   C  CE3   . TRP A 1 14  ? 4.481   -20.010 -43.888 1.00 37.80  ? 90  TRP A CE3   1 
ATOM   82   C  CZ2   . TRP A 1 14  ? 6.958   -20.286 -45.258 1.00 32.25  ? 90  TRP A CZ2   1 
ATOM   83   C  CZ3   . TRP A 1 14  ? 5.102   -18.923 -44.499 1.00 40.94  ? 90  TRP A CZ3   1 
ATOM   84   C  CH2   . TRP A 1 14  ? 6.328   -19.071 -45.173 1.00 41.64  ? 90  TRP A CH2   1 
ATOM   85   N  N     . GLY A 1 15  ? 2.332   -24.477 -40.139 1.00 40.21  ? 91  GLY A N     1 
ATOM   86   C  CA    . GLY A 1 15  ? 1.188   -24.566 -39.252 1.00 38.10  ? 91  GLY A CA    1 
ATOM   87   C  C     . GLY A 1 15  ? 0.096   -23.684 -39.819 1.00 43.84  ? 91  GLY A C     1 
ATOM   88   O  O     . GLY A 1 15  ? 0.411   -22.670 -40.450 1.00 34.79  ? 91  GLY A O     1 
ATOM   89   N  N     . PRO A 1 16  ? -1.180  -24.056 -39.588 1.00 39.89  ? 92  PRO A N     1 
ATOM   90   C  CA    . PRO A 1 16  ? -2.355  -23.435 -40.221 1.00 34.11  ? 92  PRO A CA    1 
ATOM   91   C  C     . PRO A 1 16  ? -2.680  -21.998 -39.764 1.00 37.41  ? 92  PRO A C     1 
ATOM   92   O  O     . PRO A 1 16  ? -3.497  -21.350 -40.423 1.00 38.52  ? 92  PRO A O     1 
ATOM   93   C  CB    . PRO A 1 16  ? -3.503  -24.372 -39.803 1.00 31.17  ? 92  PRO A CB    1 
ATOM   94   C  CG    . PRO A 1 16  ? -3.077  -24.894 -38.468 1.00 28.81  ? 92  PRO A CG    1 
ATOM   95   C  CD    . PRO A 1 16  ? -1.563  -25.010 -38.526 1.00 30.61  ? 92  PRO A CD    1 
ATOM   96   N  N     . HIS A 1 17  ? -2.100  -21.512 -38.667 1.00 37.32  ? 93  HIS A N     1 
ATOM   97   C  CA    . HIS A 1 17  ? -2.576  -20.236 -38.088 1.00 34.63  ? 93  HIS A CA    1 
ATOM   98   C  C     . HIS A 1 17  ? -2.050  -19.009 -38.831 1.00 36.85  ? 93  HIS A C     1 
ATOM   99   O  O     . HIS A 1 17  ? -0.837  -18.832 -38.994 1.00 33.29  ? 93  HIS A O     1 
ATOM   100  C  CB    . HIS A 1 17  ? -2.275  -20.149 -36.586 1.00 30.84  ? 93  HIS A CB    1 
ATOM   101  C  CG    . HIS A 1 17  ? -2.954  -21.217 -35.785 1.00 34.99  ? 93  HIS A CG    1 
ATOM   102  N  ND1   . HIS A 1 17  ? -2.260  -22.209 -35.123 1.00 39.46  ? 93  HIS A ND1   1 
ATOM   103  C  CD2   . HIS A 1 17  ? -4.267  -21.482 -35.589 1.00 33.01  ? 93  HIS A CD2   1 
ATOM   104  C  CE1   . HIS A 1 17  ? -3.115  -23.029 -34.539 1.00 33.33  ? 93  HIS A CE1   1 
ATOM   105  N  NE2   . HIS A 1 17  ? -4.339  -22.608 -34.804 1.00 38.97  ? 93  HIS A NE2   1 
ATOM   106  N  N     . ARG A 1 18  ? -2.980  -18.171 -39.285 1.00 33.06  ? 94  ARG A N     1 
ATOM   107  C  CA    . ARG A 1 18  ? -2.633  -17.018 -40.097 1.00 35.97  ? 94  ARG A CA    1 
ATOM   108  C  C     . ARG A 1 18  ? -2.593  -15.747 -39.269 1.00 37.89  ? 94  ARG A C     1 
ATOM   109  O  O     . ARG A 1 18  ? -3.592  -15.333 -38.681 1.00 33.86  ? 94  ARG A O     1 
ATOM   110  C  CB    . ARG A 1 18  ? -3.583  -16.893 -41.290 1.00 41.02  ? 94  ARG A CB    1 
ATOM   111  C  CG    . ARG A 1 18  ? -3.348  -17.970 -42.360 1.00 39.61  ? 94  ARG A CG    1 
ATOM   112  C  CD    . ARG A 1 18  ? -4.628  -18.298 -43.117 1.00 44.17  ? 94  ARG A CD    1 
ATOM   113  N  NE    . ARG A 1 18  ? -4.347  -18.821 -44.450 1.00 41.97  ? 94  ARG A NE    1 
ATOM   114  C  CZ    . ARG A 1 18  ? -5.271  -19.275 -45.294 1.00 46.93  ? 94  ARG A CZ    1 
ATOM   115  N  NH1   . ARG A 1 18  ? -6.553  -19.289 -44.941 1.00 42.47  ? 94  ARG A NH1   1 
ATOM   116  N  NH2   . ARG A 1 18  ? -4.907  -19.717 -46.494 1.00 42.31  ? 94  ARG A NH2   1 
ATOM   117  N  N     . LEU A 1 19  ? -1.405  -15.155 -39.237 1.00 34.21  ? 95  LEU A N     1 
ATOM   118  C  CA    . LEU A 1 19  ? -1.110  -13.964 -38.482 1.00 36.10  ? 95  LEU A CA    1 
ATOM   119  C  C     . LEU A 1 19  ? -1.340  -12.673 -39.288 1.00 39.02  ? 95  LEU A C     1 
ATOM   120  O  O     . LEU A 1 19  ? -0.737  -12.480 -40.341 1.00 36.88  ? 95  LEU A O     1 
ATOM   121  C  CB    . LEU A 1 19  ? 0.351   -14.026 -38.022 1.00 31.87  ? 95  LEU A CB    1 
ATOM   122  C  CG    . LEU A 1 19  ? 0.943   -12.691 -37.559 1.00 37.12  ? 95  LEU A CG    1 
ATOM   123  C  CD1   . LEU A 1 19  ? 0.228   -12.182 -36.299 1.00 30.10  ? 95  LEU A CD1   1 
ATOM   124  C  CD2   . LEU A 1 19  ? 2.435   -12.833 -37.323 1.00 32.24  ? 95  LEU A CD2   1 
ATOM   125  N  N     . ALA A 1 20  ? -2.208  -11.795 -38.794 1.00 31.61  ? 96  ALA A N     1 
ATOM   126  C  CA    . ALA A 1 20  ? -2.275  -10.436 -39.338 1.00 34.68  ? 96  ALA A CA    1 
ATOM   127  C  C     . ALA A 1 20  ? -1.314  -9.529  -38.581 1.00 32.99  ? 96  ALA A C     1 
ATOM   128  O  O     . ALA A 1 20  ? -1.461  -9.317  -37.378 1.00 34.66  ? 96  ALA A O     1 
ATOM   129  C  CB    . ALA A 1 20  ? -3.688  -9.877  -39.266 1.00 31.06  ? 96  ALA A CB    1 
ATOM   130  N  N     . VAL A 1 21  ? -0.313  -9.005  -39.270 1.00 30.36  ? 97  VAL A N     1 
ATOM   131  C  CA    . VAL A 1 21  ? 0.577   -8.059  -38.630 1.00 32.05  ? 97  VAL A CA    1 
ATOM   132  C  C     . VAL A 1 21  ? -0.074  -6.671  -38.750 1.00 34.64  ? 97  VAL A C     1 
ATOM   133  O  O     . VAL A 1 21  ? -0.270  -6.176  -39.842 1.00 35.09  ? 97  VAL A O     1 
ATOM   134  C  CB    . VAL A 1 21  ? 1.976   -8.095  -39.244 1.00 32.47  ? 97  VAL A CB    1 
ATOM   135  C  CG1   . VAL A 1 21  ? 2.927   -7.250  -38.428 1.00 30.67  ? 97  VAL A CG1   1 
ATOM   136  C  CG2   . VAL A 1 21  ? 2.477   -9.540  -39.301 1.00 29.98  ? 97  VAL A CG2   1 
ATOM   137  N  N     . LEU A 1 22  ? -0.457  -6.091  -37.618 1.00 31.51  ? 98  LEU A N     1 
ATOM   138  C  CA    . LEU A 1 22  ? -1.183  -4.823  -37.593 1.00 35.80  ? 98  LEU A CA    1 
ATOM   139  C  C     . LEU A 1 22  ? -0.217  -3.742  -37.174 1.00 35.36  ? 98  LEU A C     1 
ATOM   140  O  O     . LEU A 1 22  ? 0.197   -3.692  -36.013 1.00 34.17  ? 98  LEU A O     1 
ATOM   141  C  CB    . LEU A 1 22  ? -2.354  -4.888  -36.609 1.00 30.08  ? 98  LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 22  ? -3.327  -6.034  -36.903 1.00 35.53  ? 98  LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 22  ? -4.455  -6.073  -35.881 1.00 26.12  ? 98  LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 22  ? -3.871  -5.924  -38.327 1.00 28.05  ? 98  LEU A CD2   1 
ATOM   145  N  N     . VAL A 1 23  ? 0.159   -2.903  -38.136 1.00 34.07  ? 99  VAL A N     1 
ATOM   146  C  CA    . VAL A 1 23  ? 1.222   -1.935  -37.950 1.00 35.47  ? 99  VAL A CA    1 
ATOM   147  C  C     . VAL A 1 23  ? 0.656   -0.516  -37.910 1.00 37.70  ? 99  VAL A C     1 
ATOM   148  O  O     . VAL A 1 23  ? 0.242   -0.001  -38.948 1.00 34.75  ? 99  VAL A O     1 
ATOM   149  C  CB    . VAL A 1 23  ? 2.215   -1.999  -39.122 1.00 37.92  ? 99  VAL A CB    1 
ATOM   150  C  CG1   . VAL A 1 23  ? 3.425   -1.146  -38.811 1.00 33.57  ? 99  VAL A CG1   1 
ATOM   151  C  CG2   . VAL A 1 23  ? 2.612   -3.453  -39.431 1.00 28.10  ? 99  VAL A CG2   1 
ATOM   152  N  N     . PRO A 1 24  ? 0.614   0.107   -36.709 1.00 37.54  ? 100 PRO A N     1 
ATOM   153  C  CA    . PRO A 1 24  ? 0.173   1.507   -36.553 1.00 39.18  ? 100 PRO A CA    1 
ATOM   154  C  C     . PRO A 1 24  ? 1.138   2.436   -37.266 1.00 33.47  ? 100 PRO A C     1 
ATOM   155  O  O     . PRO A 1 24  ? 2.361   2.352   -37.039 1.00 30.38  ? 100 PRO A O     1 
ATOM   156  C  CB    . PRO A 1 24  ? 0.248   1.744   -35.031 1.00 33.69  ? 100 PRO A CB    1 
ATOM   157  C  CG    . PRO A 1 24  ? 1.245   0.734   -34.538 1.00 34.73  ? 100 PRO A CG    1 
ATOM   158  C  CD    . PRO A 1 24  ? 1.006   -0.488  -35.416 1.00 31.92  ? 100 PRO A CD    1 
ATOM   159  N  N     . PHE A 1 25  ? 0.607   3.303   -38.126 1.00 32.54  ? 101 PHE A N     1 
ATOM   160  C  CA    . PHE A 1 25  ? 1.476   4.063   -39.024 1.00 36.87  ? 101 PHE A CA    1 
ATOM   161  C  C     . PHE A 1 25  ? 1.056   5.505   -39.354 1.00 33.53  ? 101 PHE A C     1 
ATOM   162  O  O     . PHE A 1 25  ? -0.117  5.814   -39.607 1.00 36.13  ? 101 PHE A O     1 
ATOM   163  C  CB    . PHE A 1 25  ? 1.681   3.269   -40.323 1.00 34.99  ? 101 PHE A CB    1 
ATOM   164  C  CG    . PHE A 1 25  ? 2.812   3.772   -41.178 1.00 35.21  ? 101 PHE A CG    1 
ATOM   165  C  CD1   . PHE A 1 25  ? 4.120   3.398   -40.907 1.00 35.26  ? 101 PHE A CD1   1 
ATOM   166  C  CD2   . PHE A 1 25  ? 2.567   4.619   -42.256 1.00 36.68  ? 101 PHE A CD2   1 
ATOM   167  C  CE1   . PHE A 1 25  ? 5.175   3.856   -41.708 1.00 40.26  ? 101 PHE A CE1   1 
ATOM   168  C  CE2   . PHE A 1 25  ? 3.601   5.069   -43.061 1.00 34.75  ? 101 PHE A CE2   1 
ATOM   169  C  CZ    . PHE A 1 25  ? 4.910   4.688   -42.789 1.00 35.39  ? 101 PHE A CZ    1 
ATOM   170  N  N     . ARG A 1 26  ? 2.044   6.381   -39.342 1.00 33.38  ? 102 ARG A N     1 
ATOM   171  C  CA    . ARG A 1 26  ? 1.921   7.717   -39.921 1.00 34.58  ? 102 ARG A CA    1 
ATOM   172  C  C     . ARG A 1 26  ? 3.322   8.259   -40.035 1.00 38.33  ? 102 ARG A C     1 
ATOM   173  O  O     . ARG A 1 26  ? 4.032   8.374   -39.026 1.00 33.40  ? 102 ARG A O     1 
ATOM   174  C  CB    . ARG A 1 26  ? 1.071   8.684   -39.089 1.00 33.31  ? 102 ARG A CB    1 
ATOM   175  C  CG    . ARG A 1 26  ? 1.159   10.179  -39.594 1.00 29.36  ? 102 ARG A CG    1 
ATOM   176  C  CD    . ARG A 1 26  ? 0.517   11.142  -38.597 1.00 32.98  ? 102 ARG A CD    1 
ATOM   177  N  NE    . ARG A 1 26  ? -0.935  11.164  -38.728 1.00 35.60  ? 102 ARG A NE    1 
ATOM   178  C  CZ    . ARG A 1 26  ? -1.768  11.735  -37.859 1.00 40.93  ? 102 ARG A CZ    1 
ATOM   179  N  NH1   . ARG A 1 26  ? -1.306  12.332  -36.758 1.00 35.48  ? 102 ARG A NH1   1 
ATOM   180  N  NH2   . ARG A 1 26  ? -3.074  11.705  -38.092 1.00 42.58  ? 102 ARG A NH2   1 
ATOM   181  N  N     . GLU A 1 27  ? 3.721   8.545   -41.274 1.00 35.26  ? 103 GLU A N     1 
ATOM   182  C  CA    . GLU A 1 27  ? 4.983   9.218   -41.562 1.00 38.74  ? 103 GLU A CA    1 
ATOM   183  C  C     . GLU A 1 27  ? 6.257   8.599   -40.970 1.00 38.15  ? 103 GLU A C     1 
ATOM   184  O  O     . GLU A 1 27  ? 7.063   9.284   -40.340 1.00 40.63  ? 103 GLU A O     1 
ATOM   185  C  CB    . GLU A 1 27  ? 4.882   10.718  -41.234 1.00 39.62  ? 103 GLU A CB    1 
ATOM   186  C  CG    . GLU A 1 27  ? 4.375   11.570  -42.418 1.00 49.19  ? 103 GLU A CG    1 
ATOM   187  C  CD    . GLU A 1 27  ? 4.864   11.079  -43.798 1.00 51.14  ? 103 GLU A CD    1 
ATOM   188  O  OE1   . GLU A 1 27  ? 6.051   10.689  -43.953 1.00 42.21  ? 103 GLU A OE1   1 
ATOM   189  O  OE2   . GLU A 1 27  ? 4.034   11.067  -44.735 1.00 53.07  ? 103 GLU A OE2   1 
ATOM   190  N  N     . ARG A 1 28  ? 6.437   7.303   -41.202 1.00 38.62  ? 104 ARG A N     1 
ATOM   191  C  CA    . ARG A 1 28  ? 7.670   6.606   -40.829 1.00 41.27  ? 104 ARG A CA    1 
ATOM   192  C  C     . ARG A 1 28  ? 8.161   5.809   -42.046 1.00 43.03  ? 104 ARG A C     1 
ATOM   193  O  O     . ARG A 1 28  ? 8.341   4.589   -41.993 1.00 41.64  ? 104 ARG A O     1 
ATOM   194  C  CB    . ARG A 1 28  ? 7.431   5.684   -39.625 1.00 44.97  ? 104 ARG A CB    1 
ATOM   195  C  CG    . ARG A 1 28  ? 6.932   6.398   -38.365 1.00 33.94  ? 104 ARG A CG    1 
ATOM   196  C  CD    . ARG A 1 28  ? 8.045   7.081   -37.590 1.00 34.27  ? 104 ARG A CD    1 
ATOM   197  N  NE    . ARG A 1 28  ? 7.527   7.714   -36.372 1.00 54.80  ? 104 ARG A NE    1 
ATOM   198  C  CZ    . ARG A 1 28  ? 7.071   8.969   -36.282 1.00 46.32  ? 104 ARG A CZ    1 
ATOM   199  N  NH1   . ARG A 1 28  ? 7.067   9.773   -37.340 1.00 49.57  ? 104 ARG A NH1   1 
ATOM   200  N  NH2   . ARG A 1 28  ? 6.619   9.427   -35.124 1.00 43.69  ? 104 ARG A NH2   1 
ATOM   201  N  N     . PHE A 1 29  ? 8.351   6.526   -43.149 1.00 45.40  ? 105 PHE A N     1 
ATOM   202  C  CA    . PHE A 1 29  ? 8.656   5.936   -44.451 1.00 41.08  ? 105 PHE A CA    1 
ATOM   203  C  C     . PHE A 1 29  ? 9.978   5.180   -44.466 1.00 38.17  ? 105 PHE A C     1 
ATOM   204  O  O     . PHE A 1 29  ? 10.045  4.059   -44.964 1.00 36.97  ? 105 PHE A O     1 
ATOM   205  C  CB    . PHE A 1 29  ? 8.657   7.035   -45.523 1.00 43.33  ? 105 PHE A CB    1 
ATOM   206  C  CG    . PHE A 1 29  ? 8.784   6.517   -46.924 1.00 43.25  ? 105 PHE A CG    1 
ATOM   207  C  CD1   . PHE A 1 29  ? 7.799   5.709   -47.469 1.00 46.92  ? 105 PHE A CD1   1 
ATOM   208  C  CD2   . PHE A 1 29  ? 9.875   6.851   -47.704 1.00 40.95  ? 105 PHE A CD2   1 
ATOM   209  C  CE1   . PHE A 1 29  ? 7.911   5.227   -48.754 1.00 45.51  ? 105 PHE A CE1   1 
ATOM   210  C  CE2   . PHE A 1 29  ? 9.985   6.377   -48.990 1.00 42.42  ? 105 PHE A CE2   1 
ATOM   211  C  CZ    . PHE A 1 29  ? 9.000   5.567   -49.517 1.00 39.74  ? 105 PHE A CZ    1 
ATOM   212  N  N     . GLU A 1 30  ? 11.029  5.791   -43.923 1.00 39.33  ? 106 GLU A N     1 
ATOM   213  C  CA    . GLU A 1 30  ? 12.329  5.135   -43.891 1.00 40.86  ? 106 GLU A CA    1 
ATOM   214  C  C     . GLU A 1 30  ? 12.180  3.809   -43.179 1.00 39.83  ? 106 GLU A C     1 
ATOM   215  O  O     . GLU A 1 30  ? 12.664  2.781   -43.656 1.00 41.10  ? 106 GLU A O     1 
ATOM   216  C  CB    . GLU A 1 30  ? 13.381  5.973   -43.164 1.00 36.18  ? 106 GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 30  ? 13.843  7.204   -43.907 1.00 50.84  ? 106 GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 30  ? 12.716  8.197   -44.166 1.00 50.87  ? 106 GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 30  ? 11.971  8.545   -43.224 1.00 54.58  ? 106 GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 30  ? 12.567  8.619   -45.331 1.00 57.69  ? 106 GLU A OE2   1 
ATOM   221  N  N     . GLU A 1 31  ? 11.506  3.852   -42.031 1.00 42.64  ? 107 GLU A N     1 
ATOM   222  C  CA    . GLU A 1 31  ? 11.311  2.671   -41.200 1.00 39.70  ? 107 GLU A CA    1 
ATOM   223  C  C     . GLU A 1 31  ? 10.499  1.591   -41.926 1.00 36.51  ? 107 GLU A C     1 
ATOM   224  O  O     . GLU A 1 31  ? 10.861  0.424   -41.890 1.00 39.60  ? 107 GLU A O     1 
ATOM   225  C  CB    . GLU A 1 31  ? 10.663  3.046   -39.855 1.00 34.02  ? 107 GLU A CB    1 
ATOM   226  C  CG    . GLU A 1 31  ? 11.519  3.935   -38.956 1.00 40.00  ? 107 GLU A CG    1 
ATOM   227  C  CD    . GLU A 1 31  ? 11.313  5.438   -39.215 1.00 46.31  ? 107 GLU A CD    1 
ATOM   228  O  OE1   . GLU A 1 31  ? 10.723  5.800   -40.262 1.00 41.44  ? 107 GLU A OE1   1 
ATOM   229  O  OE2   . GLU A 1 31  ? 11.737  6.255   -38.362 1.00 40.09  ? 107 GLU A OE2   1 
ATOM   230  N  N     . LEU A 1 32  ? 9.407   1.993   -42.577 1.00 33.52  ? 108 LEU A N     1 
ATOM   231  C  CA    . LEU A 1 32  ? 8.578   1.077   -43.357 1.00 35.58  ? 108 LEU A CA    1 
ATOM   232  C  C     . LEU A 1 32  ? 9.383   0.310   -44.409 1.00 45.00  ? 108 LEU A C     1 
ATOM   233  O  O     . LEU A 1 32  ? 9.164   -0.896  -44.614 1.00 43.61  ? 108 LEU A O     1 
ATOM   234  C  CB    . LEU A 1 32  ? 7.437   1.819   -44.054 1.00 31.29  ? 108 LEU A CB    1 
ATOM   235  C  CG    . LEU A 1 32  ? 6.423   0.856   -44.666 1.00 36.99  ? 108 LEU A CG    1 
ATOM   236  C  CD1   . LEU A 1 32  ? 5.688   0.086   -43.574 1.00 32.78  ? 108 LEU A CD1   1 
ATOM   237  C  CD2   . LEU A 1 32  ? 5.444   1.581   -45.554 1.00 38.14  ? 108 LEU A CD2   1 
ATOM   238  N  N     . LEU A 1 33  ? 10.308  1.009   -45.067 1.00 40.67  ? 109 LEU A N     1 
ATOM   239  C  CA    . LEU A 1 33  ? 11.151  0.415   -46.110 1.00 41.89  ? 109 LEU A CA    1 
ATOM   240  C  C     . LEU A 1 33  ? 11.959  -0.746  -45.567 1.00 40.70  ? 109 LEU A C     1 
ATOM   241  O  O     . LEU A 1 33  ? 12.122  -1.762  -46.237 1.00 37.62  ? 109 LEU A O     1 
ATOM   242  C  CB    . LEU A 1 33  ? 12.120  1.450   -46.694 1.00 44.13  ? 109 LEU A CB    1 
ATOM   243  C  CG    . LEU A 1 33  ? 11.744  2.298   -47.909 1.00 43.15  ? 109 LEU A CG    1 
ATOM   244  C  CD1   . LEU A 1 33  ? 10.289  2.140   -48.318 1.00 42.93  ? 109 LEU A CD1   1 
ATOM   245  C  CD2   . LEU A 1 33  ? 12.085  3.755   -47.644 1.00 39.98  ? 109 LEU A CD2   1 
ATOM   246  N  N     . VAL A 1 34  ? 12.487  -0.583  -44.359 1.00 40.93  ? 110 VAL A N     1 
ATOM   247  C  CA    . VAL A 1 34  ? 13.269  -1.649  -43.747 1.00 38.51  ? 110 VAL A CA    1 
ATOM   248  C  C     . VAL A 1 34  ? 12.357  -2.720  -43.141 1.00 42.78  ? 110 VAL A C     1 
ATOM   249  O  O     . VAL A 1 34  ? 12.622  -3.906  -43.281 1.00 41.08  ? 110 VAL A O     1 
ATOM   250  C  CB    . VAL A 1 34  ? 14.218  -1.097  -42.677 1.00 38.98  ? 110 VAL A CB    1 
ATOM   251  C  CG1   . VAL A 1 34  ? 14.957  -2.226  -41.988 1.00 37.44  ? 110 VAL A CG1   1 
ATOM   252  C  CG2   . VAL A 1 34  ? 15.207  -0.119  -43.311 1.00 38.03  ? 110 VAL A CG2   1 
ATOM   253  N  N     . PHE A 1 35  ? 11.266  -2.294  -42.507 1.00 40.05  ? 111 PHE A N     1 
ATOM   254  C  CA    . PHE A 1 35  ? 10.384  -3.192  -41.749 1.00 43.25  ? 111 PHE A CA    1 
ATOM   255  C  C     . PHE A 1 35  ? 9.744   -4.309  -42.576 1.00 38.86  ? 111 PHE A C     1 
ATOM   256  O  O     . PHE A 1 35  ? 9.791   -5.471  -42.190 1.00 41.57  ? 111 PHE A O     1 
ATOM   257  C  CB    . PHE A 1 35  ? 9.284   -2.376  -41.062 1.00 37.69  ? 111 PHE A CB    1 
ATOM   258  C  CG    . PHE A 1 35  ? 8.294   -3.196  -40.272 1.00 36.03  ? 111 PHE A CG    1 
ATOM   259  C  CD1   . PHE A 1 35  ? 8.543   -3.519  -38.940 1.00 38.78  ? 111 PHE A CD1   1 
ATOM   260  C  CD2   . PHE A 1 35  ? 7.089   -3.598  -40.841 1.00 36.23  ? 111 PHE A CD2   1 
ATOM   261  C  CE1   . PHE A 1 35  ? 7.621   -4.251  -38.195 1.00 35.15  ? 111 PHE A CE1   1 
ATOM   262  C  CE2   . PHE A 1 35  ? 6.159   -4.342  -40.102 1.00 35.85  ? 111 PHE A CE2   1 
ATOM   263  C  CZ    . PHE A 1 35  ? 6.423   -4.654  -38.776 1.00 33.85  ? 111 PHE A CZ    1 
ATOM   264  N  N     . VAL A 1 36  ? 9.129   -3.949  -43.696 1.00 36.53  ? 112 VAL A N     1 
ATOM   265  C  CA    . VAL A 1 36  ? 8.324   -4.902  -44.449 1.00 35.77  ? 112 VAL A CA    1 
ATOM   266  C  C     . VAL A 1 36  ? 9.142   -6.117  -44.926 1.00 42.18  ? 112 VAL A C     1 
ATOM   267  O  O     . VAL A 1 36  ? 8.789   -7.245  -44.601 1.00 40.27  ? 112 VAL A O     1 
ATOM   268  C  CB    . VAL A 1 36  ? 7.508   -4.208  -45.578 1.00 39.35  ? 112 VAL A CB    1 
ATOM   269  C  CG1   . VAL A 1 36  ? 6.855   -5.218  -46.509 1.00 28.53  ? 112 VAL A CG1   1 
ATOM   270  C  CG2   . VAL A 1 36  ? 6.454   -3.278  -44.962 1.00 32.88  ? 112 VAL A CG2   1 
ATOM   271  N  N     . PRO A 1 37  ? 10.266  -5.900  -45.643 1.00 46.93  ? 113 PRO A N     1 
ATOM   272  C  CA    . PRO A 1 37  ? 11.015  -7.105  -46.037 1.00 37.34  ? 113 PRO A CA    1 
ATOM   273  C  C     . PRO A 1 37  ? 11.605  -7.819  -44.830 1.00 39.80  ? 113 PRO A C     1 
ATOM   274  O  O     . PRO A 1 37  ? 11.756  -9.041  -44.859 1.00 38.03  ? 113 PRO A O     1 
ATOM   275  C  CB    . PRO A 1 37  ? 12.160  -6.555  -46.904 1.00 35.56  ? 113 PRO A CB    1 
ATOM   276  C  CG    . PRO A 1 37  ? 11.789  -5.123  -47.205 1.00 37.54  ? 113 PRO A CG    1 
ATOM   277  C  CD    . PRO A 1 37  ? 10.958  -4.664  -46.052 1.00 34.11  ? 113 PRO A CD    1 
ATOM   278  N  N     . HIS A 1 38  ? 11.936  -7.075  -43.779 1.00 36.01  ? 114 HIS A N     1 
ATOM   279  C  CA    . HIS A 1 38  ? 12.552  -7.691  -42.617 1.00 40.03  ? 114 HIS A CA    1 
ATOM   280  C  C     . HIS A 1 38  ? 11.580  -8.697  -42.000 1.00 42.21  ? 114 HIS A C     1 
ATOM   281  O  O     . HIS A 1 38  ? 11.962  -9.798  -41.623 1.00 41.69  ? 114 HIS A O     1 
ATOM   282  C  CB    . HIS A 1 38  ? 12.923  -6.636  -41.586 1.00 40.68  ? 114 HIS A CB    1 
ATOM   283  C  CG    . HIS A 1 38  ? 13.535  -7.201  -40.339 1.00 43.96  ? 114 HIS A CG    1 
ATOM   284  N  ND1   . HIS A 1 38  ? 14.898  -7.226  -40.125 1.00 43.11  ? 114 HIS A ND1   1 
ATOM   285  C  CD2   . HIS A 1 38  ? 12.971  -7.760  -39.244 1.00 37.02  ? 114 HIS A CD2   1 
ATOM   286  C  CE1   . HIS A 1 38  ? 15.144  -7.767  -38.946 1.00 38.53  ? 114 HIS A CE1   1 
ATOM   287  N  NE2   . HIS A 1 38  ? 13.993  -8.105  -38.393 1.00 39.93  ? 114 HIS A NE2   1 
ATOM   288  N  N     . MET A 1 39  ? 10.315  -8.302  -41.925 1.00 43.01  ? 115 MET A N     1 
ATOM   289  C  CA    . MET A 1 39  ? 9.275   -9.139  -41.351 1.00 40.41  ? 115 MET A CA    1 
ATOM   290  C  C     . MET A 1 39  ? 8.857   -10.273 -42.279 1.00 37.60  ? 115 MET A C     1 
ATOM   291  O  O     . MET A 1 39  ? 8.466   -11.347 -41.806 1.00 39.49  ? 115 MET A O     1 
ATOM   292  C  CB    . MET A 1 39  ? 8.065   -8.288  -40.963 1.00 34.98  ? 115 MET A CB    1 
ATOM   293  C  CG    . MET A 1 39  ? 8.364   -7.294  -39.856 1.00 40.18  ? 115 MET A CG    1 
ATOM   294  S  SD    . MET A 1 39  ? 9.101   -8.024  -38.375 1.00 42.44  ? 115 MET A SD    1 
ATOM   295  C  CE    . MET A 1 39  ? 7.806   -9.152  -37.826 1.00 31.40  ? 115 MET A CE    1 
ATOM   296  N  N     . ARG A 1 40  ? 8.923   -10.047 -43.589 1.00 36.88  ? 116 ARG A N     1 
ATOM   297  C  CA    . ARG A 1 40  ? 8.666   -11.133 -44.532 1.00 40.10  ? 116 ARG A CA    1 
ATOM   298  C  C     . ARG A 1 40  ? 9.712   -12.218 -44.343 1.00 40.44  ? 116 ARG A C     1 
ATOM   299  O  O     . ARG A 1 40  ? 9.375   -13.388 -44.177 1.00 40.72  ? 116 ARG A O     1 
ATOM   300  C  CB    . ARG A 1 40  ? 8.672   -10.653 -45.978 1.00 41.75  ? 116 ARG A CB    1 
ATOM   301  C  CG    . ARG A 1 40  ? 8.614   -11.789 -47.030 1.00 40.36  ? 116 ARG A CG    1 
ATOM   302  C  CD    . ARG A 1 40  ? 8.419   -11.171 -48.395 1.00 42.07  ? 116 ARG A CD    1 
ATOM   303  N  NE    . ARG A 1 40  ? 8.392   -12.102 -49.518 1.00 56.79  ? 116 ARG A NE    1 
ATOM   304  C  CZ    . ARG A 1 40  ? 7.320   -12.790 -49.901 1.00 54.96  ? 116 ARG A CZ    1 
ATOM   305  N  NH1   . ARG A 1 40  ? 6.178   -12.697 -49.222 1.00 54.24  ? 116 ARG A NH1   1 
ATOM   306  N  NH2   . ARG A 1 40  ? 7.397   -13.590 -50.954 1.00 57.06  ? 116 ARG A NH2   1 
ATOM   307  N  N     . ARG A 1 41  ? 10.979  -11.816 -44.342 1.00 34.11  ? 117 ARG A N     1 
ATOM   308  C  CA    . ARG A 1 41  ? 12.077  -12.734 -44.111 1.00 36.65  ? 117 ARG A CA    1 
ATOM   309  C  C     . ARG A 1 41  ? 11.930  -13.464 -42.765 1.00 40.09  ? 117 ARG A C     1 
ATOM   310  O  O     . ARG A 1 41  ? 11.942  -14.694 -42.704 1.00 36.12  ? 117 ARG A O     1 
ATOM   311  C  CB    . ARG A 1 41  ? 13.409  -11.988 -44.162 1.00 38.29  ? 117 ARG A CB    1 
ATOM   312  C  CG    . ARG A 1 41  ? 14.627  -12.900 -44.218 1.00 50.96  ? 117 ARG A CG    1 
ATOM   313  C  CD    . ARG A 1 41  ? 15.923  -12.120 -44.041 1.00 56.35  ? 117 ARG A CD    1 
ATOM   314  N  NE    . ARG A 1 41  ? 16.975  -12.937 -43.436 1.00 69.09  ? 117 ARG A NE    1 
ATOM   315  C  CZ    . ARG A 1 41  ? 17.100  -13.153 -42.125 1.00 74.27  ? 117 ARG A CZ    1 
ATOM   316  N  NH1   . ARG A 1 41  ? 18.094  -13.904 -41.666 1.00 75.02  ? 117 ARG A NH1   1 
ATOM   317  N  NH2   . ARG A 1 41  ? 16.231  -12.622 -41.269 1.00 70.40  ? 117 ARG A NH2   1 
ATOM   318  N  N     . PHE A 1 42  ? 11.785  -12.690 -41.695 1.00 41.32  ? 118 PHE A N     1 
ATOM   319  C  CA    . PHE A 1 42  ? 11.702  -13.223 -40.337 1.00 35.77  ? 118 PHE A CA    1 
ATOM   320  C  C     . PHE A 1 42  ? 10.553  -14.217 -40.161 1.00 35.57  ? 118 PHE A C     1 
ATOM   321  O  O     . PHE A 1 42  ? 10.760  -15.328 -39.667 1.00 39.05  ? 118 PHE A O     1 
ATOM   322  C  CB    . PHE A 1 42  ? 11.549  -12.062 -39.370 1.00 39.89  ? 118 PHE A CB    1 
ATOM   323  C  CG    . PHE A 1 42  ? 11.463  -12.459 -37.939 1.00 35.64  ? 118 PHE A CG    1 
ATOM   324  C  CD1   . PHE A 1 42  ? 12.615  -12.658 -37.195 1.00 35.13  ? 118 PHE A CD1   1 
ATOM   325  C  CD2   . PHE A 1 42  ? 10.225  -12.591 -37.318 1.00 35.79  ? 118 PHE A CD2   1 
ATOM   326  C  CE1   . PHE A 1 42  ? 12.539  -12.991 -35.843 1.00 35.18  ? 118 PHE A CE1   1 
ATOM   327  C  CE2   . PHE A 1 42  ? 10.130  -12.924 -35.966 1.00 35.57  ? 118 PHE A CE2   1 
ATOM   328  C  CZ    . PHE A 1 42  ? 11.296  -13.125 -35.230 1.00 40.79  ? 118 PHE A CZ    1 
ATOM   329  N  N     . LEU A 1 43  ? 9.353   -13.836 -40.596 1.00 35.97  ? 119 LEU A N     1 
ATOM   330  C  CA    . LEU A 1 43  ? 8.199   -14.720 -40.444 1.00 36.04  ? 119 LEU A CA    1 
ATOM   331  C  C     . LEU A 1 43  ? 8.287   -15.952 -41.344 1.00 40.08  ? 119 LEU A C     1 
ATOM   332  O  O     . LEU A 1 43  ? 7.837   -17.033 -40.973 1.00 35.28  ? 119 LEU A O     1 
ATOM   333  C  CB    . LEU A 1 43  ? 6.888   -13.966 -40.670 1.00 33.18  ? 119 LEU A CB    1 
ATOM   334  C  CG    . LEU A 1 43  ? 6.561   -12.887 -39.618 1.00 37.51  ? 119 LEU A CG    1 
ATOM   335  C  CD1   . LEU A 1 43  ? 5.359   -12.015 -40.037 1.00 30.93  ? 119 LEU A CD1   1 
ATOM   336  C  CD2   . LEU A 1 43  ? 6.339   -13.490 -38.213 1.00 34.25  ? 119 LEU A CD2   1 
ATOM   337  N  N     . SER A 1 44  ? 8.880   -15.794 -42.520 1.00 35.82  ? 120 SER A N     1 
ATOM   338  C  CA    . SER A 1 44  ? 8.956   -16.895 -43.464 1.00 40.50  ? 120 SER A CA    1 
ATOM   339  C  C     . SER A 1 44  ? 9.913   -17.977 -42.980 1.00 34.51  ? 120 SER A C     1 
ATOM   340  O  O     . SER A 1 44  ? 9.585   -19.144 -43.029 1.00 37.31  ? 120 SER A O     1 
ATOM   341  C  CB    . SER A 1 44  ? 9.340   -16.391 -44.858 1.00 38.39  ? 120 SER A CB    1 
ATOM   342  O  OG    . SER A 1 44  ? 8.263   -15.663 -45.412 1.00 34.72  ? 120 SER A OG    1 
ATOM   343  N  N     . ARG A 1 45  ? 11.080  -17.576 -42.487 1.00 39.02  ? 121 ARG A N     1 
ATOM   344  C  CA    . ARG A 1 45  ? 12.012  -18.513 -41.875 1.00 33.17  ? 121 ARG A CA    1 
ATOM   345  C  C     . ARG A 1 45  ? 11.413  -19.254 -40.660 1.00 39.75  ? 121 ARG A C     1 
ATOM   346  O  O     . ARG A 1 45  ? 11.821  -20.379 -40.345 1.00 43.61  ? 121 ARG A O     1 
ATOM   347  C  CB    . ARG A 1 45  ? 13.312  -17.792 -41.498 1.00 38.92  ? 121 ARG A CB    1 
ATOM   348  C  CG    . ARG A 1 45  ? 14.076  -17.227 -42.715 1.00 51.04  ? 121 ARG A CG    1 
ATOM   349  C  CD    . ARG A 1 45  ? 15.259  -16.339 -42.310 1.00 46.25  ? 121 ARG A CD    1 
ATOM   350  N  NE    . ARG A 1 45  ? 15.968  -16.893 -41.161 1.00 55.01  ? 121 ARG A NE    1 
ATOM   351  C  CZ    . ARG A 1 45  ? 16.989  -17.741 -41.243 1.00 66.67  ? 121 ARG A CZ    1 
ATOM   352  N  NH1   . ARG A 1 45  ? 17.445  -18.126 -42.435 1.00 59.25  ? 121 ARG A NH1   1 
ATOM   353  N  NH2   . ARG A 1 45  ? 17.560  -18.200 -40.132 1.00 59.53  ? 121 ARG A NH2   1 
ATOM   354  N  N     . LYS A 1 46  ? 10.454  -18.627 -39.978 1.00 41.93  ? 122 LYS A N     1 
ATOM   355  C  CA    . LYS A 1 46  ? 9.816   -19.245 -38.812 1.00 37.43  ? 122 LYS A CA    1 
ATOM   356  C  C     . LYS A 1 46  ? 8.532   -19.941 -39.236 1.00 33.06  ? 122 LYS A C     1 
ATOM   357  O  O     . LYS A 1 46  ? 7.781   -20.452 -38.403 1.00 35.43  ? 122 LYS A O     1 
ATOM   358  C  CB    . LYS A 1 46  ? 9.556   -18.209 -37.698 1.00 38.09  ? 122 LYS A CB    1 
ATOM   359  C  CG    . LYS A 1 46  ? 10.845  -17.681 -37.050 1.00 38.00  ? 122 LYS A CG    1 
ATOM   360  C  CD    . LYS A 1 46  ? 10.626  -16.374 -36.279 1.00 40.64  ? 122 LYS A CD    1 
ATOM   361  C  CE    . LYS A 1 46  ? 9.638   -16.574 -35.118 1.00 39.54  ? 122 LYS A CE    1 
ATOM   362  N  NZ    . LYS A 1 46  ? 10.066  -17.632 -34.143 1.00 31.09  ? 122 LYS A NZ    1 
ATOM   363  N  N     . LYS A 1 47  ? 8.288   -19.949 -40.542 1.00 33.03  ? 123 LYS A N     1 
ATOM   364  C  CA    . LYS A 1 47  ? 7.175   -20.706 -41.114 1.00 42.27  ? 123 LYS A CA    1 
ATOM   365  C  C     . LYS A 1 47  ? 5.833   -20.268 -40.541 1.00 39.77  ? 123 LYS A C     1 
ATOM   366  O  O     . LYS A 1 47  ? 5.054   -21.089 -40.065 1.00 42.22  ? 123 LYS A O     1 
ATOM   367  C  CB    . LYS A 1 47  ? 7.369   -22.228 -40.907 1.00 36.77  ? 123 LYS A CB    1 
ATOM   368  C  CG    . LYS A 1 47  ? 8.717   -22.753 -41.398 1.00 40.09  ? 123 LYS A CG    1 
ATOM   369  C  CD    . LYS A 1 47  ? 8.745   -24.285 -41.458 1.00 44.28  ? 123 LYS A CD    1 
ATOM   370  C  CE    . LYS A 1 47  ? 10.169  -24.786 -41.658 1.00 36.18  ? 123 LYS A CE    1 
ATOM   371  N  NZ    . LYS A 1 47  ? 10.250  -26.260 -41.765 1.00 49.97  ? 123 LYS A NZ    1 
ATOM   372  N  N     . ILE A 1 48  ? 5.567   -18.970 -40.593 1.00 41.55  ? 124 ILE A N     1 
ATOM   373  C  CA    . ILE A 1 48  ? 4.317   -18.425 -40.079 1.00 35.90  ? 124 ILE A CA    1 
ATOM   374  C  C     . ILE A 1 48  ? 3.506   -17.786 -41.203 1.00 32.96  ? 124 ILE A C     1 
ATOM   375  O  O     . ILE A 1 48  ? 3.979   -16.873 -41.866 1.00 36.63  ? 124 ILE A O     1 
ATOM   376  C  CB    . ILE A 1 48  ? 4.606   -17.399 -38.978 1.00 34.13  ? 124 ILE A CB    1 
ATOM   377  C  CG1   . ILE A 1 48  ? 5.018   -18.142 -37.708 1.00 36.39  ? 124 ILE A CG1   1 
ATOM   378  C  CG2   . ILE A 1 48  ? 3.387   -16.504 -38.729 1.00 35.73  ? 124 ILE A CG2   1 
ATOM   379  C  CD1   . ILE A 1 48  ? 6.081   -17.425 -36.934 1.00 39.09  ? 124 ILE A CD1   1 
ATOM   380  N  N     . ARG A 1 49  ? 2.295   -18.281 -41.427 1.00 32.54  ? 125 ARG A N     1 
ATOM   381  C  CA    . ARG A 1 49  ? 1.419   -17.705 -42.438 1.00 31.76  ? 125 ARG A CA    1 
ATOM   382  C  C     . ARG A 1 49  ? 1.013   -16.269 -42.044 1.00 42.26  ? 125 ARG A C     1 
ATOM   383  O  O     . ARG A 1 49  ? 0.462   -16.026 -40.957 1.00 33.70  ? 125 ARG A O     1 
ATOM   384  C  CB    . ARG A 1 49  ? 0.211   -18.622 -42.651 1.00 37.05  ? 125 ARG A CB    1 
ATOM   385  C  CG    . ARG A 1 49  ? 0.619   -20.057 -43.031 1.00 36.48  ? 125 ARG A CG    1 
ATOM   386  C  CD    . ARG A 1 49  ? -0.488  -21.092 -42.796 1.00 39.70  ? 125 ARG A CD    1 
ATOM   387  N  NE    . ARG A 1 49  ? -1.136  -21.491 -44.030 1.00 50.69  ? 125 ARG A NE    1 
ATOM   388  C  CZ    . ARG A 1 49  ? -1.072  -22.706 -44.570 1.00 45.93  ? 125 ARG A CZ    1 
ATOM   389  N  NH1   . ARG A 1 49  ? -0.408  -23.702 -43.976 1.00 46.39  ? 125 ARG A NH1   1 
ATOM   390  N  NH2   . ARG A 1 49  ? -1.702  -22.925 -45.715 1.00 50.65  ? 125 ARG A NH2   1 
ATOM   391  N  N     . HIS A 1 50  ? 1.300   -15.308 -42.914 1.00 40.48  ? 126 HIS A N     1 
ATOM   392  C  CA    . HIS A 1 50  ? 1.151   -13.914 -42.519 1.00 40.44  ? 126 HIS A CA    1 
ATOM   393  C  C     . HIS A 1 50  ? 0.776   -12.962 -43.647 1.00 44.84  ? 126 HIS A C     1 
ATOM   394  O  O     . HIS A 1 50  ? 1.031   -13.223 -44.832 1.00 39.41  ? 126 HIS A O     1 
ATOM   395  C  CB    . HIS A 1 50  ? 2.453   -13.428 -41.885 1.00 36.21  ? 126 HIS A CB    1 
ATOM   396  C  CG    . HIS A 1 50  ? 3.593   -13.346 -42.853 1.00 44.25  ? 126 HIS A CG    1 
ATOM   397  N  ND1   . HIS A 1 50  ? 4.489   -14.378 -43.039 1.00 38.54  ? 126 HIS A ND1   1 
ATOM   398  C  CD2   . HIS A 1 50  ? 3.980   -12.355 -43.698 1.00 37.64  ? 126 HIS A CD2   1 
ATOM   399  C  CE1   . HIS A 1 50  ? 5.382   -14.025 -43.950 1.00 37.26  ? 126 HIS A CE1   1 
ATOM   400  N  NE2   . HIS A 1 50  ? 5.094   -12.804 -44.368 1.00 37.89  ? 126 HIS A NE2   1 
ATOM   401  N  N     . HIS A 1 51  ? 0.183   -11.844 -43.247 1.00 41.09  ? 127 HIS A N     1 
ATOM   402  C  CA    . HIS A 1 51  ? 0.001   -10.683 -44.106 1.00 34.19  ? 127 HIS A CA    1 
ATOM   403  C  C     . HIS A 1 51  ? 0.238   -9.457  -43.250 1.00 40.86  ? 127 HIS A C     1 
ATOM   404  O  O     . HIS A 1 51  ? -0.047  -9.461  -42.044 1.00 38.56  ? 127 HIS A O     1 
ATOM   405  C  CB    . HIS A 1 51  ? -1.409  -10.631 -44.699 1.00 38.21  ? 127 HIS A CB    1 
ATOM   406  C  CG    . HIS A 1 51  ? -1.555  -9.625  -45.800 1.00 48.40  ? 127 HIS A CG    1 
ATOM   407  N  ND1   . HIS A 1 51  ? -1.378  -9.946  -47.128 1.00 46.43  ? 127 HIS A ND1   1 
ATOM   408  C  CD2   . HIS A 1 51  ? -1.831  -8.300  -45.767 1.00 44.65  ? 127 HIS A CD2   1 
ATOM   409  C  CE1   . HIS A 1 51  ? -1.547  -8.863  -47.867 1.00 49.70  ? 127 HIS A CE1   1 
ATOM   410  N  NE2   . HIS A 1 51  ? -1.823  -7.851  -47.066 1.00 43.29  ? 127 HIS A NE2   1 
ATOM   411  N  N     . ILE A 1 52  ? 0.753   -8.406  -43.869 1.00 38.25  ? 128 ILE A N     1 
ATOM   412  C  CA    . ILE A 1 52  ? 1.119   -7.212  -43.144 1.00 36.08  ? 128 ILE A CA    1 
ATOM   413  C  C     . ILE A 1 52  ? 0.210   -6.059  -43.526 1.00 41.54  ? 128 ILE A C     1 
ATOM   414  O  O     . ILE A 1 52  ? 0.139   -5.685  -44.695 1.00 45.60  ? 128 ILE A O     1 
ATOM   415  C  CB    . ILE A 1 52  ? 2.577   -6.829  -43.428 1.00 35.20  ? 128 ILE A CB    1 
ATOM   416  C  CG1   . ILE A 1 52  ? 3.507   -7.945  -42.945 1.00 33.04  ? 128 ILE A CG1   1 
ATOM   417  C  CG2   . ILE A 1 52  ? 2.901   -5.496  -42.771 1.00 34.21  ? 128 ILE A CG2   1 
ATOM   418  C  CD1   . ILE A 1 52  ? 4.984   -7.760  -43.312 1.00 36.76  ? 128 ILE A CD1   1 
ATOM   419  N  N     . TYR A 1 53  ? -0.498  -5.517  -42.538 1.00 36.17  ? 129 TYR A N     1 
ATOM   420  C  CA    . TYR A 1 53  ? -1.383  -4.379  -42.747 1.00 37.83  ? 129 TYR A CA    1 
ATOM   421  C  C     . TYR A 1 53  ? -0.736  -3.126  -42.180 1.00 38.39  ? 129 TYR A C     1 
ATOM   422  O  O     . TYR A 1 53  ? -0.458  -3.051  -40.989 1.00 35.53  ? 129 TYR A O     1 
ATOM   423  C  CB    . TYR A 1 53  ? -2.757  -4.611  -42.102 1.00 38.84  ? 129 TYR A CB    1 
ATOM   424  C  CG    . TYR A 1 53  ? -3.550  -5.749  -42.727 1.00 41.53  ? 129 TYR A CG    1 
ATOM   425  C  CD1   . TYR A 1 53  ? -3.336  -7.074  -42.337 1.00 37.88  ? 129 TYR A CD1   1 
ATOM   426  C  CD2   . TYR A 1 53  ? -4.506  -5.503  -43.705 1.00 39.79  ? 129 TYR A CD2   1 
ATOM   427  C  CE1   . TYR A 1 53  ? -4.049  -8.126  -42.911 1.00 35.64  ? 129 TYR A CE1   1 
ATOM   428  C  CE2   . TYR A 1 53  ? -5.234  -6.552  -44.283 1.00 39.86  ? 129 TYR A CE2   1 
ATOM   429  C  CZ    . TYR A 1 53  ? -5.002  -7.862  -43.874 1.00 45.76  ? 129 TYR A CZ    1 
ATOM   430  O  OH    . TYR A 1 53  ? -5.716  -8.906  -44.443 1.00 47.61  ? 129 TYR A OH    1 
ATOM   431  N  N     . VAL A 1 54  ? -0.453  -2.170  -43.060 1.00 35.69  ? 130 VAL A N     1 
ATOM   432  C  CA    . VAL A 1 54  ? 0.026   -0.859  -42.663 1.00 36.31  ? 130 VAL A CA    1 
ATOM   433  C  C     . VAL A 1 54  ? -1.204  -0.001  -42.394 1.00 39.30  ? 130 VAL A C     1 
ATOM   434  O  O     . VAL A 1 54  ? -2.016  0.244   -43.298 1.00 38.46  ? 130 VAL A O     1 
ATOM   435  C  CB    . VAL A 1 54  ? 0.872   -0.196  -43.781 1.00 37.98  ? 130 VAL A CB    1 
ATOM   436  C  CG1   . VAL A 1 54  ? 1.344   1.190   -43.341 1.00 30.75  ? 130 VAL A CG1   1 
ATOM   437  C  CG2   . VAL A 1 54  ? 2.058   -1.078  -44.135 1.00 33.52  ? 130 VAL A CG2   1 
ATOM   438  N  N     . LEU A 1 55  ? -1.355  0.434   -41.149 1.00 30.46  ? 131 LEU A N     1 
ATOM   439  C  CA    . LEU A 1 55  ? -2.553  1.147   -40.745 1.00 34.09  ? 131 LEU A CA    1 
ATOM   440  C  C     . LEU A 1 55  ? -2.226  2.650   -40.696 1.00 35.95  ? 131 LEU A C     1 
ATOM   441  O  O     . LEU A 1 55  ? -1.743  3.170   -39.691 1.00 32.97  ? 131 LEU A O     1 
ATOM   442  C  CB    . LEU A 1 55  ? -3.061  0.600   -39.403 1.00 34.70  ? 131 LEU A CB    1 
ATOM   443  C  CG    . LEU A 1 55  ? -3.191  -0.938  -39.389 1.00 35.87  ? 131 LEU A CG    1 
ATOM   444  C  CD1   . LEU A 1 55  ? -3.377  -1.513  -37.970 1.00 32.12  ? 131 LEU A CD1   1 
ATOM   445  C  CD2   . LEU A 1 55  ? -4.320  -1.387  -40.304 1.00 30.60  ? 131 LEU A CD2   1 
ATOM   446  N  N     . ASN A 1 56  ? -2.469  3.322   -41.817 1.00 34.52  ? 132 ASN A N     1 
ATOM   447  C  CA    . ASN A 1 56  ? -1.970  4.674   -42.059 1.00 36.70  ? 132 ASN A CA    1 
ATOM   448  C  C     . ASN A 1 56  ? -2.966  5.759   -41.633 1.00 34.50  ? 132 ASN A C     1 
ATOM   449  O  O     . ASN A 1 56  ? -4.019  5.935   -42.265 1.00 35.92  ? 132 ASN A O     1 
ATOM   450  C  CB    . ASN A 1 56  ? -1.656  4.799   -43.545 1.00 37.38  ? 132 ASN A CB    1 
ATOM   451  C  CG    . ASN A 1 56  ? -0.966  6.091   -43.895 1.00 43.89  ? 132 ASN A CG    1 
ATOM   452  O  OD1   . ASN A 1 56  ? -0.238  6.674   -43.082 1.00 42.58  ? 132 ASN A OD1   1 
ATOM   453  N  ND2   . ASN A 1 56  ? -1.187  6.550   -45.121 1.00 41.10  ? 132 ASN A ND2   1 
ATOM   454  N  N     . GLN A 1 57  ? -2.666  6.460   -40.544 1.00 31.88  ? 133 GLN A N     1 
ATOM   455  C  CA    . GLN A 1 57  ? -3.590  7.482   -40.048 1.00 39.93  ? 133 GLN A CA    1 
ATOM   456  C  C     . GLN A 1 57  ? -3.511  8.749   -40.908 1.00 39.86  ? 133 GLN A C     1 
ATOM   457  O  O     . GLN A 1 57  ? -2.541  9.497   -40.818 1.00 37.48  ? 133 GLN A O     1 
ATOM   458  C  CB    . GLN A 1 57  ? -3.329  7.822   -38.565 1.00 37.70  ? 133 GLN A CB    1 
ATOM   459  C  CG    . GLN A 1 57  ? -4.455  8.664   -37.924 1.00 34.00  ? 133 GLN A CG    1 
ATOM   460  C  CD    . GLN A 1 57  ? -4.268  8.909   -36.431 1.00 40.10  ? 133 GLN A CD    1 
ATOM   461  O  OE1   . GLN A 1 57  ? -3.589  8.155   -35.740 1.00 44.07  ? 133 GLN A OE1   1 
ATOM   462  N  NE2   . GLN A 1 57  ? -4.878  9.976   -35.930 1.00 42.76  ? 133 GLN A NE2   1 
ATOM   463  N  N     . VAL A 1 58  ? -4.542  8.988   -41.720 1.00 38.81  ? 134 VAL A N     1 
ATOM   464  C  CA    . VAL A 1 58  ? -4.537  10.108  -42.660 1.00 43.29  ? 134 VAL A CA    1 
ATOM   465  C  C     . VAL A 1 58  ? -5.526  11.229  -42.326 1.00 44.32  ? 134 VAL A C     1 
ATOM   466  O  O     . VAL A 1 58  ? -5.721  12.137  -43.130 1.00 50.03  ? 134 VAL A O     1 
ATOM   467  C  CB    . VAL A 1 58  ? -4.804  9.657   -44.119 1.00 41.78  ? 134 VAL A CB    1 
ATOM   468  C  CG1   . VAL A 1 58  ? -3.740  8.698   -44.587 1.00 38.40  ? 134 VAL A CG1   1 
ATOM   469  C  CG2   . VAL A 1 58  ? -6.181  9.042   -44.233 1.00 40.74  ? 134 VAL A CG2   1 
ATOM   470  N  N     . ASP A 1 59  ? -6.161  11.166  -41.164 1.00 42.98  ? 135 ASP A N     1 
ATOM   471  C  CA    . ASP A 1 59  ? -6.865  12.329  -40.653 1.00 37.32  ? 135 ASP A CA    1 
ATOM   472  C  C     . ASP A 1 59  ? -5.798  13.193  -40.008 1.00 42.38  ? 135 ASP A C     1 
ATOM   473  O  O     . ASP A 1 59  ? -4.647  12.781  -39.895 1.00 42.82  ? 135 ASP A O     1 
ATOM   474  C  CB    . ASP A 1 59  ? -7.929  11.945  -39.625 1.00 41.01  ? 135 ASP A CB    1 
ATOM   475  C  CG    . ASP A 1 59  ? -7.380  11.066  -38.528 1.00 46.94  ? 135 ASP A CG    1 
ATOM   476  O  OD1   . ASP A 1 59  ? -6.559  11.555  -37.709 1.00 37.90  ? 135 ASP A OD1   1 
ATOM   477  O  OD2   . ASP A 1 59  ? -7.763  9.875   -38.504 1.00 47.24  ? 135 ASP A OD2   1 
ATOM   478  N  N     . HIS A 1 60  ? -6.176  14.385  -39.569 1.00 41.94  ? 136 HIS A N     1 
ATOM   479  C  CA    . HIS A 1 60  ? -5.194  15.310  -39.033 1.00 43.23  ? 136 HIS A CA    1 
ATOM   480  C  C     . HIS A 1 60  ? -5.204  15.355  -37.506 1.00 42.01  ? 136 HIS A C     1 
ATOM   481  O  O     . HIS A 1 60  ? -4.593  16.245  -36.906 1.00 39.18  ? 136 HIS A O     1 
ATOM   482  C  CB    . HIS A 1 60  ? -5.402  16.715  -39.619 1.00 47.10  ? 136 HIS A CB    1 
ATOM   483  C  CG    . HIS A 1 60  ? -5.138  16.806  -41.089 1.00 46.69  ? 136 HIS A CG    1 
ATOM   484  N  ND1   . HIS A 1 60  ? -4.458  15.831  -41.788 1.00 52.85  ? 136 HIS A ND1   1 
ATOM   485  C  CD2   . HIS A 1 60  ? -5.464  17.759  -41.995 1.00 47.91  ? 136 HIS A CD2   1 
ATOM   486  C  CE1   . HIS A 1 60  ? -4.373  16.180  -43.060 1.00 45.41  ? 136 HIS A CE1   1 
ATOM   487  N  NE2   . HIS A 1 60  ? -4.971  17.349  -43.210 1.00 47.26  ? 136 HIS A NE2   1 
ATOM   488  N  N     . PHE A 1 61  ? -5.882  14.395  -36.876 1.00 46.54  ? 137 PHE A N     1 
ATOM   489  C  CA    . PHE A 1 61  ? -5.868  14.306  -35.421 1.00 41.06  ? 137 PHE A CA    1 
ATOM   490  C  C     . PHE A 1 61  ? -4.521  13.770  -34.964 1.00 36.77  ? 137 PHE A C     1 
ATOM   491  O  O     . PHE A 1 61  ? -3.741  13.278  -35.774 1.00 37.53  ? 137 PHE A O     1 
ATOM   492  C  CB    . PHE A 1 61  ? -7.012  13.431  -34.916 1.00 40.43  ? 137 PHE A CB    1 
ATOM   493  C  CG    . PHE A 1 61  ? -8.368  13.936  -35.305 1.00 41.23  ? 137 PHE A CG    1 
ATOM   494  C  CD1   . PHE A 1 61  ? -8.779  15.204  -34.935 1.00 41.69  ? 137 PHE A CD1   1 
ATOM   495  C  CD2   . PHE A 1 61  ? -9.232  13.146  -36.041 1.00 42.28  ? 137 PHE A CD2   1 
ATOM   496  C  CE1   . PHE A 1 61  ? -10.031 15.669  -35.291 1.00 46.34  ? 137 PHE A CE1   1 
ATOM   497  C  CE2   . PHE A 1 61  ? -10.483 13.605  -36.409 1.00 40.53  ? 137 PHE A CE2   1 
ATOM   498  C  CZ    . PHE A 1 61  ? -10.886 14.873  -36.030 1.00 48.00  ? 137 PHE A CZ    1 
ATOM   499  N  N     . ARG A 1 62  ? -4.243  13.881  -33.674 1.00 38.01  ? 138 ARG A N     1 
ATOM   500  C  CA    . ARG A 1 62  ? -3.009  13.337  -33.112 1.00 44.16  ? 138 ARG A CA    1 
ATOM   501  C  C     . ARG A 1 62  ? -2.945  11.812  -33.292 1.00 38.86  ? 138 ARG A C     1 
ATOM   502  O  O     . ARG A 1 62  ? -3.956  11.162  -33.558 1.00 35.61  ? 138 ARG A O     1 
ATOM   503  C  CB    . ARG A 1 62  ? -2.893  13.701  -31.635 1.00 45.49  ? 138 ARG A CB    1 
ATOM   504  C  CG    . ARG A 1 62  ? -3.123  15.168  -31.361 1.00 50.43  ? 138 ARG A CG    1 
ATOM   505  C  CD    . ARG A 1 62  ? -2.197  15.642  -30.284 1.00 50.46  ? 138 ARG A CD    1 
ATOM   506  N  NE    . ARG A 1 62  ? -2.742  15.468  -28.950 1.00 47.76  ? 138 ARG A NE    1 
ATOM   507  C  CZ    . ARG A 1 62  ? -2.007  15.171  -27.884 1.00 48.26  ? 138 ARG A CZ    1 
ATOM   508  N  NH1   . ARG A 1 62  ? -0.700  14.987  -27.995 1.00 41.44  ? 138 ARG A NH1   1 
ATOM   509  N  NH2   . ARG A 1 62  ? -2.581  15.059  -26.702 1.00 60.50  ? 138 ARG A NH2   1 
ATOM   510  N  N     . PHE A 1 63  ? -1.758  11.243  -33.153 1.00 34.58  ? 139 PHE A N     1 
ATOM   511  C  CA    . PHE A 1 63  ? -1.585  9.859   -33.565 1.00 38.93  ? 139 PHE A CA    1 
ATOM   512  C  C     . PHE A 1 63  ? -2.195  8.905   -32.546 1.00 41.86  ? 139 PHE A C     1 
ATOM   513  O  O     . PHE A 1 63  ? -1.831  8.917   -31.370 1.00 37.09  ? 139 PHE A O     1 
ATOM   514  C  CB    . PHE A 1 63  ? -0.122  9.521   -33.829 1.00 33.09  ? 139 PHE A CB    1 
ATOM   515  C  CG    . PHE A 1 63  ? 0.078   8.142   -34.400 1.00 39.31  ? 139 PHE A CG    1 
ATOM   516  C  CD1   . PHE A 1 63  ? -0.085  7.910   -35.755 1.00 40.05  ? 139 PHE A CD1   1 
ATOM   517  C  CD2   . PHE A 1 63  ? 0.406   7.074   -33.577 1.00 34.94  ? 139 PHE A CD2   1 
ATOM   518  C  CE1   . PHE A 1 63  ? 0.085   6.637   -36.283 1.00 41.48  ? 139 PHE A CE1   1 
ATOM   519  C  CE2   . PHE A 1 63  ? 0.561   5.811   -34.095 1.00 39.93  ? 139 PHE A CE2   1 
ATOM   520  C  CZ    . PHE A 1 63  ? 0.406   5.589   -35.451 1.00 36.09  ? 139 PHE A CZ    1 
ATOM   521  N  N     . ASN A 1 64  ? -3.130  8.088   -33.020 1.00 34.57  ? 140 ASN A N     1 
ATOM   522  C  CA    . ASN A 1 64  ? -3.864  7.175   -32.162 1.00 40.19  ? 140 ASN A CA    1 
ATOM   523  C  C     . ASN A 1 64  ? -3.532  5.700   -32.460 1.00 37.81  ? 140 ASN A C     1 
ATOM   524  O  O     . ASN A 1 64  ? -4.254  5.026   -33.191 1.00 32.93  ? 140 ASN A O     1 
ATOM   525  C  CB    . ASN A 1 64  ? -5.360  7.437   -32.313 1.00 38.02  ? 140 ASN A CB    1 
ATOM   526  C  CG    . ASN A 1 64  ? -6.168  6.843   -31.176 1.00 39.71  ? 140 ASN A CG    1 
ATOM   527  O  OD1   . ASN A 1 64  ? -5.821  5.794   -30.631 1.00 40.26  ? 140 ASN A OD1   1 
ATOM   528  N  ND2   . ASN A 1 64  ? -7.260  7.506   -30.819 1.00 37.35  ? 140 ASN A ND2   1 
ATOM   529  N  N     . ARG A 1 65  ? -2.425  5.228   -31.895 1.00 36.43  ? 141 ARG A N     1 
ATOM   530  C  CA    . ARG A 1 65  ? -1.969  3.853   -32.047 1.00 35.79  ? 141 ARG A CA    1 
ATOM   531  C  C     . ARG A 1 65  ? -3.050  2.814   -31.771 1.00 39.88  ? 141 ARG A C     1 
ATOM   532  O  O     . ARG A 1 65  ? -3.255  1.901   -32.579 1.00 35.51  ? 141 ARG A O     1 
ATOM   533  C  CB    . ARG A 1 65  ? -0.772  3.590   -31.125 1.00 38.00  ? 141 ARG A CB    1 
ATOM   534  C  CG    . ARG A 1 65  ? -0.204  2.172   -31.215 1.00 37.09  ? 141 ARG A CG    1 
ATOM   535  C  CD    . ARG A 1 65  ? 1.086   2.104   -30.432 1.00 34.91  ? 141 ARG A CD    1 
ATOM   536  N  NE    . ARG A 1 65  ? 1.711   0.792   -30.493 1.00 32.93  ? 141 ARG A NE    1 
ATOM   537  C  CZ    . ARG A 1 65  ? 1.508   -0.196  -29.620 1.00 37.11  ? 141 ARG A CZ    1 
ATOM   538  N  NH1   . ARG A 1 65  ? 0.668   -0.053  -28.595 1.00 35.09  ? 141 ARG A NH1   1 
ATOM   539  N  NH2   . ARG A 1 65  ? 2.142   -1.351  -29.786 1.00 37.14  ? 141 ARG A NH2   1 
ATOM   540  N  N     . ALA A 1 66  ? -3.742  2.960   -30.639 1.00 35.46  ? 142 ALA A N     1 
ATOM   541  C  CA    . ALA A 1 66  ? -4.710  1.950   -30.197 1.00 35.17  ? 142 ALA A CA    1 
ATOM   542  C  C     . ALA A 1 66  ? -5.930  1.902   -31.106 1.00 37.68  ? 142 ALA A C     1 
ATOM   543  O  O     . ALA A 1 66  ? -6.400  0.814   -31.461 1.00 37.20  ? 142 ALA A O     1 
ATOM   544  C  CB    . ALA A 1 66  ? -5.131  2.182   -28.726 1.00 30.77  ? 142 ALA A CB    1 
ATOM   545  N  N     . ALA A 1 67  ? -6.438  3.072   -31.491 1.00 32.20  ? 143 ALA A N     1 
ATOM   546  C  CA    . ALA A 1 67  ? -7.605  3.113   -32.365 1.00 35.41  ? 143 ALA A CA    1 
ATOM   547  C  C     . ALA A 1 67  ? -7.277  2.502   -33.712 1.00 34.89  ? 143 ALA A C     1 
ATOM   548  O  O     . ALA A 1 67  ? -8.150  1.922   -34.352 1.00 37.34  ? 143 ALA A O     1 
ATOM   549  C  CB    . ALA A 1 67  ? -8.123  4.537   -32.552 1.00 31.84  ? 143 ALA A CB    1 
ATOM   550  N  N     . LEU A 1 68  ? -6.024  2.635   -34.146 1.00 34.95  ? 144 LEU A N     1 
ATOM   551  C  CA    . LEU A 1 68  ? -5.634  2.129   -35.459 1.00 35.86  ? 144 LEU A CA    1 
ATOM   552  C  C     . LEU A 1 68  ? -5.584  0.613   -35.416 1.00 37.10  ? 144 LEU A C     1 
ATOM   553  O  O     . LEU A 1 68  ? -6.058  -0.042  -36.344 1.00 37.31  ? 144 LEU A O     1 
ATOM   554  C  CB    . LEU A 1 68  ? -4.297  2.705   -35.929 1.00 34.54  ? 144 LEU A CB    1 
ATOM   555  C  CG    . LEU A 1 68  ? -4.299  4.194   -36.274 1.00 34.43  ? 144 LEU A CG    1 
ATOM   556  C  CD1   . LEU A 1 68  ? -2.888  4.703   -36.384 1.00 29.48  ? 144 LEU A CD1   1 
ATOM   557  C  CD2   . LEU A 1 68  ? -5.059  4.437   -37.557 1.00 37.11  ? 144 LEU A CD2   1 
ATOM   558  N  N     . ILE A 1 69  ? -5.022  0.074   -34.332 1.00 34.47  ? 145 ILE A N     1 
ATOM   559  C  CA    . ILE A 1 69  ? -4.997  -1.362  -34.109 1.00 33.28  ? 145 ILE A CA    1 
ATOM   560  C  C     . ILE A 1 69  ? -6.416  -1.921  -34.167 1.00 37.39  ? 145 ILE A C     1 
ATOM   561  O  O     . ILE A 1 69  ? -6.669  -2.920  -34.843 1.00 34.22  ? 145 ILE A O     1 
ATOM   562  C  CB    . ILE A 1 69  ? -4.341  -1.743  -32.760 1.00 36.55  ? 145 ILE A CB    1 
ATOM   563  C  CG1   . ILE A 1 69  ? -2.918  -1.185  -32.660 1.00 28.19  ? 145 ILE A CG1   1 
ATOM   564  C  CG2   . ILE A 1 69  ? -4.311  -3.263  -32.594 1.00 33.29  ? 145 ILE A CG2   1 
ATOM   565  C  CD1   . ILE A 1 69  ? -2.089  -1.527  -33.824 1.00 38.07  ? 145 ILE A CD1   1 
ATOM   566  N  N     . ASN A 1 70  ? -7.338  -1.269  -33.465 1.00 33.42  ? 146 ASN A N     1 
ATOM   567  C  CA    . ASN A 1 70  ? -8.752  -1.638  -33.537 1.00 33.42  ? 146 ASN A CA    1 
ATOM   568  C  C     . ASN A 1 70  ? -9.277  -1.698  -34.974 1.00 35.61  ? 146 ASN A C     1 
ATOM   569  O  O     . ASN A 1 70  ? -10.008 -2.620  -35.328 1.00 32.34  ? 146 ASN A O     1 
ATOM   570  C  CB    . ASN A 1 70  ? -9.610  -0.661  -32.718 1.00 38.46  ? 146 ASN A CB    1 
ATOM   571  C  CG    . ASN A 1 70  ? -9.675  -1.021  -31.229 1.00 41.60  ? 146 ASN A CG    1 
ATOM   572  O  OD1   . ASN A 1 70  ? -9.385  -2.158  -30.831 1.00 35.92  ? 146 ASN A OD1   1 
ATOM   573  N  ND2   . ASN A 1 70  ? -10.079 -0.051  -30.404 1.00 31.30  ? 146 ASN A ND2   1 
ATOM   574  N  N     . VAL A 1 71  ? -8.918  -0.702  -35.791 1.00 35.50  ? 147 VAL A N     1 
ATOM   575  C  CA    . VAL A 1 71  ? -9.374  -0.643  -37.181 1.00 31.42  ? 147 VAL A CA    1 
ATOM   576  C  C     . VAL A 1 71  ? -8.801  -1.805  -38.009 1.00 31.92  ? 147 VAL A C     1 
ATOM   577  O  O     . VAL A 1 71  ? -9.526  -2.436  -38.767 1.00 34.01  ? 147 VAL A O     1 
ATOM   578  C  CB    . VAL A 1 71  ? -9.042  0.723   -37.867 1.00 36.15  ? 147 VAL A CB    1 
ATOM   579  C  CG1   . VAL A 1 71  ? -9.234  0.635   -39.393 1.00 32.21  ? 147 VAL A CG1   1 
ATOM   580  C  CG2   . VAL A 1 71  ? -9.922  1.846   -37.303 1.00 31.84  ? 147 VAL A CG2   1 
ATOM   581  N  N     . GLY A 1 72  ? -7.504  -2.062  -37.857 1.00 26.22  ? 148 GLY A N     1 
ATOM   582  C  CA    . GLY A 1 72  ? -6.833  -3.161  -38.518 1.00 34.73  ? 148 GLY A CA    1 
ATOM   583  C  C     . GLY A 1 72  ? -7.452  -4.501  -38.165 1.00 38.49  ? 148 GLY A C     1 
ATOM   584  O  O     . GLY A 1 72  ? -7.631  -5.344  -39.039 1.00 36.77  ? 148 GLY A O     1 
ATOM   585  N  N     . PHE A 1 73  ? -7.797  -4.685  -36.891 1.00 35.19  ? 149 PHE A N     1 
ATOM   586  C  CA    . PHE A 1 73  ? -8.496  -5.889  -36.450 1.00 36.62  ? 149 PHE A CA    1 
ATOM   587  C  C     . PHE A 1 73  ? -9.780  -6.094  -37.247 1.00 38.53  ? 149 PHE A C     1 
ATOM   588  O  O     . PHE A 1 73  ? -10.059 -7.210  -37.704 1.00 41.38  ? 149 PHE A O     1 
ATOM   589  C  CB    . PHE A 1 73  ? -8.824  -5.837  -34.944 1.00 34.85  ? 149 PHE A CB    1 
ATOM   590  C  CG    . PHE A 1 73  ? -9.342  -7.155  -34.395 1.00 35.87  ? 149 PHE A CG    1 
ATOM   591  C  CD1   . PHE A 1 73  ? -10.698 -7.439  -34.396 1.00 36.62  ? 149 PHE A CD1   1 
ATOM   592  C  CD2   . PHE A 1 73  ? -8.461  -8.118  -33.916 1.00 30.59  ? 149 PHE A CD2   1 
ATOM   593  C  CE1   . PHE A 1 73  ? -11.176 -8.656  -33.904 1.00 38.68  ? 149 PHE A CE1   1 
ATOM   594  C  CE2   . PHE A 1 73  ? -8.926  -9.337  -33.432 1.00 38.63  ? 149 PHE A CE2   1 
ATOM   595  C  CZ    . PHE A 1 73  ? -10.287 -9.606  -33.418 1.00 38.81  ? 149 PHE A CZ    1 
ATOM   596  N  N     . LEU A 1 74  ? -10.552 -5.016  -37.414 1.00 35.73  ? 150 LEU A N     1 
ATOM   597  C  CA    . LEU A 1 74  ? -11.843 -5.081  -38.118 1.00 38.43  ? 150 LEU A CA    1 
ATOM   598  C  C     . LEU A 1 74  ? -11.678 -5.212  -39.625 1.00 44.06  ? 150 LEU A C     1 
ATOM   599  O  O     . LEU A 1 74  ? -12.509 -5.816  -40.299 1.00 44.83  ? 150 LEU A O     1 
ATOM   600  C  CB    . LEU A 1 74  ? -12.690 -3.842  -37.820 1.00 37.06  ? 150 LEU A CB    1 
ATOM   601  C  CG    . LEU A 1 74  ? -13.138 -3.696  -36.362 1.00 44.36  ? 150 LEU A CG    1 
ATOM   602  C  CD1   . LEU A 1 74  ? -13.794 -2.356  -36.119 1.00 34.07  ? 150 LEU A CD1   1 
ATOM   603  C  CD2   . LEU A 1 74  ? -14.069 -4.840  -35.957 1.00 31.93  ? 150 LEU A CD2   1 
ATOM   604  N  N     . GLU A 1 75  ? -10.602 -4.636  -40.148 1.00 41.18  ? 151 GLU A N     1 
ATOM   605  C  CA    . GLU A 1 75  ? -10.414 -4.548  -41.588 1.00 40.30  ? 151 GLU A CA    1 
ATOM   606  C  C     . GLU A 1 75  ? -9.504  -5.629  -42.165 1.00 41.51  ? 151 GLU A C     1 
ATOM   607  O  O     . GLU A 1 75  ? -9.252  -5.633  -43.365 1.00 49.46  ? 151 GLU A O     1 
ATOM   608  C  CB    . GLU A 1 75  ? -9.871  -3.165  -41.964 1.00 42.20  ? 151 GLU A CB    1 
ATOM   609  C  CG    . GLU A 1 75  ? -10.825 -2.016  -41.657 1.00 40.58  ? 151 GLU A CG    1 
ATOM   610  C  CD    . GLU A 1 75  ? -12.049 -2.007  -42.555 1.00 47.23  ? 151 GLU A CD    1 
ATOM   611  O  OE1   . GLU A 1 75  ? -11.941 -2.410  -43.734 1.00 51.34  ? 151 GLU A OE1   1 
ATOM   612  O  OE2   . GLU A 1 75  ? -13.126 -1.600  -42.074 1.00 55.08  ? 151 GLU A OE2   1 
ATOM   613  N  N     . SER A 1 76  ? -8.996  -6.539  -41.334 1.00 44.66  ? 152 SER A N     1 
ATOM   614  C  CA    . SER A 1 76  ? -8.109  -7.584  -41.854 1.00 45.63  ? 152 SER A CA    1 
ATOM   615  C  C     . SER A 1 76  ? -8.931  -8.730  -42.394 1.00 43.85  ? 152 SER A C     1 
ATOM   616  O  O     . SER A 1 76  ? -10.138 -8.783  -42.173 1.00 43.83  ? 152 SER A O     1 
ATOM   617  C  CB    . SER A 1 76  ? -7.140  -8.093  -40.793 1.00 41.51  ? 152 SER A CB    1 
ATOM   618  O  OG    . SER A 1 76  ? -7.430  -7.506  -39.545 1.00 45.99  ? 152 SER A OG    1 
ATOM   619  N  N     . SER A 1 77  ? -8.273  -9.639  -43.105 1.00 42.91  ? 153 SER A N     1 
ATOM   620  C  CA    . SER A 1 77  ? -8.954  -10.755 -43.752 1.00 42.53  ? 153 SER A CA    1 
ATOM   621  C  C     . SER A 1 77  ? -9.766  -11.547 -42.743 1.00 42.02  ? 153 SER A C     1 
ATOM   622  O  O     . SER A 1 77  ? -9.262  -11.900 -41.706 1.00 37.39  ? 153 SER A O     1 
ATOM   623  C  CB    . SER A 1 77  ? -7.930  -11.681 -44.393 1.00 45.76  ? 153 SER A CB    1 
ATOM   624  O  OG    . SER A 1 77  ? -8.490  -12.960 -44.580 1.00 45.82  ? 153 SER A OG    1 
ATOM   625  N  N     . ASN A 1 78  ? -11.020 -11.848 -43.042 1.00 45.26  ? 154 ASN A N     1 
ATOM   626  C  CA    . ASN A 1 78  ? -11.824 -12.567 -42.066 1.00 45.91  ? 154 ASN A CA    1 
ATOM   627  C  C     . ASN A 1 78  ? -11.390 -14.025 -41.869 1.00 49.35  ? 154 ASN A C     1 
ATOM   628  O  O     . ASN A 1 78  ? -12.040 -14.775 -41.149 1.00 56.59  ? 154 ASN A O     1 
ATOM   629  C  CB    . ASN A 1 78  ? -13.329 -12.437 -42.348 1.00 54.62  ? 154 ASN A CB    1 
ATOM   630  C  CG    . ASN A 1 78  ? -13.766 -13.190 -43.585 1.00 64.88  ? 154 ASN A CG    1 
ATOM   631  O  OD1   . ASN A 1 78  ? -12.944 -13.607 -44.400 1.00 70.46  ? 154 ASN A OD1   1 
ATOM   632  N  ND2   . ASN A 1 78  ? -15.075 -13.361 -43.738 1.00 76.03  ? 154 ASN A ND2   1 
ATOM   633  N  N     . SER A 1 79  ? -10.277 -14.411 -42.487 1.00 45.23  ? 155 SER A N     1 
ATOM   634  C  CA    . SER A 1 79  ? -9.672  -15.696 -42.195 1.00 46.90  ? 155 SER A CA    1 
ATOM   635  C  C     . SER A 1 79  ? -8.348  -15.622 -41.409 1.00 48.73  ? 155 SER A C     1 
ATOM   636  O  O     . SER A 1 79  ? -7.652  -16.635 -41.291 1.00 47.29  ? 155 SER A O     1 
ATOM   637  C  CB    . SER A 1 79  ? -9.529  -16.558 -43.466 1.00 45.50  ? 155 SER A CB    1 
ATOM   638  O  OG    . SER A 1 79  ? -8.631  -15.990 -44.393 1.00 44.51  ? 155 SER A OG    1 
ATOM   639  N  N     . THR A 1 80  ? -8.004  -14.455 -40.853 1.00 49.73  ? 156 THR A N     1 
ATOM   640  C  CA    . THR A 1 80  ? -6.841  -14.388 -39.960 1.00 45.60  ? 156 THR A CA    1 
ATOM   641  C  C     . THR A 1 80  ? -7.234  -15.108 -38.680 1.00 40.76  ? 156 THR A C     1 
ATOM   642  O  O     . THR A 1 80  ? -8.403  -15.106 -38.308 1.00 46.04  ? 156 THR A O     1 
ATOM   643  C  CB    . THR A 1 80  ? -6.342  -12.918 -39.596 1.00 39.07  ? 156 THR A CB    1 
ATOM   644  O  OG1   . THR A 1 80  ? -6.904  -12.491 -38.359 1.00 46.67  ? 156 THR A OG1   1 
ATOM   645  C  CG2   . THR A 1 80  ? -6.645  -11.905 -40.650 1.00 33.31  ? 156 THR A CG2   1 
ATOM   646  N  N     . ASP A 1 81  ? -6.273  -15.731 -38.009 1.00 39.62  ? 157 ASP A N     1 
ATOM   647  C  CA    . ASP A 1 81  ? -6.567  -16.415 -36.749 1.00 42.29  ? 157 ASP A CA    1 
ATOM   648  C  C     . ASP A 1 81  ? -6.042  -15.602 -35.588 1.00 34.88  ? 157 ASP A C     1 
ATOM   649  O  O     . ASP A 1 81  ? -6.561  -15.679 -34.492 1.00 37.47  ? 157 ASP A O     1 
ATOM   650  C  CB    . ASP A 1 81  ? -5.958  -17.826 -36.705 1.00 33.83  ? 157 ASP A CB    1 
ATOM   651  C  CG    . ASP A 1 81  ? -6.474  -18.712 -37.805 1.00 42.72  ? 157 ASP A CG    1 
ATOM   652  O  OD1   . ASP A 1 81  ? -7.652  -19.141 -37.740 1.00 53.21  ? 157 ASP A OD1   1 
ATOM   653  O  OD2   . ASP A 1 81  ? -5.694  -18.980 -38.737 1.00 40.04  ? 157 ASP A OD2   1 
ATOM   654  N  N     . TYR A 1 82  ? -4.994  -14.830 -35.836 1.00 37.55  ? 158 TYR A N     1 
ATOM   655  C  CA    . TYR A 1 82  ? -4.431  -13.983 -34.804 1.00 30.19  ? 158 TYR A CA    1 
ATOM   656  C  C     . TYR A 1 82  ? -3.713  -12.747 -35.314 1.00 34.93  ? 158 TYR A C     1 
ATOM   657  O  O     . TYR A 1 82  ? -3.371  -12.630 -36.499 1.00 34.63  ? 158 TYR A O     1 
ATOM   658  C  CB    . TYR A 1 82  ? -3.538  -14.783 -33.860 1.00 32.70  ? 158 TYR A CB    1 
ATOM   659  C  CG    . TYR A 1 82  ? -2.234  -15.316 -34.424 1.00 30.45  ? 158 TYR A CG    1 
ATOM   660  C  CD1   . TYR A 1 82  ? -2.212  -16.213 -35.494 1.00 31.61  ? 158 TYR A CD1   1 
ATOM   661  C  CD2   . TYR A 1 82  ? -1.023  -14.970 -33.832 1.00 32.27  ? 158 TYR A CD2   1 
ATOM   662  C  CE1   . TYR A 1 82  ? -1.010  -16.727 -35.965 1.00 29.44  ? 158 TYR A CE1   1 
ATOM   663  C  CE2   . TYR A 1 82  ? 0.168   -15.473 -34.287 1.00 31.16  ? 158 TYR A CE2   1 
ATOM   664  C  CZ    . TYR A 1 82  ? 0.167   -16.355 -35.344 1.00 29.71  ? 158 TYR A CZ    1 
ATOM   665  O  OH    . TYR A 1 82  ? 1.361   -16.836 -35.774 1.00 31.88  ? 158 TYR A OH    1 
ATOM   666  N  N     . ILE A 1 83  ? -3.493  -11.815 -34.394 1.00 35.49  ? 159 ILE A N     1 
ATOM   667  C  CA    . ILE A 1 83  ? -2.932  -10.523 -34.738 1.00 28.77  ? 159 ILE A CA    1 
ATOM   668  C  C     . ILE A 1 83  ? -1.670  -10.259 -33.918 1.00 35.16  ? 159 ILE A C     1 
ATOM   669  O  O     . ILE A 1 83  ? -1.516  -10.769 -32.793 1.00 30.74  ? 159 ILE A O     1 
ATOM   670  C  CB    . ILE A 1 83  ? -3.972  -9.403  -34.553 1.00 34.56  ? 159 ILE A CB    1 
ATOM   671  C  CG1   . ILE A 1 83  ? -4.381  -9.260  -33.076 1.00 31.10  ? 159 ILE A CG1   1 
ATOM   672  C  CG2   . ILE A 1 83  ? -5.203  -9.693  -35.403 1.00 28.51  ? 159 ILE A CG2   1 
ATOM   673  C  CD1   . ILE A 1 83  ? -3.778  -8.076  -32.363 1.00 33.49  ? 159 ILE A CD1   1 
ATOM   674  N  N     . ALA A 1 84  ? -0.747  -9.513  -34.524 1.00 28.71  ? 160 ALA A N     1 
ATOM   675  C  CA    . ALA A 1 84  ? 0.376   -8.915  -33.810 1.00 29.60  ? 160 ALA A CA    1 
ATOM   676  C  C     . ALA A 1 84  ? 0.288   -7.420  -34.021 1.00 35.28  ? 160 ALA A C     1 
ATOM   677  O  O     . ALA A 1 84  ? 0.512   -6.942  -35.144 1.00 31.79  ? 160 ALA A O     1 
ATOM   678  C  CB    . ALA A 1 84  ? 1.686   -9.411  -34.342 1.00 24.79  ? 160 ALA A CB    1 
ATOM   679  N  N     . MET A 1 85  ? -0.061  -6.678  -32.971 1.00 29.45  ? 161 MET A N     1 
ATOM   680  C  CA    . MET A 1 85  ? 0.117   -5.234  -33.039 1.00 30.79  ? 161 MET A CA    1 
ATOM   681  C  C     . MET A 1 85  ? 1.617   -5.048  -32.939 1.00 32.15  ? 161 MET A C     1 
ATOM   682  O  O     . MET A 1 85  ? 2.249   -5.585  -32.018 1.00 30.95  ? 161 MET A O     1 
ATOM   683  C  CB    . MET A 1 85  ? -0.649  -4.488  -31.939 1.00 34.55  ? 161 MET A CB    1 
ATOM   684  C  CG    . MET A 1 85  ? -0.232  -4.768  -30.500 1.00 31.34  ? 161 MET A CG    1 
ATOM   685  S  SD    . MET A 1 85  ? -1.320  -3.931  -29.321 1.00 31.98  ? 161 MET A SD    1 
ATOM   686  C  CE    . MET A 1 85  ? -2.771  -4.953  -29.450 1.00 23.74  ? 161 MET A CE    1 
ATOM   687  N  N     . HIS A 1 86  ? 2.188   -4.345  -33.920 1.00 25.91  ? 162 HIS A N     1 
ATOM   688  C  CA    . HIS A 1 86  ? 3.631   -4.355  -34.134 1.00 31.02  ? 162 HIS A CA    1 
ATOM   689  C  C     . HIS A 1 86  ? 4.126   -2.974  -34.507 1.00 31.55  ? 162 HIS A C     1 
ATOM   690  O  O     . HIS A 1 86  ? 3.791   -2.471  -35.574 1.00 35.99  ? 162 HIS A O     1 
ATOM   691  C  CB    . HIS A 1 86  ? 3.985   -5.335  -35.275 1.00 25.36  ? 162 HIS A CB    1 
ATOM   692  C  CG    . HIS A 1 86  ? 5.331   -5.978  -35.131 1.00 32.59  ? 162 HIS A CG    1 
ATOM   693  N  ND1   . HIS A 1 86  ? 6.503   -5.253  -35.051 1.00 32.28  ? 162 HIS A ND1   1 
ATOM   694  C  CD2   . HIS A 1 86  ? 5.693   -7.283  -35.063 1.00 30.47  ? 162 HIS A CD2   1 
ATOM   695  C  CE1   . HIS A 1 86  ? 7.525   -6.081  -34.922 1.00 33.96  ? 162 HIS A CE1   1 
ATOM   696  N  NE2   . HIS A 1 86  ? 7.063   -7.320  -34.928 1.00 31.73  ? 162 HIS A NE2   1 
ATOM   697  N  N     . ASP A 1 87  ? 4.921   -2.355  -33.641 1.00 33.72  ? 163 ASP A N     1 
ATOM   698  C  CA    . ASP A 1 87  ? 5.500   -1.054  -33.981 1.00 40.28  ? 163 ASP A CA    1 
ATOM   699  C  C     . ASP A 1 87  ? 6.394   -1.211  -35.235 1.00 42.30  ? 163 ASP A C     1 
ATOM   700  O  O     . ASP A 1 87  ? 6.968   -2.282  -35.459 1.00 37.01  ? 163 ASP A O     1 
ATOM   701  C  CB    . ASP A 1 87  ? 6.292   -0.482  -32.807 1.00 36.72  ? 163 ASP A CB    1 
ATOM   702  C  CG    . ASP A 1 87  ? 5.407   0.008   -31.675 1.00 34.16  ? 163 ASP A CG    1 
ATOM   703  O  OD1   . ASP A 1 87  ? 4.169   0.109   -31.839 1.00 34.02  ? 163 ASP A OD1   1 
ATOM   704  O  OD2   . ASP A 1 87  ? 5.967   0.328   -30.609 1.00 38.72  ? 163 ASP A OD2   1 
ATOM   705  N  N     . VAL A 1 88  ? 6.486   -0.159  -36.051 1.00 33.51  ? 164 VAL A N     1 
ATOM   706  C  CA    . VAL A 1 88  ? 7.092   -0.248  -37.382 1.00 34.07  ? 164 VAL A CA    1 
ATOM   707  C  C     . VAL A 1 88  ? 8.607   -0.102  -37.301 1.00 35.61  ? 164 VAL A C     1 
ATOM   708  O  O     . VAL A 1 88  ? 9.312   -0.285  -38.280 1.00 35.00  ? 164 VAL A O     1 
ATOM   709  C  CB    . VAL A 1 88  ? 6.506   0.827   -38.338 1.00 37.86  ? 164 VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 88  ? 6.972   2.228   -37.920 1.00 33.23  ? 164 VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 88  ? 6.867   0.545   -39.804 1.00 33.69  ? 164 VAL A CG2   1 
ATOM   712  N  N     . ASP A 1 89  ? 9.104   0.194   -36.110 1.00 37.06  ? 165 ASP A N     1 
ATOM   713  C  CA    . ASP A 1 89  ? 10.505  0.539   -35.939 1.00 38.92  ? 165 ASP A CA    1 
ATOM   714  C  C     . ASP A 1 89  ? 11.192  -0.420  -34.992 1.00 41.02  ? 165 ASP A C     1 
ATOM   715  O  O     . ASP A 1 89  ? 12.338  -0.204  -34.597 1.00 45.32  ? 165 ASP A O     1 
ATOM   716  C  CB    . ASP A 1 89  ? 10.617  1.963   -35.383 1.00 39.71  ? 165 ASP A CB    1 
ATOM   717  C  CG    . ASP A 1 89  ? 10.046  2.093   -33.975 1.00 39.46  ? 165 ASP A CG    1 
ATOM   718  O  OD1   . ASP A 1 89  ? 9.483   1.114   -33.443 1.00 40.08  ? 165 ASP A OD1   1 
ATOM   719  O  OD2   . ASP A 1 89  ? 10.147  3.188   -33.393 1.00 36.68  ? 165 ASP A OD2   1 
ATOM   720  N  N     . LEU A 1 90  ? 10.465  -1.458  -34.594 1.00 41.25  ? 166 LEU A N     1 
ATOM   721  C  CA    . LEU A 1 90  ? 10.975  -2.437  -33.651 1.00 39.78  ? 166 LEU A CA    1 
ATOM   722  C  C     . LEU A 1 90  ? 11.132  -3.761  -34.390 1.00 37.86  ? 166 LEU A C     1 
ATOM   723  O  O     . LEU A 1 90  ? 10.158  -4.454  -34.645 1.00 45.93  ? 166 LEU A O     1 
ATOM   724  C  CB    . LEU A 1 90  ? 10.001  -2.582  -32.486 1.00 36.71  ? 166 LEU A CB    1 
ATOM   725  C  CG    . LEU A 1 90  ? 10.542  -3.053  -31.147 1.00 41.31  ? 166 LEU A CG    1 
ATOM   726  C  CD1   . LEU A 1 90  ? 11.530  -2.041  -30.601 1.00 40.19  ? 166 LEU A CD1   1 
ATOM   727  C  CD2   . LEU A 1 90  ? 9.382   -3.227  -30.178 1.00 43.12  ? 166 LEU A CD2   1 
ATOM   728  N  N     . LEU A 1 91  ? 12.362  -4.102  -34.748 1.00 39.22  ? 167 LEU A N     1 
ATOM   729  C  CA    . LEU A 1 91  ? 12.612  -5.277  -35.570 1.00 42.53  ? 167 LEU A CA    1 
ATOM   730  C  C     . LEU A 1 91  ? 13.157  -6.389  -34.697 1.00 41.86  ? 167 LEU A C     1 
ATOM   731  O  O     . LEU A 1 91  ? 14.137  -6.185  -33.982 1.00 40.90  ? 167 LEU A O     1 
ATOM   732  C  CB    . LEU A 1 91  ? 13.612  -4.937  -36.683 1.00 42.80  ? 167 LEU A CB    1 
ATOM   733  C  CG    . LEU A 1 91  ? 13.232  -3.774  -37.607 1.00 40.17  ? 167 LEU A CG    1 
ATOM   734  C  CD1   . LEU A 1 91  ? 14.369  -3.460  -38.558 1.00 43.56  ? 167 LEU A CD1   1 
ATOM   735  C  CD2   . LEU A 1 91  ? 11.970  -4.091  -38.390 1.00 35.18  ? 167 LEU A CD2   1 
ATOM   736  N  N     . PRO A 1 92  ? 12.503  -7.564  -34.725 1.00 43.34  ? 168 PRO A N     1 
ATOM   737  C  CA    . PRO A 1 92  ? 13.023  -8.722  -33.992 1.00 34.64  ? 168 PRO A CA    1 
ATOM   738  C  C     . PRO A 1 92  ? 14.329  -9.214  -34.614 1.00 38.62  ? 168 PRO A C     1 
ATOM   739  O  O     . PRO A 1 92  ? 14.396  -9.334  -35.828 1.00 34.57  ? 168 PRO A O     1 
ATOM   740  C  CB    . PRO A 1 92  ? 11.912  -9.766  -34.163 1.00 37.00  ? 168 PRO A CB    1 
ATOM   741  C  CG    . PRO A 1 92  ? 11.182  -9.348  -35.403 1.00 37.31  ? 168 PRO A CG    1 
ATOM   742  C  CD    . PRO A 1 92  ? 11.211  -7.850  -35.373 1.00 36.53  ? 168 PRO A CD    1 
ATOM   743  N  N     . LEU A 1 93  ? 15.348  -9.469  -33.799 1.00 37.41  ? 169 LEU A N     1 
ATOM   744  C  CA    . LEU A 1 93  ? 16.625  -9.976  -34.294 1.00 40.41  ? 169 LEU A CA    1 
ATOM   745  C  C     . LEU A 1 93  ? 16.851  -11.419 -33.828 1.00 44.28  ? 169 LEU A C     1 
ATOM   746  O  O     . LEU A 1 93  ? 17.800  -12.083 -34.236 1.00 47.73  ? 169 LEU A O     1 
ATOM   747  C  CB    . LEU A 1 93  ? 17.770  -9.089  -33.793 1.00 42.98  ? 169 LEU A CB    1 
ATOM   748  C  CG    . LEU A 1 93  ? 17.685  -7.594  -34.122 1.00 48.07  ? 169 LEU A CG    1 
ATOM   749  C  CD1   . LEU A 1 93  ? 18.816  -6.818  -33.456 1.00 35.47  ? 169 LEU A CD1   1 
ATOM   750  C  CD2   . LEU A 1 93  ? 17.696  -7.378  -35.642 1.00 42.40  ? 169 LEU A CD2   1 
ATOM   751  N  N     . ASN A 1 94  ? 15.983  -11.901 -32.955 1.00 44.72  ? 170 ASN A N     1 
ATOM   752  C  CA    . ASN A 1 94  ? 16.149  -13.228 -32.401 1.00 39.21  ? 170 ASN A CA    1 
ATOM   753  C  C     . ASN A 1 94  ? 14.993  -14.114 -32.833 1.00 43.52  ? 170 ASN A C     1 
ATOM   754  O  O     . ASN A 1 94  ? 13.832  -13.801 -32.565 1.00 47.76  ? 170 ASN A O     1 
ATOM   755  C  CB    . ASN A 1 94  ? 16.240  -13.136 -30.880 1.00 47.41  ? 170 ASN A CB    1 
ATOM   756  C  CG    . ASN A 1 94  ? 16.686  -14.430 -30.243 1.00 45.68  ? 170 ASN A CG    1 
ATOM   757  O  OD1   . ASN A 1 94  ? 16.426  -15.514 -30.767 1.00 44.61  ? 170 ASN A OD1   1 
ATOM   758  N  ND2   . ASN A 1 94  ? 17.360  -14.325 -29.097 1.00 41.90  ? 170 ASN A ND2   1 
ATOM   759  N  N     . GLU A 1 95  ? 15.305  -15.223 -33.498 1.00 42.12  ? 171 GLU A N     1 
ATOM   760  C  CA    . GLU A 1 95  ? 14.258  -16.068 -34.063 1.00 42.94  ? 171 GLU A CA    1 
ATOM   761  C  C     . GLU A 1 95  ? 13.622  -16.991 -33.037 1.00 43.11  ? 171 GLU A C     1 
ATOM   762  O  O     . GLU A 1 95  ? 12.654  -17.689 -33.333 1.00 40.39  ? 171 GLU A O     1 
ATOM   763  C  CB    . GLU A 1 95  ? 14.776  -16.847 -35.272 1.00 47.26  ? 171 GLU A CB    1 
ATOM   764  C  CG    . GLU A 1 95  ? 14.990  -15.949 -36.478 1.00 49.65  ? 171 GLU A CG    1 
ATOM   765  C  CD    . GLU A 1 95  ? 15.529  -16.687 -37.692 1.00 57.78  ? 171 GLU A CD    1 
ATOM   766  O  OE1   . GLU A 1 95  ? 15.501  -16.091 -38.791 1.00 56.36  ? 171 GLU A OE1   1 
ATOM   767  O  OE2   . GLU A 1 95  ? 15.979  -17.848 -37.548 1.00 62.83  ? 171 GLU A OE2   1 
ATOM   768  N  N     . GLU A 1 96  ? 14.159  -16.960 -31.822 1.00 41.69  ? 172 GLU A N     1 
ATOM   769  C  CA    . GLU A 1 96  ? 13.600  -17.693 -30.695 1.00 41.61  ? 172 GLU A CA    1 
ATOM   770  C  C     . GLU A 1 96  ? 12.274  -17.102 -30.190 1.00 44.25  ? 172 GLU A C     1 
ATOM   771  O  O     . GLU A 1 96  ? 11.584  -17.719 -29.365 1.00 41.62  ? 172 GLU A O     1 
ATOM   772  C  CB    . GLU A 1 96  ? 14.598  -17.656 -29.543 1.00 47.77  ? 172 GLU A CB    1 
ATOM   773  C  CG    . GLU A 1 96  ? 14.957  -18.989 -28.968 1.00 55.00  ? 172 GLU A CG    1 
ATOM   774  C  CD    . GLU A 1 96  ? 16.037  -19.664 -29.763 1.00 67.04  ? 172 GLU A CD    1 
ATOM   775  O  OE1   . GLU A 1 96  ? 15.702  -20.380 -30.735 1.00 67.62  ? 172 GLU A OE1   1 
ATOM   776  O  OE2   . GLU A 1 96  ? 17.221  -19.468 -29.412 1.00 73.68  ? 172 GLU A OE2   1 
ATOM   777  N  N     . LEU A 1 97  ? 11.936  -15.896 -30.643 1.00 43.40  ? 173 LEU A N     1 
ATOM   778  C  CA    . LEU A 1 97  ? 10.749  -15.213 -30.142 1.00 42.52  ? 173 LEU A CA    1 
ATOM   779  C  C     . LEU A 1 97  ? 9.505   -15.881 -30.694 1.00 39.00  ? 173 LEU A C     1 
ATOM   780  O  O     . LEU A 1 97  ? 9.388   -16.088 -31.895 1.00 36.51  ? 173 LEU A O     1 
ATOM   781  C  CB    . LEU A 1 97  ? 10.752  -13.739 -30.535 1.00 39.77  ? 173 LEU A CB    1 
ATOM   782  C  CG    . LEU A 1 97  ? 11.877  -12.852 -30.005 1.00 41.26  ? 173 LEU A CG    1 
ATOM   783  C  CD1   . LEU A 1 97  ? 11.795  -11.504 -30.664 1.00 31.94  ? 173 LEU A CD1   1 
ATOM   784  C  CD2   . LEU A 1 97  ? 11.776  -12.701 -28.501 1.00 39.79  ? 173 LEU A CD2   1 
ATOM   785  N  N     . ASP A 1 98  ? 8.579   -16.215 -29.808 1.00 35.71  ? 174 ASP A N     1 
ATOM   786  C  CA    . ASP A 1 98  ? 7.342   -16.860 -30.204 1.00 38.94  ? 174 ASP A CA    1 
ATOM   787  C  C     . ASP A 1 98  ? 6.369   -15.934 -30.937 1.00 39.46  ? 174 ASP A C     1 
ATOM   788  O  O     . ASP A 1 98  ? 5.613   -15.169 -30.314 1.00 29.64  ? 174 ASP A O     1 
ATOM   789  C  CB    . ASP A 1 98  ? 6.659   -17.476 -28.981 1.00 40.36  ? 174 ASP A CB    1 
ATOM   790  C  CG    . ASP A 1 98  ? 5.591   -18.468 -29.363 1.00 42.52  ? 174 ASP A CG    1 
ATOM   791  O  OD1   . ASP A 1 98  ? 5.443   -18.729 -30.580 1.00 40.32  ? 174 ASP A OD1   1 
ATOM   792  O  OD2   . ASP A 1 98  ? 4.911   -18.994 -28.449 1.00 50.19  ? 174 ASP A OD2   1 
ATOM   793  N  N     . TYR A 1 99  ? 6.375   -16.017 -32.263 1.00 33.37  ? 175 TYR A N     1 
ATOM   794  C  CA    . TYR A 1 99  ? 5.363   -15.324 -33.052 1.00 35.04  ? 175 TYR A CA    1 
ATOM   795  C  C     . TYR A 1 99  ? 4.289   -16.308 -33.504 1.00 34.48  ? 175 TYR A C     1 
ATOM   796  O  O     . TYR A 1 99  ? 3.469   -16.006 -34.382 1.00 34.39  ? 175 TYR A O     1 
ATOM   797  C  CB    . TYR A 1 99  ? 5.986   -14.636 -34.269 1.00 32.17  ? 175 TYR A CB    1 
ATOM   798  C  CG    . TYR A 1 99  ? 6.552   -13.243 -34.041 1.00 31.87  ? 175 TYR A CG    1 
ATOM   799  C  CD1   . TYR A 1 99  ? 7.724   -13.049 -33.320 1.00 33.49  ? 175 TYR A CD1   1 
ATOM   800  C  CD2   . TYR A 1 99  ? 5.939   -12.129 -34.601 1.00 33.07  ? 175 TYR A CD2   1 
ATOM   801  C  CE1   . TYR A 1 99  ? 8.257   -11.779 -33.144 1.00 33.16  ? 175 TYR A CE1   1 
ATOM   802  C  CE2   . TYR A 1 99  ? 6.468   -10.849 -34.437 1.00 31.35  ? 175 TYR A CE2   1 
ATOM   803  C  CZ    . TYR A 1 99  ? 7.625   -10.685 -33.713 1.00 27.17  ? 175 TYR A CZ    1 
ATOM   804  O  OH    . TYR A 1 99  ? 8.135   -9.419  -33.550 1.00 37.20  ? 175 TYR A OH    1 
ATOM   805  N  N     . GLY A 1 100 ? 4.306   -17.495 -32.909 1.00 38.47  ? 176 GLY A N     1 
ATOM   806  C  CA    . GLY A 1 100 ? 3.285   -18.489 -33.174 1.00 31.23  ? 176 GLY A CA    1 
ATOM   807  C  C     . GLY A 1 100 ? 1.958   -18.113 -32.543 1.00 37.10  ? 176 GLY A C     1 
ATOM   808  O  O     . GLY A 1 100 ? 1.859   -17.141 -31.799 1.00 39.79  ? 176 GLY A O     1 
ATOM   809  N  N     . PHE A 1 101 ? 0.933   -18.893 -32.848 1.00 34.22  ? 177 PHE A N     1 
ATOM   810  C  CA    . PHE A 1 101 ? -0.396  -18.688 -32.313 1.00 36.26  ? 177 PHE A CA    1 
ATOM   811  C  C     . PHE A 1 101 ? -0.374  -18.685 -30.784 1.00 37.80  ? 177 PHE A C     1 
ATOM   812  O  O     . PHE A 1 101 ? 0.069   -19.644 -30.170 1.00 35.25  ? 177 PHE A O     1 
ATOM   813  C  CB    . PHE A 1 101 ? -1.299  -19.796 -32.825 1.00 33.21  ? 177 PHE A CB    1 
ATOM   814  C  CG    . PHE A 1 101 ? -2.735  -19.594 -32.501 1.00 42.03  ? 177 PHE A CG    1 
ATOM   815  C  CD1   . PHE A 1 101 ? -3.448  -18.581 -33.110 1.00 32.68  ? 177 PHE A CD1   1 
ATOM   816  C  CD2   . PHE A 1 101 ? -3.386  -20.433 -31.599 1.00 37.43  ? 177 PHE A CD2   1 
ATOM   817  C  CE1   . PHE A 1 101 ? -4.783  -18.397 -32.819 1.00 33.64  ? 177 PHE A CE1   1 
ATOM   818  C  CE2   . PHE A 1 101 ? -4.716  -20.246 -31.303 1.00 34.92  ? 177 PHE A CE2   1 
ATOM   819  C  CZ    . PHE A 1 101 ? -5.413  -19.225 -31.908 1.00 38.52  ? 177 PHE A CZ    1 
ATOM   820  N  N     . PRO A 1 102 ? -0.834  -17.581 -30.168 1.00 40.44  ? 178 PRO A N     1 
ATOM   821  C  CA    . PRO A 1 102 ? -0.802  -17.420 -28.709 1.00 37.47  ? 178 PRO A CA    1 
ATOM   822  C  C     . PRO A 1 102 ? -2.032  -18.033 -28.049 1.00 30.15  ? 178 PRO A C     1 
ATOM   823  O  O     . PRO A 1 102 ? -2.879  -17.330 -27.503 1.00 33.41  ? 178 PRO A O     1 
ATOM   824  C  CB    . PRO A 1 102 ? -0.792  -15.893 -28.534 1.00 36.61  ? 178 PRO A CB    1 
ATOM   825  C  CG    . PRO A 1 102 ? -1.552  -15.391 -29.721 1.00 35.13  ? 178 PRO A CG    1 
ATOM   826  C  CD    . PRO A 1 102 ? -1.295  -16.359 -30.851 1.00 32.94  ? 178 PRO A CD    1 
ATOM   827  N  N     . GLU A 1 103 ? -2.113  -19.354 -28.078 1.00 40.99  ? 179 GLU A N     1 
ATOM   828  C  CA    . GLU A 1 103 ? -3.323  -20.036 -27.641 1.00 36.91  ? 179 GLU A CA    1 
ATOM   829  C  C     . GLU A 1 103 ? -3.684  -19.850 -26.173 1.00 32.50  ? 179 GLU A C     1 
ATOM   830  O  O     . GLU A 1 103 ? -4.839  -19.592 -25.862 1.00 33.19  ? 179 GLU A O     1 
ATOM   831  C  CB    . GLU A 1 103 ? -3.263  -21.522 -27.960 1.00 40.37  ? 179 GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 103 ? -4.622  -22.178 -27.827 1.00 39.33  ? 179 GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 103 ? -4.574  -23.668 -28.081 1.00 43.05  ? 179 GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 103 ? -3.464  -24.247 -28.062 1.00 41.69  ? 179 GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 103 ? -5.650  -24.248 -28.317 1.00 54.64  ? 179 GLU A OE2   1 
ATOM   836  N  N     . ALA A 1 104 ? -2.708  -19.994 -25.280 1.00 34.03  ? 180 ALA A N     1 
ATOM   837  C  CA    . ALA A 1 104 ? -2.968  -19.940 -23.840 1.00 29.90  ? 180 ALA A CA    1 
ATOM   838  C  C     . ALA A 1 104 ? -3.267  -18.523 -23.323 1.00 33.81  ? 180 ALA A C     1 
ATOM   839  O  O     . ALA A 1 104 ? -3.737  -18.350 -22.197 1.00 31.16  ? 180 ALA A O     1 
ATOM   840  C  CB    . ALA A 1 104 ? -1.788  -20.525 -23.078 1.00 31.41  ? 180 ALA A CB    1 
ATOM   841  N  N     . GLY A 1 105 ? -2.970  -17.507 -24.125 1.00 29.93  ? 181 GLY A N     1 
ATOM   842  C  CA    . GLY A 1 105 ? -3.189  -16.138 -23.687 1.00 33.20  ? 181 GLY A CA    1 
ATOM   843  C  C     . GLY A 1 105 ? -2.315  -15.201 -24.480 1.00 33.81  ? 181 GLY A C     1 
ATOM   844  O  O     . GLY A 1 105 ? -1.447  -15.665 -25.206 1.00 37.11  ? 181 GLY A O     1 
ATOM   845  N  N     . PRO A 1 106 ? -2.552  -13.882 -24.361 1.00 36.70  ? 182 PRO A N     1 
ATOM   846  C  CA    . PRO A 1 106 ? -1.762  -12.903 -25.105 1.00 31.56  ? 182 PRO A CA    1 
ATOM   847  C  C     . PRO A 1 106 ? -0.261  -13.050 -24.852 1.00 36.12  ? 182 PRO A C     1 
ATOM   848  O  O     . PRO A 1 106 ? 0.179   -13.294 -23.720 1.00 32.89  ? 182 PRO A O     1 
ATOM   849  C  CB    . PRO A 1 106 ? -2.284  -11.572 -24.566 1.00 30.59  ? 182 PRO A CB    1 
ATOM   850  C  CG    . PRO A 1 106 ? -3.701  -11.882 -24.213 1.00 32.37  ? 182 PRO A CG    1 
ATOM   851  C  CD    . PRO A 1 106 ? -3.623  -13.228 -23.584 1.00 27.77  ? 182 PRO A CD    1 
ATOM   852  N  N     . PHE A 1 107 ? 0.517   -12.904 -25.920 1.00 31.92  ? 183 PHE A N     1 
ATOM   853  C  CA    . PHE A 1 107 ? 1.957   -13.060 -25.831 1.00 34.19  ? 183 PHE A CA    1 
ATOM   854  C  C     . PHE A 1 107 ? 2.634   -11.739 -26.163 1.00 31.97  ? 183 PHE A C     1 
ATOM   855  O  O     . PHE A 1 107 ? 2.438   -11.170 -27.245 1.00 35.83  ? 183 PHE A O     1 
ATOM   856  C  CB    . PHE A 1 107 ? 2.456   -14.174 -26.775 1.00 33.98  ? 183 PHE A CB    1 
ATOM   857  C  CG    . PHE A 1 107 ? 3.886   -14.570 -26.529 1.00 29.17  ? 183 PHE A CG    1 
ATOM   858  C  CD1   . PHE A 1 107 ? 4.192   -15.555 -25.612 1.00 31.47  ? 183 PHE A CD1   1 
ATOM   859  C  CD2   . PHE A 1 107 ? 4.924   -13.941 -27.203 1.00 33.17  ? 183 PHE A CD2   1 
ATOM   860  C  CE1   . PHE A 1 107 ? 5.516   -15.926 -25.377 1.00 31.79  ? 183 PHE A CE1   1 
ATOM   861  C  CE2   . PHE A 1 107 ? 6.247   -14.301 -26.966 1.00 36.98  ? 183 PHE A CE2   1 
ATOM   862  C  CZ    . PHE A 1 107 ? 6.539   -15.303 -26.053 1.00 36.34  ? 183 PHE A CZ    1 
ATOM   863  N  N     . HIS A 1 108 ? 3.437   -11.257 -25.229 1.00 32.50  ? 184 HIS A N     1 
ATOM   864  C  CA    . HIS A 1 108 ? 4.030   -9.943  -25.366 1.00 33.63  ? 184 HIS A CA    1 
ATOM   865  C  C     . HIS A 1 108 ? 5.477   -10.123 -25.784 1.00 32.62  ? 184 HIS A C     1 
ATOM   866  O  O     . HIS A 1 108 ? 6.333   -10.430 -24.958 1.00 34.22  ? 184 HIS A O     1 
ATOM   867  C  CB    . HIS A 1 108 ? 3.923   -9.163  -24.050 1.00 30.77  ? 184 HIS A CB    1 
ATOM   868  C  CG    . HIS A 1 108 ? 4.621   -7.842  -24.082 1.00 38.75  ? 184 HIS A CG    1 
ATOM   869  N  ND1   . HIS A 1 108 ? 5.392   -7.386  -23.035 1.00 38.81  ? 184 HIS A ND1   1 
ATOM   870  C  CD2   . HIS A 1 108 ? 4.666   -6.879  -25.037 1.00 28.28  ? 184 HIS A CD2   1 
ATOM   871  C  CE1   . HIS A 1 108 ? 5.886   -6.199  -23.345 1.00 38.52  ? 184 HIS A CE1   1 
ATOM   872  N  NE2   . HIS A 1 108 ? 5.461   -5.870  -24.552 1.00 34.94  ? 184 HIS A NE2   1 
ATOM   873  N  N     . VAL A 1 109 ? 5.737   -9.949  -27.075 1.00 31.36  ? 185 VAL A N     1 
ATOM   874  C  CA    . VAL A 1 109 ? 7.064   -10.177 -27.623 1.00 32.91  ? 185 VAL A CA    1 
ATOM   875  C  C     . VAL A 1 109 ? 8.080   -9.186  -27.060 1.00 37.47  ? 185 VAL A C     1 
ATOM   876  O  O     . VAL A 1 109 ? 9.145   -9.599  -26.602 1.00 32.90  ? 185 VAL A O     1 
ATOM   877  C  CB    . VAL A 1 109 ? 7.052   -10.110 -29.178 1.00 37.64  ? 185 VAL A CB    1 
ATOM   878  C  CG1   . VAL A 1 109 ? 8.469   -10.071 -29.735 1.00 31.96  ? 185 VAL A CG1   1 
ATOM   879  C  CG2   . VAL A 1 109 ? 6.271   -11.276 -29.760 1.00 29.31  ? 185 VAL A CG2   1 
ATOM   880  N  N     . ALA A 1 110 ? 7.737   -7.891  -27.065 1.00 34.34  ? 186 ALA A N     1 
ATOM   881  C  CA    . ALA A 1 110 ? 8.676   -6.828  -26.658 1.00 38.16  ? 186 ALA A CA    1 
ATOM   882  C  C     . ALA A 1 110 ? 8.749   -6.652  -25.140 1.00 40.79  ? 186 ALA A C     1 
ATOM   883  O  O     . ALA A 1 110 ? 8.633   -5.536  -24.617 1.00 35.74  ? 186 ALA A O     1 
ATOM   884  C  CB    . ALA A 1 110 ? 8.323   -5.496  -27.341 1.00 31.21  ? 186 ALA A CB    1 
ATOM   885  N  N     . SER A 1 111 ? 8.953   -7.774  -24.455 1.00 39.96  ? 187 SER A N     1 
ATOM   886  C  CA    . SER A 1 111 ? 9.017   -7.853  -22.999 1.00 42.11  ? 187 SER A CA    1 
ATOM   887  C  C     . SER A 1 111 ? 9.891   -6.775  -22.365 1.00 39.06  ? 187 SER A C     1 
ATOM   888  O  O     . SER A 1 111 ? 10.919  -6.413  -22.937 1.00 42.48  ? 187 SER A O     1 
ATOM   889  C  CB    . SER A 1 111 ? 9.551   -9.237  -22.601 1.00 35.47  ? 187 SER A CB    1 
ATOM   890  O  OG    . SER A 1 111 ? 10.033  -9.240  -21.268 1.00 41.96  ? 187 SER A OG    1 
ATOM   891  N  N     . PRO A 1 112 ? 9.497   -6.282  -21.168 1.00 38.31  ? 188 PRO A N     1 
ATOM   892  C  CA    . PRO A 1 112 ? 10.276  -5.295  -20.406 1.00 38.43  ? 188 PRO A CA    1 
ATOM   893  C  C     . PRO A 1 112 ? 11.670  -5.801  -20.040 1.00 44.23  ? 188 PRO A C     1 
ATOM   894  O  O     . PRO A 1 112 ? 12.538  -5.007  -19.675 1.00 47.07  ? 188 PRO A O     1 
ATOM   895  C  CB    . PRO A 1 112 ? 9.444   -5.090  -19.140 1.00 40.05  ? 188 PRO A CB    1 
ATOM   896  C  CG    . PRO A 1 112 ? 8.598   -6.335  -19.028 1.00 40.29  ? 188 PRO A CG    1 
ATOM   897  C  CD    . PRO A 1 112 ? 8.273   -6.677  -20.447 1.00 40.73  ? 188 PRO A CD    1 
ATOM   898  N  N     . GLU A 1 113 ? 11.889  -7.107  -20.144 1.00 42.58  ? 189 GLU A N     1 
ATOM   899  C  CA    . GLU A 1 113 ? 13.212  -7.679  -19.899 1.00 45.69  ? 189 GLU A CA    1 
ATOM   900  C  C     . GLU A 1 113 ? 14.121  -7.469  -21.119 1.00 48.65  ? 189 GLU A C     1 
ATOM   901  O  O     . GLU A 1 113 ? 15.351  -7.523  -21.022 1.00 50.61  ? 189 GLU A O     1 
ATOM   902  C  CB    . GLU A 1 113 ? 13.066  -9.166  -19.557 1.00 47.61  ? 189 GLU A CB    1 
ATOM   903  C  CG    . GLU A 1 113 ? 14.346  -10.001 -19.583 1.00 57.99  ? 189 GLU A CG    1 
ATOM   904  C  CD    . GLU A 1 113 ? 14.063  -11.511 -19.578 1.00 62.37  ? 189 GLU A CD    1 
ATOM   905  O  OE1   . GLU A 1 113 ? 13.127  -11.953 -18.869 1.00 61.35  ? 189 GLU A OE1   1 
ATOM   906  O  OE2   . GLU A 1 113 ? 14.770  -12.252 -20.292 1.00 51.94  ? 189 GLU A OE2   1 
ATOM   907  N  N     . LEU A 1 114 ? 13.499  -7.177  -22.258 1.00 44.03  ? 190 LEU A N     1 
ATOM   908  C  CA    . LEU A 1 114 ? 14.171  -7.235  -23.547 1.00 43.86  ? 190 LEU A CA    1 
ATOM   909  C  C     . LEU A 1 114 ? 14.094  -5.889  -24.260 1.00 53.06  ? 190 LEU A C     1 
ATOM   910  O  O     . LEU A 1 114 ? 14.937  -5.570  -25.104 1.00 51.54  ? 190 LEU A O     1 
ATOM   911  C  CB    . LEU A 1 114 ? 13.526  -8.326  -24.414 1.00 41.03  ? 190 LEU A CB    1 
ATOM   912  C  CG    . LEU A 1 114 ? 14.108  -9.752  -24.433 1.00 49.15  ? 190 LEU A CG    1 
ATOM   913  C  CD1   . LEU A 1 114 ? 14.789  -10.133 -23.145 1.00 45.35  ? 190 LEU A CD1   1 
ATOM   914  C  CD2   . LEU A 1 114 ? 13.042  -10.794 -24.793 1.00 39.68  ? 190 LEU A CD2   1 
ATOM   915  N  N     . HIS A 1 115 ? 13.074  -5.105  -23.920 1.00 47.31  ? 191 HIS A N     1 
ATOM   916  C  CA    . HIS A 1 115 ? 12.843  -3.827  -24.576 1.00 46.27  ? 191 HIS A CA    1 
ATOM   917  C  C     . HIS A 1 115 ? 13.953  -2.849  -24.221 1.00 46.94  ? 191 HIS A C     1 
ATOM   918  O  O     . HIS A 1 115 ? 14.414  -2.829  -23.083 1.00 48.80  ? 191 HIS A O     1 
ATOM   919  C  CB    . HIS A 1 115 ? 11.474  -3.243  -24.190 1.00 45.14  ? 191 HIS A CB    1 
ATOM   920  C  CG    . HIS A 1 115 ? 11.012  -2.155  -25.110 1.00 43.13  ? 191 HIS A CG    1 
ATOM   921  N  ND1   . HIS A 1 115 ? 11.448  -0.850  -25.000 1.00 45.10  ? 191 HIS A ND1   1 
ATOM   922  C  CD2   . HIS A 1 115 ? 10.183  -2.183  -26.180 1.00 40.75  ? 191 HIS A CD2   1 
ATOM   923  C  CE1   . HIS A 1 115 ? 10.894  -0.120  -25.950 1.00 37.17  ? 191 HIS A CE1   1 
ATOM   924  N  NE2   . HIS A 1 115 ? 10.124  -0.903  -26.683 1.00 39.74  ? 191 HIS A NE2   1 
ATOM   925  N  N     . PRO A 1 116 ? 14.393  -2.037  -25.200 1.00 47.81  ? 192 PRO A N     1 
ATOM   926  C  CA    . PRO A 1 116 ? 15.482  -1.081  -24.970 1.00 49.68  ? 192 PRO A CA    1 
ATOM   927  C  C     . PRO A 1 116 ? 15.145  0.036   -23.974 1.00 42.69  ? 192 PRO A C     1 
ATOM   928  O  O     . PRO A 1 116 ? 16.029  0.424   -23.215 1.00 41.36  ? 192 PRO A O     1 
ATOM   929  C  CB    . PRO A 1 116 ? 15.741  -0.498  -26.366 1.00 50.03  ? 192 PRO A CB    1 
ATOM   930  C  CG    . PRO A 1 116 ? 14.479  -0.738  -27.119 1.00 50.40  ? 192 PRO A CG    1 
ATOM   931  C  CD    . PRO A 1 116 ? 13.966  -2.047  -26.607 1.00 41.37  ? 192 PRO A CD    1 
ATOM   932  N  N     . LEU A 1 117 ? 13.905  0.525   -23.961 1.00 43.61  ? 193 LEU A N     1 
ATOM   933  C  CA    . LEU A 1 117 ? 13.559  1.714   -23.166 1.00 42.88  ? 193 LEU A CA    1 
ATOM   934  C  C     . LEU A 1 117 ? 12.604  1.483   -21.995 1.00 47.05  ? 193 LEU A C     1 
ATOM   935  O  O     . LEU A 1 117 ? 12.640  2.223   -21.006 1.00 47.81  ? 193 LEU A O     1 
ATOM   936  C  CB    . LEU A 1 117 ? 12.955  2.794   -24.061 1.00 39.18  ? 193 LEU A CB    1 
ATOM   937  C  CG    . LEU A 1 117 ? 13.796  3.231   -25.253 1.00 43.39  ? 193 LEU A CG    1 
ATOM   938  C  CD1   . LEU A 1 117 ? 13.028  4.220   -26.100 1.00 37.67  ? 193 LEU A CD1   1 
ATOM   939  C  CD2   . LEU A 1 117 ? 15.107  3.825   -24.769 1.00 47.16  ? 193 LEU A CD2   1 
ATOM   940  N  N     . TYR A 1 118 ? 11.727  0.491   -22.106 1.00 42.16  ? 194 TYR A N     1 
ATOM   941  C  CA    . TYR A 1 118 ? 10.662  0.362   -21.119 1.00 37.40  ? 194 TYR A CA    1 
ATOM   942  C  C     . TYR A 1 118 ? 10.753  -0.963  -20.372 1.00 45.11  ? 194 TYR A C     1 
ATOM   943  O  O     . TYR A 1 118 ? 10.731  -2.034  -20.978 1.00 38.23  ? 194 TYR A O     1 
ATOM   944  C  CB    . TYR A 1 118 ? 9.303   0.572   -21.780 1.00 33.39  ? 194 TYR A CB    1 
ATOM   945  C  CG    . TYR A 1 118 ? 9.245   1.837   -22.622 1.00 43.56  ? 194 TYR A CG    1 
ATOM   946  C  CD1   . TYR A 1 118 ? 9.452   3.108   -22.052 1.00 38.86  ? 194 TYR A CD1   1 
ATOM   947  C  CD2   . TYR A 1 118 ? 8.996   1.766   -23.990 1.00 40.19  ? 194 TYR A CD2   1 
ATOM   948  C  CE1   . TYR A 1 118 ? 9.400   4.268   -22.842 1.00 31.93  ? 194 TYR A CE1   1 
ATOM   949  C  CE2   . TYR A 1 118 ? 8.940   2.903   -24.776 1.00 38.19  ? 194 TYR A CE2   1 
ATOM   950  C  CZ    . TYR A 1 118 ? 9.140   4.155   -24.197 1.00 35.31  ? 194 TYR A CZ    1 
ATOM   951  O  OH    . TYR A 1 118 ? 9.082   5.266   -25.004 1.00 32.34  ? 194 TYR A OH    1 
ATOM   952  N  N     . HIS A 1 119 ? 10.867  -0.878  -19.049 1.00 45.31  ? 195 HIS A N     1 
ATOM   953  C  CA    . HIS A 1 119 ? 11.283  -2.030  -18.258 1.00 45.30  ? 195 HIS A CA    1 
ATOM   954  C  C     . HIS A 1 119 ? 10.389  -2.341  -17.064 1.00 42.22  ? 195 HIS A C     1 
ATOM   955  O  O     . HIS A 1 119 ? 10.756  -3.139  -16.198 1.00 43.63  ? 195 HIS A O     1 
ATOM   956  C  CB    . HIS A 1 119 ? 12.728  -1.832  -17.801 1.00 47.32  ? 195 HIS A CB    1 
ATOM   957  C  CG    . HIS A 1 119 ? 13.670  -1.516  -18.922 1.00 45.64  ? 195 HIS A CG    1 
ATOM   958  N  ND1   . HIS A 1 119 ? 14.596  -0.499  -18.853 1.00 50.65  ? 195 HIS A ND1   1 
ATOM   959  C  CD2   . HIS A 1 119 ? 13.817  -2.076  -20.145 1.00 49.80  ? 195 HIS A CD2   1 
ATOM   960  C  CE1   . HIS A 1 119 ? 15.281  -0.452  -19.983 1.00 44.89  ? 195 HIS A CE1   1 
ATOM   961  N  NE2   . HIS A 1 119 ? 14.828  -1.399  -20.783 1.00 49.70  ? 195 HIS A NE2   1 
ATOM   962  N  N     . TYR A 1 120 ? 9.215   -1.722  -17.021 1.00 39.41  ? 196 TYR A N     1 
ATOM   963  C  CA    . TYR A 1 120 ? 8.285   -1.960  -15.915 1.00 44.68  ? 196 TYR A CA    1 
ATOM   964  C  C     . TYR A 1 120 ? 7.374   -3.160  -16.152 1.00 39.94  ? 196 TYR A C     1 
ATOM   965  O  O     . TYR A 1 120 ? 7.031   -3.455  -17.290 1.00 40.98  ? 196 TYR A O     1 
ATOM   966  C  CB    . TYR A 1 120 ? 7.468   -0.701  -15.586 1.00 34.46  ? 196 TYR A CB    1 
ATOM   967  C  CG    . TYR A 1 120 ? 6.625   -0.121  -16.703 1.00 38.27  ? 196 TYR A CG    1 
ATOM   968  C  CD1   . TYR A 1 120 ? 7.174   0.760   -17.642 1.00 36.93  ? 196 TYR A CD1   1 
ATOM   969  C  CD2   . TYR A 1 120 ? 5.265   -0.394  -16.778 1.00 36.75  ? 196 TYR A CD2   1 
ATOM   970  C  CE1   . TYR A 1 120 ? 6.393   1.329   -18.645 1.00 30.70  ? 196 TYR A CE1   1 
ATOM   971  C  CE2   . TYR A 1 120 ? 4.477   0.171   -17.769 1.00 40.37  ? 196 TYR A CE2   1 
ATOM   972  C  CZ    . TYR A 1 120 ? 5.045   1.029   -18.700 1.00 39.18  ? 196 TYR A CZ    1 
ATOM   973  O  OH    . TYR A 1 120 ? 4.242   1.572   -19.675 1.00 36.86  ? 196 TYR A OH    1 
ATOM   974  N  N     . LYS A 1 121 ? 6.978   -3.825  -15.064 1.00 42.87  ? 197 LYS A N     1 
ATOM   975  C  CA    . LYS A 1 121 ? 6.292   -5.129  -15.102 1.00 43.41  ? 197 LYS A CA    1 
ATOM   976  C  C     . LYS A 1 121 ? 5.130   -5.226  -16.088 1.00 39.06  ? 197 LYS A C     1 
ATOM   977  O  O     . LYS A 1 121 ? 4.980   -6.217  -16.805 1.00 42.39  ? 197 LYS A O     1 
ATOM   978  C  CB    . LYS A 1 121 ? 5.775   -5.487  -13.700 1.00 41.10  ? 197 LYS A CB    1 
ATOM   979  C  CG    . LYS A 1 121 ? 6.273   -6.812  -13.142 1.00 51.77  ? 197 LYS A CG    1 
ATOM   980  C  CD    . LYS A 1 121 ? 5.728   -7.038  -11.720 1.00 62.20  ? 197 LYS A CD    1 
ATOM   981  C  CE    . LYS A 1 121 ? 6.275   -8.315  -11.068 1.00 69.04  ? 197 LYS A CE    1 
ATOM   982  N  NZ    . LYS A 1 121 ? 7.688   -8.194  -10.570 1.00 60.13  ? 197 LYS A NZ    1 
ATOM   983  N  N     . THR A 1 122 ? 4.301   -4.193  -16.109 1.00 36.16  ? 198 THR A N     1 
ATOM   984  C  CA    . THR A 1 122 ? 3.049   -4.234  -16.844 1.00 31.56  ? 198 THR A CA    1 
ATOM   985  C  C     . THR A 1 122 ? 3.145   -3.530  -18.202 1.00 39.39  ? 198 THR A C     1 
ATOM   986  O  O     . THR A 1 122 ? 2.129   -3.185  -18.808 1.00 42.88  ? 198 THR A O     1 
ATOM   987  C  CB    . THR A 1 122 ? 1.899   -3.647  -15.999 1.00 34.80  ? 198 THR A CB    1 
ATOM   988  O  OG1   . THR A 1 122 ? 2.137   -2.253  -15.744 1.00 39.34  ? 198 THR A OG1   1 
ATOM   989  C  CG2   . THR A 1 122 ? 1.808   -4.379  -14.679 1.00 33.00  ? 198 THR A CG2   1 
ATOM   990  N  N     . TYR A 1 123 ? 4.365   -3.305  -18.676 1.00 32.11  ? 199 TYR A N     1 
ATOM   991  C  CA    . TYR A 1 123 ? 4.537   -2.738  -20.007 1.00 37.01  ? 199 TYR A CA    1 
ATOM   992  C  C     . TYR A 1 123 ? 4.147   -3.777  -21.059 1.00 36.45  ? 199 TYR A C     1 
ATOM   993  O  O     . TYR A 1 123 ? 4.703   -4.874  -21.091 1.00 34.54  ? 199 TYR A O     1 
ATOM   994  C  CB    . TYR A 1 123 ? 5.982   -2.274  -20.226 1.00 36.79  ? 199 TYR A CB    1 
ATOM   995  C  CG    . TYR A 1 123 ? 6.234   -1.787  -21.625 1.00 37.06  ? 199 TYR A CG    1 
ATOM   996  C  CD1   . TYR A 1 123 ? 5.711   -0.578  -22.063 1.00 30.93  ? 199 TYR A CD1   1 
ATOM   997  C  CD2   . TYR A 1 123 ? 6.975   -2.546  -22.518 1.00 37.50  ? 199 TYR A CD2   1 
ATOM   998  C  CE1   . TYR A 1 123 ? 5.928   -0.136  -23.361 1.00 39.64  ? 199 TYR A CE1   1 
ATOM   999  C  CE2   . TYR A 1 123 ? 7.202   -2.110  -23.817 1.00 39.34  ? 199 TYR A CE2   1 
ATOM   1000 C  CZ    . TYR A 1 123 ? 6.680   -0.908  -24.233 1.00 40.64  ? 199 TYR A CZ    1 
ATOM   1001 O  OH    . TYR A 1 123 ? 6.909   -0.484  -25.523 1.00 37.82  ? 199 TYR A OH    1 
ATOM   1002 N  N     . VAL A 1 124 ? 3.178   -3.442  -21.902 1.00 35.06  ? 200 VAL A N     1 
ATOM   1003 C  CA    . VAL A 1 124 ? 2.769   -4.333  -22.992 1.00 35.56  ? 200 VAL A CA    1 
ATOM   1004 C  C     . VAL A 1 124 ? 2.842   -3.650  -24.367 1.00 37.51  ? 200 VAL A C     1 
ATOM   1005 O  O     . VAL A 1 124 ? 2.120   -4.034  -25.302 1.00 34.78  ? 200 VAL A O     1 
ATOM   1006 C  CB    . VAL A 1 124 ? 1.348   -4.915  -22.765 1.00 39.17  ? 200 VAL A CB    1 
ATOM   1007 C  CG1   . VAL A 1 124 ? 1.281   -5.681  -21.433 1.00 30.09  ? 200 VAL A CG1   1 
ATOM   1008 C  CG2   . VAL A 1 124 ? 0.292   -3.817  -22.828 1.00 25.78  ? 200 VAL A CG2   1 
ATOM   1009 N  N     . GLY A 1 125 ? 3.718   -2.650  -24.489 1.00 34.71  ? 201 GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 125 ? 3.872   -1.911  -25.742 1.00 34.83  ? 201 GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 125 ? 4.738   -2.622  -26.781 1.00 37.31  ? 201 GLY A C     1 
ATOM   1012 O  O     . GLY A 1 125 ? 5.210   -3.741  -26.561 1.00 35.78  ? 201 GLY A O     1 
ATOM   1013 N  N     . GLY A 1 126 ? 4.937   -1.982  -27.930 1.00 36.15  ? 202 GLY A N     1 
ATOM   1014 C  CA    . GLY A 1 126 ? 5.877   -2.477  -28.921 1.00 32.63  ? 202 GLY A CA    1 
ATOM   1015 C  C     . GLY A 1 126 ? 5.304   -3.547  -29.827 1.00 37.30  ? 202 GLY A C     1 
ATOM   1016 O  O     . GLY A 1 126 ? 4.845   -3.246  -30.926 1.00 33.66  ? 202 GLY A O     1 
ATOM   1017 N  N     . ILE A 1 127 ? 5.329   -4.794  -29.354 1.00 30.01  ? 203 ILE A N     1 
ATOM   1018 C  CA    . ILE A 1 127 ? 4.826   -5.932  -30.104 1.00 29.17  ? 203 ILE A CA    1 
ATOM   1019 C  C     . ILE A 1 127 ? 4.054   -6.840  -29.143 1.00 35.10  ? 203 ILE A C     1 
ATOM   1020 O  O     . ILE A 1 127 ? 4.599   -7.326  -28.143 1.00 31.87  ? 203 ILE A O     1 
ATOM   1021 C  CB    . ILE A 1 127 ? 5.984   -6.757  -30.719 1.00 32.92  ? 203 ILE A CB    1 
ATOM   1022 C  CG1   . ILE A 1 127 ? 6.901   -5.878  -31.579 1.00 31.39  ? 203 ILE A CG1   1 
ATOM   1023 C  CG2   . ILE A 1 127 ? 5.450   -7.901  -31.535 1.00 26.88  ? 203 ILE A CG2   1 
ATOM   1024 C  CD1   . ILE A 1 127 ? 8.334   -6.381  -31.630 1.00 30.34  ? 203 ILE A CD1   1 
ATOM   1025 N  N     . LEU A 1 128 ? 2.785   -7.069  -29.448 1.00 33.21  ? 204 LEU A N     1 
ATOM   1026 C  CA    . LEU A 1 128 ? 1.906   -7.831  -28.569 1.00 29.32  ? 204 LEU A CA    1 
ATOM   1027 C  C     . LEU A 1 128 ? 0.985   -8.650  -29.444 1.00 34.35  ? 204 LEU A C     1 
ATOM   1028 O  O     . LEU A 1 128 ? 0.378   -8.104  -30.377 1.00 31.11  ? 204 LEU A O     1 
ATOM   1029 C  CB    . LEU A 1 128 ? 1.080   -6.873  -27.702 1.00 32.44  ? 204 LEU A CB    1 
ATOM   1030 C  CG    . LEU A 1 128 ? 0.101   -7.441  -26.675 1.00 29.90  ? 204 LEU A CG    1 
ATOM   1031 C  CD1   . LEU A 1 128 ? 0.798   -8.402  -25.741 1.00 30.20  ? 204 LEU A CD1   1 
ATOM   1032 C  CD2   . LEU A 1 128 ? -0.518  -6.301  -25.899 1.00 28.56  ? 204 LEU A CD2   1 
ATOM   1033 N  N     . LEU A 1 129 ? 0.877   -9.949  -29.144 1.00 29.37  ? 205 LEU A N     1 
ATOM   1034 C  CA    . LEU A 1 129 ? 0.105   -10.865 -29.972 1.00 31.39  ? 205 LEU A CA    1 
ATOM   1035 C  C     . LEU A 1 129 ? -1.140  -11.392 -29.250 1.00 36.90  ? 205 LEU A C     1 
ATOM   1036 O  O     . LEU A 1 129 ? -1.088  -11.752 -28.068 1.00 32.43  ? 205 LEU A O     1 
ATOM   1037 C  CB    . LEU A 1 129 ? 0.991   -12.045 -30.435 1.00 28.57  ? 205 LEU A CB    1 
ATOM   1038 C  CG    . LEU A 1 129 ? 1.944   -11.748 -31.607 1.00 37.39  ? 205 LEU A CG    1 
ATOM   1039 C  CD1   . LEU A 1 129 ? 3.059   -10.750 -31.261 1.00 31.62  ? 205 LEU A CD1   1 
ATOM   1040 C  CD2   . LEU A 1 129 ? 2.538   -13.024 -32.202 1.00 34.89  ? 205 LEU A CD2   1 
ATOM   1041 N  N     . LEU A 1 130 ? -2.257  -11.457 -29.967 1.00 33.16  ? 206 LEU A N     1 
ATOM   1042 C  CA    . LEU A 1 130 ? -3.450  -12.092 -29.425 1.00 35.87  ? 206 LEU A CA    1 
ATOM   1043 C  C     . LEU A 1 130 ? -4.218  -12.880 -30.476 1.00 35.03  ? 206 LEU A C     1 
ATOM   1044 O  O     . LEU A 1 130 ? -4.238  -12.513 -31.649 1.00 33.61  ? 206 LEU A O     1 
ATOM   1045 C  CB    . LEU A 1 130 ? -4.393  -11.064 -28.800 1.00 36.29  ? 206 LEU A CB    1 
ATOM   1046 C  CG    . LEU A 1 130 ? -3.937  -10.171 -27.646 1.00 33.52  ? 206 LEU A CG    1 
ATOM   1047 C  CD1   . LEU A 1 130 ? -3.199  -8.937  -28.191 1.00 26.80  ? 206 LEU A CD1   1 
ATOM   1048 C  CD2   . LEU A 1 130 ? -5.161  -9.790  -26.807 1.00 31.36  ? 206 LEU A CD2   1 
ATOM   1049 N  N     . SER A 1 131 ? -4.868  -13.958 -30.045 1.00 30.28  ? 207 SER A N     1 
ATOM   1050 C  CA    . SER A 1 131 ? -5.813  -14.644 -30.902 1.00 34.49  ? 207 SER A CA    1 
ATOM   1051 C  C     . SER A 1 131 ? -6.963  -13.693 -31.127 1.00 29.42  ? 207 SER A C     1 
ATOM   1052 O  O     . SER A 1 131 ? -7.235  -12.829 -30.286 1.00 34.91  ? 207 SER A O     1 
ATOM   1053 C  CB    . SER A 1 131 ? -6.343  -15.907 -30.216 1.00 33.73  ? 207 SER A CB    1 
ATOM   1054 O  OG    . SER A 1 131 ? -7.125  -15.544 -29.085 1.00 33.37  ? 207 SER A OG    1 
ATOM   1055 N  N     . LYS A 1 132 ? -7.668  -13.857 -32.239 1.00 36.09  ? 208 LYS A N     1 
ATOM   1056 C  CA    . LYS A 1 132 ? -8.845  -13.033 -32.464 1.00 30.68  ? 208 LYS A CA    1 
ATOM   1057 C  C     . LYS A 1 132 ? -9.841  -13.129 -31.308 1.00 35.80  ? 208 LYS A C     1 
ATOM   1058 O  O     . LYS A 1 132 ? -10.315 -12.101 -30.817 1.00 38.74  ? 208 LYS A O     1 
ATOM   1059 C  CB    . LYS A 1 132 ? -9.477  -13.300 -33.835 1.00 34.94  ? 208 LYS A CB    1 
ATOM   1060 C  CG    . LYS A 1 132 ? -8.676  -12.645 -34.977 1.00 44.28  ? 208 LYS A CG    1 
ATOM   1061 C  CD    . LYS A 1 132 ? -9.360  -12.739 -36.355 1.00 50.10  ? 208 LYS A CD    1 
ATOM   1062 C  CE    . LYS A 1 132 ? -10.477 -11.702 -36.525 1.00 59.06  ? 208 LYS A CE    1 
ATOM   1063 N  NZ    . LYS A 1 132 ? -10.920 -11.628 -37.958 1.00 66.97  ? 208 LYS A NZ    1 
ATOM   1064 N  N     . GLN A 1 133 ? -10.108 -14.345 -30.830 1.00 33.99  ? 209 GLN A N     1 
ATOM   1065 C  CA    . GLN A 1 133 ? -11.048 -14.503 -29.720 1.00 42.27  ? 209 GLN A CA    1 
ATOM   1066 C  C     . GLN A 1 133 ? -10.638 -13.712 -28.461 1.00 36.48  ? 209 GLN A C     1 
ATOM   1067 O  O     . GLN A 1 133 ? -11.456 -13.004 -27.870 1.00 38.35  ? 209 GLN A O     1 
ATOM   1068 C  CB    . GLN A 1 133 ? -11.327 -15.987 -29.404 1.00 40.89  ? 209 GLN A CB    1 
ATOM   1069 C  CG    . GLN A 1 133 ? -12.113 -16.214 -28.093 1.00 46.41  ? 209 GLN A CG    1 
ATOM   1070 C  CD    . GLN A 1 133 ? -13.518 -15.580 -28.081 1.00 61.04  ? 209 GLN A CD    1 
ATOM   1071 O  OE1   . GLN A 1 133 ? -13.933 -14.910 -29.038 1.00 63.83  ? 209 GLN A OE1   1 
ATOM   1072 N  NE2   . GLN A 1 133 ? -14.255 -15.799 -26.989 1.00 50.71  ? 209 GLN A NE2   1 
ATOM   1073 N  N     . HIS A 1 134 ? -9.367  -13.801 -28.077 1.00 33.98  ? 210 HIS A N     1 
ATOM   1074 C  CA    . HIS A 1 134 ? -8.881  -13.054 -26.926 1.00 34.48  ? 210 HIS A CA    1 
ATOM   1075 C  C     . HIS A 1 134 ? -8.928  -11.531 -27.090 1.00 43.35  ? 210 HIS A C     1 
ATOM   1076 O  O     . HIS A 1 134 ? -9.087  -10.819 -26.098 1.00 36.70  ? 210 HIS A O     1 
ATOM   1077 C  CB    . HIS A 1 134 ? -7.466  -13.487 -26.553 1.00 32.42  ? 210 HIS A CB    1 
ATOM   1078 C  CG    . HIS A 1 134 ? -7.402  -14.845 -25.934 1.00 38.94  ? 210 HIS A CG    1 
ATOM   1079 N  ND1   . HIS A 1 134 ? -6.226  -15.404 -25.481 1.00 36.25  ? 210 HIS A ND1   1 
ATOM   1080 C  CD2   . HIS A 1 134 ? -8.371  -15.761 -25.694 1.00 28.61  ? 210 HIS A CD2   1 
ATOM   1081 C  CE1   . HIS A 1 134 ? -6.470  -16.611 -25.003 1.00 33.54  ? 210 HIS A CE1   1 
ATOM   1082 N  NE2   . HIS A 1 134 ? -7.766  -16.847 -25.115 1.00 34.03  ? 210 HIS A NE2   1 
ATOM   1083 N  N     . TYR A 1 135 ? -8.751  -11.036 -28.317 1.00 35.81  ? 211 TYR A N     1 
ATOM   1084 C  CA    . TYR A 1 135 ? -8.800  -9.600  -28.556 1.00 38.42  ? 211 TYR A CA    1 
ATOM   1085 C  C     . TYR A 1 135 ? -10.243 -9.124  -28.416 1.00 37.11  ? 211 TYR A C     1 
ATOM   1086 O  O     . TYR A 1 135 ? -10.493 -8.093  -27.818 1.00 34.92  ? 211 TYR A O     1 
ATOM   1087 C  CB    . TYR A 1 135 ? -8.232  -9.250  -29.942 1.00 38.15  ? 211 TYR A CB    1 
ATOM   1088 C  CG    . TYR A 1 135 ? -8.034  -7.762  -30.221 1.00 36.30  ? 211 TYR A CG    1 
ATOM   1089 C  CD1   . TYR A 1 135 ? -6.867  -7.115  -29.846 1.00 34.00  ? 211 TYR A CD1   1 
ATOM   1090 C  CD2   . TYR A 1 135 ? -9.003  -7.020  -30.884 1.00 33.53  ? 211 TYR A CD2   1 
ATOM   1091 C  CE1   . TYR A 1 135 ? -6.680  -5.768  -30.097 1.00 32.87  ? 211 TYR A CE1   1 
ATOM   1092 C  CE2   . TYR A 1 135 ? -8.817  -5.682  -31.153 1.00 32.55  ? 211 TYR A CE2   1 
ATOM   1093 C  CZ    . TYR A 1 135 ? -7.655  -5.059  -30.758 1.00 35.88  ? 211 TYR A CZ    1 
ATOM   1094 O  OH    . TYR A 1 135 ? -7.468  -3.715  -31.021 1.00 35.76  ? 211 TYR A OH    1 
ATOM   1095 N  N     . ARG A 1 136 ? -11.188 -9.886  -28.958 1.00 38.23  ? 212 ARG A N     1 
ATOM   1096 C  CA    . ARG A 1 136 ? -12.603 -9.553  -28.821 1.00 43.03  ? 212 ARG A CA    1 
ATOM   1097 C  C     . ARG A 1 136 ? -13.081 -9.587  -27.358 1.00 42.74  ? 212 ARG A C     1 
ATOM   1098 O  O     . ARG A 1 136 ? -13.900 -8.775  -26.931 1.00 39.30  ? 212 ARG A O     1 
ATOM   1099 C  CB    . ARG A 1 136 ? -13.449 -10.497 -29.672 1.00 39.58  ? 212 ARG A CB    1 
ATOM   1100 C  CG    . ARG A 1 136 ? -13.200 -10.353 -31.157 1.00 47.29  ? 212 ARG A CG    1 
ATOM   1101 C  CD    . ARG A 1 136 ? -14.383 -10.873 -31.954 1.00 58.07  ? 212 ARG A CD    1 
ATOM   1102 N  NE    . ARG A 1 136 ? -14.178 -10.748 -33.392 1.00 58.07  ? 212 ARG A NE    1 
ATOM   1103 C  CZ    . ARG A 1 136 ? -13.845 -11.760 -34.184 1.00 60.56  ? 212 ARG A CZ    1 
ATOM   1104 N  NH1   . ARG A 1 136 ? -13.669 -11.562 -35.488 1.00 59.91  ? 212 ARG A NH1   1 
ATOM   1105 N  NH2   . ARG A 1 136 ? -13.693 -12.974 -33.667 1.00 61.45  ? 212 ARG A NH2   1 
ATOM   1106 N  N     . LEU A 1 137 ? -12.553 -10.537 -26.599 1.00 42.46  ? 213 LEU A N     1 
ATOM   1107 C  CA    . LEU A 1 137 ? -12.903 -10.704 -25.197 1.00 41.77  ? 213 LEU A CA    1 
ATOM   1108 C  C     . LEU A 1 137 ? -12.540 -9.463  -24.387 1.00 42.83  ? 213 LEU A C     1 
ATOM   1109 O  O     . LEU A 1 137 ? -13.124 -9.215  -23.344 1.00 43.16  ? 213 LEU A O     1 
ATOM   1110 C  CB    . LEU A 1 137 ? -12.138 -11.898 -24.643 1.00 32.98  ? 213 LEU A CB    1 
ATOM   1111 C  CG    . LEU A 1 137 ? -12.832 -13.070 -23.975 1.00 44.09  ? 213 LEU A CG    1 
ATOM   1112 C  CD1   . LEU A 1 137 ? -14.232 -13.338 -24.528 1.00 34.17  ? 213 LEU A CD1   1 
ATOM   1113 C  CD2   . LEU A 1 137 ? -11.909 -14.258 -24.181 1.00 27.16  ? 213 LEU A CD2   1 
ATOM   1114 N  N     . CYS A 1 138 ? -11.536 -8.720  -24.850 1.00 44.08  ? 214 CYS A N     1 
ATOM   1115 C  CA    . CYS A 1 138 ? -11.106 -7.475  -24.207 1.00 36.80  ? 214 CYS A CA    1 
ATOM   1116 C  C     . CYS A 1 138 ? -11.871 -6.298  -24.774 1.00 38.26  ? 214 CYS A C     1 
ATOM   1117 O  O     . CYS A 1 138 ? -11.718 -5.156  -24.313 1.00 44.68  ? 214 CYS A O     1 
ATOM   1118 C  CB    . CYS A 1 138 ? -9.627  -7.205  -24.499 1.00 44.86  ? 214 CYS A CB    1 
ATOM   1119 S  SG    . CYS A 1 138 ? -8.466  -8.383  -23.840 1.00 37.16  ? 214 CYS A SG    1 
ATOM   1120 N  N     . ASN A 1 139 ? -12.675 -6.569  -25.794 1.00 39.04  ? 215 ASN A N     1 
ATOM   1121 C  CA    . ASN A 1 139 ? -13.245 -5.504  -26.605 1.00 44.76  ? 215 ASN A CA    1 
ATOM   1122 C  C     . ASN A 1 139 ? -12.125 -4.623  -27.165 1.00 41.97  ? 215 ASN A C     1 
ATOM   1123 O  O     . ASN A 1 139 ? -12.230 -3.396  -27.184 1.00 41.95  ? 215 ASN A O     1 
ATOM   1124 C  CB    . ASN A 1 139 ? -14.267 -4.659  -25.820 1.00 35.60  ? 215 ASN A CB    1 
ATOM   1125 C  CG    . ASN A 1 139 ? -15.059 -3.730  -26.732 1.00 45.12  ? 215 ASN A CG    1 
ATOM   1126 O  OD1   . ASN A 1 139 ? -15.243 -4.037  -27.916 1.00 42.81  ? 215 ASN A OD1   1 
ATOM   1127 N  ND2   . ASN A 1 139 ? -15.504 -2.584  -26.202 1.00 38.57  ? 215 ASN A ND2   1 
ATOM   1128 N  N     . GLY A 1 140 ? -11.041 -5.261  -27.593 1.00 38.35  ? 216 GLY A N     1 
ATOM   1129 C  CA    . GLY A 1 140 ? -9.942  -4.551  -28.224 1.00 38.59  ? 216 GLY A CA    1 
ATOM   1130 C  C     . GLY A 1 140 ? -9.324  -3.493  -27.337 1.00 40.23  ? 216 GLY A C     1 
ATOM   1131 O  O     . GLY A 1 140 ? -9.399  -3.578  -26.112 1.00 35.55  ? 216 GLY A O     1 
ATOM   1132 N  N     . MET A 1 141 ? -8.721  -2.484  -27.953 1.00 35.14  ? 217 MET A N     1 
ATOM   1133 C  CA    . MET A 1 141 ? -8.097  -1.420  -27.184 1.00 37.97  ? 217 MET A CA    1 
ATOM   1134 C  C     . MET A 1 141 ? -9.018  -0.209  -27.030 1.00 39.07  ? 217 MET A C     1 
ATOM   1135 O  O     . MET A 1 141 ? -10.048 -0.102  -27.702 1.00 32.55  ? 217 MET A O     1 
ATOM   1136 C  CB    . MET A 1 141 ? -6.774  -1.012  -27.830 1.00 40.25  ? 217 MET A CB    1 
ATOM   1137 C  CG    . MET A 1 141 ? -5.827  -2.181  -27.993 1.00 34.16  ? 217 MET A CG    1 
ATOM   1138 S  SD    . MET A 1 141 ? -4.348  -1.721  -28.888 1.00 34.22  ? 217 MET A SD    1 
ATOM   1139 C  CE    . MET A 1 141 ? -3.193  -1.406  -27.561 1.00 23.09  ? 217 MET A CE    1 
ATOM   1140 N  N     . SER A 1 142 ? -8.645  0.694   -26.133 1.00 37.38  ? 218 SER A N     1 
ATOM   1141 C  CA    . SER A 1 142 ? -9.371  1.950   -25.984 1.00 39.74  ? 218 SER A CA    1 
ATOM   1142 C  C     . SER A 1 142 ? -9.183  2.807   -27.235 1.00 42.45  ? 218 SER A C     1 
ATOM   1143 O  O     . SER A 1 142 ? -8.162  2.708   -27.921 1.00 40.83  ? 218 SER A O     1 
ATOM   1144 C  CB    . SER A 1 142 ? -8.869  2.715   -24.757 1.00 36.37  ? 218 SER A CB    1 
ATOM   1145 O  OG    . SER A 1 142 ? -9.458  4.000   -24.663 1.00 40.23  ? 218 SER A OG    1 
ATOM   1146 N  N     . ASN A 1 143 ? -10.169 3.655   -27.514 1.00 43.21  ? 219 ASN A N     1 
ATOM   1147 C  CA    . ASN A 1 143 ? -10.074 4.645   -28.582 1.00 43.31  ? 219 ASN A CA    1 
ATOM   1148 C  C     . ASN A 1 143 ? -9.740  6.042   -28.073 1.00 41.79  ? 219 ASN A C     1 
ATOM   1149 O  O     . ASN A 1 143 ? -9.537  6.967   -28.859 1.00 49.13  ? 219 ASN A O     1 
ATOM   1150 C  CB    . ASN A 1 143 ? -11.377 4.664   -29.387 1.00 39.12  ? 219 ASN A CB    1 
ATOM   1151 C  CG    . ASN A 1 143 ? -11.690 3.307   -29.994 1.00 44.17  ? 219 ASN A CG    1 
ATOM   1152 O  OD1   . ASN A 1 143 ? -10.844 2.711   -30.655 1.00 42.03  ? 219 ASN A OD1   1 
ATOM   1153 N  ND2   . ASN A 1 143 ? -12.895 2.802   -29.752 1.00 45.38  ? 219 ASN A ND2   1 
ATOM   1154 N  N     . ARG A 1 144 ? -9.643  6.186   -26.757 1.00 46.57  ? 220 ARG A N     1 
ATOM   1155 C  CA    . ARG A 1 144 ? -9.592  7.507   -26.135 1.00 48.33  ? 220 ARG A CA    1 
ATOM   1156 C  C     . ARG A 1 144 ? -8.188  8.107   -26.002 1.00 46.29  ? 220 ARG A C     1 
ATOM   1157 O  O     . ARG A 1 144 ? -8.034  9.192   -25.432 1.00 40.93  ? 220 ARG A O     1 
ATOM   1158 C  CB    . ARG A 1 144 ? -10.264 7.457   -24.752 1.00 47.48  ? 220 ARG A CB    1 
ATOM   1159 C  CG    . ARG A 1 144 ? -11.691 6.924   -24.773 1.00 59.70  ? 220 ARG A CG    1 
ATOM   1160 C  CD    . ARG A 1 144 ? -12.310 6.914   -23.375 1.00 62.91  ? 220 ARG A CD    1 
ATOM   1161 N  NE    . ARG A 1 144 ? -12.327 8.254   -22.790 1.00 76.62  ? 220 ARG A NE    1 
ATOM   1162 C  CZ    . ARG A 1 144 ? -13.225 9.194   -23.087 1.00 76.71  ? 220 ARG A CZ    1 
ATOM   1163 N  NH1   . ARG A 1 144 ? -14.189 8.950   -23.968 1.00 70.32  ? 220 ARG A NH1   1 
ATOM   1164 N  NH2   . ARG A 1 144 ? -13.154 10.384  -22.508 1.00 77.01  ? 220 ARG A NH2   1 
ATOM   1165 N  N     . PHE A 1 145 ? -7.171  7.419   -26.519 1.00 42.45  ? 221 PHE A N     1 
ATOM   1166 C  CA    . PHE A 1 145 ? -5.789  7.859   -26.311 1.00 34.33  ? 221 PHE A CA    1 
ATOM   1167 C  C     . PHE A 1 145 ? -5.193  8.495   -27.559 1.00 39.22  ? 221 PHE A C     1 
ATOM   1168 O  O     . PHE A 1 145 ? -4.814  7.800   -28.486 1.00 40.60  ? 221 PHE A O     1 
ATOM   1169 C  CB    . PHE A 1 145 ? -4.912  6.697   -25.817 1.00 38.27  ? 221 PHE A CB    1 
ATOM   1170 C  CG    . PHE A 1 145 ? -5.301  6.184   -24.456 1.00 40.73  ? 221 PHE A CG    1 
ATOM   1171 C  CD1   . PHE A 1 145 ? -6.287  5.217   -24.319 1.00 41.81  ? 221 PHE A CD1   1 
ATOM   1172 C  CD2   . PHE A 1 145 ? -4.699  6.685   -23.311 1.00 40.89  ? 221 PHE A CD2   1 
ATOM   1173 C  CE1   . PHE A 1 145 ? -6.665  4.753   -23.055 1.00 46.43  ? 221 PHE A CE1   1 
ATOM   1174 C  CE2   . PHE A 1 145 ? -5.066  6.227   -22.052 1.00 44.14  ? 221 PHE A CE2   1 
ATOM   1175 C  CZ    . PHE A 1 145 ? -6.053  5.260   -21.922 1.00 41.97  ? 221 PHE A CZ    1 
ATOM   1176 N  N     . TRP A 1 146 ? -5.116  9.823   -27.581 1.00 46.13  ? 222 TRP A N     1 
ATOM   1177 C  CA    . TRP A 1 146 ? -4.537  10.537  -28.714 1.00 40.13  ? 222 TRP A CA    1 
ATOM   1178 C  C     . TRP A 1 146 ? -3.179  11.105  -28.313 1.00 42.47  ? 222 TRP A C     1 
ATOM   1179 O  O     . TRP A 1 146 ? -3.065  11.764  -27.289 1.00 42.05  ? 222 TRP A O     1 
ATOM   1180 C  CB    . TRP A 1 146 ? -5.465  11.660  -29.164 1.00 45.68  ? 222 TRP A CB    1 
ATOM   1181 C  CG    . TRP A 1 146 ? -6.882  11.225  -29.445 1.00 44.39  ? 222 TRP A CG    1 
ATOM   1182 C  CD1   . TRP A 1 146 ? -7.893  11.078  -28.534 1.00 42.47  ? 222 TRP A CD1   1 
ATOM   1183 C  CD2   . TRP A 1 146 ? -7.447  10.904  -30.724 1.00 35.90  ? 222 TRP A CD2   1 
ATOM   1184 N  NE1   . TRP A 1 146 ? -9.048  10.688  -29.167 1.00 39.44  ? 222 TRP A NE1   1 
ATOM   1185 C  CE2   . TRP A 1 146 ? -8.802  10.569  -30.509 1.00 36.62  ? 222 TRP A CE2   1 
ATOM   1186 C  CE3   . TRP A 1 146 ? -6.939  10.861  -32.025 1.00 40.46  ? 222 TRP A CE3   1 
ATOM   1187 C  CZ2   . TRP A 1 146 ? -9.652  10.200  -31.548 1.00 33.23  ? 222 TRP A CZ2   1 
ATOM   1188 C  CZ3   . TRP A 1 146 ? -7.789  10.493  -33.058 1.00 39.38  ? 222 TRP A CZ3   1 
ATOM   1189 C  CH2   . TRP A 1 146 ? -9.127  10.165  -32.813 1.00 32.93  ? 222 TRP A CH2   1 
ATOM   1190 N  N     . GLY A 1 147 ? -2.147  10.850  -29.115 1.00 40.31  ? 223 GLY A N     1 
ATOM   1191 C  CA    . GLY A 1 147 ? -0.793  11.213  -28.730 1.00 35.70  ? 223 GLY A CA    1 
ATOM   1192 C  C     . GLY A 1 147 ? -0.122  10.056  -28.001 1.00 38.94  ? 223 GLY A C     1 
ATOM   1193 O  O     . GLY A 1 147 ? -0.765  9.059   -27.687 1.00 36.75  ? 223 GLY A O     1 
ATOM   1194 N  N     . TRP A 1 148 ? 1.171   10.196  -27.727 1.00 38.49  ? 224 TRP A N     1 
ATOM   1195 C  CA    . TRP A 1 148 ? 1.962   9.144   -27.107 1.00 37.01  ? 224 TRP A CA    1 
ATOM   1196 C  C     . TRP A 1 148 ? 1.510   8.881   -25.668 1.00 45.58  ? 224 TRP A C     1 
ATOM   1197 O  O     . TRP A 1 148 ? 1.159   9.815   -24.948 1.00 38.02  ? 224 TRP A O     1 
ATOM   1198 C  CB    . TRP A 1 148 ? 3.430   9.566   -27.120 1.00 46.17  ? 224 TRP A CB    1 
ATOM   1199 C  CG    . TRP A 1 148 ? 4.392   8.553   -26.560 1.00 36.23  ? 224 TRP A CG    1 
ATOM   1200 C  CD1   . TRP A 1 148 ? 5.163   7.682   -27.270 1.00 35.93  ? 224 TRP A CD1   1 
ATOM   1201 C  CD2   . TRP A 1 148 ? 4.705   8.337   -25.179 1.00 35.49  ? 224 TRP A CD2   1 
ATOM   1202 N  NE1   . TRP A 1 148 ? 5.930   6.920   -26.413 1.00 43.51  ? 224 TRP A NE1   1 
ATOM   1203 C  CE2   . TRP A 1 148 ? 5.665   7.302   -25.126 1.00 34.46  ? 224 TRP A CE2   1 
ATOM   1204 C  CE3   . TRP A 1 148 ? 4.261   8.910   -23.980 1.00 40.52  ? 224 TRP A CE3   1 
ATOM   1205 C  CZ2   . TRP A 1 148 ? 6.189   6.835   -23.925 1.00 39.17  ? 224 TRP A CZ2   1 
ATOM   1206 C  CZ3   . TRP A 1 148 ? 4.777   8.435   -22.785 1.00 35.57  ? 224 TRP A CZ3   1 
ATOM   1207 C  CH2   . TRP A 1 148 ? 5.726   7.407   -22.763 1.00 37.93  ? 224 TRP A CH2   1 
ATOM   1208 N  N     . GLY A 1 149 ? 1.502   7.609   -25.261 1.00 39.43  ? 225 GLY A N     1 
ATOM   1209 C  CA    . GLY A 1 149 ? 1.312   7.242   -23.866 1.00 28.10  ? 225 GLY A CA    1 
ATOM   1210 C  C     . GLY A 1 149 ? 0.014   6.551   -23.460 1.00 42.69  ? 225 GLY A C     1 
ATOM   1211 O  O     . GLY A 1 149 ? -1.068  6.871   -23.967 1.00 39.94  ? 225 GLY A O     1 
ATOM   1212 N  N     . ARG A 1 150 ? 0.144   5.580   -22.551 1.00 44.60  ? 226 ARG A N     1 
ATOM   1213 C  CA    . ARG A 1 150 ? -0.968  5.062   -21.737 1.00 43.74  ? 226 ARG A CA    1 
ATOM   1214 C  C     . ARG A 1 150 ? -2.010  4.155   -22.417 1.00 38.98  ? 226 ARG A C     1 
ATOM   1215 O  O     . ARG A 1 150 ? -2.880  3.614   -21.737 1.00 44.94  ? 226 ARG A O     1 
ATOM   1216 C  CB    . ARG A 1 150 ? -1.691  6.214   -21.001 1.00 42.71  ? 226 ARG A CB    1 
ATOM   1217 C  CG    . ARG A 1 150 ? -0.858  6.935   -19.955 1.00 51.21  ? 226 ARG A CG    1 
ATOM   1218 C  CD    . ARG A 1 150 ? -0.366  6.008   -18.822 1.00 70.83  ? 226 ARG A CD    1 
ATOM   1219 N  NE    . ARG A 1 150 ? -1.406  5.129   -18.268 1.00 70.33  ? 226 ARG A NE    1 
ATOM   1220 C  CZ    . ARG A 1 150 ? -1.288  4.436   -17.133 1.00 71.00  ? 226 ARG A CZ    1 
ATOM   1221 N  NH1   . ARG A 1 150 ? -0.181  4.522   -16.403 1.00 69.75  ? 226 ARG A NH1   1 
ATOM   1222 N  NH2   . ARG A 1 150 ? -2.282  3.656   -16.717 1.00 70.28  ? 226 ARG A NH2   1 
ATOM   1223 N  N     . GLU A 1 151 ? -1.955  3.999   -23.735 1.00 36.22  ? 227 GLU A N     1 
ATOM   1224 C  CA    . GLU A 1 151 ? -2.941  3.169   -24.423 1.00 32.04  ? 227 GLU A CA    1 
ATOM   1225 C  C     . GLU A 1 151 ? -2.627  1.693   -24.150 1.00 39.51  ? 227 GLU A C     1 
ATOM   1226 O  O     . GLU A 1 151 ? -3.530  0.849   -24.099 1.00 31.28  ? 227 GLU A O     1 
ATOM   1227 C  CB    . GLU A 1 151 ? -2.976  3.467   -25.938 1.00 32.47  ? 227 GLU A CB    1 
ATOM   1228 C  CG    . GLU A 1 151 ? -1.954  2.696   -26.825 1.00 31.25  ? 227 GLU A CG    1 
ATOM   1229 C  CD    . GLU A 1 151 ? -0.508  3.106   -26.590 1.00 39.33  ? 227 GLU A CD    1 
ATOM   1230 O  OE1   . GLU A 1 151 ? -0.286  4.143   -25.921 1.00 34.71  ? 227 GLU A OE1   1 
ATOM   1231 O  OE2   . GLU A 1 151 ? 0.414   2.400   -27.086 1.00 31.91  ? 227 GLU A OE2   1 
ATOM   1232 N  N     . ASP A 1 152 ? -1.340  1.410   -23.951 1.00 35.10  ? 228 ASP A N     1 
ATOM   1233 C  CA    . ASP A 1 152 ? -0.865  0.062   -23.668 1.00 37.40  ? 228 ASP A CA    1 
ATOM   1234 C  C     . ASP A 1 152 ? -1.095  -0.324  -22.206 1.00 36.56  ? 228 ASP A C     1 
ATOM   1235 O  O     . ASP A 1 152 ? -1.589  -1.421  -21.910 1.00 36.10  ? 228 ASP A O     1 
ATOM   1236 C  CB    . ASP A 1 152 ? 0.616   -0.112  -24.086 1.00 34.53  ? 228 ASP A CB    1 
ATOM   1237 C  CG    . ASP A 1 152 ? 1.517   1.022   -23.600 1.00 41.12  ? 228 ASP A CG    1 
ATOM   1238 O  OD1   . ASP A 1 152 ? 1.062   1.905   -22.823 1.00 37.77  ? 228 ASP A OD1   1 
ATOM   1239 O  OD2   . ASP A 1 152 ? 2.703   1.025   -24.000 1.00 37.39  ? 228 ASP A OD2   1 
ATOM   1240 N  N     . ASP A 1 153 ? -0.750  0.588   -21.301 1.00 37.50  ? 229 ASP A N     1 
ATOM   1241 C  CA    . ASP A 1 153 ? -1.047  0.431   -19.879 1.00 39.62  ? 229 ASP A CA    1 
ATOM   1242 C  C     . ASP A 1 153 ? -2.528  0.149   -19.681 1.00 36.74  ? 229 ASP A C     1 
ATOM   1243 O  O     . ASP A 1 153 ? -2.903  -0.713  -18.893 1.00 44.77  ? 229 ASP A O     1 
ATOM   1244 C  CB    . ASP A 1 153 ? -0.669  1.695   -19.103 1.00 43.77  ? 229 ASP A CB    1 
ATOM   1245 C  CG    . ASP A 1 153 ? 0.819   1.972   -19.121 1.00 48.19  ? 229 ASP A CG    1 
ATOM   1246 O  OD1   . ASP A 1 153 ? 1.608   1.012   -19.244 1.00 44.56  ? 229 ASP A OD1   1 
ATOM   1247 O  OD2   . ASP A 1 153 ? 1.204   3.162   -19.013 1.00 56.54  ? 229 ASP A OD2   1 
ATOM   1248 N  N     . GLU A 1 154 ? -3.377  0.863   -20.406 1.00 33.61  ? 230 GLU A N     1 
ATOM   1249 C  CA    . GLU A 1 154 ? -4.805  0.608   -20.291 1.00 39.87  ? 230 GLU A CA    1 
ATOM   1250 C  C     . GLU A 1 154 ? -5.197  -0.779  -20.829 1.00 37.30  ? 230 GLU A C     1 
ATOM   1251 O  O     . GLU A 1 154 ? -6.005  -1.483  -20.216 1.00 33.87  ? 230 GLU A O     1 
ATOM   1252 C  CB    . GLU A 1 154 ? -5.624  1.722   -20.947 1.00 38.96  ? 230 GLU A CB    1 
ATOM   1253 C  CG    . GLU A 1 154 ? -7.087  1.795   -20.492 1.00 36.04  ? 230 GLU A CG    1 
ATOM   1254 C  CD    . GLU A 1 154 ? -8.022  1.067   -21.438 1.00 41.31  ? 230 GLU A CD    1 
ATOM   1255 O  OE1   . GLU A 1 154 ? -9.255  1.169   -21.279 1.00 47.69  ? 230 GLU A OE1   1 
ATOM   1256 O  OE2   . GLU A 1 154 ? -7.519  0.386   -22.355 1.00 44.75  ? 230 GLU A OE2   1 
ATOM   1257 N  N     . PHE A 1 155 ? -4.621  -1.180  -21.961 1.00 34.58  ? 231 PHE A N     1 
ATOM   1258 C  CA    . PHE A 1 155 ? -4.959  -2.472  -22.558 1.00 31.77  ? 231 PHE A CA    1 
ATOM   1259 C  C     . PHE A 1 155 ? -4.542  -3.616  -21.648 1.00 33.28  ? 231 PHE A C     1 
ATOM   1260 O  O     . PHE A 1 155 ? -5.232  -4.634  -21.571 1.00 38.04  ? 231 PHE A O     1 
ATOM   1261 C  CB    . PHE A 1 155 ? -4.292  -2.637  -23.917 1.00 34.30  ? 231 PHE A CB    1 
ATOM   1262 C  CG    . PHE A 1 155 ? -4.756  -3.842  -24.669 1.00 33.99  ? 231 PHE A CG    1 
ATOM   1263 C  CD1   . PHE A 1 155 ? -6.098  -4.007  -24.980 1.00 37.17  ? 231 PHE A CD1   1 
ATOM   1264 C  CD2   . PHE A 1 155 ? -3.856  -4.799  -25.093 1.00 33.50  ? 231 PHE A CD2   1 
ATOM   1265 C  CE1   . PHE A 1 155 ? -6.529  -5.104  -25.697 1.00 32.08  ? 231 PHE A CE1   1 
ATOM   1266 C  CE2   . PHE A 1 155 ? -4.283  -5.900  -25.817 1.00 35.88  ? 231 PHE A CE2   1 
ATOM   1267 C  CZ    . PHE A 1 155 ? -5.619  -6.049  -26.121 1.00 33.47  ? 231 PHE A CZ    1 
ATOM   1268 N  N     . TYR A 1 156 ? -3.408  -3.436  -20.970 1.00 36.21  ? 232 TYR A N     1 
ATOM   1269 C  CA    . TYR A 1 156 ? -2.976  -4.354  -19.932 1.00 36.50  ? 232 TYR A CA    1 
ATOM   1270 C  C     . TYR A 1 156 ? -4.091  -4.606  -18.947 1.00 39.54  ? 232 TYR A C     1 
ATOM   1271 O  O     . TYR A 1 156 ? -4.345  -5.762  -18.584 1.00 38.83  ? 232 TYR A O     1 
ATOM   1272 C  CB    . TYR A 1 156 ? -1.751  -3.842  -19.170 1.00 38.14  ? 232 TYR A CB    1 
ATOM   1273 C  CG    . TYR A 1 156 ? -1.354  -4.781  -18.050 1.00 38.55  ? 232 TYR A CG    1 
ATOM   1274 C  CD1   . TYR A 1 156 ? -0.605  -5.913  -18.306 1.00 41.31  ? 232 TYR A CD1   1 
ATOM   1275 C  CD2   . TYR A 1 156 ? -1.740  -4.540  -16.738 1.00 48.82  ? 232 TYR A CD2   1 
ATOM   1276 C  CE1   . TYR A 1 156 ? -0.245  -6.786  -17.289 1.00 43.88  ? 232 TYR A CE1   1 
ATOM   1277 C  CE2   . TYR A 1 156 ? -1.384  -5.404  -15.712 1.00 47.97  ? 232 TYR A CE2   1 
ATOM   1278 C  CZ    . TYR A 1 156 ? -0.638  -6.530  -15.995 1.00 45.59  ? 232 TYR A CZ    1 
ATOM   1279 O  OH    . TYR A 1 156 ? -0.281  -7.394  -14.981 1.00 41.26  ? 232 TYR A OH    1 
ATOM   1280 N  N     . ARG A 1 157 ? -4.762  -3.530  -18.526 1.00 42.25  ? 233 ARG A N     1 
ATOM   1281 C  CA    . ARG A 1 157 ? -5.846  -3.638  -17.549 1.00 37.95  ? 233 ARG A CA    1 
ATOM   1282 C  C     . ARG A 1 157 ? -7.041  -4.356  -18.152 1.00 37.77  ? 233 ARG A C     1 
ATOM   1283 O  O     . ARG A 1 157 ? -7.736  -5.093  -17.459 1.00 39.60  ? 233 ARG A O     1 
ATOM   1284 C  CB    . ARG A 1 157 ? -6.263  -2.270  -16.998 1.00 40.45  ? 233 ARG A CB    1 
ATOM   1285 C  CG    . ARG A 1 157 ? -5.323  -1.717  -15.936 1.00 54.17  ? 233 ARG A CG    1 
ATOM   1286 C  CD    . ARG A 1 157 ? -5.813  -0.366  -15.374 1.00 69.07  ? 233 ARG A CD    1 
ATOM   1287 N  NE    . ARG A 1 157 ? -5.338  0.788   -16.147 1.00 79.91  ? 233 ARG A NE    1 
ATOM   1288 C  CZ    . ARG A 1 157 ? -6.127  1.678   -16.755 1.00 78.11  ? 233 ARG A CZ    1 
ATOM   1289 N  NH1   . ARG A 1 157 ? -7.452  1.558   -16.686 1.00 73.89  ? 233 ARG A NH1   1 
ATOM   1290 N  NH2   . ARG A 1 157 ? -5.589  2.694   -17.429 1.00 65.70  ? 233 ARG A NH2   1 
ATOM   1291 N  N     . ARG A 1 158 ? -7.285  -4.147  -19.442 1.00 28.94  ? 234 ARG A N     1 
ATOM   1292 C  CA    . ARG A 1 158 ? -8.332  -4.911  -20.114 1.00 33.58  ? 234 ARG A CA    1 
ATOM   1293 C  C     . ARG A 1 158 ? -8.026  -6.422  -20.126 1.00 36.31  ? 234 ARG A C     1 
ATOM   1294 O  O     . ARG A 1 158 ? -8.939  -7.240  -20.066 1.00 36.31  ? 234 ARG A O     1 
ATOM   1295 C  CB    . ARG A 1 158 ? -8.513  -4.426  -21.553 1.00 28.24  ? 234 ARG A CB    1 
ATOM   1296 C  CG    . ARG A 1 158 ? -9.098  -3.064  -21.653 1.00 35.86  ? 234 ARG A CG    1 
ATOM   1297 C  CD    . ARG A 1 158 ? -9.343  -2.621  -23.093 1.00 34.38  ? 234 ARG A CD    1 
ATOM   1298 N  NE    . ARG A 1 158 ? -9.886  -1.271  -23.083 1.00 36.73  ? 234 ARG A NE    1 
ATOM   1299 C  CZ    . ARG A 1 158 ? -10.919 -0.861  -23.807 1.00 38.86  ? 234 ARG A CZ    1 
ATOM   1300 N  NH1   . ARG A 1 158 ? -11.510 -1.689  -24.652 1.00 33.58  ? 234 ARG A NH1   1 
ATOM   1301 N  NH2   . ARG A 1 158 ? -11.352 0.391   -23.687 1.00 38.91  ? 234 ARG A NH2   1 
ATOM   1302 N  N     . ILE A 1 159 ? -6.746  -6.775  -20.237 1.00 33.25  ? 235 ILE A N     1 
ATOM   1303 C  CA    . ILE A 1 159 ? -6.330  -8.170  -20.346 1.00 34.90  ? 235 ILE A CA    1 
ATOM   1304 C  C     . ILE A 1 159 ? -6.496  -8.850  -18.990 1.00 37.33  ? 235 ILE A C     1 
ATOM   1305 O  O     . ILE A 1 159 ? -7.092  -9.923  -18.880 1.00 36.76  ? 235 ILE A O     1 
ATOM   1306 C  CB    . ILE A 1 159 ? -4.860  -8.287  -20.821 1.00 27.71  ? 235 ILE A CB    1 
ATOM   1307 C  CG1   . ILE A 1 159 ? -4.725  -7.814  -22.270 1.00 38.53  ? 235 ILE A CG1   1 
ATOM   1308 C  CG2   . ILE A 1 159 ? -4.367  -9.711  -20.708 1.00 32.21  ? 235 ILE A CG2   1 
ATOM   1309 C  CD1   . ILE A 1 159 ? -3.311  -7.892  -22.809 1.00 35.96  ? 235 ILE A CD1   1 
ATOM   1310 N  N     . LYS A 1 160 ? -5.967  -8.187  -17.968 1.00 41.85  ? 236 LYS A N     1 
ATOM   1311 C  CA    . LYS A 1 160 ? -6.088  -8.598  -16.580 1.00 37.22  ? 236 LYS A CA    1 
ATOM   1312 C  C     . LYS A 1 160 ? -7.557  -8.679  -16.144 1.00 45.67  ? 236 LYS A C     1 
ATOM   1313 O  O     . LYS A 1 160 ? -7.989  -9.690  -15.560 1.00 42.30  ? 236 LYS A O     1 
ATOM   1314 C  CB    . LYS A 1 160 ? -5.294  -7.623  -15.706 1.00 39.04  ? 236 LYS A CB    1 
ATOM   1315 C  CG    . LYS A 1 160 ? -5.140  -8.029  -14.248 1.00 60.64  ? 236 LYS A CG    1 
ATOM   1316 C  CD    . LYS A 1 160 ? -3.719  -7.760  -13.731 1.00 62.66  ? 236 LYS A CD    1 
ATOM   1317 C  CE    . LYS A 1 160 ? -3.707  -6.795  -12.543 1.00 54.00  ? 236 LYS A CE    1 
ATOM   1318 N  NZ    . LYS A 1 160 ? -4.001  -5.378  -12.930 1.00 59.99  ? 236 LYS A NZ    1 
ATOM   1319 N  N     . GLY A 1 161 ? -8.331  -7.634  -16.443 1.00 36.86  ? 237 GLY A N     1 
ATOM   1320 C  CA    . GLY A 1 161 ? -9.742  -7.611  -16.085 1.00 36.09  ? 237 GLY A CA    1 
ATOM   1321 C  C     . GLY A 1 161 ? -10.571 -8.716  -16.722 1.00 34.61  ? 237 GLY A C     1 
ATOM   1322 O  O     . GLY A 1 161 ? -11.580 -9.176  -16.182 1.00 38.30  ? 237 GLY A O     1 
ATOM   1323 N  N     . ALA A 1 162 ? -10.141 -9.146  -17.893 1.00 41.60  ? 238 ALA A N     1 
ATOM   1324 C  CA    . ALA A 1 162 ? -10.841 -10.181 -18.634 1.00 33.28  ? 238 ALA A CA    1 
ATOM   1325 C  C     . ALA A 1 162 ? -10.441 -11.561 -18.123 1.00 32.54  ? 238 ALA A C     1 
ATOM   1326 O  O     . ALA A 1 162 ? -11.011 -12.567 -18.541 1.00 36.38  ? 238 ALA A O     1 
ATOM   1327 C  CB    . ALA A 1 162 ? -10.509 -10.056 -20.113 1.00 29.20  ? 238 ALA A CB    1 
ATOM   1328 N  N     . GLY A 1 163 ? -9.432  -11.601 -17.253 1.00 34.85  ? 239 GLY A N     1 
ATOM   1329 C  CA    . GLY A 1 163 ? -8.911  -12.850 -16.713 1.00 36.49  ? 239 GLY A CA    1 
ATOM   1330 C  C     . GLY A 1 163 ? -7.992  -13.617 -17.661 1.00 43.83  ? 239 GLY A C     1 
ATOM   1331 O  O     . GLY A 1 163 ? -7.806  -14.839 -17.529 1.00 39.41  ? 239 GLY A O     1 
ATOM   1332 N  N     . LEU A 1 164 ? -7.419  -12.900 -18.624 1.00 37.08  ? 240 LEU A N     1 
ATOM   1333 C  CA    . LEU A 1 164 ? -6.500  -13.490 -19.579 1.00 32.45  ? 240 LEU A CA    1 
ATOM   1334 C  C     . LEU A 1 164 ? -5.085  -13.484 -19.016 1.00 33.27  ? 240 LEU A C     1 
ATOM   1335 O  O     . LEU A 1 164 ? -4.666  -12.509 -18.397 1.00 36.58  ? 240 LEU A O     1 
ATOM   1336 C  CB    . LEU A 1 164 ? -6.542  -12.713 -20.890 1.00 35.68  ? 240 LEU A CB    1 
ATOM   1337 C  CG    . LEU A 1 164 ? -7.848  -12.719 -21.687 1.00 30.71  ? 240 LEU A CG    1 
ATOM   1338 C  CD1   . LEU A 1 164 ? -7.690  -11.817 -22.898 1.00 30.34  ? 240 LEU A CD1   1 
ATOM   1339 C  CD2   . LEU A 1 164 ? -8.260  -14.105 -22.116 1.00 31.41  ? 240 LEU A CD2   1 
ATOM   1340 N  N     . GLN A 1 165 ? -4.348  -14.574 -19.216 1.00 31.78  ? 241 GLN A N     1 
ATOM   1341 C  CA    . GLN A 1 165 ? -2.974  -14.645 -18.716 1.00 35.67  ? 241 GLN A CA    1 
ATOM   1342 C  C     . GLN A 1 165 ? -2.011  -14.086 -19.758 1.00 29.60  ? 241 GLN A C     1 
ATOM   1343 O  O     . GLN A 1 165 ? -2.132  -14.381 -20.936 1.00 37.86  ? 241 GLN A O     1 
ATOM   1344 C  CB    . GLN A 1 165 ? -2.577  -16.083 -18.335 1.00 35.21  ? 241 GLN A CB    1 
ATOM   1345 C  CG    . GLN A 1 165 ? -1.183  -16.184 -17.693 1.00 32.10  ? 241 GLN A CG    1 
ATOM   1346 C  CD    . GLN A 1 165 ? -0.799  -17.611 -17.308 1.00 40.44  ? 241 GLN A CD    1 
ATOM   1347 O  OE1   . GLN A 1 165 ? -1.631  -18.514 -17.324 1.00 34.85  ? 241 GLN A OE1   1 
ATOM   1348 N  NE2   . GLN A 1 165 ? 0.474   -17.816 -16.973 1.00 38.24  ? 241 GLN A NE2   1 
ATOM   1349 N  N     . LEU A 1 166 ? -1.057  -13.278 -19.316 1.00 36.83  ? 242 LEU A N     1 
ATOM   1350 C  CA    . LEU A 1 166 ? -0.104  -12.655 -20.222 1.00 36.77  ? 242 LEU A CA    1 
ATOM   1351 C  C     . LEU A 1 166 ? 1.182   -13.456 -20.215 1.00 36.36  ? 242 LEU A C     1 
ATOM   1352 O  O     . LEU A 1 166 ? 1.708   -13.792 -19.157 1.00 36.03  ? 242 LEU A O     1 
ATOM   1353 C  CB    . LEU A 1 166 ? 0.167   -11.205 -19.800 1.00 38.63  ? 242 LEU A CB    1 
ATOM   1354 C  CG    . LEU A 1 166 ? 1.233   -10.409 -20.558 1.00 32.98  ? 242 LEU A CG    1 
ATOM   1355 C  CD1   . LEU A 1 166 ? 0.772   -10.119 -21.953 1.00 31.50  ? 242 LEU A CD1   1 
ATOM   1356 C  CD2   . LEU A 1 166 ? 1.520   -9.114  -19.816 1.00 36.17  ? 242 LEU A CD2   1 
ATOM   1357 N  N     . PHE A 1 167 ? 1.676   -13.769 -21.406 1.00 38.35  ? 243 PHE A N     1 
ATOM   1358 C  CA    . PHE A 1 167 ? 2.912   -14.523 -21.549 1.00 38.62  ? 243 PHE A CA    1 
ATOM   1359 C  C     . PHE A 1 167 ? 4.014   -13.681 -22.166 1.00 32.18  ? 243 PHE A C     1 
ATOM   1360 O  O     . PHE A 1 167 ? 3.755   -12.817 -22.997 1.00 33.59  ? 243 PHE A O     1 
ATOM   1361 C  CB    . PHE A 1 167 ? 2.672   -15.806 -22.368 1.00 32.93  ? 243 PHE A CB    1 
ATOM   1362 C  CG    . PHE A 1 167 ? 1.782   -16.786 -21.671 1.00 30.41  ? 243 PHE A CG    1 
ATOM   1363 C  CD1   . PHE A 1 167 ? 0.410   -16.728 -21.832 1.00 28.71  ? 243 PHE A CD1   1 
ATOM   1364 C  CD2   . PHE A 1 167 ? 2.318   -17.744 -20.824 1.00 32.46  ? 243 PHE A CD2   1 
ATOM   1365 C  CE1   . PHE A 1 167 ? -0.427  -17.625 -21.161 1.00 33.25  ? 243 PHE A CE1   1 
ATOM   1366 C  CE2   . PHE A 1 167 ? 1.493   -18.648 -20.151 1.00 27.91  ? 243 PHE A CE2   1 
ATOM   1367 C  CZ    . PHE A 1 167 ? 0.118   -18.586 -20.328 1.00 30.04  ? 243 PHE A CZ    1 
ATOM   1368 N  N     . ARG A 1 168 ? 5.241   -13.960 -21.737 1.00 36.71  ? 244 ARG A N     1 
ATOM   1369 C  CA    . ARG A 1 168 ? 6.438   -13.336 -22.267 1.00 31.77  ? 244 ARG A CA    1 
ATOM   1370 C  C     . ARG A 1 168 ? 7.520   -14.357 -22.629 1.00 42.40  ? 244 ARG A C     1 
ATOM   1371 O  O     . ARG A 1 168 ? 7.517   -15.470 -22.108 1.00 41.00  ? 244 ARG A O     1 
ATOM   1372 C  CB    . ARG A 1 168 ? 6.962   -12.337 -21.248 1.00 39.61  ? 244 ARG A CB    1 
ATOM   1373 C  CG    . ARG A 1 168 ? 6.329   -10.970 -21.416 1.00 40.06  ? 244 ARG A CG    1 
ATOM   1374 C  CD    . ARG A 1 168 ? 6.170   -10.306 -20.107 1.00 37.39  ? 244 ARG A CD    1 
ATOM   1375 N  NE    . ARG A 1 168 ? 5.684   -8.948  -20.264 1.00 43.26  ? 244 ARG A NE    1 
ATOM   1376 C  CZ    . ARG A 1 168 ? 5.297   -8.202  -19.243 1.00 40.42  ? 244 ARG A CZ    1 
ATOM   1377 N  NH1   . ARG A 1 168 ? 5.355   -8.702  -18.018 1.00 38.94  ? 244 ARG A NH1   1 
ATOM   1378 N  NH2   . ARG A 1 168 ? 4.857   -6.973  -19.442 1.00 42.45  ? 244 ARG A NH2   1 
ATOM   1379 N  N     . PRO A 1 169 ? 8.450   -13.985 -23.538 1.00 45.04  ? 245 PRO A N     1 
ATOM   1380 C  CA    . PRO A 1 169 ? 9.560   -14.876 -23.907 1.00 36.98  ? 245 PRO A CA    1 
ATOM   1381 C  C     . PRO A 1 169 ? 10.385  -15.339 -22.694 1.00 41.78  ? 245 PRO A C     1 
ATOM   1382 O  O     . PRO A 1 169 ? 10.692  -14.538 -21.810 1.00 41.67  ? 245 PRO A O     1 
ATOM   1383 C  CB    . PRO A 1 169 ? 10.431  -13.992 -24.813 1.00 42.56  ? 245 PRO A CB    1 
ATOM   1384 C  CG    . PRO A 1 169 ? 9.500   -12.990 -25.385 1.00 40.01  ? 245 PRO A CG    1 
ATOM   1385 C  CD    . PRO A 1 169 ? 8.467   -12.731 -24.315 1.00 39.26  ? 245 PRO A CD    1 
ATOM   1386 N  N     . SER A 1 170 ? 10.739  -16.621 -22.657 1.00 46.77  ? 246 SER A N     1 
ATOM   1387 C  CA    . SER A 1 170 ? 11.631  -17.139 -21.620 1.00 48.79  ? 246 SER A CA    1 
ATOM   1388 C  C     . SER A 1 170 ? 12.909  -17.698 -22.235 1.00 48.38  ? 246 SER A C     1 
ATOM   1389 O  O     . SER A 1 170 ? 12.898  -18.222 -23.349 1.00 48.98  ? 246 SER A O     1 
ATOM   1390 C  CB    . SER A 1 170 ? 10.931  -18.214 -20.798 1.00 48.08  ? 246 SER A CB    1 
ATOM   1391 O  OG    . SER A 1 170 ? 10.115  -19.015 -21.632 1.00 55.06  ? 246 SER A OG    1 
ATOM   1392 N  N     . GLY A 1 171 ? 14.017  -17.568 -21.514 1.00 48.38  ? 247 GLY A N     1 
ATOM   1393 C  CA    . GLY A 1 171 ? 15.279  -18.120 -21.974 1.00 47.86  ? 247 GLY A CA    1 
ATOM   1394 C  C     . GLY A 1 171 ? 15.897  -17.358 -23.128 1.00 47.61  ? 247 GLY A C     1 
ATOM   1395 O  O     . GLY A 1 171 ? 16.756  -17.875 -23.838 1.00 51.63  ? 247 GLY A O     1 
ATOM   1396 N  N     . ILE A 1 172 ? 15.454  -16.125 -23.328 1.00 47.83  ? 248 ILE A N     1 
ATOM   1397 C  CA    . ILE A 1 172 ? 16.060  -15.271 -24.334 1.00 45.09  ? 248 ILE A CA    1 
ATOM   1398 C  C     . ILE A 1 172 ? 17.344  -14.718 -23.725 1.00 53.98  ? 248 ILE A C     1 
ATOM   1399 O  O     . ILE A 1 172 ? 17.361  -14.310 -22.560 1.00 58.16  ? 248 ILE A O     1 
ATOM   1400 C  CB    . ILE A 1 172 ? 15.099  -14.139 -24.769 1.00 48.29  ? 248 ILE A CB    1 
ATOM   1401 C  CG1   . ILE A 1 172 ? 13.897  -14.729 -25.505 1.00 44.74  ? 248 ILE A CG1   1 
ATOM   1402 C  CG2   . ILE A 1 172 ? 15.810  -13.104 -25.659 1.00 40.71  ? 248 ILE A CG2   1 
ATOM   1403 C  CD1   . ILE A 1 172 ? 14.272  -15.469 -26.783 1.00 40.54  ? 248 ILE A CD1   1 
ATOM   1404 N  N     . THR A 1 173 ? 18.420  -14.722 -24.504 1.00 51.52  ? 249 THR A N     1 
ATOM   1405 C  CA    . THR A 1 173 ? 19.732  -14.377 -23.976 1.00 47.89  ? 249 THR A CA    1 
ATOM   1406 C  C     . THR A 1 173 ? 20.274  -13.071 -24.550 1.00 49.54  ? 249 THR A C     1 
ATOM   1407 O  O     . THR A 1 173 ? 21.233  -12.517 -24.024 1.00 52.98  ? 249 THR A O     1 
ATOM   1408 C  CB    . THR A 1 173 ? 20.739  -15.508 -24.244 1.00 48.67  ? 249 THR A CB    1 
ATOM   1409 O  OG1   . THR A 1 173 ? 20.887  -15.689 -25.660 1.00 61.10  ? 249 THR A OG1   1 
ATOM   1410 C  CG2   . THR A 1 173 ? 20.242  -16.810 -23.636 1.00 46.95  ? 249 THR A CG2   1 
ATOM   1411 N  N     . THR A 1 174 ? 19.648  -12.576 -25.615 1.00 50.89  ? 250 THR A N     1 
ATOM   1412 C  CA    . THR A 1 174 ? 20.133  -11.384 -26.320 1.00 44.89  ? 250 THR A CA    1 
ATOM   1413 C  C     . THR A 1 174 ? 19.870  -10.072 -25.576 1.00 48.66  ? 250 THR A C     1 
ATOM   1414 O  O     . THR A 1 174 ? 20.393  -9.018  -25.949 1.00 51.05  ? 250 THR A O     1 
ATOM   1415 C  CB    . THR A 1 174 ? 19.554  -11.306 -27.744 1.00 43.78  ? 250 THR A CB    1 
ATOM   1416 O  OG1   . THR A 1 174 ? 18.191  -11.747 -27.733 1.00 50.95  ? 250 THR A OG1   1 
ATOM   1417 C  CG2   . THR A 1 174 ? 20.338  -12.210 -28.673 1.00 46.49  ? 250 THR A CG2   1 
ATOM   1418 N  N     . GLY A 1 175 ? 19.064  -10.146 -24.522 1.00 55.18  ? 251 GLY A N     1 
ATOM   1419 C  CA    . GLY A 1 175 ? 18.793  -9.002  -23.675 1.00 41.36  ? 251 GLY A CA    1 
ATOM   1420 C  C     . GLY A 1 175 ? 18.348  -7.783  -24.452 1.00 54.22  ? 251 GLY A C     1 
ATOM   1421 O  O     . GLY A 1 175 ? 17.430  -7.864  -25.267 1.00 55.64  ? 251 GLY A O     1 
ATOM   1422 N  N     . TYR A 1 176 ? 19.015  -6.657  -24.213 1.00 53.01  ? 252 TYR A N     1 
ATOM   1423 C  CA    . TYR A 1 176 ? 18.631  -5.389  -24.831 1.00 56.72  ? 252 TYR A CA    1 
ATOM   1424 C  C     . TYR A 1 176 ? 19.040  -5.276  -26.300 1.00 53.59  ? 252 TYR A C     1 
ATOM   1425 O  O     . TYR A 1 176 ? 18.825  -4.240  -26.925 1.00 53.33  ? 252 TYR A O     1 
ATOM   1426 C  CB    . TYR A 1 176 ? 19.174  -4.201  -24.029 1.00 52.47  ? 252 TYR A CB    1 
ATOM   1427 C  CG    . TYR A 1 176 ? 18.551  -4.068  -22.658 1.00 57.70  ? 252 TYR A CG    1 
ATOM   1428 C  CD1   . TYR A 1 176 ? 17.198  -4.334  -22.458 1.00 53.66  ? 252 TYR A CD1   1 
ATOM   1429 C  CD2   . TYR A 1 176 ? 19.313  -3.692  -21.560 1.00 60.70  ? 252 TYR A CD2   1 
ATOM   1430 C  CE1   . TYR A 1 176 ? 16.618  -4.217  -21.201 1.00 50.70  ? 252 TYR A CE1   1 
ATOM   1431 C  CE2   . TYR A 1 176 ? 18.742  -3.571  -20.296 1.00 65.23  ? 252 TYR A CE2   1 
ATOM   1432 C  CZ    . TYR A 1 176 ? 17.395  -3.836  -20.125 1.00 59.07  ? 252 TYR A CZ    1 
ATOM   1433 O  OH    . TYR A 1 176 ? 16.825  -3.713  -18.878 1.00 64.85  ? 252 TYR A OH    1 
ATOM   1434 N  N     . LYS A 1 177 ? 19.619  -6.343  -26.845 1.00 50.60  ? 253 LYS A N     1 
ATOM   1435 C  CA    . LYS A 1 177 ? 19.924  -6.399  -28.270 1.00 50.58  ? 253 LYS A CA    1 
ATOM   1436 C  C     . LYS A 1 177 ? 19.026  -7.419  -28.966 1.00 44.31  ? 253 LYS A C     1 
ATOM   1437 O  O     . LYS A 1 177 ? 19.396  -8.002  -29.988 1.00 49.19  ? 253 LYS A O     1 
ATOM   1438 C  CB    . LYS A 1 177 ? 21.402  -6.733  -28.497 1.00 57.40  ? 253 LYS A CB    1 
ATOM   1439 C  CG    . LYS A 1 177 ? 22.366  -5.656  -28.005 1.00 57.29  ? 253 LYS A CG    1 
ATOM   1440 C  CD    . LYS A 1 177 ? 23.818  -6.019  -28.304 1.00 65.26  ? 253 LYS A CD    1 
ATOM   1441 C  CE    . LYS A 1 177 ? 24.785  -4.897  -27.907 1.00 71.04  ? 253 LYS A CE    1 
ATOM   1442 N  NZ    . LYS A 1 177 ? 24.623  -3.658  -28.731 1.00 66.11  ? 253 LYS A NZ    1 
ATOM   1443 N  N     . THR A 1 178 ? 17.842  -7.631  -28.404 1.00 45.28  ? 254 THR A N     1 
ATOM   1444 C  CA    . THR A 1 178 ? 16.872  -8.562  -28.975 1.00 46.19  ? 254 THR A CA    1 
ATOM   1445 C  C     . THR A 1 178 ? 16.179  -7.892  -30.155 1.00 44.97  ? 254 THR A C     1 
ATOM   1446 O  O     . THR A 1 178 ? 15.858  -8.536  -31.152 1.00 44.84  ? 254 THR A O     1 
ATOM   1447 C  CB    . THR A 1 178 ? 15.844  -9.013  -27.914 1.00 41.53  ? 254 THR A CB    1 
ATOM   1448 O  OG1   . THR A 1 178 ? 16.520  -9.729  -26.879 1.00 42.42  ? 254 THR A OG1   1 
ATOM   1449 C  CG2   . THR A 1 178 ? 14.789  -9.908  -28.502 1.00 43.62  ? 254 THR A CG2   1 
ATOM   1450 N  N     . PHE A 1 179 ? 15.981  -6.583  -30.046 1.00 45.96  ? 255 PHE A N     1 
ATOM   1451 C  CA    . PHE A 1 179 ? 15.344  -5.820  -31.110 1.00 41.40  ? 255 PHE A CA    1 
ATOM   1452 C  C     . PHE A 1 179 ? 16.271  -4.729  -31.604 1.00 45.98  ? 255 PHE A C     1 
ATOM   1453 O  O     . PHE A 1 179 ? 17.132  -4.251  -30.860 1.00 45.94  ? 255 PHE A O     1 
ATOM   1454 C  CB    . PHE A 1 179 ? 14.046  -5.176  -30.607 1.00 37.48  ? 255 PHE A CB    1 
ATOM   1455 C  CG    . PHE A 1 179 ? 13.092  -6.153  -29.990 1.00 42.48  ? 255 PHE A CG    1 
ATOM   1456 C  CD1   . PHE A 1 179 ? 12.143  -6.799  -30.766 1.00 40.97  ? 255 PHE A CD1   1 
ATOM   1457 C  CD2   . PHE A 1 179 ? 13.152  -6.441  -28.639 1.00 39.79  ? 255 PHE A CD2   1 
ATOM   1458 C  CE1   . PHE A 1 179 ? 11.264  -7.707  -30.197 1.00 42.61  ? 255 PHE A CE1   1 
ATOM   1459 C  CE2   . PHE A 1 179 ? 12.276  -7.353  -28.072 1.00 40.64  ? 255 PHE A CE2   1 
ATOM   1460 C  CZ    . PHE A 1 179 ? 11.336  -7.985  -28.852 1.00 37.58  ? 255 PHE A CZ    1 
ATOM   1461 N  N     . ARG A 1 180 ? 16.091  -4.339  -32.861 1.00 41.70  ? 256 ARG A N     1 
ATOM   1462 C  CA    . ARG A 1 180 ? 16.656  -3.092  -33.335 1.00 41.89  ? 256 ARG A CA    1 
ATOM   1463 C  C     . ARG A 1 180 ? 15.560  -2.047  -33.213 1.00 45.68  ? 256 ARG A C     1 
ATOM   1464 O  O     . ARG A 1 180 ? 14.523  -2.174  -33.854 1.00 46.30  ? 256 ARG A O     1 
ATOM   1465 C  CB    . ARG A 1 180 ? 17.133  -3.202  -34.787 1.00 45.71  ? 256 ARG A CB    1 
ATOM   1466 C  CG    . ARG A 1 180 ? 18.120  -2.106  -35.213 1.00 44.63  ? 256 ARG A CG    1 
ATOM   1467 C  CD    . ARG A 1 180 ? 18.585  -2.321  -36.635 1.00 45.12  ? 256 ARG A CD    1 
ATOM   1468 N  NE    . ARG A 1 180 ? 18.888  -3.729  -36.901 1.00 61.04  ? 256 ARG A NE    1 
ATOM   1469 C  CZ    . ARG A 1 180 ? 18.746  -4.307  -38.095 1.00 61.75  ? 256 ARG A CZ    1 
ATOM   1470 N  NH1   . ARG A 1 180 ? 18.308  -3.594  -39.131 1.00 67.24  ? 256 ARG A NH1   1 
ATOM   1471 N  NH2   . ARG A 1 180 ? 19.037  -5.590  -38.259 1.00 57.84  ? 256 ARG A NH2   1 
ATOM   1472 N  N     . HIS A 1 181 ? 15.775  -1.044  -32.361 1.00 42.59  ? 257 HIS A N     1 
ATOM   1473 C  CA    . HIS A 1 181 ? 14.843  0.064   -32.228 1.00 39.36  ? 257 HIS A CA    1 
ATOM   1474 C  C     . HIS A 1 181 ? 15.426  1.303   -32.925 1.00 49.49  ? 257 HIS A C     1 
ATOM   1475 O  O     . HIS A 1 181 ? 16.123  2.117   -32.316 1.00 50.43  ? 257 HIS A O     1 
ATOM   1476 C  CB    . HIS A 1 181 ? 14.546  0.356   -30.757 1.00 37.40  ? 257 HIS A CB    1 
ATOM   1477 C  CG    . HIS A 1 181 ? 13.445  1.356   -30.539 1.00 37.41  ? 257 HIS A CG    1 
ATOM   1478 N  ND1   . HIS A 1 181 ? 13.454  2.262   -29.496 1.00 34.51  ? 257 HIS A ND1   1 
ATOM   1479 C  CD2   . HIS A 1 181 ? 12.299  1.591   -31.224 1.00 39.96  ? 257 HIS A CD2   1 
ATOM   1480 C  CE1   . HIS A 1 181 ? 12.368  3.010   -29.553 1.00 38.01  ? 257 HIS A CE1   1 
ATOM   1481 N  NE2   . HIS A 1 181 ? 11.654  2.632   -30.599 1.00 36.43  ? 257 HIS A NE2   1 
ATOM   1482 N  N     . LEU A 1 182 ? 15.127  1.427   -34.211 1.00 41.14  ? 258 LEU A N     1 
ATOM   1483 C  CA    . LEU A 1 182 ? 15.618  2.520   -35.043 1.00 52.60  ? 258 LEU A CA    1 
ATOM   1484 C  C     . LEU A 1 182 ? 14.761  3.778   -34.874 1.00 43.25  ? 258 LEU A C     1 
ATOM   1485 O  O     . LEU A 1 182 ? 13.890  4.080   -35.687 1.00 47.89  ? 258 LEU A O     1 
ATOM   1486 C  CB    . LEU A 1 182 ? 15.678  2.079   -36.515 1.00 56.23  ? 258 LEU A CB    1 
ATOM   1487 C  CG    . LEU A 1 182 ? 14.642  1.092   -37.079 1.00 51.77  ? 258 LEU A CG    1 
ATOM   1488 C  CD1   . LEU A 1 182 ? 14.694  1.083   -38.608 1.00 49.91  ? 258 LEU A CD1   1 
ATOM   1489 C  CD2   . LEU A 1 182 ? 14.865  -0.326  -36.571 1.00 48.91  ? 258 LEU A CD2   1 
ATOM   1490 N  N     . HIS A 1 183 ? 15.011  4.503   -33.798 1.00 44.75  ? 259 HIS A N     1 
ATOM   1491 C  CA    . HIS A 1 183 ? 14.136  5.592   -33.410 1.00 48.51  ? 259 HIS A CA    1 
ATOM   1492 C  C     . HIS A 1 183 ? 14.949  6.706   -32.781 1.00 48.16  ? 259 HIS A C     1 
ATOM   1493 O  O     . HIS A 1 183 ? 15.187  6.704   -31.581 1.00 57.93  ? 259 HIS A O     1 
ATOM   1494 C  CB    . HIS A 1 183 ? 13.074  5.088   -32.426 1.00 44.70  ? 259 HIS A CB    1 
ATOM   1495 C  CG    . HIS A 1 183 ? 12.037  6.108   -32.064 1.00 40.72  ? 259 HIS A CG    1 
ATOM   1496 N  ND1   . HIS A 1 183 ? 10.763  5.761   -31.670 1.00 38.98  ? 259 HIS A ND1   1 
ATOM   1497 C  CD2   . HIS A 1 183 ? 12.086  7.461   -32.022 1.00 40.12  ? 259 HIS A CD2   1 
ATOM   1498 C  CE1   . HIS A 1 183 ? 10.070  6.854   -31.406 1.00 42.51  ? 259 HIS A CE1   1 
ATOM   1499 N  NE2   . HIS A 1 183 ? 10.848  7.900   -31.620 1.00 45.56  ? 259 HIS A NE2   1 
ATOM   1500 N  N     . ASP A 1 184 ? 15.375  7.653   -33.606 1.00 52.64  ? 260 ASP A N     1 
ATOM   1501 C  CA    . ASP A 1 184 ? 16.059  8.846   -33.126 1.00 53.20  ? 260 ASP A CA    1 
ATOM   1502 C  C     . ASP A 1 184 ? 15.055  9.727   -32.404 1.00 52.86  ? 260 ASP A C     1 
ATOM   1503 O  O     . ASP A 1 184 ? 14.083  10.189  -33.008 1.00 50.40  ? 260 ASP A O     1 
ATOM   1504 C  CB    . ASP A 1 184 ? 16.642  9.605   -34.314 1.00 61.89  ? 260 ASP A CB    1 
ATOM   1505 C  CG    . ASP A 1 184 ? 17.578  10.719  -33.900 1.00 66.07  ? 260 ASP A CG    1 
ATOM   1506 O  OD1   . ASP A 1 184 ? 17.210  11.546  -33.024 1.00 59.58  ? 260 ASP A OD1   1 
ATOM   1507 O  OD2   . ASP A 1 184 ? 18.690  10.758  -34.471 1.00 67.98  ? 260 ASP A OD2   1 
ATOM   1508 N  N     . PRO A 1 185 ? 15.280  9.974   -31.106 1.00 57.53  ? 261 PRO A N     1 
ATOM   1509 C  CA    . PRO A 1 185 ? 14.283  10.753  -30.360 1.00 55.43  ? 261 PRO A CA    1 
ATOM   1510 C  C     . PRO A 1 185 ? 14.251  12.226  -30.789 1.00 65.83  ? 261 PRO A C     1 
ATOM   1511 O  O     . PRO A 1 185 ? 13.282  12.927  -30.467 1.00 68.40  ? 261 PRO A O     1 
ATOM   1512 C  CB    . PRO A 1 185 ? 14.722  10.593  -28.902 1.00 51.60  ? 261 PRO A CB    1 
ATOM   1513 C  CG    . PRO A 1 185 ? 16.170  10.255  -28.971 1.00 55.62  ? 261 PRO A CG    1 
ATOM   1514 C  CD    . PRO A 1 185 ? 16.388  9.505   -30.255 1.00 54.56  ? 261 PRO A CD    1 
ATOM   1515 N  N     . ALA A 1 186 ? 15.274  12.673  -31.521 1.00 59.13  ? 262 ALA A N     1 
ATOM   1516 C  CA    . ALA A 1 186 ? 15.317  14.047  -32.029 1.00 71.41  ? 262 ALA A CA    1 
ATOM   1517 C  C     . ALA A 1 186 ? 14.571  14.211  -33.361 1.00 72.31  ? 262 ALA A C     1 
ATOM   1518 O  O     . ALA A 1 186 ? 13.888  15.218  -33.574 1.00 73.85  ? 262 ALA A O     1 
ATOM   1519 C  CB    . ALA A 1 186 ? 16.761  14.527  -32.163 1.00 68.17  ? 262 ALA A CB    1 
ATOM   1520 N  N     . TRP A 1 187 ? 14.704  13.224  -34.249 1.00 60.76  ? 263 TRP A N     1 
ATOM   1521 C  CA    . TRP A 1 187 ? 14.020  13.257  -35.545 1.00 56.16  ? 263 TRP A CA    1 
ATOM   1522 C  C     . TRP A 1 187 ? 12.576  12.763  -35.442 1.00 55.75  ? 263 TRP A C     1 
ATOM   1523 O  O     . TRP A 1 187 ? 11.675  13.311  -36.074 1.00 51.54  ? 263 TRP A O     1 
ATOM   1524 C  CB    . TRP A 1 187 ? 14.795  12.438  -36.584 1.00 56.35  ? 263 TRP A CB    1 
ATOM   1525 C  CG    . TRP A 1 187 ? 14.388  12.709  -38.016 1.00 61.76  ? 263 TRP A CG    1 
ATOM   1526 C  CD1   . TRP A 1 187 ? 13.818  11.824  -38.887 1.00 57.36  ? 263 TRP A CD1   1 
ATOM   1527 C  CD2   . TRP A 1 187 ? 14.518  13.950  -38.733 1.00 63.09  ? 263 TRP A CD2   1 
ATOM   1528 N  NE1   . TRP A 1 187 ? 13.590  12.433  -40.103 1.00 59.05  ? 263 TRP A NE1   1 
ATOM   1529 C  CE2   . TRP A 1 187 ? 14.012  13.735  -40.036 1.00 61.03  ? 263 TRP A CE2   1 
ATOM   1530 C  CE3   . TRP A 1 187 ? 15.018  15.218  -38.404 1.00 58.48  ? 263 TRP A CE3   1 
ATOM   1531 C  CZ2   . TRP A 1 187 ? 13.986  14.745  -41.010 1.00 60.51  ? 263 TRP A CZ2   1 
ATOM   1532 C  CZ3   . TRP A 1 187 ? 14.991  16.223  -39.375 1.00 56.81  ? 263 TRP A CZ3   1 
ATOM   1533 C  CH2   . TRP A 1 187 ? 14.477  15.978  -40.659 1.00 54.61  ? 263 TRP A CH2   1 
ATOM   1534 N  N     . ARG A 1 188 ? 12.369  11.713  -34.650 1.00 55.75  ? 264 ARG A N     1 
ATOM   1535 C  CA    . ARG A 1 188 ? 11.032  11.205  -34.376 1.00 51.46  ? 264 ARG A CA    1 
ATOM   1536 C  C     . ARG A 1 188 ? 10.601  11.623  -32.967 1.00 54.58  ? 264 ARG A C     1 
ATOM   1537 O  O     . ARG A 1 188 ? 10.790  10.887  -32.000 1.00 52.78  ? 264 ARG A O     1 
ATOM   1538 C  CB    . ARG A 1 188 ? 10.994  9.682   -34.525 1.00 53.36  ? 264 ARG A CB    1 
ATOM   1539 C  CG    . ARG A 1 188 ? 11.525  9.169   -35.855 1.00 48.31  ? 264 ARG A CG    1 
ATOM   1540 C  CD    . ARG A 1 188 ? 10.835  9.822   -37.052 1.00 45.81  ? 264 ARG A CD    1 
ATOM   1541 N  NE    . ARG A 1 188 ? 11.040  9.042   -38.277 1.00 48.04  ? 264 ARG A NE    1 
ATOM   1542 C  CZ    . ARG A 1 188 ? 10.708  9.450   -39.500 1.00 46.74  ? 264 ARG A CZ    1 
ATOM   1543 N  NH1   . ARG A 1 188 ? 10.170  10.654  -39.688 1.00 43.40  ? 264 ARG A NH1   1 
ATOM   1544 N  NH2   . ARG A 1 188 ? 10.936  8.659   -40.543 1.00 38.74  ? 264 ARG A NH2   1 
ATOM   1545 N  N     . LYS A 1 189 ? 10.036  12.820  -32.859 1.00 57.57  ? 265 LYS A N     1 
ATOM   1546 C  CA    . LYS A 1 189 ? 9.667   13.376  -31.567 1.00 53.46  ? 265 LYS A CA    1 
ATOM   1547 C  C     . LYS A 1 189 ? 8.362   12.763  -31.096 1.00 53.48  ? 265 LYS A C     1 
ATOM   1548 O  O     . LYS A 1 189 ? 7.389   12.707  -31.846 1.00 54.97  ? 265 LYS A O     1 
ATOM   1549 C  CB    . LYS A 1 189 ? 9.529   14.898  -31.657 1.00 61.91  ? 265 LYS A CB    1 
ATOM   1550 C  CG    . LYS A 1 189 ? 10.765  15.601  -32.205 1.00 67.68  ? 265 LYS A CG    1 
ATOM   1551 C  CD    . LYS A 1 189 ? 10.650  17.121  -32.101 1.00 73.74  ? 265 LYS A CD    1 
ATOM   1552 C  CE    . LYS A 1 189 ? 11.901  17.796  -32.647 1.00 79.33  ? 265 LYS A CE    1 
ATOM   1553 N  NZ    . LYS A 1 189 ? 13.147  17.198  -32.072 1.00 74.01  ? 265 LYS A NZ    1 
ATOM   1554 N  N     . ARG A 1 190 ? 8.345   12.298  -29.853 1.00 49.52  ? 266 ARG A N     1 
ATOM   1555 C  CA    . ARG A 1 190 ? 7.140   11.698  -29.299 1.00 47.43  ? 266 ARG A CA    1 
ATOM   1556 C  C     . ARG A 1 190 ? 6.179   12.788  -28.871 1.00 51.08  ? 266 ARG A C     1 
ATOM   1557 O  O     . ARG A 1 190 ? 6.553   13.726  -28.165 1.00 53.53  ? 266 ARG A O     1 
ATOM   1558 C  CB    . ARG A 1 190 ? 7.479   10.793  -28.121 1.00 46.55  ? 266 ARG A CB    1 
ATOM   1559 C  CG    . ARG A 1 190 ? 8.272   9.566   -28.485 1.00 41.54  ? 266 ARG A CG    1 
ATOM   1560 C  CD    . ARG A 1 190 ? 8.795   8.875   -27.227 1.00 40.59  ? 266 ARG A CD    1 
ATOM   1561 N  NE    . ARG A 1 190 ? 9.427   7.591   -27.527 1.00 41.15  ? 266 ARG A NE    1 
ATOM   1562 C  CZ    . ARG A 1 190 ? 10.688  7.448   -27.929 1.00 43.35  ? 266 ARG A CZ    1 
ATOM   1563 N  NH1   . ARG A 1 190 ? 11.459  8.517   -28.090 1.00 42.59  ? 266 ARG A NH1   1 
ATOM   1564 N  NH2   . ARG A 1 190 ? 11.177  6.232   -28.182 1.00 37.23  ? 266 ARG A NH2   1 
ATOM   1565 N  N     . ASP A 1 191 ? 4.943   12.677  -29.330 1.00 44.61  ? 267 ASP A N     1 
ATOM   1566 C  CA    . ASP A 1 191 ? 3.934   13.652  -28.993 1.00 39.18  ? 267 ASP A CA    1 
ATOM   1567 C  C     . ASP A 1 191 ? 3.389   13.381  -27.571 1.00 50.18  ? 267 ASP A C     1 
ATOM   1568 O  O     . ASP A 1 191 ? 2.352   12.727  -27.403 1.00 48.02  ? 267 ASP A O     1 
ATOM   1569 C  CB    . ASP A 1 191 ? 2.824   13.633  -30.047 1.00 32.84  ? 267 ASP A CB    1 
ATOM   1570 C  CG    . ASP A 1 191 ? 1.709   14.625  -29.734 1.00 47.42  ? 267 ASP A CG    1 
ATOM   1571 O  OD1   . ASP A 1 191 ? 1.930   15.525  -28.893 1.00 45.06  ? 267 ASP A OD1   1 
ATOM   1572 O  OD2   . ASP A 1 191 ? 0.610   14.503  -30.317 1.00 45.00  ? 267 ASP A OD2   1 
ATOM   1573 N  N     . GLN A 1 192 ? 4.090   13.896  -26.557 1.00 52.12  ? 268 GLN A N     1 
ATOM   1574 C  CA    . GLN A 1 192 ? 3.823   13.538  -25.157 1.00 52.94  ? 268 GLN A CA    1 
ATOM   1575 C  C     . GLN A 1 192 ? 3.076   14.590  -24.337 1.00 60.16  ? 268 GLN A C     1 
ATOM   1576 O  O     . GLN A 1 192 ? 2.830   14.390  -23.148 1.00 70.95  ? 268 GLN A O     1 
ATOM   1577 C  CB    . GLN A 1 192 ? 5.135   13.197  -24.443 1.00 51.64  ? 268 GLN A CB    1 
ATOM   1578 C  CG    . GLN A 1 192 ? 6.121   12.466  -25.321 1.00 50.66  ? 268 GLN A CG    1 
ATOM   1579 C  CD    . GLN A 1 192 ? 7.285   11.884  -24.556 1.00 49.37  ? 268 GLN A CD    1 
ATOM   1580 O  OE1   . GLN A 1 192 ? 8.232   12.590  -24.212 1.00 51.70  ? 268 GLN A OE1   1 
ATOM   1581 N  NE2   . GLN A 1 192 ? 7.230   10.579  -24.296 1.00 50.07  ? 268 GLN A NE2   1 
ATOM   1582 N  N     . LYS A 1 193 ? 2.717   15.703  -24.960 1.00 58.41  ? 269 LYS A N     1 
ATOM   1583 C  CA    . LYS A 1 193 ? 2.014   16.762  -24.248 1.00 64.95  ? 269 LYS A CA    1 
ATOM   1584 C  C     . LYS A 1 193 ? 0.635   16.315  -23.761 1.00 70.40  ? 269 LYS A C     1 
ATOM   1585 O  O     . LYS A 1 193 ? -0.145  15.733  -24.517 1.00 63.69  ? 269 LYS A O     1 
ATOM   1586 C  CB    . LYS A 1 193 ? 1.893   18.009  -25.128 1.00 64.99  ? 269 LYS A CB    1 
ATOM   1587 C  CG    . LYS A 1 193 ? 1.227   19.197  -24.442 1.00 76.59  ? 269 LYS A CG    1 
ATOM   1588 C  CD    . LYS A 1 193 ? 1.189   20.424  -25.354 1.00 78.67  ? 269 LYS A CD    1 
ATOM   1589 C  CE    . LYS A 1 193 ? 0.277   21.508  -24.786 1.00 72.36  ? 269 LYS A CE    1 
ATOM   1590 N  NZ    . LYS A 1 193 ? 0.142   22.660  -25.718 1.00 71.59  ? 269 LYS A NZ    1 
ATOM   1591 N  N     . ARG A 1 194 ? 0.345   16.588  -22.490 1.00 76.56  ? 270 ARG A N     1 
ATOM   1592 C  CA    . ARG A 1 194 ? -0.971  16.312  -21.920 1.00 78.58  ? 270 ARG A CA    1 
ATOM   1593 C  C     . ARG A 1 194 ? -1.832  17.579  -21.938 1.00 81.88  ? 270 ARG A C     1 
ATOM   1594 O  O     . ARG A 1 194 ? -1.641  18.476  -21.117 1.00 83.60  ? 270 ARG A O     1 
ATOM   1595 C  CB    . ARG A 1 194 ? -0.839  15.810  -20.485 1.00 80.90  ? 270 ARG A CB    1 
ATOM   1596 C  CG    . ARG A 1 194 ? 0.361   14.935  -20.238 1.00 79.74  ? 270 ARG A CG    1 
ATOM   1597 C  CD    . ARG A 1 194 ? 0.108   13.497  -20.645 1.00 85.45  ? 270 ARG A CD    1 
ATOM   1598 N  NE    . ARG A 1 194 ? 1.153   12.623  -20.116 1.00 92.52  ? 270 ARG A NE    1 
ATOM   1599 C  CZ    . ARG A 1 194 ? 1.124   12.070  -18.907 1.00 92.16  ? 270 ARG A CZ    1 
ATOM   1600 N  NH1   . ARG A 1 194 ? 0.089   12.285  -18.100 1.00 97.40  ? 270 ARG A NH1   1 
ATOM   1601 N  NH2   . ARG A 1 194 ? 2.122   11.292  -18.507 1.00 89.26  ? 270 ARG A NH2   1 
ATOM   1602 N  N     . ILE A 1 195 ? -2.782  17.642  -22.869 1.00 86.76  ? 271 ILE A N     1 
ATOM   1603 C  CA    . ILE A 1 195 ? -3.606  18.838  -23.063 1.00 89.07  ? 271 ILE A CA    1 
ATOM   1604 C  C     . ILE A 1 195 ? -4.812  18.878  -22.114 1.00 90.60  ? 271 ILE A C     1 
ATOM   1605 O  O     . ILE A 1 195 ? -5.811  18.180  -22.329 1.00 83.65  ? 271 ILE A O     1 
ATOM   1606 C  CB    . ILE A 1 195 ? -4.078  18.973  -24.542 1.00 85.48  ? 271 ILE A CB    1 
ATOM   1607 C  CG1   . ILE A 1 195 ? -2.885  18.865  -25.501 1.00 75.77  ? 271 ILE A CG1   1 
ATOM   1608 C  CG2   . ILE A 1 195 ? -4.822  20.285  -24.759 1.00 80.22  ? 271 ILE A CG2   1 
ATOM   1609 C  CD1   . ILE A 1 195 ? -3.257  18.957  -26.969 1.00 71.21  ? 271 ILE A CD1   1 
ATOM   1610 N  N     . ALA A 1 196 ? -4.691  19.698  -21.067 1.00 92.81  ? 272 ALA A N     1 
ATOM   1611 C  CA    . ALA A 1 196 ? -5.740  19.910  -20.057 1.00 94.30  ? 272 ALA A CA    1 
ATOM   1612 C  C     . ALA A 1 196 ? -6.222  18.643  -19.332 1.00 92.70  ? 272 ALA A C     1 
ATOM   1613 O  O     . ALA A 1 196 ? -5.489  18.060  -18.528 1.00 90.37  ? 272 ALA A O     1 
ATOM   1614 C  CB    . ALA A 1 196 ? -6.923  20.684  -20.652 1.00 90.96  ? 272 ALA A CB    1 
ATOM   1615 N  N     . ALA A 1 197 ? -7.458  18.235  -19.618 1.00 86.12  ? 273 ALA A N     1 
ATOM   1616 C  CA    . ALA A 1 197 ? -8.088  17.100  -18.947 1.00 84.57  ? 273 ALA A CA    1 
ATOM   1617 C  C     . ALA A 1 197 ? -7.571  15.744  -19.433 1.00 91.35  ? 273 ALA A C     1 
ATOM   1618 O  O     . ALA A 1 197 ? -8.009  14.697  -18.949 1.00 94.22  ? 273 ALA A O     1 
ATOM   1619 C  CB    . ALA A 1 197 ? -9.601  17.175  -19.098 1.00 85.85  ? 273 ALA A CB    1 
ATOM   1620 N  N     . GLN A 1 198 ? -6.649  15.770  -20.395 1.00 95.45  ? 274 GLN A N     1 
ATOM   1621 C  CA    . GLN A 1 198 ? -6.002  14.554  -20.893 1.00 89.18  ? 274 GLN A CA    1 
ATOM   1622 C  C     . GLN A 1 198 ? -5.130  13.941  -19.804 1.00 93.87  ? 274 GLN A C     1 
ATOM   1623 O  O     . GLN A 1 198 ? -5.019  12.715  -19.691 1.00 92.06  ? 274 GLN A O     1 
ATOM   1624 C  CB    . GLN A 1 198 ? -5.146  14.855  -22.133 1.00 77.56  ? 274 GLN A CB    1 
ATOM   1625 C  CG    . GLN A 1 198 ? -4.270  13.679  -22.583 1.00 76.95  ? 274 GLN A CG    1 
ATOM   1626 C  CD    . GLN A 1 198 ? -3.435  13.985  -23.821 1.00 75.32  ? 274 GLN A CD    1 
ATOM   1627 O  OE1   . GLN A 1 198 ? -3.170  15.152  -24.145 1.00 69.60  ? 274 GLN A OE1   1 
ATOM   1628 N  NE2   . GLN A 1 198 ? -3.017  12.933  -24.525 1.00 60.34  ? 274 GLN A NE2   1 
ATOM   1629 N  N     . LYS A 1 199 ? -4.527  14.807  -18.992 1.00 93.57  ? 275 LYS A N     1 
ATOM   1630 C  CA    . LYS A 1 199 ? -3.617  14.370  -17.939 1.00 96.25  ? 275 LYS A CA    1 
ATOM   1631 C  C     . LYS A 1 199 ? -4.350  13.592  -16.842 1.00 95.97  ? 275 LYS A C     1 
ATOM   1632 O  O     . LYS A 1 199 ? -3.718  12.984  -15.978 1.00 98.15  ? 275 LYS A O     1 
ATOM   1633 C  CB    . LYS A 1 199 ? -2.858  15.569  -17.350 1.00 93.43  ? 275 LYS A CB    1 
ATOM   1634 C  CG    . LYS A 1 199 ? -1.482  15.220  -16.788 1.00 94.15  ? 275 LYS A CG    1 
ATOM   1635 C  CD    . LYS A 1 199 ? -1.328  15.722  -15.357 1.00 94.86  ? 275 LYS A CD    1 
ATOM   1636 C  CE    . LYS A 1 199 ? -0.397  14.828  -14.544 1.00 89.07  ? 275 LYS A CE    1 
ATOM   1637 N  NZ    . LYS A 1 199 ? 1.037   15.205  -14.674 1.00 82.29  ? 275 LYS A NZ    1 
ATOM   1638 N  N     . GLN A 1 200 ? -5.682  13.604  -16.896 1.00 94.86  ? 276 GLN A N     1 
ATOM   1639 C  CA    . GLN A 1 200 ? -6.516  12.899  -15.922 1.00 96.24  ? 276 GLN A CA    1 
ATOM   1640 C  C     . GLN A 1 200 ? -7.089  11.609  -16.507 1.00 100.04 ? 276 GLN A C     1 
ATOM   1641 O  O     . GLN A 1 200 ? -6.955  10.527  -15.927 1.00 93.85  ? 276 GLN A O     1 
ATOM   1642 C  CB    . GLN A 1 200 ? -7.666  13.798  -15.464 1.00 90.97  ? 276 GLN A CB    1 
ATOM   1643 C  CG    . GLN A 1 200 ? -7.375  15.286  -15.561 1.00 92.99  ? 276 GLN A CG    1 
ATOM   1644 C  CD    . GLN A 1 200 ? -6.129  15.693  -14.795 1.00 96.10  ? 276 GLN A CD    1 
ATOM   1645 O  OE1   . GLN A 1 200 ? -5.746  15.048  -13.819 1.00 99.20  ? 276 GLN A OE1   1 
ATOM   1646 N  NE2   . GLN A 1 200 ? -5.481  16.762  -15.247 1.00 92.75  ? 276 GLN A NE2   1 
ATOM   1647 N  N     . GLU A 1 201 ? -7.726  11.742  -17.666 1.00 98.98  ? 277 GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 201 ? -8.399  10.628  -18.324 1.00 95.12  ? 277 GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 201 ? -7.479  9.474   -18.720 1.00 97.27  ? 277 GLU A C     1 
ATOM   1650 O  O     . GLU A 1 201 ? -7.945  8.348   -18.916 1.00 99.39  ? 277 GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 201 ? -9.152  11.136  -19.548 1.00 87.00  ? 277 GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 201 ? -10.509 11.718  -19.222 1.00 87.62  ? 277 GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 201 ? -11.629 10.827  -19.709 1.00 92.67  ? 277 GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 201 ? -12.735 10.877  -19.124 1.00 94.57  ? 277 GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 201 ? -11.396 10.073  -20.682 1.00 86.67  ? 277 GLU A OE2   1 
ATOM   1656 N  N     . GLN A 1 202 ? -6.183  9.760   -18.837 1.00 96.16  ? 278 GLN A N     1 
ATOM   1657 C  CA    . GLN A 1 202 ? -5.179  8.760   -19.219 1.00 89.52  ? 278 GLN A CA    1 
ATOM   1658 C  C     . GLN A 1 202 ? -5.160  7.521   -18.310 1.00 90.37  ? 278 GLN A C     1 
ATOM   1659 O  O     . GLN A 1 202 ? -4.977  6.393   -18.778 1.00 76.53  ? 278 GLN A O     1 
ATOM   1660 C  CB    . GLN A 1 202 ? -3.787  9.397   -19.235 1.00 86.14  ? 278 GLN A CB    1 
ATOM   1661 C  CG    . GLN A 1 202 ? -3.231  9.719   -20.614 1.00 75.79  ? 278 GLN A CG    1 
ATOM   1662 C  CD    . GLN A 1 202 ? -1.772  10.142  -20.538 1.00 88.63  ? 278 GLN A CD    1 
ATOM   1663 O  OE1   . GLN A 1 202 ? -1.278  10.473  -19.457 1.00 96.29  ? 278 GLN A OE1   1 
ATOM   1664 N  NE2   . GLN A 1 202 ? -1.072  10.124  -21.679 1.00 71.86  ? 278 GLN A NE2   1 
ATOM   1665 N  N     . PHE A 1 203 ? -5.356  7.739   -17.011 1.00 99.58  ? 279 PHE A N     1 
ATOM   1666 C  CA    . PHE A 1 203 ? -5.259  6.665   -16.023 1.00 98.88  ? 279 PHE A CA    1 
ATOM   1667 C  C     . PHE A 1 203 ? -6.638  6.170   -15.566 1.00 99.84  ? 279 PHE A C     1 
ATOM   1668 O  O     . PHE A 1 203 ? -6.733  5.301   -14.695 1.00 99.24  ? 279 PHE A O     1 
ATOM   1669 C  CB    . PHE A 1 203 ? -4.436  7.122   -14.806 1.00 100.98 ? 279 PHE A CB    1 
ATOM   1670 C  CG    . PHE A 1 203 ? -3.253  7.997   -15.155 1.00 97.32  ? 279 PHE A CG    1 
ATOM   1671 C  CD1   . PHE A 1 203 ? -2.010  7.436   -15.431 1.00 86.17  ? 279 PHE A CD1   1 
ATOM   1672 C  CD2   . PHE A 1 203 ? -3.385  9.382   -15.196 1.00 90.23  ? 279 PHE A CD2   1 
ATOM   1673 C  CE1   . PHE A 1 203 ? -0.924  8.240   -15.749 1.00 87.05  ? 279 PHE A CE1   1 
ATOM   1674 C  CE2   . PHE A 1 203 ? -2.305  10.190  -15.515 1.00 88.17  ? 279 PHE A CE2   1 
ATOM   1675 C  CZ    . PHE A 1 203 ? -1.074  9.620   -15.791 1.00 91.93  ? 279 PHE A CZ    1 
ATOM   1676 N  N     . LYS A 1 204 ? -7.697  6.725   -16.157 1.00 101.37 ? 280 LYS A N     1 
ATOM   1677 C  CA    . LYS A 1 204 ? -9.073  6.362   -15.799 1.00 100.68 ? 280 LYS A CA    1 
ATOM   1678 C  C     . LYS A 1 204 ? -9.424  4.895   -16.081 1.00 101.47 ? 280 LYS A C     1 
ATOM   1679 O  O     . LYS A 1 204 ? -8.653  4.160   -16.708 1.00 92.61  ? 280 LYS A O     1 
ATOM   1680 C  CB    . LYS A 1 204 ? -10.078 7.283   -16.500 1.00 92.03  ? 280 LYS A CB    1 
ATOM   1681 C  CG    . LYS A 1 204 ? -10.452 8.521   -15.703 1.00 96.47  ? 280 LYS A CG    1 
ATOM   1682 C  CD    . LYS A 1 204 ? -11.640 9.234   -16.341 1.00 98.32  ? 280 LYS A CD    1 
ATOM   1683 C  CE    . LYS A 1 204 ? -12.293 10.226  -15.381 1.00 93.37  ? 280 LYS A CE    1 
ATOM   1684 N  NZ    . LYS A 1 204 ? -11.381 11.333  -14.982 1.00 92.16  ? 280 LYS A NZ    1 
ATOM   1685 N  N     . VAL A 1 205 ? -10.596 4.477   -15.607 1.00 106.92 ? 281 VAL A N     1 
ATOM   1686 C  CA    . VAL A 1 205 ? -11.062 3.106   -15.802 1.00 100.26 ? 281 VAL A CA    1 
ATOM   1687 C  C     . VAL A 1 205 ? -12.190 3.030   -16.838 1.00 102.40 ? 281 VAL A C     1 
ATOM   1688 O  O     . VAL A 1 205 ? -13.339 2.727   -16.499 1.00 99.60  ? 281 VAL A O     1 
ATOM   1689 C  CB    . VAL A 1 205 ? -11.511 2.452   -14.466 1.00 101.66 ? 281 VAL A CB    1 
ATOM   1690 C  CG1   . VAL A 1 205 ? -10.558 1.321   -14.072 1.00 87.12  ? 281 VAL A CG1   1 
ATOM   1691 C  CG2   . VAL A 1 205 ? -11.615 3.499   -13.355 1.00 94.47  ? 281 VAL A CG2   1 
ATOM   1692 N  N     . ASP A 1 206 ? -11.838 3.328   -18.092 1.00 99.09  ? 282 ASP A N     1 
ATOM   1693 C  CA    . ASP A 1 206 ? -12.717 3.194   -19.262 1.00 95.23  ? 282 ASP A CA    1 
ATOM   1694 C  C     . ASP A 1 206 ? -13.536 1.894   -19.209 1.00 96.69  ? 282 ASP A C     1 
ATOM   1695 O  O     . ASP A 1 206 ? -12.980 0.791   -19.311 1.00 88.14  ? 282 ASP A O     1 
ATOM   1696 C  CB    . ASP A 1 206 ? -11.844 3.227   -20.534 1.00 89.87  ? 282 ASP A CB    1 
ATOM   1697 C  CG    . ASP A 1 206 ? -12.658 3.271   -21.836 1.00 87.39  ? 282 ASP A CG    1 
ATOM   1698 O  OD1   . ASP A 1 206 ? -13.887 3.009   -21.809 1.00 88.32  ? 282 ASP A OD1   1 
ATOM   1699 O  OD2   . ASP A 1 206 ? -12.045 3.561   -22.898 1.00 58.61  ? 282 ASP A OD2   1 
ATOM   1700 N  N     . ARG A 1 207 ? -14.854 2.022   -19.053 1.00 96.68  ? 283 ARG A N     1 
ATOM   1701 C  CA    . ARG A 1 207 ? -15.725 0.844   -18.942 1.00 97.62  ? 283 ARG A CA    1 
ATOM   1702 C  C     . ARG A 1 207 ? -16.580 0.607   -20.195 1.00 92.78  ? 283 ARG A C     1 
ATOM   1703 O  O     . ARG A 1 207 ? -17.109 -0.487  -20.399 1.00 87.77  ? 283 ARG A O     1 
ATOM   1704 C  CB    . ARG A 1 207 ? -16.614 0.930   -17.684 1.00 85.13  ? 283 ARG A CB    1 
ATOM   1705 C  CG    . ARG A 1 207 ? -17.475 -0.319  -17.384 1.00 88.91  ? 283 ARG A CG    1 
ATOM   1706 C  CD    . ARG A 1 207 ? -16.682 -1.500  -16.774 1.00 84.51  ? 283 ARG A CD    1 
ATOM   1707 N  NE    . ARG A 1 207 ? -15.795 -2.190  -17.721 1.00 84.78  ? 283 ARG A NE    1 
ATOM   1708 C  CZ    . ARG A 1 207 ? -15.867 -3.488  -18.023 1.00 79.47  ? 283 ARG A CZ    1 
ATOM   1709 N  NH1   . ARG A 1 207 ? -16.792 -4.256  -17.454 1.00 60.22  ? 283 ARG A NH1   1 
ATOM   1710 N  NH2   . ARG A 1 207 ? -15.011 -4.024  -18.891 1.00 67.63  ? 283 ARG A NH2   1 
ATOM   1711 N  N     . GLU A 1 208 ? -16.696 1.620   -21.048 1.00 89.32  ? 284 GLU A N     1 
ATOM   1712 C  CA    . GLU A 1 208 ? -17.673 1.553   -22.133 1.00 85.21  ? 284 GLU A CA    1 
ATOM   1713 C  C     . GLU A 1 208 ? -17.156 1.050   -23.503 1.00 83.00  ? 284 GLU A C     1 
ATOM   1714 O  O     . GLU A 1 208 ? -17.747 0.131   -24.092 1.00 73.08  ? 284 GLU A O     1 
ATOM   1715 C  CB    . GLU A 1 208 ? -18.454 2.886   -22.247 1.00 86.18  ? 284 GLU A CB    1 
ATOM   1716 C  CG    . GLU A 1 208 ? -17.876 3.967   -23.183 1.00 81.74  ? 284 GLU A CG    1 
ATOM   1717 C  CD    . GLU A 1 208 ? -16.512 4.495   -22.748 1.00 88.57  ? 284 GLU A CD    1 
ATOM   1718 O  OE1   . GLU A 1 208 ? -16.285 4.651   -21.526 1.00 95.11  ? 284 GLU A OE1   1 
ATOM   1719 O  OE2   . GLU A 1 208 ? -15.666 4.759   -23.636 1.00 85.53  ? 284 GLU A OE2   1 
ATOM   1720 N  N     . GLY A 1 209 ? -16.052 1.619   -23.991 1.00 69.98  ? 285 GLY A N     1 
ATOM   1721 C  CA    . GLY A 1 209 ? -15.730 1.531   -25.407 1.00 57.56  ? 285 GLY A CA    1 
ATOM   1722 C  C     . GLY A 1 209 ? -14.523 0.717   -25.836 1.00 54.35  ? 285 GLY A C     1 
ATOM   1723 O  O     . GLY A 1 209 ? -13.783 0.162   -25.011 1.00 49.25  ? 285 GLY A O     1 
ATOM   1724 N  N     . GLY A 1 210 ? -14.337 0.643   -27.153 1.00 42.72  ? 286 GLY A N     1 
ATOM   1725 C  CA    . GLY A 1 210 ? -13.205 -0.049  -27.732 1.00 37.61  ? 286 GLY A CA    1 
ATOM   1726 C  C     . GLY A 1 210 ? -13.462 -0.568  -29.133 1.00 42.30  ? 286 GLY A C     1 
ATOM   1727 O  O     . GLY A 1 210 ? -13.835 0.185   -30.042 1.00 44.37  ? 286 GLY A O     1 
ATOM   1728 N  N     . LEU A 1 211 ? -13.254 -1.867  -29.304 1.00 38.38  ? 287 LEU A N     1 
ATOM   1729 C  CA    . LEU A 1 211 ? -13.441 -2.519  -30.590 1.00 36.48  ? 287 LEU A CA    1 
ATOM   1730 C  C     . LEU A 1 211 ? -14.853 -2.297  -31.128 1.00 43.67  ? 287 LEU A C     1 
ATOM   1731 O  O     . LEU A 1 211 ? -15.043 -2.121  -32.337 1.00 44.20  ? 287 LEU A O     1 
ATOM   1732 C  CB    . LEU A 1 211 ? -13.130 -4.018  -30.477 1.00 32.36  ? 287 LEU A CB    1 
ATOM   1733 C  CG    . LEU A 1 211 ? -13.229 -4.820  -31.775 1.00 37.70  ? 287 LEU A CG    1 
ATOM   1734 C  CD1   . LEU A 1 211 ? -12.292 -4.224  -32.809 1.00 34.20  ? 287 LEU A CD1   1 
ATOM   1735 C  CD2   . LEU A 1 211 ? -12.916 -6.297  -31.547 1.00 41.11  ? 287 LEU A CD2   1 
ATOM   1736 N  N     . ASN A 1 212 ? -15.844 -2.269  -30.235 1.00 43.68  ? 288 ASN A N     1 
ATOM   1737 C  CA    . ASN A 1 212 ? -17.227 -2.115  -30.690 1.00 49.32  ? 288 ASN A CA    1 
ATOM   1738 C  C     . ASN A 1 212 ? -17.748 -0.682  -30.884 1.00 49.33  ? 288 ASN A C     1 
ATOM   1739 O  O     . ASN A 1 212 ? -18.875 -0.495  -31.351 1.00 46.61  ? 288 ASN A O     1 
ATOM   1740 C  CB    . ASN A 1 212 ? -18.209 -2.974  -29.875 1.00 48.37  ? 288 ASN A CB    1 
ATOM   1741 C  CG    . ASN A 1 212 ? -18.160 -2.692  -28.380 1.00 53.42  ? 288 ASN A CG    1 
ATOM   1742 O  OD1   . ASN A 1 212 ? -17.741 -1.620  -27.931 1.00 52.06  ? 288 ASN A OD1   1 
ATOM   1743 N  ND2   . ASN A 1 212 ? -18.595 -3.670  -27.598 1.00 53.81  ? 288 ASN A ND2   1 
ATOM   1744 N  N     . THR A 1 213 ? -16.932 0.324   -30.567 1.00 47.18  ? 289 THR A N     1 
ATOM   1745 C  CA    . THR A 1 213 ? -17.369 1.708   -30.756 1.00 41.13  ? 289 THR A CA    1 
ATOM   1746 C  C     . THR A 1 213 ? -16.447 2.535   -31.636 1.00 45.68  ? 289 THR A C     1 
ATOM   1747 O  O     . THR A 1 213 ? -16.638 3.736   -31.740 1.00 51.19  ? 289 THR A O     1 
ATOM   1748 C  CB    . THR A 1 213 ? -17.492 2.461   -29.432 1.00 37.17  ? 289 THR A CB    1 
ATOM   1749 O  OG1   . THR A 1 213 ? -16.188 2.670   -28.883 1.00 42.54  ? 289 THR A OG1   1 
ATOM   1750 C  CG2   . THR A 1 213 ? -18.329 1.677   -28.442 1.00 52.62  ? 289 THR A CG2   1 
ATOM   1751 N  N     . VAL A 1 214 ? -15.449 1.917   -32.262 1.00 46.66  ? 290 VAL A N     1 
ATOM   1752 C  CA    . VAL A 1 214 ? -14.473 2.702   -33.013 1.00 48.30  ? 290 VAL A CA    1 
ATOM   1753 C  C     . VAL A 1 214 ? -15.061 3.352   -34.277 1.00 43.93  ? 290 VAL A C     1 
ATOM   1754 O  O     . VAL A 1 214 ? -15.663 2.688   -35.125 1.00 45.77  ? 290 VAL A O     1 
ATOM   1755 C  CB    . VAL A 1 214 ? -13.164 1.927   -33.302 1.00 50.20  ? 290 VAL A CB    1 
ATOM   1756 C  CG1   . VAL A 1 214 ? -13.419 0.714   -34.189 1.00 39.14  ? 290 VAL A CG1   1 
ATOM   1757 C  CG2   . VAL A 1 214 ? -12.126 2.866   -33.922 1.00 44.66  ? 290 VAL A CG2   1 
ATOM   1758 N  N     . LYS A 1 215 ? -14.899 4.668   -34.366 1.00 42.79  ? 291 LYS A N     1 
ATOM   1759 C  CA    . LYS A 1 215 ? -15.505 5.473   -35.428 1.00 43.75  ? 291 LYS A CA    1 
ATOM   1760 C  C     . LYS A 1 215 ? -14.456 5.865   -36.451 1.00 44.76  ? 291 LYS A C     1 
ATOM   1761 O  O     . LYS A 1 215 ? -13.503 6.576   -36.118 1.00 43.26  ? 291 LYS A O     1 
ATOM   1762 C  CB    . LYS A 1 215 ? -16.111 6.745   -34.834 1.00 51.12  ? 291 LYS A CB    1 
ATOM   1763 C  CG    . LYS A 1 215 ? -17.262 6.513   -33.896 1.00 48.97  ? 291 LYS A CG    1 
ATOM   1764 C  CD    . LYS A 1 215 ? -18.421 5.851   -34.617 1.00 56.24  ? 291 LYS A CD    1 
ATOM   1765 C  CE    . LYS A 1 215 ? -19.634 5.757   -33.704 1.00 65.37  ? 291 LYS A CE    1 
ATOM   1766 N  NZ    . LYS A 1 215 ? -19.267 5.166   -32.385 1.00 64.79  ? 291 LYS A NZ    1 
ATOM   1767 N  N     . TYR A 1 216 ? -14.627 5.403   -37.690 1.00 46.27  ? 292 TYR A N     1 
ATOM   1768 C  CA    . TYR A 1 216 ? -13.631 5.633   -38.733 1.00 42.22  ? 292 TYR A CA    1 
ATOM   1769 C  C     . TYR A 1 216 ? -14.195 5.323   -40.102 1.00 45.46  ? 292 TYR A C     1 
ATOM   1770 O  O     . TYR A 1 216 ? -15.304 4.824   -40.234 1.00 46.71  ? 292 TYR A O     1 
ATOM   1771 C  CB    . TYR A 1 216 ? -12.435 4.706   -38.528 1.00 45.11  ? 292 TYR A CB    1 
ATOM   1772 C  CG    . TYR A 1 216 ? -12.769 3.263   -38.856 1.00 47.00  ? 292 TYR A CG    1 
ATOM   1773 C  CD1   . TYR A 1 216 ? -13.443 2.462   -37.937 1.00 48.64  ? 292 TYR A CD1   1 
ATOM   1774 C  CD2   . TYR A 1 216 ? -12.429 2.702   -40.087 1.00 45.63  ? 292 TYR A CD2   1 
ATOM   1775 C  CE1   . TYR A 1 216 ? -13.760 1.146   -38.231 1.00 40.29  ? 292 TYR A CE1   1 
ATOM   1776 C  CE2   . TYR A 1 216 ? -12.749 1.380   -40.388 1.00 45.95  ? 292 TYR A CE2   1 
ATOM   1777 C  CZ    . TYR A 1 216 ? -13.416 0.612   -39.449 1.00 41.29  ? 292 TYR A CZ    1 
ATOM   1778 O  OH    . TYR A 1 216 ? -13.744 -0.692  -39.722 1.00 41.99  ? 292 TYR A OH    1 
ATOM   1779 N  N     . HIS A 1 217 ? -13.406 5.598   -41.130 1.00 44.81  ? 293 HIS A N     1 
ATOM   1780 C  CA    . HIS A 1 217 ? -13.642 4.959   -42.415 1.00 49.76  ? 293 HIS A CA    1 
ATOM   1781 C  C     . HIS A 1 217 ? -12.329 4.802   -43.185 1.00 47.42  ? 293 HIS A C     1 
ATOM   1782 O  O     . HIS A 1 217 ? -11.394 5.587   -43.016 1.00 48.68  ? 293 HIS A O     1 
ATOM   1783 C  CB    . HIS A 1 217 ? -14.714 5.689   -43.231 1.00 49.55  ? 293 HIS A CB    1 
ATOM   1784 C  CG    . HIS A 1 217 ? -14.178 6.785   -44.097 1.00 53.50  ? 293 HIS A CG    1 
ATOM   1785 N  ND1   . HIS A 1 217 ? -13.829 8.021   -43.598 1.00 54.75  ? 293 HIS A ND1   1 
ATOM   1786 C  CD2   . HIS A 1 217 ? -13.943 6.832   -45.433 1.00 44.37  ? 293 HIS A CD2   1 
ATOM   1787 C  CE1   . HIS A 1 217 ? -13.397 8.784   -44.589 1.00 62.83  ? 293 HIS A CE1   1 
ATOM   1788 N  NE2   . HIS A 1 217 ? -13.456 8.085   -45.711 1.00 62.53  ? 293 HIS A NE2   1 
ATOM   1789 N  N     . VAL A 1 218 ? -12.246 3.758   -44.000 1.00 48.24  ? 294 VAL A N     1 
ATOM   1790 C  CA    . VAL A 1 218 ? -11.073 3.569   -44.833 1.00 47.95  ? 294 VAL A CA    1 
ATOM   1791 C  C     . VAL A 1 218 ? -11.220 4.416   -46.086 1.00 45.34  ? 294 VAL A C     1 
ATOM   1792 O  O     . VAL A 1 218 ? -12.186 4.270   -46.826 1.00 44.10  ? 294 VAL A O     1 
ATOM   1793 C  CB    . VAL A 1 218 ? -10.877 2.100   -45.211 1.00 45.74  ? 294 VAL A CB    1 
ATOM   1794 C  CG1   . VAL A 1 218 ? -9.550  1.932   -45.916 1.00 41.48  ? 294 VAL A CG1   1 
ATOM   1795 C  CG2   . VAL A 1 218 ? -10.933 1.218   -43.966 1.00 39.93  ? 294 VAL A CG2   1 
ATOM   1796 N  N     . ALA A 1 219 ? -10.264 5.312   -46.309 1.00 46.78  ? 295 ALA A N     1 
ATOM   1797 C  CA    . ALA A 1 219 ? -10.311 6.231   -47.448 1.00 50.11  ? 295 ALA A CA    1 
ATOM   1798 C  C     . ALA A 1 219 ? -9.845  5.520   -48.702 1.00 47.77  ? 295 ALA A C     1 
ATOM   1799 O  O     . ALA A 1 219 ? -10.485 5.568   -49.751 1.00 49.08  ? 295 ALA A O     1 
ATOM   1800 C  CB    . ALA A 1 219 ? -9.435  7.457   -47.186 1.00 39.69  ? 295 ALA A CB    1 
ATOM   1801 N  N     . SER A 1 220 ? -8.707  4.864   -48.586 1.00 44.66  ? 296 SER A N     1 
ATOM   1802 C  CA    . SER A 1 220 ? -8.225  4.048   -49.674 1.00 51.02  ? 296 SER A CA    1 
ATOM   1803 C  C     . SER A 1 220 ? -7.533  2.817   -49.120 1.00 47.84  ? 296 SER A C     1 
ATOM   1804 O  O     . SER A 1 220 ? -7.198  2.740   -47.935 1.00 44.24  ? 296 SER A O     1 
ATOM   1805 C  CB    . SER A 1 220 ? -7.253  4.831   -50.536 1.00 40.91  ? 296 SER A CB    1 
ATOM   1806 O  OG    . SER A 1 220 ? -6.102  5.156   -49.787 1.00 46.78  ? 296 SER A OG    1 
ATOM   1807 N  N     . ARG A 1 221 ? -7.305  1.873   -50.011 1.00 44.17  ? 297 ARG A N     1 
ATOM   1808 C  CA    . ARG A 1 221 ? -6.673  0.616   -49.693 1.00 45.77  ? 297 ARG A CA    1 
ATOM   1809 C  C     . ARG A 1 221 ? -5.720  0.460   -50.860 1.00 49.48  ? 297 ARG A C     1 
ATOM   1810 O  O     . ARG A 1 221 ? -6.152  0.508   -52.015 1.00 48.83  ? 297 ARG A O     1 
ATOM   1811 C  CB    . ARG A 1 221 ? -7.742  -0.477  -49.724 1.00 44.55  ? 297 ARG A CB    1 
ATOM   1812 C  CG    . ARG A 1 221 ? -7.445  -1.721  -48.932 1.00 57.06  ? 297 ARG A CG    1 
ATOM   1813 C  CD    . ARG A 1 221 ? -8.695  -2.597  -48.827 1.00 61.79  ? 297 ARG A CD    1 
ATOM   1814 N  NE    . ARG A 1 221 ? -9.825  -1.853  -48.272 1.00 61.88  ? 297 ARG A NE    1 
ATOM   1815 C  CZ    . ARG A 1 221 ? -10.375 -2.098  -47.085 1.00 63.19  ? 297 ARG A CZ    1 
ATOM   1816 N  NH1   . ARG A 1 221 ? -9.909  -3.091  -46.331 1.00 57.57  ? 297 ARG A NH1   1 
ATOM   1817 N  NH2   . ARG A 1 221 ? -11.401 -1.360  -46.657 1.00 51.73  ? 297 ARG A NH2   1 
ATOM   1818 N  N     . THR A 1 222 ? -4.426  0.323   -50.588 1.00 44.66  ? 298 THR A N     1 
ATOM   1819 C  CA    . THR A 1 222 ? -3.466  0.169   -51.679 1.00 43.85  ? 298 THR A CA    1 
ATOM   1820 C  C     . THR A 1 222 ? -2.467  -0.986  -51.495 1.00 47.99  ? 298 THR A C     1 
ATOM   1821 O  O     . THR A 1 222 ? -1.828  -1.120  -50.443 1.00 42.85  ? 298 THR A O     1 
ATOM   1822 C  CB    . THR A 1 222 ? -2.723  1.501   -51.982 1.00 49.11  ? 298 THR A CB    1 
ATOM   1823 O  OG1   . THR A 1 222 ? -1.609  1.246   -52.841 1.00 55.25  ? 298 THR A OG1   1 
ATOM   1824 C  CG2   . THR A 1 222 ? -2.205  2.106   -50.733 1.00 46.30  ? 298 THR A CG2   1 
ATOM   1825 N  N     . ALA A 1 223 ? -2.335  -1.820  -52.528 1.00 45.30  ? 299 ALA A N     1 
ATOM   1826 C  CA    . ALA A 1 223 ? -1.329  -2.875  -52.505 1.00 43.37  ? 299 ALA A CA    1 
ATOM   1827 C  C     . ALA A 1 223 ? 0.027   -2.229  -52.661 1.00 42.56  ? 299 ALA A C     1 
ATOM   1828 O  O     . ALA A 1 223 ? 0.240   -1.416  -53.552 1.00 45.48  ? 299 ALA A O     1 
ATOM   1829 C  CB    . ALA A 1 223 ? -1.569  -3.914  -53.619 1.00 33.16  ? 299 ALA A CB    1 
ATOM   1830 N  N     . LEU A 1 224 ? 0.952   -2.586  -51.789 1.00 45.96  ? 300 LEU A N     1 
ATOM   1831 C  CA    . LEU A 1 224 ? 2.278   -1.990  -51.829 1.00 39.02  ? 300 LEU A CA    1 
ATOM   1832 C  C     . LEU A 1 224 ? 3.309   -3.098  -51.744 1.00 41.33  ? 300 LEU A C     1 
ATOM   1833 O  O     . LEU A 1 224 ? 3.210   -3.974  -50.887 1.00 40.32  ? 300 LEU A O     1 
ATOM   1834 C  CB    . LEU A 1 224 ? 2.451   -1.062  -50.635 1.00 44.89  ? 300 LEU A CB    1 
ATOM   1835 C  CG    . LEU A 1 224 ? 3.679   -0.172  -50.635 1.00 46.23  ? 300 LEU A CG    1 
ATOM   1836 C  CD1   . LEU A 1 224 ? 3.517   0.830   -51.750 1.00 46.52  ? 300 LEU A CD1   1 
ATOM   1837 C  CD2   . LEU A 1 224 ? 3.814   0.526   -49.303 1.00 38.25  ? 300 LEU A CD2   1 
ATOM   1838 N  N     . SER A 1 225 ? 4.295   -3.080  -52.629 1.00 36.76  ? 301 SER A N     1 
ATOM   1839 C  CA    . SER A 1 225 ? 5.371   -4.033  -52.505 1.00 41.01  ? 301 SER A CA    1 
ATOM   1840 C  C     . SER A 1 225 ? 6.667   -3.287  -52.204 1.00 45.02  ? 301 SER A C     1 
ATOM   1841 O  O     . SER A 1 225 ? 7.018   -2.337  -52.896 1.00 48.18  ? 301 SER A O     1 
ATOM   1842 C  CB    . SER A 1 225 ? 5.473   -4.885  -53.772 1.00 45.80  ? 301 SER A CB    1 
ATOM   1843 O  OG    . SER A 1 225 ? 6.346   -5.973  -53.566 1.00 50.29  ? 301 SER A OG    1 
ATOM   1844 N  N     . VAL A 1 226 ? 7.367   -3.710  -51.159 1.00 45.07  ? 302 VAL A N     1 
ATOM   1845 C  CA    . VAL A 1 226 ? 8.593   -3.046  -50.740 1.00 42.96  ? 302 VAL A CA    1 
ATOM   1846 C  C     . VAL A 1 226 ? 9.756   -3.990  -50.916 1.00 53.35  ? 302 VAL A C     1 
ATOM   1847 O  O     . VAL A 1 226 ? 9.969   -4.882  -50.093 1.00 53.72  ? 302 VAL A O     1 
ATOM   1848 C  CB    . VAL A 1 226 ? 8.524   -2.642  -49.256 1.00 45.73  ? 302 VAL A CB    1 
ATOM   1849 C  CG1   . VAL A 1 226 ? 9.857   -2.063  -48.781 1.00 39.59  ? 302 VAL A CG1   1 
ATOM   1850 C  CG2   . VAL A 1 226 ? 7.388   -1.664  -49.025 1.00 38.81  ? 302 VAL A CG2   1 
ATOM   1851 N  N     . GLY A 1 227 ? 10.497  -3.804  -52.002 1.00 53.12  ? 303 GLY A N     1 
ATOM   1852 C  CA    . GLY A 1 227 ? 11.617  -4.668  -52.313 1.00 48.22  ? 303 GLY A CA    1 
ATOM   1853 C  C     . GLY A 1 227 ? 11.208  -6.123  -52.320 1.00 52.36  ? 303 GLY A C     1 
ATOM   1854 O  O     . GLY A 1 227 ? 11.809  -6.937  -51.624 1.00 52.88  ? 303 GLY A O     1 
ATOM   1855 N  N     . GLY A 1 228 ? 10.169  -6.438  -53.088 1.00 50.39  ? 304 GLY A N     1 
ATOM   1856 C  CA    . GLY A 1 228 ? 9.657   -7.793  -53.184 1.00 51.04  ? 304 GLY A CA    1 
ATOM   1857 C  C     . GLY A 1 228 ? 8.578   -8.127  -52.155 1.00 49.02  ? 304 GLY A C     1 
ATOM   1858 O  O     . GLY A 1 228 ? 7.612   -8.820  -52.467 1.00 44.39  ? 304 GLY A O     1 
ATOM   1859 N  N     . ALA A 1 229 ? 8.737   -7.624  -50.933 1.00 46.55  ? 305 ALA A N     1 
ATOM   1860 C  CA    . ALA A 1 229 ? 7.814   -7.942  -49.833 1.00 46.67  ? 305 ALA A CA    1 
ATOM   1861 C  C     . ALA A 1 229 ? 6.533   -7.133  -49.922 1.00 46.85  ? 305 ALA A C     1 
ATOM   1862 O  O     . ALA A 1 229 ? 6.573   -5.900  -49.900 1.00 49.01  ? 305 ALA A O     1 
ATOM   1863 C  CB    . ALA A 1 229 ? 8.484   -7.700  -48.489 1.00 38.29  ? 305 ALA A CB    1 
ATOM   1864 N  N     . PRO A 1 230 ? 5.389   -7.821  -50.022 1.00 37.65  ? 306 PRO A N     1 
ATOM   1865 C  CA    . PRO A 1 230 ? 4.097   -7.151  -50.197 1.00 35.75  ? 306 PRO A CA    1 
ATOM   1866 C  C     . PRO A 1 230 ? 3.465   -6.746  -48.860 1.00 42.85  ? 306 PRO A C     1 
ATOM   1867 O  O     . PRO A 1 230 ? 3.817   -7.276  -47.809 1.00 42.12  ? 306 PRO A O     1 
ATOM   1868 C  CB    . PRO A 1 230 ? 3.249   -8.235  -50.859 1.00 36.25  ? 306 PRO A CB    1 
ATOM   1869 C  CG    . PRO A 1 230 ? 3.777   -9.507  -50.260 1.00 37.73  ? 306 PRO A CG    1 
ATOM   1870 C  CD    . PRO A 1 230 ? 5.253   -9.290  -50.008 1.00 41.56  ? 306 PRO A CD    1 
ATOM   1871 N  N     . CYS A 1 231 ? 2.540   -5.797  -48.915 1.00 40.31  ? 307 CYS A N     1 
ATOM   1872 C  CA    . CYS A 1 231 ? 1.746   -5.414  -47.763 1.00 36.42  ? 307 CYS A CA    1 
ATOM   1873 C  C     . CYS A 1 231 ? 0.501   -4.691  -48.244 1.00 42.31  ? 307 CYS A C     1 
ATOM   1874 O  O     . CYS A 1 231 ? 0.355   -4.398  -49.433 1.00 39.78  ? 307 CYS A O     1 
ATOM   1875 C  CB    . CYS A 1 231 ? 2.546   -4.570  -46.757 1.00 37.35  ? 307 CYS A CB    1 
ATOM   1876 S  SG    . CYS A 1 231 ? 3.077   -2.900  -47.252 1.00 42.79  ? 307 CYS A SG    1 
ATOM   1877 N  N     . THR A 1 232 ? -0.412  -4.436  -47.324 1.00 42.57  ? 308 THR A N     1 
ATOM   1878 C  CA    . THR A 1 232 ? -1.612  -3.693  -47.648 1.00 43.32  ? 308 THR A CA    1 
ATOM   1879 C  C     . THR A 1 232 ? -1.657  -2.414  -46.810 1.00 38.75  ? 308 THR A C     1 
ATOM   1880 O  O     . THR A 1 232 ? -1.716  -2.460  -45.579 1.00 35.78  ? 308 THR A O     1 
ATOM   1881 C  CB    . THR A 1 232 ? -2.873  -4.553  -47.410 1.00 38.02  ? 308 THR A CB    1 
ATOM   1882 O  OG1   . THR A 1 232 ? -2.879  -5.643  -48.333 1.00 44.02  ? 308 THR A OG1   1 
ATOM   1883 C  CG2   . THR A 1 232 ? -4.148  -3.735  -47.605 1.00 41.37  ? 308 THR A CG2   1 
ATOM   1884 N  N     . VAL A 1 233 ? -1.605  -1.267  -47.477 1.00 43.60  ? 309 VAL A N     1 
ATOM   1885 C  CA    . VAL A 1 233 ? -1.757  -0.000  -46.773 1.00 34.74  ? 309 VAL A CA    1 
ATOM   1886 C  C     . VAL A 1 233 ? -3.228  0.348   -46.708 1.00 38.02  ? 309 VAL A C     1 
ATOM   1887 O  O     . VAL A 1 233 ? -3.904  0.387   -47.735 1.00 40.40  ? 309 VAL A O     1 
ATOM   1888 C  CB    . VAL A 1 233 ? -0.994  1.150   -47.449 1.00 42.49  ? 309 VAL A CB    1 
ATOM   1889 C  CG1   . VAL A 1 233 ? -1.260  2.456   -46.695 1.00 39.46  ? 309 VAL A CG1   1 
ATOM   1890 C  CG2   . VAL A 1 233 ? 0.511   0.838   -47.512 1.00 33.77  ? 309 VAL A CG2   1 
ATOM   1891 N  N     . LEU A 1 234 ? -3.722  0.550   -45.486 1.00 36.46  ? 310 LEU A N     1 
ATOM   1892 C  CA    . LEU A 1 234 ? -5.074  1.044   -45.247 1.00 40.00  ? 310 LEU A CA    1 
ATOM   1893 C  C     . LEU A 1 234 ? -4.999  2.536   -44.885 1.00 37.09  ? 310 LEU A C     1 
ATOM   1894 O  O     . LEU A 1 234 ? -4.361  2.903   -43.904 1.00 32.21  ? 310 LEU A O     1 
ATOM   1895 C  CB    . LEU A 1 234 ? -5.733  0.276   -44.097 1.00 31.88  ? 310 LEU A CB    1 
ATOM   1896 C  CG    . LEU A 1 234 ? -5.910  -1.225  -44.274 1.00 39.80  ? 310 LEU A CG    1 
ATOM   1897 C  CD1   . LEU A 1 234 ? -6.690  -1.806  -43.103 1.00 42.30  ? 310 LEU A CD1   1 
ATOM   1898 C  CD2   . LEU A 1 234 ? -6.613  -1.524  -45.570 1.00 42.36  ? 310 LEU A CD2   1 
ATOM   1899 N  N     . ASN A 1 235 ? -5.603  3.393   -45.703 1.00 34.79  ? 311 ASN A N     1 
ATOM   1900 C  CA    . ASN A 1 235 ? -5.656  4.814   -45.378 1.00 43.86  ? 311 ASN A CA    1 
ATOM   1901 C  C     . ASN A 1 235 ? -6.865  5.044   -44.494 1.00 40.11  ? 311 ASN A C     1 
ATOM   1902 O  O     . ASN A 1 235 ? -8.013  4.919   -44.937 1.00 38.18  ? 311 ASN A O     1 
ATOM   1903 C  CB    . ASN A 1 235 ? -5.714  5.679   -46.638 1.00 43.37  ? 311 ASN A CB    1 
ATOM   1904 C  CG    . ASN A 1 235 ? -4.333  5.977   -47.209 1.00 44.65  ? 311 ASN A CG    1 
ATOM   1905 O  OD1   . ASN A 1 235 ? -3.323  5.449   -46.743 1.00 42.05  ? 311 ASN A OD1   1 
ATOM   1906 N  ND2   . ASN A 1 235 ? -4.286  6.853   -48.208 1.00 50.19  ? 311 ASN A ND2   1 
ATOM   1907 N  N     . ILE A 1 236 ? -6.594  5.347   -43.232 1.00 34.24  ? 312 ILE A N     1 
ATOM   1908 C  CA    . ILE A 1 236 ? -7.632  5.339   -42.214 1.00 40.34  ? 312 ILE A CA    1 
ATOM   1909 C  C     . ILE A 1 236 ? -7.938  6.752   -41.705 1.00 41.95  ? 312 ILE A C     1 
ATOM   1910 O  O     . ILE A 1 236 ? -7.045  7.460   -41.236 1.00 34.61  ? 312 ILE A O     1 
ATOM   1911 C  CB    . ILE A 1 236 ? -7.228  4.423   -41.041 1.00 35.13  ? 312 ILE A CB    1 
ATOM   1912 C  CG1   . ILE A 1 236 ? -7.136  2.966   -41.516 1.00 38.05  ? 312 ILE A CG1   1 
ATOM   1913 C  CG2   . ILE A 1 236 ? -8.220  4.552   -39.897 1.00 38.27  ? 312 ILE A CG2   1 
ATOM   1914 C  CD1   . ILE A 1 236 ? -6.170  2.114   -40.708 1.00 34.44  ? 312 ILE A CD1   1 
ATOM   1915 N  N     . MET A 1 237 ? -9.204  7.147   -41.830 1.00 42.45  ? 313 MET A N     1 
ATOM   1916 C  CA    . MET A 1 237 ? -9.706  8.405   -41.283 1.00 44.08  ? 313 MET A CA    1 
ATOM   1917 C  C     . MET A 1 237 ? -10.415 8.113   -39.965 1.00 42.90  ? 313 MET A C     1 
ATOM   1918 O  O     . MET A 1 237 ? -11.534 7.600   -39.962 1.00 46.74  ? 313 MET A O     1 
ATOM   1919 C  CB    . MET A 1 237 ? -10.716 9.036   -42.249 1.00 47.07  ? 313 MET A CB    1 
ATOM   1920 C  CG    . MET A 1 237 ? -10.156 9.498   -43.592 1.00 54.69  ? 313 MET A CG    1 
ATOM   1921 S  SD    . MET A 1 237 ? -9.289  11.069  -43.458 1.00 60.33  ? 313 MET A SD    1 
ATOM   1922 C  CE    . MET A 1 237 ? -10.614 12.151  -42.949 1.00 45.68  ? 313 MET A CE    1 
ATOM   1923 N  N     . LEU A 1 238 ? -9.771  8.425   -38.848 1.00 44.96  ? 314 LEU A N     1 
ATOM   1924 C  CA    . LEU A 1 238 ? -10.385 8.211   -37.531 1.00 45.67  ? 314 LEU A CA    1 
ATOM   1925 C  C     . LEU A 1 238 ? -11.249 9.402   -37.137 1.00 46.21  ? 314 LEU A C     1 
ATOM   1926 O  O     . LEU A 1 238 ? -10.803 10.547  -37.189 1.00 45.62  ? 314 LEU A O     1 
ATOM   1927 C  CB    . LEU A 1 238 ? -9.308  8.032   -36.462 1.00 40.07  ? 314 LEU A CB    1 
ATOM   1928 C  CG    . LEU A 1 238 ? -8.356  6.857   -36.606 1.00 38.40  ? 314 LEU A CG    1 
ATOM   1929 C  CD1   . LEU A 1 238 ? -7.301  6.932   -35.530 1.00 31.63  ? 314 LEU A CD1   1 
ATOM   1930 C  CD2   . LEU A 1 238 ? -9.143  5.558   -36.532 1.00 37.69  ? 314 LEU A CD2   1 
ATOM   1931 N  N     . ASP A 1 239 ? -12.485 9.140   -36.749 1.00 47.28  ? 315 ASP A N     1 
ATOM   1932 C  CA    A ASP A 1 239 ? -13.369 10.193  -36.260 0.55 50.53  ? 315 ASP A CA    1 
ATOM   1933 C  CA    B ASP A 1 239 ? -13.356 10.202  -36.275 0.45 50.52  ? 315 ASP A CA    1 
ATOM   1934 C  C     . ASP A 1 239 ? -12.979 10.591  -34.844 1.00 50.43  ? 315 ASP A C     1 
ATOM   1935 O  O     . ASP A 1 239 ? -12.450 9.782   -34.086 1.00 49.50  ? 315 ASP A O     1 
ATOM   1936 C  CB    A ASP A 1 239 ? -14.829 9.732   -36.284 0.55 48.89  ? 315 ASP A CB    1 
ATOM   1937 C  CB    B ASP A 1 239 ? -14.822 9.769   -36.366 0.45 48.92  ? 315 ASP A CB    1 
ATOM   1938 C  CG    A ASP A 1 239 ? -15.776 10.754  -35.675 0.55 50.34  ? 315 ASP A CG    1 
ATOM   1939 C  CG    B ASP A 1 239 ? -15.262 9.497   -37.801 0.45 50.15  ? 315 ASP A CG    1 
ATOM   1940 O  OD1   A ASP A 1 239 ? -15.511 11.970  -35.804 0.55 52.95  ? 315 ASP A OD1   1 
ATOM   1941 O  OD1   B ASP A 1 239 ? -14.391 9.398   -38.691 0.45 47.84  ? 315 ASP A OD1   1 
ATOM   1942 O  OD2   A ASP A 1 239 ? -16.784 10.340  -35.064 0.55 54.00  ? 315 ASP A OD2   1 
ATOM   1943 O  OD2   B ASP A 1 239 ? -16.481 9.372   -38.041 0.45 53.18  ? 315 ASP A OD2   1 
ATOM   1944 N  N     . CYS A 1 240 ? -13.231 11.844  -34.488 1.00 56.27  ? 316 CYS A N     1 
ATOM   1945 C  CA    . CYS A 1 240 ? -13.007 12.299  -33.119 1.00 56.51  ? 316 CYS A CA    1 
ATOM   1946 C  C     . CYS A 1 240 ? -14.236 13.038  -32.612 1.00 53.19  ? 316 CYS A C     1 
ATOM   1947 O  O     . CYS A 1 240 ? -14.650 14.042  -33.193 1.00 61.05  ? 316 CYS A O     1 
ATOM   1948 C  CB    . CYS A 1 240 ? -11.758 13.189  -33.011 1.00 52.85  ? 316 CYS A CB    1 
ATOM   1949 S  SG    . CYS A 1 240 ? -11.554 14.034  -31.391 1.00 55.38  ? 316 CYS A SG    1 
ATOM   1950 N  N     . ASP A 1 241 ? -14.829 12.511  -31.548 1.00 56.75  ? 317 ASP A N     1 
ATOM   1951 C  CA    . ASP A 1 241 ? -15.861 13.210  -30.793 1.00 59.51  ? 317 ASP A CA    1 
ATOM   1952 C  C     . ASP A 1 241 ? -15.119 14.207  -29.919 1.00 55.89  ? 317 ASP A C     1 
ATOM   1953 O  O     . ASP A 1 241 ? -14.562 13.834  -28.887 1.00 58.01  ? 317 ASP A O     1 
ATOM   1954 C  CB    . ASP A 1 241 ? -16.647 12.207  -29.923 1.00 72.08  ? 317 ASP A CB    1 
ATOM   1955 C  CG    . ASP A 1 241 ? -17.777 12.862  -29.110 1.00 67.46  ? 317 ASP A CG    1 
ATOM   1956 O  OD1   . ASP A 1 241 ? -17.479 13.673  -28.208 1.00 65.97  ? 317 ASP A OD1   1 
ATOM   1957 O  OD2   . ASP A 1 241 ? -18.964 12.538  -29.355 1.00 57.97  ? 317 ASP A OD2   1 
ATOM   1958 N  N     . LYS A 1 242 ? -15.091 15.471  -30.329 1.00 57.75  ? 318 LYS A N     1 
ATOM   1959 C  CA    . LYS A 1 242 ? -14.265 16.452  -29.636 1.00 56.61  ? 318 LYS A CA    1 
ATOM   1960 C  C     . LYS A 1 242 ? -14.792 16.770  -28.238 1.00 65.41  ? 318 LYS A C     1 
ATOM   1961 O  O     . LYS A 1 242 ? -14.081 17.352  -27.411 1.00 60.37  ? 318 LYS A O     1 
ATOM   1962 C  CB    . LYS A 1 242 ? -14.122 17.720  -30.474 1.00 62.89  ? 318 LYS A CB    1 
ATOM   1963 C  CG    . LYS A 1 242 ? -13.892 17.435  -31.940 1.00 61.11  ? 318 LYS A CG    1 
ATOM   1964 C  CD    . LYS A 1 242 ? -13.096 18.541  -32.607 1.00 59.03  ? 318 LYS A CD    1 
ATOM   1965 C  CE    . LYS A 1 242 ? -12.806 18.170  -34.051 1.00 59.95  ? 318 LYS A CE    1 
ATOM   1966 N  NZ    . LYS A 1 242 ? -11.973 19.192  -34.749 1.00 69.93  ? 318 LYS A NZ    1 
ATOM   1967 N  N     . THR A 1 243 ? -16.035 16.371  -27.975 1.00 65.63  ? 319 THR A N     1 
ATOM   1968 C  CA    . THR A 1 243 ? -16.640 16.566  -26.660 1.00 68.95  ? 319 THR A CA    1 
ATOM   1969 C  C     . THR A 1 243 ? -16.047 15.597  -25.633 1.00 67.62  ? 319 THR A C     1 
ATOM   1970 O  O     . THR A 1 243 ? -15.666 15.999  -24.533 1.00 68.64  ? 319 THR A O     1 
ATOM   1971 C  CB    . THR A 1 243 ? -18.180 16.390  -26.693 1.00 66.40  ? 319 THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 243 ? -18.746 17.237  -27.699 1.00 65.85  ? 319 THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 243 ? -18.786 16.750  -25.344 1.00 66.45  ? 319 THR A CG2   1 
ATOM   1974 N  N     . ALA A 1 244 ? -15.977 14.320  -25.997 1.00 65.81  ? 320 ALA A N     1 
ATOM   1975 C  CA    . ALA A 1 244 ? -15.437 13.291  -25.107 1.00 57.64  ? 320 ALA A CA    1 
ATOM   1976 C  C     . ALA A 1 244 ? -13.920 13.413  -24.914 1.00 64.16  ? 320 ALA A C     1 
ATOM   1977 O  O     . ALA A 1 244 ? -13.415 13.302  -23.795 1.00 62.45  ? 320 ALA A O     1 
ATOM   1978 C  CB    . ALA A 1 244 ? -15.801 11.914  -25.622 1.00 63.08  ? 320 ALA A CB    1 
ATOM   1979 N  N     . THR A 1 245 ? -13.200 13.644  -26.011 1.00 68.59  ? 321 THR A N     1 
ATOM   1980 C  CA    . THR A 1 245 ? -11.740 13.728  -25.984 1.00 64.88  ? 321 THR A CA    1 
ATOM   1981 C  C     . THR A 1 245 ? -11.230 14.939  -26.775 1.00 65.09  ? 321 THR A C     1 
ATOM   1982 O  O     . THR A 1 245 ? -10.827 14.808  -27.932 1.00 58.06  ? 321 THR A O     1 
ATOM   1983 C  CB    . THR A 1 245 ? -11.102 12.450  -26.571 1.00 58.59  ? 321 THR A CB    1 
ATOM   1984 O  OG1   . THR A 1 245 ? -11.538 12.282  -27.926 1.00 56.69  ? 321 THR A OG1   1 
ATOM   1985 C  CG2   . THR A 1 245 ? -11.506 11.222  -25.766 1.00 55.87  ? 321 THR A CG2   1 
ATOM   1986 N  N     . PRO A 1 246 ? -11.240 16.129  -26.149 1.00 65.19  ? 322 PRO A N     1 
ATOM   1987 C  CA    . PRO A 1 246 ? -10.786 17.354  -26.821 1.00 61.14  ? 322 PRO A CA    1 
ATOM   1988 C  C     . PRO A 1 246 ? -9.294  17.320  -27.150 1.00 62.38  ? 322 PRO A C     1 
ATOM   1989 O  O     . PRO A 1 246 ? -8.835  18.106  -27.988 1.00 65.20  ? 322 PRO A O     1 
ATOM   1990 C  CB    . PRO A 1 246 ? -11.039 18.443  -25.779 1.00 56.77  ? 322 PRO A CB    1 
ATOM   1991 C  CG    . PRO A 1 246 ? -11.938 17.831  -24.760 1.00 54.69  ? 322 PRO A CG    1 
ATOM   1992 C  CD    . PRO A 1 246 ? -11.647 16.379  -24.759 1.00 63.11  ? 322 PRO A CD    1 
ATOM   1993 N  N     . TRP A 1 247 ? -8.551  16.426  -26.497 1.00 55.34  ? 323 TRP A N     1 
ATOM   1994 C  CA    . TRP A 1 247 ? -7.100  16.373  -26.648 1.00 56.79  ? 323 TRP A CA    1 
ATOM   1995 C  C     . TRP A 1 247 ? -6.687  15.674  -27.949 1.00 56.71  ? 323 TRP A C     1 
ATOM   1996 O  O     . TRP A 1 247 ? -5.505  15.408  -28.180 1.00 48.21  ? 323 TRP A O     1 
ATOM   1997 C  CB    . TRP A 1 247 ? -6.445  15.714  -25.427 1.00 54.35  ? 323 TRP A CB    1 
ATOM   1998 C  CG    . TRP A 1 247 ? -6.976  14.344  -25.081 1.00 67.37  ? 323 TRP A CG    1 
ATOM   1999 C  CD1   . TRP A 1 247 ? -6.526  13.137  -25.557 1.00 64.57  ? 323 TRP A CD1   1 
ATOM   2000 C  CD2   . TRP A 1 247 ? -8.041  14.039  -24.169 1.00 66.20  ? 323 TRP A CD2   1 
ATOM   2001 N  NE1   . TRP A 1 247 ? -7.253  12.106  -25.002 1.00 61.22  ? 323 TRP A NE1   1 
ATOM   2002 C  CE2   . TRP A 1 247 ? -8.188  12.634  -24.149 1.00 65.87  ? 323 TRP A CE2   1 
ATOM   2003 C  CE3   . TRP A 1 247 ? -8.889  14.816  -23.376 1.00 67.43  ? 323 TRP A CE3   1 
ATOM   2004 C  CZ2   . TRP A 1 247 ? -9.144  11.995  -23.364 1.00 68.93  ? 323 TRP A CZ2   1 
ATOM   2005 C  CZ3   . TRP A 1 247 ? -9.841  14.179  -22.599 1.00 67.89  ? 323 TRP A CZ3   1 
ATOM   2006 C  CH2   . TRP A 1 247 ? -9.960  12.784  -22.598 1.00 73.36  ? 323 TRP A CH2   1 
ATOM   2007 N  N     . CYS A 1 248 ? -7.673  15.401  -28.797 1.00 50.13  ? 324 CYS A N     1 
ATOM   2008 C  CA    . CYS A 1 248 ? -7.440  14.737  -30.067 1.00 52.53  ? 324 CYS A CA    1 
ATOM   2009 C  C     . CYS A 1 248 ? -6.834  15.668  -31.098 1.00 52.47  ? 324 CYS A C     1 
ATOM   2010 O  O     . CYS A 1 248 ? -6.095  15.221  -31.973 1.00 45.32  ? 324 CYS A O     1 
ATOM   2011 C  CB    . CYS A 1 248 ? -8.738  14.137  -30.614 1.00 50.38  ? 324 CYS A CB    1 
ATOM   2012 S  SG    . CYS A 1 248 ? -9.963  15.312  -31.218 1.00 47.58  ? 324 CYS A SG    1 
ATOM   2013 N  N     . THR A 1 249 ? -7.143  16.958  -30.990 1.00 53.08  ? 325 THR A N     1 
ATOM   2014 C  CA    . THR A 1 249 ? -6.729  17.920  -32.008 1.00 45.97  ? 325 THR A CA    1 
ATOM   2015 C  C     . THR A 1 249 ? -5.429  18.626  -31.689 1.00 53.46  ? 325 THR A C     1 
ATOM   2016 O  O     . THR A 1 249 ? -4.846  18.457  -30.616 1.00 52.84  ? 325 THR A O     1 
ATOM   2017 C  CB    . THR A 1 249 ? -7.772  19.023  -32.234 1.00 43.89  ? 325 THR A CB    1 
ATOM   2018 O  OG1   . THR A 1 249 ? -8.071  19.639  -30.978 1.00 61.08  ? 325 THR A OG1   1 
ATOM   2019 C  CG2   . THR A 1 249 ? -9.047  18.462  -32.852 1.00 46.67  ? 325 THR A CG2   1 
ATOM   2020 N  N     . PHE A 1 250 ? -5.012  19.446  -32.649 1.00 71.84  ? 326 PHE A N     1 
ATOM   2021 C  CA    . PHE A 1 250 ? -3.809  20.265  -32.543 1.00 71.24  ? 326 PHE A CA    1 
ATOM   2022 C  C     . PHE A 1 250 ? -2.579  19.364  -32.345 1.00 69.43  ? 326 PHE A C     1 
ATOM   2023 O  O     . PHE A 1 250 ? -2.195  19.033  -31.219 1.00 69.41  ? 326 PHE A O     1 
ATOM   2024 C  CB    . PHE A 1 250 ? -4.045  21.466  -31.581 1.00 53.26  ? 326 PHE A CB    1 
ATOM   2025 C  CG    . PHE A 1 250 ? -2.987  21.696  -30.523 1.00 66.38  ? 326 PHE A CG    1 
ATOM   2026 C  CD1   . PHE A 1 250 ? -1.643  21.865  -30.844 1.00 71.45  ? 326 PHE A CD1   1 
ATOM   2027 C  CD2   . PHE A 1 250 ? -3.374  21.856  -29.194 1.00 73.82  ? 326 PHE A CD2   1 
ATOM   2028 C  CE1   . PHE A 1 250 ? -0.700  22.103  -29.855 1.00 72.76  ? 326 PHE A CE1   1 
ATOM   2029 C  CE2   . PHE A 1 250 ? -2.442  22.106  -28.200 1.00 75.23  ? 326 PHE A CE2   1 
ATOM   2030 C  CZ    . PHE A 1 250 ? -1.103  22.227  -28.530 1.00 79.25  ? 326 PHE A CZ    1 
ATOM   2031 N  N     . SER A 1 251 ? -2.060  18.944  -33.511 1.00 71.70  ? 327 SER A N     1 
ATOM   2032 C  CA    . SER A 1 251 ? -0.875  18.092  -33.778 1.00 61.59  ? 327 SER A CA    1 
ATOM   2033 C  C     . SER A 1 251 ? -1.209  16.885  -34.682 1.00 66.99  ? 327 SER A C     1 
ATOM   2034 O  O     . SER A 1 251 ? -2.235  16.871  -35.380 1.00 59.30  ? 327 SER A O     1 
ATOM   2035 C  CB    . SER A 1 251 ? -0.116  17.639  -32.525 1.00 67.14  ? 327 SER A CB    1 
ATOM   2036 O  OG    . SER A 1 251 ? 1.043   16.901  -32.881 1.00 76.85  ? 327 SER A OG    1 
ATOM   2037 O  OXT   . SER A 1 251 ? -0.459  15.895  -34.754 1.00 57.71  ? 327 SER A OXT   1 
ATOM   2038 N  N     . ALA B 1 12  ? -3.406  5.971   0.717   1.00 59.23  ? 88  ALA B N     1 
ATOM   2039 C  CA    . ALA B 1 12  ? -2.980  4.865   1.583   1.00 79.43  ? 88  ALA B CA    1 
ATOM   2040 C  C     . ALA B 1 12  ? -3.376  3.502   1.005   1.00 83.66  ? 88  ALA B C     1 
ATOM   2041 O  O     . ALA B 1 12  ? -4.355  2.890   1.445   1.00 77.83  ? 88  ALA B O     1 
ATOM   2042 C  CB    . ALA B 1 12  ? -3.541  5.035   2.995   1.00 82.33  ? 88  ALA B CB    1 
ATOM   2043 N  N     . SER B 1 13  ? -2.591  3.036   0.032   1.00 82.19  ? 89  SER B N     1 
ATOM   2044 C  CA    . SER B 1 13  ? -2.924  1.850   -0.755  1.00 78.77  ? 89  SER B CA    1 
ATOM   2045 C  C     . SER B 1 13  ? -2.582  0.526   -0.072  1.00 80.12  ? 89  SER B C     1 
ATOM   2046 O  O     . SER B 1 13  ? -1.588  0.414   0.652   1.00 78.10  ? 89  SER B O     1 
ATOM   2047 C  CB    . SER B 1 13  ? -2.266  1.916   -2.135  1.00 80.22  ? 89  SER B CB    1 
ATOM   2048 O  OG    . SER B 1 13  ? -2.695  0.841   -2.956  1.00 82.03  ? 89  SER B OG    1 
ATOM   2049 N  N     . TRP B 1 14  ? -3.420  -0.474  -0.342  1.00 81.98  ? 90  TRP B N     1 
ATOM   2050 C  CA    . TRP B 1 14  ? -3.375  -1.779  0.314   1.00 79.86  ? 90  TRP B CA    1 
ATOM   2051 C  C     . TRP B 1 14  ? -2.925  -2.894  -0.629  1.00 74.57  ? 90  TRP B C     1 
ATOM   2052 O  O     . TRP B 1 14  ? -3.487  -3.994  -0.608  1.00 71.62  ? 90  TRP B O     1 
ATOM   2053 C  CB    . TRP B 1 14  ? -4.774  -2.144  0.820   1.00 80.99  ? 90  TRP B CB    1 
ATOM   2054 C  CG    . TRP B 1 14  ? -5.280  -1.348  1.991   1.00 76.47  ? 90  TRP B CG    1 
ATOM   2055 C  CD1   . TRP B 1 14  ? -4.538  -0.642  2.895   1.00 79.37  ? 90  TRP B CD1   1 
ATOM   2056 C  CD2   . TRP B 1 14  ? -6.650  -1.191  2.385   1.00 73.04  ? 90  TRP B CD2   1 
ATOM   2057 N  NE1   . TRP B 1 14  ? -5.364  -0.060  3.831   1.00 76.20  ? 90  TRP B NE1   1 
ATOM   2058 C  CE2   . TRP B 1 14  ? -6.665  -0.380  3.537   1.00 72.09  ? 90  TRP B CE2   1 
ATOM   2059 C  CE3   . TRP B 1 14  ? -7.866  -1.661  1.875   1.00 68.68  ? 90  TRP B CE3   1 
ATOM   2060 C  CZ2   . TRP B 1 14  ? -7.846  -0.028  4.186   1.00 75.60  ? 90  TRP B CZ2   1 
ATOM   2061 C  CZ3   . TRP B 1 14  ? -9.036  -1.313  2.522   1.00 65.91  ? 90  TRP B CZ3   1 
ATOM   2062 C  CH2   . TRP B 1 14  ? -9.019  -0.504  3.663   1.00 70.27  ? 90  TRP B CH2   1 
ATOM   2063 N  N     . GLY B 1 15  ? -1.924  -2.619  -1.458  1.00 79.10  ? 91  GLY B N     1 
ATOM   2064 C  CA    . GLY B 1 15  ? -1.473  -3.596  -2.437  1.00 73.55  ? 91  GLY B CA    1 
ATOM   2065 C  C     . GLY B 1 15  ? -2.250  -3.492  -3.736  1.00 67.90  ? 91  GLY B C     1 
ATOM   2066 O  O     . GLY B 1 15  ? -3.223  -2.744  -3.816  1.00 69.53  ? 91  GLY B O     1 
ATOM   2067 N  N     . PRO B 1 16  ? -1.837  -4.258  -4.758  1.00 69.23  ? 92  PRO B N     1 
ATOM   2068 C  CA    . PRO B 1 16  ? -2.368  -4.134  -6.123  1.00 67.99  ? 92  PRO B CA    1 
ATOM   2069 C  C     . PRO B 1 16  ? -3.649  -4.946  -6.371  1.00 65.39  ? 92  PRO B C     1 
ATOM   2070 O  O     . PRO B 1 16  ? -4.293  -4.778  -7.410  1.00 64.90  ? 92  PRO B O     1 
ATOM   2071 C  CB    . PRO B 1 16  ? -1.232  -4.704  -6.967  1.00 61.84  ? 92  PRO B CB    1 
ATOM   2072 C  CG    . PRO B 1 16  ? -0.689  -5.810  -6.094  1.00 63.37  ? 92  PRO B CG    1 
ATOM   2073 C  CD    . PRO B 1 16  ? -0.832  -5.334  -4.660  1.00 61.98  ? 92  PRO B CD    1 
ATOM   2074 N  N     . HIS B 1 17  ? -4.004  -5.819  -5.433  1.00 59.86  ? 93  HIS B N     1 
ATOM   2075 C  CA    . HIS B 1 17  ? -5.169  -6.679  -5.591  1.00 55.42  ? 93  HIS B CA    1 
ATOM   2076 C  C     . HIS B 1 17  ? -6.461  -6.001  -5.157  1.00 53.52  ? 93  HIS B C     1 
ATOM   2077 O  O     . HIS B 1 17  ? -6.487  -5.242  -4.183  1.00 58.68  ? 93  HIS B O     1 
ATOM   2078 C  CB    . HIS B 1 17  ? -4.972  -7.975  -4.810  1.00 53.04  ? 93  HIS B CB    1 
ATOM   2079 C  CG    . HIS B 1 17  ? -3.808  -8.787  -5.280  1.00 52.91  ? 93  HIS B CG    1 
ATOM   2080 N  ND1   . HIS B 1 17  ? -3.626  -9.128  -6.604  1.00 50.37  ? 93  HIS B ND1   1 
ATOM   2081 C  CD2   . HIS B 1 17  ? -2.772  -9.336  -4.604  1.00 53.81  ? 93  HIS B CD2   1 
ATOM   2082 C  CE1   . HIS B 1 17  ? -2.526  -9.851  -6.723  1.00 51.20  ? 93  HIS B CE1   1 
ATOM   2083 N  NE2   . HIS B 1 17  ? -1.986  -9.990  -5.524  1.00 55.15  ? 93  HIS B NE2   1 
ATOM   2084 N  N     . ARG B 1 18  ? -7.533  -6.291  -5.884  1.00 47.57  ? 94  ARG B N     1 
ATOM   2085 C  CA    . ARG B 1 18  ? -8.841  -5.705  -5.610  1.00 52.69  ? 94  ARG B CA    1 
ATOM   2086 C  C     . ARG B 1 18  ? -9.958  -6.726  -5.888  1.00 49.79  ? 94  ARG B C     1 
ATOM   2087 O  O     . ARG B 1 18  ? -10.004 -7.345  -6.953  1.00 46.05  ? 94  ARG B O     1 
ATOM   2088 C  CB    . ARG B 1 18  ? -9.022  -4.415  -6.426  1.00 51.63  ? 94  ARG B CB    1 
ATOM   2089 C  CG    . ARG B 1 18  ? -10.389 -3.773  -6.330  1.00 53.00  ? 94  ARG B CG    1 
ATOM   2090 C  CD    . ARG B 1 18  ? -10.295 -2.246  -6.502  1.00 65.04  ? 94  ARG B CD    1 
ATOM   2091 N  NE    . ARG B 1 18  ? -11.504 -1.671  -7.094  1.00 55.83  ? 94  ARG B NE    1 
ATOM   2092 C  CZ    . ARG B 1 18  ? -12.462 -1.060  -6.411  1.00 52.97  ? 94  ARG B CZ    1 
ATOM   2093 N  NH1   . ARG B 1 18  ? -12.351 -0.919  -5.097  1.00 55.26  ? 94  ARG B NH1   1 
ATOM   2094 N  NH2   . ARG B 1 18  ? -13.523 -0.575  -7.051  1.00 56.50  ? 94  ARG B NH2   1 
ATOM   2095 N  N     . LEU B 1 19  ? -10.854 -6.899  -4.922  1.00 47.94  ? 95  LEU B N     1 
ATOM   2096 C  CA    . LEU B 1 19  ? -11.850 -7.963  -4.985  1.00 43.45  ? 95  LEU B CA    1 
ATOM   2097 C  C     . LEU B 1 19  ? -13.219 -7.528  -5.529  1.00 47.28  ? 95  LEU B C     1 
ATOM   2098 O  O     . LEU B 1 19  ? -13.856 -6.609  -4.997  1.00 40.24  ? 95  LEU B O     1 
ATOM   2099 C  CB    . LEU B 1 19  ? -12.021 -8.593  -3.595  1.00 42.58  ? 95  LEU B CB    1 
ATOM   2100 C  CG    . LEU B 1 19  ? -13.251 -9.475  -3.379  1.00 41.00  ? 95  LEU B CG    1 
ATOM   2101 C  CD1   . LEU B 1 19  ? -13.194 -10.699 -4.307  1.00 37.54  ? 95  LEU B CD1   1 
ATOM   2102 C  CD2   . LEU B 1 19  ? -13.397 -9.890  -1.903  1.00 41.88  ? 95  LEU B CD2   1 
ATOM   2103 N  N     . ALA B 1 20  ? -13.682 -8.207  -6.579  1.00 38.98  ? 96  ALA B N     1 
ATOM   2104 C  CA    . ALA B 1 20  ? -15.077 -8.063  -6.994  1.00 35.59  ? 96  ALA B CA    1 
ATOM   2105 C  C     . ALA B 1 20  ? -15.970 -9.033  -6.208  1.00 40.97  ? 96  ALA B C     1 
ATOM   2106 O  O     . ALA B 1 20  ? -15.916 -10.242 -6.449  1.00 35.70  ? 96  ALA B O     1 
ATOM   2107 C  CB    . ALA B 1 20  ? -15.215 -8.305  -8.476  1.00 34.36  ? 96  ALA B CB    1 
ATOM   2108 N  N     . VAL B 1 21  ? -16.775 -8.515  -5.271  1.00 38.67  ? 97  VAL B N     1 
ATOM   2109 C  CA    . VAL B 1 21  ? -17.740 -9.359  -4.550  1.00 35.31  ? 97  VAL B CA    1 
ATOM   2110 C  C     . VAL B 1 21  ? -18.994 -9.572  -5.385  1.00 34.37  ? 97  VAL B C     1 
ATOM   2111 O  O     . VAL B 1 21  ? -19.785 -8.660  -5.586  1.00 37.82  ? 97  VAL B O     1 
ATOM   2112 C  CB    . VAL B 1 21  ? -18.158 -8.789  -3.184  1.00 37.92  ? 97  VAL B CB    1 
ATOM   2113 C  CG1   . VAL B 1 21  ? -19.039 -9.814  -2.442  1.00 32.54  ? 97  VAL B CG1   1 
ATOM   2114 C  CG2   . VAL B 1 21  ? -16.937 -8.409  -2.359  1.00 31.62  ? 97  VAL B CG2   1 
ATOM   2115 N  N     . LEU B 1 22  ? -19.163 -10.784 -5.887  1.00 37.27  ? 98  LEU B N     1 
ATOM   2116 C  CA    . LEU B 1 22  ? -20.251 -11.058 -6.806  1.00 33.84  ? 98  LEU B CA    1 
ATOM   2117 C  C     . LEU B 1 22  ? -21.403 -11.727 -6.055  1.00 37.20  ? 98  LEU B C     1 
ATOM   2118 O  O     . LEU B 1 22  ? -21.331 -12.900 -5.668  1.00 35.71  ? 98  LEU B O     1 
ATOM   2119 C  CB    . LEU B 1 22  ? -19.745 -11.879 -8.006  1.00 32.67  ? 98  LEU B CB    1 
ATOM   2120 C  CG    . LEU B 1 22  ? -18.566 -11.238 -8.774  1.00 36.03  ? 98  LEU B CG    1 
ATOM   2121 C  CD1   . LEU B 1 22  ? -18.028 -12.142 -9.895  1.00 26.64  ? 98  LEU B CD1   1 
ATOM   2122 C  CD2   . LEU B 1 22  ? -18.916 -9.847  -9.336  1.00 27.89  ? 98  LEU B CD2   1 
ATOM   2123 N  N     . VAL B 1 23  ? -22.457 -10.943 -5.837  1.00 33.94  ? 99  VAL B N     1 
ATOM   2124 C  CA    . VAL B 1 23  ? -23.592 -11.347 -5.031  1.00 33.78  ? 99  VAL B CA    1 
ATOM   2125 C  C     . VAL B 1 23  ? -24.796 -11.680 -5.899  1.00 32.00  ? 99  VAL B C     1 
ATOM   2126 O  O     . VAL B 1 23  ? -25.434 -10.790 -6.431  1.00 33.95  ? 99  VAL B O     1 
ATOM   2127 C  CB    . VAL B 1 23  ? -23.991 -10.225 -4.049  1.00 39.64  ? 99  VAL B CB    1 
ATOM   2128 C  CG1   . VAL B 1 23  ? -25.106 -10.686 -3.130  1.00 33.96  ? 99  VAL B CG1   1 
ATOM   2129 C  CG2   . VAL B 1 23  ? -22.781 -9.768  -3.247  1.00 36.72  ? 99  VAL B CG2   1 
ATOM   2130 N  N     . PRO B 1 24  ? -25.113 -12.975 -6.035  1.00 36.11  ? 100 PRO B N     1 
ATOM   2131 C  CA    . PRO B 1 24  ? -26.306 -13.404 -6.779  1.00 36.23  ? 100 PRO B CA    1 
ATOM   2132 C  C     . PRO B 1 24  ? -27.571 -12.961 -6.033  1.00 35.04  ? 100 PRO B C     1 
ATOM   2133 O  O     . PRO B 1 24  ? -27.646 -13.181 -4.830  1.00 34.72  ? 100 PRO B O     1 
ATOM   2134 C  CB    . PRO B 1 24  ? -26.170 -14.940 -6.814  1.00 37.57  ? 100 PRO B CB    1 
ATOM   2135 C  CG    . PRO B 1 24  ? -25.309 -15.286 -5.646  1.00 28.78  ? 100 PRO B CG    1 
ATOM   2136 C  CD    . PRO B 1 24  ? -24.395 -14.102 -5.410  1.00 32.92  ? 100 PRO B CD    1 
ATOM   2137 N  N     . PHE B 1 25  ? -28.533 -12.341 -6.719  1.00 35.34  ? 101 PHE B N     1 
ATOM   2138 C  CA    . PHE B 1 25  ? -29.595 -11.615 -6.024  1.00 35.98  ? 101 PHE B CA    1 
ATOM   2139 C  C     . PHE B 1 25  ? -30.956 -11.601 -6.717  1.00 35.67  ? 101 PHE B C     1 
ATOM   2140 O  O     . PHE B 1 25  ? -31.061 -11.300 -7.904  1.00 37.59  ? 101 PHE B O     1 
ATOM   2141 C  CB    . PHE B 1 25  ? -29.157 -10.161 -5.781  1.00 29.57  ? 101 PHE B CB    1 
ATOM   2142 C  CG    . PHE B 1 25  ? -30.042 -9.406  -4.813  1.00 36.98  ? 101 PHE B CG    1 
ATOM   2143 C  CD1   . PHE B 1 25  ? -29.883 -9.557  -3.442  1.00 36.77  ? 101 PHE B CD1   1 
ATOM   2144 C  CD2   . PHE B 1 25  ? -31.035 -8.547  -5.274  1.00 32.61  ? 101 PHE B CD2   1 
ATOM   2145 C  CE1   . PHE B 1 25  ? -30.702 -8.856  -2.550  1.00 34.66  ? 101 PHE B CE1   1 
ATOM   2146 C  CE2   . PHE B 1 25  ? -31.846 -7.855  -4.397  1.00 32.70  ? 101 PHE B CE2   1 
ATOM   2147 C  CZ    . PHE B 1 25  ? -31.679 -8.003  -3.036  1.00 33.28  ? 101 PHE B CZ    1 
ATOM   2148 N  N     . ARG B 1 26  ? -31.992 -11.924 -5.951  1.00 36.09  ? 102 ARG B N     1 
ATOM   2149 C  CA    . ARG B 1 26  ? -33.379 -11.613 -6.307  1.00 35.19  ? 102 ARG B CA    1 
ATOM   2150 C  C     . ARG B 1 26  ? -34.271 -11.754 -5.075  1.00 41.12  ? 102 ARG B C     1 
ATOM   2151 O  O     . ARG B 1 26  ? -34.257 -12.800 -4.402  1.00 36.82  ? 102 ARG B O     1 
ATOM   2152 C  CB    . ARG B 1 26  ? -33.896 -12.520 -7.421  1.00 36.21  ? 102 ARG B CB    1 
ATOM   2153 C  CG    . ARG B 1 26  ? -35.418 -12.529 -7.520  1.00 42.40  ? 102 ARG B CG    1 
ATOM   2154 C  CD    . ARG B 1 26  ? -35.937 -13.691 -8.355  1.00 41.99  ? 102 ARG B CD    1 
ATOM   2155 N  NE    . ARG B 1 26  ? -35.822 -13.423 -9.784  1.00 41.35  ? 102 ARG B NE    1 
ATOM   2156 C  CZ    . ARG B 1 26  ? -35.947 -14.351 -10.730 1.00 43.49  ? 102 ARG B CZ    1 
ATOM   2157 N  NH1   . ARG B 1 26  ? -36.182 -15.616 -10.403 1.00 43.98  ? 102 ARG B NH1   1 
ATOM   2158 N  NH2   . ARG B 1 26  ? -35.831 -14.015 -12.008 1.00 38.42  ? 102 ARG B NH2   1 
ATOM   2159 N  N     . GLU B 1 27  ? -35.034 -10.707 -4.776  1.00 38.60  ? 103 GLU B N     1 
ATOM   2160 C  CA    . GLU B 1 27  ? -35.988 -10.729 -3.657  1.00 36.88  ? 103 GLU B CA    1 
ATOM   2161 C  C     . GLU B 1 27  ? -35.330 -11.111 -2.321  1.00 35.35  ? 103 GLU B C     1 
ATOM   2162 O  O     . GLU B 1 27  ? -35.803 -12.008 -1.612  1.00 40.58  ? 103 GLU B O     1 
ATOM   2163 C  CB    . GLU B 1 27  ? -37.168 -11.671 -3.942  1.00 44.34  ? 103 GLU B CB    1 
ATOM   2164 C  CG    . GLU B 1 27  ? -38.153 -11.247 -5.033  1.00 40.53  ? 103 GLU B CG    1 
ATOM   2165 C  CD    . GLU B 1 27  ? -38.858 -12.468 -5.672  1.00 60.48  ? 103 GLU B CD    1 
ATOM   2166 O  OE1   . GLU B 1 27  ? -39.104 -13.455 -4.951  1.00 65.15  ? 103 GLU B OE1   1 
ATOM   2167 O  OE2   . GLU B 1 27  ? -39.148 -12.466 -6.896  1.00 58.51  ? 103 GLU B OE2   1 
ATOM   2168 N  N     . ARG B 1 28  ? -34.219 -10.461 -2.000  1.00 35.58  ? 104 ARG B N     1 
ATOM   2169 C  CA    . ARG B 1 28  ? -33.599 -10.622 -0.691  1.00 41.81  ? 104 ARG B CA    1 
ATOM   2170 C  C     . ARG B 1 28  ? -33.270 -9.255  -0.055  1.00 40.99  ? 104 ARG B C     1 
ATOM   2171 O  O     . ARG B 1 28  ? -32.158 -9.027  0.426   1.00 43.97  ? 104 ARG B O     1 
ATOM   2172 C  CB    . ARG B 1 28  ? -32.349 -11.504 -0.782  1.00 39.48  ? 104 ARG B CB    1 
ATOM   2173 C  CG    . ARG B 1 28  ? -32.599 -12.935 -1.298  1.00 40.92  ? 104 ARG B CG    1 
ATOM   2174 C  CD    . ARG B 1 28  ? -33.338 -13.823 -0.285  1.00 42.84  ? 104 ARG B CD    1 
ATOM   2175 N  NE    . ARG B 1 28  ? -33.471 -15.214 -0.747  1.00 39.56  ? 104 ARG B NE    1 
ATOM   2176 C  CZ    . ARG B 1 28  ? -34.465 -15.676 -1.506  1.00 38.46  ? 104 ARG B CZ    1 
ATOM   2177 N  NH1   . ARG B 1 28  ? -35.440 -14.866 -1.915  1.00 40.73  ? 104 ARG B NH1   1 
ATOM   2178 N  NH2   . ARG B 1 28  ? -34.490 -16.956 -1.861  1.00 43.20  ? 104 ARG B NH2   1 
ATOM   2179 N  N     . PHE B 1 29  ? -34.249 -8.357  -0.046  1.00 36.44  ? 105 PHE B N     1 
ATOM   2180 C  CA    . PHE B 1 29  ? -34.014 -6.969  0.368   1.00 41.65  ? 105 PHE B CA    1 
ATOM   2181 C  C     . PHE B 1 29  ? -33.516 -6.872  1.804   1.00 42.85  ? 105 PHE B C     1 
ATOM   2182 O  O     . PHE B 1 29  ? -32.505 -6.226  2.072   1.00 48.26  ? 105 PHE B O     1 
ATOM   2183 C  CB    . PHE B 1 29  ? -35.283 -6.130  0.178   1.00 46.05  ? 105 PHE B CB    1 
ATOM   2184 C  CG    . PHE B 1 29  ? -35.115 -4.657  0.507   1.00 43.44  ? 105 PHE B CG    1 
ATOM   2185 C  CD1   . PHE B 1 29  ? -34.334 -3.838  -0.289  1.00 42.10  ? 105 PHE B CD1   1 
ATOM   2186 C  CD2   . PHE B 1 29  ? -35.775 -4.095  1.593   1.00 37.02  ? 105 PHE B CD2   1 
ATOM   2187 C  CE1   . PHE B 1 29  ? -34.189 -2.483  0.005   1.00 45.60  ? 105 PHE B CE1   1 
ATOM   2188 C  CE2   . PHE B 1 29  ? -35.644 -2.747  1.892   1.00 39.56  ? 105 PHE B CE2   1 
ATOM   2189 C  CZ    . PHE B 1 29  ? -34.847 -1.936  1.093   1.00 43.11  ? 105 PHE B CZ    1 
ATOM   2190 N  N     . GLU B 1 30  ? -34.220 -7.527  2.719   1.00 40.32  ? 106 GLU B N     1 
ATOM   2191 C  CA    A GLU B 1 30  ? -33.849 -7.503  4.127   0.22 41.96  ? 106 GLU B CA    1 
ATOM   2192 C  CA    B GLU B 1 30  ? -33.860 -7.526  4.133   0.51 42.11  ? 106 GLU B CA    1 
ATOM   2193 C  CA    C GLU B 1 30  ? -33.849 -7.500  4.126   0.27 42.03  ? 106 GLU B CA    1 
ATOM   2194 C  C     . GLU B 1 30  ? -32.402 -7.947  4.333   1.00 43.11  ? 106 GLU B C     1 
ATOM   2195 O  O     . GLU B 1 30  ? -31.624 -7.259  5.002   1.00 45.31  ? 106 GLU B O     1 
ATOM   2196 C  CB    A GLU B 1 30  ? -34.802 -8.372  4.952   0.22 40.15  ? 106 GLU B CB    1 
ATOM   2197 C  CB    B GLU B 1 30  ? -34.801 -8.452  4.927   0.51 39.65  ? 106 GLU B CB    1 
ATOM   2198 C  CB    C GLU B 1 30  ? -34.807 -8.363  4.954   0.27 39.80  ? 106 GLU B CB    1 
ATOM   2199 C  CG    A GLU B 1 30  ? -36.264 -7.968  4.836   0.22 39.75  ? 106 GLU B CG    1 
ATOM   2200 C  CG    B GLU B 1 30  ? -34.474 -8.542  6.411   0.51 39.04  ? 106 GLU B CG    1 
ATOM   2201 C  CG    C GLU B 1 30  ? -36.266 -7.953  4.829   0.27 39.74  ? 106 GLU B CG    1 
ATOM   2202 C  CD    A GLU B 1 30  ? -36.987 -8.694  3.718   0.22 42.07  ? 106 GLU B CD    1 
ATOM   2203 C  CD    B GLU B 1 30  ? -35.393 -9.485  7.189   0.51 39.92  ? 106 GLU B CD    1 
ATOM   2204 C  CD    C GLU B 1 30  ? -36.993 -8.694  3.724   0.27 42.09  ? 106 GLU B CD    1 
ATOM   2205 O  OE1   A GLU B 1 30  ? -36.853 -8.279  2.546   0.22 38.81  ? 106 GLU B OE1   1 
ATOM   2206 O  OE1   B GLU B 1 30  ? -36.313 -10.083 6.584   0.51 37.03  ? 106 GLU B OE1   1 
ATOM   2207 O  OE1   C GLU B 1 30  ? -36.872 -8.289  2.547   0.27 38.79  ? 106 GLU B OE1   1 
ATOM   2208 O  OE2   A GLU B 1 30  ? -37.690 -9.686  4.017   0.22 43.76  ? 106 GLU B OE2   1 
ATOM   2209 O  OE2   B GLU B 1 30  ? -35.183 -9.625  8.415   0.51 32.50  ? 106 GLU B OE2   1 
ATOM   2210 O  OE2   C GLU B 1 30  ? -37.686 -9.688  4.039   0.27 43.77  ? 106 GLU B OE2   1 
ATOM   2211 N  N     . GLU B 1 31  ? -32.040 -9.091  3.747   1.00 38.33  ? 107 GLU B N     1 
ATOM   2212 C  CA    . GLU B 1 31  ? -30.685 -9.627  3.862   1.00 33.76  ? 107 GLU B CA    1 
ATOM   2213 C  C     . GLU B 1 31  ? -29.619 -8.688  3.259   1.00 43.60  ? 107 GLU B C     1 
ATOM   2214 O  O     . GLU B 1 31  ? -28.495 -8.594  3.761   1.00 41.87  ? 107 GLU B O     1 
ATOM   2215 C  CB    . GLU B 1 31  ? -30.603 -11.007 3.202   1.00 37.97  ? 107 GLU B CB    1 
ATOM   2216 C  CG    . GLU B 1 31  ? -31.541 -12.049 3.777   1.00 39.75  ? 107 GLU B CG    1 
ATOM   2217 C  CD    . GLU B 1 31  ? -32.927 -12.050 3.138   1.00 46.17  ? 107 GLU B CD    1 
ATOM   2218 O  OE1   . GLU B 1 31  ? -33.311 -11.045 2.498   1.00 43.24  ? 107 GLU B OE1   1 
ATOM   2219 O  OE2   . GLU B 1 31  ? -33.635 -13.070 3.281   1.00 45.21  ? 107 GLU B OE2   1 
ATOM   2220 N  N     . LEU B 1 32  ? -29.979 -7.998  2.181   1.00 40.46  ? 108 LEU B N     1 
ATOM   2221 C  CA    . LEU B 1 32  ? -29.082 -7.045  1.548   1.00 40.30  ? 108 LEU B CA    1 
ATOM   2222 C  C     . LEU B 1 32  ? -28.710 -5.908  2.501   1.00 41.28  ? 108 LEU B C     1 
ATOM   2223 O  O     . LEU B 1 32  ? -27.547 -5.536  2.609   1.00 42.96  ? 108 LEU B O     1 
ATOM   2224 C  CB    . LEU B 1 32  ? -29.719 -6.483  0.281   1.00 34.80  ? 108 LEU B CB    1 
ATOM   2225 C  CG    . LEU B 1 32  ? -28.802 -5.577  -0.546  1.00 43.78  ? 108 LEU B CG    1 
ATOM   2226 C  CD1   . LEU B 1 32  ? -27.758 -6.410  -1.262  1.00 36.16  ? 108 LEU B CD1   1 
ATOM   2227 C  CD2   . LEU B 1 32  ? -29.605 -4.737  -1.528  1.00 40.21  ? 108 LEU B CD2   1 
ATOM   2228 N  N     . LEU B 1 33  ? -29.702 -5.378  3.205   1.00 43.09  ? 109 LEU B N     1 
ATOM   2229 C  CA    . LEU B 1 33  ? -29.488 -4.279  4.147   1.00 43.61  ? 109 LEU B CA    1 
ATOM   2230 C  C     . LEU B 1 33  ? -28.415 -4.607  5.173   1.00 43.17  ? 109 LEU B C     1 
ATOM   2231 O  O     . LEU B 1 33  ? -27.705 -3.718  5.627   1.00 43.59  ? 109 LEU B O     1 
ATOM   2232 C  CB    . LEU B 1 33  ? -30.787 -3.932  4.872   1.00 42.26  ? 109 LEU B CB    1 
ATOM   2233 C  CG    . LEU B 1 33  ? -31.729 -2.885  4.276   1.00 50.32  ? 109 LEU B CG    1 
ATOM   2234 C  CD1   . LEU B 1 33  ? -31.344 -2.500  2.859   1.00 47.69  ? 109 LEU B CD1   1 
ATOM   2235 C  CD2   . LEU B 1 33  ? -33.165 -3.383  4.332   1.00 45.18  ? 109 LEU B CD2   1 
ATOM   2236 N  N     . VAL B 1 34  ? -28.303 -5.887  5.525   1.00 41.89  ? 110 VAL B N     1 
ATOM   2237 C  CA    . VAL B 1 34  ? -27.311 -6.355  6.485   1.00 40.89  ? 110 VAL B CA    1 
ATOM   2238 C  C     . VAL B 1 34  ? -25.979 -6.740  5.818   1.00 45.13  ? 110 VAL B C     1 
ATOM   2239 O  O     . VAL B 1 34  ? -24.906 -6.465  6.359   1.00 43.24  ? 110 VAL B O     1 
ATOM   2240 C  CB    . VAL B 1 34  ? -27.853 -7.563  7.301   1.00 49.54  ? 110 VAL B CB    1 
ATOM   2241 C  CG1   . VAL B 1 34  ? -26.750 -8.201  8.120   1.00 41.98  ? 110 VAL B CG1   1 
ATOM   2242 C  CG2   . VAL B 1 34  ? -29.010 -7.130  8.206   1.00 43.79  ? 110 VAL B CG2   1 
ATOM   2243 N  N     . PHE B 1 35  ? -26.057 -7.369  4.645   1.00 42.74  ? 111 PHE B N     1 
ATOM   2244 C  CA    . PHE B 1 35  ? -24.875 -7.878  3.937   1.00 43.18  ? 111 PHE B CA    1 
ATOM   2245 C  C     . PHE B 1 35  ? -23.895 -6.772  3.552   1.00 42.96  ? 111 PHE B C     1 
ATOM   2246 O  O     . PHE B 1 35  ? -22.709 -6.837  3.887   1.00 41.60  ? 111 PHE B O     1 
ATOM   2247 C  CB    . PHE B 1 35  ? -25.315 -8.655  2.688   1.00 42.02  ? 111 PHE B CB    1 
ATOM   2248 C  CG    . PHE B 1 35  ? -24.180 -9.219  1.874   1.00 40.14  ? 111 PHE B CG    1 
ATOM   2249 C  CD1   . PHE B 1 35  ? -23.574 -8.463  0.872   1.00 41.24  ? 111 PHE B CD1   1 
ATOM   2250 C  CD2   . PHE B 1 35  ? -23.753 -10.521 2.071   1.00 40.82  ? 111 PHE B CD2   1 
ATOM   2251 C  CE1   . PHE B 1 35  ? -22.539 -8.987  0.109   1.00 39.18  ? 111 PHE B CE1   1 
ATOM   2252 C  CE2   . PHE B 1 35  ? -22.725 -11.058 1.303   1.00 41.88  ? 111 PHE B CE2   1 
ATOM   2253 C  CZ    . PHE B 1 35  ? -22.116 -10.289 0.321   1.00 36.79  ? 111 PHE B CZ    1 
ATOM   2254 N  N     . VAL B 1 36  ? -24.395 -5.759  2.853   1.00 40.17  ? 112 VAL B N     1 
ATOM   2255 C  CA    . VAL B 1 36  ? -23.538 -4.683  2.356   1.00 40.10  ? 112 VAL B CA    1 
ATOM   2256 C  C     . VAL B 1 36  ? -22.662 -4.031  3.442   1.00 45.99  ? 112 VAL B C     1 
ATOM   2257 O  O     . VAL B 1 36  ? -21.431 -4.075  3.338   1.00 44.62  ? 112 VAL B O     1 
ATOM   2258 C  CB    . VAL B 1 36  ? -24.334 -3.643  1.531   1.00 39.74  ? 112 VAL B CB    1 
ATOM   2259 C  CG1   . VAL B 1 36  ? -23.423 -2.516  1.056   1.00 48.57  ? 112 VAL B CG1   1 
ATOM   2260 C  CG2   . VAL B 1 36  ? -25.023 -4.319  0.363   1.00 38.91  ? 112 VAL B CG2   1 
ATOM   2261 N  N     . PRO B 1 37  ? -23.274 -3.462  4.505   1.00 45.77  ? 113 PRO B N     1 
ATOM   2262 C  CA    . PRO B 1 37  ? -22.375 -2.872  5.504   1.00 43.20  ? 113 PRO B CA    1 
ATOM   2263 C  C     . PRO B 1 37  ? -21.546 -3.901  6.266   1.00 43.15  ? 113 PRO B C     1 
ATOM   2264 O  O     . PRO B 1 37  ? -20.418 -3.598  6.643   1.00 49.84  ? 113 PRO B O     1 
ATOM   2265 C  CB    . PRO B 1 37  ? -23.328 -2.113  6.446   1.00 44.17  ? 113 PRO B CB    1 
ATOM   2266 C  CG    . PRO B 1 37  ? -24.648 -2.749  6.257   1.00 48.30  ? 113 PRO B CG    1 
ATOM   2267 C  CD    . PRO B 1 37  ? -24.690 -3.193  4.817   1.00 45.49  ? 113 PRO B CD    1 
ATOM   2268 N  N     . HIS B 1 38  ? -22.079 -5.099  6.478   1.00 41.30  ? 114 HIS B N     1 
ATOM   2269 C  CA    . HIS B 1 38  ? -21.303 -6.145  7.133   1.00 42.30  ? 114 HIS B CA    1 
ATOM   2270 C  C     . HIS B 1 38  ? -20.002 -6.464  6.382   1.00 46.43  ? 114 HIS B C     1 
ATOM   2271 O  O     . HIS B 1 38  ? -18.923 -6.493  6.979   1.00 48.51  ? 114 HIS B O     1 
ATOM   2272 C  CB    . HIS B 1 38  ? -22.135 -7.413  7.313   1.00 36.80  ? 114 HIS B CB    1 
ATOM   2273 C  CG    . HIS B 1 38  ? -21.391 -8.523  7.979   1.00 42.10  ? 114 HIS B CG    1 
ATOM   2274 N  ND1   . HIS B 1 38  ? -21.535 -8.817  9.317   1.00 47.64  ? 114 HIS B ND1   1 
ATOM   2275 C  CD2   . HIS B 1 38  ? -20.488 -9.408  7.495   1.00 46.48  ? 114 HIS B CD2   1 
ATOM   2276 C  CE1   . HIS B 1 38  ? -20.758 -9.838  9.629   1.00 43.17  ? 114 HIS B CE1   1 
ATOM   2277 N  NE2   . HIS B 1 38  ? -20.114 -10.219 8.539   1.00 52.48  ? 114 HIS B NE2   1 
ATOM   2278 N  N     . MET B 1 39  ? -20.102 -6.696  5.075   1.00 43.33  ? 115 MET B N     1 
ATOM   2279 C  CA    . MET B 1 39  ? -18.913 -6.961  4.269   1.00 40.56  ? 115 MET B CA    1 
ATOM   2280 C  C     . MET B 1 39  ? -17.989 -5.742  4.104   1.00 44.32  ? 115 MET B C     1 
ATOM   2281 O  O     . MET B 1 39  ? -16.772 -5.908  4.006   1.00 48.39  ? 115 MET B O     1 
ATOM   2282 C  CB    . MET B 1 39  ? -19.300 -7.536  2.908   1.00 39.74  ? 115 MET B CB    1 
ATOM   2283 C  CG    . MET B 1 39  ? -20.195 -8.750  3.008   1.00 41.72  ? 115 MET B CG    1 
ATOM   2284 S  SD    . MET B 1 39  ? -19.369 -10.097 3.864   1.00 45.09  ? 115 MET B SD    1 
ATOM   2285 C  CE    . MET B 1 39  ? -17.894 -10.277 2.854   1.00 40.55  ? 115 MET B CE    1 
ATOM   2286 N  N     . ARG B 1 40  ? -18.538 -4.525  4.079   1.00 45.72  ? 116 ARG B N     1 
ATOM   2287 C  CA    . ARG B 1 40  ? -17.657 -3.357  4.018   1.00 49.22  ? 116 ARG B CA    1 
ATOM   2288 C  C     . ARG B 1 40  ? -16.751 -3.326  5.237   1.00 51.11  ? 116 ARG B C     1 
ATOM   2289 O  O     . ARG B 1 40  ? -15.535 -3.222  5.112   1.00 58.39  ? 116 ARG B O     1 
ATOM   2290 C  CB    . ARG B 1 40  ? -18.410 -2.032  3.891   1.00 43.48  ? 116 ARG B CB    1 
ATOM   2291 C  CG    . ARG B 1 40  ? -17.468 -0.794  3.722   1.00 47.71  ? 116 ARG B CG    1 
ATOM   2292 C  CD    . ARG B 1 40  ? -18.258 0.522   3.579   1.00 51.17  ? 116 ARG B CD    1 
ATOM   2293 N  NE    . ARG B 1 40  ? -17.446 1.716   3.302   1.00 63.52  ? 116 ARG B NE    1 
ATOM   2294 C  CZ    . ARG B 1 40  ? -16.759 1.934   2.174   1.00 61.49  ? 116 ARG B CZ    1 
ATOM   2295 N  NH1   . ARG B 1 40  ? -16.739 1.025   1.200   1.00 61.93  ? 116 ARG B NH1   1 
ATOM   2296 N  NH2   . ARG B 1 40  ? -16.065 3.059   2.022   1.00 58.54  ? 116 ARG B NH2   1 
ATOM   2297 N  N     . ARG B 1 41  ? -17.347 -3.442  6.413   1.00 51.02  ? 117 ARG B N     1 
ATOM   2298 C  CA    . ARG B 1 41  ? -16.580 -3.411  7.646   1.00 54.09  ? 117 ARG B CA    1 
ATOM   2299 C  C     . ARG B 1 41  ? -15.596 -4.578  7.690   1.00 55.75  ? 117 ARG B C     1 
ATOM   2300 O  O     . ARG B 1 41  ? -14.393 -4.380  7.863   1.00 55.81  ? 117 ARG B O     1 
ATOM   2301 C  CB    . ARG B 1 41  ? -17.515 -3.416  8.859   1.00 56.64  ? 117 ARG B CB    1 
ATOM   2302 C  CG    . ARG B 1 41  ? -16.811 -3.639  10.176  1.00 64.13  ? 117 ARG B CG    1 
ATOM   2303 C  CD    . ARG B 1 41  ? -17.807 -3.864  11.300  1.00 72.29  ? 117 ARG B CD    1 
ATOM   2304 N  NE    . ARG B 1 41  ? -17.179 -4.548  12.428  1.00 82.65  ? 117 ARG B NE    1 
ATOM   2305 C  CZ    . ARG B 1 41  ? -16.477 -3.937  13.379  1.00 91.71  ? 117 ARG B CZ    1 
ATOM   2306 N  NH1   . ARG B 1 41  ? -16.311 -2.616  13.348  1.00 85.00  ? 117 ARG B NH1   1 
ATOM   2307 N  NH2   . ARG B 1 41  ? -15.942 -4.647  14.365  1.00 91.27  ? 117 ARG B NH2   1 
ATOM   2308 N  N     . PHE B 1 42  ? -16.112 -5.788  7.505   1.00 50.31  ? 118 PHE B N     1 
ATOM   2309 C  CA    . PHE B 1 42  ? -15.288 -6.988  7.488   1.00 45.68  ? 118 PHE B CA    1 
ATOM   2310 C  C     . PHE B 1 42  ? -14.079 -6.916  6.536   1.00 56.57  ? 118 PHE B C     1 
ATOM   2311 O  O     . PHE B 1 42  ? -12.947 -7.207  6.931   1.00 59.55  ? 118 PHE B O     1 
ATOM   2312 C  CB    . PHE B 1 42  ? -16.157 -8.184  7.126   1.00 53.31  ? 118 PHE B CB    1 
ATOM   2313 C  CG    . PHE B 1 42  ? -15.415 -9.489  7.083   1.00 54.19  ? 118 PHE B CG    1 
ATOM   2314 C  CD1   . PHE B 1 42  ? -15.211 -10.222 8.241   1.00 49.58  ? 118 PHE B CD1   1 
ATOM   2315 C  CD2   . PHE B 1 42  ? -14.941 -9.994  5.877   1.00 53.94  ? 118 PHE B CD2   1 
ATOM   2316 C  CE1   . PHE B 1 42  ? -14.542 -11.436 8.206   1.00 57.86  ? 118 PHE B CE1   1 
ATOM   2317 C  CE2   . PHE B 1 42  ? -14.270 -11.216 5.827   1.00 55.48  ? 118 PHE B CE2   1 
ATOM   2318 C  CZ    . PHE B 1 42  ? -14.070 -11.939 6.996   1.00 57.11  ? 118 PHE B CZ    1 
ATOM   2319 N  N     . LEU B 1 43  ? -14.310 -6.536  5.285   1.00 50.32  ? 119 LEU B N     1 
ATOM   2320 C  CA    . LEU B 1 43  ? -13.213 -6.492  4.324   1.00 54.42  ? 119 LEU B CA    1 
ATOM   2321 C  C     . LEU B 1 43  ? -12.259 -5.315  4.556   1.00 56.38  ? 119 LEU B C     1 
ATOM   2322 O  O     . LEU B 1 43  ? -11.052 -5.447  4.357   1.00 56.51  ? 119 LEU B O     1 
ATOM   2323 C  CB    . LEU B 1 43  ? -13.743 -6.497  2.888   1.00 51.36  ? 119 LEU B CB    1 
ATOM   2324 C  CG    . LEU B 1 43  ? -14.457 -7.782  2.467   1.00 51.67  ? 119 LEU B CG    1 
ATOM   2325 C  CD1   . LEU B 1 43  ? -15.083 -7.624  1.093   1.00 41.76  ? 119 LEU B CD1   1 
ATOM   2326 C  CD2   . LEU B 1 43  ? -13.508 -8.971  2.499   1.00 45.21  ? 119 LEU B CD2   1 
ATOM   2327 N  N     . SER B 1 44  ? -12.795 -4.171  4.974   1.00 56.64  ? 120 SER B N     1 
ATOM   2328 C  CA    . SER B 1 44  ? -11.961 -3.003  5.275   1.00 59.55  ? 120 SER B CA    1 
ATOM   2329 C  C     . SER B 1 44  ? -10.985 -3.282  6.417   1.00 62.47  ? 120 SER B C     1 
ATOM   2330 O  O     . SER B 1 44  ? -9.819  -2.903  6.348   1.00 64.64  ? 120 SER B O     1 
ATOM   2331 C  CB    . SER B 1 44  ? -12.820 -1.784  5.608   1.00 54.73  ? 120 SER B CB    1 
ATOM   2332 O  OG    . SER B 1 44  ? -13.602 -1.394  4.492   1.00 60.54  ? 120 SER B OG    1 
ATOM   2333 N  N     . ARG B 1 45  ? -11.470 -3.947  7.463   1.00 65.11  ? 121 ARG B N     1 
ATOM   2334 C  CA    . ARG B 1 45  ? -10.623 -4.358  8.581   1.00 66.48  ? 121 ARG B CA    1 
ATOM   2335 C  C     . ARG B 1 45  ? -9.514  -5.329  8.150   1.00 67.22  ? 121 ARG B C     1 
ATOM   2336 O  O     . ARG B 1 45  ? -8.400  -5.274  8.670   1.00 73.65  ? 121 ARG B O     1 
ATOM   2337 C  CB    . ARG B 1 45  ? -11.469 -4.974  9.704   1.00 68.99  ? 121 ARG B CB    1 
ATOM   2338 C  CG    . ARG B 1 45  ? -12.300 -3.963  10.489  1.00 72.37  ? 121 ARG B CG    1 
ATOM   2339 C  CD    . ARG B 1 45  ? -13.364 -4.642  11.348  1.00 73.35  ? 121 ARG B CD    1 
ATOM   2340 N  NE    . ARG B 1 45  ? -12.795 -5.600  12.292  1.00 80.70  ? 121 ARG B NE    1 
ATOM   2341 C  CZ    . ARG B 1 45  ? -12.528 -5.332  13.568  1.00 81.65  ? 121 ARG B CZ    1 
ATOM   2342 N  NH1   . ARG B 1 45  ? -12.777 -4.131  14.067  1.00 80.90  ? 121 ARG B NH1   1 
ATOM   2343 N  NH2   . ARG B 1 45  ? -12.013 -6.271  14.349  1.00 88.26  ? 121 ARG B NH2   1 
ATOM   2344 N  N     . LYS B 1 46  ? -9.812  -6.215  7.204   1.00 59.78  ? 122 LYS B N     1 
ATOM   2345 C  CA    . LYS B 1 46  ? -8.792  -7.123  6.686   1.00 56.62  ? 122 LYS B CA    1 
ATOM   2346 C  C     . LYS B 1 46  ? -7.934  -6.473  5.593   1.00 63.21  ? 122 LYS B C     1 
ATOM   2347 O  O     . LYS B 1 46  ? -7.101  -7.129  4.964   1.00 63.64  ? 122 LYS B O     1 
ATOM   2348 C  CB    . LYS B 1 46  ? -9.429  -8.422  6.199   1.00 56.39  ? 122 LYS B CB    1 
ATOM   2349 C  CG    . LYS B 1 46  ? -10.069 -9.215  7.330   1.00 53.06  ? 122 LYS B CG    1 
ATOM   2350 C  CD    . LYS B 1 46  ? -10.885 -10.368 6.815   1.00 49.52  ? 122 LYS B CD    1 
ATOM   2351 C  CE    . LYS B 1 46  ? -10.002 -11.413 6.208   1.00 55.54  ? 122 LYS B CE    1 
ATOM   2352 N  NZ    . LYS B 1 46  ? -9.004  -11.948 7.168   1.00 56.75  ? 122 LYS B NZ    1 
ATOM   2353 N  N     . LYS B 1 47  ? -8.143  -5.174  5.396   1.00 60.43  ? 123 LYS B N     1 
ATOM   2354 C  CA    . LYS B 1 47  ? -7.364  -4.361  4.459   1.00 67.28  ? 123 LYS B CA    1 
ATOM   2355 C  C     . LYS B 1 47  ? -7.434  -4.831  2.996   1.00 64.94  ? 123 LYS B C     1 
ATOM   2356 O  O     . LYS B 1 47  ? -6.455  -4.763  2.249   1.00 62.77  ? 123 LYS B O     1 
ATOM   2357 C  CB    . LYS B 1 47  ? -5.921  -4.186  4.954   1.00 70.56  ? 123 LYS B CB    1 
ATOM   2358 C  CG    . LYS B 1 47  ? -5.675  -2.837  5.638   1.00 70.91  ? 123 LYS B CG    1 
ATOM   2359 C  CD    . LYS B 1 47  ? -4.483  -2.858  6.588   1.00 69.92  ? 123 LYS B CD    1 
ATOM   2360 C  CE    . LYS B 1 47  ? -4.850  -3.516  7.910   1.00 77.95  ? 123 LYS B CE    1 
ATOM   2361 N  NZ    . LYS B 1 47  ? -5.998  -2.828  8.575   1.00 73.63  ? 123 LYS B NZ    1 
ATOM   2362 N  N     . ILE B 1 48  ? -8.625  -5.270  2.601   1.00 63.93  ? 124 ILE B N     1 
ATOM   2363 C  CA    . ILE B 1 48  ? -8.898  -5.763  1.259   1.00 56.28  ? 124 ILE B CA    1 
ATOM   2364 C  C     . ILE B 1 48  ? -9.680  -4.741  0.434   1.00 56.07  ? 124 ILE B C     1 
ATOM   2365 O  O     . ILE B 1 48  ? -10.807 -4.383  0.774   1.00 57.65  ? 124 ILE B O     1 
ATOM   2366 C  CB    . ILE B 1 48  ? -9.684  -7.079  1.334   1.00 47.27  ? 124 ILE B CB    1 
ATOM   2367 C  CG1   . ILE B 1 48  ? -8.772  -8.189  1.845   1.00 43.66  ? 124 ILE B CG1   1 
ATOM   2368 C  CG2   . ILE B 1 48  ? -10.264 -7.444  -0.010  1.00 47.24  ? 124 ILE B CG2   1 
ATOM   2369 C  CD1   . ILE B 1 48  ? -9.503  -9.323  2.514   1.00 45.04  ? 124 ILE B CD1   1 
ATOM   2370 N  N     . ARG B 1 49  ? -9.072  -4.270  -0.648  1.00 55.89  ? 125 ARG B N     1 
ATOM   2371 C  CA    . ARG B 1 49  ? -9.742  -3.354  -1.561  1.00 52.07  ? 125 ARG B CA    1 
ATOM   2372 C  C     . ARG B 1 49  ? -10.818 -4.128  -2.306  1.00 48.04  ? 125 ARG B C     1 
ATOM   2373 O  O     . ARG B 1 49  ? -10.564 -5.218  -2.806  1.00 46.68  ? 125 ARG B O     1 
ATOM   2374 C  CB    . ARG B 1 49  ? -8.735  -2.738  -2.536  1.00 55.37  ? 125 ARG B CB    1 
ATOM   2375 C  CG    . ARG B 1 49  ? -7.657  -1.892  -1.864  1.00 63.55  ? 125 ARG B CG    1 
ATOM   2376 C  CD    . ARG B 1 49  ? -6.593  -1.443  -2.857  1.00 73.12  ? 125 ARG B CD    1 
ATOM   2377 N  NE    . ARG B 1 49  ? -7.195  -0.979  -4.103  1.00 77.29  ? 125 ARG B NE    1 
ATOM   2378 C  CZ    . ARG B 1 49  ? -6.643  -1.133  -5.302  1.00 74.96  ? 125 ARG B CZ    1 
ATOM   2379 N  NH1   . ARG B 1 49  ? -5.467  -1.733  -5.414  1.00 77.60  ? 125 ARG B NH1   1 
ATOM   2380 N  NH2   . ARG B 1 49  ? -7.266  -0.691  -6.388  1.00 78.73  ? 125 ARG B NH2   1 
ATOM   2381 N  N     . HIS B 1 50  ? -12.023 -3.576  -2.382  1.00 44.72  ? 126 HIS B N     1 
ATOM   2382 C  CA    . HIS B 1 50  ? -13.144 -4.351  -2.897  1.00 43.58  ? 126 HIS B CA    1 
ATOM   2383 C  C     . HIS B 1 50  ? -14.285 -3.484  -3.378  1.00 40.89  ? 126 HIS B C     1 
ATOM   2384 O  O     . HIS B 1 50  ? -14.366 -2.305  -3.063  1.00 50.71  ? 126 HIS B O     1 
ATOM   2385 C  CB    . HIS B 1 50  ? -13.674 -5.280  -1.803  1.00 44.00  ? 126 HIS B CB    1 
ATOM   2386 C  CG    . HIS B 1 50  ? -14.286 -4.547  -0.652  1.00 42.90  ? 126 HIS B CG    1 
ATOM   2387 N  ND1   . HIS B 1 50  ? -13.544 -4.093  0.417   1.00 48.53  ? 126 HIS B ND1   1 
ATOM   2388 C  CD2   . HIS B 1 50  ? -15.560 -4.158  -0.420  1.00 41.08  ? 126 HIS B CD2   1 
ATOM   2389 C  CE1   . HIS B 1 50  ? -14.340 -3.467  1.267   1.00 48.92  ? 126 HIS B CE1   1 
ATOM   2390 N  NE2   . HIS B 1 50  ? -15.568 -3.489  0.783   1.00 48.36  ? 126 HIS B NE2   1 
ATOM   2391 N  N     . HIS B 1 51  ? -15.178 -4.090  -4.141  1.00 42.82  ? 127 HIS B N     1 
ATOM   2392 C  CA    . HIS B 1 51  ? -16.433 -3.462  -4.521  1.00 37.50  ? 127 HIS B CA    1 
ATOM   2393 C  C     . HIS B 1 51  ? -17.498 -4.556  -4.575  1.00 43.15  ? 127 HIS B C     1 
ATOM   2394 O  O     . HIS B 1 51  ? -17.234 -5.703  -4.994  1.00 36.05  ? 127 HIS B O     1 
ATOM   2395 C  CB    . HIS B 1 51  ? -16.326 -2.726  -5.872  1.00 34.18  ? 127 HIS B CB    1 
ATOM   2396 C  CG    . HIS B 1 51  ? -17.518 -1.870  -6.183  1.00 45.60  ? 127 HIS B CG    1 
ATOM   2397 N  ND1   . HIS B 1 51  ? -17.792 -0.697  -5.503  1.00 47.00  ? 127 HIS B ND1   1 
ATOM   2398 C  CD2   . HIS B 1 51  ? -18.525 -2.028  -7.076  1.00 40.40  ? 127 HIS B CD2   1 
ATOM   2399 C  CE1   . HIS B 1 51  ? -18.910 -0.167  -5.970  1.00 39.47  ? 127 HIS B CE1   1 
ATOM   2400 N  NE2   . HIS B 1 51  ? -19.371 -0.949  -6.931  1.00 45.02  ? 127 HIS B NE2   1 
ATOM   2401 N  N     . ILE B 1 52  ? -18.700 -4.202  -4.143  1.00 41.75  ? 128 ILE B N     1 
ATOM   2402 C  CA    . ILE B 1 52  ? -19.786 -5.167  -4.033  1.00 41.98  ? 128 ILE B CA    1 
ATOM   2403 C  C     . ILE B 1 52  ? -20.740 -5.008  -5.205  1.00 41.17  ? 128 ILE B C     1 
ATOM   2404 O  O     . ILE B 1 52  ? -21.300 -3.932  -5.394  1.00 40.96  ? 128 ILE B O     1 
ATOM   2405 C  CB    . ILE B 1 52  ? -20.559 -4.986  -2.701  1.00 39.13  ? 128 ILE B CB    1 
ATOM   2406 C  CG1   . ILE B 1 52  ? -19.601 -5.139  -1.515  1.00 34.93  ? 128 ILE B CG1   1 
ATOM   2407 C  CG2   . ILE B 1 52  ? -21.712 -5.980  -2.608  1.00 37.51  ? 128 ILE B CG2   1 
ATOM   2408 C  CD1   . ILE B 1 52  ? -20.193 -4.713  -0.163  1.00 39.53  ? 128 ILE B CD1   1 
ATOM   2409 N  N     . TYR B 1 53  ? -20.906 -6.078  -5.987  1.00 34.57  ? 129 TYR B N     1 
ATOM   2410 C  CA    . TYR B 1 53  ? -21.822 -6.083  -7.120  1.00 34.80  ? 129 TYR B CA    1 
ATOM   2411 C  C     . TYR B 1 53  ? -23.068 -6.909  -6.827  1.00 36.64  ? 129 TYR B C     1 
ATOM   2412 O  O     . TYR B 1 53  ? -23.002 -8.125  -6.666  1.00 37.07  ? 129 TYR B O     1 
ATOM   2413 C  CB    . TYR B 1 53  ? -21.133 -6.627  -8.387  1.00 32.62  ? 129 TYR B CB    1 
ATOM   2414 C  CG    . TYR B 1 53  ? -20.009 -5.760  -8.902  1.00 30.94  ? 129 TYR B CG    1 
ATOM   2415 C  CD1   . TYR B 1 53  ? -18.704 -5.931  -8.457  1.00 37.81  ? 129 TYR B CD1   1 
ATOM   2416 C  CD2   . TYR B 1 53  ? -20.249 -4.770  -9.828  1.00 38.69  ? 129 TYR B CD2   1 
ATOM   2417 C  CE1   . TYR B 1 53  ? -17.663 -5.133  -8.932  1.00 32.52  ? 129 TYR B CE1   1 
ATOM   2418 C  CE2   . TYR B 1 53  ? -19.219 -3.969  -10.302 1.00 41.11  ? 129 TYR B CE2   1 
ATOM   2419 C  CZ    . TYR B 1 53  ? -17.935 -4.155  -9.847  1.00 36.54  ? 129 TYR B CZ    1 
ATOM   2420 O  OH    . TYR B 1 53  ? -16.929 -3.354  -10.329 1.00 44.73  ? 129 TYR B OH    1 
ATOM   2421 N  N     . VAL B 1 54  ? -24.211 -6.245  -6.792  1.00 38.11  ? 130 VAL B N     1 
ATOM   2422 C  CA    . VAL B 1 54  ? -25.471 -6.913  -6.524  1.00 36.74  ? 130 VAL B CA    1 
ATOM   2423 C  C     . VAL B 1 54  ? -26.068 -7.323  -7.844  1.00 33.59  ? 130 VAL B C     1 
ATOM   2424 O  O     . VAL B 1 54  ? -26.570 -6.490  -8.587  1.00 39.16  ? 130 VAL B O     1 
ATOM   2425 C  CB    . VAL B 1 54  ? -26.439 -5.981  -5.777  1.00 41.11  ? 130 VAL B CB    1 
ATOM   2426 C  CG1   . VAL B 1 54  ? -27.732 -6.694  -5.484  1.00 40.31  ? 130 VAL B CG1   1 
ATOM   2427 C  CG2   . VAL B 1 54  ? -25.799 -5.495  -4.499  1.00 31.64  ? 130 VAL B CG2   1 
ATOM   2428 N  N     . LEU B 1 55  ? -25.978 -8.614  -8.141  1.00 39.03  ? 131 LEU B N     1 
ATOM   2429 C  CA    . LEU B 1 55  ? -26.339 -9.152  -9.440  1.00 34.41  ? 131 LEU B CA    1 
ATOM   2430 C  C     . LEU B 1 55  ? -27.809 -9.547  -9.446  1.00 35.63  ? 131 LEU B C     1 
ATOM   2431 O  O     . LEU B 1 55  ? -28.161 -10.703 -9.231  1.00 39.79  ? 131 LEU B O     1 
ATOM   2432 C  CB    . LEU B 1 55  ? -25.431 -10.335 -9.769  1.00 34.42  ? 131 LEU B CB    1 
ATOM   2433 C  CG    . LEU B 1 55  ? -23.942 -9.986  -9.626  1.00 35.87  ? 131 LEU B CG    1 
ATOM   2434 C  CD1   . LEU B 1 55  ? -23.062 -11.201 -9.820  1.00 35.04  ? 131 LEU B CD1   1 
ATOM   2435 C  CD2   . LEU B 1 55  ? -23.541 -8.888  -10.595 1.00 38.32  ? 131 LEU B CD2   1 
ATOM   2436 N  N     . ASN B 1 56  ? -28.662 -8.562  -9.700  1.00 38.53  ? 132 ASN B N     1 
ATOM   2437 C  CA    . ASN B 1 56  ? -30.098 -8.677  -9.495  1.00 32.72  ? 132 ASN B CA    1 
ATOM   2438 C  C     . ASN B 1 56  ? -30.813 -9.258  -10.710 1.00 34.51  ? 132 ASN B C     1 
ATOM   2439 O  O     . ASN B 1 56  ? -30.867 -8.627  -11.758 1.00 41.38  ? 132 ASN B O     1 
ATOM   2440 C  CB    . ASN B 1 56  ? -30.658 -7.299  -9.134  1.00 33.20  ? 132 ASN B CB    1 
ATOM   2441 C  CG    . ASN B 1 56  ? -32.123 -7.341  -8.757  1.00 39.07  ? 132 ASN B CG    1 
ATOM   2442 O  OD1   . ASN B 1 56  ? -32.605 -8.344  -8.249  1.00 37.08  ? 132 ASN B OD1   1 
ATOM   2443 N  ND2   . ASN B 1 56  ? -32.837 -6.242  -8.992  1.00 36.20  ? 132 ASN B ND2   1 
ATOM   2444 N  N     . GLN B 1 57  ? -31.351 -10.472 -10.587 1.00 38.07  ? 133 GLN B N     1 
ATOM   2445 C  CA    . GLN B 1 57  ? -32.017 -11.095 -11.729 1.00 38.68  ? 133 GLN B CA    1 
ATOM   2446 C  C     . GLN B 1 57  ? -33.430 -10.545 -11.897 1.00 34.79  ? 133 GLN B C     1 
ATOM   2447 O  O     . GLN B 1 57  ? -34.284 -10.794 -11.061 1.00 38.39  ? 133 GLN B O     1 
ATOM   2448 C  CB    . GLN B 1 57  ? -32.039 -12.622 -11.589 1.00 35.07  ? 133 GLN B CB    1 
ATOM   2449 C  CG    . GLN B 1 57  ? -32.402 -13.369 -12.876 1.00 35.09  ? 133 GLN B CG    1 
ATOM   2450 C  CD    . GLN B 1 57  ? -32.369 -14.898 -12.708 1.00 42.87  ? 133 GLN B CD    1 
ATOM   2451 O  OE1   . GLN B 1 57  ? -31.651 -15.419 -11.855 1.00 39.66  ? 133 GLN B OE1   1 
ATOM   2452 N  NE2   . GLN B 1 57  ? -33.156 -15.614 -13.520 1.00 39.12  ? 133 GLN B NE2   1 
ATOM   2453 N  N     . VAL B 1 58  ? -33.681 -9.803  -12.977 1.00 37.79  ? 134 VAL B N     1 
ATOM   2454 C  CA    . VAL B 1 58  ? -34.988 -9.143  -13.152 1.00 32.36  ? 134 VAL B CA    1 
ATOM   2455 C  C     . VAL B 1 58  ? -35.865 -9.716  -14.270 1.00 42.73  ? 134 VAL B C     1 
ATOM   2456 O  O     . VAL B 1 58  ? -36.996 -9.262  -14.475 1.00 38.70  ? 134 VAL B O     1 
ATOM   2457 C  CB    . VAL B 1 58  ? -34.858 -7.611  -13.307 1.00 42.55  ? 134 VAL B CB    1 
ATOM   2458 C  CG1   . VAL B 1 58  ? -34.243 -7.013  -12.050 1.00 30.29  ? 134 VAL B CG1   1 
ATOM   2459 C  CG2   . VAL B 1 58  ? -34.043 -7.247  -14.574 1.00 38.88  ? 134 VAL B CG2   1 
ATOM   2460 N  N     . ASP B 1 59  ? -35.352 -10.720 -14.979 1.00 39.29  ? 135 ASP B N     1 
ATOM   2461 C  CA    . ASP B 1 59  ? -36.178 -11.479 -15.909 1.00 40.84  ? 135 ASP B CA    1 
ATOM   2462 C  C     . ASP B 1 59  ? -37.139 -12.301 -15.096 1.00 38.35  ? 135 ASP B C     1 
ATOM   2463 O  O     . ASP B 1 59  ? -37.018 -12.377 -13.883 1.00 40.90  ? 135 ASP B O     1 
ATOM   2464 C  CB    . ASP B 1 59  ? -35.334 -12.415 -16.777 1.00 38.13  ? 135 ASP B CB    1 
ATOM   2465 C  CG    . ASP B 1 59  ? -34.427 -13.307 -15.954 1.00 44.15  ? 135 ASP B CG    1 
ATOM   2466 O  OD1   . ASP B 1 59  ? -34.924 -14.236 -15.285 1.00 39.59  ? 135 ASP B OD1   1 
ATOM   2467 O  OD2   . ASP B 1 59  ? -33.202 -13.075 -15.977 1.00 49.92  ? 135 ASP B OD2   1 
ATOM   2468 N  N     . HIS B 1 60  ? -38.075 -12.950 -15.767 1.00 43.78  ? 136 HIS B N     1 
ATOM   2469 C  CA    . HIS B 1 60  ? -39.087 -13.720 -15.065 1.00 45.79  ? 136 HIS B CA    1 
ATOM   2470 C  C     . HIS B 1 60  ? -38.793 -15.226 -15.015 1.00 49.39  ? 136 HIS B C     1 
ATOM   2471 O  O     . HIS B 1 60  ? -39.662 -16.017 -14.643 1.00 51.35  ? 136 HIS B O     1 
ATOM   2472 C  CB    . HIS B 1 60  ? -40.469 -13.426 -15.658 1.00 47.87  ? 136 HIS B CB    1 
ATOM   2473 C  CG    . HIS B 1 60  ? -40.997 -12.072 -15.294 1.00 56.08  ? 136 HIS B CG    1 
ATOM   2474 N  ND1   . HIS B 1 60  ? -42.270 -11.653 -15.620 1.00 62.68  ? 136 HIS B ND1   1 
ATOM   2475 C  CD2   . HIS B 1 60  ? -40.427 -11.047 -14.612 1.00 48.62  ? 136 HIS B CD2   1 
ATOM   2476 C  CE1   . HIS B 1 60  ? -42.458 -10.427 -15.161 1.00 53.09  ? 136 HIS B CE1   1 
ATOM   2477 N  NE2   . HIS B 1 60  ? -41.355 -10.037 -14.547 1.00 48.04  ? 136 HIS B NE2   1 
ATOM   2478 N  N     . PHE B 1 61  ? -37.564 -15.611 -15.368 1.00 45.09  ? 137 PHE B N     1 
ATOM   2479 C  CA    . PHE B 1 61  ? -37.159 -17.018 -15.330 1.00 46.86  ? 137 PHE B CA    1 
ATOM   2480 C  C     . PHE B 1 61  ? -36.771 -17.427 -13.915 1.00 46.91  ? 137 PHE B C     1 
ATOM   2481 O  O     . PHE B 1 61  ? -36.717 -16.586 -13.011 1.00 43.92  ? 137 PHE B O     1 
ATOM   2482 C  CB    . PHE B 1 61  ? -35.989 -17.304 -16.284 1.00 37.34  ? 137 PHE B CB    1 
ATOM   2483 C  CG    . PHE B 1 61  ? -36.288 -17.010 -17.714 1.00 42.73  ? 137 PHE B CG    1 
ATOM   2484 C  CD1   . PHE B 1 61  ? -37.287 -17.700 -18.383 1.00 41.28  ? 137 PHE B CD1   1 
ATOM   2485 C  CD2   . PHE B 1 61  ? -35.561 -16.043 -18.404 1.00 49.90  ? 137 PHE B CD2   1 
ATOM   2486 C  CE1   . PHE B 1 61  ? -37.571 -17.425 -19.706 1.00 44.04  ? 137 PHE B CE1   1 
ATOM   2487 C  CE2   . PHE B 1 61  ? -35.835 -15.758 -19.739 1.00 43.68  ? 137 PHE B CE2   1 
ATOM   2488 C  CZ    . PHE B 1 61  ? -36.844 -16.455 -20.389 1.00 48.36  ? 137 PHE B CZ    1 
ATOM   2489 N  N     . ARG B 1 62  ? -36.501 -18.719 -13.742 1.00 36.23  ? 138 ARG B N     1 
ATOM   2490 C  CA    . ARG B 1 62  ? -36.084 -19.263 -12.453 1.00 46.13  ? 138 ARG B CA    1 
ATOM   2491 C  C     . ARG B 1 62  ? -34.703 -18.746 -12.063 1.00 40.69  ? 138 ARG B C     1 
ATOM   2492 O  O     . ARG B 1 62  ? -33.933 -18.286 -12.908 1.00 43.85  ? 138 ARG B O     1 
ATOM   2493 C  CB    . ARG B 1 62  ? -36.077 -20.799 -12.476 1.00 41.39  ? 138 ARG B CB    1 
ATOM   2494 C  CG    . ARG B 1 62  ? -37.428 -21.412 -12.758 1.00 51.12  ? 138 ARG B CG    1 
ATOM   2495 C  CD    . ARG B 1 62  ? -37.661 -22.635 -11.896 1.00 51.99  ? 138 ARG B CD    1 
ATOM   2496 N  NE    . ARG B 1 62  ? -37.287 -23.878 -12.546 1.00 56.80  ? 138 ARG B NE    1 
ATOM   2497 C  CZ    . ARG B 1 62  ? -36.982 -24.995 -11.894 1.00 52.71  ? 138 ARG B CZ    1 
ATOM   2498 N  NH1   . ARG B 1 62  ? -36.985 -25.023 -10.566 1.00 51.68  ? 138 ARG B NH1   1 
ATOM   2499 N  NH2   . ARG B 1 62  ? -36.663 -26.084 -12.575 1.00 54.57  ? 138 ARG B NH2   1 
ATOM   2500 N  N     . PHE B 1 63  ? -34.387 -18.837 -10.780 1.00 39.62  ? 139 PHE B N     1 
ATOM   2501 C  CA    . PHE B 1 63  ? -33.188 -18.218 -10.273 1.00 29.33  ? 139 PHE B CA    1 
ATOM   2502 C  C     . PHE B 1 63  ? -31.948 -18.979 -10.661 1.00 42.16  ? 139 PHE B C     1 
ATOM   2503 O  O     . PHE B 1 63  ? -31.823 -20.187 -10.398 1.00 36.68  ? 139 PHE B O     1 
ATOM   2504 C  CB    . PHE B 1 63  ? -33.234 -18.026 -8.765  1.00 32.36  ? 139 PHE B CB    1 
ATOM   2505 C  CG    . PHE B 1 63  ? -32.125 -17.171 -8.256  1.00 33.61  ? 139 PHE B CG    1 
ATOM   2506 C  CD1   . PHE B 1 63  ? -32.196 -15.789 -8.373  1.00 38.22  ? 139 PHE B CD1   1 
ATOM   2507 C  CD2   . PHE B 1 63  ? -30.993 -17.738 -7.709  1.00 29.32  ? 139 PHE B CD2   1 
ATOM   2508 C  CE1   . PHE B 1 63  ? -31.168 -14.999 -7.921  1.00 35.04  ? 139 PHE B CE1   1 
ATOM   2509 C  CE2   . PHE B 1 63  ? -29.960 -16.959 -7.267  1.00 33.59  ? 139 PHE B CE2   1 
ATOM   2510 C  CZ    . PHE B 1 63  ? -30.046 -15.584 -7.366  1.00 35.73  ? 139 PHE B CZ    1 
ATOM   2511 N  N     . ASN B 1 64  ? -31.016 -18.243 -11.262 1.00 35.66  ? 140 ASN B N     1 
ATOM   2512 C  CA    . ASN B 1 64  ? -29.846 -18.842 -11.862 1.00 36.63  ? 140 ASN B CA    1 
ATOM   2513 C  C     . ASN B 1 64  ? -28.563 -18.247 -11.284 1.00 40.41  ? 140 ASN B C     1 
ATOM   2514 O  O     . ASN B 1 64  ? -27.959 -17.341 -11.886 1.00 39.41  ? 140 ASN B O     1 
ATOM   2515 C  CB    . ASN B 1 64  ? -29.918 -18.642 -13.374 1.00 34.15  ? 140 ASN B CB    1 
ATOM   2516 C  CG    . ASN B 1 64  ? -28.922 -19.493 -14.132 1.00 39.05  ? 140 ASN B CG    1 
ATOM   2517 O  OD1   . ASN B 1 64  ? -27.825 -19.788 -13.640 1.00 36.92  ? 140 ASN B OD1   1 
ATOM   2518 N  ND2   . ASN B 1 64  ? -29.287 -19.867 -15.357 1.00 34.28  ? 140 ASN B ND2   1 
ATOM   2519 N  N     . ARG B 1 65  ? -28.158 -18.756 -10.118 1.00 34.65  ? 141 ARG B N     1 
ATOM   2520 C  CA    . ARG B 1 65  ? -26.948 -18.284 -9.437  1.00 38.35  ? 141 ARG B CA    1 
ATOM   2521 C  C     . ARG B 1 65  ? -25.733 -18.230 -10.370 1.00 35.92  ? 141 ARG B C     1 
ATOM   2522 O  O     . ARG B 1 65  ? -25.043 -17.210 -10.467 1.00 32.84  ? 141 ARG B O     1 
ATOM   2523 C  CB    . ARG B 1 65  ? -26.627 -19.153 -8.212  1.00 26.52  ? 141 ARG B CB    1 
ATOM   2524 C  CG    . ARG B 1 65  ? -25.617 -18.508 -7.243  1.00 32.65  ? 141 ARG B CG    1 
ATOM   2525 C  CD    . ARG B 1 65  ? -25.461 -19.302 -5.911  1.00 27.81  ? 141 ARG B CD    1 
ATOM   2526 N  NE    . ARG B 1 65  ? -24.297 -20.165 -6.040  1.00 44.58  ? 141 ARG B NE    1 
ATOM   2527 C  CZ    . ARG B 1 65  ? -23.156 -20.004 -5.384  1.00 34.48  ? 141 ARG B CZ    1 
ATOM   2528 N  NH1   . ARG B 1 65  ? -23.031 -19.051 -4.486  1.00 31.03  ? 141 ARG B NH1   1 
ATOM   2529 N  NH2   . ARG B 1 65  ? -22.151 -20.834 -5.613  1.00 36.93  ? 141 ARG B NH2   1 
ATOM   2530 N  N     . ALA B 1 66  ? -25.493 -19.330 -11.068 1.00 34.56  ? 142 ALA B N     1 
ATOM   2531 C  CA    . ALA B 1 66  ? -24.266 -19.480 -11.825 1.00 34.56  ? 142 ALA B CA    1 
ATOM   2532 C  C     . ALA B 1 66  ? -24.199 -18.501 -13.009 1.00 37.37  ? 142 ALA B C     1 
ATOM   2533 O  O     . ALA B 1 66  ? -23.168 -17.847 -13.212 1.00 32.55  ? 142 ALA B O     1 
ATOM   2534 C  CB    . ALA B 1 66  ? -24.091 -20.927 -12.277 1.00 34.30  ? 142 ALA B CB    1 
ATOM   2535 N  N     . ALA B 1 67  ? -25.294 -18.381 -13.762 1.00 31.45  ? 143 ALA B N     1 
ATOM   2536 C  CA    . ALA B 1 67  ? -25.334 -17.461 -14.891 1.00 33.61  ? 143 ALA B CA    1 
ATOM   2537 C  C     . ALA B 1 67  ? -25.015 -16.045 -14.434 1.00 41.16  ? 143 ALA B C     1 
ATOM   2538 O  O     . ALA B 1 67  ? -24.257 -15.320 -15.104 1.00 32.34  ? 143 ALA B O     1 
ATOM   2539 C  CB    . ALA B 1 67  ? -26.683 -17.503 -15.592 1.00 30.16  ? 143 ALA B CB    1 
ATOM   2540 N  N     . LEU B 1 68  ? -25.572 -15.671 -13.277 1.00 38.30  ? 144 LEU B N     1 
ATOM   2541 C  CA    . LEU B 1 68  ? -25.354 -14.339 -12.712 1.00 34.09  ? 144 LEU B CA    1 
ATOM   2542 C  C     . LEU B 1 68  ? -23.896 -14.110 -12.315 1.00 33.62  ? 144 LEU B C     1 
ATOM   2543 O  O     . LEU B 1 68  ? -23.375 -13.004 -12.467 1.00 37.11  ? 144 LEU B O     1 
ATOM   2544 C  CB    . LEU B 1 68  ? -26.273 -14.098 -11.508 1.00 31.56  ? 144 LEU B CB    1 
ATOM   2545 C  CG    . LEU B 1 68  ? -27.770 -14.180 -11.804 1.00 35.07  ? 144 LEU B CG    1 
ATOM   2546 C  CD1   . LEU B 1 68  ? -28.572 -14.324 -10.509 1.00 30.26  ? 144 LEU B CD1   1 
ATOM   2547 C  CD2   . LEU B 1 68  ? -28.224 -12.983 -12.587 1.00 33.10  ? 144 LEU B CD2   1 
ATOM   2548 N  N     . ILE B 1 69  ? -23.246 -15.139 -11.781 1.00 31.31  ? 145 ILE B N     1 
ATOM   2549 C  CA    . ILE B 1 69  ? -21.832 -15.023 -11.448 1.00 33.11  ? 145 ILE B CA    1 
ATOM   2550 C  C     . ILE B 1 69  ? -21.023 -14.744 -12.721 1.00 39.99  ? 145 ILE B C     1 
ATOM   2551 O  O     . ILE B 1 69  ? -20.036 -14.008 -12.686 1.00 38.25  ? 145 ILE B O     1 
ATOM   2552 C  CB    . ILE B 1 69  ? -21.293 -16.281 -10.758 1.00 37.25  ? 145 ILE B CB    1 
ATOM   2553 C  CG1   . ILE B 1 69  ? -22.124 -16.591 -9.503  1.00 43.70  ? 145 ILE B CG1   1 
ATOM   2554 C  CG2   . ILE B 1 69  ? -19.817 -16.116 -10.398 1.00 28.39  ? 145 ILE B CG2   1 
ATOM   2555 C  CD1   . ILE B 1 69  ? -22.223 -15.412 -8.544  1.00 36.57  ? 145 ILE B CD1   1 
ATOM   2556 N  N     . ASN B 1 70  ? -21.450 -15.327 -13.840 1.00 32.37  ? 146 ASN B N     1 
ATOM   2557 C  CA    . ASN B 1 70  ? -20.766 -15.117 -15.091 1.00 33.39  ? 146 ASN B CA    1 
ATOM   2558 C  C     . ASN B 1 70  ? -20.952 -13.661 -15.507 1.00 36.62  ? 146 ASN B C     1 
ATOM   2559 O  O     . ASN B 1 70  ? -19.975 -12.956 -15.770 1.00 34.70  ? 146 ASN B O     1 
ATOM   2560 C  CB    . ASN B 1 70  ? -21.297 -16.048 -16.167 1.00 29.39  ? 146 ASN B CB    1 
ATOM   2561 C  CG    . ASN B 1 70  ? -20.670 -17.433 -16.111 1.00 38.11  ? 146 ASN B CG    1 
ATOM   2562 O  OD1   . ASN B 1 70  ? -19.613 -17.633 -15.501 1.00 35.54  ? 146 ASN B OD1   1 
ATOM   2563 N  ND2   . ASN B 1 70  ? -21.312 -18.394 -16.775 1.00 31.43  ? 146 ASN B ND2   1 
ATOM   2564 N  N     . VAL B 1 71  ? -22.207 -13.214 -15.532 1.00 35.40  ? 147 VAL B N     1 
ATOM   2565 C  CA    . VAL B 1 71  ? -22.522 -11.813 -15.793 1.00 39.05  ? 147 VAL B CA    1 
ATOM   2566 C  C     . VAL B 1 71  ? -21.717 -10.847 -14.923 1.00 34.87  ? 147 VAL B C     1 
ATOM   2567 O  O     . VAL B 1 71  ? -21.084 -9.933  -15.428 1.00 35.60  ? 147 VAL B O     1 
ATOM   2568 C  CB    . VAL B 1 71  ? -24.010 -11.520 -15.644 1.00 31.00  ? 147 VAL B CB    1 
ATOM   2569 C  CG1   . VAL B 1 71  ? -24.262 -10.041 -15.869 1.00 30.89  ? 147 VAL B CG1   1 
ATOM   2570 C  CG2   . VAL B 1 71  ? -24.789 -12.321 -16.646 1.00 28.81  ? 147 VAL B CG2   1 
ATOM   2571 N  N     . GLY B 1 72  ? -21.714 -11.073 -13.621 1.00 31.63  ? 148 GLY B N     1 
ATOM   2572 C  CA    . GLY B 1 72  ? -20.929 -10.246 -12.725 1.00 33.73  ? 148 GLY B CA    1 
ATOM   2573 C  C     . GLY B 1 72  ? -19.443 -10.193 -13.047 1.00 36.01  ? 148 GLY B C     1 
ATOM   2574 O  O     . GLY B 1 72  ? -18.809 -9.155  -12.885 1.00 34.29  ? 148 GLY B O     1 
ATOM   2575 N  N     . PHE B 1 73  ? -18.883 -11.316 -13.485 1.00 36.88  ? 149 PHE B N     1 
ATOM   2576 C  CA    . PHE B 1 73  ? -17.490 -11.360 -13.897 1.00 35.87  ? 149 PHE B CA    1 
ATOM   2577 C  C     . PHE B 1 73  ? -17.303 -10.410 -15.064 1.00 35.61  ? 149 PHE B C     1 
ATOM   2578 O  O     . PHE B 1 73  ? -16.353 -9.647  -15.096 1.00 36.39  ? 149 PHE B O     1 
ATOM   2579 C  CB    . PHE B 1 73  ? -17.083 -12.765 -14.342 1.00 30.85  ? 149 PHE B CB    1 
ATOM   2580 C  CG    . PHE B 1 73  ? -15.650 -12.867 -14.799 1.00 31.13  ? 149 PHE B CG    1 
ATOM   2581 C  CD1   . PHE B 1 73  ? -15.289 -12.554 -16.109 1.00 39.03  ? 149 PHE B CD1   1 
ATOM   2582 C  CD2   . PHE B 1 73  ? -14.658 -13.258 -13.916 1.00 35.19  ? 149 PHE B CD2   1 
ATOM   2583 C  CE1   . PHE B 1 73  ? -13.957 -12.633 -16.537 1.00 37.15  ? 149 PHE B CE1   1 
ATOM   2584 C  CE2   . PHE B 1 73  ? -13.329 -13.355 -14.332 1.00 36.11  ? 149 PHE B CE2   1 
ATOM   2585 C  CZ    . PHE B 1 73  ? -12.980 -13.041 -15.647 1.00 39.83  ? 149 PHE B CZ    1 
ATOM   2586 N  N     . LEU B 1 74  ? -18.215 -10.488 -16.028 1.00 38.69  ? 150 LEU B N     1 
ATOM   2587 C  CA    . LEU B 1 74  ? -18.120 -9.725  -17.270 1.00 30.61  ? 150 LEU B CA    1 
ATOM   2588 C  C     . LEU B 1 74  ? -18.363 -8.243  -17.050 1.00 37.55  ? 150 LEU B C     1 
ATOM   2589 O  O     . LEU B 1 74  ? -17.898 -7.416  -17.831 1.00 36.19  ? 150 LEU B O     1 
ATOM   2590 C  CB    . LEU B 1 74  ? -19.131 -10.263 -18.292 1.00 35.05  ? 150 LEU B CB    1 
ATOM   2591 C  CG    . LEU B 1 74  ? -18.861 -11.650 -18.897 1.00 40.43  ? 150 LEU B CG    1 
ATOM   2592 C  CD1   . LEU B 1 74  ? -19.965 -12.047 -19.869 1.00 28.28  ? 150 LEU B CD1   1 
ATOM   2593 C  CD2   . LEU B 1 74  ? -17.507 -11.668 -19.600 1.00 31.99  ? 150 LEU B CD2   1 
ATOM   2594 N  N     . GLU B 1 75  ? -19.111 -7.914  -15.995 1.00 34.23  ? 151 GLU B N     1 
ATOM   2595 C  CA    . GLU B 1 75  ? -19.512 -6.536  -15.731 1.00 34.09  ? 151 GLU B CA    1 
ATOM   2596 C  C     . GLU B 1 75  ? -18.680 -5.897  -14.633 1.00 39.82  ? 151 GLU B C     1 
ATOM   2597 O  O     . GLU B 1 75  ? -18.855 -4.717  -14.324 1.00 47.58  ? 151 GLU B O     1 
ATOM   2598 C  CB    . GLU B 1 75  ? -20.991 -6.474  -15.348 1.00 33.87  ? 151 GLU B CB    1 
ATOM   2599 C  CG    . GLU B 1 75  ? -21.937 -6.927  -16.445 1.00 35.76  ? 151 GLU B CG    1 
ATOM   2600 C  CD    . GLU B 1 75  ? -21.904 -6.012  -17.660 1.00 39.04  ? 151 GLU B CD    1 
ATOM   2601 O  OE1   . GLU B 1 75  ? -21.780 -4.780  -17.474 1.00 41.60  ? 151 GLU B OE1   1 
ATOM   2602 O  OE2   . GLU B 1 75  ? -22.015 -6.527  -18.801 1.00 43.63  ? 151 GLU B OE2   1 
ATOM   2603 N  N     . SER B 1 76  ? -17.784 -6.669  -14.027 1.00 37.18  ? 152 SER B N     1 
ATOM   2604 C  CA    . SER B 1 76  ? -16.930 -6.132  -12.975 1.00 39.84  ? 152 SER B CA    1 
ATOM   2605 C  C     . SER B 1 76  ? -15.966 -5.117  -13.571 1.00 41.58  ? 152 SER B C     1 
ATOM   2606 O  O     . SER B 1 76  ? -15.741 -5.103  -14.773 1.00 44.15  ? 152 SER B O     1 
ATOM   2607 C  CB    . SER B 1 76  ? -16.151 -7.248  -12.283 1.00 37.23  ? 152 SER B CB    1 
ATOM   2608 O  OG    . SER B 1 76  ? -15.360 -7.950  -13.225 1.00 45.57  ? 152 SER B OG    1 
ATOM   2609 N  N     . SER B 1 77  ? -15.412 -4.260  -12.724 1.00 44.34  ? 153 SER B N     1 
ATOM   2610 C  CA    . SER B 1 77  ? -14.430 -3.272  -13.156 1.00 43.98  ? 153 SER B CA    1 
ATOM   2611 C  C     . SER B 1 77  ? -13.117 -3.968  -13.535 1.00 45.16  ? 153 SER B C     1 
ATOM   2612 O  O     . SER B 1 77  ? -12.747 -4.974  -12.916 1.00 41.90  ? 153 SER B O     1 
ATOM   2613 C  CB    . SER B 1 77  ? -14.191 -2.271  -12.029 1.00 37.35  ? 153 SER B CB    1 
ATOM   2614 O  OG    . SER B 1 77  ? -12.901 -1.700  -12.108 1.00 44.34  ? 153 SER B OG    1 
ATOM   2615 N  N     . ASN B 1 78  ? -12.410 -3.435  -14.537 1.00 37.29  ? 154 ASN B N     1 
ATOM   2616 C  CA    . ASN B 1 78  ? -11.123 -4.007  -14.945 1.00 41.10  ? 154 ASN B CA    1 
ATOM   2617 C  C     . ASN B 1 78  ? -10.092 -3.833  -13.843 1.00 42.84  ? 154 ASN B C     1 
ATOM   2618 O  O     . ASN B 1 78  ? -8.998  -4.387  -13.905 1.00 46.05  ? 154 ASN B O     1 
ATOM   2619 C  CB    . ASN B 1 78  ? -10.591 -3.381  -16.245 1.00 39.78  ? 154 ASN B CB    1 
ATOM   2620 C  CG    . ASN B 1 78  ? -11.344 -3.852  -17.487 1.00 43.51  ? 154 ASN B CG    1 
ATOM   2621 O  OD1   . ASN B 1 78  ? -11.950 -4.927  -17.506 1.00 48.21  ? 154 ASN B OD1   1 
ATOM   2622 N  ND2   . ASN B 1 78  ? -11.310 -3.039  -18.532 1.00 42.11  ? 154 ASN B ND2   1 
ATOM   2623 N  N     . SER B 1 79  ? -10.446 -3.045  -12.836 1.00 46.20  ? 155 SER B N     1 
ATOM   2624 C  CA    . SER B 1 79  ? -9.571  -2.823  -11.693 1.00 50.77  ? 155 SER B CA    1 
ATOM   2625 C  C     . SER B 1 79  ? -9.628  -3.964  -10.670 1.00 42.31  ? 155 SER B C     1 
ATOM   2626 O  O     . SER B 1 79  ? -8.813  -4.000  -9.753  1.00 53.23  ? 155 SER B O     1 
ATOM   2627 C  CB    . SER B 1 79  ? -9.893  -1.481  -11.019 1.00 41.89  ? 155 SER B CB    1 
ATOM   2628 O  OG    . SER B 1 79  ? -11.141 -1.540  -10.351 1.00 46.70  ? 155 SER B OG    1 
ATOM   2629 N  N     . THR B 1 80  ? -10.586 -4.882  -10.811 1.00 41.44  ? 156 THR B N     1 
ATOM   2630 C  CA    . THR B 1 80  ? -10.642 -6.059  -9.922  1.00 44.65  ? 156 THR B CA    1 
ATOM   2631 C  C     . THR B 1 80  ? -9.957  -7.263  -10.568 1.00 36.87  ? 156 THR B C     1 
ATOM   2632 O  O     . THR B 1 80  ? -10.255 -7.601  -11.702 1.00 40.20  ? 156 THR B O     1 
ATOM   2633 C  CB    . THR B 1 80  ? -12.097 -6.455  -9.523  1.00 42.23  ? 156 THR B CB    1 
ATOM   2634 O  OG1   . THR B 1 80  ? -12.882 -6.674  -10.703 1.00 43.35  ? 156 THR B OG1   1 
ATOM   2635 C  CG2   . THR B 1 80  ? -12.760 -5.377  -8.643  1.00 38.54  ? 156 THR B CG2   1 
ATOM   2636 N  N     . ASP B 1 81  ? -9.042  -7.913  -9.856  1.00 39.49  ? 157 ASP B N     1 
ATOM   2637 C  CA    . ASP B 1 81  ? -8.316  -9.034  -10.447 1.00 43.16  ? 157 ASP B CA    1 
ATOM   2638 C  C     . ASP B 1 81  ? -8.715  -10.403 -9.869  1.00 40.65  ? 157 ASP B C     1 
ATOM   2639 O  O     . ASP B 1 81  ? -8.195  -11.441 -10.288 1.00 42.84  ? 157 ASP B O     1 
ATOM   2640 C  CB    . ASP B 1 81  ? -6.798  -8.811  -10.377 1.00 37.32  ? 157 ASP B CB    1 
ATOM   2641 C  CG    . ASP B 1 81  ? -6.295  -8.682  -8.958  1.00 43.15  ? 157 ASP B CG    1 
ATOM   2642 O  OD1   . ASP B 1 81  ? -7.121  -8.425  -8.061  1.00 47.19  ? 157 ASP B OD1   1 
ATOM   2643 O  OD2   . ASP B 1 81  ? -5.075  -8.837  -8.735  1.00 47.16  ? 157 ASP B OD2   1 
ATOM   2644 N  N     . TYR B 1 82  ? -9.640  -10.403 -8.916  1.00 43.99  ? 158 TYR B N     1 
ATOM   2645 C  CA    . TYR B 1 82  ? -10.218 -11.664 -8.434  1.00 45.02  ? 158 TYR B CA    1 
ATOM   2646 C  C     . TYR B 1 82  ? -11.646 -11.495 -7.917  1.00 40.26  ? 158 TYR B C     1 
ATOM   2647 O  O     . TYR B 1 82  ? -12.051 -10.412 -7.515  1.00 47.99  ? 158 TYR B O     1 
ATOM   2648 C  CB    . TYR B 1 82  ? -9.315  -12.340 -7.399  1.00 38.93  ? 158 TYR B CB    1 
ATOM   2649 C  CG    . TYR B 1 82  ? -9.299  -11.713 -6.022  1.00 42.60  ? 158 TYR B CG    1 
ATOM   2650 C  CD1   . TYR B 1 82  ? -8.799  -10.434 -5.816  1.00 40.00  ? 158 TYR B CD1   1 
ATOM   2651 C  CD2   . TYR B 1 82  ? -9.753  -12.428 -4.908  1.00 45.96  ? 158 TYR B CD2   1 
ATOM   2652 C  CE1   . TYR B 1 82  ? -8.771  -9.872  -4.545  1.00 40.92  ? 158 TYR B CE1   1 
ATOM   2653 C  CE2   . TYR B 1 82  ? -9.727  -11.877 -3.636  1.00 41.80  ? 158 TYR B CE2   1 
ATOM   2654 C  CZ    . TYR B 1 82  ? -9.233  -10.601 -3.460  1.00 42.38  ? 158 TYR B CZ    1 
ATOM   2655 O  OH    . TYR B 1 82  ? -9.208  -10.054 -2.198  1.00 45.19  ? 158 TYR B OH    1 
ATOM   2656 N  N     . ILE B 1 83  ? -12.408 -12.575 -7.955  1.00 41.52  ? 159 ILE B N     1 
ATOM   2657 C  CA    . ILE B 1 83  ? -13.827 -12.530 -7.632  1.00 40.18  ? 159 ILE B CA    1 
ATOM   2658 C  C     . ILE B 1 83  ? -14.193 -13.391 -6.421  1.00 41.63  ? 159 ILE B C     1 
ATOM   2659 O  O     . ILE B 1 83  ? -13.444 -14.282 -6.008  1.00 41.90  ? 159 ILE B O     1 
ATOM   2660 C  CB    . ILE B 1 83  ? -14.664 -12.954 -8.855  1.00 39.50  ? 159 ILE B CB    1 
ATOM   2661 C  CG1   . ILE B 1 83  ? -14.441 -14.433 -9.184  1.00 39.04  ? 159 ILE B CG1   1 
ATOM   2662 C  CG2   . ILE B 1 83  ? -14.270 -12.114 -10.066 1.00 33.57  ? 159 ILE B CG2   1 
ATOM   2663 C  CD1   . ILE B 1 83  ? -15.618 -15.310 -8.888  1.00 37.31  ? 159 ILE B CD1   1 
ATOM   2664 N  N     . ALA B 1 84  ? -15.352 -13.101 -5.844  1.00 44.30  ? 160 ALA B N     1 
ATOM   2665 C  CA    . ALA B 1 84  ? -15.905 -13.895 -4.758  1.00 36.83  ? 160 ALA B CA    1 
ATOM   2666 C  C     . ALA B 1 84  ? -17.382 -14.063 -5.035  1.00 39.81  ? 160 ALA B C     1 
ATOM   2667 O  O     . ALA B 1 84  ? -18.156 -13.129 -4.823  1.00 37.46  ? 160 ALA B O     1 
ATOM   2668 C  CB    . ALA B 1 84  ? -15.707 -13.179 -3.425  1.00 39.13  ? 160 ALA B CB    1 
ATOM   2669 N  N     . MET B 1 85  ? -17.796 -15.222 -5.538  1.00 35.57  ? 161 MET B N     1 
ATOM   2670 C  CA    . MET B 1 85  ? -19.227 -15.461 -5.574  1.00 37.96  ? 161 MET B CA    1 
ATOM   2671 C  C     . MET B 1 85  ? -19.656 -15.600 -4.109  1.00 41.10  ? 161 MET B C     1 
ATOM   2672 O  O     . MET B 1 85  ? -19.070 -16.364 -3.347  1.00 40.36  ? 161 MET B O     1 
ATOM   2673 C  CB    . MET B 1 85  ? -19.590 -16.683 -6.412  1.00 37.08  ? 161 MET B CB    1 
ATOM   2674 C  CG    . MET B 1 85  ? -18.820 -17.921 -6.101  1.00 36.85  ? 161 MET B CG    1 
ATOM   2675 S  SD    . MET B 1 85  ? -19.143 -19.165 -7.359  1.00 40.65  ? 161 MET B SD    1 
ATOM   2676 C  CE    . MET B 1 85  ? -17.699 -19.009 -8.400  1.00 35.88  ? 161 MET B CE    1 
ATOM   2677 N  N     . HIS B 1 86  ? -20.643 -14.817 -3.707  1.00 34.96  ? 162 HIS B N     1 
ATOM   2678 C  CA    . HIS B 1 86  ? -20.911 -14.651 -2.294  1.00 42.41  ? 162 HIS B CA    1 
ATOM   2679 C  C     . HIS B 1 86  ? -22.406 -14.554 -2.038  1.00 39.19  ? 162 HIS B C     1 
ATOM   2680 O  O     . HIS B 1 86  ? -23.022 -13.545 -2.349  1.00 38.10  ? 162 HIS B O     1 
ATOM   2681 C  CB    . HIS B 1 86  ? -20.211 -13.389 -1.778  1.00 41.82  ? 162 HIS B CB    1 
ATOM   2682 C  CG    . HIS B 1 86  ? -19.881 -13.443 -0.321  1.00 40.73  ? 162 HIS B CG    1 
ATOM   2683 N  ND1   . HIS B 1 86  ? -20.839 -13.641 0.650   1.00 40.19  ? 162 HIS B ND1   1 
ATOM   2684 C  CD2   . HIS B 1 86  ? -18.699 -13.353 0.329   1.00 43.15  ? 162 HIS B CD2   1 
ATOM   2685 C  CE1   . HIS B 1 86  ? -20.263 -13.653 1.838   1.00 42.37  ? 162 HIS B CE1   1 
ATOM   2686 N  NE2   . HIS B 1 86  ? -18.963 -13.493 1.671   1.00 43.63  ? 162 HIS B NE2   1 
ATOM   2687 N  N     . ASP B 1 87  ? -22.987 -15.617 -1.492  1.00 37.90  ? 163 ASP B N     1 
ATOM   2688 C  CA    . ASP B 1 87  ? -24.399 -15.613 -1.137  1.00 35.46  ? 163 ASP B CA    1 
ATOM   2689 C  C     . ASP B 1 87  ? -24.701 -14.436 -0.222  1.00 40.24  ? 163 ASP B C     1 
ATOM   2690 O  O     . ASP B 1 87  ? -23.863 -14.032 0.588   1.00 39.59  ? 163 ASP B O     1 
ATOM   2691 C  CB    . ASP B 1 87  ? -24.787 -16.944 -0.484  1.00 34.47  ? 163 ASP B CB    1 
ATOM   2692 C  CG    . ASP B 1 87  ? -24.727 -18.089 -1.460  1.00 42.82  ? 163 ASP B CG    1 
ATOM   2693 O  OD1   . ASP B 1 87  ? -24.289 -17.837 -2.612  1.00 36.58  ? 163 ASP B OD1   1 
ATOM   2694 O  OD2   . ASP B 1 87  ? -25.099 -19.230 -1.085  1.00 41.33  ? 163 ASP B OD2   1 
ATOM   2695 N  N     . VAL B 1 88  ? -25.889 -13.865 -0.379  1.00 39.25  ? 164 VAL B N     1 
ATOM   2696 C  CA    . VAL B 1 88  ? -26.213 -12.606 0.282   1.00 32.41  ? 164 VAL B CA    1 
ATOM   2697 C  C     . VAL B 1 88  ? -26.625 -12.816 1.749   1.00 39.17  ? 164 VAL B C     1 
ATOM   2698 O  O     . VAL B 1 88  ? -26.582 -11.884 2.553   1.00 37.54  ? 164 VAL B O     1 
ATOM   2699 C  CB    . VAL B 1 88  ? -27.283 -11.821 -0.528  1.00 36.06  ? 164 VAL B CB    1 
ATOM   2700 C  CG1   . VAL B 1 88  ? -28.635 -12.522 -0.485  1.00 30.21  ? 164 VAL B CG1   1 
ATOM   2701 C  CG2   . VAL B 1 88  ? -27.374 -10.360 -0.085  1.00 39.72  ? 164 VAL B CG2   1 
ATOM   2702 N  N     . ASP B 1 89  ? -26.983 -14.053 2.097   1.00 39.25  ? 165 ASP B N     1 
ATOM   2703 C  CA    . ASP B 1 89  ? -27.402 -14.388 3.460   1.00 45.45  ? 165 ASP B CA    1 
ATOM   2704 C  C     . ASP B 1 89  ? -26.311 -15.125 4.234   1.00 47.23  ? 165 ASP B C     1 
ATOM   2705 O  O     . ASP B 1 89  ? -26.558 -15.641 5.319   1.00 49.28  ? 165 ASP B O     1 
ATOM   2706 C  CB    . ASP B 1 89  ? -28.664 -15.258 3.438   1.00 36.36  ? 165 ASP B CB    1 
ATOM   2707 C  CG    . ASP B 1 89  ? -28.449 -16.580 2.712   1.00 45.35  ? 165 ASP B CG    1 
ATOM   2708 O  OD1   . ASP B 1 89  ? -27.278 -16.905 2.384   1.00 41.23  ? 165 ASP B OD1   1 
ATOM   2709 O  OD2   . ASP B 1 89  ? -29.449 -17.293 2.461   1.00 34.28  ? 165 ASP B OD2   1 
ATOM   2710 N  N     . LEU B 1 90  ? -25.116 -15.215 3.665   1.00 43.74  ? 166 LEU B N     1 
ATOM   2711 C  CA    . LEU B 1 90  ? -24.056 -15.968 4.323   1.00 46.75  ? 166 LEU B CA    1 
ATOM   2712 C  C     . LEU B 1 90  ? -22.983 -15.008 4.808   1.00 44.92  ? 166 LEU B C     1 
ATOM   2713 O  O     . LEU B 1 90  ? -22.150 -14.549 4.032   1.00 52.62  ? 166 LEU B O     1 
ATOM   2714 C  CB    . LEU B 1 90  ? -23.488 -17.031 3.383   1.00 40.59  ? 166 LEU B CB    1 
ATOM   2715 C  CG    . LEU B 1 90  ? -22.722 -18.176 4.036   1.00 43.35  ? 166 LEU B CG    1 
ATOM   2716 C  CD1   . LEU B 1 90  ? -23.573 -18.877 5.080   1.00 48.01  ? 166 LEU B CD1   1 
ATOM   2717 C  CD2   . LEU B 1 90  ? -22.301 -19.171 2.991   1.00 33.18  ? 166 LEU B CD2   1 
ATOM   2718 N  N     . LEU B 1 91  ? -23.017 -14.697 6.100   1.00 46.08  ? 167 LEU B N     1 
ATOM   2719 C  CA    . LEU B 1 91  ? -22.171 -13.650 6.669   1.00 49.66  ? 167 LEU B CA    1 
ATOM   2720 C  C     . LEU B 1 91  ? -21.004 -14.220 7.467   1.00 52.72  ? 167 LEU B C     1 
ATOM   2721 O  O     . LEU B 1 91  ? -21.209 -15.016 8.386   1.00 60.07  ? 167 LEU B O     1 
ATOM   2722 C  CB    . LEU B 1 91  ? -23.011 -12.732 7.558   1.00 41.68  ? 167 LEU B CB    1 
ATOM   2723 C  CG    . LEU B 1 91  ? -24.187 -12.056 6.851   1.00 49.08  ? 167 LEU B CG    1 
ATOM   2724 C  CD1   . LEU B 1 91  ? -24.957 -11.184 7.825   1.00 45.07  ? 167 LEU B CD1   1 
ATOM   2725 C  CD2   . LEU B 1 91  ? -23.709 -11.225 5.641   1.00 44.86  ? 167 LEU B CD2   1 
ATOM   2726 N  N     . PRO B 1 92  ? -19.772 -13.819 7.121   1.00 52.08  ? 168 PRO B N     1 
ATOM   2727 C  CA    . PRO B 1 92  ? -18.624 -14.378 7.841   1.00 52.07  ? 168 PRO B CA    1 
ATOM   2728 C  C     . PRO B 1 92  ? -18.470 -13.748 9.229   1.00 49.57  ? 168 PRO B C     1 
ATOM   2729 O  O     . PRO B 1 92  ? -18.518 -12.520 9.378   1.00 47.86  ? 168 PRO B O     1 
ATOM   2730 C  CB    . PRO B 1 92  ? -17.440 -14.033 6.931   1.00 49.65  ? 168 PRO B CB    1 
ATOM   2731 C  CG    . PRO B 1 92  ? -17.867 -12.779 6.219   1.00 43.77  ? 168 PRO B CG    1 
ATOM   2732 C  CD    . PRO B 1 92  ? -19.370 -12.851 6.079   1.00 46.70  ? 168 PRO B CD    1 
ATOM   2733 N  N     . LEU B 1 93  ? -18.292 -14.600 10.238  1.00 55.83  ? 169 LEU B N     1 
ATOM   2734 C  CA    . LEU B 1 93  ? -18.168 -14.160 11.629  1.00 54.92  ? 169 LEU B CA    1 
ATOM   2735 C  C     . LEU B 1 93  ? -16.724 -14.222 12.132  1.00 54.96  ? 169 LEU B C     1 
ATOM   2736 O  O     . LEU B 1 93  ? -16.395 -13.655 13.166  1.00 57.75  ? 169 LEU B O     1 
ATOM   2737 C  CB    . LEU B 1 93  ? -19.060 -15.018 12.528  1.00 54.85  ? 169 LEU B CB    1 
ATOM   2738 C  CG    . LEU B 1 93  ? -20.570 -14.926 12.283  1.00 54.73  ? 169 LEU B CG    1 
ATOM   2739 C  CD1   . LEU B 1 93  ? -21.348 -15.648 13.375  1.00 45.54  ? 169 LEU B CD1   1 
ATOM   2740 C  CD2   . LEU B 1 93  ? -21.008 -13.470 12.164  1.00 50.89  ? 169 LEU B CD2   1 
ATOM   2741 N  N     . ASN B 1 94  ? -15.870 -14.905 11.379  1.00 54.34  ? 170 ASN B N     1 
ATOM   2742 C  CA    . ASN B 1 94  ? -14.500 -15.190 11.785  1.00 55.81  ? 170 ASN B CA    1 
ATOM   2743 C  C     . ASN B 1 94  ? -13.510 -14.429 10.905  1.00 57.92  ? 170 ASN B C     1 
ATOM   2744 O  O     . ASN B 1 94  ? -13.384 -14.701 9.712   1.00 55.71  ? 170 ASN B O     1 
ATOM   2745 C  CB    . ASN B 1 94  ? -14.253 -16.701 11.664  1.00 52.24  ? 170 ASN B CB    1 
ATOM   2746 C  CG    . ASN B 1 94  ? -13.020 -17.169 12.421  1.00 58.46  ? 170 ASN B CG    1 
ATOM   2747 O  OD1   . ASN B 1 94  ? -12.046 -16.436 12.575  1.00 54.84  ? 170 ASN B OD1   1 
ATOM   2748 N  ND2   . ASN B 1 94  ? -13.062 -18.410 12.899  1.00 66.28  ? 170 ASN B ND2   1 
ATOM   2749 N  N     . GLU B 1 95  ? -12.790 -13.486 11.494  1.00 63.15  ? 171 GLU B N     1 
ATOM   2750 C  CA    . GLU B 1 95  ? -11.877 -12.645 10.721  1.00 63.24  ? 171 GLU B CA    1 
ATOM   2751 C  C     . GLU B 1 95  ? -10.643 -13.397 10.217  1.00 60.94  ? 171 GLU B C     1 
ATOM   2752 O  O     . GLU B 1 95  ? -9.780  -12.814 9.562   1.00 60.09  ? 171 GLU B O     1 
ATOM   2753 C  CB    . GLU B 1 95  ? -11.466 -11.418 11.537  1.00 57.56  ? 171 GLU B CB    1 
ATOM   2754 C  CG    . GLU B 1 95  ? -12.534 -10.347 11.606  1.00 63.12  ? 171 GLU B CG    1 
ATOM   2755 C  CD    . GLU B 1 95  ? -12.095 -9.139  12.417  1.00 83.98  ? 171 GLU B CD    1 
ATOM   2756 O  OE1   . GLU B 1 95  ? -10.963 -9.151  12.952  1.00 86.33  ? 171 GLU B OE1   1 
ATOM   2757 O  OE2   . GLU B 1 95  ? -12.885 -8.176  12.519  1.00 84.40  ? 171 GLU B OE2   1 
ATOM   2758 N  N     . GLU B 1 96  ? -10.577 -14.692 10.519  1.00 61.23  ? 172 GLU B N     1 
ATOM   2759 C  CA    . GLU B 1 96  ? -9.449  -15.540 10.147  1.00 61.72  ? 172 GLU B CA    1 
ATOM   2760 C  C     . GLU B 1 96  ? -9.691  -16.160 8.777   1.00 60.97  ? 172 GLU B C     1 
ATOM   2761 O  O     . GLU B 1 96  ? -8.829  -16.844 8.224   1.00 52.80  ? 172 GLU B O     1 
ATOM   2762 C  CB    . GLU B 1 96  ? -9.281  -16.659 11.182  1.00 67.89  ? 172 GLU B CB    1 
ATOM   2763 C  CG    . GLU B 1 96  ? -7.843  -17.051 11.485  1.00 75.88  ? 172 GLU B CG    1 
ATOM   2764 C  CD    . GLU B 1 96  ? -7.179  -16.123 12.493  1.00 77.07  ? 172 GLU B CD    1 
ATOM   2765 O  OE1   . GLU B 1 96  ? -7.715  -15.022 12.752  1.00 72.52  ? 172 GLU B OE1   1 
ATOM   2766 O  OE2   . GLU B 1 96  ? -6.117  -16.503 13.031  1.00 82.89  ? 172 GLU B OE2   1 
ATOM   2767 N  N     . LEU B 1 97  ? -10.886 -15.941 8.244   1.00 60.71  ? 173 LEU B N     1 
ATOM   2768 C  CA    . LEU B 1 97  ? -11.219 -16.433 6.921   1.00 56.74  ? 173 LEU B CA    1 
ATOM   2769 C  C     . LEU B 1 97  ? -10.479 -15.600 5.875   1.00 55.37  ? 173 LEU B C     1 
ATOM   2770 O  O     . LEU B 1 97  ? -10.649 -14.387 5.797   1.00 55.78  ? 173 LEU B O     1 
ATOM   2771 C  CB    . LEU B 1 97  ? -12.725 -16.375 6.692   1.00 49.41  ? 173 LEU B CB    1 
ATOM   2772 C  CG    . LEU B 1 97  ? -13.584 -17.262 7.584   1.00 52.17  ? 173 LEU B CG    1 
ATOM   2773 C  CD1   . LEU B 1 97  ? -15.031 -16.945 7.325   1.00 60.77  ? 173 LEU B CD1   1 
ATOM   2774 C  CD2   . LEU B 1 97  ? -13.310 -18.736 7.337   1.00 55.20  ? 173 LEU B CD2   1 
ATOM   2775 N  N     . ASP B 1 98  ? -9.650  -16.267 5.086   1.00 51.49  ? 174 ASP B N     1 
ATOM   2776 C  CA    . ASP B 1 98  ? -8.804  -15.612 4.099   1.00 53.81  ? 174 ASP B CA    1 
ATOM   2777 C  C     . ASP B 1 98  ? -9.594  -15.180 2.863   1.00 51.31  ? 174 ASP B C     1 
ATOM   2778 O  O     . ASP B 1 98  ? -9.994  -16.014 2.044   1.00 50.42  ? 174 ASP B O     1 
ATOM   2779 C  CB    . ASP B 1 98  ? -7.678  -16.567 3.702   1.00 50.37  ? 174 ASP B CB    1 
ATOM   2780 C  CG    . ASP B 1 98  ? -6.581  -15.895 2.909   1.00 53.78  ? 174 ASP B CG    1 
ATOM   2781 O  OD1   . ASP B 1 98  ? -6.609  -14.652 2.705   1.00 52.47  ? 174 ASP B OD1   1 
ATOM   2782 O  OD2   . ASP B 1 98  ? -5.667  -16.636 2.501   1.00 56.08  ? 174 ASP B OD2   1 
ATOM   2783 N  N     . TYR B 1 99  ? -9.813  -13.873 2.744   1.00 49.71  ? 175 TYR B N     1 
ATOM   2784 C  CA    . TYR B 1 99  ? -10.498 -13.298 1.594   1.00 45.03  ? 175 TYR B CA    1 
ATOM   2785 C  C     . TYR B 1 99  ? -9.492  -12.560 0.717   1.00 46.83  ? 175 TYR B C     1 
ATOM   2786 O  O     . TYR B 1 99  ? -9.860  -11.688 -0.063  1.00 49.72  ? 175 TYR B O     1 
ATOM   2787 C  CB    . TYR B 1 99  ? -11.575 -12.313 2.049   1.00 39.99  ? 175 TYR B CB    1 
ATOM   2788 C  CG    . TYR B 1 99  ? -12.954 -12.891 2.307   1.00 45.44  ? 175 TYR B CG    1 
ATOM   2789 C  CD1   . TYR B 1 99  ? -13.194 -13.720 3.402   1.00 46.09  ? 175 TYR B CD1   1 
ATOM   2790 C  CD2   . TYR B 1 99  ? -14.029 -12.574 1.475   1.00 37.87  ? 175 TYR B CD2   1 
ATOM   2791 C  CE1   . TYR B 1 99  ? -14.453 -14.229 3.649   1.00 44.21  ? 175 TYR B CE1   1 
ATOM   2792 C  CE2   . TYR B 1 99  ? -15.297 -13.076 1.712   1.00 38.02  ? 175 TYR B CE2   1 
ATOM   2793 C  CZ    . TYR B 1 99  ? -15.504 -13.905 2.806   1.00 47.17  ? 175 TYR B CZ    1 
ATOM   2794 O  OH    . TYR B 1 99  ? -16.759 -14.416 3.069   1.00 44.43  ? 175 TYR B OH    1 
ATOM   2795 N  N     . GLY B 1 100 ? -8.216  -12.886 0.870   1.00 43.31  ? 176 GLY B N     1 
ATOM   2796 C  CA    . GLY B 1 100 ? -7.189  -12.285 0.037   1.00 48.94  ? 176 GLY B CA    1 
ATOM   2797 C  C     . GLY B 1 100 ? -7.092  -12.929 -1.337  1.00 47.35  ? 176 GLY B C     1 
ATOM   2798 O  O     . GLY B 1 100 ? -7.754  -13.926 -1.615  1.00 47.11  ? 176 GLY B O     1 
ATOM   2799 N  N     . PHE B 1 101 ? -6.270  -12.355 -2.206  1.00 45.39  ? 177 PHE B N     1 
ATOM   2800 C  CA    . PHE B 1 101 ? -6.042  -12.934 -3.531  1.00 49.61  ? 177 PHE B CA    1 
ATOM   2801 C  C     . PHE B 1 101 ? -5.599  -14.406 -3.445  1.00 47.86  ? 177 PHE B C     1 
ATOM   2802 O  O     . PHE B 1 101 ? -4.546  -14.695 -2.892  1.00 58.17  ? 177 PHE B O     1 
ATOM   2803 C  CB    . PHE B 1 101 ? -4.986  -12.109 -4.270  1.00 49.24  ? 177 PHE B CB    1 
ATOM   2804 C  CG    . PHE B 1 101 ? -4.851  -12.449 -5.722  1.00 48.37  ? 177 PHE B CG    1 
ATOM   2805 C  CD1   . PHE B 1 101 ? -5.634  -11.816 -6.668  1.00 46.04  ? 177 PHE B CD1   1 
ATOM   2806 C  CD2   . PHE B 1 101 ? -3.932  -13.395 -6.144  1.00 48.89  ? 177 PHE B CD2   1 
ATOM   2807 C  CE1   . PHE B 1 101 ? -5.509  -12.123 -8.004  1.00 44.71  ? 177 PHE B CE1   1 
ATOM   2808 C  CE2   . PHE B 1 101 ? -3.806  -13.705 -7.484  1.00 49.75  ? 177 PHE B CE2   1 
ATOM   2809 C  CZ    . PHE B 1 101 ? -4.596  -13.072 -8.412  1.00 47.48  ? 177 PHE B CZ    1 
ATOM   2810 N  N     . PRO B 1 102 ? -6.403  -15.338 -3.997  1.00 51.87  ? 178 PRO B N     1 
ATOM   2811 C  CA    . PRO B 1 102 ? -6.131  -16.783 -3.913  1.00 44.86  ? 178 PRO B CA    1 
ATOM   2812 C  C     . PRO B 1 102 ? -5.182  -17.269 -5.009  1.00 47.92  ? 178 PRO B C     1 
ATOM   2813 O  O     . PRO B 1 102 ? -5.585  -17.980 -5.932  1.00 44.63  ? 178 PRO B O     1 
ATOM   2814 C  CB    . PRO B 1 102 ? -7.514  -17.397 -4.120  1.00 43.45  ? 178 PRO B CB    1 
ATOM   2815 C  CG    . PRO B 1 102 ? -8.182  -16.442 -5.074  1.00 43.73  ? 178 PRO B CG    1 
ATOM   2816 C  CD    . PRO B 1 102 ? -7.649  -15.063 -4.738  1.00 44.22  ? 178 PRO B CD    1 
ATOM   2817 N  N     . GLU B 1 103 ? -3.918  -16.888 -4.881  1.00 56.19  ? 179 GLU B N     1 
ATOM   2818 C  CA    . GLU B 1 103 ? -2.900  -17.125 -5.902  1.00 56.31  ? 179 GLU B CA    1 
ATOM   2819 C  C     . GLU B 1 103 ? -2.723  -18.598 -6.298  1.00 49.14  ? 179 GLU B C     1 
ATOM   2820 O  O     . GLU B 1 103 ? -2.592  -18.921 -7.480  1.00 52.55  ? 179 GLU B O     1 
ATOM   2821 C  CB    . GLU B 1 103 ? -1.568  -16.531 -5.426  1.00 59.36  ? 179 GLU B CB    1 
ATOM   2822 C  CG    . GLU B 1 103 ? -0.393  -16.728 -6.362  1.00 63.71  ? 179 GLU B CG    1 
ATOM   2823 C  CD    . GLU B 1 103 ? 0.705   -15.705 -6.115  1.00 80.70  ? 179 GLU B CD    1 
ATOM   2824 O  OE1   . GLU B 1 103 ? 0.397   -14.638 -5.537  1.00 83.15  ? 179 GLU B OE1   1 
ATOM   2825 O  OE2   . GLU B 1 103 ? 1.870   -15.963 -6.495  1.00 84.76  ? 179 GLU B OE2   1 
ATOM   2826 N  N     . ALA B 1 104 ? -2.738  -19.485 -5.312  1.00 49.00  ? 180 ALA B N     1 
ATOM   2827 C  CA    . ALA B 1 104 ? -2.464  -20.907 -5.544  1.00 45.36  ? 180 ALA B CA    1 
ATOM   2828 C  C     . ALA B 1 104 ? -3.589  -21.686 -6.228  1.00 44.02  ? 180 ALA B C     1 
ATOM   2829 O  O     . ALA B 1 104 ? -3.361  -22.768 -6.761  1.00 50.03  ? 180 ALA B O     1 
ATOM   2830 C  CB    . ALA B 1 104 ? -2.112  -21.565 -4.238  1.00 43.18  ? 180 ALA B CB    1 
ATOM   2831 N  N     . GLY B 1 105 ? -4.805  -21.154 -6.188  1.00 45.60  ? 181 GLY B N     1 
ATOM   2832 C  CA    . GLY B 1 105 ? -5.963  -21.850 -6.717  1.00 36.99  ? 181 GLY B CA    1 
ATOM   2833 C  C     . GLY B 1 105 ? -7.220  -21.356 -6.020  1.00 41.23  ? 181 GLY B C     1 
ATOM   2834 O  O     . GLY B 1 105 ? -7.132  -20.635 -5.034  1.00 43.34  ? 181 GLY B O     1 
ATOM   2835 N  N     . PRO B 1 106 ? -8.394  -21.735 -6.543  1.00 41.84  ? 182 PRO B N     1 
ATOM   2836 C  CA    . PRO B 1 106 ? -9.710  -21.363 -6.008  1.00 36.72  ? 182 PRO B CA    1 
ATOM   2837 C  C     . PRO B 1 106 ? -9.813  -21.610 -4.501  1.00 45.30  ? 182 PRO B C     1 
ATOM   2838 O  O     . PRO B 1 106 ? -9.455  -22.684 -4.032  1.00 48.35  ? 182 PRO B O     1 
ATOM   2839 C  CB    . PRO B 1 106 ? -10.661 -22.285 -6.773  1.00 38.47  ? 182 PRO B CB    1 
ATOM   2840 C  CG    . PRO B 1 106 ? -9.977  -22.493 -8.090  1.00 34.72  ? 182 PRO B CG    1 
ATOM   2841 C  CD    . PRO B 1 106 ? -8.498  -22.512 -7.795  1.00 33.32  ? 182 PRO B CD    1 
ATOM   2842 N  N     . PHE B 1 107 ? -10.275 -20.612 -3.756  1.00 43.39  ? 183 PHE B N     1 
ATOM   2843 C  CA    . PHE B 1 107 ? -10.363 -20.704 -2.300  1.00 41.76  ? 183 PHE B CA    1 
ATOM   2844 C  C     . PHE B 1 107 ? -11.812 -20.759 -1.842  1.00 45.58  ? 183 PHE B C     1 
ATOM   2845 O  O     . PHE B 1 107 ? -12.558 -19.788 -1.993  1.00 45.64  ? 183 PHE B O     1 
ATOM   2846 C  CB    . PHE B 1 107 ? -9.674  -19.519 -1.626  1.00 43.31  ? 183 PHE B CB    1 
ATOM   2847 C  CG    . PHE B 1 107 ? -9.440  -19.722 -0.165  1.00 49.08  ? 183 PHE B CG    1 
ATOM   2848 C  CD1   . PHE B 1 107 ? -8.416  -20.544 0.275   1.00 47.67  ? 183 PHE B CD1   1 
ATOM   2849 C  CD2   . PHE B 1 107 ? -10.252 -19.107 0.776   1.00 53.96  ? 183 PHE B CD2   1 
ATOM   2850 C  CE1   . PHE B 1 107 ? -8.196  -20.744 1.637   1.00 55.78  ? 183 PHE B CE1   1 
ATOM   2851 C  CE2   . PHE B 1 107 ? -10.041 -19.304 2.142   1.00 52.42  ? 183 PHE B CE2   1 
ATOM   2852 C  CZ    . PHE B 1 107 ? -9.016  -20.125 2.572   1.00 53.03  ? 183 PHE B CZ    1 
ATOM   2853 N  N     . HIS B 1 108 ? -12.204 -21.896 -1.278  1.00 46.42  ? 184 HIS B N     1 
ATOM   2854 C  CA    . HIS B 1 108 ? -13.564 -22.086 -0.795  1.00 47.93  ? 184 HIS B CA    1 
ATOM   2855 C  C     . HIS B 1 108 ? -13.709 -21.592 0.647   1.00 46.43  ? 184 HIS B C     1 
ATOM   2856 O  O     . HIS B 1 108 ? -13.407 -22.325 1.585   1.00 46.33  ? 184 HIS B O     1 
ATOM   2857 C  CB    . HIS B 1 108 ? -13.945 -23.565 -0.873  1.00 40.58  ? 184 HIS B CB    1 
ATOM   2858 C  CG    . HIS B 1 108 ? -15.376 -23.833 -0.524  1.00 44.89  ? 184 HIS B CG    1 
ATOM   2859 N  ND1   . HIS B 1 108 ? -15.804 -25.023 0.026   1.00 41.70  ? 184 HIS B ND1   1 
ATOM   2860 C  CD2   . HIS B 1 108 ? -16.479 -23.058 -0.644  1.00 47.29  ? 184 HIS B CD2   1 
ATOM   2861 C  CE1   . HIS B 1 108 ? -17.108 -24.970 0.226   1.00 38.74  ? 184 HIS B CE1   1 
ATOM   2862 N  NE2   . HIS B 1 108 ? -17.543 -23.788 -0.178  1.00 43.04  ? 184 HIS B NE2   1 
ATOM   2863 N  N     . VAL B 1 109 ? -14.167 -20.358 0.828   1.00 47.07  ? 185 VAL B N     1 
ATOM   2864 C  CA    . VAL B 1 109 ? -14.361 -19.822 2.178   1.00 42.01  ? 185 VAL B CA    1 
ATOM   2865 C  C     . VAL B 1 109 ? -15.370 -20.664 2.977   1.00 49.34  ? 185 VAL B C     1 
ATOM   2866 O  O     . VAL B 1 109 ? -15.105 -21.041 4.122   1.00 45.76  ? 185 VAL B O     1 
ATOM   2867 C  CB    . VAL B 1 109 ? -14.807 -18.343 2.151   1.00 46.52  ? 185 VAL B CB    1 
ATOM   2868 C  CG1   . VAL B 1 109 ? -15.345 -17.915 3.509   1.00 38.77  ? 185 VAL B CG1   1 
ATOM   2869 C  CG2   . VAL B 1 109 ? -13.653 -17.433 1.718   1.00 44.49  ? 185 VAL B CG2   1 
ATOM   2870 N  N     . ALA B 1 110 ? -16.504 -20.979 2.351   1.00 44.67  ? 186 ALA B N     1 
ATOM   2871 C  CA    . ALA B 1 110 ? -17.611 -21.657 3.020   1.00 44.14  ? 186 ALA B CA    1 
ATOM   2872 C  C     . ALA B 1 110 ? -17.425 -23.171 3.075   1.00 44.53  ? 186 ALA B C     1 
ATOM   2873 O  O     . ALA B 1 110 ? -18.319 -23.917 2.695   1.00 41.38  ? 186 ALA B O     1 
ATOM   2874 C  CB    . ALA B 1 110 ? -18.922 -21.314 2.338   1.00 37.61  ? 186 ALA B CB    1 
ATOM   2875 N  N     . SER B 1 111 ? -16.262 -23.600 3.560   1.00 46.95  ? 187 SER B N     1 
ATOM   2876 C  CA    . SER B 1 111 ? -15.879 -25.009 3.676   1.00 47.47  ? 187 SER B CA    1 
ATOM   2877 C  C     . SER B 1 111 ? -16.976 -25.928 4.215   1.00 50.71  ? 187 SER B C     1 
ATOM   2878 O  O     . SER B 1 111 ? -17.785 -25.520 5.049   1.00 49.04  ? 187 SER B O     1 
ATOM   2879 C  CB    . SER B 1 111 ? -14.659 -25.119 4.594   1.00 53.48  ? 187 SER B CB    1 
ATOM   2880 O  OG    . SER B 1 111 ? -14.308 -26.473 4.813   1.00 52.59  ? 187 SER B OG    1 
ATOM   2881 N  N     . PRO B 1 112 ? -16.998 -27.178 3.742   1.00 40.52  ? 188 PRO B N     1 
ATOM   2882 C  CA    . PRO B 1 112 ? -17.915 -28.198 4.261   1.00 50.73  ? 188 PRO B CA    1 
ATOM   2883 C  C     . PRO B 1 112 ? -17.662 -28.457 5.747   1.00 50.09  ? 188 PRO B C     1 
ATOM   2884 O  O     . PRO B 1 112 ? -18.536 -28.981 6.430   1.00 53.50  ? 188 PRO B O     1 
ATOM   2885 C  CB    . PRO B 1 112 ? -17.552 -29.446 3.454   1.00 47.27  ? 188 PRO B CB    1 
ATOM   2886 C  CG    . PRO B 1 112 ? -16.878 -28.935 2.250   1.00 50.61  ? 188 PRO B CG    1 
ATOM   2887 C  CD    . PRO B 1 112 ? -16.161 -27.694 2.659   1.00 37.86  ? 188 PRO B CD    1 
ATOM   2888 N  N     . GLU B 1 113 ? -16.478 -28.086 6.229   1.00 47.99  ? 189 GLU B N     1 
ATOM   2889 C  CA    . GLU B 1 113 ? -16.165 -28.162 7.648   1.00 57.25  ? 189 GLU B CA    1 
ATOM   2890 C  C     . GLU B 1 113 ? -16.853 -27.036 8.432   1.00 63.38  ? 189 GLU B C     1 
ATOM   2891 O  O     . GLU B 1 113 ? -17.099 -27.169 9.629   1.00 58.92  ? 189 GLU B O     1 
ATOM   2892 C  CB    . GLU B 1 113 ? -14.645 -28.099 7.866   1.00 62.16  ? 189 GLU B CB    1 
ATOM   2893 C  CG    . GLU B 1 113 ? -14.215 -28.246 9.325   1.00 67.78  ? 189 GLU B CG    1 
ATOM   2894 C  CD    . GLU B 1 113 ? -12.745 -27.931 9.564   1.00 82.06  ? 189 GLU B CD    1 
ATOM   2895 O  OE1   . GLU B 1 113 ? -12.086 -27.377 8.656   1.00 79.27  ? 189 GLU B OE1   1 
ATOM   2896 O  OE2   . GLU B 1 113 ? -12.248 -28.236 10.673  1.00 83.23  ? 189 GLU B OE2   1 
ATOM   2897 N  N     . LEU B 1 114 ? -17.168 -25.931 7.755   1.00 57.61  ? 190 LEU B N     1 
ATOM   2898 C  CA    . LEU B 1 114 ? -17.648 -24.738 8.447   1.00 57.41  ? 190 LEU B CA    1 
ATOM   2899 C  C     . LEU B 1 114 ? -19.074 -24.323 8.086   1.00 55.30  ? 190 LEU B C     1 
ATOM   2900 O  O     . LEU B 1 114 ? -19.725 -23.612 8.843   1.00 53.48  ? 190 LEU B O     1 
ATOM   2901 C  CB    . LEU B 1 114 ? -16.706 -23.569 8.187   1.00 56.88  ? 190 LEU B CB    1 
ATOM   2902 C  CG    . LEU B 1 114 ? -15.212 -23.876 8.276   1.00 62.01  ? 190 LEU B CG    1 
ATOM   2903 C  CD1   . LEU B 1 114 ? -14.413 -22.599 8.002   1.00 60.49  ? 190 LEU B CD1   1 
ATOM   2904 C  CD2   . LEU B 1 114 ? -14.845 -24.471 9.626   1.00 60.56  ? 190 LEU B CD2   1 
ATOM   2905 N  N     . HIS B 1 115 ? -19.552 -24.756 6.927   1.00 54.09  ? 191 HIS B N     1 
ATOM   2906 C  CA    . HIS B 1 115 ? -20.880 -24.358 6.472   1.00 55.60  ? 191 HIS B CA    1 
ATOM   2907 C  C     . HIS B 1 115 ? -21.932 -25.038 7.330   1.00 47.59  ? 191 HIS B C     1 
ATOM   2908 O  O     . HIS B 1 115 ? -21.795 -26.217 7.651   1.00 52.92  ? 191 HIS B O     1 
ATOM   2909 C  CB    . HIS B 1 115 ? -21.073 -24.713 4.991   1.00 52.51  ? 191 HIS B CB    1 
ATOM   2910 C  CG    . HIS B 1 115 ? -22.335 -24.165 4.398   1.00 49.76  ? 191 HIS B CG    1 
ATOM   2911 N  ND1   . HIS B 1 115 ? -23.561 -24.770 4.567   1.00 45.02  ? 191 HIS B ND1   1 
ATOM   2912 C  CD2   . HIS B 1 115 ? -22.562 -23.057 3.650   1.00 44.20  ? 191 HIS B CD2   1 
ATOM   2913 C  CE1   . HIS B 1 115 ? -24.489 -24.066 3.945   1.00 44.01  ? 191 HIS B CE1   1 
ATOM   2914 N  NE2   . HIS B 1 115 ? -23.907 -23.024 3.377   1.00 47.73  ? 191 HIS B NE2   1 
ATOM   2915 N  N     . PRO B 1 116 ? -22.990 -24.301 7.706   1.00 49.94  ? 192 PRO B N     1 
ATOM   2916 C  CA    . PRO B 1 116 ? -23.981 -24.863 8.643   1.00 50.19  ? 192 PRO B CA    1 
ATOM   2917 C  C     . PRO B 1 116 ? -24.858 -25.974 8.061   1.00 52.33  ? 192 PRO B C     1 
ATOM   2918 O  O     . PRO B 1 116 ? -25.357 -26.786 8.839   1.00 51.55  ? 192 PRO B O     1 
ATOM   2919 C  CB    . PRO B 1 116 ? -24.836 -23.647 9.038   1.00 51.15  ? 192 PRO B CB    1 
ATOM   2920 C  CG    . PRO B 1 116 ? -24.643 -22.656 7.927   1.00 51.32  ? 192 PRO B CG    1 
ATOM   2921 C  CD    . PRO B 1 116 ? -23.232 -22.873 7.425   1.00 52.26  ? 192 PRO B CD    1 
ATOM   2922 N  N     . LEU B 1 117 ? -25.031 -26.024 6.739   1.00 52.52  ? 193 LEU B N     1 
ATOM   2923 C  CA    . LEU B 1 117 ? -25.933 -27.002 6.113   1.00 48.28  ? 193 LEU B CA    1 
ATOM   2924 C  C     . LEU B 1 117 ? -25.254 -28.054 5.241   1.00 55.94  ? 193 LEU B C     1 
ATOM   2925 O  O     . LEU B 1 117 ? -25.609 -29.229 5.297   1.00 54.58  ? 193 LEU B O     1 
ATOM   2926 C  CB    . LEU B 1 117 ? -26.998 -26.298 5.272   1.00 48.58  ? 193 LEU B CB    1 
ATOM   2927 C  CG    . LEU B 1 117 ? -28.319 -25.845 5.902   1.00 55.88  ? 193 LEU B CG    1 
ATOM   2928 C  CD1   . LEU B 1 117 ? -28.282 -25.802 7.435   1.00 50.13  ? 193 LEU B CD1   1 
ATOM   2929 C  CD2   . LEU B 1 117 ? -28.708 -24.493 5.326   1.00 44.22  ? 193 LEU B CD2   1 
ATOM   2930 N  N     . TYR B 1 118 ? -24.297 -27.647 4.414   1.00 54.96  ? 194 TYR B N     1 
ATOM   2931 C  CA    . TYR B 1 118 ? -23.715 -28.591 3.458   1.00 50.66  ? 194 TYR B CA    1 
ATOM   2932 C  C     . TYR B 1 118 ? -22.336 -29.054 3.910   1.00 48.71  ? 194 TYR B C     1 
ATOM   2933 O  O     . TYR B 1 118 ? -21.461 -28.241 4.211   1.00 49.22  ? 194 TYR B O     1 
ATOM   2934 C  CB    . TYR B 1 118 ? -23.741 -28.012 2.027   1.00 49.42  ? 194 TYR B CB    1 
ATOM   2935 C  CG    . TYR B 1 118 ? -25.117 -27.459 1.715   1.00 44.17  ? 194 TYR B CG    1 
ATOM   2936 C  CD1   . TYR B 1 118 ? -26.219 -28.310 1.613   1.00 44.29  ? 194 TYR B CD1   1 
ATOM   2937 C  CD2   . TYR B 1 118 ? -25.328 -26.093 1.594   1.00 40.18  ? 194 TYR B CD2   1 
ATOM   2938 C  CE1   . TYR B 1 118 ? -27.486 -27.816 1.371   1.00 45.70  ? 194 TYR B CE1   1 
ATOM   2939 C  CE2   . TYR B 1 118 ? -26.599 -25.579 1.354   1.00 42.51  ? 194 TYR B CE2   1 
ATOM   2940 C  CZ    . TYR B 1 118 ? -27.674 -26.445 1.246   1.00 51.72  ? 194 TYR B CZ    1 
ATOM   2941 O  OH    . TYR B 1 118 ? -28.932 -25.940 1.011   1.00 44.03  ? 194 TYR B OH    1 
ATOM   2942 N  N     . HIS B 1 119 ? -22.164 -30.373 3.971   1.00 50.46  ? 195 HIS B N     1 
ATOM   2943 C  CA    . HIS B 1 119 ? -21.016 -30.972 4.642   1.00 49.78  ? 195 HIS B CA    1 
ATOM   2944 C  C     . HIS B 1 119 ? -20.275 -32.015 3.805   1.00 45.45  ? 195 HIS B C     1 
ATOM   2945 O  O     . HIS B 1 119 ? -19.188 -32.440 4.189   1.00 46.24  ? 195 HIS B O     1 
ATOM   2946 C  CB    . HIS B 1 119 ? -21.456 -31.580 5.983   1.00 50.33  ? 195 HIS B CB    1 
ATOM   2947 C  CG    . HIS B 1 119 ? -22.102 -30.590 6.905   1.00 56.67  ? 195 HIS B CG    1 
ATOM   2948 N  ND1   . HIS B 1 119 ? -23.337 -30.802 7.481   1.00 53.22  ? 195 HIS B ND1   1 
ATOM   2949 C  CD2   . HIS B 1 119 ? -21.691 -29.374 7.337   1.00 54.27  ? 195 HIS B CD2   1 
ATOM   2950 C  CE1   . HIS B 1 119 ? -23.654 -29.761 8.230   1.00 55.55  ? 195 HIS B CE1   1 
ATOM   2951 N  NE2   . HIS B 1 119 ? -22.671 -28.883 8.165   1.00 54.01  ? 195 HIS B NE2   1 
ATOM   2952 N  N     . TYR B 1 120 ? -20.849 -32.430 2.674   1.00 39.53  ? 196 TYR B N     1 
ATOM   2953 C  CA    . TYR B 1 120 ? -20.146 -33.357 1.779   1.00 43.74  ? 196 TYR B CA    1 
ATOM   2954 C  C     . TYR B 1 120 ? -18.879 -32.691 1.234   1.00 45.33  ? 196 TYR B C     1 
ATOM   2955 O  O     . TYR B 1 120 ? -18.787 -31.467 1.180   1.00 50.11  ? 196 TYR B O     1 
ATOM   2956 C  CB    . TYR B 1 120 ? -21.058 -33.900 0.668   1.00 37.39  ? 196 TYR B CB    1 
ATOM   2957 C  CG    . TYR B 1 120 ? -21.602 -32.868 -0.298  1.00 52.58  ? 196 TYR B CG    1 
ATOM   2958 C  CD1   . TYR B 1 120 ? -22.681 -32.046 0.049   1.00 48.97  ? 196 TYR B CD1   1 
ATOM   2959 C  CD2   . TYR B 1 120 ? -21.054 -32.732 -1.573  1.00 51.92  ? 196 TYR B CD2   1 
ATOM   2960 C  CE1   . TYR B 1 120 ? -23.185 -31.113 -0.851  1.00 43.49  ? 196 TYR B CE1   1 
ATOM   2961 C  CE2   . TYR B 1 120 ? -21.544 -31.808 -2.472  1.00 44.78  ? 196 TYR B CE2   1 
ATOM   2962 C  CZ    . TYR B 1 120 ? -22.607 -31.003 -2.110  1.00 50.37  ? 196 TYR B CZ    1 
ATOM   2963 O  OH    . TYR B 1 120 ? -23.084 -30.100 -3.025  1.00 48.68  ? 196 TYR B OH    1 
ATOM   2964 N  N     . LYS B 1 121 ? -17.885 -33.488 0.868   1.00 52.48  ? 197 LYS B N     1 
ATOM   2965 C  CA    . LYS B 1 121 ? -16.547 -32.928 0.692   1.00 58.18  ? 197 LYS B CA    1 
ATOM   2966 C  C     . LYS B 1 121 ? -16.287 -32.160 -0.608  1.00 52.01  ? 197 LYS B C     1 
ATOM   2967 O  O     . LYS B 1 121 ? -15.365 -31.350 -0.657  1.00 46.70  ? 197 LYS B O     1 
ATOM   2968 C  CB    . LYS B 1 121 ? -15.454 -33.972 0.964   1.00 47.15  ? 197 LYS B CB    1 
ATOM   2969 C  CG    . LYS B 1 121 ? -15.609 -35.262 0.221   1.00 54.32  ? 197 LYS B CG    1 
ATOM   2970 C  CD    . LYS B 1 121 ? -14.558 -36.246 0.698   1.00 57.82  ? 197 LYS B CD    1 
ATOM   2971 C  CE    . LYS B 1 121 ? -15.121 -37.654 0.806   1.00 44.52  ? 197 LYS B CE    1 
ATOM   2972 N  NZ    . LYS B 1 121 ? -14.067 -38.638 0.429   1.00 41.89  ? 197 LYS B NZ    1 
ATOM   2973 N  N     . THR B 1 122 ? -17.093 -32.394 -1.642  1.00 45.22  ? 198 THR B N     1 
ATOM   2974 C  CA    . THR B 1 122 ? -16.943 -31.637 -2.876  1.00 45.76  ? 198 THR B CA    1 
ATOM   2975 C  C     . THR B 1 122 ? -17.893 -30.441 -2.974  1.00 51.97  ? 198 THR B C     1 
ATOM   2976 O  O     . THR B 1 122 ? -18.106 -29.909 -4.063  1.00 46.46  ? 198 THR B O     1 
ATOM   2977 C  CB    . THR B 1 122 ? -17.183 -32.491 -4.090  1.00 42.63  ? 198 THR B CB    1 
ATOM   2978 O  OG1   . THR B 1 122 ? -18.514 -33.006 -4.034  1.00 39.97  ? 198 THR B OG1   1 
ATOM   2979 C  CG2   . THR B 1 122 ? -16.165 -33.620 -4.162  1.00 41.28  ? 198 THR B CG2   1 
ATOM   2980 N  N     . TYR B 1 123 ? -18.469 -30.035 -1.844  1.00 44.23  ? 199 TYR B N     1 
ATOM   2981 C  CA    . TYR B 1 123 ? -19.334 -28.867 -1.808  1.00 48.36  ? 199 TYR B CA    1 
ATOM   2982 C  C     . TYR B 1 123 ? -18.520 -27.576 -1.923  1.00 45.03  ? 199 TYR B C     1 
ATOM   2983 O  O     . TYR B 1 123 ? -17.596 -27.347 -1.144  1.00 44.40  ? 199 TYR B O     1 
ATOM   2984 C  CB    . TYR B 1 123 ? -20.173 -28.838 -0.525  1.00 39.51  ? 199 TYR B CB    1 
ATOM   2985 C  CG    . TYR B 1 123 ? -20.920 -27.526 -0.338  1.00 42.95  ? 199 TYR B CG    1 
ATOM   2986 C  CD1   . TYR B 1 123 ? -22.113 -27.286 -1.008  1.00 40.48  ? 199 TYR B CD1   1 
ATOM   2987 C  CD2   . TYR B 1 123 ? -20.432 -26.530 0.507   1.00 40.95  ? 199 TYR B CD2   1 
ATOM   2988 C  CE1   . TYR B 1 123 ? -22.805 -26.097 -0.844  1.00 38.27  ? 199 TYR B CE1   1 
ATOM   2989 C  CE2   . TYR B 1 123 ? -21.123 -25.320 0.676   1.00 44.47  ? 199 TYR B CE2   1 
ATOM   2990 C  CZ    . TYR B 1 123 ? -22.314 -25.117 -0.005  1.00 41.58  ? 199 TYR B CZ    1 
ATOM   2991 O  OH    . TYR B 1 123 ? -23.016 -23.935 0.127   1.00 36.90  ? 199 TYR B OH    1 
ATOM   2992 N  N     . VAL B 1 124 ? -18.868 -26.729 -2.886  1.00 44.83  ? 200 VAL B N     1 
ATOM   2993 C  CA    . VAL B 1 124 ? -18.167 -25.455 -3.056  1.00 37.26  ? 200 VAL B CA    1 
ATOM   2994 C  C     . VAL B 1 124 ? -19.130 -24.273 -3.161  1.00 43.57  ? 200 VAL B C     1 
ATOM   2995 O  O     . VAL B 1 124 ? -18.803 -23.244 -3.764  1.00 44.73  ? 200 VAL B O     1 
ATOM   2996 C  CB    . VAL B 1 124 ? -17.223 -25.469 -4.280  1.00 41.22  ? 200 VAL B CB    1 
ATOM   2997 C  CG1   . VAL B 1 124 ? -16.114 -26.497 -4.081  1.00 41.89  ? 200 VAL B CG1   1 
ATOM   2998 C  CG2   . VAL B 1 124 ? -17.997 -25.730 -5.575  1.00 39.74  ? 200 VAL B CG2   1 
ATOM   2999 N  N     . GLY B 1 125 ? -20.311 -24.414 -2.562  1.00 40.26  ? 201 GLY B N     1 
ATOM   3000 C  CA    . GLY B 1 125 ? -21.319 -23.373 -2.627  1.00 38.98  ? 201 GLY B CA    1 
ATOM   3001 C  C     . GLY B 1 125 ? -21.069 -22.292 -1.599  1.00 39.05  ? 201 GLY B C     1 
ATOM   3002 O  O     . GLY B 1 125 ? -20.075 -22.336 -0.883  1.00 44.14  ? 201 GLY B O     1 
ATOM   3003 N  N     . GLY B 1 126 ? -21.968 -21.316 -1.527  1.00 37.47  ? 202 GLY B N     1 
ATOM   3004 C  CA    . GLY B 1 126 ? -21.890 -20.281 -0.511  1.00 40.55  ? 202 GLY B CA    1 
ATOM   3005 C  C     . GLY B 1 126 ? -20.969 -19.124 -0.855  1.00 42.93  ? 202 GLY B C     1 
ATOM   3006 O  O     . GLY B 1 126 ? -21.406 -18.113 -1.399  1.00 43.63  ? 202 GLY B O     1 
ATOM   3007 N  N     . ILE B 1 127 ? -19.692 -19.274 -0.518  1.00 40.95  ? 203 ILE B N     1 
ATOM   3008 C  CA    . ILE B 1 127 ? -18.692 -18.246 -0.742  1.00 38.63  ? 203 ILE B CA    1 
ATOM   3009 C  C     . ILE B 1 127 ? -17.464 -18.910 -1.354  1.00 49.11  ? 203 ILE B C     1 
ATOM   3010 O  O     . ILE B 1 127 ? -16.845 -19.758 -0.711  1.00 46.43  ? 203 ILE B O     1 
ATOM   3011 C  CB    . ILE B 1 127 ? -18.275 -17.577 0.578   1.00 43.42  ? 203 ILE B CB    1 
ATOM   3012 C  CG1   . ILE B 1 127 ? -19.497 -17.104 1.374   1.00 46.67  ? 203 ILE B CG1   1 
ATOM   3013 C  CG2   . ILE B 1 127 ? -17.360 -16.417 0.315   1.00 37.02  ? 203 ILE B CG2   1 
ATOM   3014 C  CD1   . ILE B 1 127 ? -19.164 -16.656 2.791   1.00 41.20  ? 203 ILE B CD1   1 
ATOM   3015 N  N     . LEU B 1 128 ? -17.122 -18.528 -2.590  1.00 41.66  ? 204 LEU B N     1 
ATOM   3016 C  CA    . LEU B 1 128 ? -16.031 -19.151 -3.338  1.00 35.86  ? 204 LEU B CA    1 
ATOM   3017 C  C     . LEU B 1 128 ? -15.218 -18.111 -4.136  1.00 47.23  ? 204 LEU B C     1 
ATOM   3018 O  O     . LEU B 1 128 ? -15.777 -17.339 -4.919  1.00 38.21  ? 204 LEU B O     1 
ATOM   3019 C  CB    . LEU B 1 128 ? -16.581 -20.236 -4.271  1.00 41.04  ? 204 LEU B CB    1 
ATOM   3020 C  CG    . LEU B 1 128 ? -15.591 -20.905 -5.231  1.00 37.10  ? 204 LEU B CG    1 
ATOM   3021 C  CD1   . LEU B 1 128 ? -14.476 -21.609 -4.465  1.00 39.22  ? 204 LEU B CD1   1 
ATOM   3022 C  CD2   . LEU B 1 128 ? -16.294 -21.853 -6.189  1.00 30.83  ? 204 LEU B CD2   1 
ATOM   3023 N  N     . LEU B 1 129 ? -13.902 -18.101 -3.925  1.00 43.88  ? 205 LEU B N     1 
ATOM   3024 C  CA    . LEU B 1 129 ? -13.019 -17.106 -4.519  1.00 37.28  ? 205 LEU B CA    1 
ATOM   3025 C  C     . LEU B 1 129 ? -12.116 -17.723 -5.586  1.00 41.44  ? 205 LEU B C     1 
ATOM   3026 O  O     . LEU B 1 129 ? -11.567 -18.803 -5.394  1.00 48.47  ? 205 LEU B O     1 
ATOM   3027 C  CB    . LEU B 1 129 ? -12.154 -16.431 -3.451  1.00 33.91  ? 205 LEU B CB    1 
ATOM   3028 C  CG    . LEU B 1 129 ? -12.798 -15.387 -2.529  1.00 42.92  ? 205 LEU B CG    1 
ATOM   3029 C  CD1   . LEU B 1 129 ? -13.886 -15.999 -1.665  1.00 44.38  ? 205 LEU B CD1   1 
ATOM   3030 C  CD2   . LEU B 1 129 ? -11.756 -14.745 -1.647  1.00 36.76  ? 205 LEU B CD2   1 
ATOM   3031 N  N     . LEU B 1 130 ? -11.981 -17.037 -6.715  1.00 36.52  ? 206 LEU B N     1 
ATOM   3032 C  CA    . LEU B 1 130 ? -11.016 -17.399 -7.740  1.00 38.40  ? 206 LEU B CA    1 
ATOM   3033 C  C     . LEU B 1 130 ? -10.394 -16.118 -8.249  1.00 42.56  ? 206 LEU B C     1 
ATOM   3034 O  O     . LEU B 1 130 ? -11.023 -15.060 -8.204  1.00 37.19  ? 206 LEU B O     1 
ATOM   3035 C  CB    . LEU B 1 130 ? -11.685 -18.108 -8.918  1.00 32.48  ? 206 LEU B CB    1 
ATOM   3036 C  CG    . LEU B 1 130 ? -12.274 -19.514 -8.753  1.00 37.19  ? 206 LEU B CG    1 
ATOM   3037 C  CD1   . LEU B 1 130 ? -13.646 -19.489 -8.102  1.00 41.11  ? 206 LEU B CD1   1 
ATOM   3038 C  CD2   . LEU B 1 130 ? -12.335 -20.217 -10.099 1.00 37.54  ? 206 LEU B CD2   1 
ATOM   3039 N  N     . SER B 1 131 ? -9.152  -16.220 -8.717  1.00 41.17  ? 207 SER B N     1 
ATOM   3040 C  CA    . SER B 1 131 ? -8.549  -15.193 -9.541  1.00 36.18  ? 207 SER B CA    1 
ATOM   3041 C  C     . SER B 1 131 ? -9.354  -15.157 -10.827 1.00 32.88  ? 207 SER B C     1 
ATOM   3042 O  O     . SER B 1 131 ? -9.892  -16.178 -11.246 1.00 39.82  ? 207 SER B O     1 
ATOM   3043 C  CB    . SER B 1 131 ? -7.101  -15.552 -9.851  1.00 37.38  ? 207 SER B CB    1 
ATOM   3044 O  OG    . SER B 1 131 ? -7.024  -16.670 -10.736 1.00 39.93  ? 207 SER B OG    1 
ATOM   3045 N  N     . LYS B 1 132 ? -9.452  -13.989 -11.446 1.00 35.78  ? 208 LYS B N     1 
ATOM   3046 C  CA    . LYS B 1 132 ? -10.158 -13.864 -12.711 1.00 34.83  ? 208 LYS B CA    1 
ATOM   3047 C  C     . LYS B 1 132 ? -9.528  -14.791 -13.729 1.00 36.81  ? 208 LYS B C     1 
ATOM   3048 O  O     . LYS B 1 132 ? -10.198 -15.358 -14.593 1.00 38.30  ? 208 LYS B O     1 
ATOM   3049 C  CB    . LYS B 1 132 ? -10.080 -12.424 -13.205 1.00 31.67  ? 208 LYS B CB    1 
ATOM   3050 C  CG    . LYS B 1 132 ? -11.057 -11.510 -12.526 1.00 38.47  ? 208 LYS B CG    1 
ATOM   3051 C  CD    . LYS B 1 132 ? -11.158 -10.163 -13.218 1.00 38.14  ? 208 LYS B CD    1 
ATOM   3052 C  CE    . LYS B 1 132 ? -12.438 -9.458  -12.794 1.00 41.06  ? 208 LYS B CE    1 
ATOM   3053 N  NZ    . LYS B 1 132 ? -12.523 -8.074  -13.328 1.00 40.72  ? 208 LYS B NZ    1 
ATOM   3054 N  N     . GLN B 1 133 ? -8.219  -14.940 -13.603 1.00 30.61  ? 209 GLN B N     1 
ATOM   3055 C  CA    . GLN B 1 133 ? -7.444  -15.813 -14.454 1.00 35.56  ? 209 GLN B CA    1 
ATOM   3056 C  C     . GLN B 1 133 ? -7.941  -17.260 -14.355 1.00 40.44  ? 209 GLN B C     1 
ATOM   3057 O  O     . GLN B 1 133 ? -8.204  -17.919 -15.373 1.00 37.63  ? 209 GLN B O     1 
ATOM   3058 C  CB    . GLN B 1 133 ? -5.983  -15.702 -14.028 1.00 38.32  ? 209 GLN B CB    1 
ATOM   3059 C  CG    . GLN B 1 133 ? -4.986  -16.217 -15.026 1.00 45.34  ? 209 GLN B CG    1 
ATOM   3060 C  CD    . GLN B 1 133 ? -3.638  -15.554 -14.855 1.00 40.58  ? 209 GLN B CD    1 
ATOM   3061 O  OE1   . GLN B 1 133 ? -3.504  -14.328 -15.016 1.00 46.51  ? 209 GLN B OE1   1 
ATOM   3062 N  NE2   . GLN B 1 133 ? -2.634  -16.351 -14.505 1.00 43.96  ? 209 GLN B NE2   1 
ATOM   3063 N  N     . HIS B 1 134 ? -8.082  -17.750 -13.124 1.00 36.24  ? 210 HIS B N     1 
ATOM   3064 C  CA    . HIS B 1 134 ? -8.561  -19.113 -12.907 1.00 39.48  ? 210 HIS B CA    1 
ATOM   3065 C  C     . HIS B 1 134 ? -10.032 -19.241 -13.268 1.00 42.00  ? 210 HIS B C     1 
ATOM   3066 O  O     . HIS B 1 134 ? -10.465 -20.274 -13.785 1.00 39.10  ? 210 HIS B O     1 
ATOM   3067 C  CB    . HIS B 1 134 ? -8.324  -19.554 -11.461 1.00 38.59  ? 210 HIS B CB    1 
ATOM   3068 C  CG    . HIS B 1 134 ? -6.886  -19.830 -11.156 1.00 44.83  ? 210 HIS B CG    1 
ATOM   3069 N  ND1   . HIS B 1 134 ? -6.391  -19.872 -9.870  1.00 38.47  ? 210 HIS B ND1   1 
ATOM   3070 C  CD2   . HIS B 1 134 ? -5.834  -20.067 -11.976 1.00 35.86  ? 210 HIS B CD2   1 
ATOM   3071 C  CE1   . HIS B 1 134 ? -5.095  -20.133 -9.911  1.00 41.82  ? 210 HIS B CE1   1 
ATOM   3072 N  NE2   . HIS B 1 134 ? -4.734  -20.256 -11.178 1.00 41.79  ? 210 HIS B NE2   1 
ATOM   3073 N  N     . TYR B 1 135 ? -10.799 -18.191 -13.008 1.00 28.73  ? 211 TYR B N     1 
ATOM   3074 C  CA    . TYR B 1 135 ? -12.203 -18.227 -13.368 1.00 29.82  ? 211 TYR B CA    1 
ATOM   3075 C  C     . TYR B 1 135 ? -12.349 -18.338 -14.881 1.00 30.61  ? 211 TYR B C     1 
ATOM   3076 O  O     . TYR B 1 135 ? -13.127 -19.150 -15.381 1.00 36.00  ? 211 TYR B O     1 
ATOM   3077 C  CB    . TYR B 1 135 ? -12.941 -16.997 -12.813 1.00 32.54  ? 211 TYR B CB    1 
ATOM   3078 C  CG    . TYR B 1 135 ? -14.442 -17.113 -12.894 1.00 28.07  ? 211 TYR B CG    1 
ATOM   3079 C  CD1   . TYR B 1 135 ? -15.150 -17.778 -11.910 1.00 32.58  ? 211 TYR B CD1   1 
ATOM   3080 C  CD2   . TYR B 1 135 ? -15.149 -16.576 -13.961 1.00 29.92  ? 211 TYR B CD2   1 
ATOM   3081 C  CE1   . TYR B 1 135 ? -16.521 -17.891 -11.959 1.00 29.10  ? 211 TYR B CE1   1 
ATOM   3082 C  CE2   . TYR B 1 135 ? -16.528 -16.681 -14.024 1.00 32.97  ? 211 TYR B CE2   1 
ATOM   3083 C  CZ    . TYR B 1 135 ? -17.209 -17.359 -13.014 1.00 30.62  ? 211 TYR B CZ    1 
ATOM   3084 O  OH    . TYR B 1 135 ? -18.582 -17.497 -13.048 1.00 31.96  ? 211 TYR B OH    1 
ATOM   3085 N  N     . ARG B 1 136 ? -11.567 -17.540 -15.606 1.00 37.29  ? 212 ARG B N     1 
ATOM   3086 C  CA    . ARG B 1 136 ? -11.564 -17.570 -17.065 1.00 35.73  ? 212 ARG B CA    1 
ATOM   3087 C  C     . ARG B 1 136 ? -11.074 -18.929 -17.608 1.00 38.20  ? 212 ARG B C     1 
ATOM   3088 O  O     . ARG B 1 136 ? -11.606 -19.438 -18.596 1.00 37.38  ? 212 ARG B O     1 
ATOM   3089 C  CB    . ARG B 1 136 ? -10.727 -16.408 -17.625 1.00 33.19  ? 212 ARG B CB    1 
ATOM   3090 C  CG    . ARG B 1 136 ? -10.455 -16.489 -19.123 1.00 36.08  ? 212 ARG B CG    1 
ATOM   3091 C  CD    . ARG B 1 136 ? -11.737 -16.337 -19.929 1.00 36.22  ? 212 ARG B CD    1 
ATOM   3092 N  NE    . ARG B 1 136 ? -12.218 -14.955 -19.903 1.00 39.98  ? 212 ARG B NE    1 
ATOM   3093 C  CZ    . ARG B 1 136 ? -13.357 -14.553 -20.453 1.00 36.15  ? 212 ARG B CZ    1 
ATOM   3094 N  NH1   . ARG B 1 136 ? -14.136 -15.425 -21.066 1.00 43.00  ? 212 ARG B NH1   1 
ATOM   3095 N  NH2   . ARG B 1 136 ? -13.724 -13.286 -20.381 1.00 40.36  ? 212 ARG B NH2   1 
ATOM   3096 N  N     . LEU B 1 137 ? -10.078 -19.516 -16.952 1.00 37.30  ? 213 LEU B N     1 
ATOM   3097 C  CA    . LEU B 1 137 ? -9.573  -20.846 -17.338 1.00 39.91  ? 213 LEU B CA    1 
ATOM   3098 C  C     . LEU B 1 137 ? -10.651 -21.937 -17.334 1.00 36.00  ? 213 LEU B C     1 
ATOM   3099 O  O     . LEU B 1 137 ? -10.694 -22.771 -18.235 1.00 36.14  ? 213 LEU B O     1 
ATOM   3100 C  CB    . LEU B 1 137 ? -8.408  -21.264 -16.439 1.00 42.35  ? 213 LEU B CB    1 
ATOM   3101 C  CG    . LEU B 1 137 ? -7.655  -22.541 -16.816 1.00 39.71  ? 213 LEU B CG    1 
ATOM   3102 C  CD1   . LEU B 1 137 ? -6.852  -22.300 -18.094 1.00 29.39  ? 213 LEU B CD1   1 
ATOM   3103 C  CD2   . LEU B 1 137 ? -6.763  -22.948 -15.666 1.00 32.28  ? 213 LEU B CD2   1 
ATOM   3104 N  N     . CYS B 1 138 ? -11.527 -21.913 -16.331 1.00 39.81  ? 214 CYS B N     1 
ATOM   3105 C  CA    . CYS B 1 138 ? -12.674 -22.823 -16.274 1.00 37.44  ? 214 CYS B CA    1 
ATOM   3106 C  C     . CYS B 1 138 ? -13.823 -22.465 -17.239 1.00 40.07  ? 214 CYS B C     1 
ATOM   3107 O  O     . CYS B 1 138 ? -14.836 -23.169 -17.268 1.00 40.74  ? 214 CYS B O     1 
ATOM   3108 C  CB    . CYS B 1 138 ? -13.238 -22.882 -14.850 1.00 37.42  ? 214 CYS B CB    1 
ATOM   3109 S  SG    . CYS B 1 138 ? -12.029 -23.220 -13.544 1.00 39.70  ? 214 CYS B SG    1 
ATOM   3110 N  N     . ASN B 1 139 ? -13.677 -21.379 -18.003 1.00 36.79  ? 215 ASN B N     1 
ATOM   3111 C  CA    . ASN B 1 139 ? -14.792 -20.805 -18.771 1.00 34.52  ? 215 ASN B CA    1 
ATOM   3112 C  C     . ASN B 1 139 ? -15.975 -20.452 -17.873 1.00 32.58  ? 215 ASN B C     1 
ATOM   3113 O  O     . ASN B 1 139 ? -17.139 -20.585 -18.266 1.00 34.39  ? 215 ASN B O     1 
ATOM   3114 C  CB    . ASN B 1 139 ? -15.242 -21.715 -19.933 1.00 30.19  ? 215 ASN B CB    1 
ATOM   3115 C  CG    . ASN B 1 139 ? -16.221 -21.019 -20.886 1.00 38.74  ? 215 ASN B CG    1 
ATOM   3116 O  OD1   . ASN B 1 139 ? -16.229 -19.782 -21.005 1.00 42.80  ? 215 ASN B OD1   1 
ATOM   3117 N  ND2   . ASN B 1 139 ? -17.072 -21.801 -21.539 1.00 33.58  ? 215 ASN B ND2   1 
ATOM   3118 N  N     . GLY B 1 140 ? -15.671 -19.987 -16.663 1.00 34.87  ? 216 GLY B N     1 
ATOM   3119 C  CA    . GLY B 1 140 ? -16.702 -19.661 -15.691 1.00 32.36  ? 216 GLY B CA    1 
ATOM   3120 C  C     . GLY B 1 140 ? -17.573 -20.851 -15.285 1.00 35.60  ? 216 GLY B C     1 
ATOM   3121 O  O     . GLY B 1 140 ? -17.134 -22.008 -15.266 1.00 40.78  ? 216 GLY B O     1 
ATOM   3122 N  N     . MET B 1 141 ? -18.819 -20.550 -14.953 1.00 34.99  ? 217 MET B N     1 
ATOM   3123 C  CA    . MET B 1 141 ? -19.770 -21.542 -14.519 1.00 34.98  ? 217 MET B CA    1 
ATOM   3124 C  C     . MET B 1 141 ? -20.724 -21.823 -15.657 1.00 35.60  ? 217 MET B C     1 
ATOM   3125 O  O     . MET B 1 141 ? -20.783 -21.081 -16.620 1.00 35.57  ? 217 MET B O     1 
ATOM   3126 C  CB    . MET B 1 141 ? -20.540 -21.024 -13.303 1.00 36.29  ? 217 MET B CB    1 
ATOM   3127 C  CG    . MET B 1 141 ? -19.638 -20.632 -12.164 1.00 32.89  ? 217 MET B CG    1 
ATOM   3128 S  SD    . MET B 1 141 ? -20.524 -20.023 -10.732 1.00 41.90  ? 217 MET B SD    1 
ATOM   3129 C  CE    . MET B 1 141 ? -20.983 -21.533 -9.876  1.00 39.04  ? 217 MET B CE    1 
ATOM   3130 N  N     . SER B 1 142 ? -21.471 -22.905 -15.543 1.00 40.37  ? 218 SER B N     1 
ATOM   3131 C  CA    . SER B 1 142 ? -22.493 -23.226 -16.522 1.00 42.22  ? 218 SER B CA    1 
ATOM   3132 C  C     . SER B 1 142 ? -23.686 -22.272 -16.403 1.00 39.80  ? 218 SER B C     1 
ATOM   3133 O  O     . SER B 1 142 ? -24.002 -21.782 -15.305 1.00 38.25  ? 218 SER B O     1 
ATOM   3134 C  CB    . SER B 1 142 ? -22.956 -24.671 -16.307 1.00 34.02  ? 218 SER B CB    1 
ATOM   3135 O  OG    . SER B 1 142 ? -24.053 -24.980 -17.141 1.00 38.42  ? 218 SER B OG    1 
ATOM   3136 N  N     . ASN B 1 143 ? -24.355 -22.026 -17.524 1.00 33.42  ? 219 ASN B N     1 
ATOM   3137 C  CA    . ASN B 1 143 ? -25.591 -21.254 -17.523 1.00 36.35  ? 219 ASN B CA    1 
ATOM   3138 C  C     . ASN B 1 143 ? -26.862 -22.117 -17.586 1.00 39.06  ? 219 ASN B C     1 
ATOM   3139 O  O     . ASN B 1 143 ? -27.964 -21.590 -17.724 1.00 43.83  ? 219 ASN B O     1 
ATOM   3140 C  CB    . ASN B 1 143 ? -25.590 -20.230 -18.673 1.00 36.36  ? 219 ASN B CB    1 
ATOM   3141 C  CG    . ASN B 1 143 ? -24.261 -19.500 -18.809 1.00 38.29  ? 219 ASN B CG    1 
ATOM   3142 O  OD1   . ASN B 1 143 ? -23.820 -18.798 -17.892 1.00 36.44  ? 219 ASN B OD1   1 
ATOM   3143 N  ND2   . ASN B 1 143 ? -23.619 -19.656 -19.964 1.00 36.85  ? 219 ASN B ND2   1 
ATOM   3144 N  N     . ARG B 1 144 ? -26.708 -23.434 -17.469 1.00 40.30  ? 220 ARG B N     1 
ATOM   3145 C  CA    . ARG B 1 144 ? -27.812 -24.386 -17.644 1.00 41.32  ? 220 ARG B CA    1 
ATOM   3146 C  C     . ARG B 1 144 ? -28.605 -24.698 -16.371 1.00 43.60  ? 220 ARG B C     1 
ATOM   3147 O  O     . ARG B 1 144 ? -29.615 -25.403 -16.418 1.00 43.42  ? 220 ARG B O     1 
ATOM   3148 C  CB    . ARG B 1 144 ? -27.286 -25.712 -18.215 1.00 42.72  ? 220 ARG B CB    1 
ATOM   3149 C  CG    . ARG B 1 144 ? -26.621 -25.595 -19.572 1.00 47.64  ? 220 ARG B CG    1 
ATOM   3150 C  CD    . ARG B 1 144 ? -26.003 -26.934 -19.998 1.00 49.83  ? 220 ARG B CD    1 
ATOM   3151 N  NE    . ARG B 1 144 ? -26.992 -28.007 -20.069 1.00 50.41  ? 220 ARG B NE    1 
ATOM   3152 C  CZ    . ARG B 1 144 ? -27.759 -28.251 -21.129 1.00 56.60  ? 220 ARG B CZ    1 
ATOM   3153 N  NH1   . ARG B 1 144 ? -27.653 -27.494 -22.214 1.00 65.84  ? 220 ARG B NH1   1 
ATOM   3154 N  NH2   . ARG B 1 144 ? -28.632 -29.249 -21.106 1.00 53.77  ? 220 ARG B NH2   1 
ATOM   3155 N  N     . PHE B 1 145 ? -28.152 -24.190 -15.234 1.00 41.26  ? 221 PHE B N     1 
ATOM   3156 C  CA    . PHE B 1 145 ? -28.819 -24.481 -13.969 1.00 35.36  ? 221 PHE B CA    1 
ATOM   3157 C  C     . PHE B 1 145 ? -29.813 -23.378 -13.545 1.00 43.20  ? 221 PHE B C     1 
ATOM   3158 O  O     . PHE B 1 145 ? -29.431 -22.319 -13.020 1.00 38.54  ? 221 PHE B O     1 
ATOM   3159 C  CB    . PHE B 1 145 ? -27.777 -24.766 -12.893 1.00 33.94  ? 221 PHE B CB    1 
ATOM   3160 C  CG    . PHE B 1 145 ? -26.923 -25.961 -13.202 1.00 40.43  ? 221 PHE B CG    1 
ATOM   3161 C  CD1   . PHE B 1 145 ? -25.830 -25.848 -14.048 1.00 35.90  ? 221 PHE B CD1   1 
ATOM   3162 C  CD2   . PHE B 1 145 ? -27.232 -27.208 -12.674 1.00 42.99  ? 221 PHE B CD2   1 
ATOM   3163 C  CE1   . PHE B 1 145 ? -25.052 -26.955 -14.361 1.00 38.44  ? 221 PHE B CE1   1 
ATOM   3164 C  CE2   . PHE B 1 145 ? -26.459 -28.328 -12.979 1.00 38.97  ? 221 PHE B CE2   1 
ATOM   3165 C  CZ    . PHE B 1 145 ? -25.368 -28.204 -13.816 1.00 38.52  ? 221 PHE B CZ    1 
ATOM   3166 N  N     . TRP B 1 146 ? -31.088 -23.641 -13.818 1.00 40.77  ? 222 TRP B N     1 
ATOM   3167 C  CA    . TRP B 1 146 ? -32.195 -22.793 -13.399 1.00 43.41  ? 222 TRP B CA    1 
ATOM   3168 C  C     . TRP B 1 146 ? -32.883 -23.430 -12.174 1.00 43.82  ? 222 TRP B C     1 
ATOM   3169 O  O     . TRP B 1 146 ? -33.242 -24.604 -12.188 1.00 44.05  ? 222 TRP B O     1 
ATOM   3170 C  CB    . TRP B 1 146 ? -33.187 -22.621 -14.561 1.00 41.98  ? 222 TRP B CB    1 
ATOM   3171 C  CG    . TRP B 1 146 ? -32.543 -22.137 -15.840 1.00 38.91  ? 222 TRP B CG    1 
ATOM   3172 C  CD1   . TRP B 1 146 ? -31.971 -22.906 -16.808 1.00 41.87  ? 222 TRP B CD1   1 
ATOM   3173 C  CD2   . TRP B 1 146 ? -32.403 -20.770 -16.278 1.00 39.08  ? 222 TRP B CD2   1 
ATOM   3174 N  NE1   . TRP B 1 146 ? -31.485 -22.116 -17.821 1.00 37.78  ? 222 TRP B NE1   1 
ATOM   3175 C  CE2   . TRP B 1 146 ? -31.733 -20.801 -17.519 1.00 41.19  ? 222 TRP B CE2   1 
ATOM   3176 C  CE3   . TRP B 1 146 ? -32.773 -19.528 -15.734 1.00 36.26  ? 222 TRP B CE3   1 
ATOM   3177 C  CZ2   . TRP B 1 146 ? -31.431 -19.635 -18.235 1.00 38.76  ? 222 TRP B CZ2   1 
ATOM   3178 C  CZ3   . TRP B 1 146 ? -32.475 -18.370 -16.445 1.00 36.17  ? 222 TRP B CZ3   1 
ATOM   3179 C  CH2   . TRP B 1 146 ? -31.812 -18.431 -17.686 1.00 40.68  ? 222 TRP B CH2   1 
ATOM   3180 N  N     . GLY B 1 147 ? -33.062 -22.655 -11.112 1.00 45.54  ? 223 GLY B N     1 
ATOM   3181 C  CA    . GLY B 1 147 ? -33.579 -23.196 -9.872  1.00 41.62  ? 223 GLY B CA    1 
ATOM   3182 C  C     . GLY B 1 147 ? -32.429 -23.595 -8.972  1.00 43.06  ? 223 GLY B C     1 
ATOM   3183 O  O     . GLY B 1 147 ? -31.288 -23.699 -9.430  1.00 42.72  ? 223 GLY B O     1 
ATOM   3184 N  N     . TRP B 1 148 ? -32.729 -23.802 -7.691  1.00 41.99  ? 224 TRP B N     1 
ATOM   3185 C  CA    . TRP B 1 148 ? -31.741 -24.246 -6.705  1.00 40.67  ? 224 TRP B CA    1 
ATOM   3186 C  C     . TRP B 1 148 ? -31.035 -25.524 -7.178  1.00 41.12  ? 224 TRP B C     1 
ATOM   3187 O  O     . TRP B 1 148 ? -31.653 -26.367 -7.819  1.00 38.87  ? 224 TRP B O     1 
ATOM   3188 C  CB    . TRP B 1 148 ? -32.435 -24.506 -5.358  1.00 37.36  ? 224 TRP B CB    1 
ATOM   3189 C  CG    . TRP B 1 148 ? -31.507 -24.933 -4.246  1.00 37.92  ? 224 TRP B CG    1 
ATOM   3190 C  CD1   . TRP B 1 148 ? -30.947 -24.128 -3.298  1.00 38.86  ? 224 TRP B CD1   1 
ATOM   3191 C  CD2   . TRP B 1 148 ? -31.032 -26.263 -3.973  1.00 35.93  ? 224 TRP B CD2   1 
ATOM   3192 N  NE1   . TRP B 1 148 ? -30.154 -24.866 -2.456  1.00 40.40  ? 224 TRP B NE1   1 
ATOM   3193 C  CE2   . TRP B 1 148 ? -30.184 -26.178 -2.852  1.00 37.18  ? 224 TRP B CE2   1 
ATOM   3194 C  CE3   . TRP B 1 148 ? -31.244 -27.515 -4.567  1.00 43.33  ? 224 TRP B CE3   1 
ATOM   3195 C  CZ2   . TRP B 1 148 ? -29.557 -27.297 -2.305  1.00 43.07  ? 224 TRP B CZ2   1 
ATOM   3196 C  CZ3   . TRP B 1 148 ? -30.607 -28.624 -4.036  1.00 36.91  ? 224 TRP B CZ3   1 
ATOM   3197 C  CH2   . TRP B 1 148 ? -29.774 -28.508 -2.915  1.00 44.22  ? 224 TRP B CH2   1 
ATOM   3198 N  N     . GLY B 1 149 ? -29.742 -25.657 -6.890  1.00 37.10  ? 225 GLY B N     1 
ATOM   3199 C  CA    . GLY B 1 149 ? -29.090 -26.945 -7.035  1.00 41.19  ? 225 GLY B CA    1 
ATOM   3200 C  C     . GLY B 1 149 ? -28.041 -27.220 -8.100  1.00 43.73  ? 225 GLY B C     1 
ATOM   3201 O  O     . GLY B 1 149 ? -28.204 -26.876 -9.270  1.00 38.80  ? 225 GLY B O     1 
ATOM   3202 N  N     . ARG B 1 150 ? -26.953 -27.848 -7.657  1.00 40.05  ? 226 ARG B N     1 
ATOM   3203 C  CA    . ARG B 1 150 ? -25.989 -28.519 -8.526  1.00 41.66  ? 226 ARG B CA    1 
ATOM   3204 C  C     . ARG B 1 150 ? -25.091 -27.656 -9.407  1.00 43.43  ? 226 ARG B C     1 
ATOM   3205 O  O     . ARG B 1 150 ? -24.177 -28.198 -10.030 1.00 42.28  ? 226 ARG B O     1 
ATOM   3206 C  CB    . ARG B 1 150 ? -26.681 -29.583 -9.393  1.00 47.26  ? 226 ARG B CB    1 
ATOM   3207 C  CG    . ARG B 1 150 ? -27.523 -30.585 -8.605  1.00 50.63  ? 226 ARG B CG    1 
ATOM   3208 C  CD    . ARG B 1 150 ? -26.719 -31.314 -7.540  1.00 40.79  ? 226 ARG B CD    1 
ATOM   3209 N  NE    . ARG B 1 150 ? -27.518 -31.428 -6.328  1.00 50.36  ? 226 ARG B NE    1 
ATOM   3210 C  CZ    . ARG B 1 150 ? -27.068 -31.199 -5.097  1.00 46.67  ? 226 ARG B CZ    1 
ATOM   3211 N  NH1   . ARG B 1 150 ? -25.801 -30.864 -4.885  1.00 48.46  ? 226 ARG B NH1   1 
ATOM   3212 N  NH2   . ARG B 1 150 ? -27.891 -31.310 -4.069  1.00 49.08  ? 226 ARG B NH2   1 
ATOM   3213 N  N     . GLU B 1 151 ? -25.327 -26.345 -9.481  1.00 35.96  ? 227 GLU B N     1 
ATOM   3214 C  CA    . GLU B 1 151 ? -24.495 -25.516 -10.361 1.00 35.10  ? 227 GLU B CA    1 
ATOM   3215 C  C     . GLU B 1 151 ? -23.100 -25.407 -9.757  1.00 34.15  ? 227 GLU B C     1 
ATOM   3216 O  O     . GLU B 1 151 ? -22.121 -25.226 -10.462 1.00 36.20  ? 227 GLU B O     1 
ATOM   3217 C  CB    . GLU B 1 151 ? -25.103 -24.123 -10.584 1.00 35.54  ? 227 GLU B CB    1 
ATOM   3218 C  CG    . GLU B 1 151 ? -24.753 -23.091 -9.511  1.00 33.88  ? 227 GLU B CG    1 
ATOM   3219 C  CD    . GLU B 1 151 ? -25.392 -23.382 -8.156  1.00 35.83  ? 227 GLU B CD    1 
ATOM   3220 O  OE1   . GLU B 1 151 ? -26.403 -24.117 -8.110  1.00 34.99  ? 227 GLU B OE1   1 
ATOM   3221 O  OE2   . GLU B 1 151 ? -24.884 -22.864 -7.136  1.00 38.05  ? 227 GLU B OE2   1 
ATOM   3222 N  N     . ASP B 1 152 ? -23.021 -25.525 -8.436  1.00 37.28  ? 228 ASP B N     1 
ATOM   3223 C  CA    . ASP B 1 152 ? -21.738 -25.478 -7.757  1.00 38.82  ? 228 ASP B CA    1 
ATOM   3224 C  C     . ASP B 1 152 ? -20.967 -26.798 -7.951  1.00 45.75  ? 228 ASP B C     1 
ATOM   3225 O  O     . ASP B 1 152 ? -19.747 -26.793 -8.166  1.00 45.04  ? 228 ASP B O     1 
ATOM   3226 C  CB    . ASP B 1 152 ? -21.909 -25.106 -6.269  1.00 37.24  ? 228 ASP B CB    1 
ATOM   3227 C  CG    . ASP B 1 152 ? -23.050 -25.865 -5.588  1.00 41.23  ? 228 ASP B CG    1 
ATOM   3228 O  OD1   . ASP B 1 152 ? -23.513 -26.863 -6.164  1.00 41.32  ? 228 ASP B OD1   1 
ATOM   3229 O  OD2   . ASP B 1 152 ? -23.484 -25.460 -4.477  1.00 45.05  ? 228 ASP B OD2   1 
ATOM   3230 N  N     . ASP B 1 153 ? -21.686 -27.919 -7.910  1.00 40.65  ? 229 ASP B N     1 
ATOM   3231 C  CA    . ASP B 1 153 ? -21.073 -29.228 -8.132  1.00 42.52  ? 229 ASP B CA    1 
ATOM   3232 C  C     . ASP B 1 153 ? -20.558 -29.336 -9.561  1.00 44.52  ? 229 ASP B C     1 
ATOM   3233 O  O     . ASP B 1 153 ? -19.490 -29.901 -9.804  1.00 41.65  ? 229 ASP B O     1 
ATOM   3234 C  CB    . ASP B 1 153 ? -22.070 -30.359 -7.853  1.00 34.86  ? 229 ASP B CB    1 
ATOM   3235 C  CG    . ASP B 1 153 ? -22.647 -30.292 -6.448  1.00 43.90  ? 229 ASP B CG    1 
ATOM   3236 O  OD1   . ASP B 1 153 ? -21.877 -30.045 -5.496  1.00 41.68  ? 229 ASP B OD1   1 
ATOM   3237 O  OD2   . ASP B 1 153 ? -23.873 -30.478 -6.298  1.00 45.54  ? 229 ASP B OD2   1 
ATOM   3238 N  N     . GLU B 1 154 ? -21.317 -28.797 -10.509 1.00 40.25  ? 230 GLU B N     1 
ATOM   3239 C  CA    . GLU B 1 154 ? -20.866 -28.798 -11.890 1.00 41.26  ? 230 GLU B CA    1 
ATOM   3240 C  C     . GLU B 1 154 ? -19.595 -27.940 -11.985 1.00 41.04  ? 230 GLU B C     1 
ATOM   3241 O  O     . GLU B 1 154 ? -18.629 -28.311 -12.643 1.00 43.60  ? 230 GLU B O     1 
ATOM   3242 C  CB    . GLU B 1 154 ? -21.973 -28.294 -12.822 1.00 39.13  ? 230 GLU B CB    1 
ATOM   3243 C  CG    . GLU B 1 154 ? -21.769 -28.608 -14.299 1.00 41.43  ? 230 GLU B CG    1 
ATOM   3244 C  CD    . GLU B 1 154 ? -20.789 -27.673 -14.989 1.00 47.91  ? 230 GLU B CD    1 
ATOM   3245 O  OE1   . GLU B 1 154 ? -20.329 -28.012 -16.105 1.00 43.03  ? 230 GLU B OE1   1 
ATOM   3246 O  OE2   . GLU B 1 154 ? -20.483 -26.596 -14.424 1.00 43.05  ? 230 GLU B OE2   1 
ATOM   3247 N  N     . PHE B 1 155 ? -19.578 -26.822 -11.275 1.00 38.79  ? 231 PHE B N     1 
ATOM   3248 C  CA    . PHE B 1 155 ? -18.424 -25.941 -11.307 1.00 40.05  ? 231 PHE B CA    1 
ATOM   3249 C  C     . PHE B 1 155 ? -17.198 -26.548 -10.630 1.00 40.25  ? 231 PHE B C     1 
ATOM   3250 O  O     . PHE B 1 155 ? -16.063 -26.271 -11.027 1.00 45.15  ? 231 PHE B O     1 
ATOM   3251 C  CB    . PHE B 1 155 ? -18.757 -24.580 -10.691 1.00 40.86  ? 231 PHE B CB    1 
ATOM   3252 C  CG    . PHE B 1 155 ? -17.657 -23.579 -10.831 1.00 37.90  ? 231 PHE B CG    1 
ATOM   3253 C  CD1   . PHE B 1 155 ? -17.193 -23.218 -12.093 1.00 39.27  ? 231 PHE B CD1   1 
ATOM   3254 C  CD2   . PHE B 1 155 ? -17.074 -23.008 -9.716  1.00 37.09  ? 231 PHE B CD2   1 
ATOM   3255 C  CE1   . PHE B 1 155 ? -16.175 -22.305 -12.234 1.00 38.60  ? 231 PHE B CE1   1 
ATOM   3256 C  CE2   . PHE B 1 155 ? -16.047 -22.084 -9.851  1.00 36.20  ? 231 PHE B CE2   1 
ATOM   3257 C  CZ    . PHE B 1 155 ? -15.602 -21.728 -11.110 1.00 32.20  ? 231 PHE B CZ    1 
ATOM   3258 N  N     . TYR B 1 156 ? -17.429 -27.358 -9.599  1.00 43.02  ? 232 TYR B N     1 
ATOM   3259 C  CA    . TYR B 1 156 ? -16.349 -28.091 -8.938  1.00 39.41  ? 232 TYR B CA    1 
ATOM   3260 C  C     . TYR B 1 156 ? -15.633 -29.017 -9.916  1.00 41.30  ? 232 TYR B C     1 
ATOM   3261 O  O     . TYR B 1 156 ? -14.435 -29.233 -9.798  1.00 44.44  ? 232 TYR B O     1 
ATOM   3262 C  CB    . TYR B 1 156 ? -16.874 -28.917 -7.755  1.00 44.25  ? 232 TYR B CB    1 
ATOM   3263 C  CG    . TYR B 1 156 ? -15.799 -29.751 -7.080  1.00 47.39  ? 232 TYR B CG    1 
ATOM   3264 C  CD1   . TYR B 1 156 ? -14.976 -29.196 -6.111  1.00 47.67  ? 232 TYR B CD1   1 
ATOM   3265 C  CD2   . TYR B 1 156 ? -15.593 -31.083 -7.430  1.00 39.91  ? 232 TYR B CD2   1 
ATOM   3266 C  CE1   . TYR B 1 156 ? -13.985 -29.941 -5.497  1.00 45.26  ? 232 TYR B CE1   1 
ATOM   3267 C  CE2   . TYR B 1 156 ? -14.602 -31.831 -6.824  1.00 47.98  ? 232 TYR B CE2   1 
ATOM   3268 C  CZ    . TYR B 1 156 ? -13.801 -31.257 -5.854  1.00 48.99  ? 232 TYR B CZ    1 
ATOM   3269 O  OH    . TYR B 1 156 ? -12.811 -31.994 -5.235  1.00 48.55  ? 232 TYR B OH    1 
ATOM   3270 N  N     . ARG B 1 157 ? -16.372 -29.574 -10.869 1.00 40.71  ? 233 ARG B N     1 
ATOM   3271 C  CA    . ARG B 1 157 ? -15.780 -30.433 -11.892 1.00 40.16  ? 233 ARG B CA    1 
ATOM   3272 C  C     . ARG B 1 157 ? -14.906 -29.655 -12.883 1.00 45.02  ? 233 ARG B C     1 
ATOM   3273 O  O     . ARG B 1 157 ? -13.871 -30.153 -13.343 1.00 43.71  ? 233 ARG B O     1 
ATOM   3274 C  CB    . ARG B 1 157 ? -16.872 -31.213 -12.623 1.00 44.92  ? 233 ARG B CB    1 
ATOM   3275 C  CG    . ARG B 1 157 ? -17.399 -32.394 -11.788 1.00 64.61  ? 233 ARG B CG    1 
ATOM   3276 C  CD    . ARG B 1 157 ? -18.830 -32.802 -12.139 1.00 58.97  ? 233 ARG B CD    1 
ATOM   3277 N  NE    . ARG B 1 157 ? -18.888 -33.777 -13.222 1.00 57.71  ? 233 ARG B NE    1 
ATOM   3278 C  CZ    . ARG B 1 157 ? -19.977 -34.475 -13.538 1.00 68.62  ? 233 ARG B CZ    1 
ATOM   3279 N  NH1   . ARG B 1 157 ? -21.099 -34.306 -12.846 1.00 64.58  ? 233 ARG B NH1   1 
ATOM   3280 N  NH2   . ARG B 1 157 ? -19.946 -35.347 -14.541 1.00 71.38  ? 233 ARG B NH2   1 
ATOM   3281 N  N     . ARG B 1 158 ? -15.320 -28.433 -13.208 1.00 46.12  ? 234 ARG B N     1 
ATOM   3282 C  CA    . ARG B 1 158 ? -14.511 -27.576 -14.071 1.00 36.16  ? 234 ARG B CA    1 
ATOM   3283 C  C     . ARG B 1 158 ? -13.203 -27.247 -13.359 1.00 35.70  ? 234 ARG B C     1 
ATOM   3284 O  O     . ARG B 1 158 ? -12.136 -27.421 -13.927 1.00 40.38  ? 234 ARG B O     1 
ATOM   3285 C  CB    . ARG B 1 158 ? -15.275 -26.313 -14.447 1.00 35.67  ? 234 ARG B CB    1 
ATOM   3286 C  CG    . ARG B 1 158 ? -16.581 -26.565 -15.178 1.00 33.81  ? 234 ARG B CG    1 
ATOM   3287 C  CD    . ARG B 1 158 ? -17.289 -25.257 -15.514 1.00 40.65  ? 234 ARG B CD    1 
ATOM   3288 N  NE    . ARG B 1 158 ? -18.444 -25.479 -16.372 1.00 36.84  ? 234 ARG B NE    1 
ATOM   3289 C  CZ    . ARG B 1 158 ? -18.770 -24.703 -17.395 1.00 38.32  ? 234 ARG B CZ    1 
ATOM   3290 N  NH1   . ARG B 1 158 ? -18.035 -23.630 -17.674 1.00 37.96  ? 234 ARG B NH1   1 
ATOM   3291 N  NH2   . ARG B 1 158 ? -19.835 -24.994 -18.132 1.00 40.75  ? 234 ARG B NH2   1 
ATOM   3292 N  N     . ILE B 1 159 ? -13.281 -26.820 -12.098 1.00 43.74  ? 235 ILE B N     1 
ATOM   3293 C  CA    . ILE B 1 159 ? -12.071 -26.586 -11.309 1.00 36.48  ? 235 ILE B CA    1 
ATOM   3294 C  C     . ILE B 1 159 ? -11.063 -27.743 -11.439 1.00 51.88  ? 235 ILE B C     1 
ATOM   3295 O  O     . ILE B 1 159 ? -9.933  -27.530 -11.900 1.00 49.99  ? 235 ILE B O     1 
ATOM   3296 C  CB    . ILE B 1 159 ? -12.393 -26.319 -9.831  1.00 41.83  ? 235 ILE B CB    1 
ATOM   3297 C  CG1   . ILE B 1 159 ? -13.179 -25.010 -9.690  1.00 44.97  ? 235 ILE B CG1   1 
ATOM   3298 C  CG2   . ILE B 1 159 ? -11.114 -26.239 -9.006  1.00 37.89  ? 235 ILE B CG2   1 
ATOM   3299 C  CD1   . ILE B 1 159 ? -13.534 -24.649 -8.235  1.00 35.76  ? 235 ILE B CD1   1 
ATOM   3300 N  N     . LYS B 1 160 ? -11.483 -28.965 -11.092 1.00 44.70  ? 236 LYS B N     1 
ATOM   3301 C  CA    . LYS B 1 160 ? -10.598 -30.128 -11.188 1.00 42.27  ? 236 LYS B CA    1 
ATOM   3302 C  C     . LYS B 1 160 ? -10.173 -30.420 -12.621 1.00 44.47  ? 236 LYS B C     1 
ATOM   3303 O  O     . LYS B 1 160 ? -9.006  -30.736 -12.876 1.00 42.49  ? 236 LYS B O     1 
ATOM   3304 C  CB    . LYS B 1 160 ? -11.237 -31.375 -10.565 1.00 41.91  ? 236 LYS B CB    1 
ATOM   3305 C  CG    . LYS B 1 160 ? -11.457 -31.259 -9.055  1.00 44.37  ? 236 LYS B CG    1 
ATOM   3306 C  CD    . LYS B 1 160 ? -10.225 -30.696 -8.347  1.00 45.17  ? 236 LYS B CD    1 
ATOM   3307 C  CE    . LYS B 1 160 ? -10.284 -30.945 -6.843  1.00 55.98  ? 236 LYS B CE    1 
ATOM   3308 N  NZ    . LYS B 1 160 ? -10.132 -32.402 -6.545  1.00 54.63  ? 236 LYS B NZ    1 
ATOM   3309 N  N     . GLY B 1 161 ? -11.115 -30.296 -13.553 1.00 39.18  ? 237 GLY B N     1 
ATOM   3310 C  CA    . GLY B 1 161 ? -10.861 -30.631 -14.943 1.00 31.47  ? 237 GLY B CA    1 
ATOM   3311 C  C     . GLY B 1 161 ? -9.927  -29.660 -15.644 1.00 45.74  ? 237 GLY B C     1 
ATOM   3312 O  O     . GLY B 1 161 ? -9.356  -29.995 -16.683 1.00 44.35  ? 237 GLY B O     1 
ATOM   3313 N  N     . ALA B 1 162 ? -9.795  -28.454 -15.092 1.00 41.28  ? 238 ALA B N     1 
ATOM   3314 C  CA    . ALA B 1 162 ? -8.854  -27.467 -15.599 1.00 41.87  ? 238 ALA B CA    1 
ATOM   3315 C  C     . ALA B 1 162 ? -7.496  -27.620 -14.927 1.00 48.41  ? 238 ALA B C     1 
ATOM   3316 O  O     . ALA B 1 162 ? -6.581  -26.828 -15.173 1.00 51.98  ? 238 ALA B O     1 
ATOM   3317 C  CB    . ALA B 1 162 ? -9.389  -26.053 -15.364 1.00 43.92  ? 238 ALA B CB    1 
ATOM   3318 N  N     . GLY B 1 163 ? -7.377  -28.615 -14.053 1.00 43.61  ? 239 GLY B N     1 
ATOM   3319 C  CA    . GLY B 1 163 ? -6.119  -28.903 -13.387 1.00 40.80  ? 239 GLY B CA    1 
ATOM   3320 C  C     . GLY B 1 163 ? -5.782  -28.019 -12.204 1.00 47.47  ? 239 GLY B C     1 
ATOM   3321 O  O     . GLY B 1 163 ? -4.631  -27.968 -11.770 1.00 53.22  ? 239 GLY B O     1 
ATOM   3322 N  N     . LEU B 1 164 ? -6.785  -27.328 -11.672 1.00 46.00  ? 240 LEU B N     1 
ATOM   3323 C  CA    . LEU B 1 164 ? -6.579  -26.445 -10.531 1.00 48.71  ? 240 LEU B CA    1 
ATOM   3324 C  C     . LEU B 1 164 ? -6.808  -27.176 -9.208  1.00 48.50  ? 240 LEU B C     1 
ATOM   3325 O  O     . LEU B 1 164 ? -7.556  -28.146 -9.144  1.00 46.79  ? 240 LEU B O     1 
ATOM   3326 C  CB    . LEU B 1 164 ? -7.500  -25.229 -10.629 1.00 45.90  ? 240 LEU B CB    1 
ATOM   3327 C  CG    . LEU B 1 164 ? -7.337  -24.332 -11.859 1.00 43.87  ? 240 LEU B CG    1 
ATOM   3328 C  CD1   . LEU B 1 164 ? -8.517  -23.361 -11.942 1.00 44.74  ? 240 LEU B CD1   1 
ATOM   3329 C  CD2   . LEU B 1 164 ? -6.010  -23.567 -11.800 1.00 40.26  ? 240 LEU B CD2   1 
ATOM   3330 N  N     . GLN B 1 165 ? -6.156  -26.711 -8.150  1.00 51.44  ? 241 GLN B N     1 
ATOM   3331 C  CA    A GLN B 1 165 ? -6.327  -27.339 -6.850  0.48 53.73  ? 241 GLN B CA    1 
ATOM   3332 C  CA    B GLN B 1 165 ? -6.300  -27.318 -6.831  0.52 53.74  ? 241 GLN B CA    1 
ATOM   3333 C  C     . GLN B 1 165 ? -7.224  -26.467 -5.973  1.00 52.16  ? 241 GLN B C     1 
ATOM   3334 O  O     . GLN B 1 165 ? -7.103  -25.239 -5.958  1.00 51.02  ? 241 GLN B O     1 
ATOM   3335 C  CB    A GLN B 1 165 ? -4.971  -27.598 -6.180  0.48 56.40  ? 241 GLN B CB    1 
ATOM   3336 C  CB    B GLN B 1 165 ? -4.931  -27.455 -6.151  0.52 56.44  ? 241 GLN B CB    1 
ATOM   3337 C  CG    A GLN B 1 165 ? -3.890  -28.167 -7.112  0.48 53.93  ? 241 GLN B CG    1 
ATOM   3338 C  CG    B GLN B 1 165 ? -4.982  -27.993 -4.724  0.52 55.44  ? 241 GLN B CG    1 
ATOM   3339 C  CD    A GLN B 1 165 ? -4.194  -29.571 -7.627  0.48 55.67  ? 241 GLN B CD    1 
ATOM   3340 C  CD    B GLN B 1 165 ? -3.605  -28.175 -4.114  0.52 59.15  ? 241 GLN B CD    1 
ATOM   3341 O  OE1   A GLN B 1 165 ? -4.801  -30.387 -6.930  0.48 52.60  ? 241 GLN B OE1   1 
ATOM   3342 O  OE1   B GLN B 1 165 ? -2.591  -27.851 -4.731  0.52 61.01  ? 241 GLN B OE1   1 
ATOM   3343 N  NE2   A GLN B 1 165 ? -3.761  -29.857 -8.855  0.48 45.13  ? 241 GLN B NE2   1 
ATOM   3344 N  NE2   B GLN B 1 165 ? -3.562  -28.698 -2.894  0.52 57.85  ? 241 GLN B NE2   1 
ATOM   3345 N  N     . LEU B 1 166 ? -8.142  -27.117 -5.265  1.00 47.35  ? 242 LEU B N     1 
ATOM   3346 C  CA    . LEU B 1 166 ? -9.084  -26.428 -4.400  1.00 46.49  ? 242 LEU B CA    1 
ATOM   3347 C  C     . LEU B 1 166 ? -8.470  -26.242 -3.028  1.00 48.58  ? 242 LEU B C     1 
ATOM   3348 O  O     . LEU B 1 166 ? -7.748  -27.112 -2.551  1.00 60.53  ? 242 LEU B O     1 
ATOM   3349 C  CB    . LEU B 1 166 ? -10.362 -27.243 -4.274  1.00 48.12  ? 242 LEU B CB    1 
ATOM   3350 C  CG    . LEU B 1 166 ? -11.719 -26.540 -4.356  1.00 54.59  ? 242 LEU B CG    1 
ATOM   3351 C  CD1   . LEU B 1 166 ? -12.665 -27.155 -3.354  1.00 44.74  ? 242 LEU B CD1   1 
ATOM   3352 C  CD2   . LEU B 1 166 ? -11.643 -25.022 -4.191  1.00 42.33  ? 242 LEU B CD2   1 
ATOM   3353 N  N     . PHE B 1 167 ? -8.757  -25.113 -2.392  1.00 48.55  ? 243 PHE B N     1 
ATOM   3354 C  CA    . PHE B 1 167 ? -8.239  -24.836 -1.059  1.00 49.99  ? 243 PHE B CA    1 
ATOM   3355 C  C     . PHE B 1 167 ? -9.357  -24.445 -0.099  1.00 52.57  ? 243 PHE B C     1 
ATOM   3356 O  O     . PHE B 1 167 ? -10.293 -23.747 -0.479  1.00 54.56  ? 243 PHE B O     1 
ATOM   3357 C  CB    . PHE B 1 167 ? -7.194  -23.717 -1.107  1.00 53.43  ? 243 PHE B CB    1 
ATOM   3358 C  CG    . PHE B 1 167 ? -5.942  -24.080 -1.854  1.00 58.81  ? 243 PHE B CG    1 
ATOM   3359 C  CD1   . PHE B 1 167 ? -4.914  -24.762 -1.222  1.00 54.83  ? 243 PHE B CD1   1 
ATOM   3360 C  CD2   . PHE B 1 167 ? -5.788  -23.727 -3.187  1.00 51.04  ? 243 PHE B CD2   1 
ATOM   3361 C  CE1   . PHE B 1 167 ? -3.760  -25.092 -1.908  1.00 66.87  ? 243 PHE B CE1   1 
ATOM   3362 C  CE2   . PHE B 1 167 ? -4.632  -24.053 -3.881  1.00 56.39  ? 243 PHE B CE2   1 
ATOM   3363 C  CZ    . PHE B 1 167 ? -3.618  -24.734 -3.244  1.00 61.56  ? 243 PHE B CZ    1 
ATOM   3364 N  N     . ARG B 1 168 ? -9.247  -24.892 1.148   1.00 54.12  ? 244 ARG B N     1 
ATOM   3365 C  CA    . ARG B 1 168 ? -10.197 -24.526 2.197   1.00 51.50  ? 244 ARG B CA    1 
ATOM   3366 C  C     . ARG B 1 168 ? -9.469  -23.803 3.337   1.00 53.26  ? 244 ARG B C     1 
ATOM   3367 O  O     . ARG B 1 168 ? -8.248  -23.869 3.433   1.00 55.40  ? 244 ARG B O     1 
ATOM   3368 C  CB    . ARG B 1 168 ? -10.885 -25.781 2.735   1.00 52.92  ? 244 ARG B CB    1 
ATOM   3369 C  CG    . ARG B 1 168 ? -12.297 -26.020 2.224   1.00 54.71  ? 244 ARG B CG    1 
ATOM   3370 C  CD    . ARG B 1 168 ? -12.316 -26.476 0.782   1.00 52.08  ? 244 ARG B CD    1 
ATOM   3371 N  NE    . ARG B 1 168 ? -13.622 -26.998 0.382   1.00 46.16  ? 244 ARG B NE    1 
ATOM   3372 C  CZ    . ARG B 1 168 ? -13.801 -28.190 -0.183  1.00 56.11  ? 244 ARG B CZ    1 
ATOM   3373 N  NH1   . ARG B 1 168 ? -12.758 -28.978 -0.403  1.00 53.45  ? 244 ARG B NH1   1 
ATOM   3374 N  NH2   . ARG B 1 168 ? -15.016 -28.598 -0.530  1.00 45.51  ? 244 ARG B NH2   1 
ATOM   3375 N  N     . PRO B 1 169 ? -10.209 -23.094 4.205   1.00 55.72  ? 245 PRO B N     1 
ATOM   3376 C  CA    . PRO B 1 169 ? -9.507  -22.516 5.358   1.00 57.14  ? 245 PRO B CA    1 
ATOM   3377 C  C     . PRO B 1 169 ? -9.016  -23.616 6.307   1.00 62.65  ? 245 PRO B C     1 
ATOM   3378 O  O     . PRO B 1 169 ? -9.584  -24.711 6.335   1.00 61.29  ? 245 PRO B O     1 
ATOM   3379 C  CB    . PRO B 1 169 ? -10.586 -21.665 6.043   1.00 53.30  ? 245 PRO B CB    1 
ATOM   3380 C  CG    . PRO B 1 169 ? -11.635 -21.445 5.004   1.00 50.45  ? 245 PRO B CG    1 
ATOM   3381 C  CD    . PRO B 1 169 ? -11.618 -22.672 4.146   1.00 49.13  ? 245 PRO B CD    1 
ATOM   3382 N  N     . SER B 1 170 ? -7.965  -23.329 7.068   1.00 63.04  ? 246 SER B N     1 
ATOM   3383 C  CA    . SER B 1 170 ? -7.452  -24.292 8.040   1.00 66.94  ? 246 SER B CA    1 
ATOM   3384 C  C     . SER B 1 170 ? -7.071  -23.607 9.354   1.00 66.73  ? 246 SER B C     1 
ATOM   3385 O  O     . SER B 1 170 ? -6.472  -22.530 9.356   1.00 67.33  ? 246 SER B O     1 
ATOM   3386 C  CB    . SER B 1 170 ? -6.255  -25.050 7.472   1.00 62.13  ? 246 SER B CB    1 
ATOM   3387 O  OG    . SER B 1 170 ? -5.121  -24.206 7.405   1.00 67.44  ? 246 SER B OG    1 
ATOM   3388 N  N     . GLY B 1 171 ? -7.424  -24.236 10.469  1.00 64.61  ? 247 GLY B N     1 
ATOM   3389 C  CA    . GLY B 1 171 ? -7.126  -23.681 11.774  1.00 65.48  ? 247 GLY B CA    1 
ATOM   3390 C  C     . GLY B 1 171 ? -8.268  -22.819 12.267  1.00 69.03  ? 247 GLY B C     1 
ATOM   3391 O  O     . GLY B 1 171 ? -8.096  -21.950 13.124  1.00 67.59  ? 247 GLY B O     1 
ATOM   3392 N  N     . ILE B 1 172 ? -9.448  -23.054 11.710  1.00 67.35  ? 248 ILE B N     1 
ATOM   3393 C  CA    . ILE B 1 172 ? -10.620 -22.306 12.121  1.00 68.40  ? 248 ILE B CA    1 
ATOM   3394 C  C     . ILE B 1 172 ? -11.223 -22.948 13.372  1.00 71.51  ? 248 ILE B C     1 
ATOM   3395 O  O     . ILE B 1 172 ? -11.729 -24.076 13.335  1.00 64.54  ? 248 ILE B O     1 
ATOM   3396 C  CB    . ILE B 1 172 ? -11.639 -22.183 10.972  1.00 65.23  ? 248 ILE B CB    1 
ATOM   3397 C  CG1   . ILE B 1 172 ? -11.040 -21.357 9.829   1.00 62.99  ? 248 ILE B CG1   1 
ATOM   3398 C  CG2   . ILE B 1 172 ? -12.923 -21.540 11.460  1.00 65.76  ? 248 ILE B CG2   1 
ATOM   3399 C  CD1   . ILE B 1 172 ? -10.762 -19.912 10.186  1.00 57.79  ? 248 ILE B CD1   1 
ATOM   3400 N  N     . THR B 1 173 ? -11.129 -22.218 14.481  1.00 73.99  ? 249 THR B N     1 
ATOM   3401 C  CA    . THR B 1 173 ? -11.594 -22.678 15.790  1.00 73.52  ? 249 THR B CA    1 
ATOM   3402 C  C     . THR B 1 173 ? -13.108 -22.734 15.837  1.00 68.76  ? 249 THR B C     1 
ATOM   3403 O  O     . THR B 1 173 ? -13.688 -23.732 16.276  1.00 70.72  ? 249 THR B O     1 
ATOM   3404 C  CB    . THR B 1 173 ? -11.095 -21.737 16.909  1.00 74.56  ? 249 THR B CB    1 
ATOM   3405 O  OG1   . THR B 1 173 ? -9.699  -21.965 17.134  1.00 83.48  ? 249 THR B OG1   1 
ATOM   3406 C  CG2   . THR B 1 173 ? -11.859 -21.968 18.208  1.00 78.83  ? 249 THR B CG2   1 
ATOM   3407 N  N     . THR B 1 174 ? -13.735 -21.649 15.381  1.00 69.75  ? 250 THR B N     1 
ATOM   3408 C  CA    . THR B 1 174 ? -15.189 -21.544 15.273  1.00 62.40  ? 250 THR B CA    1 
ATOM   3409 C  C     . THR B 1 174 ? -15.727 -22.719 14.470  1.00 65.84  ? 250 THR B C     1 
ATOM   3410 O  O     . THR B 1 174 ? -14.974 -23.396 13.776  1.00 76.17  ? 250 THR B O     1 
ATOM   3411 C  CB    . THR B 1 174 ? -15.613 -20.202 14.636  1.00 63.44  ? 250 THR B CB    1 
ATOM   3412 O  OG1   . THR B 1 174 ? -14.994 -20.050 13.347  1.00 69.43  ? 250 THR B OG1   1 
ATOM   3413 C  CG2   . THR B 1 174 ? -15.182 -19.041 15.517  1.00 59.89  ? 250 THR B CG2   1 
ATOM   3414 N  N     . GLY B 1 175 ? -17.016 -23.001 14.570  1.00 59.89  ? 251 GLY B N     1 
ATOM   3415 C  CA    . GLY B 1 175 ? -17.491 -24.216 13.943  1.00 62.39  ? 251 GLY B CA    1 
ATOM   3416 C  C     . GLY B 1 175 ? -18.551 -23.941 12.914  1.00 65.74  ? 251 GLY B C     1 
ATOM   3417 O  O     . GLY B 1 175 ? -18.292 -23.308 11.893  1.00 66.59  ? 251 GLY B O     1 
ATOM   3418 N  N     . TYR B 1 176 ? -19.757 -24.421 13.196  1.00 63.55  ? 252 TYR B N     1 
ATOM   3419 C  CA    . TYR B 1 176 ? -20.916 -24.106 12.391  1.00 49.60  ? 252 TYR B CA    1 
ATOM   3420 C  C     . TYR B 1 176 ? -21.424 -22.750 12.836  1.00 52.01  ? 252 TYR B C     1 
ATOM   3421 O  O     . TYR B 1 176 ? -22.537 -22.348 12.507  1.00 53.80  ? 252 TYR B O     1 
ATOM   3422 C  CB    . TYR B 1 176 ? -21.991 -25.172 12.560  1.00 53.27  ? 252 TYR B CB    1 
ATOM   3423 C  CG    . TYR B 1 176 ? -21.599 -26.533 12.028  1.00 56.04  ? 252 TYR B CG    1 
ATOM   3424 C  CD1   . TYR B 1 176 ? -20.565 -26.674 11.106  1.00 55.80  ? 252 TYR B CD1   1 
ATOM   3425 C  CD2   . TYR B 1 176 ? -22.276 -27.685 12.438  1.00 62.88  ? 252 TYR B CD2   1 
ATOM   3426 C  CE1   . TYR B 1 176 ? -20.212 -27.930 10.604  1.00 56.08  ? 252 TYR B CE1   1 
ATOM   3427 C  CE2   . TYR B 1 176 ? -21.929 -28.945 11.945  1.00 55.89  ? 252 TYR B CE2   1 
ATOM   3428 C  CZ    . TYR B 1 176 ? -20.893 -29.058 11.031  1.00 61.31  ? 252 TYR B CZ    1 
ATOM   3429 O  OH    . TYR B 1 176 ? -20.537 -30.296 10.537  1.00 63.07  ? 252 TYR B OH    1 
ATOM   3430 N  N     . LYS B 1 177 ? -20.597 -22.054 13.608  1.00 57.08  ? 253 LYS B N     1 
ATOM   3431 C  CA    . LYS B 1 177 ? -20.852 -20.667 13.965  1.00 60.05  ? 253 LYS B CA    1 
ATOM   3432 C  C     . LYS B 1 177 ? -19.760 -19.793 13.329  1.00 56.89  ? 253 LYS B C     1 
ATOM   3433 O  O     . LYS B 1 177 ? -19.512 -18.665 13.754  1.00 59.78  ? 253 LYS B O     1 
ATOM   3434 C  CB    . LYS B 1 177 ? -20.915 -20.495 15.490  1.00 62.51  ? 253 LYS B CB    1 
ATOM   3435 C  CG    . LYS B 1 177 ? -21.962 -21.390 16.164  1.00 69.08  ? 253 LYS B CG    1 
ATOM   3436 C  CD    . LYS B 1 177 ? -21.894 -21.337 17.690  1.00 75.53  ? 253 LYS B CD    1 
ATOM   3437 C  CE    . LYS B 1 177 ? -22.867 -20.324 18.271  1.00 73.72  ? 253 LYS B CE    1 
ATOM   3438 N  NZ    . LYS B 1 177 ? -24.266 -20.572 17.822  1.00 73.58  ? 253 LYS B NZ    1 
ATOM   3439 N  N     . THR B 1 178 ? -19.110 -20.331 12.300  1.00 58.71  ? 254 THR B N     1 
ATOM   3440 C  CA    . THR B 1 178 ? -18.155 -19.557 11.516  1.00 58.86  ? 254 THR B CA    1 
ATOM   3441 C  C     . THR B 1 178 ? -18.914 -18.509 10.704  1.00 52.14  ? 254 THR B C     1 
ATOM   3442 O  O     . THR B 1 178 ? -18.447 -17.387 10.545  1.00 50.78  ? 254 THR B O     1 
ATOM   3443 C  CB    . THR B 1 178 ? -17.310 -20.470 10.598  1.00 60.53  ? 254 THR B CB    1 
ATOM   3444 O  OG1   . THR B 1 178 ? -16.528 -21.362 11.404  1.00 54.55  ? 254 THR B OG1   1 
ATOM   3445 C  CG2   . THR B 1 178 ? -16.379 -19.655 9.708   1.00 55.11  ? 254 THR B CG2   1 
ATOM   3446 N  N     . PHE B 1 179 ? -20.107 -18.880 10.235  1.00 49.41  ? 255 PHE B N     1 
ATOM   3447 C  CA    . PHE B 1 179 ? -20.967 -17.989 9.458   1.00 49.96  ? 255 PHE B CA    1 
ATOM   3448 C  C     . PHE B 1 179 ? -22.342 -17.807 10.083  1.00 54.20  ? 255 PHE B C     1 
ATOM   3449 O  O     . PHE B 1 179 ? -22.894 -18.742 10.659  1.00 54.81  ? 255 PHE B O     1 
ATOM   3450 C  CB    . PHE B 1 179 ? -21.178 -18.548 8.048   1.00 49.00  ? 255 PHE B CB    1 
ATOM   3451 C  CG    . PHE B 1 179 ? -19.902 -18.838 7.308   1.00 50.39  ? 255 PHE B CG    1 
ATOM   3452 C  CD1   . PHE B 1 179 ? -19.146 -17.807 6.776   1.00 51.72  ? 255 PHE B CD1   1 
ATOM   3453 C  CD2   . PHE B 1 179 ? -19.470 -20.140 7.134   1.00 42.83  ? 255 PHE B CD2   1 
ATOM   3454 C  CE1   . PHE B 1 179 ? -17.972 -18.071 6.088   1.00 54.99  ? 255 PHE B CE1   1 
ATOM   3455 C  CE2   . PHE B 1 179 ? -18.299 -20.412 6.450   1.00 50.17  ? 255 PHE B CE2   1 
ATOM   3456 C  CZ    . PHE B 1 179 ? -17.546 -19.377 5.925   1.00 52.60  ? 255 PHE B CZ    1 
ATOM   3457 N  N     . ARG B 1 180 ? -22.907 -16.612 9.942   1.00 54.15  ? 256 ARG B N     1 
ATOM   3458 C  CA    . ARG B 1 180 ? -24.330 -16.427 10.209  1.00 51.02  ? 256 ARG B CA    1 
ATOM   3459 C  C     . ARG B 1 180 ? -25.119 -16.710 8.934   1.00 53.61  ? 256 ARG B C     1 
ATOM   3460 O  O     . ARG B 1 180 ? -24.793 -16.192 7.864   1.00 51.44  ? 256 ARG B O     1 
ATOM   3461 C  CB    . ARG B 1 180 ? -24.634 -15.013 10.707  1.00 52.43  ? 256 ARG B CB    1 
ATOM   3462 C  CG    . ARG B 1 180 ? -26.038 -14.868 11.302  1.00 51.66  ? 256 ARG B CG    1 
ATOM   3463 C  CD    . ARG B 1 180 ? -26.434 -13.398 11.414  1.00 56.42  ? 256 ARG B CD    1 
ATOM   3464 N  NE    . ARG B 1 180 ? -25.364 -12.619 12.029  1.00 65.64  ? 256 ARG B NE    1 
ATOM   3465 C  CZ    . ARG B 1 180 ? -25.215 -11.304 11.904  1.00 58.15  ? 256 ARG B CZ    1 
ATOM   3466 N  NH1   . ARG B 1 180 ? -26.069 -10.593 11.173  1.00 55.36  ? 256 ARG B NH1   1 
ATOM   3467 N  NH2   . ARG B 1 180 ? -24.201 -10.702 12.508  1.00 56.39  ? 256 ARG B NH2   1 
ATOM   3468 N  N     . HIS B 1 181 ? -26.145 -17.546 9.051   1.00 50.57  ? 257 HIS B N     1 
ATOM   3469 C  CA    . HIS B 1 181 ? -26.977 -17.921 7.919   1.00 44.36  ? 257 HIS B CA    1 
ATOM   3470 C  C     . HIS B 1 181 ? -28.447 -17.787 8.276   1.00 44.53  ? 257 HIS B C     1 
ATOM   3471 O  O     . HIS B 1 181 ? -29.123 -18.789 8.497   1.00 49.56  ? 257 HIS B O     1 
ATOM   3472 C  CB    . HIS B 1 181 ? -26.695 -19.372 7.516   1.00 44.21  ? 257 HIS B CB    1 
ATOM   3473 C  CG    . HIS B 1 181 ? -27.317 -19.770 6.211   1.00 46.84  ? 257 HIS B CG    1 
ATOM   3474 N  ND1   . HIS B 1 181 ? -27.974 -20.971 6.032   1.00 46.93  ? 257 HIS B ND1   1 
ATOM   3475 C  CD2   . HIS B 1 181 ? -27.357 -19.139 5.013   1.00 42.80  ? 257 HIS B CD2   1 
ATOM   3476 C  CE1   . HIS B 1 181 ? -28.404 -21.054 4.785   1.00 43.15  ? 257 HIS B CE1   1 
ATOM   3477 N  NE2   . HIS B 1 181 ? -28.045 -19.953 4.145   1.00 45.15  ? 257 HIS B NE2   1 
ATOM   3478 N  N     . LEU B 1 182 ? -28.953 -16.561 8.334   1.00 55.44  ? 258 LEU B N     1 
ATOM   3479 C  CA    . LEU B 1 182 ? -30.357 -16.357 8.706   1.00 62.06  ? 258 LEU B CA    1 
ATOM   3480 C  C     . LEU B 1 182 ? -31.283 -16.627 7.523   1.00 60.20  ? 258 LEU B C     1 
ATOM   3481 O  O     . LEU B 1 182 ? -31.854 -15.709 6.924   1.00 56.78  ? 258 LEU B O     1 
ATOM   3482 C  CB    . LEU B 1 182 ? -30.584 -14.957 9.289   1.00 58.59  ? 258 LEU B CB    1 
ATOM   3483 C  CG    . LEU B 1 182 ? -29.830 -14.701 10.599  1.00 66.41  ? 258 LEU B CG    1 
ATOM   3484 C  CD1   . LEU B 1 182 ? -30.113 -13.304 11.144  1.00 53.63  ? 258 LEU B CD1   1 
ATOM   3485 C  CD2   . LEU B 1 182 ? -30.153 -15.783 11.644  1.00 57.66  ? 258 LEU B CD2   1 
ATOM   3486 N  N     . HIS B 1 183 ? -31.421 -17.908 7.204   1.00 50.53  ? 259 HIS B N     1 
ATOM   3487 C  CA    . HIS B 1 183 ? -32.185 -18.346 6.053   1.00 49.39  ? 259 HIS B CA    1 
ATOM   3488 C  C     . HIS B 1 183 ? -33.283 -19.280 6.550   1.00 48.32  ? 259 HIS B C     1 
ATOM   3489 O  O     . HIS B 1 183 ? -33.049 -20.458 6.826   1.00 47.40  ? 259 HIS B O     1 
ATOM   3490 C  CB    . HIS B 1 183 ? -31.252 -19.034 5.041   1.00 38.11  ? 259 HIS B CB    1 
ATOM   3491 C  CG    . HIS B 1 183 ? -31.932 -19.519 3.799   1.00 36.64  ? 259 HIS B CG    1 
ATOM   3492 N  ND1   . HIS B 1 183 ? -31.232 -19.854 2.656   1.00 40.63  ? 259 HIS B ND1   1 
ATOM   3493 C  CD2   . HIS B 1 183 ? -33.238 -19.720 3.509   1.00 39.37  ? 259 HIS B CD2   1 
ATOM   3494 C  CE1   . HIS B 1 183 ? -32.080 -20.234 1.718   1.00 38.15  ? 259 HIS B CE1   1 
ATOM   3495 N  NE2   . HIS B 1 183 ? -33.305 -20.166 2.211   1.00 40.42  ? 259 HIS B NE2   1 
ATOM   3496 N  N     . ASP B 1 184 ? -34.485 -18.734 6.667   1.00 51.24  ? 260 ASP B N     1 
ATOM   3497 C  CA    . ASP B 1 184 ? -35.648 -19.499 7.100   1.00 50.38  ? 260 ASP B CA    1 
ATOM   3498 C  C     . ASP B 1 184 ? -36.218 -20.239 5.903   1.00 47.16  ? 260 ASP B C     1 
ATOM   3499 O  O     . ASP B 1 184 ? -36.723 -19.615 4.973   1.00 48.43  ? 260 ASP B O     1 
ATOM   3500 C  CB    . ASP B 1 184 ? -36.693 -18.547 7.689   1.00 53.04  ? 260 ASP B CB    1 
ATOM   3501 C  CG    . ASP B 1 184 ? -37.842 -19.267 8.389   1.00 54.17  ? 260 ASP B CG    1 
ATOM   3502 O  OD1   . ASP B 1 184 ? -38.122 -20.454 8.089   1.00 47.83  ? 260 ASP B OD1   1 
ATOM   3503 O  OD2   . ASP B 1 184 ? -38.485 -18.607 9.235   1.00 56.39  ? 260 ASP B OD2   1 
ATOM   3504 N  N     . PRO B 1 185 ? -36.156 -21.581 5.931   1.00 54.21  ? 261 PRO B N     1 
ATOM   3505 C  CA    . PRO B 1 185 ? -36.544 -22.429 4.793   1.00 48.93  ? 261 PRO B CA    1 
ATOM   3506 C  C     . PRO B 1 185 ? -38.022 -22.323 4.425   1.00 49.47  ? 261 PRO B C     1 
ATOM   3507 O  O     . PRO B 1 185 ? -38.413 -22.736 3.333   1.00 50.16  ? 261 PRO B O     1 
ATOM   3508 C  CB    . PRO B 1 185 ? -36.226 -23.849 5.282   1.00 52.74  ? 261 PRO B CB    1 
ATOM   3509 C  CG    . PRO B 1 185 ? -35.279 -23.662 6.441   1.00 55.71  ? 261 PRO B CG    1 
ATOM   3510 C  CD    . PRO B 1 185 ? -35.687 -22.375 7.079   1.00 50.37  ? 261 PRO B CD    1 
ATOM   3511 N  N     . ALA B 1 186 ? -38.838 -21.793 5.329   1.00 47.49  ? 262 ALA B N     1 
ATOM   3512 C  CA    . ALA B 1 186 ? -40.257 -21.609 5.039   1.00 57.02  ? 262 ALA B CA    1 
ATOM   3513 C  C     . ALA B 1 186 ? -40.564 -20.194 4.523   1.00 59.93  ? 262 ALA B C     1 
ATOM   3514 O  O     . ALA B 1 186 ? -41.601 -19.966 3.891   1.00 62.10  ? 262 ALA B O     1 
ATOM   3515 C  CB    . ALA B 1 186 ? -41.106 -21.944 6.264   1.00 56.47  ? 262 ALA B CB    1 
ATOM   3516 N  N     . TRP B 1 187 ? -39.655 -19.255 4.784   1.00 49.53  ? 263 TRP B N     1 
ATOM   3517 C  CA    . TRP B 1 187 ? -39.792 -17.891 4.284   1.00 46.03  ? 263 TRP B CA    1 
ATOM   3518 C  C     . TRP B 1 187 ? -39.046 -17.687 2.953   1.00 49.26  ? 263 TRP B C     1 
ATOM   3519 O  O     . TRP B 1 187 ? -39.591 -17.119 2.004   1.00 43.97  ? 263 TRP B O     1 
ATOM   3520 C  CB    . TRP B 1 187 ? -39.302 -16.896 5.335   1.00 45.45  ? 263 TRP B CB    1 
ATOM   3521 C  CG    . TRP B 1 187 ? -39.607 -15.472 4.997   1.00 48.53  ? 263 TRP B CG    1 
ATOM   3522 C  CD1   . TRP B 1 187 ? -38.707 -14.469 4.774   1.00 46.23  ? 263 TRP B CD1   1 
ATOM   3523 C  CD2   . TRP B 1 187 ? -40.906 -14.891 4.825   1.00 46.59  ? 263 TRP B CD2   1 
ATOM   3524 N  NE1   . TRP B 1 187 ? -39.364 -13.300 4.483   1.00 47.78  ? 263 TRP B NE1   1 
ATOM   3525 C  CE2   . TRP B 1 187 ? -40.715 -13.530 4.510   1.00 45.96  ? 263 TRP B CE2   1 
ATOM   3526 C  CE3   . TRP B 1 187 ? -42.212 -15.389 4.916   1.00 45.25  ? 263 TRP B CE3   1 
ATOM   3527 C  CZ2   . TRP B 1 187 ? -41.780 -12.661 4.281   1.00 44.29  ? 263 TRP B CZ2   1 
ATOM   3528 C  CZ3   . TRP B 1 187 ? -43.268 -14.527 4.692   1.00 44.95  ? 263 TRP B CZ3   1 
ATOM   3529 C  CH2   . TRP B 1 187 ? -43.046 -13.176 4.380   1.00 44.60  ? 263 TRP B CH2   1 
ATOM   3530 N  N     . ARG B 1 188 ? -37.796 -18.139 2.895   1.00 50.66  ? 264 ARG B N     1 
ATOM   3531 C  CA    . ARG B 1 188 ? -37.039 -18.146 1.645   1.00 47.15  ? 264 ARG B CA    1 
ATOM   3532 C  C     . ARG B 1 188 ? -37.012 -19.571 1.135   1.00 47.57  ? 264 ARG B C     1 
ATOM   3533 O  O     . ARG B 1 188 ? -36.071 -20.325 1.389   1.00 45.71  ? 264 ARG B O     1 
ATOM   3534 C  CB    . ARG B 1 188 ? -35.615 -17.609 1.839   1.00 45.19  ? 264 ARG B CB    1 
ATOM   3535 C  CG    . ARG B 1 188 ? -35.539 -16.179 2.408   1.00 44.38  ? 264 ARG B CG    1 
ATOM   3536 C  CD    . ARG B 1 188 ? -36.471 -15.218 1.694   1.00 41.52  ? 264 ARG B CD    1 
ATOM   3537 N  NE    . ARG B 1 188 ? -36.135 -13.836 2.025   1.00 45.46  ? 264 ARG B NE    1 
ATOM   3538 C  CZ    . ARG B 1 188 ? -36.753 -12.764 1.537   1.00 46.35  ? 264 ARG B CZ    1 
ATOM   3539 N  NH1   . ARG B 1 188 ? -37.764 -12.897 0.684   1.00 41.57  ? 264 ARG B NH1   1 
ATOM   3540 N  NH2   . ARG B 1 188 ? -36.345 -11.549 1.891   1.00 49.61  ? 264 ARG B NH2   1 
ATOM   3541 N  N     . LYS B 1 189 ? -38.072 -19.942 0.432   1.00 49.37  ? 265 LYS B N     1 
ATOM   3542 C  CA    . LYS B 1 189 ? -38.249 -21.310 -0.016  1.00 46.14  ? 265 LYS B CA    1 
ATOM   3543 C  C     . LYS B 1 189 ? -37.319 -21.633 -1.193  1.00 53.41  ? 265 LYS B C     1 
ATOM   3544 O  O     . LYS B 1 189 ? -37.318 -20.930 -2.206  1.00 53.57  ? 265 LYS B O     1 
ATOM   3545 C  CB    . LYS B 1 189 ? -39.715 -21.538 -0.400  1.00 58.64  ? 265 LYS B CB    1 
ATOM   3546 C  CG    . LYS B 1 189 ? -40.316 -22.839 0.146   1.00 69.01  ? 265 LYS B CG    1 
ATOM   3547 C  CD    . LYS B 1 189 ? -39.551 -24.076 -0.353  1.00 73.47  ? 265 LYS B CD    1 
ATOM   3548 C  CE    . LYS B 1 189 ? -40.165 -25.375 0.164   1.00 71.93  ? 265 LYS B CE    1 
ATOM   3549 N  NZ    . LYS B 1 189 ? -41.527 -25.600 -0.397  1.00 82.46  ? 265 LYS B NZ    1 
ATOM   3550 N  N     . ARG B 1 190 ? -36.526 -22.692 -1.055  1.00 42.63  ? 266 ARG B N     1 
ATOM   3551 C  CA    . ARG B 1 190 ? -35.631 -23.110 -2.131  1.00 44.21  ? 266 ARG B CA    1 
ATOM   3552 C  C     . ARG B 1 190 ? -36.413 -23.703 -3.289  1.00 48.35  ? 266 ARG B C     1 
ATOM   3553 O  O     . ARG B 1 190 ? -37.259 -24.576 -3.099  1.00 49.36  ? 266 ARG B O     1 
ATOM   3554 C  CB    . ARG B 1 190 ? -34.593 -24.117 -1.635  1.00 44.19  ? 266 ARG B CB    1 
ATOM   3555 C  CG    . ARG B 1 190 ? -33.582 -23.523 -0.678  1.00 42.01  ? 266 ARG B CG    1 
ATOM   3556 C  CD    . ARG B 1 190 ? -32.821 -24.616 0.028   1.00 40.45  ? 266 ARG B CD    1 
ATOM   3557 N  NE    . ARG B 1 190 ? -31.826 -24.068 0.942   1.00 43.32  ? 266 ARG B NE    1 
ATOM   3558 C  CZ    . ARG B 1 190 ? -32.086 -23.679 2.181   1.00 40.79  ? 266 ARG B CZ    1 
ATOM   3559 N  NH1   . ARG B 1 190 ? -33.317 -23.782 2.657   1.00 46.04  ? 266 ARG B NH1   1 
ATOM   3560 N  NH2   . ARG B 1 190 ? -31.116 -23.189 2.941   1.00 38.18  ? 266 ARG B NH2   1 
ATOM   3561 N  N     . ASP B 1 191 ? -36.125 -23.223 -4.492  1.00 45.46  ? 267 ASP B N     1 
ATOM   3562 C  CA    . ASP B 1 191 ? -36.809 -23.701 -5.676  1.00 41.56  ? 267 ASP B CA    1 
ATOM   3563 C  C     . ASP B 1 191 ? -36.138 -24.999 -6.130  1.00 49.85  ? 267 ASP B C     1 
ATOM   3564 O  O     . ASP B 1 191 ? -35.249 -24.997 -6.982  1.00 47.89  ? 267 ASP B O     1 
ATOM   3565 C  CB    . ASP B 1 191 ? -36.791 -22.621 -6.754  1.00 42.76  ? 267 ASP B CB    1 
ATOM   3566 C  CG    . ASP B 1 191 ? -37.458 -23.057 -8.043  1.00 50.21  ? 267 ASP B CG    1 
ATOM   3567 O  OD1   . ASP B 1 191 ? -38.028 -24.161 -8.110  1.00 54.07  ? 267 ASP B OD1   1 
ATOM   3568 O  OD2   . ASP B 1 191 ? -37.414 -22.274 -9.003  1.00 46.65  ? 267 ASP B OD2   1 
ATOM   3569 N  N     . GLN B 1 192 ? -36.594 -26.106 -5.546  1.00 46.70  ? 268 GLN B N     1 
ATOM   3570 C  CA    . GLN B 1 192 ? -35.936 -27.397 -5.677  1.00 46.93  ? 268 GLN B CA    1 
ATOM   3571 C  C     . GLN B 1 192 ? -36.594 -28.337 -6.675  1.00 48.37  ? 268 GLN B C     1 
ATOM   3572 O  O     . GLN B 1 192 ? -36.040 -29.390 -7.004  1.00 53.10  ? 268 GLN B O     1 
ATOM   3573 C  CB    . GLN B 1 192 ? -35.810 -28.052 -4.300  1.00 46.32  ? 268 GLN B CB    1 
ATOM   3574 C  CG    . GLN B 1 192 ? -34.580 -27.562 -3.564  1.00 39.93  ? 268 GLN B CG    1 
ATOM   3575 C  CD    . GLN B 1 192 ? -34.587 -27.907 -2.108  1.00 43.46  ? 268 GLN B CD    1 
ATOM   3576 O  OE1   . GLN B 1 192 ? -35.645 -28.024 -1.500  1.00 51.04  ? 268 GLN B OE1   1 
ATOM   3577 N  NE2   . GLN B 1 192 ? -33.404 -28.053 -1.526  1.00 45.32  ? 268 GLN B NE2   1 
ATOM   3578 N  N     . LYS B 1 193 ? -37.754 -27.934 -7.180  1.00 52.86  ? 269 LYS B N     1 
ATOM   3579 C  CA    . LYS B 1 193 ? -38.512 -28.745 -8.122  1.00 53.08  ? 269 LYS B CA    1 
ATOM   3580 C  C     . LYS B 1 193 ? -37.725 -29.101 -9.391  1.00 52.86  ? 269 LYS B C     1 
ATOM   3581 O  O     . LYS B 1 193 ? -37.078 -28.254 -9.997  1.00 61.09  ? 269 LYS B O     1 
ATOM   3582 C  CB    . LYS B 1 193 ? -39.827 -28.044 -8.482  1.00 55.17  ? 269 LYS B CB    1 
ATOM   3583 C  CG    . LYS B 1 193 ? -40.690 -28.808 -9.482  1.00 56.36  ? 269 LYS B CG    1 
ATOM   3584 C  CD    . LYS B 1 193 ? -42.009 -28.090 -9.740  1.00 63.42  ? 269 LYS B CD    1 
ATOM   3585 C  CE    . LYS B 1 193 ? -42.862 -28.852 -10.746 1.00 72.64  ? 269 LYS B CE    1 
ATOM   3586 N  NZ    . LYS B 1 193 ? -44.195 -28.217 -10.934 1.00 80.04  ? 269 LYS B NZ    1 
ATOM   3587 N  N     . ARG B 1 194 ? -37.789 -30.366 -9.780  1.00 54.92  ? 270 ARG B N     1 
ATOM   3588 C  CA    . ARG B 1 194 ? -37.150 -30.834 -10.997 1.00 54.97  ? 270 ARG B CA    1 
ATOM   3589 C  C     . ARG B 1 194 ? -38.187 -31.019 -12.099 1.00 61.75  ? 270 ARG B C     1 
ATOM   3590 O  O     . ARG B 1 194 ? -38.974 -31.967 -12.079 1.00 61.39  ? 270 ARG B O     1 
ATOM   3591 C  CB    . ARG B 1 194 ? -36.400 -32.144 -10.749 1.00 57.12  ? 270 ARG B CB    1 
ATOM   3592 C  CG    . ARG B 1 194 ? -34.930 -31.970 -10.423 1.00 56.52  ? 270 ARG B CG    1 
ATOM   3593 C  CD    . ARG B 1 194 ? -34.744 -31.217 -9.141  1.00 63.58  ? 270 ARG B CD    1 
ATOM   3594 N  NE    . ARG B 1 194 ? -33.516 -30.431 -9.140  1.00 66.33  ? 270 ARG B NE    1 
ATOM   3595 C  CZ    . ARG B 1 194 ? -33.466 -29.117 -9.336  1.00 54.61  ? 270 ARG B CZ    1 
ATOM   3596 N  NH1   . ARG B 1 194 ? -34.572 -28.433 -9.562  1.00 57.30  ? 270 ARG B NH1   1 
ATOM   3597 N  NH2   . ARG B 1 194 ? -32.303 -28.490 -9.312  1.00 52.12  ? 270 ARG B NH2   1 
ATOM   3598 N  N     . ILE B 1 195 ? -38.180 -30.101 -13.059 1.00 61.33  ? 271 ILE B N     1 
ATOM   3599 C  CA    . ILE B 1 195 ? -39.105 -30.136 -14.182 1.00 52.17  ? 271 ILE B CA    1 
ATOM   3600 C  C     . ILE B 1 195 ? -38.561 -31.033 -15.295 1.00 61.97  ? 271 ILE B C     1 
ATOM   3601 O  O     . ILE B 1 195 ? -37.525 -30.725 -15.910 1.00 53.39  ? 271 ILE B O     1 
ATOM   3602 C  CB    . ILE B 1 195 ? -39.372 -28.710 -14.707 1.00 55.96  ? 271 ILE B CB    1 
ATOM   3603 C  CG1   . ILE B 1 195 ? -39.934 -27.844 -13.571 1.00 58.53  ? 271 ILE B CG1   1 
ATOM   3604 C  CG2   . ILE B 1 195 ? -40.312 -28.739 -15.902 1.00 47.10  ? 271 ILE B CG2   1 
ATOM   3605 C  CD1   . ILE B 1 195 ? -39.871 -26.352 -13.819 1.00 57.99  ? 271 ILE B CD1   1 
ATOM   3606 N  N     . ALA B 1 196 ? -39.263 -32.146 -15.529 1.00 62.37  ? 272 ALA B N     1 
ATOM   3607 C  CA    . ALA B 1 196 ? -38.923 -33.106 -16.580 1.00 51.71  ? 272 ALA B CA    1 
ATOM   3608 C  C     . ALA B 1 196 ? -37.452 -33.500 -16.546 1.00 53.84  ? 272 ALA B C     1 
ATOM   3609 O  O     . ALA B 1 196 ? -36.948 -33.924 -15.504 1.00 59.33  ? 272 ALA B O     1 
ATOM   3610 C  CB    . ALA B 1 196 ? -39.306 -32.568 -17.955 1.00 48.03  ? 272 ALA B CB    1 
ATOM   3611 N  N     . ALA B 1 197 ? -36.767 -33.329 -17.675 1.00 45.12  ? 273 ALA B N     1 
ATOM   3612 C  CA    . ALA B 1 197 ? -35.392 -33.821 -17.837 1.00 54.15  ? 273 ALA B CA    1 
ATOM   3613 C  C     . ALA B 1 197 ? -34.357 -33.161 -16.919 1.00 57.55  ? 273 ALA B C     1 
ATOM   3614 O  O     . ALA B 1 197 ? -33.258 -33.694 -16.753 1.00 57.13  ? 273 ALA B O     1 
ATOM   3615 C  CB    . ALA B 1 197 ? -34.942 -33.725 -19.312 1.00 47.31  ? 273 ALA B CB    1 
ATOM   3616 N  N     . GLN B 1 198 ? -34.700 -32.007 -16.344 1.00 53.55  ? 274 GLN B N     1 
ATOM   3617 C  CA    . GLN B 1 198 ? -33.847 -31.346 -15.350 1.00 55.44  ? 274 GLN B CA    1 
ATOM   3618 C  C     . GLN B 1 198 ? -33.381 -32.308 -14.236 1.00 52.04  ? 274 GLN B C     1 
ATOM   3619 O  O     . GLN B 1 198 ? -32.241 -32.220 -13.759 1.00 47.74  ? 274 GLN B O     1 
ATOM   3620 C  CB    . GLN B 1 198 ? -34.552 -30.113 -14.744 1.00 53.63  ? 274 GLN B CB    1 
ATOM   3621 C  CG    . GLN B 1 198 ? -33.702 -29.347 -13.721 1.00 48.84  ? 274 GLN B CG    1 
ATOM   3622 C  CD    . GLN B 1 198 ? -34.474 -28.271 -12.955 1.00 55.92  ? 274 GLN B CD    1 
ATOM   3623 O  OE1   . GLN B 1 198 ? -35.694 -28.336 -12.821 1.00 55.81  ? 274 GLN B OE1   1 
ATOM   3624 N  NE2   . GLN B 1 198 ? -33.754 -27.276 -12.445 1.00 48.85  ? 274 GLN B NE2   1 
ATOM   3625 N  N     . LYS B 1 199 ? -34.257 -33.231 -13.840 1.00 60.46  ? 275 LYS B N     1 
ATOM   3626 C  CA    . LYS B 1 199 ? -33.909 -34.275 -12.867 1.00 59.00  ? 275 LYS B CA    1 
ATOM   3627 C  C     . LYS B 1 199 ? -32.628 -35.034 -13.242 1.00 59.13  ? 275 LYS B C     1 
ATOM   3628 O  O     . LYS B 1 199 ? -31.813 -35.329 -12.377 1.00 59.86  ? 275 LYS B O     1 
ATOM   3629 C  CB    . LYS B 1 199 ? -35.091 -35.231 -12.651 1.00 58.89  ? 275 LYS B CB    1 
ATOM   3630 C  CG    . LYS B 1 199 ? -34.810 -36.388 -11.691 1.00 64.01  ? 275 LYS B CG    1 
ATOM   3631 C  CD    . LYS B 1 199 ? -36.069 -37.207 -11.411 1.00 66.72  ? 275 LYS B CD    1 
ATOM   3632 C  CE    . LYS B 1 199 ? -35.792 -38.345 -10.422 1.00 68.55  ? 275 LYS B CE    1 
ATOM   3633 N  NZ    . LYS B 1 199 ? -34.911 -39.408 -11.007 1.00 69.93  ? 275 LYS B NZ    1 
ATOM   3634 N  N     . GLN B 1 200 ? -32.448 -35.311 -14.536 1.00 57.28  ? 276 GLN B N     1 
ATOM   3635 C  CA    . GLN B 1 200 ? -31.265 -36.004 -15.044 1.00 51.55  ? 276 GLN B CA    1 
ATOM   3636 C  C     . GLN B 1 200 ? -30.099 -35.087 -15.430 1.00 57.97  ? 276 GLN B C     1 
ATOM   3637 O  O     . GLN B 1 200 ? -28.935 -35.465 -15.268 1.00 60.02  ? 276 GLN B O     1 
ATOM   3638 C  CB    . GLN B 1 200 ? -31.637 -36.884 -16.257 1.00 53.13  ? 276 GLN B CB    1 
ATOM   3639 C  CG    . GLN B 1 200 ? -32.548 -38.164 -15.938 1.00 51.91  ? 276 GLN B CG    1 
ATOM   3640 C  CD    . GLN B 1 200 ? -33.993 -37.688 -15.805 1.00 57.41  ? 276 GLN B CD    1 
ATOM   3641 O  OE1   . GLN B 1 200 ? -34.345 -36.661 -16.418 1.00 63.21  ? 276 GLN B OE1   1 
ATOM   3642 N  NE2   . GLN B 1 200 ? -34.803 -38.342 -14.989 1.00 51.61  ? 276 GLN B NE2   1 
ATOM   3643 N  N     . GLU B 1 201 ? -30.419 -33.907 -15.970 1.00 52.29  ? 277 GLU B N     1 
ATOM   3644 C  CA    . GLU B 1 201 ? -29.418 -32.953 -16.466 1.00 53.14  ? 277 GLU B CA    1 
ATOM   3645 C  C     . GLU B 1 201 ? -28.577 -32.236 -15.391 1.00 48.01  ? 277 GLU B C     1 
ATOM   3646 O  O     . GLU B 1 201 ? -27.428 -31.875 -15.643 1.00 43.33  ? 277 GLU B O     1 
ATOM   3647 C  CB    . GLU B 1 201 ? -30.080 -31.914 -17.372 1.00 47.57  ? 277 GLU B CB    1 
ATOM   3648 C  CG    . GLU B 1 201 ? -30.726 -32.503 -18.617 1.00 50.75  ? 277 GLU B CG    1 
ATOM   3649 C  CD    . GLU B 1 201 ? -29.712 -32.892 -19.681 1.00 61.27  ? 277 GLU B CD    1 
ATOM   3650 O  OE1   . GLU B 1 201 ? -28.843 -32.055 -20.016 1.00 65.83  ? 277 GLU B OE1   1 
ATOM   3651 O  OE2   . GLU B 1 201 ? -29.778 -34.038 -20.178 1.00 72.18  ? 277 GLU B OE2   1 
ATOM   3652 N  N     . GLN B 1 202 ? -29.135 -32.046 -14.196 1.00 48.15  ? 278 GLN B N     1 
ATOM   3653 C  CA    . GLN B 1 202 ? -28.428 -31.356 -13.114 1.00 43.80  ? 278 GLN B CA    1 
ATOM   3654 C  C     . GLN B 1 202 ? -27.123 -32.062 -12.739 1.00 49.40  ? 278 GLN B C     1 
ATOM   3655 O  O     . GLN B 1 202 ? -26.193 -31.436 -12.219 1.00 49.28  ? 278 GLN B O     1 
ATOM   3656 C  CB    . GLN B 1 202 ? -29.340 -31.196 -11.882 1.00 49.00  ? 278 GLN B CB    1 
ATOM   3657 C  CG    . GLN B 1 202 ? -29.641 -32.502 -11.155 1.00 51.26  ? 278 GLN B CG    1 
ATOM   3658 C  CD    . GLN B 1 202 ? -30.761 -32.376 -10.134 1.00 54.05  ? 278 GLN B CD    1 
ATOM   3659 O  OE1   . GLN B 1 202 ? -30.874 -31.369 -9.428  1.00 58.88  ? 278 GLN B OE1   1 
ATOM   3660 N  NE2   . GLN B 1 202 ? -31.599 -33.410 -10.049 1.00 56.90  ? 278 GLN B NE2   1 
ATOM   3661 N  N     . PHE B 1 203 ? -27.054 -33.361 -13.029 1.00 48.35  ? 279 PHE B N     1 
ATOM   3662 C  CA    . PHE B 1 203 ? -25.887 -34.176 -12.698 1.00 49.58  ? 279 PHE B CA    1 
ATOM   3663 C  C     . PHE B 1 203 ? -24.873 -34.289 -13.835 1.00 55.09  ? 279 PHE B C     1 
ATOM   3664 O  O     . PHE B 1 203 ? -23.801 -34.871 -13.656 1.00 54.65  ? 279 PHE B O     1 
ATOM   3665 C  CB    . PHE B 1 203 ? -26.326 -35.579 -12.274 1.00 53.39  ? 279 PHE B CB    1 
ATOM   3666 C  CG    . PHE B 1 203 ? -27.255 -35.584 -11.105 1.00 51.16  ? 279 PHE B CG    1 
ATOM   3667 C  CD1   . PHE B 1 203 ? -26.868 -35.022 -9.890  1.00 43.46  ? 279 PHE B CD1   1 
ATOM   3668 C  CD2   . PHE B 1 203 ? -28.513 -36.148 -11.212 1.00 50.69  ? 279 PHE B CD2   1 
ATOM   3669 C  CE1   . PHE B 1 203 ? -27.722 -35.024 -8.803  1.00 53.01  ? 279 PHE B CE1   1 
ATOM   3670 C  CE2   . PHE B 1 203 ? -29.378 -36.150 -10.128 1.00 54.66  ? 279 PHE B CE2   1 
ATOM   3671 C  CZ    . PHE B 1 203 ? -28.983 -35.590 -8.920  1.00 52.47  ? 279 PHE B CZ    1 
ATOM   3672 N  N     . LYS B 1 204 ? -25.211 -33.737 -15.000 1.00 54.51  ? 280 LYS B N     1 
ATOM   3673 C  CA    . LYS B 1 204 ? -24.332 -33.807 -16.166 1.00 52.26  ? 280 LYS B CA    1 
ATOM   3674 C  C     . LYS B 1 204 ? -23.322 -32.664 -16.196 1.00 55.41  ? 280 LYS B C     1 
ATOM   3675 O  O     . LYS B 1 204 ? -23.538 -31.603 -15.614 1.00 56.84  ? 280 LYS B O     1 
ATOM   3676 C  CB    . LYS B 1 204 ? -25.139 -33.783 -17.462 1.00 53.79  ? 280 LYS B CB    1 
ATOM   3677 C  CG    . LYS B 1 204 ? -26.043 -34.975 -17.693 1.00 50.48  ? 280 LYS B CG    1 
ATOM   3678 C  CD    . LYS B 1 204 ? -26.712 -34.833 -19.049 1.00 58.35  ? 280 LYS B CD    1 
ATOM   3679 C  CE    . LYS B 1 204 ? -27.195 -36.156 -19.596 1.00 66.37  ? 280 LYS B CE    1 
ATOM   3680 N  NZ    . LYS B 1 204 ? -27.568 -35.997 -21.029 1.00 68.14  ? 280 LYS B NZ    1 
ATOM   3681 N  N     . VAL B 1 205 ? -22.216 -32.903 -16.884 1.00 57.03  ? 281 VAL B N     1 
ATOM   3682 C  CA    . VAL B 1 205 ? -21.194 -31.894 -17.114 1.00 55.47  ? 281 VAL B CA    1 
ATOM   3683 C  C     . VAL B 1 205 ? -21.587 -31.048 -18.329 1.00 56.54  ? 281 VAL B C     1 
ATOM   3684 O  O     . VAL B 1 205 ? -22.123 -31.570 -19.311 1.00 55.05  ? 281 VAL B O     1 
ATOM   3685 C  CB    . VAL B 1 205 ? -19.817 -32.575 -17.345 1.00 62.02  ? 281 VAL B CB    1 
ATOM   3686 C  CG1   . VAL B 1 205 ? -19.103 -32.006 -18.560 1.00 55.78  ? 281 VAL B CG1   1 
ATOM   3687 C  CG2   . VAL B 1 205 ? -18.954 -32.471 -16.106 1.00 55.03  ? 281 VAL B CG2   1 
ATOM   3688 N  N     . ASP B 1 206 ? -21.347 -29.741 -18.246 1.00 54.03  ? 282 ASP B N     1 
ATOM   3689 C  CA    . ASP B 1 206 ? -21.565 -28.836 -19.369 1.00 46.78  ? 282 ASP B CA    1 
ATOM   3690 C  C     . ASP B 1 206 ? -20.209 -28.545 -20.003 1.00 55.00  ? 282 ASP B C     1 
ATOM   3691 O  O     . ASP B 1 206 ? -19.393 -27.818 -19.427 1.00 58.47  ? 282 ASP B O     1 
ATOM   3692 C  CB    . ASP B 1 206 ? -22.223 -27.535 -18.877 1.00 49.19  ? 282 ASP B CB    1 
ATOM   3693 C  CG    . ASP B 1 206 ? -22.514 -26.536 -19.999 1.00 51.53  ? 282 ASP B CG    1 
ATOM   3694 O  OD1   . ASP B 1 206 ? -22.115 -26.745 -21.166 1.00 57.71  ? 282 ASP B OD1   1 
ATOM   3695 O  OD2   . ASP B 1 206 ? -23.147 -25.509 -19.700 1.00 52.57  ? 282 ASP B OD2   1 
ATOM   3696 N  N     . ARG B 1 207 ? -19.963 -29.105 -21.185 1.00 51.92  ? 283 ARG B N     1 
ATOM   3697 C  CA    . ARG B 1 207 ? -18.702 -28.848 -21.886 1.00 56.25  ? 283 ARG B CA    1 
ATOM   3698 C  C     . ARG B 1 207 ? -18.788 -27.689 -22.864 1.00 58.26  ? 283 ARG B C     1 
ATOM   3699 O  O     . ARG B 1 207 ? -17.769 -27.117 -23.235 1.00 58.11  ? 283 ARG B O     1 
ATOM   3700 C  CB    . ARG B 1 207 ? -18.194 -30.099 -22.612 1.00 57.23  ? 283 ARG B CB    1 
ATOM   3701 C  CG    . ARG B 1 207 ? -17.614 -31.137 -21.680 1.00 62.49  ? 283 ARG B CG    1 
ATOM   3702 C  CD    . ARG B 1 207 ? -16.948 -32.273 -22.430 1.00 67.26  ? 283 ARG B CD    1 
ATOM   3703 N  NE    . ARG B 1 207 ? -16.342 -33.231 -21.510 1.00 61.65  ? 283 ARG B NE    1 
ATOM   3704 C  CZ    . ARG B 1 207 ? -17.005 -34.237 -20.950 1.00 66.68  ? 283 ARG B CZ    1 
ATOM   3705 N  NH1   . ARG B 1 207 ? -18.296 -34.411 -21.223 1.00 62.76  ? 283 ARG B NH1   1 
ATOM   3706 N  NH2   . ARG B 1 207 ? -16.378 -35.071 -20.127 1.00 65.83  ? 283 ARG B NH2   1 
ATOM   3707 N  N     . GLU B 1 208 ? -19.999 -27.343 -23.283 1.00 60.54  ? 284 GLU B N     1 
ATOM   3708 C  CA    . GLU B 1 208 ? -20.166 -26.310 -24.301 1.00 65.39  ? 284 GLU B CA    1 
ATOM   3709 C  C     . GLU B 1 208 ? -20.084 -24.888 -23.743 1.00 60.77  ? 284 GLU B C     1 
ATOM   3710 O  O     . GLU B 1 208 ? -19.189 -24.120 -24.092 1.00 65.14  ? 284 GLU B O     1 
ATOM   3711 C  CB    . GLU B 1 208 ? -21.487 -26.498 -25.059 1.00 63.37  ? 284 GLU B CB    1 
ATOM   3712 C  CG    . GLU B 1 208 ? -21.670 -27.885 -25.675 1.00 75.38  ? 284 GLU B CG    1 
ATOM   3713 C  CD    . GLU B 1 208 ? -20.560 -28.265 -26.652 1.00 81.43  ? 284 GLU B CD    1 
ATOM   3714 O  OE1   . GLU B 1 208 ? -20.256 -29.474 -26.755 1.00 81.93  ? 284 GLU B OE1   1 
ATOM   3715 O  OE2   . GLU B 1 208 ? -20.001 -27.362 -27.317 1.00 82.00  ? 284 GLU B OE2   1 
ATOM   3716 N  N     . GLY B 1 209 ? -21.022 -24.539 -22.875 1.00 52.90  ? 285 GLY B N     1 
ATOM   3717 C  CA    . GLY B 1 209 ? -21.201 -23.150 -22.514 1.00 55.14  ? 285 GLY B CA    1 
ATOM   3718 C  C     . GLY B 1 209 ? -20.519 -22.691 -21.246 1.00 47.49  ? 285 GLY B C     1 
ATOM   3719 O  O     . GLY B 1 209 ? -19.843 -23.457 -20.555 1.00 47.29  ? 285 GLY B O     1 
ATOM   3720 N  N     . GLY B 1 210 ? -20.713 -21.415 -20.941 1.00 46.57  ? 286 GLY B N     1 
ATOM   3721 C  CA    . GLY B 1 210 ? -20.199 -20.844 -19.716 1.00 40.07  ? 286 GLY B CA    1 
ATOM   3722 C  C     . GLY B 1 210 ? -19.996 -19.352 -19.845 1.00 37.07  ? 286 GLY B C     1 
ATOM   3723 O  O     . GLY B 1 210 ? -20.883 -18.624 -20.284 1.00 39.19  ? 286 GLY B O     1 
ATOM   3724 N  N     . LEU B 1 211 ? -18.812 -18.904 -19.460 1.00 33.04  ? 287 LEU B N     1 
ATOM   3725 C  CA    . LEU B 1 211 ? -18.493 -17.481 -19.421 1.00 37.88  ? 287 LEU B CA    1 
ATOM   3726 C  C     . LEU B 1 211 ? -18.582 -16.835 -20.812 1.00 40.50  ? 287 LEU B C     1 
ATOM   3727 O  O     . LEU B 1 211 ? -19.018 -15.700 -20.937 1.00 41.01  ? 287 LEU B O     1 
ATOM   3728 C  CB    . LEU B 1 211 ? -17.100 -17.304 -18.826 1.00 33.13  ? 287 LEU B CB    1 
ATOM   3729 C  CG    . LEU B 1 211 ? -16.541 -15.915 -18.594 1.00 40.44  ? 287 LEU B CG    1 
ATOM   3730 C  CD1   . LEU B 1 211 ? -17.499 -15.028 -17.786 1.00 31.28  ? 287 LEU B CD1   1 
ATOM   3731 C  CD2   . LEU B 1 211 ? -15.212 -16.088 -17.880 1.00 38.63  ? 287 LEU B CD2   1 
ATOM   3732 N  N     . ASN B 1 212 ? -18.216 -17.587 -21.849 1.00 40.15  ? 288 ASN B N     1 
ATOM   3733 C  CA    . ASN B 1 212 ? -18.196 -17.077 -23.222 1.00 43.82  ? 288 ASN B CA    1 
ATOM   3734 C  C     . ASN B 1 212 ? -19.472 -17.368 -23.996 1.00 41.59  ? 288 ASN B C     1 
ATOM   3735 O  O     . ASN B 1 212 ? -19.506 -17.276 -25.218 1.00 50.82  ? 288 ASN B O     1 
ATOM   3736 C  CB    . ASN B 1 212 ? -16.990 -17.647 -23.990 1.00 46.12  ? 288 ASN B CB    1 
ATOM   3737 C  CG    . ASN B 1 212 ? -16.975 -19.178 -24.016 1.00 44.32  ? 288 ASN B CG    1 
ATOM   3738 O  OD1   . ASN B 1 212 ? -17.953 -19.844 -23.646 1.00 47.20  ? 288 ASN B OD1   1 
ATOM   3739 N  ND2   . ASN B 1 212 ? -15.861 -19.735 -24.448 1.00 41.16  ? 288 ASN B ND2   1 
ATOM   3740 N  N     . THR B 1 213 ? -20.524 -17.700 -23.272 1.00 43.32  ? 289 THR B N     1 
ATOM   3741 C  CA    . THR B 1 213 ? -21.748 -18.196 -23.873 1.00 40.06  ? 289 THR B CA    1 
ATOM   3742 C  C     . THR B 1 213 ? -22.942 -17.480 -23.247 1.00 42.72  ? 289 THR B C     1 
ATOM   3743 O  O     . THR B 1 213 ? -24.005 -17.360 -23.860 1.00 43.57  ? 289 THR B O     1 
ATOM   3744 C  CB    . THR B 1 213 ? -21.817 -19.726 -23.667 1.00 42.16  ? 289 THR B CB    1 
ATOM   3745 O  OG1   . THR B 1 213 ? -21.221 -20.372 -24.803 1.00 50.63  ? 289 THR B OG1   1 
ATOM   3746 C  CG2   . THR B 1 213 ? -23.231 -20.224 -23.461 1.00 40.29  ? 289 THR B CG2   1 
ATOM   3747 N  N     . VAL B 1 214 ? -22.745 -16.972 -22.034 1.00 39.60  ? 290 VAL B N     1 
ATOM   3748 C  CA    . VAL B 1 214 ? -23.832 -16.352 -21.293 1.00 43.45  ? 290 VAL B CA    1 
ATOM   3749 C  C     . VAL B 1 214 ? -24.455 -15.176 -22.050 1.00 39.94  ? 290 VAL B C     1 
ATOM   3750 O  O     . VAL B 1 214 ? -23.779 -14.228 -22.435 1.00 38.66  ? 290 VAL B O     1 
ATOM   3751 C  CB    . VAL B 1 214 ? -23.424 -15.964 -19.848 1.00 38.22  ? 290 VAL B CB    1 
ATOM   3752 C  CG1   . VAL B 1 214 ? -22.324 -14.908 -19.841 1.00 36.88  ? 290 VAL B CG1   1 
ATOM   3753 C  CG2   . VAL B 1 214 ? -24.649 -15.518 -19.050 1.00 37.05  ? 290 VAL B CG2   1 
ATOM   3754 N  N     . LYS B 1 215 ? -25.755 -15.299 -22.286 1.00 40.13  ? 291 LYS B N     1 
ATOM   3755 C  CA    . LYS B 1 215 ? -26.539 -14.357 -23.050 1.00 32.77  ? 291 LYS B CA    1 
ATOM   3756 C  C     . LYS B 1 215 ? -27.421 -13.572 -22.079 1.00 47.31  ? 291 LYS B C     1 
ATOM   3757 O  O     . LYS B 1 215 ? -28.186 -14.171 -21.326 1.00 44.71  ? 291 LYS B O     1 
ATOM   3758 C  CB    . LYS B 1 215 ? -27.421 -15.146 -24.015 1.00 51.73  ? 291 LYS B CB    1 
ATOM   3759 C  CG    . LYS B 1 215 ? -27.497 -14.592 -25.429 1.00 59.11  ? 291 LYS B CG    1 
ATOM   3760 C  CD    . LYS B 1 215 ? -28.759 -15.093 -26.113 1.00 66.62  ? 291 LYS B CD    1 
ATOM   3761 C  CE    . LYS B 1 215 ? -29.109 -14.274 -27.347 1.00 71.59  ? 291 LYS B CE    1 
ATOM   3762 N  NZ    . LYS B 1 215 ? -30.492 -14.595 -27.829 1.00 71.09  ? 291 LYS B NZ    1 
ATOM   3763 N  N     . TYR B 1 216 ? -27.325 -12.243 -22.107 1.00 39.33  ? 292 TYR B N     1 
ATOM   3764 C  CA    . TYR B 1 216 ? -28.012 -11.397 -21.141 1.00 42.73  ? 292 TYR B CA    1 
ATOM   3765 C  C     . TYR B 1 216 ? -27.984 -9.949  -21.608 1.00 41.44  ? 292 TYR B C     1 
ATOM   3766 O  O     . TYR B 1 216 ? -27.298 -9.616  -22.560 1.00 37.60  ? 292 TYR B O     1 
ATOM   3767 C  CB    . TYR B 1 216 ? -27.295 -11.489 -19.789 1.00 41.54  ? 292 TYR B CB    1 
ATOM   3768 C  CG    . TYR B 1 216 ? -25.951 -10.780 -19.783 1.00 41.88  ? 292 TYR B CG    1 
ATOM   3769 C  CD1   . TYR B 1 216 ? -24.803 -11.392 -20.288 1.00 36.89  ? 292 TYR B CD1   1 
ATOM   3770 C  CD2   . TYR B 1 216 ? -25.835 -9.482  -19.290 1.00 43.28  ? 292 TYR B CD2   1 
ATOM   3771 C  CE1   . TYR B 1 216 ? -23.574 -10.730 -20.284 1.00 30.73  ? 292 TYR B CE1   1 
ATOM   3772 C  CE2   . TYR B 1 216 ? -24.623 -8.813  -19.292 1.00 39.76  ? 292 TYR B CE2   1 
ATOM   3773 C  CZ    . TYR B 1 216 ? -23.501 -9.436  -19.781 1.00 37.25  ? 292 TYR B CZ    1 
ATOM   3774 O  OH    . TYR B 1 216 ? -22.316 -8.737  -19.752 1.00 39.19  ? 292 TYR B OH    1 
ATOM   3775 N  N     . HIS B 1 217 ? -28.715 -9.071  -20.936 1.00 45.24  ? 293 HIS B N     1 
ATOM   3776 C  CA    . HIS B 1 217 ? -28.381 -7.643  -21.023 1.00 50.01  ? 293 HIS B CA    1 
ATOM   3777 C  C     . HIS B 1 217 ? -28.599 -6.963  -19.678 1.00 48.12  ? 293 HIS B C     1 
ATOM   3778 O  O     . HIS B 1 217 ? -29.387 -7.445  -18.851 1.00 45.66  ? 293 HIS B O     1 
ATOM   3779 C  CB    . HIS B 1 217 ? -29.140 -6.927  -22.144 1.00 51.77  ? 293 HIS B CB    1 
ATOM   3780 C  CG    . HIS B 1 217 ? -30.572 -6.642  -21.824 1.00 57.33  ? 293 HIS B CG    1 
ATOM   3781 N  ND1   . HIS B 1 217 ? -31.000 -5.415  -21.362 1.00 58.40  ? 293 HIS B ND1   1 
ATOM   3782 C  CD2   . HIS B 1 217 ? -31.677 -7.423  -21.911 1.00 53.03  ? 293 HIS B CD2   1 
ATOM   3783 C  CE1   . HIS B 1 217 ? -32.308 -5.454  -21.169 1.00 61.88  ? 293 HIS B CE1   1 
ATOM   3784 N  NE2   . HIS B 1 217 ? -32.741 -6.662  -21.491 1.00 56.22  ? 293 HIS B NE2   1 
ATOM   3785 N  N     . VAL B 1 218 ? -27.878 -5.880  -19.419 1.00 40.73  ? 294 VAL B N     1 
ATOM   3786 C  CA    . VAL B 1 218 ? -28.142 -5.185  -18.174 1.00 42.32  ? 294 VAL B CA    1 
ATOM   3787 C  C     . VAL B 1 218 ? -29.077 -4.009  -18.403 1.00 46.39  ? 294 VAL B C     1 
ATOM   3788 O  O     . VAL B 1 218 ? -28.780 -3.089  -19.161 1.00 49.03  ? 294 VAL B O     1 
ATOM   3789 C  CB    . VAL B 1 218 ? -26.871 -4.882  -17.313 1.00 42.95  ? 294 VAL B CB    1 
ATOM   3790 C  CG1   . VAL B 1 218 ? -25.601 -5.203  -18.054 1.00 36.92  ? 294 VAL B CG1   1 
ATOM   3791 C  CG2   . VAL B 1 218 ? -26.897 -3.472  -16.737 1.00 32.77  ? 294 VAL B CG2   1 
ATOM   3792 N  N     . ALA B 1 219 ? -30.243 -4.101  -17.777 1.00 40.35  ? 295 ALA B N     1 
ATOM   3793 C  CA    . ALA B 1 219 ? -31.321 -3.153  -17.994 1.00 47.25  ? 295 ALA B CA    1 
ATOM   3794 C  C     . ALA B 1 219 ? -31.111 -1.843  -17.240 1.00 43.56  ? 295 ALA B C     1 
ATOM   3795 O  O     . ALA B 1 219 ? -31.633 -0.820  -17.653 1.00 40.73  ? 295 ALA B O     1 
ATOM   3796 C  CB    . ALA B 1 219 ? -32.658 -3.780  -17.620 1.00 44.78  ? 295 ALA B CB    1 
ATOM   3797 N  N     . SER B 1 220 ? -30.369 -1.885  -16.133 1.00 41.35  ? 296 SER B N     1 
ATOM   3798 C  CA    . SER B 1 220 ? -29.993 -0.673  -15.389 1.00 43.38  ? 296 SER B CA    1 
ATOM   3799 C  C     . SER B 1 220 ? -28.806 -0.929  -14.484 1.00 42.40  ? 296 SER B C     1 
ATOM   3800 O  O     . SER B 1 220 ? -28.533 -2.070  -14.076 1.00 35.22  ? 296 SER B O     1 
ATOM   3801 C  CB    . SER B 1 220 ? -31.113 -0.169  -14.461 1.00 38.73  ? 296 SER B CB    1 
ATOM   3802 O  OG    . SER B 1 220 ? -32.401 -0.568  -14.874 1.00 55.09  ? 296 SER B OG    1 
ATOM   3803 N  N     . ARG B 1 221 ? -28.119 0.158   -14.164 1.00 34.46  ? 297 ARG B N     1 
ATOM   3804 C  CA    A ARG B 1 221 ? -27.106 0.149   -13.128 0.47 39.70  ? 297 ARG B CA    1 
ATOM   3805 C  CA    B ARG B 1 221 ? -27.093 0.159   -13.128 0.53 39.70  ? 297 ARG B CA    1 
ATOM   3806 C  C     . ARG B 1 221 ? -27.492 1.259   -12.165 1.00 42.61  ? 297 ARG B C     1 
ATOM   3807 O  O     . ARG B 1 221 ? -27.748 2.376   -12.578 1.00 43.33  ? 297 ARG B O     1 
ATOM   3808 C  CB    A ARG B 1 221 ? -25.720 0.391   -13.737 0.47 37.03  ? 297 ARG B CB    1 
ATOM   3809 C  CB    B ARG B 1 221 ? -25.693 0.460   -13.697 0.53 37.02  ? 297 ARG B CB    1 
ATOM   3810 C  CG    A ARG B 1 221 ? -25.443 -0.504  -14.936 0.47 39.81  ? 297 ARG B CG    1 
ATOM   3811 C  CG    B ARG B 1 221 ? -25.107 -0.615  -14.600 0.53 39.98  ? 297 ARG B CG    1 
ATOM   3812 C  CD    A ARG B 1 221 ? -24.346 0.025   -15.856 0.47 43.75  ? 297 ARG B CD    1 
ATOM   3813 C  CD    B ARG B 1 221 ? -23.739 -0.224  -15.191 0.53 44.04  ? 297 ARG B CD    1 
ATOM   3814 N  NE    A ARG B 1 221 ? -24.389 -0.648  -17.153 0.47 37.46  ? 297 ARG B NE    1 
ATOM   3815 N  NE    B ARG B 1 221 ? -22.596 -0.475  -14.310 0.53 36.92  ? 297 ARG B NE    1 
ATOM   3816 C  CZ    A ARG B 1 221 ? -23.809 -1.814  -17.405 0.47 35.92  ? 297 ARG B CZ    1 
ATOM   3817 C  CZ    B ARG B 1 221 ? -21.695 -1.435  -14.508 0.53 36.15  ? 297 ARG B CZ    1 
ATOM   3818 N  NH1   A ARG B 1 221 ? -23.904 -2.355  -18.610 0.47 34.15  ? 297 ARG B NH1   1 
ATOM   3819 N  NH1   B ARG B 1 221 ? -20.683 -1.583  -13.665 0.53 36.07  ? 297 ARG B NH1   1 
ATOM   3820 N  NH2   A ARG B 1 221 ? -23.128 -2.435  -16.453 0.47 34.79  ? 297 ARG B NH2   1 
ATOM   3821 N  NH2   B ARG B 1 221 ? -21.798 -2.249  -15.552 0.53 35.23  ? 297 ARG B NH2   1 
ATOM   3822 N  N     . THR B 1 222 ? -27.587 0.952   -10.882 1.00 43.34  ? 298 THR B N     1 
ATOM   3823 C  CA    . THR B 1 222 ? -27.826 2.030   -9.939  1.00 39.55  ? 298 THR B CA    1 
ATOM   3824 C  C     . THR B 1 222 ? -26.898 1.924   -8.751  1.00 41.03  ? 298 THR B C     1 
ATOM   3825 O  O     . THR B 1 222 ? -26.695 0.839   -8.196  1.00 42.64  ? 298 THR B O     1 
ATOM   3826 C  CB    . THR B 1 222 ? -29.328 2.200   -9.522  1.00 51.60  ? 298 THR B CB    1 
ATOM   3827 O  OG1   . THR B 1 222 ? -29.442 2.386   -8.107  1.00 48.74  ? 298 THR B OG1   1 
ATOM   3828 C  CG2   . THR B 1 222 ? -30.142 1.036   -9.910  1.00 36.89  ? 298 THR B CG2   1 
ATOM   3829 N  N     . ALA B 1 223 ? -26.310 3.061   -8.396  1.00 38.42  ? 299 ALA B N     1 
ATOM   3830 C  CA    . ALA B 1 223 ? -25.439 3.151   -7.244  1.00 37.14  ? 299 ALA B CA    1 
ATOM   3831 C  C     . ALA B 1 223 ? -26.340 3.030   -6.030  1.00 46.33  ? 299 ALA B C     1 
ATOM   3832 O  O     . ALA B 1 223 ? -27.503 3.419   -6.076  1.00 49.98  ? 299 ALA B O     1 
ATOM   3833 C  CB    . ALA B 1 223 ? -24.704 4.483   -7.249  1.00 40.16  ? 299 ALA B CB    1 
ATOM   3834 N  N     . LEU B 1 224 ? -25.836 2.455   -4.952  1.00 46.42  ? 300 LEU B N     1 
ATOM   3835 C  CA    . LEU B 1 224 ? -26.687 2.220   -3.805  1.00 44.79  ? 300 LEU B CA    1 
ATOM   3836 C  C     . LEU B 1 224 ? -25.845 2.235   -2.548  1.00 51.28  ? 300 LEU B C     1 
ATOM   3837 O  O     . LEU B 1 224 ? -24.900 1.451   -2.417  1.00 51.38  ? 300 LEU B O     1 
ATOM   3838 C  CB    . LEU B 1 224 ? -27.407 0.873   -3.950  1.00 46.27  ? 300 LEU B CB    1 
ATOM   3839 C  CG    . LEU B 1 224 ? -28.400 0.406   -2.891  1.00 40.40  ? 300 LEU B CG    1 
ATOM   3840 C  CD1   . LEU B 1 224 ? -29.659 1.244   -2.941  1.00 53.07  ? 300 LEU B CD1   1 
ATOM   3841 C  CD2   . LEU B 1 224 ? -28.755 -1.065  -3.066  1.00 39.87  ? 300 LEU B CD2   1 
ATOM   3842 N  N     . SER B 1 225 ? -26.180 3.140   -1.633  1.00 38.40  ? 301 SER B N     1 
ATOM   3843 C  CA    . SER B 1 225 ? -25.526 3.170   -0.333  1.00 45.08  ? 301 SER B CA    1 
ATOM   3844 C  C     . SER B 1 225 ? -26.416 2.529   0.734   1.00 41.44  ? 301 SER B C     1 
ATOM   3845 O  O     . SER B 1 225 ? -27.626 2.717   0.752   1.00 43.05  ? 301 SER B O     1 
ATOM   3846 C  CB    . SER B 1 225 ? -25.132 4.596   0.048   1.00 40.25  ? 301 SER B CB    1 
ATOM   3847 O  OG    . SER B 1 225 ? -23.796 4.843   -0.342  1.00 55.58  ? 301 SER B OG    1 
ATOM   3848 N  N     . VAL B 1 226 ? -25.805 1.743   1.605   1.00 43.91  ? 302 VAL B N     1 
ATOM   3849 C  CA    . VAL B 1 226 ? -26.547 0.939   2.561   1.00 43.63  ? 302 VAL B CA    1 
ATOM   3850 C  C     . VAL B 1 226 ? -25.828 1.049   3.894   1.00 48.80  ? 302 VAL B C     1 
ATOM   3851 O  O     . VAL B 1 226 ? -24.766 0.462   4.083   1.00 51.18  ? 302 VAL B O     1 
ATOM   3852 C  CB    . VAL B 1 226 ? -26.623 -0.531  2.096   1.00 44.79  ? 302 VAL B CB    1 
ATOM   3853 C  CG1   . VAL B 1 226 ? -27.458 -1.351  3.050   1.00 46.71  ? 302 VAL B CG1   1 
ATOM   3854 C  CG2   . VAL B 1 226 ? -27.200 -0.617  0.676   1.00 41.18  ? 302 VAL B CG2   1 
ATOM   3855 N  N     . GLY B 1 227 ? -26.383 1.846   4.801   1.00 49.94  ? 303 GLY B N     1 
ATOM   3856 C  CA    . GLY B 1 227 ? -25.704 2.161   6.042   1.00 47.38  ? 303 GLY B CA    1 
ATOM   3857 C  C     . GLY B 1 227 ? -24.389 2.871   5.791   1.00 51.50  ? 303 GLY B C     1 
ATOM   3858 O  O     . GLY B 1 227 ? -23.455 2.747   6.579   1.00 59.18  ? 303 GLY B O     1 
ATOM   3859 N  N     . GLY B 1 228 ? -24.314 3.612   4.687   1.00 46.36  ? 304 GLY B N     1 
ATOM   3860 C  CA    . GLY B 1 228 ? -23.086 4.282   4.294   1.00 41.36  ? 304 GLY B CA    1 
ATOM   3861 C  C     . GLY B 1 228 ? -22.115 3.417   3.505   1.00 46.76  ? 304 GLY B C     1 
ATOM   3862 O  O     . GLY B 1 228 ? -21.098 3.907   3.013   1.00 51.66  ? 304 GLY B O     1 
ATOM   3863 N  N     . ALA B 1 229 ? -22.413 2.128   3.389   1.00 45.98  ? 305 ALA B N     1 
ATOM   3864 C  CA    . ALA B 1 229 ? -21.591 1.227   2.581   1.00 46.60  ? 305 ALA B CA    1 
ATOM   3865 C  C     . ALA B 1 229 ? -22.069 1.229   1.129   1.00 40.83  ? 305 ALA B C     1 
ATOM   3866 O  O     . ALA B 1 229 ? -23.248 1.040   0.860   1.00 47.31  ? 305 ALA B O     1 
ATOM   3867 C  CB    . ALA B 1 229 ? -21.631 -0.180  3.163   1.00 48.25  ? 305 ALA B CB    1 
ATOM   3868 N  N     . PRO B 1 230 ? -21.158 1.462   0.180   1.00 43.34  ? 306 PRO B N     1 
ATOM   3869 C  CA    . PRO B 1 230 ? -21.595 1.569   -1.217  1.00 45.34  ? 306 PRO B CA    1 
ATOM   3870 C  C     . PRO B 1 230 ? -21.645 0.213   -1.919  1.00 51.02  ? 306 PRO B C     1 
ATOM   3871 O  O     . PRO B 1 230 ? -20.917 -0.710  -1.544  1.00 45.26  ? 306 PRO B O     1 
ATOM   3872 C  CB    . PRO B 1 230 ? -20.495 2.417   -1.847  1.00 42.09  ? 306 PRO B CB    1 
ATOM   3873 C  CG    . PRO B 1 230 ? -19.258 2.000   -1.087  1.00 46.26  ? 306 PRO B CG    1 
ATOM   3874 C  CD    . PRO B 1 230 ? -19.721 1.742   0.335   1.00 47.02  ? 306 PRO B CD    1 
ATOM   3875 N  N     . CYS B 1 231 ? -22.498 0.104   -2.931  1.00 40.24  ? 307 CYS B N     1 
ATOM   3876 C  CA    . CYS B 1 231 ? -22.544 -1.082  -3.757  1.00 38.57  ? 307 CYS B CA    1 
ATOM   3877 C  C     . CYS B 1 231 ? -23.147 -0.702  -5.088  1.00 37.36  ? 307 CYS B C     1 
ATOM   3878 O  O     . CYS B 1 231 ? -23.756 0.348   -5.221  1.00 39.81  ? 307 CYS B O     1 
ATOM   3879 C  CB    . CYS B 1 231 ? -23.363 -2.196  -3.086  1.00 42.20  ? 307 CYS B CB    1 
ATOM   3880 S  SG    . CYS B 1 231 ? -25.172 -2.033  -3.214  1.00 46.61  ? 307 CYS B SG    1 
ATOM   3881 N  N     . THR B 1 232 ? -22.968 -1.556  -6.082  1.00 38.18  ? 308 THR B N     1 
ATOM   3882 C  CA    . THR B 1 232 ? -23.539 -1.311  -7.389  1.00 37.17  ? 308 THR B CA    1 
ATOM   3883 C  C     . THR B 1 232 ? -24.594 -2.365  -7.665  1.00 38.02  ? 308 THR B C     1 
ATOM   3884 O  O     . THR B 1 232 ? -24.310 -3.562  -7.626  1.00 43.22  ? 308 THR B O     1 
ATOM   3885 C  CB    . THR B 1 232 ? -22.462 -1.395  -8.486  1.00 39.59  ? 308 THR B CB    1 
ATOM   3886 O  OG1   . THR B 1 232 ? -21.417 -0.460  -8.202  1.00 45.73  ? 308 THR B OG1   1 
ATOM   3887 C  CG2   . THR B 1 232 ? -23.062 -1.112  -9.855  1.00 30.47  ? 308 THR B CG2   1 
ATOM   3888 N  N     . VAL B 1 233 ? -25.812 -1.927  -7.948  1.00 40.27  ? 309 VAL B N     1 
ATOM   3889 C  CA    . VAL B 1 233 ? -26.862 -2.851  -8.327  1.00 36.55  ? 309 VAL B CA    1 
ATOM   3890 C  C     . VAL B 1 233 ? -26.995 -2.930  -9.847  1.00 42.44  ? 309 VAL B C     1 
ATOM   3891 O  O     . VAL B 1 233 ? -27.278 -1.924  -10.510 1.00 40.01  ? 309 VAL B O     1 
ATOM   3892 C  CB    . VAL B 1 233 ? -28.201 -2.491  -7.678  1.00 35.86  ? 309 VAL B CB    1 
ATOM   3893 C  CG1   . VAL B 1 233 ? -29.293 -3.458  -8.127  1.00 35.18  ? 309 VAL B CG1   1 
ATOM   3894 C  CG2   . VAL B 1 233 ? -28.062 -2.533  -6.170  1.00 33.61  ? 309 VAL B CG2   1 
ATOM   3895 N  N     . LEU B 1 234 ? -26.784 -4.136  -10.382 1.00 36.61  ? 310 LEU B N     1 
ATOM   3896 C  CA    . LEU B 1 234 ? -26.957 -4.411  -11.805 1.00 33.16  ? 310 LEU B CA    1 
ATOM   3897 C  C     . LEU B 1 234 ? -28.278 -5.124  -12.012 1.00 36.05  ? 310 LEU B C     1 
ATOM   3898 O  O     . LEU B 1 234 ? -28.504 -6.182  -11.434 1.00 38.27  ? 310 LEU B O     1 
ATOM   3899 C  CB    . LEU B 1 234 ? -25.822 -5.307  -12.319 1.00 36.52  ? 310 LEU B CB    1 
ATOM   3900 C  CG    . LEU B 1 234 ? -24.387 -4.787  -12.191 1.00 39.53  ? 310 LEU B CG    1 
ATOM   3901 C  CD1   . LEU B 1 234 ? -23.405 -5.805  -12.720 1.00 37.59  ? 310 LEU B CD1   1 
ATOM   3902 C  CD2   . LEU B 1 234 ? -24.221 -3.476  -12.951 1.00 32.60  ? 310 LEU B CD2   1 
ATOM   3903 N  N     . ASN B 1 235 ? -29.168 -4.550  -12.810 1.00 36.30  ? 311 ASN B N     1 
ATOM   3904 C  CA    . ASN B 1 235 ? -30.420 -5.226  -13.092 1.00 32.90  ? 311 ASN B CA    1 
ATOM   3905 C  C     . ASN B 1 235 ? -30.238 -6.089  -14.323 1.00 40.78  ? 311 ASN B C     1 
ATOM   3906 O  O     . ASN B 1 235 ? -30.177 -5.585  -15.446 1.00 41.47  ? 311 ASN B O     1 
ATOM   3907 C  CB    . ASN B 1 235 ? -31.583 -4.240  -13.230 1.00 31.04  ? 311 ASN B CB    1 
ATOM   3908 C  CG    . ASN B 1 235 ? -32.135 -3.789  -11.865 1.00 40.77  ? 311 ASN B CG    1 
ATOM   3909 O  OD1   . ASN B 1 235 ? -31.461 -3.924  -10.832 1.00 38.27  ? 311 ASN B OD1   1 
ATOM   3910 N  ND2   . ASN B 1 235 ? -33.362 -3.253  -11.860 1.00 31.51  ? 311 ASN B ND2   1 
ATOM   3911 N  N     . ILE B 1 236 ? -30.114 -7.398  -14.101 1.00 40.38  ? 312 ILE B N     1 
ATOM   3912 C  CA    . ILE B 1 236 ? -29.674 -8.299  -15.159 1.00 32.31  ? 312 ILE B CA    1 
ATOM   3913 C  C     . ILE B 1 236 ? -30.825 -9.072  -15.769 1.00 37.40  ? 312 ILE B C     1 
ATOM   3914 O  O     . ILE B 1 236 ? -31.596 -9.734  -15.079 1.00 39.53  ? 312 ILE B O     1 
ATOM   3915 C  CB    . ILE B 1 236 ? -28.595 -9.268  -14.663 1.00 31.82  ? 312 ILE B CB    1 
ATOM   3916 C  CG1   . ILE B 1 236 ? -27.382 -8.493  -14.159 1.00 28.21  ? 312 ILE B CG1   1 
ATOM   3917 C  CG2   . ILE B 1 236 ? -28.196 -10.260 -15.775 1.00 32.45  ? 312 ILE B CG2   1 
ATOM   3918 C  CD1   . ILE B 1 236 ? -26.496 -9.292  -13.236 1.00 30.15  ? 312 ILE B CD1   1 
ATOM   3919 N  N     . MET B 1 237 ? -30.939 -8.968  -17.080 1.00 39.85  ? 313 MET B N     1 
ATOM   3920 C  CA    . MET B 1 237 ? -31.988 -9.645  -17.803 1.00 40.99  ? 313 MET B CA    1 
ATOM   3921 C  C     . MET B 1 237 ? -31.392 -10.892 -18.477 1.00 45.56  ? 313 MET B C     1 
ATOM   3922 O  O     . MET B 1 237 ? -30.825 -10.798 -19.573 1.00 45.20  ? 313 MET B O     1 
ATOM   3923 C  CB    . MET B 1 237 ? -32.546 -8.680  -18.845 1.00 49.75  ? 313 MET B CB    1 
ATOM   3924 C  CG    . MET B 1 237 ? -33.926 -9.005  -19.332 1.00 57.56  ? 313 MET B CG    1 
ATOM   3925 S  SD    . MET B 1 237 ? -35.173 -8.522  -18.144 1.00 58.00  ? 313 MET B SD    1 
ATOM   3926 C  CE    . MET B 1 237 ? -36.658 -8.948  -19.048 1.00 49.68  ? 313 MET B CE    1 
ATOM   3927 N  N     . LEU B 1 238 ? -31.490 -12.053 -17.826 1.00 43.13  ? 314 LEU B N     1 
ATOM   3928 C  CA    . LEU B 1 238 ? -30.939 -13.277 -18.417 1.00 42.81  ? 314 LEU B CA    1 
ATOM   3929 C  C     . LEU B 1 238 ? -31.789 -13.742 -19.581 1.00 42.24  ? 314 LEU B C     1 
ATOM   3930 O  O     . LEU B 1 238 ? -33.014 -13.633 -19.561 1.00 46.07  ? 314 LEU B O     1 
ATOM   3931 C  CB    . LEU B 1 238 ? -30.815 -14.406 -17.397 1.00 39.81  ? 314 LEU B CB    1 
ATOM   3932 C  CG    . LEU B 1 238 ? -29.829 -14.157 -16.261 1.00 41.31  ? 314 LEU B CG    1 
ATOM   3933 C  CD1   . LEU B 1 238 ? -29.869 -15.295 -15.237 1.00 41.47  ? 314 LEU B CD1   1 
ATOM   3934 C  CD2   . LEU B 1 238 ? -28.439 -13.977 -16.821 1.00 30.69  ? 314 LEU B CD2   1 
ATOM   3935 N  N     . ASP B 1 239 ? -31.122 -14.239 -20.606 1.00 43.93  ? 315 ASP B N     1 
ATOM   3936 C  CA    . ASP B 1 239 ? -31.792 -14.831 -21.738 1.00 49.75  ? 315 ASP B CA    1 
ATOM   3937 C  C     . ASP B 1 239 ? -31.813 -16.339 -21.528 1.00 50.81  ? 315 ASP B C     1 
ATOM   3938 O  O     . ASP B 1 239 ? -30.912 -16.893 -20.876 1.00 48.61  ? 315 ASP B O     1 
ATOM   3939 C  CB    . ASP B 1 239 ? -31.021 -14.493 -23.002 1.00 55.41  ? 315 ASP B CB    1 
ATOM   3940 C  CG    . ASP B 1 239 ? -31.813 -14.769 -24.245 1.00 68.43  ? 315 ASP B CG    1 
ATOM   3941 O  OD1   . ASP B 1 239 ? -31.624 -15.858 -24.839 1.00 64.88  ? 315 ASP B OD1   1 
ATOM   3942 O  OD2   . ASP B 1 239 ? -32.625 -13.888 -24.619 1.00 71.29  ? 315 ASP B OD2   1 
ATOM   3943 N  N     . CYS B 1 240 ? -32.846 -17.008 -22.033 1.00 49.04  ? 316 CYS B N     1 
ATOM   3944 C  CA    . CYS B 1 240 ? -32.845 -18.473 -22.005 1.00 50.78  ? 316 CYS B CA    1 
ATOM   3945 C  C     . CYS B 1 240 ? -33.218 -19.129 -23.327 1.00 54.82  ? 316 CYS B C     1 
ATOM   3946 O  O     . CYS B 1 240 ? -34.196 -18.740 -23.965 1.00 58.24  ? 316 CYS B O     1 
ATOM   3947 C  CB    . CYS B 1 240 ? -33.786 -19.010 -20.924 1.00 45.17  ? 316 CYS B CB    1 
ATOM   3948 S  SG    . CYS B 1 240 ? -34.053 -20.771 -21.184 1.00 59.97  ? 316 CYS B SG    1 
ATOM   3949 N  N     . ASP B 1 241 ? -32.448 -20.142 -23.711 1.00 52.40  ? 317 ASP B N     1 
ATOM   3950 C  CA    . ASP B 1 241 ? -32.783 -20.961 -24.860 1.00 48.62  ? 317 ASP B CA    1 
ATOM   3951 C  C     . ASP B 1 241 ? -33.666 -22.091 -24.356 1.00 49.74  ? 317 ASP B C     1 
ATOM   3952 O  O     . ASP B 1 241 ? -33.175 -23.029 -23.733 1.00 50.36  ? 317 ASP B O     1 
ATOM   3953 C  CB    . ASP B 1 241 ? -31.511 -21.538 -25.482 1.00 45.01  ? 317 ASP B CB    1 
ATOM   3954 C  CG    . ASP B 1 241 ? -31.783 -22.393 -26.711 1.00 52.57  ? 317 ASP B CG    1 
ATOM   3955 O  OD1   . ASP B 1 241 ? -32.958 -22.644 -27.051 1.00 54.09  ? 317 ASP B OD1   1 
ATOM   3956 O  OD2   . ASP B 1 241 ? -30.799 -22.826 -27.336 1.00 52.33  ? 317 ASP B OD2   1 
ATOM   3957 N  N     . LYS B 1 242 ? -34.967 -22.002 -24.615 1.00 53.12  ? 318 LYS B N     1 
ATOM   3958 C  CA    . LYS B 1 242 ? -35.916 -22.976 -24.077 1.00 52.67  ? 318 LYS B CA    1 
ATOM   3959 C  C     . LYS B 1 242 ? -35.769 -24.368 -24.692 1.00 54.90  ? 318 LYS B C     1 
ATOM   3960 O  O     . LYS B 1 242 ? -36.179 -25.368 -24.093 1.00 58.35  ? 318 LYS B O     1 
ATOM   3961 C  CB    . LYS B 1 242 ? -37.350 -22.470 -24.224 1.00 47.81  ? 318 LYS B CB    1 
ATOM   3962 C  CG    . LYS B 1 242 ? -37.646 -21.271 -23.367 1.00 42.83  ? 318 LYS B CG    1 
ATOM   3963 C  CD    . LYS B 1 242 ? -39.127 -20.967 -23.364 1.00 57.75  ? 318 LYS B CD    1 
ATOM   3964 C  CE    . LYS B 1 242 ? -39.411 -19.615 -22.720 1.00 55.88  ? 318 LYS B CE    1 
ATOM   3965 N  NZ    . LYS B 1 242 ? -40.863 -19.445 -22.442 1.00 62.84  ? 318 LYS B NZ    1 
ATOM   3966 N  N     . THR B 1 243 ? -35.185 -24.430 -25.883 1.00 51.57  ? 319 THR B N     1 
ATOM   3967 C  CA    . THR B 1 243 ? -34.899 -25.702 -26.525 1.00 47.10  ? 319 THR B CA    1 
ATOM   3968 C  C     . THR B 1 243 ? -33.858 -26.483 -25.729 1.00 53.13  ? 319 THR B C     1 
ATOM   3969 O  O     . THR B 1 243 ? -34.045 -27.661 -25.422 1.00 60.01  ? 319 THR B O     1 
ATOM   3970 C  CB    . THR B 1 243 ? -34.374 -25.490 -27.958 1.00 60.67  ? 319 THR B CB    1 
ATOM   3971 O  OG1   . THR B 1 243 ? -35.402 -24.892 -28.752 1.00 56.87  ? 319 THR B OG1   1 
ATOM   3972 C  CG2   . THR B 1 243 ? -33.949 -26.814 -28.582 1.00 59.11  ? 319 THR B CG2   1 
ATOM   3973 N  N     . ALA B 1 244 ? -32.760 -25.818 -25.390 1.00 52.51  ? 320 ALA B N     1 
ATOM   3974 C  CA    . ALA B 1 244 ? -31.673 -26.463 -24.664 1.00 52.45  ? 320 ALA B CA    1 
ATOM   3975 C  C     . ALA B 1 244 ? -32.029 -26.740 -23.193 1.00 58.61  ? 320 ALA B C     1 
ATOM   3976 O  O     . ALA B 1 244 ? -31.832 -27.854 -22.688 1.00 50.52  ? 320 ALA B O     1 
ATOM   3977 C  CB    . ALA B 1 244 ? -30.406 -25.622 -24.768 1.00 47.53  ? 320 ALA B CB    1 
ATOM   3978 N  N     . THR B 1 245 ? -32.544 -25.728 -22.503 1.00 51.95  ? 321 THR B N     1 
ATOM   3979 C  CA    . THR B 1 245 ? -32.898 -25.885 -21.093 1.00 49.76  ? 321 THR B CA    1 
ATOM   3980 C  C     . THR B 1 245 ? -34.319 -25.410 -20.825 1.00 52.15  ? 321 THR B C     1 
ATOM   3981 O  O     . THR B 1 245 ? -34.524 -24.298 -20.342 1.00 50.16  ? 321 THR B O     1 
ATOM   3982 C  CB    . THR B 1 245 ? -31.938 -25.110 -20.170 1.00 50.27  ? 321 THR B CB    1 
ATOM   3983 O  OG1   . THR B 1 245 ? -32.124 -23.699 -20.357 1.00 47.58  ? 321 THR B OG1   1 
ATOM   3984 C  CG2   . THR B 1 245 ? -30.473 -25.482 -20.454 1.00 47.39  ? 321 THR B CG2   1 
ATOM   3985 N  N     . PRO B 1 246 ? -35.313 -26.258 -21.133 1.00 54.55  ? 322 PRO B N     1 
ATOM   3986 C  CA    . PRO B 1 246 ? -36.716 -25.866 -20.963 1.00 49.64  ? 322 PRO B CA    1 
ATOM   3987 C  C     . PRO B 1 246 ? -37.161 -25.719 -19.497 1.00 47.63  ? 322 PRO B C     1 
ATOM   3988 O  O     . PRO B 1 246 ? -38.246 -25.186 -19.270 1.00 49.49  ? 322 PRO B O     1 
ATOM   3989 C  CB    . PRO B 1 246 ? -37.480 -27.001 -21.655 1.00 46.20  ? 322 PRO B CB    1 
ATOM   3990 C  CG    . PRO B 1 246 ? -36.569 -28.167 -21.578 1.00 43.71  ? 322 PRO B CG    1 
ATOM   3991 C  CD    . PRO B 1 246 ? -35.183 -27.613 -21.698 1.00 51.56  ? 322 PRO B CD    1 
ATOM   3992 N  N     . TRP B 1 247 ? -36.348 -26.147 -18.530 1.00 41.37  ? 323 TRP B N     1 
ATOM   3993 C  CA    . TRP B 1 247 ? -36.718 -26.018 -17.109 1.00 50.45  ? 323 TRP B CA    1 
ATOM   3994 C  C     . TRP B 1 247 ? -36.475 -24.588 -16.587 1.00 52.29  ? 323 TRP B C     1 
ATOM   3995 O  O     . TRP B 1 247 ? -36.517 -24.306 -15.375 1.00 46.13  ? 323 TRP B O     1 
ATOM   3996 C  CB    . TRP B 1 247 ? -36.000 -27.063 -16.252 1.00 44.29  ? 323 TRP B CB    1 
ATOM   3997 C  CG    . TRP B 1 247 ? -34.523 -27.100 -16.475 1.00 50.08  ? 323 TRP B CG    1 
ATOM   3998 C  CD1   . TRP B 1 247 ? -33.572 -26.440 -15.756 1.00 46.78  ? 323 TRP B CD1   1 
ATOM   3999 C  CD2   . TRP B 1 247 ? -33.817 -27.837 -17.494 1.00 49.97  ? 323 TRP B CD2   1 
ATOM   4000 N  NE1   . TRP B 1 247 ? -32.323 -26.710 -16.264 1.00 46.56  ? 323 TRP B NE1   1 
ATOM   4001 C  CE2   . TRP B 1 247 ? -32.445 -27.567 -17.327 1.00 47.39  ? 323 TRP B CE2   1 
ATOM   4002 C  CE3   . TRP B 1 247 ? -34.216 -28.700 -18.523 1.00 49.43  ? 323 TRP B CE3   1 
ATOM   4003 C  CZ2   . TRP B 1 247 ? -31.467 -28.129 -18.155 1.00 43.71  ? 323 TRP B CZ2   1 
ATOM   4004 C  CZ3   . TRP B 1 247 ? -33.245 -29.255 -19.343 1.00 45.81  ? 323 TRP B CZ3   1 
ATOM   4005 C  CH2   . TRP B 1 247 ? -31.888 -28.969 -19.152 1.00 52.69  ? 323 TRP B CH2   1 
ATOM   4006 N  N     . CYS B 1 248 ? -36.195 -23.724 -17.557 1.00 51.33  ? 324 CYS B N     1 
ATOM   4007 C  CA    . CYS B 1 248 ? -36.194 -22.274 -17.470 1.00 49.49  ? 324 CYS B CA    1 
ATOM   4008 C  C     . CYS B 1 248 ? -37.294 -21.668 -16.662 1.00 50.45  ? 324 CYS B C     1 
ATOM   4009 O  O     . CYS B 1 248 ? -37.080 -20.817 -15.802 1.00 44.00  ? 324 CYS B O     1 
ATOM   4010 C  CB    . CYS B 1 248 ? -36.574 -21.775 -18.857 1.00 43.36  ? 324 CYS B CB    1 
ATOM   4011 S  SG    . CYS B 1 248 ? -35.332 -20.985 -19.643 1.00 51.68  ? 324 CYS B SG    1 
ATOM   4012 N  N     . THR B 1 249 ? -38.500 -22.061 -17.056 1.00 54.40  ? 325 THR B N     1 
ATOM   4013 C  CA    . THR B 1 249 ? -39.708 -21.331 -16.741 1.00 55.45  ? 325 THR B CA    1 
ATOM   4014 C  C     . THR B 1 249 ? -40.535 -21.942 -15.616 1.00 66.68  ? 325 THR B C     1 
ATOM   4015 O  O     . THR B 1 249 ? -40.050 -22.747 -14.816 1.00 70.98  ? 325 THR B O     1 
ATOM   4016 C  CB    . THR B 1 249 ? -40.585 -21.246 -17.971 1.00 49.94  ? 325 THR B CB    1 
ATOM   4017 O  OG1   . THR B 1 249 ? -40.621 -22.536 -18.586 1.00 64.56  ? 325 THR B OG1   1 
ATOM   4018 C  CG2   . THR B 1 249 ? -40.016 -20.259 -18.952 1.00 49.88  ? 325 THR B CG2   1 
ATOM   4019 N  N     . PHE B 1 250 ? -41.813 -21.586 -15.627 1.00 74.52  ? 326 PHE B N     1 
ATOM   4020 C  CA    . PHE B 1 250 ? -42.658 -21.566 -14.431 1.00 70.02  ? 326 PHE B CA    1 
ATOM   4021 C  C     . PHE B 1 250 ? -41.976 -21.575 -13.047 1.00 77.96  ? 326 PHE B C     1 
ATOM   4022 O  O     . PHE B 1 250 ? -41.839 -22.631 -12.413 1.00 76.29  ? 326 PHE B O     1 
ATOM   4023 C  CB    . PHE B 1 250 ? -43.921 -22.447 -14.529 1.00 64.94  ? 326 PHE B CB    1 
ATOM   4024 C  CG    . PHE B 1 250 ? -43.673 -23.911 -14.639 1.00 71.94  ? 326 PHE B CG    1 
ATOM   4025 C  CD1   . PHE B 1 250 ? -43.144 -24.460 -15.795 1.00 76.60  ? 326 PHE B CD1   1 
ATOM   4026 C  CD2   . PHE B 1 250 ? -44.054 -24.753 -13.610 1.00 74.61  ? 326 PHE B CD2   1 
ATOM   4027 C  CE1   . PHE B 1 250 ? -42.949 -25.826 -15.909 1.00 75.28  ? 326 PHE B CE1   1 
ATOM   4028 C  CE2   . PHE B 1 250 ? -43.872 -26.119 -13.702 1.00 79.56  ? 326 PHE B CE2   1 
ATOM   4029 C  CZ    . PHE B 1 250 ? -43.314 -26.663 -14.859 1.00 89.34  ? 326 PHE B CZ    1 
ATOM   4030 N  N     . SER B 1 251 ? -41.522 -20.366 -12.663 1.00 75.67  ? 327 SER B N     1 
ATOM   4031 C  CA    . SER B 1 251 ? -41.104 -19.917 -11.307 1.00 66.42  ? 327 SER B CA    1 
ATOM   4032 C  C     . SER B 1 251 ? -40.159 -18.705 -11.381 1.00 65.81  ? 327 SER B C     1 
ATOM   4033 O  O     . SER B 1 251 ? -39.477 -18.356 -10.408 1.00 61.14  ? 327 SER B O     1 
ATOM   4034 C  CB    . SER B 1 251 ? -40.463 -21.011 -10.441 1.00 76.41  ? 327 SER B CB    1 
ATOM   4035 O  OG    . SER B 1 251 ? -40.174 -20.505 -9.145  1.00 86.42  ? 327 SER B OG    1 
ATOM   4036 O  OXT   . SER B 1 251 ? -40.034 -18.063 -12.428 1.00 61.12  ? 327 SER B OXT   1 
ATOM   4037 N  N     . ASP C 1 3   ? 33.487  15.311  15.434  1.00 81.93  ? 79  ASP C N     1 
ATOM   4038 C  CA    . ASP C 1 3   ? 33.765  15.108  14.012  1.00 89.96  ? 79  ASP C CA    1 
ATOM   4039 C  C     . ASP C 1 3   ? 35.256  14.999  13.693  1.00 92.96  ? 79  ASP C C     1 
ATOM   4040 O  O     . ASP C 1 3   ? 36.113  15.218  14.551  1.00 94.96  ? 79  ASP C O     1 
ATOM   4041 C  CB    . ASP C 1 3   ? 33.163  16.242  13.173  1.00 91.79  ? 79  ASP C CB    1 
ATOM   4042 C  CG    . ASP C 1 3   ? 31.736  15.957  12.729  1.00 84.67  ? 79  ASP C CG    1 
ATOM   4043 O  OD1   . ASP C 1 3   ? 31.365  14.764  12.637  1.00 70.39  ? 79  ASP C OD1   1 
ATOM   4044 O  OD2   . ASP C 1 3   ? 30.994  16.933  12.460  1.00 73.82  ? 79  ASP C OD2   1 
ATOM   4045 N  N     . ILE C 1 4   ? 35.545  14.643  12.445  1.00 95.14  ? 80  ILE C N     1 
ATOM   4046 C  CA    . ILE C 1 4   ? 36.892  14.728  11.885  1.00 102.66 ? 80  ILE C CA    1 
ATOM   4047 C  C     . ILE C 1 4   ? 36.924  16.030  11.078  1.00 100.15 ? 80  ILE C C     1 
ATOM   4048 O  O     . ILE C 1 4   ? 35.898  16.422  10.513  1.00 96.03  ? 80  ILE C O     1 
ATOM   4049 C  CB    . ILE C 1 4   ? 37.224  13.509  10.964  1.00 95.05  ? 80  ILE C CB    1 
ATOM   4050 C  CG1   . ILE C 1 4   ? 36.084  12.482  10.974  1.00 91.74  ? 80  ILE C CG1   1 
ATOM   4051 C  CG2   . ILE C 1 4   ? 38.535  12.847  11.380  1.00 89.94  ? 80  ILE C CG2   1 
ATOM   4052 C  CD1   . ILE C 1 4   ? 36.282  11.321  10.010  1.00 75.95  ? 80  ILE C CD1   1 
ATOM   4053 N  N     . PRO C 1 5   ? 38.086  16.715  11.034  1.00 104.42 ? 81  PRO C N     1 
ATOM   4054 C  CA    . PRO C 1 5   ? 38.187  18.024  10.365  1.00 100.41 ? 81  PRO C CA    1 
ATOM   4055 C  C     . PRO C 1 5   ? 37.625  18.034  8.938   1.00 92.52  ? 81  PRO C C     1 
ATOM   4056 O  O     . PRO C 1 5   ? 36.982  19.006  8.537   1.00 83.42  ? 81  PRO C O     1 
ATOM   4057 C  CB    . PRO C 1 5   ? 39.697  18.284  10.339  1.00 102.69 ? 81  PRO C CB    1 
ATOM   4058 C  CG    . PRO C 1 5   ? 40.221  17.536  11.521  1.00 104.90 ? 81  PRO C CG    1 
ATOM   4059 C  CD    . PRO C 1 5   ? 39.370  16.301  11.634  1.00 99.47  ? 81  PRO C CD    1 
ATOM   4060 N  N     . GLU C 1 6   ? 37.851  16.945  8.205   1.00 98.20  ? 82  GLU C N     1 
ATOM   4061 C  CA    . GLU C 1 6   ? 37.472  16.839  6.798   1.00 89.00  ? 82  GLU C CA    1 
ATOM   4062 C  C     . GLU C 1 6   ? 36.139  16.115  6.563   1.00 82.88  ? 82  GLU C C     1 
ATOM   4063 O  O     . GLU C 1 6   ? 35.775  15.858  5.413   1.00 72.62  ? 82  GLU C O     1 
ATOM   4064 C  CB    . GLU C 1 6   ? 38.580  16.109  6.024   1.00 91.20  ? 82  GLU C CB    1 
ATOM   4065 C  CG    . GLU C 1 6   ? 39.020  14.793  6.673   1.00 95.57  ? 82  GLU C CG    1 
ATOM   4066 C  CD    . GLU C 1 6   ? 39.720  13.843  5.704   1.00 100.06 ? 82  GLU C CD    1 
ATOM   4067 O  OE1   . GLU C 1 6   ? 40.867  13.434  5.989   1.00 100.41 ? 82  GLU C OE1   1 
ATOM   4068 O  OE2   . GLU C 1 6   ? 39.118  13.489  4.667   1.00 99.81  ? 82  GLU C OE2   1 
ATOM   4069 N  N     . HIS C 1 7   ? 35.413  15.807  7.639   1.00 80.54  ? 83  HIS C N     1 
ATOM   4070 C  CA    . HIS C 1 7   ? 34.273  14.882  7.571   1.00 74.18  ? 83  HIS C CA    1 
ATOM   4071 C  C     . HIS C 1 7   ? 33.169  15.257  6.580   1.00 67.37  ? 83  HIS C C     1 
ATOM   4072 O  O     . HIS C 1 7   ? 32.770  14.447  5.739   1.00 50.44  ? 83  HIS C O     1 
ATOM   4073 C  CB    . HIS C 1 7   ? 33.660  14.647  8.950   1.00 71.03  ? 83  HIS C CB    1 
ATOM   4074 C  CG    . HIS C 1 7   ? 32.589  13.601  8.950   1.00 74.29  ? 83  HIS C CG    1 
ATOM   4075 N  ND1   . HIS C 1 7   ? 32.864  12.255  8.820   1.00 67.98  ? 83  HIS C ND1   1 
ATOM   4076 C  CD2   . HIS C 1 7   ? 31.240  13.703  9.040   1.00 66.05  ? 83  HIS C CD2   1 
ATOM   4077 C  CE1   . HIS C 1 7   ? 31.732  11.573  8.845   1.00 62.34  ? 83  HIS C CE1   1 
ATOM   4078 N  NE2   . HIS C 1 7   ? 30.732  12.427  8.975   1.00 63.36  ? 83  HIS C NE2   1 
ATOM   4079 N  N     . TRP C 1 8   ? 32.651  16.471  6.687   1.00 66.45  ? 84  TRP C N     1 
ATOM   4080 C  CA    . TRP C 1 8   ? 31.714  16.941  5.677   1.00 61.62  ? 84  TRP C CA    1 
ATOM   4081 C  C     . TRP C 1 8   ? 32.484  17.395  4.452   1.00 55.22  ? 84  TRP C C     1 
ATOM   4082 O  O     . TRP C 1 8   ? 33.493  18.075  4.565   1.00 62.00  ? 84  TRP C O     1 
ATOM   4083 C  CB    . TRP C 1 8   ? 30.848  18.080  6.219   1.00 56.18  ? 84  TRP C CB    1 
ATOM   4084 C  CG    . TRP C 1 8   ? 30.024  17.655  7.378   1.00 49.77  ? 84  TRP C CG    1 
ATOM   4085 C  CD1   . TRP C 1 8   ? 30.259  17.924  8.691   1.00 52.24  ? 84  TRP C CD1   1 
ATOM   4086 C  CD2   . TRP C 1 8   ? 28.845  16.851  7.334   1.00 52.67  ? 84  TRP C CD2   1 
ATOM   4087 N  NE1   . TRP C 1 8   ? 29.287  17.352  9.474   1.00 55.22  ? 84  TRP C NE1   1 
ATOM   4088 C  CE2   . TRP C 1 8   ? 28.405  16.684  8.665   1.00 59.94  ? 84  TRP C CE2   1 
ATOM   4089 C  CE3   . TRP C 1 8   ? 28.114  16.255  6.300   1.00 51.09  ? 84  TRP C CE3   1 
ATOM   4090 C  CZ2   . TRP C 1 8   ? 27.269  15.941  8.991   1.00 52.84  ? 84  TRP C CZ2   1 
ATOM   4091 C  CZ3   . TRP C 1 8   ? 26.981  15.518  6.625   1.00 51.92  ? 84  TRP C CZ3   1 
ATOM   4092 C  CH2   . TRP C 1 8   ? 26.574  15.365  7.961   1.00 50.33  ? 84  TRP C CH2   1 
ATOM   4093 N  N     . GLU C 1 9   ? 32.026  17.004  3.277   1.00 56.17  ? 85  GLU C N     1 
ATOM   4094 C  CA    . GLU C 1 9   ? 32.544  17.620  2.078   1.00 55.12  ? 85  GLU C CA    1 
ATOM   4095 C  C     . GLU C 1 9   ? 31.796  18.937  1.929   1.00 60.79  ? 85  GLU C C     1 
ATOM   4096 O  O     . GLU C 1 9   ? 30.581  18.947  1.725   1.00 56.09  ? 85  GLU C O     1 
ATOM   4097 C  CB    . GLU C 1 9   ? 32.355  16.722  0.855   1.00 49.74  ? 85  GLU C CB    1 
ATOM   4098 C  CG    . GLU C 1 9   ? 32.559  17.440  -0.498  1.00 63.09  ? 85  GLU C CG    1 
ATOM   4099 C  CD    . GLU C 1 9   ? 34.011  17.851  -0.793  1.00 65.94  ? 85  GLU C CD    1 
ATOM   4100 O  OE1   . GLU C 1 9   ? 34.899  17.651  0.064   1.00 70.73  ? 85  GLU C OE1   1 
ATOM   4101 O  OE2   . GLU C 1 9   ? 34.264  18.375  -1.900  1.00 65.90  ? 85  GLU C OE2   1 
ATOM   4102 N  N     . GLU C 1 10  ? 32.516  20.049  2.048   1.00 60.16  ? 86  GLU C N     1 
ATOM   4103 C  CA    . GLU C 1 10  ? 31.859  21.350  2.112   1.00 57.28  ? 86  GLU C CA    1 
ATOM   4104 C  C     . GLU C 1 10  ? 32.756  22.492  1.684   1.00 51.85  ? 86  GLU C C     1 
ATOM   4105 O  O     . GLU C 1 10  ? 33.971  22.455  1.891   1.00 56.08  ? 86  GLU C O     1 
ATOM   4106 C  CB    . GLU C 1 10  ? 31.347  21.614  3.537   1.00 58.15  ? 86  GLU C CB    1 
ATOM   4107 C  CG    . GLU C 1 10  ? 32.444  21.653  4.603   1.00 55.27  ? 86  GLU C CG    1 
ATOM   4108 C  CD    . GLU C 1 10  ? 31.893  21.561  6.015   1.00 53.46  ? 86  GLU C CD    1 
ATOM   4109 O  OE1   . GLU C 1 10  ? 32.697  21.443  6.962   1.00 57.06  ? 86  GLU C OE1   1 
ATOM   4110 O  OE2   . GLU C 1 10  ? 30.657  21.611  6.182   1.00 54.38  ? 86  GLU C OE2   1 
ATOM   4111 N  N     . ASP C 1 11  ? 32.140  23.502  1.077   1.00 53.15  ? 87  ASP C N     1 
ATOM   4112 C  CA    . ASP C 1 11  ? 32.792  24.785  0.847   1.00 52.74  ? 87  ASP C CA    1 
ATOM   4113 C  C     . ASP C 1 11  ? 32.103  25.895  1.680   1.00 56.91  ? 87  ASP C C     1 
ATOM   4114 O  O     . ASP C 1 11  ? 30.895  25.825  1.961   1.00 55.29  ? 87  ASP C O     1 
ATOM   4115 C  CB    . ASP C 1 11  ? 32.795  25.126  -0.640  1.00 46.02  ? 87  ASP C CB    1 
ATOM   4116 C  CG    . ASP C 1 11  ? 33.649  26.339  -0.950  1.00 59.04  ? 87  ASP C CG    1 
ATOM   4117 O  OD1   . ASP C 1 11  ? 34.890  26.209  -0.899  1.00 59.47  ? 87  ASP C OD1   1 
ATOM   4118 O  OD2   . ASP C 1 11  ? 33.084  27.421  -1.235  1.00 59.61  ? 87  ASP C OD2   1 
ATOM   4119 N  N     . ALA C 1 12  ? 32.871  26.907  2.080   1.00 54.14  ? 88  ALA C N     1 
ATOM   4120 C  CA    . ALA C 1 12  ? 32.350  27.975  2.936   1.00 52.85  ? 88  ALA C CA    1 
ATOM   4121 C  C     . ALA C 1 12  ? 31.191  28.695  2.257   1.00 49.00  ? 88  ALA C C     1 
ATOM   4122 O  O     . ALA C 1 12  ? 30.274  29.175  2.912   1.00 45.05  ? 88  ALA C O     1 
ATOM   4123 C  CB    . ALA C 1 12  ? 33.453  28.953  3.295   1.00 49.24  ? 88  ALA C CB    1 
ATOM   4124 N  N     . SER C 1 13  ? 31.229  28.739  0.933   1.00 52.23  ? 89  SER C N     1 
ATOM   4125 C  CA    . SER C 1 13  ? 30.190  29.391  0.149   1.00 49.60  ? 89  SER C CA    1 
ATOM   4126 C  C     . SER C 1 13  ? 28.905  28.574  0.017   1.00 52.21  ? 89  SER C C     1 
ATOM   4127 O  O     . SER C 1 13  ? 27.912  29.071  -0.517  1.00 50.34  ? 89  SER C O     1 
ATOM   4128 C  CB    . SER C 1 13  ? 30.726  29.686  -1.253  1.00 60.56  ? 89  SER C CB    1 
ATOM   4129 O  OG    . SER C 1 13  ? 29.678  29.680  -2.210  1.00 68.10  ? 89  SER C OG    1 
ATOM   4130 N  N     . TRP C 1 14  ? 28.929  27.314  0.453   1.00 50.43  ? 90  TRP C N     1 
ATOM   4131 C  CA    . TRP C 1 14  ? 27.745  26.464  0.337   1.00 50.86  ? 90  TRP C CA    1 
ATOM   4132 C  C     . TRP C 1 14  ? 26.799  26.728  1.496   1.00 51.26  ? 90  TRP C C     1 
ATOM   4133 O  O     . TRP C 1 14  ? 27.245  27.066  2.600   1.00 42.70  ? 90  TRP C O     1 
ATOM   4134 C  CB    . TRP C 1 14  ? 28.122  24.977  0.293   1.00 49.37  ? 90  TRP C CB    1 
ATOM   4135 C  CG    . TRP C 1 14  ? 28.997  24.608  -0.888  1.00 53.07  ? 90  TRP C CG    1 
ATOM   4136 C  CD1   . TRP C 1 14  ? 29.431  25.440  -1.879  1.00 51.28  ? 90  TRP C CD1   1 
ATOM   4137 C  CD2   . TRP C 1 14  ? 29.541  23.317  -1.187  1.00 55.70  ? 90  TRP C CD2   1 
ATOM   4138 N  NE1   . TRP C 1 14  ? 30.215  24.751  -2.772  1.00 44.47  ? 90  TRP C NE1   1 
ATOM   4139 C  CE2   . TRP C 1 14  ? 30.299  23.447  -2.372  1.00 51.83  ? 90  TRP C CE2   1 
ATOM   4140 C  CE3   . TRP C 1 14  ? 29.461  22.063  -0.569  1.00 46.24  ? 90  TRP C CE3   1 
ATOM   4141 C  CZ2   . TRP C 1 14  ? 30.967  22.372  -2.955  1.00 44.03  ? 90  TRP C CZ2   1 
ATOM   4142 C  CZ3   . TRP C 1 14  ? 30.131  20.996  -1.147  1.00 50.85  ? 90  TRP C CZ3   1 
ATOM   4143 C  CH2   . TRP C 1 14  ? 30.873  21.158  -2.329  1.00 51.86  ? 90  TRP C CH2   1 
ATOM   4144 N  N     . GLY C 1 15  ? 25.500  26.569  1.243   1.00 46.91  ? 91  GLY C N     1 
ATOM   4145 C  CA    . GLY C 1 15  ? 24.496  26.731  2.280   1.00 45.89  ? 91  GLY C CA    1 
ATOM   4146 C  C     . GLY C 1 15  ? 24.780  25.786  3.434   1.00 50.91  ? 91  GLY C C     1 
ATOM   4147 O  O     . GLY C 1 15  ? 25.399  24.752  3.228   1.00 49.52  ? 91  GLY C O     1 
ATOM   4148 N  N     . PRO C 1 16  ? 24.308  26.124  4.644   1.00 47.83  ? 92  PRO C N     1 
ATOM   4149 C  CA    . PRO C 1 16  ? 24.774  25.457  5.865   1.00 47.38  ? 92  PRO C CA    1 
ATOM   4150 C  C     . PRO C 1 16  ? 24.296  24.013  6.038   1.00 47.08  ? 92  PRO C C     1 
ATOM   4151 O  O     . PRO C 1 16  ? 24.885  23.267  6.832   1.00 44.53  ? 92  PRO C O     1 
ATOM   4152 C  CB    . PRO C 1 16  ? 24.162  26.323  6.978   1.00 43.44  ? 92  PRO C CB    1 
ATOM   4153 C  CG    . PRO C 1 16  ? 22.899  26.840  6.375   1.00 36.76  ? 92  PRO C CG    1 
ATOM   4154 C  CD    . PRO C 1 16  ? 23.224  27.091  4.923   1.00 40.44  ? 92  PRO C CD    1 
ATOM   4155 N  N     . HIS C 1 17  ? 23.232  23.627  5.343   1.00 40.56  ? 93  HIS C N     1 
ATOM   4156 C  CA    . HIS C 1 17  ? 22.594  22.341  5.639   1.00 48.86  ? 93  HIS C CA    1 
ATOM   4157 C  C     . HIS C 1 17  ? 23.412  21.114  5.198   1.00 48.56  ? 93  HIS C C     1 
ATOM   4158 O  O     . HIS C 1 17  ? 23.777  20.968  4.025   1.00 41.32  ? 93  HIS C O     1 
ATOM   4159 C  CB    . HIS C 1 17  ? 21.170  22.297  5.086   1.00 46.06  ? 93  HIS C CB    1 
ATOM   4160 C  CG    . HIS C 1 17  ? 20.244  23.260  5.752   1.00 48.95  ? 93  HIS C CG    1 
ATOM   4161 N  ND1   . HIS C 1 17  ? 19.623  24.288  5.073   1.00 47.24  ? 93  HIS C ND1   1 
ATOM   4162 C  CD2   . HIS C 1 17  ? 19.850  23.368  7.046   1.00 42.80  ? 93  HIS C CD2   1 
ATOM   4163 C  CE1   . HIS C 1 17  ? 18.871  24.974  5.917   1.00 44.76  ? 93  HIS C CE1   1 
ATOM   4164 N  NE2   . HIS C 1 17  ? 18.998  24.440  7.121   1.00 36.94  ? 93  HIS C NE2   1 
ATOM   4165 N  N     . ARG C 1 18  ? 23.702  20.249  6.163   1.00 40.77  ? 94  ARG C N     1 
ATOM   4166 C  CA    . ARG C 1 18  ? 24.551  19.095  5.924   1.00 46.23  ? 94  ARG C CA    1 
ATOM   4167 C  C     . ARG C 1 18  ? 23.719  17.841  5.722   1.00 43.63  ? 94  ARG C C     1 
ATOM   4168 O  O     . ARG C 1 18  ? 22.903  17.474  6.571   1.00 47.33  ? 94  ARG C O     1 
ATOM   4169 C  CB    . ARG C 1 18  ? 25.568  18.922  7.058   1.00 45.00  ? 94  ARG C CB    1 
ATOM   4170 C  CG    . ARG C 1 18  ? 26.585  20.067  7.124   1.00 54.58  ? 94  ARG C CG    1 
ATOM   4171 C  CD    . ARG C 1 18  ? 27.301  20.165  8.472   1.00 54.67  ? 94  ARG C CD    1 
ATOM   4172 N  NE    . ARG C 1 18  ? 28.580  20.867  8.346   1.00 56.81  ? 94  ARG C NE    1 
ATOM   4173 C  CZ    . ARG C 1 18  ? 29.309  21.310  9.369   1.00 55.07  ? 94  ARG C CZ    1 
ATOM   4174 N  NH1   . ARG C 1 18  ? 28.887  21.149  10.614  1.00 53.48  ? 94  ARG C NH1   1 
ATOM   4175 N  NH2   . ARG C 1 18  ? 30.465  21.921  9.142   1.00 54.45  ? 94  ARG C NH2   1 
ATOM   4176 N  N     . LEU C 1 19  ? 23.941  17.198  4.579   1.00 43.73  ? 95  LEU C N     1 
ATOM   4177 C  CA    . LEU C 1 19  ? 23.219  16.003  4.170   1.00 40.32  ? 95  LEU C CA    1 
ATOM   4178 C  C     . LEU C 1 19  ? 23.986  14.728  4.492   1.00 42.48  ? 95  LEU C C     1 
ATOM   4179 O  O     . LEU C 1 19  ? 25.117  14.554  4.056   1.00 44.84  ? 95  LEU C O     1 
ATOM   4180 C  CB    . LEU C 1 19  ? 22.956  16.061  2.667   1.00 41.39  ? 95  LEU C CB    1 
ATOM   4181 C  CG    . LEU C 1 19  ? 22.477  14.794  1.963   1.00 42.42  ? 95  LEU C CG    1 
ATOM   4182 C  CD1   . LEU C 1 19  ? 21.177  14.269  2.575   1.00 33.91  ? 95  LEU C CD1   1 
ATOM   4183 C  CD2   . LEU C 1 19  ? 22.305  15.098  0.483   1.00 42.08  ? 95  LEU C CD2   1 
ATOM   4184 N  N     . ALA C 1 20  ? 23.369  13.847  5.271   1.00 38.98  ? 96  ALA C N     1 
ATOM   4185 C  CA    . ALA C 1 20  ? 23.893  12.502  5.468   1.00 43.71  ? 96  ALA C CA    1 
ATOM   4186 C  C     . ALA C 1 20  ? 23.260  11.562  4.424   1.00 41.48  ? 96  ALA C C     1 
ATOM   4187 O  O     . ALA C 1 20  ? 22.048  11.346  4.419   1.00 43.93  ? 96  ALA C O     1 
ATOM   4188 C  CB    . ALA C 1 20  ? 23.605  12.019  6.887   1.00 34.37  ? 96  ALA C CB    1 
ATOM   4189 N  N     . VAL C 1 21  ? 24.065  11.040  3.511   1.00 37.33  ? 97  VAL C N     1 
ATOM   4190 C  CA    . VAL C 1 21  ? 23.551  10.120  2.500   1.00 37.31  ? 97  VAL C CA    1 
ATOM   4191 C  C     . VAL C 1 21  ? 23.590  8.712   3.088   1.00 33.13  ? 97  VAL C C     1 
ATOM   4192 O  O     . VAL C 1 21  ? 24.662  8.151   3.316   1.00 32.52  ? 97  VAL C O     1 
ATOM   4193 C  CB    . VAL C 1 21  ? 24.355  10.201  1.179   1.00 39.42  ? 97  VAL C CB    1 
ATOM   4194 C  CG1   . VAL C 1 21  ? 23.833  9.197   0.199   1.00 33.74  ? 97  VAL C CG1   1 
ATOM   4195 C  CG2   . VAL C 1 21  ? 24.261  11.613  0.570   1.00 36.65  ? 97  VAL C CG2   1 
ATOM   4196 N  N     . LEU C 1 22  ? 22.417  8.169   3.393   1.00 31.93  ? 98  LEU C N     1 
ATOM   4197 C  CA    . LEU C 1 22  ? 22.334  6.880   4.076   1.00 33.29  ? 98  LEU C CA    1 
ATOM   4198 C  C     . LEU C 1 22  ? 22.072  5.785   3.053   1.00 33.93  ? 98  LEU C C     1 
ATOM   4199 O  O     . LEU C 1 22  ? 20.969  5.685   2.491   1.00 31.74  ? 98  LEU C O     1 
ATOM   4200 C  CB    . LEU C 1 22  ? 21.237  6.897   5.149   1.00 29.28  ? 98  LEU C CB    1 
ATOM   4201 C  CG    . LEU C 1 22  ? 21.363  8.003   6.214   1.00 40.13  ? 98  LEU C CG    1 
ATOM   4202 C  CD1   . LEU C 1 22  ? 20.164  8.009   7.157   1.00 39.60  ? 98  LEU C CD1   1 
ATOM   4203 C  CD2   . LEU C 1 22  ? 22.656  7.874   7.018   1.00 38.50  ? 98  LEU C CD2   1 
ATOM   4204 N  N     . VAL C 1 23  ? 23.094  4.976   2.796   1.00 32.53  ? 99  VAL C N     1 
ATOM   4205 C  CA    . VAL C 1 23  ? 23.005  3.962   1.745   1.00 31.28  ? 99  VAL C CA    1 
ATOM   4206 C  C     . VAL C 1 23  ? 22.828  2.553   2.293   1.00 31.43  ? 99  VAL C C     1 
ATOM   4207 O  O     . VAL C 1 23  ? 23.771  1.977   2.846   1.00 33.03  ? 99  VAL C O     1 
ATOM   4208 C  CB    . VAL C 1 23  ? 24.233  4.000   0.848   1.00 31.19  ? 99  VAL C CB    1 
ATOM   4209 C  CG1   . VAL C 1 23  ? 24.073  3.000   -0.284  1.00 31.83  ? 99  VAL C CG1   1 
ATOM   4210 C  CG2   . VAL C 1 23  ? 24.447  5.429   0.312   1.00 35.76  ? 99  VAL C CG2   1 
ATOM   4211 N  N     . PRO C 1 24  ? 21.614  1.992   2.151   1.00 30.71  ? 100 PRO C N     1 
ATOM   4212 C  CA    . PRO C 1 24  ? 21.410  0.599   2.587   1.00 37.45  ? 100 PRO C CA    1 
ATOM   4213 C  C     . PRO C 1 24  ? 22.271  -0.309  1.725   1.00 38.29  ? 100 PRO C C     1 
ATOM   4214 O  O     . PRO C 1 24  ? 22.247  -0.198  0.495   1.00 37.61  ? 100 PRO C O     1 
ATOM   4215 C  CB    . PRO C 1 24  ? 19.921  0.342   2.317   1.00 34.65  ? 100 PRO C CB    1 
ATOM   4216 C  CG    . PRO C 1 24  ? 19.520  1.366   1.305   1.00 36.68  ? 100 PRO C CG    1 
ATOM   4217 C  CD    . PRO C 1 24  ? 20.421  2.562   1.504   1.00 29.46  ? 100 PRO C CD    1 
ATOM   4218 N  N     . PHE C 1 25  ? 23.047  -1.179  2.353   1.00 35.50  ? 101 PHE C N     1 
ATOM   4219 C  CA    . PHE C 1 25  ? 24.034  -1.911  1.592   1.00 35.04  ? 101 PHE C CA    1 
ATOM   4220 C  C     . PHE C 1 25  ? 24.237  -3.368  2.019   1.00 39.08  ? 101 PHE C C     1 
ATOM   4221 O  O     . PHE C 1 25  ? 24.387  -3.679  3.197   1.00 40.47  ? 101 PHE C O     1 
ATOM   4222 C  CB    . PHE C 1 25  ? 25.368  -1.155  1.610   1.00 32.61  ? 101 PHE C CB    1 
ATOM   4223 C  CG    . PHE C 1 25  ? 26.396  -1.702  0.638   1.00 43.29  ? 101 PHE C CG    1 
ATOM   4224 C  CD1   . PHE C 1 25  ? 26.385  -1.305  -0.696  1.00 33.82  ? 101 PHE C CD1   1 
ATOM   4225 C  CD2   . PHE C 1 25  ? 27.372  -2.616  1.060   1.00 33.56  ? 101 PHE C CD2   1 
ATOM   4226 C  CE1   . PHE C 1 25  ? 27.327  -1.803  -1.595  1.00 33.55  ? 101 PHE C CE1   1 
ATOM   4227 C  CE2   . PHE C 1 25  ? 28.311  -3.113  0.172   1.00 32.04  ? 101 PHE C CE2   1 
ATOM   4228 C  CZ    . PHE C 1 25  ? 28.291  -2.698  -1.159  1.00 37.16  ? 101 PHE C CZ    1 
ATOM   4229 N  N     . ARG C 1 26  ? 24.226  -4.258  1.037   1.00 36.19  ? 102 ARG C N     1 
ATOM   4230 C  CA    . ARG C 1 26  ? 24.789  -5.592  1.209   1.00 37.63  ? 102 ARG C CA    1 
ATOM   4231 C  C     . ARG C 1 26  ? 25.142  -6.141  -0.148  1.00 32.35  ? 102 ARG C C     1 
ATOM   4232 O  O     . ARG C 1 26  ? 24.275  -6.281  -1.006  1.00 37.13  ? 102 ARG C O     1 
ATOM   4233 C  CB    . ARG C 1 26  ? 23.835  -6.569  1.890   1.00 31.81  ? 102 ARG C CB    1 
ATOM   4234 C  CG    . ARG C 1 26  ? 24.394  -8.015  1.900   1.00 33.23  ? 102 ARG C CG    1 
ATOM   4235 C  CD    . ARG C 1 26  ? 23.340  -9.033  2.333   1.00 30.86  ? 102 ARG C CD    1 
ATOM   4236 N  NE    . ARG C 1 26  ? 23.275  -9.136  3.786   1.00 39.80  ? 102 ARG C NE    1 
ATOM   4237 C  CZ    . ARG C 1 26  ? 22.234  -9.610  4.457   1.00 36.92  ? 102 ARG C CZ    1 
ATOM   4238 N  NH1   . ARG C 1 26  ? 21.150  -10.020 3.815   1.00 39.56  ? 102 ARG C NH1   1 
ATOM   4239 N  NH2   . ARG C 1 26  ? 22.283  -9.673  5.777   1.00 41.48  ? 102 ARG C NH2   1 
ATOM   4240 N  N     . GLU C 1 27  ? 26.417  -6.445  -0.326  1.00 36.19  ? 103 GLU C N     1 
ATOM   4241 C  CA    . GLU C 1 27  ? 26.920  -7.094  -1.542  1.00 40.41  ? 103 GLU C CA    1 
ATOM   4242 C  C     . GLU C 1 27  ? 26.501  -6.485  -2.890  1.00 42.72  ? 103 GLU C C     1 
ATOM   4243 O  O     . GLU C 1 27  ? 26.013  -7.186  -3.778  1.00 39.67  ? 103 GLU C O     1 
ATOM   4244 C  CB    . GLU C 1 27  ? 26.665  -8.613  -1.516  1.00 39.11  ? 103 GLU C CB    1 
ATOM   4245 C  CG    . GLU C 1 27  ? 27.886  -9.457  -1.067  1.00 38.31  ? 103 GLU C CG    1 
ATOM   4246 C  CD    . GLU C 1 27  ? 29.253  -8.881  -1.494  1.00 45.68  ? 103 GLU C CD    1 
ATOM   4247 O  OE1   . GLU C 1 27  ? 29.397  -8.310  -2.612  1.00 51.67  ? 103 GLU C OE1   1 
ATOM   4248 O  OE2   . GLU C 1 27  ? 30.202  -9.006  -0.693  1.00 46.73  ? 103 GLU C OE2   1 
ATOM   4249 N  N     A ARG C 1 28  ? 26.702  -5.178  -3.027  0.57 40.30  ? 104 ARG C N     1 
ATOM   4250 N  N     B ARG C 1 28  ? 26.687  -5.174  -3.020  0.43 40.29  ? 104 ARG C N     1 
ATOM   4251 C  CA    A ARG C 1 28  ? 26.502  -4.487  -4.299  0.57 41.25  ? 104 ARG C CA    1 
ATOM   4252 C  CA    B ARG C 1 28  ? 26.500  -4.475  -4.290  0.43 41.23  ? 104 ARG C CA    1 
ATOM   4253 C  C     A ARG C 1 28  ? 27.767  -3.701  -4.649  0.57 41.19  ? 104 ARG C C     1 
ATOM   4254 C  C     B ARG C 1 28  ? 27.772  -3.689  -4.607  0.43 41.20  ? 104 ARG C C     1 
ATOM   4255 O  O     A ARG C 1 28  ? 27.716  -2.515  -4.964  0.57 43.79  ? 104 ARG C O     1 
ATOM   4256 O  O     B ARG C 1 28  ? 27.732  -2.486  -4.858  0.43 43.71  ? 104 ARG C O     1 
ATOM   4257 C  CB    A ARG C 1 28  ? 25.295  -3.555  -4.213  0.57 40.38  ? 104 ARG C CB    1 
ATOM   4258 C  CB    B ARG C 1 28  ? 25.297  -3.532  -4.216  0.43 40.36  ? 104 ARG C CB    1 
ATOM   4259 C  CG    A ARG C 1 28  ? 23.990  -4.272  -3.874  0.57 39.79  ? 104 ARG C CG    1 
ATOM   4260 C  CG    B ARG C 1 28  ? 23.961  -4.231  -3.963  0.43 39.78  ? 104 ARG C CG    1 
ATOM   4261 C  CD    A ARG C 1 28  ? 23.580  -5.202  -4.989  0.57 36.67  ? 104 ARG C CD    1 
ATOM   4262 C  CD    B ARG C 1 28  ? 23.348  -4.769  -5.246  0.43 36.95  ? 104 ARG C CD    1 
ATOM   4263 N  NE    A ARG C 1 28  ? 22.215  -5.696  -4.832  0.57 39.65  ? 104 ARG C NE    1 
ATOM   4264 N  NE    B ARG C 1 28  ? 22.054  -5.400  -5.003  0.43 39.61  ? 104 ARG C NE    1 
ATOM   4265 C  CZ    A ARG C 1 28  ? 21.891  -6.894  -4.348  0.57 33.33  ? 104 ARG C CZ    1 
ATOM   4266 C  CZ    B ARG C 1 28  ? 20.877  -4.859  -5.309  0.43 38.83  ? 104 ARG C CZ    1 
ATOM   4267 N  NH1   A ARG C 1 28  ? 22.835  -7.747  -3.966  0.57 36.24  ? 104 ARG C NH1   1 
ATOM   4268 N  NH1   B ARG C 1 28  ? 20.818  -3.668  -5.887  0.43 32.96  ? 104 ARG C NH1   1 
ATOM   4269 N  NH2   A ARG C 1 28  ? 20.618  -7.240  -4.264  0.57 32.68  ? 104 ARG C NH2   1 
ATOM   4270 N  NH2   B ARG C 1 28  ? 19.756  -5.517  -5.043  0.43 38.19  ? 104 ARG C NH2   1 
ATOM   4271 N  N     . PHE C 1 29  ? 28.902  -4.386  -4.584  1.00 42.85  ? 105 PHE C N     1 
ATOM   4272 C  CA    . PHE C 1 29  ? 30.217  -3.769  -4.730  1.00 40.34  ? 105 PHE C CA    1 
ATOM   4273 C  C     . PHE C 1 29  ? 30.444  -3.026  -6.055  1.00 42.73  ? 105 PHE C C     1 
ATOM   4274 O  O     . PHE C 1 29  ? 31.001  -1.927  -6.056  1.00 43.72  ? 105 PHE C O     1 
ATOM   4275 C  CB    . PHE C 1 29  ? 31.274  -4.858  -4.502  1.00 48.18  ? 105 PHE C CB    1 
ATOM   4276 C  CG    . PHE C 1 29  ? 32.690  -4.373  -4.572  1.00 46.81  ? 105 PHE C CG    1 
ATOM   4277 C  CD1   . PHE C 1 29  ? 33.178  -3.469  -3.641  1.00 48.94  ? 105 PHE C CD1   1 
ATOM   4278 C  CD2   . PHE C 1 29  ? 33.547  -4.848  -5.552  1.00 43.29  ? 105 PHE C CD2   1 
ATOM   4279 C  CE1   . PHE C 1 29  ? 34.495  -3.029  -3.699  1.00 43.78  ? 105 PHE C CE1   1 
ATOM   4280 C  CE2   . PHE C 1 29  ? 34.859  -4.411  -5.614  1.00 42.21  ? 105 PHE C CE2   1 
ATOM   4281 C  CZ    . PHE C 1 29  ? 35.333  -3.501  -4.682  1.00 41.77  ? 105 PHE C CZ    1 
ATOM   4282 N  N     . GLU C 1 30  ? 30.006  -3.600  -7.175  1.00 41.62  ? 106 GLU C N     1 
ATOM   4283 C  CA    . GLU C 1 30  ? 30.186  -2.932  -8.470  1.00 41.52  ? 106 GLU C CA    1 
ATOM   4284 C  C     . GLU C 1 30  ? 29.448  -1.616  -8.494  1.00 39.20  ? 106 GLU C C     1 
ATOM   4285 O  O     . GLU C 1 30  ? 29.968  -0.608  -8.959  1.00 46.19  ? 106 GLU C O     1 
ATOM   4286 C  CB    . GLU C 1 30  ? 29.667  -3.775  -9.630  1.00 34.62  ? 106 GLU C CB    1 
ATOM   4287 C  CG    . GLU C 1 30  ? 30.569  -4.893  -10.028 1.00 43.00  ? 106 GLU C CG    1 
ATOM   4288 C  CD    . GLU C 1 30  ? 30.582  -5.997  -9.001  1.00 47.68  ? 106 GLU C CD    1 
ATOM   4289 O  OE1   . GLU C 1 30  ? 31.640  -6.644  -8.860  1.00 48.71  ? 106 GLU C OE1   1 
ATOM   4290 O  OE2   . GLU C 1 30  ? 29.545  -6.207  -8.333  1.00 47.05  ? 106 GLU C OE2   1 
ATOM   4291 N  N     . GLU C 1 31  ? 28.209  -1.654  -8.030  1.00 44.90  ? 107 GLU C N     1 
ATOM   4292 C  CA    . GLU C 1 31  ? 27.373  -0.469  -7.980  1.00 43.91  ? 107 GLU C CA    1 
ATOM   4293 C  C     . GLU C 1 31  ? 28.029  0.597   -7.103  1.00 39.88  ? 107 GLU C C     1 
ATOM   4294 O  O     . GLU C 1 31  ? 28.102  1.765   -7.489  1.00 41.41  ? 107 GLU C O     1 
ATOM   4295 C  CB    . GLU C 1 31  ? 25.975  -0.833  -7.465  1.00 39.91  ? 107 GLU C CB    1 
ATOM   4296 C  CG    . GLU C 1 31  ? 25.151  -1.674  -8.451  1.00 44.82  ? 107 GLU C CG    1 
ATOM   4297 C  CD    . GLU C 1 31  ? 25.293  -3.192  -8.252  1.00 42.95  ? 107 GLU C CD    1 
ATOM   4298 O  OE1   . GLU C 1 31  ? 26.296  -3.635  -7.652  1.00 37.79  ? 107 GLU C OE1   1 
ATOM   4299 O  OE2   . GLU C 1 31  ? 24.387  -3.937  -8.704  1.00 40.47  ? 107 GLU C OE2   1 
ATOM   4300 N  N     . LEU C 1 32  ? 28.525  0.175   -5.940  1.00 37.28  ? 108 LEU C N     1 
ATOM   4301 C  CA    . LEU C 1 32  ? 29.194  1.073   -5.002  1.00 37.96  ? 108 LEU C CA    1 
ATOM   4302 C  C     . LEU C 1 32  ? 30.347  1.838   -5.642  1.00 44.45  ? 108 LEU C C     1 
ATOM   4303 O  O     . LEU C 1 32  ? 30.476  3.063   -5.451  1.00 42.70  ? 108 LEU C O     1 
ATOM   4304 C  CB    . LEU C 1 32  ? 29.700  0.318   -3.777  1.00 28.99  ? 108 LEU C CB    1 
ATOM   4305 C  CG    . LEU C 1 32  ? 30.201  1.228   -2.658  1.00 36.26  ? 108 LEU C CG    1 
ATOM   4306 C  CD1   . LEU C 1 32  ? 29.057  2.030   -2.049  1.00 37.95  ? 108 LEU C CD1   1 
ATOM   4307 C  CD2   . LEU C 1 32  ? 30.906  0.438   -1.597  1.00 35.36  ? 108 LEU C CD2   1 
ATOM   4308 N  N     . LEU C 1 33  ? 31.179  1.118   -6.395  1.00 40.61  ? 109 LEU C N     1 
ATOM   4309 C  CA    . LEU C 1 33  ? 32.307  1.724   -7.110  1.00 41.95  ? 109 LEU C CA    1 
ATOM   4310 C  C     . LEU C 1 33  ? 31.886  2.888   -8.008  1.00 38.21  ? 109 LEU C C     1 
ATOM   4311 O  O     . LEU C 1 33  ? 32.622  3.860   -8.168  1.00 37.49  ? 109 LEU C O     1 
ATOM   4312 C  CB    . LEU C 1 33  ? 33.039  0.680   -7.955  1.00 45.98  ? 109 LEU C CB    1 
ATOM   4313 C  CG    . LEU C 1 33  ? 34.264  -0.026  -7.365  1.00 45.91  ? 109 LEU C CG    1 
ATOM   4314 C  CD1   . LEU C 1 33  ? 34.456  0.300   -5.913  1.00 40.33  ? 109 LEU C CD1   1 
ATOM   4315 C  CD2   . LEU C 1 33  ? 34.144  -1.517  -7.567  1.00 39.90  ? 109 LEU C CD2   1 
ATOM   4316 N  N     . VAL C 1 34  ? 30.708  2.771   -8.606  1.00 36.87  ? 110 VAL C N     1 
ATOM   4317 C  CA    . VAL C 1 34  ? 30.199  3.811   -9.478  1.00 32.80  ? 110 VAL C CA    1 
ATOM   4318 C  C     . VAL C 1 34  ? 29.473  4.878   -8.652  1.00 44.34  ? 110 VAL C C     1 
ATOM   4319 O  O     . VAL C 1 34  ? 29.566  6.077   -8.946  1.00 40.97  ? 110 VAL C O     1 
ATOM   4320 C  CB    . VAL C 1 34  ? 29.234  3.219   -10.522 1.00 40.94  ? 110 VAL C CB    1 
ATOM   4321 C  CG1   . VAL C 1 34  ? 28.647  4.324   -11.385 1.00 37.51  ? 110 VAL C CG1   1 
ATOM   4322 C  CG2   . VAL C 1 34  ? 29.963  2.187   -11.386 1.00 35.80  ? 110 VAL C CG2   1 
ATOM   4323 N  N     . PHE C 1 35  ? 28.777  4.428   -7.605  1.00 40.34  ? 111 PHE C N     1 
ATOM   4324 C  CA    . PHE C 1 35  ? 27.915  5.284   -6.797  1.00 38.91  ? 111 PHE C CA    1 
ATOM   4325 C  C     . PHE C 1 35  ? 28.635  6.430   -6.089  1.00 37.52  ? 111 PHE C C     1 
ATOM   4326 O  O     . PHE C 1 35  ? 28.284  7.595   -6.259  1.00 41.96  ? 111 PHE C O     1 
ATOM   4327 C  CB    . PHE C 1 35  ? 27.187  4.464   -5.737  1.00 32.83  ? 111 PHE C CB    1 
ATOM   4328 C  CG    . PHE C 1 35  ? 26.189  5.266   -4.953  1.00 41.90  ? 111 PHE C CG    1 
ATOM   4329 C  CD1   . PHE C 1 35  ? 24.925  5.528   -5.476  1.00 36.94  ? 111 PHE C CD1   1 
ATOM   4330 C  CD2   . PHE C 1 35  ? 26.513  5.780   -3.706  1.00 38.31  ? 111 PHE C CD2   1 
ATOM   4331 C  CE1   . PHE C 1 35  ? 24.009  6.271   -4.766  1.00 35.66  ? 111 PHE C CE1   1 
ATOM   4332 C  CE2   . PHE C 1 35  ? 25.591  6.524   -2.987  1.00 40.66  ? 111 PHE C CE2   1 
ATOM   4333 C  CZ    . PHE C 1 35  ? 24.332  6.761   -3.515  1.00 34.03  ? 111 PHE C CZ    1 
ATOM   4334 N  N     . VAL C 1 36  ? 29.621  6.077   -5.275  1.00 39.31  ? 112 VAL C N     1 
ATOM   4335 C  CA    . VAL C 1 36  ? 30.335  7.038   -4.447  1.00 40.01  ? 112 VAL C CA    1 
ATOM   4336 C  C     . VAL C 1 36  ? 30.888  8.250   -5.231  1.00 42.26  ? 112 VAL C C     1 
ATOM   4337 O  O     . VAL C 1 36  ? 30.575  9.389   -4.871  1.00 43.88  ? 112 VAL C O     1 
ATOM   4338 C  CB    . VAL C 1 36  ? 31.397  6.341   -3.541  1.00 37.98  ? 112 VAL C CB    1 
ATOM   4339 C  CG1   . VAL C 1 36  ? 32.095  7.348   -2.639  1.00 36.06  ? 112 VAL C CG1   1 
ATOM   4340 C  CG2   . VAL C 1 36  ? 30.729  5.276   -2.694  1.00 31.53  ? 112 VAL C CG2   1 
ATOM   4341 N  N     . PRO C 1 37  ? 31.662  8.020   -6.320  1.00 39.69  ? 113 PRO C N     1 
ATOM   4342 C  CA    . PRO C 1 37  ? 32.172  9.177   -7.072  1.00 38.70  ? 113 PRO C CA    1 
ATOM   4343 C  C     . PRO C 1 37  ? 31.053  9.937   -7.767  1.00 40.62  ? 113 PRO C C     1 
ATOM   4344 O  O     . PRO C 1 37  ? 31.034  11.163  -7.723  1.00 41.32  ? 113 PRO C O     1 
ATOM   4345 C  CB    . PRO C 1 37  ? 33.103  8.545   -8.121  1.00 40.69  ? 113 PRO C CB    1 
ATOM   4346 C  CG    . PRO C 1 37  ? 33.408  7.181   -7.608  1.00 37.42  ? 113 PRO C CG    1 
ATOM   4347 C  CD    . PRO C 1 37  ? 32.168  6.754   -6.877  1.00 38.82  ? 113 PRO C CD    1 
ATOM   4348 N  N     . HIS C 1 38  ? 30.129  9.218   -8.395  1.00 40.93  ? 114 HIS C N     1 
ATOM   4349 C  CA    . HIS C 1 38  ? 28.983  9.856   -9.024  1.00 37.61  ? 114 HIS C CA    1 
ATOM   4350 C  C     . HIS C 1 38  ? 28.298  10.823  -8.054  1.00 41.30  ? 114 HIS C C     1 
ATOM   4351 O  O     . HIS C 1 38  ? 28.064  11.974  -8.402  1.00 40.16  ? 114 HIS C O     1 
ATOM   4352 C  CB    . HIS C 1 38  ? 27.980  8.812   -9.506  1.00 39.57  ? 114 HIS C CB    1 
ATOM   4353 C  CG    . HIS C 1 38  ? 26.749  9.396   -10.133 1.00 40.17  ? 114 HIS C CG    1 
ATOM   4354 N  ND1   . HIS C 1 38  ? 26.560  9.445   -11.496 1.00 37.29  ? 114 HIS C ND1   1 
ATOM   4355 C  CD2   . HIS C 1 38  ? 25.641  9.948   -9.581  1.00 41.82  ? 114 HIS C CD2   1 
ATOM   4356 C  CE1   . HIS C 1 38  ? 25.391  10.002  -11.760 1.00 34.96  ? 114 HIS C CE1   1 
ATOM   4357 N  NE2   . HIS C 1 38  ? 24.814  10.320  -10.614 1.00 39.83  ? 114 HIS C NE2   1 
ATOM   4358 N  N     . MET C 1 39  ? 27.994  10.352  -6.841  1.00 43.86  ? 115 MET C N     1 
ATOM   4359 C  CA    . MET C 1 39  ? 27.308  11.185  -5.842  1.00 42.48  ? 115 MET C CA    1 
ATOM   4360 C  C     . MET C 1 39  ? 28.153  12.348  -5.327  1.00 40.53  ? 115 MET C C     1 
ATOM   4361 O  O     . MET C 1 39  ? 27.630  13.442  -5.138  1.00 42.28  ? 115 MET C O     1 
ATOM   4362 C  CB    . MET C 1 39  ? 26.787  10.354  -4.667  1.00 38.47  ? 115 MET C CB    1 
ATOM   4363 C  CG    . MET C 1 39  ? 25.667  9.398   -5.036  1.00 34.64  ? 115 MET C CG    1 
ATOM   4364 S  SD    . MET C 1 39  ? 24.297  10.139  -5.945  1.00 44.83  ? 115 MET C SD    1 
ATOM   4365 C  CE    . MET C 1 39  ? 23.659  11.387  -4.776  1.00 38.09  ? 115 MET C CE    1 
ATOM   4366 N  N     . ARG C 1 40  ? 29.444  12.111  -5.092  1.00 42.68  ? 116 ARG C N     1 
ATOM   4367 C  CA    . ARG C 1 40  ? 30.345  13.195  -4.719  1.00 42.93  ? 116 ARG C CA    1 
ATOM   4368 C  C     . ARG C 1 40  ? 30.303  14.282  -5.781  1.00 47.35  ? 116 ARG C C     1 
ATOM   4369 O  O     . ARG C 1 40  ? 30.181  15.462  -5.464  1.00 45.86  ? 116 ARG C O     1 
ATOM   4370 C  CB    . ARG C 1 40  ? 31.782  12.714  -4.547  1.00 41.58  ? 116 ARG C CB    1 
ATOM   4371 C  CG    . ARG C 1 40  ? 32.826  13.852  -4.431  1.00 38.71  ? 116 ARG C CG    1 
ATOM   4372 C  CD    . ARG C 1 40  ? 34.129  13.297  -3.878  1.00 48.24  ? 116 ARG C CD    1 
ATOM   4373 N  NE    . ARG C 1 40  ? 35.217  14.260  -3.725  1.00 54.02  ? 116 ARG C NE    1 
ATOM   4374 C  CZ    . ARG C 1 40  ? 35.450  14.963  -2.617  1.00 61.18  ? 116 ARG C CZ    1 
ATOM   4375 N  NH1   . ARG C 1 40  ? 34.649  14.845  -1.560  1.00 61.22  ? 116 ARG C NH1   1 
ATOM   4376 N  NH2   . ARG C 1 40  ? 36.477  15.805  -2.571  1.00 69.86  ? 116 ARG C NH2   1 
ATOM   4377 N  N     . ARG C 1 41  ? 30.385  13.867  -7.040  1.00 38.48  ? 117 ARG C N     1 
ATOM   4378 C  CA    . ARG C 1 41  ? 30.358  14.796  -8.151  1.00 42.92  ? 117 ARG C CA    1 
ATOM   4379 C  C     . ARG C 1 41  ? 29.035  15.560  -8.209  1.00 46.12  ? 117 ARG C C     1 
ATOM   4380 O  O     . ARG C 1 41  ? 29.012  16.790  -8.291  1.00 47.23  ? 117 ARG C O     1 
ATOM   4381 C  CB    . ARG C 1 41  ? 30.597  14.056  -9.467  1.00 43.30  ? 117 ARG C CB    1 
ATOM   4382 C  CG    . ARG C 1 41  ? 30.791  14.988  -10.639 1.00 50.22  ? 117 ARG C CG    1 
ATOM   4383 C  CD    . ARG C 1 41  ? 30.836  14.256  -11.967 1.00 60.42  ? 117 ARG C CD    1 
ATOM   4384 N  NE    . ARG C 1 41  ? 30.662  15.200  -13.067 1.00 78.36  ? 117 ARG C NE    1 
ATOM   4385 C  CZ    . ARG C 1 41  ? 29.484  15.525  -13.598 1.00 83.35  ? 117 ARG C CZ    1 
ATOM   4386 N  NH1   . ARG C 1 41  ? 28.368  14.961  -13.144 1.00 77.94  ? 117 ARG C NH1   1 
ATOM   4387 N  NH2   . ARG C 1 41  ? 29.420  16.409  -14.591 1.00 76.54  ? 117 ARG C NH2   1 
ATOM   4388 N  N     . PHE C 1 42  ? 27.936  14.817  -8.164  1.00 42.19  ? 118 PHE C N     1 
ATOM   4389 C  CA    . PHE C 1 42  ? 26.598  15.383  -8.303  1.00 42.83  ? 118 PHE C CA    1 
ATOM   4390 C  C     . PHE C 1 42  ? 26.291  16.378  -7.175  1.00 42.59  ? 118 PHE C C     1 
ATOM   4391 O  O     . PHE C 1 42  ? 25.808  17.480  -7.425  1.00 46.18  ? 118 PHE C O     1 
ATOM   4392 C  CB    . PHE C 1 42  ? 25.598  14.232  -8.286  1.00 41.21  ? 118 PHE C CB    1 
ATOM   4393 C  CG    . PHE C 1 42  ? 24.153  14.641  -8.385  1.00 41.45  ? 118 PHE C CG    1 
ATOM   4394 C  CD1   . PHE C 1 42  ? 23.560  14.843  -9.622  1.00 38.15  ? 118 PHE C CD1   1 
ATOM   4395 C  CD2   . PHE C 1 42  ? 23.371  14.751  -7.241  1.00 35.72  ? 118 PHE C CD2   1 
ATOM   4396 C  CE1   . PHE C 1 42  ? 22.229  15.171  -9.717  1.00 38.29  ? 118 PHE C CE1   1 
ATOM   4397 C  CE2   . PHE C 1 42  ? 22.038  15.081  -7.322  1.00 32.99  ? 118 PHE C CE2   1 
ATOM   4398 C  CZ    . PHE C 1 42  ? 21.463  15.293  -8.562  1.00 40.96  ? 118 PHE C CZ    1 
ATOM   4399 N  N     . LEU C 1 43  ? 26.585  15.980  -5.939  1.00 42.74  ? 119 LEU C N     1 
ATOM   4400 C  CA    . LEU C 1 43  ? 26.254  16.790  -4.776  1.00 47.61  ? 119 LEU C CA    1 
ATOM   4401 C  C     . LEU C 1 43  ? 27.153  18.008  -4.684  1.00 46.27  ? 119 LEU C C     1 
ATOM   4402 O  O     . LEU C 1 43  ? 26.721  19.052  -4.227  1.00 43.13  ? 119 LEU C O     1 
ATOM   4403 C  CB    . LEU C 1 43  ? 26.326  15.970  -3.484  1.00 42.77  ? 119 LEU C CB    1 
ATOM   4404 C  CG    . LEU C 1 43  ? 25.248  14.889  -3.334  1.00 42.01  ? 119 LEU C CG    1 
ATOM   4405 C  CD1   . LEU C 1 43  ? 25.488  14.026  -2.105  1.00 39.40  ? 119 LEU C CD1   1 
ATOM   4406 C  CD2   . LEU C 1 43  ? 23.865  15.508  -3.290  1.00 36.80  ? 119 LEU C CD2   1 
ATOM   4407 N  N     . SER C 1 44  ? 28.397  17.868  -5.131  1.00 50.57  ? 120 SER C N     1 
ATOM   4408 C  CA    . SER C 1 44  ? 29.355  18.966  -5.077  1.00 47.09  ? 120 SER C CA    1 
ATOM   4409 C  C     . SER C 1 44  ? 29.027  20.044  -6.098  1.00 48.46  ? 120 SER C C     1 
ATOM   4410 O  O     . SER C 1 44  ? 29.105  21.226  -5.794  1.00 47.70  ? 120 SER C O     1 
ATOM   4411 C  CB    . SER C 1 44  ? 30.783  18.462  -5.253  1.00 44.38  ? 120 SER C CB    1 
ATOM   4412 O  OG    . SER C 1 44  ? 31.158  17.679  -4.135  1.00 48.50  ? 120 SER C OG    1 
ATOM   4413 N  N     . ARG C 1 45  ? 28.632  19.638  -7.298  1.00 47.66  ? 121 ARG C N     1 
ATOM   4414 C  CA    . ARG C 1 45  ? 28.182  20.607  -8.292  1.00 49.07  ? 121 ARG C CA    1 
ATOM   4415 C  C     . ARG C 1 45  ? 26.946  21.378  -7.797  1.00 48.13  ? 121 ARG C C     1 
ATOM   4416 O  O     . ARG C 1 45  ? 26.797  22.571  -8.066  1.00 46.74  ? 121 ARG C O     1 
ATOM   4417 C  CB    . ARG C 1 45  ? 27.911  19.919  -9.636  1.00 42.89  ? 121 ARG C CB    1 
ATOM   4418 C  CG    . ARG C 1 45  ? 29.176  19.437  -10.331 1.00 53.95  ? 121 ARG C CG    1 
ATOM   4419 C  CD    . ARG C 1 45  ? 28.871  18.546  -11.527 1.00 57.21  ? 121 ARG C CD    1 
ATOM   4420 N  NE    . ARG C 1 45  ? 27.883  19.157  -12.410 1.00 64.11  ? 121 ARG C NE    1 
ATOM   4421 C  CZ    . ARG C 1 45  ? 28.175  20.002  -13.395 1.00 67.93  ? 121 ARG C CZ    1 
ATOM   4422 N  NH1   . ARG C 1 45  ? 29.437  20.344  -13.638 1.00 59.53  ? 121 ARG C NH1   1 
ATOM   4423 N  NH2   . ARG C 1 45  ? 27.201  20.506  -14.141 1.00 64.97  ? 121 ARG C NH2   1 
ATOM   4424 N  N     . LYS C 1 46  ? 26.071  20.693  -7.065  1.00 50.29  ? 122 LYS C N     1 
ATOM   4425 C  CA    . LYS C 1 46  ? 24.843  21.303  -6.566  1.00 46.02  ? 122 LYS C CA    1 
ATOM   4426 C  C     . LYS C 1 46  ? 25.080  22.033  -5.248  1.00 47.70  ? 122 LYS C C     1 
ATOM   4427 O  O     . LYS C 1 46  ? 24.144  22.581  -4.646  1.00 45.71  ? 122 LYS C O     1 
ATOM   4428 C  CB    . LYS C 1 46  ? 23.733  20.253  -6.420  1.00 42.98  ? 122 LYS C CB    1 
ATOM   4429 C  CG    . LYS C 1 46  ? 23.173  19.781  -7.760  1.00 47.32  ? 122 LYS C CG    1 
ATOM   4430 C  CD    . LYS C 1 46  ? 22.233  18.602  -7.597  1.00 48.54  ? 122 LYS C CD    1 
ATOM   4431 C  CE    . LYS C 1 46  ? 21.048  18.982  -6.726  1.00 46.04  ? 122 LYS C CE    1 
ATOM   4432 N  NZ    . LYS C 1 46  ? 20.070  19.762  -7.517  1.00 38.63  ? 122 LYS C NZ    1 
ATOM   4433 N  N     . LYS C 1 47  ? 26.337  22.030  -4.811  1.00 43.20  ? 123 LYS C N     1 
ATOM   4434 C  CA    . LYS C 1 47  ? 26.758  22.770  -3.627  1.00 47.47  ? 123 LYS C CA    1 
ATOM   4435 C  C     . LYS C 1 47  ? 26.072  22.283  -2.350  1.00 46.87  ? 123 LYS C C     1 
ATOM   4436 O  O     . LYS C 1 47  ? 25.711  23.080  -1.487  1.00 43.59  ? 123 LYS C O     1 
ATOM   4437 C  CB    . LYS C 1 47  ? 26.551  24.281  -3.829  1.00 47.59  ? 123 LYS C CB    1 
ATOM   4438 C  CG    . LYS C 1 47  ? 27.266  24.831  -5.062  1.00 51.20  ? 123 LYS C CG    1 
ATOM   4439 C  CD    . LYS C 1 47  ? 27.023  26.323  -5.265  1.00 52.30  ? 123 LYS C CD    1 
ATOM   4440 C  CE    . LYS C 1 47  ? 27.860  26.852  -6.430  1.00 50.28  ? 123 LYS C CE    1 
ATOM   4441 N  NZ    . LYS C 1 47  ? 27.528  28.274  -6.738  1.00 64.46  ? 123 LYS C NZ    1 
ATOM   4442 N  N     . ILE C 1 48  ? 25.907  20.967  -2.229  1.00 48.30  ? 124 ILE C N     1 
ATOM   4443 C  CA    . ILE C 1 48  ? 25.324  20.383  -1.020  1.00 47.95  ? 124 ILE C CA    1 
ATOM   4444 C  C     . ILE C 1 48  ? 26.407  19.764  -0.142  1.00 45.49  ? 124 ILE C C     1 
ATOM   4445 O  O     . ILE C 1 48  ? 27.115  18.859  -0.557  1.00 50.42  ? 124 ILE C O     1 
ATOM   4446 C  CB    . ILE C 1 48  ? 24.226  19.343  -1.358  1.00 43.81  ? 124 ILE C CB    1 
ATOM   4447 C  CG1   . ILE C 1 48  ? 22.978  20.060  -1.864  1.00 45.44  ? 124 ILE C CG1   1 
ATOM   4448 C  CG2   . ILE C 1 48  ? 23.851  18.525  -0.139  1.00 41.46  ? 124 ILE C CG2   1 
ATOM   4449 C  CD1   . ILE C 1 48  ? 22.240  19.302  -2.921  1.00 46.00  ? 124 ILE C CD1   1 
ATOM   4450 N  N     . ARG C 1 49  ? 26.548  20.278  1.070   1.00 45.28  ? 125 ARG C N     1 
ATOM   4451 C  CA    . ARG C 1 49  ? 27.496  19.716  2.015   1.00 49.43  ? 125 ARG C CA    1 
ATOM   4452 C  C     . ARG C 1 49  ? 26.991  18.327  2.415   1.00 47.76  ? 125 ARG C C     1 
ATOM   4453 O  O     . ARG C 1 49  ? 25.836  18.172  2.819   1.00 42.29  ? 125 ARG C O     1 
ATOM   4454 C  CB    . ARG C 1 49  ? 27.621  20.633  3.239   1.00 53.46  ? 125 ARG C CB    1 
ATOM   4455 C  CG    . ARG C 1 49  ? 27.876  22.105  2.890   1.00 53.60  ? 125 ARG C CG    1 
ATOM   4456 C  CD    . ARG C 1 49  ? 27.633  23.019  4.091   1.00 55.02  ? 125 ARG C CD    1 
ATOM   4457 N  NE    . ARG C 1 49  ? 28.861  23.386  4.781   1.00 59.90  ? 125 ARG C NE    1 
ATOM   4458 C  CZ    . ARG C 1 49  ? 29.317  24.630  4.895   1.00 57.88  ? 125 ARG C CZ    1 
ATOM   4459 N  NH1   . ARG C 1 49  ? 28.641  25.646  4.373   1.00 55.81  ? 125 ARG C NH1   1 
ATOM   4460 N  NH2   . ARG C 1 49  ? 30.454  24.855  5.543   1.00 55.67  ? 125 ARG C NH2   1 
ATOM   4461 N  N     . HIS C 1 50  ? 27.846  17.316  2.296   1.00 48.20  ? 126 HIS C N     1 
ATOM   4462 C  CA    . HIS C 1 50  ? 27.382  15.941  2.435   1.00 45.23  ? 126 HIS C CA    1 
ATOM   4463 C  C     . HIS C 1 50  ? 28.438  14.991  2.946   1.00 44.42  ? 126 HIS C C     1 
ATOM   4464 O  O     . HIS C 1 50  ? 29.626  15.283  2.916   1.00 44.57  ? 126 HIS C O     1 
ATOM   4465 C  CB    . HIS C 1 50  ? 26.907  15.429  1.089   1.00 39.15  ? 126 HIS C CB    1 
ATOM   4466 C  CG    . HIS C 1 50  ? 28.008  15.297  0.086   1.00 49.01  ? 126 HIS C CG    1 
ATOM   4467 N  ND1   . HIS C 1 50  ? 28.301  16.283  -0.831  1.00 48.41  ? 126 HIS C ND1   1 
ATOM   4468 C  CD2   . HIS C 1 50  ? 28.896  14.301  -0.138  1.00 45.45  ? 126 HIS C CD2   1 
ATOM   4469 C  CE1   . HIS C 1 50  ? 29.314  15.895  -1.582  1.00 42.94  ? 126 HIS C CE1   1 
ATOM   4470 N  NE2   . HIS C 1 50  ? 29.695  14.698  -1.182  1.00 44.14  ? 126 HIS C NE2   1 
ATOM   4471 N  N     . HIS C 1 51  ? 27.979  13.837  3.406   1.00 47.44  ? 127 HIS C N     1 
ATOM   4472 C  CA    . HIS C 1 51  ? 28.846  12.711  3.699   1.00 41.92  ? 127 HIS C CA    1 
ATOM   4473 C  C     . HIS C 1 51  ? 28.052  11.466  3.394   1.00 43.60  ? 127 HIS C C     1 
ATOM   4474 O  O     . HIS C 1 51  ? 26.846  11.426  3.618   1.00 45.94  ? 127 HIS C O     1 
ATOM   4475 C  CB    . HIS C 1 51  ? 29.260  12.707  5.166   1.00 50.97  ? 127 HIS C CB    1 
ATOM   4476 C  CG    . HIS C 1 51  ? 30.245  11.635  5.508   1.00 48.28  ? 127 HIS C CG    1 
ATOM   4477 N  ND1   . HIS C 1 51  ? 31.607  11.822  5.424   1.00 55.35  ? 127 HIS C ND1   1 
ATOM   4478 C  CD2   . HIS C 1 51  ? 30.067  10.359  5.921   1.00 45.75  ? 127 HIS C CD2   1 
ATOM   4479 C  CE1   . HIS C 1 51  ? 32.227  10.710  5.774   1.00 55.76  ? 127 HIS C CE1   1 
ATOM   4480 N  NE2   . HIS C 1 51  ? 31.314  9.807   6.087   1.00 49.36  ? 127 HIS C NE2   1 
ATOM   4481 N  N     . ILE C 1 52  ? 28.719  10.443  2.883   1.00 45.43  ? 128 ILE C N     1 
ATOM   4482 C  CA    . ILE C 1 52  ? 28.024  9.235   2.453   1.00 44.54  ? 128 ILE C CA    1 
ATOM   4483 C  C     . ILE C 1 52  ? 28.250  8.075   3.420   1.00 39.57  ? 128 ILE C C     1 
ATOM   4484 O  O     . ILE C 1 52  ? 29.389  7.674   3.660   1.00 41.43  ? 128 ILE C O     1 
ATOM   4485 C  CB    . ILE C 1 52  ? 28.470  8.821   1.033   1.00 43.58  ? 128 ILE C CB    1 
ATOM   4486 C  CG1   . ILE C 1 52  ? 28.235  9.984   0.058   1.00 39.28  ? 128 ILE C CG1   1 
ATOM   4487 C  CG2   . ILE C 1 52  ? 27.765  7.520   0.604   1.00 37.31  ? 128 ILE C CG2   1 
ATOM   4488 C  CD1   . ILE C 1 52  ? 28.948  9.831   -1.295  1.00 37.58  ? 128 ILE C CD1   1 
ATOM   4489 N  N     . TYR C 1 53  ? 27.167  7.550   3.984   1.00 33.89  ? 129 TYR C N     1 
ATOM   4490 C  CA    . TYR C 1 53  ? 27.283  6.439   4.922   1.00 38.78  ? 129 TYR C CA    1 
ATOM   4491 C  C     . TYR C 1 53  ? 26.813  5.155   4.273   1.00 33.53  ? 129 TYR C C     1 
ATOM   4492 O  O     . TYR C 1 53  ? 25.665  5.048   3.841   1.00 34.54  ? 129 TYR C O     1 
ATOM   4493 C  CB    . TYR C 1 53  ? 26.481  6.700   6.194   1.00 35.40  ? 129 TYR C CB    1 
ATOM   4494 C  CG    . TYR C 1 53  ? 27.015  7.821   7.055   1.00 43.59  ? 129 TYR C CG    1 
ATOM   4495 C  CD1   . TYR C 1 53  ? 26.584  9.133   6.871   1.00 40.60  ? 129 TYR C CD1   1 
ATOM   4496 C  CD2   . TYR C 1 53  ? 27.944  7.568   8.062   1.00 44.56  ? 129 TYR C CD2   1 
ATOM   4497 C  CE1   . TYR C 1 53  ? 27.071  10.165  7.659   1.00 39.76  ? 129 TYR C CE1   1 
ATOM   4498 C  CE2   . TYR C 1 53  ? 28.428  8.597   8.863   1.00 47.47  ? 129 TYR C CE2   1 
ATOM   4499 C  CZ    . TYR C 1 53  ? 27.984  9.894   8.655   1.00 44.53  ? 129 TYR C CZ    1 
ATOM   4500 O  OH    . TYR C 1 53  ? 28.467  10.922  9.446   1.00 45.68  ? 129 TYR C OH    1 
ATOM   4501 N  N     . VAL C 1 54  ? 27.715  4.189   4.176   1.00 34.93  ? 130 VAL C N     1 
ATOM   4502 C  CA    . VAL C 1 54  ? 27.362  2.894   3.624   1.00 30.22  ? 130 VAL C CA    1 
ATOM   4503 C  C     . VAL C 1 54  ? 26.952  1.960   4.772   1.00 37.09  ? 130 VAL C C     1 
ATOM   4504 O  O     . VAL C 1 54  ? 27.774  1.562   5.600   1.00 37.18  ? 130 VAL C O     1 
ATOM   4505 C  CB    . VAL C 1 54  ? 28.507  2.313   2.785   1.00 35.11  ? 130 VAL C CB    1 
ATOM   4506 C  CG1   . VAL C 1 54  ? 28.118  0.972   2.200   1.00 30.67  ? 130 VAL C CG1   1 
ATOM   4507 C  CG2   . VAL C 1 54  ? 28.866  3.276   1.669   1.00 34.98  ? 130 VAL C CG2   1 
ATOM   4508 N  N     . LEU C 1 55  ? 25.663  1.646   4.830   1.00 34.35  ? 131 LEU C N     1 
ATOM   4509 C  CA    . LEU C 1 55  ? 25.109  0.860   5.922   1.00 36.30  ? 131 LEU C CA    1 
ATOM   4510 C  C     . LEU C 1 55  ? 25.126  -0.618  5.537   1.00 35.88  ? 131 LEU C C     1 
ATOM   4511 O  O     . LEU C 1 55  ? 24.180  -1.131  4.932   1.00 36.33  ? 131 LEU C O     1 
ATOM   4512 C  CB    . LEU C 1 55  ? 23.695  1.362   6.268   1.00 31.87  ? 131 LEU C CB    1 
ATOM   4513 C  CG    . LEU C 1 55  ? 23.682  2.902   6.255   1.00 33.98  ? 131 LEU C CG    1 
ATOM   4514 C  CD1   . LEU C 1 55  ? 22.289  3.486   6.307   1.00 31.50  ? 131 LEU C CD1   1 
ATOM   4515 C  CD2   . LEU C 1 55  ? 24.544  3.484   7.368   1.00 31.27  ? 131 LEU C CD2   1 
ATOM   4516 N  N     . ASN C 1 56  ? 26.227  -1.282  5.883   1.00 34.83  ? 132 ASN C N     1 
ATOM   4517 C  CA    . ASN C 1 56  ? 26.520  -2.644  5.428   1.00 34.30  ? 132 ASN C CA    1 
ATOM   4518 C  C     . ASN C 1 56  ? 25.980  -3.746  6.351   1.00 36.04  ? 132 ASN C C     1 
ATOM   4519 O  O     . ASN C 1 56  ? 26.595  -4.062  7.366   1.00 37.82  ? 132 ASN C O     1 
ATOM   4520 C  CB    . ASN C 1 56  ? 28.032  -2.795  5.305   1.00 37.23  ? 132 ASN C CB    1 
ATOM   4521 C  CG    . ASN C 1 56  ? 28.437  -4.051  4.571   1.00 36.22  ? 132 ASN C CG    1 
ATOM   4522 O  OD1   . ASN C 1 56  ? 27.659  -4.616  3.806   1.00 38.42  ? 132 ASN C OD1   1 
ATOM   4523 N  ND2   . ASN C 1 56  ? 29.670  -4.491  4.794   1.00 36.06  ? 132 ASN C ND2   1 
ATOM   4524 N  N     . GLN C 1 57  ? 24.838  -4.328  5.998   1.00 34.98  ? 133 GLN C N     1 
ATOM   4525 C  CA    . GLN C 1 57  ? 24.237  -5.391  6.808   1.00 41.26  ? 133 GLN C CA    1 
ATOM   4526 C  C     . GLN C 1 57  ? 25.081  -6.665  6.842   1.00 41.60  ? 133 GLN C C     1 
ATOM   4527 O  O     . GLN C 1 57  ? 25.062  -7.453  5.897   1.00 47.79  ? 133 GLN C O     1 
ATOM   4528 C  CB    . GLN C 1 57  ? 22.821  -5.710  6.319   1.00 38.23  ? 133 GLN C CB    1 
ATOM   4529 C  CG    . GLN C 1 57  ? 22.106  -6.709  7.201   1.00 40.09  ? 133 GLN C CG    1 
ATOM   4530 C  CD    . GLN C 1 57  ? 20.634  -6.876  6.861   1.00 40.80  ? 133 GLN C CD    1 
ATOM   4531 O  OE1   . GLN C 1 57  ? 20.031  -6.051  6.160   1.00 38.77  ? 133 GLN C OE1   1 
ATOM   4532 N  NE2   . GLN C 1 57  ? 20.047  -7.956  7.358   1.00 36.93  ? 133 GLN C NE2   1 
ATOM   4533 N  N     . VAL C 1 58  ? 25.808  -6.876  7.938   1.00 46.01  ? 134 VAL C N     1 
ATOM   4534 C  CA    . VAL C 1 58  ? 26.753  -7.992  8.016   1.00 44.88  ? 134 VAL C CA    1 
ATOM   4535 C  C     . VAL C 1 58  ? 26.285  -9.152  8.887   1.00 44.59  ? 134 VAL C C     1 
ATOM   4536 O  O     . VAL C 1 58  ? 27.029  -10.109 9.076   1.00 44.47  ? 134 VAL C O     1 
ATOM   4537 C  CB    . VAL C 1 58  ? 28.141  -7.558  8.522   1.00 46.39  ? 134 VAL C CB    1 
ATOM   4538 C  CG1   . VAL C 1 58  ? 28.815  -6.651  7.511   1.00 40.35  ? 134 VAL C CG1   1 
ATOM   4539 C  CG2   . VAL C 1 58  ? 28.019  -6.879  9.878   1.00 45.81  ? 134 VAL C CG2   1 
ATOM   4540 N  N     . ASP C 1 59  ? 25.065  -9.073  9.411   1.00 41.32  ? 135 ASP C N     1 
ATOM   4541 C  CA    . ASP C 1 59  ? 24.417  -10.257 9.978   1.00 47.36  ? 135 ASP C CA    1 
ATOM   4542 C  C     . ASP C 1 59  ? 23.993  -11.157 8.826   1.00 44.64  ? 135 ASP C C     1 
ATOM   4543 O  O     . ASP C 1 59  ? 24.164  -10.798 7.656   1.00 41.59  ? 135 ASP C O     1 
ATOM   4544 C  CB    . ASP C 1 59  ? 23.194  -9.880  10.820  1.00 41.93  ? 135 ASP C CB    1 
ATOM   4545 C  CG    . ASP C 1 59  ? 22.192  -9.054  10.042  1.00 43.95  ? 135 ASP C CG    1 
ATOM   4546 O  OD1   . ASP C 1 59  ? 21.473  -9.614  9.190   1.00 44.83  ? 135 ASP C OD1   1 
ATOM   4547 O  OD2   . ASP C 1 59  ? 22.128  -7.835  10.270  1.00 41.93  ? 135 ASP C OD2   1 
ATOM   4548 N  N     . HIS C 1 60  ? 23.430  -12.319 9.151   1.00 40.73  ? 136 HIS C N     1 
ATOM   4549 C  CA    . HIS C 1 60  ? 23.009  -13.275 8.128   1.00 43.22  ? 136 HIS C CA    1 
ATOM   4550 C  C     . HIS C 1 60  ? 21.494  -13.350 7.970   1.00 43.21  ? 136 HIS C C     1 
ATOM   4551 O  O     . HIS C 1 60  ? 20.959  -14.309 7.412   1.00 46.12  ? 136 HIS C O     1 
ATOM   4552 C  CB    . HIS C 1 60  ? 23.599  -14.668 8.389   1.00 44.59  ? 136 HIS C CB    1 
ATOM   4553 C  CG    . HIS C 1 60  ? 25.092  -14.697 8.353   1.00 43.72  ? 136 HIS C CG    1 
ATOM   4554 N  ND1   . HIS C 1 60  ? 25.828  -15.803 8.720   1.00 49.18  ? 136 HIS C ND1   1 
ATOM   4555 C  CD2   . HIS C 1 60  ? 25.991  -13.748 7.996   1.00 47.70  ? 136 HIS C CD2   1 
ATOM   4556 C  CE1   . HIS C 1 60  ? 27.114  -15.537 8.586   1.00 51.68  ? 136 HIS C CE1   1 
ATOM   4557 N  NE2   . HIS C 1 60  ? 27.242  -14.295 8.150   1.00 49.44  ? 136 HIS C NE2   1 
ATOM   4558 N  N     . PHE C 1 61  ? 20.806  -12.322 8.444   1.00 44.11  ? 137 PHE C N     1 
ATOM   4559 C  CA    . PHE C 1 61  ? 19.370  -12.240 8.262   1.00 43.56  ? 137 PHE C CA    1 
ATOM   4560 C  C     . PHE C 1 61  ? 19.030  -11.719 6.876   1.00 45.34  ? 137 PHE C C     1 
ATOM   4561 O  O     . PHE C 1 61  ? 19.914  -11.278 6.130   1.00 45.15  ? 137 PHE C O     1 
ATOM   4562 C  CB    . PHE C 1 61  ? 18.775  -11.348 9.344   1.00 44.68  ? 137 PHE C CB    1 
ATOM   4563 C  CG    . PHE C 1 61  ? 18.987  -11.876 10.731  1.00 47.22  ? 137 PHE C CG    1 
ATOM   4564 C  CD1   . PHE C 1 61  ? 18.931  -13.245 10.976  1.00 50.78  ? 137 PHE C CD1   1 
ATOM   4565 C  CD2   . PHE C 1 61  ? 19.259  -11.020 11.785  1.00 47.02  ? 137 PHE C CD2   1 
ATOM   4566 C  CE1   . PHE C 1 61  ? 19.126  -13.740 12.248  1.00 51.85  ? 137 PHE C CE1   1 
ATOM   4567 C  CE2   . PHE C 1 61  ? 19.453  -11.512 13.065  1.00 44.99  ? 137 PHE C CE2   1 
ATOM   4568 C  CZ    . PHE C 1 61  ? 19.384  -12.872 13.295  1.00 48.52  ? 137 PHE C CZ    1 
ATOM   4569 N  N     . ARG C 1 62  ? 17.754  -11.787 6.516   1.00 38.13  ? 138 ARG C N     1 
ATOM   4570 C  CA    . ARG C 1 62  ? 17.312  -11.226 5.243   1.00 36.35  ? 138 ARG C CA    1 
ATOM   4571 C  C     . ARG C 1 62  ? 17.558  -9.717  5.204   1.00 43.01  ? 138 ARG C C     1 
ATOM   4572 O  O     . ARG C 1 62  ? 17.616  -9.052  6.253   1.00 40.72  ? 138 ARG C O     1 
ATOM   4573 C  CB    . ARG C 1 62  ? 15.841  -11.567 4.986   1.00 42.69  ? 138 ARG C CB    1 
ATOM   4574 C  CG    . ARG C 1 62  ? 15.576  -13.083 5.016   1.00 51.68  ? 138 ARG C CG    1 
ATOM   4575 C  CD    . ARG C 1 62  ? 14.662  -13.535 3.895   1.00 40.40  ? 138 ARG C CD    1 
ATOM   4576 N  NE    . ARG C 1 62  ? 13.266  -13.200 4.139   1.00 45.72  ? 138 ARG C NE    1 
ATOM   4577 C  CZ    . ARG C 1 62  ? 12.352  -13.056 3.186   1.00 44.88  ? 138 ARG C CZ    1 
ATOM   4578 N  NH1   . ARG C 1 62  ? 12.680  -13.199 1.916   1.00 49.75  ? 138 ARG C NH1   1 
ATOM   4579 N  NH2   . ARG C 1 62  ? 11.108  -12.757 3.504   1.00 61.16  ? 138 ARG C NH2   1 
ATOM   4580 N  N     . PHE C 1 63  ? 17.714  -9.173  4.001   1.00 37.91  ? 139 PHE C N     1 
ATOM   4581 C  CA    . PHE C 1 63  ? 18.105  -7.782  3.878   1.00 35.03  ? 139 PHE C CA    1 
ATOM   4582 C  C     . PHE C 1 63  ? 17.019  -6.838  4.390   1.00 39.66  ? 139 PHE C C     1 
ATOM   4583 O  O     . PHE C 1 63  ? 15.868  -6.874  3.930   1.00 38.90  ? 139 PHE C O     1 
ATOM   4584 C  CB    . PHE C 1 63  ? 18.492  -7.430  2.443   1.00 31.03  ? 139 PHE C CB    1 
ATOM   4585 C  CG    . PHE C 1 63  ? 19.060  -6.046  2.305   1.00 35.80  ? 139 PHE C CG    1 
ATOM   4586 C  CD1   . PHE C 1 63  ? 20.372  -5.785  2.664   1.00 35.51  ? 139 PHE C CD1   1 
ATOM   4587 C  CD2   . PHE C 1 63  ? 18.276  -5.002  1.853   1.00 34.69  ? 139 PHE C CD2   1 
ATOM   4588 C  CE1   . PHE C 1 63  ? 20.893  -4.518  2.542   1.00 32.56  ? 139 PHE C CE1   1 
ATOM   4589 C  CE2   . PHE C 1 63  ? 18.793  -3.744  1.736   1.00 32.34  ? 139 PHE C CE2   1 
ATOM   4590 C  CZ    . PHE C 1 63  ? 20.104  -3.501  2.076   1.00 32.78  ? 139 PHE C CZ    1 
ATOM   4591 N  N     . ASN C 1 64  ? 17.397  -5.986  5.336   1.00 35.59  ? 140 ASN C N     1 
ATOM   4592 C  CA    . ASN C 1 64  ? 16.432  -5.098  5.987   1.00 38.49  ? 140 ASN C CA    1 
ATOM   4593 C  C     . ASN C 1 64  ? 16.752  -3.628  5.701   1.00 37.53  ? 140 ASN C C     1 
ATOM   4594 O  O     . ASN C 1 64  ? 17.425  -2.966  6.497   1.00 39.97  ? 140 ASN C O     1 
ATOM   4595 C  CB    . ASN C 1 64  ? 16.403  -5.375  7.498   1.00 38.49  ? 140 ASN C CB    1 
ATOM   4596 C  CG    . ASN C 1 64  ? 15.172  -4.804  8.192   1.00 38.53  ? 140 ASN C CG    1 
ATOM   4597 O  OD1   . ASN C 1 64  ? 14.604  -3.797  7.774   1.00 42.80  ? 140 ASN C OD1   1 
ATOM   4598 N  ND2   . ASN C 1 64  ? 14.768  -5.449  9.276   1.00 44.00  ? 140 ASN C ND2   1 
ATOM   4599 N  N     . ARG C 1 65  ? 16.269  -3.128  4.561   1.00 40.05  ? 141 ARG C N     1 
ATOM   4600 C  CA    . ARG C 1 65  ? 16.570  -1.762  4.136   1.00 35.63  ? 141 ARG C CA    1 
ATOM   4601 C  C     . ARG C 1 65  ? 16.192  -0.720  5.196   1.00 39.71  ? 141 ARG C C     1 
ATOM   4602 O  O     . ARG C 1 65  ? 17.016  0.121   5.556   1.00 37.37  ? 141 ARG C O     1 
ATOM   4603 C  CB    . ARG C 1 65  ? 15.909  -1.408  2.794   1.00 31.62  ? 141 ARG C CB    1 
ATOM   4604 C  CG    . ARG C 1 65  ? 16.342  -0.019  2.315   1.00 35.44  ? 141 ARG C CG    1 
ATOM   4605 C  CD    . ARG C 1 65  ? 16.024  0.269   0.861   1.00 37.45  ? 141 ARG C CD    1 
ATOM   4606 N  NE    . ARG C 1 65  ? 14.783  1.012   0.753   1.00 45.74  ? 141 ARG C NE    1 
ATOM   4607 C  CZ    . ARG C 1 65  ? 14.694  2.314   0.521   1.00 42.91  ? 141 ARG C CZ    1 
ATOM   4608 N  NH1   . ARG C 1 65  ? 15.778  3.044   0.329   1.00 49.62  ? 141 ARG C NH1   1 
ATOM   4609 N  NH2   . ARG C 1 65  ? 13.503  2.884   0.465   1.00 50.83  ? 141 ARG C NH2   1 
ATOM   4610 N  N     . ALA C 1 66  ? 14.961  -0.798  5.704   1.00 42.08  ? 142 ALA C N     1 
ATOM   4611 C  CA    . ALA C 1 66  ? 14.443  0.200   6.646   1.00 38.41  ? 142 ALA C CA    1 
ATOM   4612 C  C     . ALA C 1 66  ? 15.176  0.238   7.997   1.00 37.45  ? 142 ALA C C     1 
ATOM   4613 O  O     . ALA C 1 66  ? 15.476  1.319   8.516   1.00 40.71  ? 142 ALA C O     1 
ATOM   4614 C  CB    . ALA C 1 66  ? 12.935  0.031   6.843   1.00 37.75  ? 142 ALA C CB    1 
ATOM   4615 N  N     . ALA C 1 67  ? 15.469  -0.923  8.571   1.00 39.16  ? 143 ALA C N     1 
ATOM   4616 C  CA    . ALA C 1 67  ? 16.203  -0.937  9.835   1.00 41.23  ? 143 ALA C CA    1 
ATOM   4617 C  C     . ALA C 1 67  ? 17.576  -0.288  9.667   1.00 38.93  ? 143 ALA C C     1 
ATOM   4618 O  O     . ALA C 1 67  ? 18.030  0.450   10.541  1.00 39.84  ? 143 ALA C O     1 
ATOM   4619 C  CB    . ALA C 1 67  ? 16.335  -2.347  10.390  1.00 35.81  ? 143 ALA C CB    1 
ATOM   4620 N  N     . LEU C 1 68  ? 18.221  -0.569  8.536   1.00 40.70  ? 144 LEU C N     1 
ATOM   4621 C  CA    . LEU C 1 68  ? 19.524  0.005   8.200   1.00 36.03  ? 144 LEU C CA    1 
ATOM   4622 C  C     . LEU C 1 68  ? 19.485  1.526   8.143   1.00 35.72  ? 144 LEU C C     1 
ATOM   4623 O  O     . LEU C 1 68  ? 20.434  2.197   8.562   1.00 37.22  ? 144 LEU C O     1 
ATOM   4624 C  CB    . LEU C 1 68  ? 20.010  -0.542  6.848   1.00 39.53  ? 144 LEU C CB    1 
ATOM   4625 C  CG    . LEU C 1 68  ? 20.447  -2.002  6.893   1.00 36.10  ? 144 LEU C CG    1 
ATOM   4626 C  CD1   . LEU C 1 68  ? 20.668  -2.555  5.495   1.00 35.37  ? 144 LEU C CD1   1 
ATOM   4627 C  CD2   . LEU C 1 68  ? 21.697  -2.165  7.756   1.00 33.50  ? 144 LEU C CD2   1 
ATOM   4628 N  N     . ILE C 1 69  ? 18.398  2.066   7.601   1.00 33.51  ? 145 ILE C N     1 
ATOM   4629 C  CA    . ILE C 1 69  ? 18.206  3.507   7.557   1.00 33.45  ? 145 ILE C CA    1 
ATOM   4630 C  C     . ILE C 1 69  ? 18.071  4.081   8.965   1.00 38.77  ? 145 ILE C C     1 
ATOM   4631 O  O     . ILE C 1 69  ? 18.605  5.154   9.245   1.00 42.24  ? 145 ILE C O     1 
ATOM   4632 C  CB    . ILE C 1 69  ? 16.980  3.904   6.721   1.00 36.17  ? 145 ILE C CB    1 
ATOM   4633 C  CG1   . ILE C 1 69  ? 17.039  3.247   5.345   1.00 39.91  ? 145 ILE C CG1   1 
ATOM   4634 C  CG2   . ILE C 1 69  ? 16.917  5.421   6.544   1.00 31.08  ? 145 ILE C CG2   1 
ATOM   4635 C  CD1   . ILE C 1 69  ? 18.209  3.678   4.523   1.00 38.07  ? 145 ILE C CD1   1 
ATOM   4636 N  N     . ASN C 1 70  ? 17.363  3.369   9.845   1.00 38.31  ? 146 ASN C N     1 
ATOM   4637 C  CA    . ASN C 1 70  ? 17.266  3.778   11.246  1.00 42.93  ? 146 ASN C CA    1 
ATOM   4638 C  C     . ASN C 1 70  ? 18.646  3.814   11.883  1.00 42.89  ? 146 ASN C C     1 
ATOM   4639 O  O     . ASN C 1 70  ? 19.010  4.787   12.544  1.00 40.41  ? 146 ASN C O     1 
ATOM   4640 C  CB    . ASN C 1 70  ? 16.366  2.839   12.048  1.00 38.11  ? 146 ASN C CB    1 
ATOM   4641 C  CG    . ASN C 1 70  ? 14.905  3.107   11.826  1.00 39.51  ? 146 ASN C CG    1 
ATOM   4642 O  OD1   . ASN C 1 70  ? 14.521  4.206   11.450  1.00 36.10  ? 146 ASN C OD1   1 
ATOM   4643 N  ND2   . ASN C 1 70  ? 14.070  2.092   12.070  1.00 41.54  ? 146 ASN C ND2   1 
ATOM   4644 N  N     . VAL C 1 71  ? 19.414  2.751   11.671  1.00 37.07  ? 147 VAL C N     1 
ATOM   4645 C  CA    . VAL C 1 71  ? 20.757  2.679   12.219  1.00 38.80  ? 147 VAL C CA    1 
ATOM   4646 C  C     . VAL C 1 71  ? 21.611  3.840   11.720  1.00 42.76  ? 147 VAL C C     1 
ATOM   4647 O  O     . VAL C 1 71  ? 22.318  4.469   12.502  1.00 42.77  ? 147 VAL C O     1 
ATOM   4648 C  CB    . VAL C 1 71  ? 21.419  1.335   11.912  1.00 32.56  ? 147 VAL C CB    1 
ATOM   4649 C  CG1   . VAL C 1 71  ? 22.858  1.321   12.400  1.00 40.97  ? 147 VAL C CG1   1 
ATOM   4650 C  CG2   . VAL C 1 71  ? 20.634  0.213   12.584  1.00 41.52  ? 147 VAL C CG2   1 
ATOM   4651 N  N     . GLY C 1 72  ? 21.520  4.134   10.422  1.00 40.38  ? 148 GLY C N     1 
ATOM   4652 C  CA    . GLY C 1 72  ? 22.301  5.199   9.827   1.00 41.15  ? 148 GLY C CA    1 
ATOM   4653 C  C     . GLY C 1 72  ? 21.907  6.546   10.406  1.00 41.90  ? 148 GLY C C     1 
ATOM   4654 O  O     . GLY C 1 72  ? 22.744  7.428   10.608  1.00 42.88  ? 148 GLY C O     1 
ATOM   4655 N  N     . PHE C 1 73  ? 20.619  6.700   10.680  1.00 41.07  ? 149 PHE C N     1 
ATOM   4656 C  CA    . PHE C 1 73  ? 20.141  7.914   11.293  1.00 40.85  ? 149 PHE C CA    1 
ATOM   4657 C  C     . PHE C 1 73  ? 20.782  8.106   12.665  1.00 41.87  ? 149 PHE C C     1 
ATOM   4658 O  O     . PHE C 1 73  ? 21.267  9.189   12.990  1.00 44.89  ? 149 PHE C O     1 
ATOM   4659 C  CB    . PHE C 1 73  ? 18.620  7.916   11.392  1.00 40.22  ? 149 PHE C CB    1 
ATOM   4660 C  CG    . PHE C 1 73  ? 18.057  9.243   11.808  1.00 43.87  ? 149 PHE C CG    1 
ATOM   4661 C  CD1   . PHE C 1 73  ? 17.945  9.575   13.151  1.00 43.29  ? 149 PHE C CD1   1 
ATOM   4662 C  CD2   . PHE C 1 73  ? 17.682  10.181  10.858  1.00 46.63  ? 149 PHE C CD2   1 
ATOM   4663 C  CE1   . PHE C 1 73  ? 17.446  10.809  13.537  1.00 47.96  ? 149 PHE C CE1   1 
ATOM   4664 C  CE2   . PHE C 1 73  ? 17.179  11.416  11.240  1.00 48.44  ? 149 PHE C CE2   1 
ATOM   4665 C  CZ    . PHE C 1 73  ? 17.057  11.726  12.587  1.00 43.48  ? 149 PHE C CZ    1 
ATOM   4666 N  N     . LEU C 1 74  ? 20.790  7.045   13.461  1.00 43.59  ? 150 LEU C N     1 
ATOM   4667 C  CA    . LEU C 1 74  ? 21.371  7.086   14.798  1.00 41.25  ? 150 LEU C CA    1 
ATOM   4668 C  C     . LEU C 1 74  ? 22.881  7.266   14.766  1.00 48.53  ? 150 LEU C C     1 
ATOM   4669 O  O     . LEU C 1 74  ? 23.448  7.988   15.584  1.00 51.89  ? 150 LEU C O     1 
ATOM   4670 C  CB    . LEU C 1 74  ? 21.016  5.803   15.558  1.00 40.17  ? 150 LEU C CB    1 
ATOM   4671 C  CG    . LEU C 1 74  ? 19.516  5.672   15.830  1.00 49.43  ? 150 LEU C CG    1 
ATOM   4672 C  CD1   . LEU C 1 74  ? 19.186  4.316   16.427  1.00 43.87  ? 150 LEU C CD1   1 
ATOM   4673 C  CD2   . LEU C 1 74  ? 19.030  6.823   16.740  1.00 43.27  ? 150 LEU C CD2   1 
ATOM   4674 N  N     . GLU C 1 75  ? 23.534  6.617   13.810  1.00 48.33  ? 151 GLU C N     1 
ATOM   4675 C  CA    . GLU C 1 75  ? 24.988  6.556   13.814  1.00 45.34  ? 151 GLU C CA    1 
ATOM   4676 C  C     . GLU C 1 75  ? 25.663  7.677   13.017  1.00 49.47  ? 151 GLU C C     1 
ATOM   4677 O  O     . GLU C 1 75  ? 26.886  7.782   13.019  1.00 52.52  ? 151 GLU C O     1 
ATOM   4678 C  CB    . GLU C 1 75  ? 25.449  5.183   13.334  1.00 45.55  ? 151 GLU C CB    1 
ATOM   4679 C  CG    . GLU C 1 75  ? 24.910  4.030   14.184  1.00 46.25  ? 151 GLU C CG    1 
ATOM   4680 C  CD    . GLU C 1 75  ? 25.617  3.907   15.525  1.00 52.19  ? 151 GLU C CD    1 
ATOM   4681 O  OE1   . GLU C 1 75  ? 26.847  4.123   15.568  1.00 49.27  ? 151 GLU C OE1   1 
ATOM   4682 O  OE2   . GLU C 1 75  ? 24.947  3.590   16.537  1.00 54.30  ? 151 GLU C OE2   1 
ATOM   4683 N  N     . SER C 1 76  ? 24.873  8.517   12.353  1.00 44.43  ? 152 SER C N     1 
ATOM   4684 C  CA    . SER C 1 76  ? 25.426  9.617   11.560  1.00 54.62  ? 152 SER C CA    1 
ATOM   4685 C  C     . SER C 1 76  ? 25.877  10.785  12.447  1.00 52.54  ? 152 SER C C     1 
ATOM   4686 O  O     . SER C 1 76  ? 25.428  10.912  13.584  1.00 48.48  ? 152 SER C O     1 
ATOM   4687 C  CB    . SER C 1 76  ? 24.406  10.106  10.523  1.00 48.35  ? 152 SER C CB    1 
ATOM   4688 O  OG    . SER C 1 76  ? 23.247  10.642  11.150  1.00 55.72  ? 152 SER C OG    1 
ATOM   4689 N  N     . SER C 1 77  ? 26.761  11.628  11.913  1.00 52.50  ? 153 SER C N     1 
ATOM   4690 C  CA    . SER C 1 77  ? 27.287  12.801  12.624  1.00 55.13  ? 153 SER C CA    1 
ATOM   4691 C  C     . SER C 1 77  ? 26.208  13.652  13.299  1.00 56.40  ? 153 SER C C     1 
ATOM   4692 O  O     . SER C 1 77  ? 25.162  13.900  12.703  1.00 56.63  ? 153 SER C O     1 
ATOM   4693 C  CB    . SER C 1 77  ? 28.070  13.691  11.659  1.00 55.47  ? 153 SER C CB    1 
ATOM   4694 O  OG    . SER C 1 77  ? 28.022  15.045  12.090  1.00 57.46  ? 153 SER C OG    1 
ATOM   4695 N  N     . ASN C 1 78  ? 26.478  14.102  14.530  1.00 53.91  ? 154 ASN C N     1 
ATOM   4696 C  CA    . ASN C 1 78  ? 25.557  14.970  15.281  1.00 54.35  ? 154 ASN C CA    1 
ATOM   4697 C  C     . ASN C 1 78  ? 25.152  16.215  14.512  1.00 51.09  ? 154 ASN C C     1 
ATOM   4698 O  O     . ASN C 1 78  ? 24.033  16.705  14.652  1.00 57.23  ? 154 ASN C O     1 
ATOM   4699 C  CB    . ASN C 1 78  ? 26.183  15.434  16.601  1.00 59.25  ? 154 ASN C CB    1 
ATOM   4700 C  CG    . ASN C 1 78  ? 26.593  14.284  17.495  1.00 68.34  ? 154 ASN C CG    1 
ATOM   4701 O  OD1   . ASN C 1 78  ? 25.988  13.209  17.468  1.00 73.21  ? 154 ASN C OD1   1 
ATOM   4702 N  ND2   . ASN C 1 78  ? 27.628  14.505  18.301  1.00 71.37  ? 154 ASN C ND2   1 
ATOM   4703 N  N     . SER C 1 79  ? 26.071  16.727  13.703  1.00 51.60  ? 155 SER C N     1 
ATOM   4704 C  CA    . SER C 1 79  ? 25.832  17.968  12.974  1.00 57.54  ? 155 SER C CA    1 
ATOM   4705 C  C     . SER C 1 79  ? 25.132  17.748  11.634  1.00 57.92  ? 155 SER C C     1 
ATOM   4706 O  O     . SER C 1 79  ? 24.992  18.685  10.843  1.00 57.36  ? 155 SER C O     1 
ATOM   4707 C  CB    . SER C 1 79  ? 27.134  18.753  12.790  1.00 49.70  ? 155 SER C CB    1 
ATOM   4708 O  OG    . SER C 1 79  ? 28.092  17.978  12.104  1.00 56.61  ? 155 SER C OG    1 
ATOM   4709 N  N     . THR C 1 80  ? 24.694  16.515  11.386  1.00 51.30  ? 156 THR C N     1 
ATOM   4710 C  CA    . THR C 1 80  ? 23.779  16.241  10.282  1.00 51.59  ? 156 THR C CA    1 
ATOM   4711 C  C     . THR C 1 80  ? 22.507  17.072  10.443  1.00 50.85  ? 156 THR C C     1 
ATOM   4712 O  O     . THR C 1 80  ? 21.876  17.042  11.502  1.00 46.43  ? 156 THR C O     1 
ATOM   4713 C  CB    . THR C 1 80  ? 23.348  14.753  10.262  1.00 53.68  ? 156 THR C CB    1 
ATOM   4714 O  OG1   . THR C 1 80  ? 24.484  13.918  10.016  1.00 50.81  ? 156 THR C OG1   1 
ATOM   4715 C  CG2   . THR C 1 80  ? 22.300  14.503  9.187   1.00 42.17  ? 156 THR C CG2   1 
ATOM   4716 N  N     . ASP C 1 81  ? 22.127  17.802  9.397   1.00 43.44  ? 157 ASP C N     1 
ATOM   4717 C  CA    . ASP C 1 81  ? 20.868  18.545  9.410   1.00 44.00  ? 157 ASP C CA    1 
ATOM   4718 C  C     . ASP C 1 81  ? 19.736  17.727  8.807   1.00 49.20  ? 157 ASP C C     1 
ATOM   4719 O  O     . ASP C 1 81  ? 18.574  17.876  9.194   1.00 46.22  ? 157 ASP C O     1 
ATOM   4720 C  CB    . ASP C 1 81  ? 21.004  19.868  8.643   1.00 49.86  ? 157 ASP C CB    1 
ATOM   4721 C  CG    . ASP C 1 81  ? 21.918  20.851  9.336   1.00 53.61  ? 157 ASP C CG    1 
ATOM   4722 O  OD1   . ASP C 1 81  ? 21.548  21.344  10.428  1.00 60.28  ? 157 ASP C OD1   1 
ATOM   4723 O  OD2   . ASP C 1 81  ? 23.003  21.132  8.787   1.00 56.74  ? 157 ASP C OD2   1 
ATOM   4724 N  N     . TYR C 1 82  ? 20.082  16.873  7.842   1.00 48.79  ? 158 TYR C N     1 
ATOM   4725 C  CA    . TYR C 1 82  ? 19.098  16.036  7.165   1.00 41.27  ? 158 TYR C CA    1 
ATOM   4726 C  C     . TYR C 1 82  ? 19.697  14.798  6.487   1.00 44.02  ? 158 TYR C C     1 
ATOM   4727 O  O     . TYR C 1 82  ? 20.908  14.671  6.349   1.00 40.36  ? 158 TYR C O     1 
ATOM   4728 C  CB    . TYR C 1 82  ? 18.266  16.856  6.178   1.00 42.38  ? 158 TYR C CB    1 
ATOM   4729 C  CG    . TYR C 1 82  ? 18.974  17.371  4.937   1.00 42.85  ? 158 TYR C CG    1 
ATOM   4730 C  CD1   . TYR C 1 82  ? 20.020  18.272  5.023   1.00 41.60  ? 158 TYR C CD1   1 
ATOM   4731 C  CD2   . TYR C 1 82  ? 18.550  16.987  3.669   1.00 41.73  ? 158 TYR C CD2   1 
ATOM   4732 C  CE1   . TYR C 1 82  ? 20.637  18.760  3.875   1.00 43.78  ? 158 TYR C CE1   1 
ATOM   4733 C  CE2   . TYR C 1 82  ? 19.154  17.470  2.526   1.00 39.94  ? 158 TYR C CE2   1 
ATOM   4734 C  CZ    . TYR C 1 82  ? 20.194  18.360  2.633   1.00 40.41  ? 158 TYR C CZ    1 
ATOM   4735 O  OH    . TYR C 1 82  ? 20.802  18.836  1.491   1.00 39.58  ? 158 TYR C OH    1 
ATOM   4736 N  N     . ILE C 1 83  ? 18.827  13.884  6.078   1.00 41.16  ? 159 ILE C N     1 
ATOM   4737 C  CA    . ILE C 1 83  ? 19.255  12.605  5.543   1.00 34.10  ? 159 ILE C CA    1 
ATOM   4738 C  C     . ILE C 1 83  ? 18.619  12.325  4.190   1.00 40.21  ? 159 ILE C C     1 
ATOM   4739 O  O     . ILE C 1 83  ? 17.506  12.783  3.894   1.00 37.34  ? 159 ILE C O     1 
ATOM   4740 C  CB    . ILE C 1 83  ? 18.911  11.452  6.490   1.00 33.84  ? 159 ILE C CB    1 
ATOM   4741 C  CG1   . ILE C 1 83  ? 17.399  11.360  6.694   1.00 38.65  ? 159 ILE C CG1   1 
ATOM   4742 C  CG2   . ILE C 1 83  ? 19.627  11.622  7.813   1.00 37.08  ? 159 ILE C CG2   1 
ATOM   4743 C  CD1   . ILE C 1 83  ? 16.758  10.229  5.947   1.00 39.66  ? 159 ILE C CD1   1 
ATOM   4744 N  N     . ALA C 1 84  ? 19.354  11.588  3.361   1.00 34.16  ? 160 ALA C N     1 
ATOM   4745 C  CA    . ALA C 1 84  ? 18.780  10.997  2.177   1.00 29.08  ? 160 ALA C CA    1 
ATOM   4746 C  C     . ALA C 1 84  ? 18.930  9.491   2.291   1.00 34.36  ? 160 ALA C C     1 
ATOM   4747 O  O     . ALA C 1 84  ? 20.037  8.959   2.364   1.00 35.31  ? 160 ALA C O     1 
ATOM   4748 C  CB    . ALA C 1 84  ? 19.436  11.522  0.925   1.00 32.02  ? 160 ALA C CB    1 
ATOM   4749 N  N     . MET C 1 85  ? 17.779  8.839   2.383   1.00 36.11  ? 161 MET C N     1 
ATOM   4750 C  CA    . MET C 1 85  ? 17.594  7.404   2.223   1.00 37.55  ? 161 MET C CA    1 
ATOM   4751 C  C     . MET C 1 85  ? 17.877  7.131   0.734   1.00 40.25  ? 161 MET C C     1 
ATOM   4752 O  O     . MET C 1 85  ? 17.096  7.564   -0.122  1.00 39.75  ? 161 MET C O     1 
ATOM   4753 C  CB    . MET C 1 85  ? 16.112  7.172   2.499   1.00 32.52  ? 161 MET C CB    1 
ATOM   4754 C  CG    . MET C 1 85  ? 15.713  5.901   3.077   1.00 45.18  ? 161 MET C CG    1 
ATOM   4755 S  SD    . MET C 1 85  ? 13.937  6.025   3.268   1.00 40.81  ? 161 MET C SD    1 
ATOM   4756 C  CE    . MET C 1 85  ? 13.821  7.347   4.494   1.00 39.29  ? 161 MET C CE    1 
ATOM   4757 N  N     . HIS C 1 86  ? 18.974  6.455   0.394   1.00 33.58  ? 162 HIS C N     1 
ATOM   4758 C  CA    . HIS C 1 86  ? 19.421  6.471   -1.018  1.00 35.98  ? 162 HIS C CA    1 
ATOM   4759 C  C     . HIS C 1 86  ? 19.922  5.117   -1.529  1.00 34.29  ? 162 HIS C C     1 
ATOM   4760 O  O     . HIS C 1 86  ? 20.969  4.632   -1.091  1.00 35.82  ? 162 HIS C O     1 
ATOM   4761 C  CB    . HIS C 1 86  ? 20.530  7.521   -1.207  1.00 31.22  ? 162 HIS C CB    1 
ATOM   4762 C  CG    . HIS C 1 86  ? 20.589  8.110   -2.586  1.00 40.59  ? 162 HIS C CG    1 
ATOM   4763 N  ND1   . HIS C 1 86  ? 20.794  7.350   -3.717  1.00 34.92  ? 162 HIS C ND1   1 
ATOM   4764 C  CD2   . HIS C 1 86  ? 20.485  9.394   -3.013  1.00 39.45  ? 162 HIS C CD2   1 
ATOM   4765 C  CE1   . HIS C 1 86  ? 20.793  8.136   -4.782  1.00 41.48  ? 162 HIS C CE1   1 
ATOM   4766 N  NE2   . HIS C 1 86  ? 20.613  9.382   -4.381  1.00 35.57  ? 162 HIS C NE2   1 
ATOM   4767 N  N     . ASP C 1 87  ? 19.190  4.505   -2.453  1.00 35.73  ? 163 ASP C N     1 
ATOM   4768 C  CA    . ASP C 1 87  ? 19.617  3.208   -2.995  1.00 38.36  ? 163 ASP C CA    1 
ATOM   4769 C  C     . ASP C 1 87  ? 20.960  3.335   -3.721  1.00 35.01  ? 163 ASP C C     1 
ATOM   4770 O  O     . ASP C 1 87  ? 21.233  4.351   -4.357  1.00 36.72  ? 163 ASP C O     1 
ATOM   4771 C  CB    . ASP C 1 87  ? 18.549  2.613   -3.907  1.00 34.53  ? 163 ASP C CB    1 
ATOM   4772 C  CG    . ASP C 1 87  ? 17.318  2.141   -3.139  1.00 42.60  ? 163 ASP C CG    1 
ATOM   4773 O  OD1   . ASP C 1 87  ? 17.361  2.081   -1.881  1.00 36.81  ? 163 ASP C OD1   1 
ATOM   4774 O  OD2   . ASP C 1 87  ? 16.309  1.807   -3.797  1.00 40.07  ? 163 ASP C OD2   1 
ATOM   4775 N  N     . VAL C 1 88  ? 21.806  2.320   -3.578  1.00 33.51  ? 164 VAL C N     1 
ATOM   4776 C  CA    . VAL C 1 88  ? 23.180  2.360   -4.066  1.00 33.35  ? 164 VAL C CA    1 
ATOM   4777 C  C     . VAL C 1 88  ? 23.262  2.219   -5.589  1.00 37.93  ? 164 VAL C C     1 
ATOM   4778 O  O     . VAL C 1 88  ? 24.332  2.395   -6.175  1.00 35.42  ? 164 VAL C O     1 
ATOM   4779 C  CB    . VAL C 1 88  ? 24.012  1.229   -3.449  1.00 33.80  ? 164 VAL C CB    1 
ATOM   4780 C  CG1   . VAL C 1 88  ? 23.671  -0.090  -4.121  1.00 35.58  ? 164 VAL C CG1   1 
ATOM   4781 C  CG2   . VAL C 1 88  ? 25.514  1.523   -3.544  1.00 33.10  ? 164 VAL C CG2   1 
ATOM   4782 N  N     . ASP C 1 89  ? 22.132  1.929   -6.229  1.00 31.45  ? 165 ASP C N     1 
ATOM   4783 C  CA    . ASP C 1 89  ? 22.130  1.593   -7.647  1.00 37.76  ? 165 ASP C CA    1 
ATOM   4784 C  C     . ASP C 1 89  ? 21.264  2.550   -8.444  1.00 39.76  ? 165 ASP C C     1 
ATOM   4785 O  O     . ASP C 1 89  ? 20.937  2.284   -9.602  1.00 35.28  ? 165 ASP C O     1 
ATOM   4786 C  CB    . ASP C 1 89  ? 21.626  0.160   -7.835  1.00 37.90  ? 165 ASP C CB    1 
ATOM   4787 C  CG    . ASP C 1 89  ? 20.160  0.009   -7.493  1.00 40.43  ? 165 ASP C CG    1 
ATOM   4788 O  OD1   . ASP C 1 89  ? 19.549  0.989   -7.004  1.00 37.57  ? 165 ASP C OD1   1 
ATOM   4789 O  OD2   . ASP C 1 89  ? 19.616  -1.098  -7.703  1.00 41.37  ? 165 ASP C OD2   1 
ATOM   4790 N  N     . LEU C 1 90  ? 20.860  3.641   -7.797  1.00 40.22  ? 166 LEU C N     1 
ATOM   4791 C  CA    . LEU C 1 90  ? 19.974  4.616   -8.411  1.00 35.45  ? 166 LEU C CA    1 
ATOM   4792 C  C     . LEU C 1 90  ? 20.684  5.962   -8.572  1.00 39.58  ? 166 LEU C C     1 
ATOM   4793 O  O     . LEU C 1 90  ? 20.766  6.739   -7.629  1.00 39.29  ? 166 LEU C O     1 
ATOM   4794 C  CB    . LEU C 1 90  ? 18.739  4.798   -7.550  1.00 41.22  ? 166 LEU C CB    1 
ATOM   4795 C  CG    . LEU C 1 90  ? 17.374  4.411   -8.103  1.00 47.06  ? 166 LEU C CG    1 
ATOM   4796 C  CD1   . LEU C 1 90  ? 16.326  5.154   -7.309  1.00 36.43  ? 166 LEU C CD1   1 
ATOM   4797 C  CD2   . LEU C 1 90  ? 17.240  4.699   -9.575  1.00 36.07  ? 166 LEU C CD2   1 
ATOM   4798 N  N     . LEU C 1 91  ? 21.184  6.240   -9.770  1.00 40.02  ? 167 LEU C N     1 
ATOM   4799 C  CA    . LEU C 1 91  ? 22.012  7.422   -9.984  1.00 35.84  ? 167 LEU C CA    1 
ATOM   4800 C  C     . LEU C 1 91  ? 21.216  8.552   -10.595 1.00 43.26  ? 167 LEU C C     1 
ATOM   4801 O  O     . LEU C 1 91  ? 20.712  8.410   -11.710 1.00 39.07  ? 167 LEU C O     1 
ATOM   4802 C  CB    . LEU C 1 91  ? 23.184  7.102   -10.902 1.00 43.02  ? 167 LEU C CB    1 
ATOM   4803 C  CG    . LEU C 1 91  ? 24.020  5.866   -10.572 1.00 48.72  ? 167 LEU C CG    1 
ATOM   4804 C  CD1   . LEU C 1 91  ? 25.190  5.752   -11.541 1.00 41.56  ? 167 LEU C CD1   1 
ATOM   4805 C  CD2   . LEU C 1 91  ? 24.495  5.901   -9.129  1.00 38.02  ? 167 LEU C CD2   1 
ATOM   4806 N  N     . PRO C 1 92  ? 21.106  9.681   -9.865  1.00 38.74  ? 168 PRO C N     1 
ATOM   4807 C  CA    . PRO C 1 92  ? 20.475  10.895  -10.398 1.00 42.35  ? 168 PRO C CA    1 
ATOM   4808 C  C     . PRO C 1 92  ? 21.262  11.411  -11.589 1.00 40.73  ? 168 PRO C C     1 
ATOM   4809 O  O     . PRO C 1 92  ? 22.470  11.577  -11.471 1.00 41.45  ? 168 PRO C O     1 
ATOM   4810 C  CB    . PRO C 1 92  ? 20.575  11.899  -9.233  1.00 37.22  ? 168 PRO C CB    1 
ATOM   4811 C  CG    . PRO C 1 92  ? 21.695  11.406  -8.386  1.00 42.42  ? 168 PRO C CG    1 
ATOM   4812 C  CD    . PRO C 1 92  ? 21.631  9.879   -8.502  1.00 36.73  ? 168 PRO C CD    1 
ATOM   4813 N  N     . LEU C 1 93  ? 20.586  11.652  -12.707 1.00 38.67  ? 169 LEU C N     1 
ATOM   4814 C  CA    . LEU C 1 93  ? 21.227  12.182  -13.904 1.00 41.89  ? 169 LEU C CA    1 
ATOM   4815 C  C     . LEU C 1 93  ? 20.779  13.614  -14.214 1.00 46.88  ? 169 LEU C C     1 
ATOM   4816 O  O     . LEU C 1 93  ? 21.279  14.245  -15.137 1.00 46.75  ? 169 LEU C O     1 
ATOM   4817 C  CB    . LEU C 1 93  ? 20.901  11.300  -15.098 1.00 42.24  ? 169 LEU C CB    1 
ATOM   4818 C  CG    . LEU C 1 93  ? 21.338  9.840   -15.011 1.00 46.64  ? 169 LEU C CG    1 
ATOM   4819 C  CD1   . LEU C 1 93  ? 20.974  9.121   -16.295 1.00 38.09  ? 169 LEU C CD1   1 
ATOM   4820 C  CD2   . LEU C 1 93  ? 22.838  9.746   -14.737 1.00 42.85  ? 169 LEU C CD2   1 
ATOM   4821 N  N     . ASN C 1 94  ? 19.828  14.117  -13.443 1.00 46.07  ? 170 ASN C N     1 
ATOM   4822 C  CA    . ASN C 1 94  ? 19.248  15.420  -13.706 1.00 42.01  ? 170 ASN C CA    1 
ATOM   4823 C  C     . ASN C 1 94  ? 19.509  16.336  -12.519 1.00 48.72  ? 170 ASN C C     1 
ATOM   4824 O  O     . ASN C 1 94  ? 19.037  16.091  -11.404 1.00 43.85  ? 170 ASN C O     1 
ATOM   4825 C  CB    . ASN C 1 94  ? 17.745  15.272  -13.957 1.00 42.78  ? 170 ASN C CB    1 
ATOM   4826 C  CG    . ASN C 1 94  ? 17.090  16.561  -14.418 1.00 52.44  ? 170 ASN C CG    1 
ATOM   4827 O  OD1   . ASN C 1 94  ? 17.522  17.660  -14.066 1.00 54.91  ? 170 ASN C OD1   1 
ATOM   4828 N  ND2   . ASN C 1 94  ? 16.027  16.429  -15.201 1.00 53.85  ? 170 ASN C ND2   1 
ATOM   4829 N  N     . GLU C 1 95  ? 20.247  17.410  -12.756 1.00 47.40  ? 171 GLU C N     1 
ATOM   4830 C  CA    . GLU C 1 95  ? 20.664  18.251  -11.645 1.00 48.93  ? 171 GLU C CA    1 
ATOM   4831 C  C     . GLU C 1 95  ? 19.540  19.122  -11.085 1.00 46.10  ? 171 GLU C C     1 
ATOM   4832 O  O     . GLU C 1 95  ? 19.701  19.767  -10.053 1.00 44.86  ? 171 GLU C O     1 
ATOM   4833 C  CB    . GLU C 1 95  ? 21.919  19.041  -12.016 1.00 52.71  ? 171 GLU C CB    1 
ATOM   4834 C  CG    . GLU C 1 95  ? 23.114  18.107  -12.203 1.00 50.39  ? 171 GLU C CG    1 
ATOM   4835 C  CD    . GLU C 1 95  ? 24.415  18.825  -12.503 1.00 67.77  ? 171 GLU C CD    1 
ATOM   4836 O  OE1   . GLU C 1 95  ? 25.374  18.147  -12.947 1.00 63.81  ? 171 GLU C OE1   1 
ATOM   4837 O  OE2   . GLU C 1 95  ? 24.482  20.057  -12.289 1.00 67.27  ? 171 GLU C OE2   1 
ATOM   4838 N  N     . GLU C 1 96  ? 18.386  19.097  -11.742 1.00 45.05  ? 172 GLU C N     1 
ATOM   4839 C  CA    . GLU C 1 96  ? 17.236  19.859  -11.278 1.00 45.39  ? 172 GLU C CA    1 
ATOM   4840 C  C     . GLU C 1 96  ? 16.533  19.200  -10.100 1.00 50.98  ? 172 GLU C C     1 
ATOM   4841 O  O     . GLU C 1 96  ? 15.639  19.798  -9.504  1.00 50.24  ? 172 GLU C O     1 
ATOM   4842 C  CB    . GLU C 1 96  ? 16.236  20.073  -12.418 1.00 57.62  ? 172 GLU C CB    1 
ATOM   4843 C  CG    . GLU C 1 96  ? 16.766  20.930  -13.559 1.00 63.71  ? 172 GLU C CG    1 
ATOM   4844 C  CD    . GLU C 1 96  ? 15.674  21.352  -14.529 1.00 75.77  ? 172 GLU C CD    1 
ATOM   4845 O  OE1   . GLU C 1 96  ? 14.522  20.870  -14.396 1.00 71.17  ? 172 GLU C OE1   1 
ATOM   4846 O  OE2   . GLU C 1 96  ? 15.970  22.172  -15.425 1.00 80.53  ? 172 GLU C OE2   1 
ATOM   4847 N  N     . LEU C 1 97  ? 16.923  17.968  -9.772  1.00 45.47  ? 173 LEU C N     1 
ATOM   4848 C  CA    . LEU C 1 97  ? 16.359  17.282  -8.615  1.00 43.64  ? 173 LEU C CA    1 
ATOM   4849 C  C     . LEU C 1 97  ? 16.745  18.003  -7.329  1.00 40.97  ? 173 LEU C C     1 
ATOM   4850 O  O     . LEU C 1 97  ? 17.910  18.324  -7.103  1.00 44.30  ? 173 LEU C O     1 
ATOM   4851 C  CB    . LEU C 1 97  ? 16.832  15.826  -8.558  1.00 42.18  ? 173 LEU C CB    1 
ATOM   4852 C  CG    . LEU C 1 97  ? 16.450  14.983  -9.771  1.00 41.09  ? 173 LEU C CG    1 
ATOM   4853 C  CD1   . LEU C 1 97  ? 17.212  13.666  -9.778  1.00 43.70  ? 173 LEU C CD1   1 
ATOM   4854 C  CD2   . LEU C 1 97  ? 14.947  14.757  -9.790  1.00 37.05  ? 173 LEU C CD2   1 
ATOM   4855 N  N     . ASP C 1 98  ? 15.764  18.231  -6.472  1.00 44.59  ? 174 ASP C N     1 
ATOM   4856 C  CA    . ASP C 1 98  ? 15.996  18.937  -5.226  1.00 39.01  ? 174 ASP C CA    1 
ATOM   4857 C  C     . ASP C 1 98  ? 16.584  18.035  -4.143  1.00 42.62  ? 174 ASP C C     1 
ATOM   4858 O  O     . ASP C 1 98  ? 15.853  17.348  -3.407  1.00 43.56  ? 174 ASP C O     1 
ATOM   4859 C  CB    . ASP C 1 98  ? 14.690  19.592  -4.758  1.00 46.81  ? 174 ASP C CB    1 
ATOM   4860 C  CG    . ASP C 1 98  ? 14.887  20.553  -3.586  1.00 51.77  ? 174 ASP C CG    1 
ATOM   4861 O  OD1   . ASP C 1 98  ? 16.056  20.883  -3.276  1.00 47.19  ? 174 ASP C OD1   1 
ATOM   4862 O  OD2   . ASP C 1 98  ? 13.862  20.982  -2.987  1.00 46.41  ? 174 ASP C OD2   1 
ATOM   4863 N  N     . TYR C 1 99  ? 17.910  18.037  -4.042  1.00 35.32  ? 175 TYR C N     1 
ATOM   4864 C  CA    . TYR C 1 99  ? 18.574  17.382  -2.916  1.00 43.61  ? 175 TYR C CA    1 
ATOM   4865 C  C     . TYR C 1 99  ? 18.879  18.362  -1.786  1.00 40.26  ? 175 TYR C C     1 
ATOM   4866 O  O     . TYR C 1 99  ? 19.689  18.065  -0.904  1.00 42.47  ? 175 TYR C O     1 
ATOM   4867 C  CB    . TYR C 1 99  ? 19.881  16.708  -3.345  1.00 35.76  ? 175 TYR C CB    1 
ATOM   4868 C  CG    . TYR C 1 99  ? 19.756  15.319  -3.942  1.00 32.31  ? 175 TYR C CG    1 
ATOM   4869 C  CD1   . TYR C 1 99  ? 19.207  15.130  -5.202  1.00 36.29  ? 175 TYR C CD1   1 
ATOM   4870 C  CD2   . TYR C 1 99  ? 20.245  14.212  -3.271  1.00 36.95  ? 175 TYR C CD2   1 
ATOM   4871 C  CE1   . TYR C 1 99  ? 19.123  13.880  -5.761  1.00 42.41  ? 175 TYR C CE1   1 
ATOM   4872 C  CE2   . TYR C 1 99  ? 20.154  12.945  -3.821  1.00 41.01  ? 175 TYR C CE2   1 
ATOM   4873 C  CZ    . TYR C 1 99  ? 19.594  12.784  -5.069  1.00 39.59  ? 175 TYR C CZ    1 
ATOM   4874 O  OH    . TYR C 1 99  ? 19.503  11.534  -5.629  1.00 40.63  ? 175 TYR C OH    1 
ATOM   4875 N  N     . GLY C 1 100 ? 18.246  19.532  -1.815  1.00 42.90  ? 176 GLY C N     1 
ATOM   4876 C  CA    . GLY C 1 100 ? 18.428  20.517  -0.764  1.00 35.94  ? 176 GLY C CA    1 
ATOM   4877 C  C     . GLY C 1 100 ? 17.673  20.156  0.509   1.00 44.15  ? 176 GLY C C     1 
ATOM   4878 O  O     . GLY C 1 100 ? 17.028  19.113  0.582   1.00 48.23  ? 176 GLY C O     1 
ATOM   4879 N  N     . PHE C 1 101 ? 17.754  21.022  1.516   1.00 47.86  ? 177 PHE C N     1 
ATOM   4880 C  CA    . PHE C 1 101 ? 17.070  20.800  2.784   1.00 44.32  ? 177 PHE C CA    1 
ATOM   4881 C  C     . PHE C 1 101 ? 15.559  20.754  2.554   1.00 44.15  ? 177 PHE C C     1 
ATOM   4882 O  O     . PHE C 1 101 ? 14.979  21.702  2.041   1.00 43.53  ? 177 PHE C O     1 
ATOM   4883 C  CB    . PHE C 1 101 ? 17.440  21.916  3.774   1.00 46.90  ? 177 PHE C CB    1 
ATOM   4884 C  CG    . PHE C 1 101 ? 16.880  21.721  5.162   1.00 47.50  ? 177 PHE C CG    1 
ATOM   4885 C  CD1   . PHE C 1 101 ? 17.376  20.732  5.990   1.00 41.32  ? 177 PHE C CD1   1 
ATOM   4886 C  CD2   . PHE C 1 101 ? 15.877  22.548  5.643   1.00 44.88  ? 177 PHE C CD2   1 
ATOM   4887 C  CE1   . PHE C 1 101 ? 16.873  20.557  7.275   1.00 45.23  ? 177 PHE C CE1   1 
ATOM   4888 C  CE2   . PHE C 1 101 ? 15.372  22.374  6.927   1.00 51.19  ? 177 PHE C CE2   1 
ATOM   4889 C  CZ    . PHE C 1 101 ? 15.870  21.372  7.738   1.00 44.20  ? 177 PHE C CZ    1 
ATOM   4890 N  N     . PRO C 1 102 ? 14.918  19.637  2.917   1.00 45.17  ? 178 PRO C N     1 
ATOM   4891 C  CA    . PRO C 1 102 ? 13.474  19.504  2.697   1.00 48.72  ? 178 PRO C CA    1 
ATOM   4892 C  C     . PRO C 1 102 ? 12.671  20.082  3.870   1.00 44.52  ? 178 PRO C C     1 
ATOM   4893 O  O     . PRO C 1 102 ? 11.982  19.337  4.577   1.00 45.58  ? 178 PRO C O     1 
ATOM   4894 C  CB    . PRO C 1 102 ? 13.291  17.983  2.628   1.00 43.22  ? 178 PRO C CB    1 
ATOM   4895 C  CG    . PRO C 1 102 ? 14.321  17.469  3.587   1.00 43.31  ? 178 PRO C CG    1 
ATOM   4896 C  CD    . PRO C 1 102 ? 15.512  18.395  3.446   1.00 39.83  ? 178 PRO C CD    1 
ATOM   4897 N  N     . GLU C 1 103 ? 12.764  21.392  4.069   1.00 48.70  ? 179 GLU C N     1 
ATOM   4898 C  CA    . GLU C 1 103 ? 12.138  22.060  5.213   1.00 45.10  ? 179 GLU C CA    1 
ATOM   4899 C  C     . GLU C 1 103 ? 10.633  21.841  5.245   1.00 43.54  ? 179 GLU C C     1 
ATOM   4900 O  O     . GLU C 1 103 ? 10.067  21.473  6.277   1.00 45.44  ? 179 GLU C O     1 
ATOM   4901 C  CB    . GLU C 1 103 ? 12.442  23.561  5.184   1.00 46.29  ? 179 GLU C CB    1 
ATOM   4902 C  CG    . GLU C 1 103 ? 12.063  24.290  6.474   1.00 50.80  ? 179 GLU C CG    1 
ATOM   4903 C  CD    . GLU C 1 103 ? 12.230  25.796  6.356   1.00 53.09  ? 179 GLU C CD    1 
ATOM   4904 O  OE1   . GLU C 1 103 ? 12.651  26.270  5.278   1.00 53.10  ? 179 GLU C OE1   1 
ATOM   4905 O  OE2   . GLU C 1 103 ? 11.940  26.506  7.345   1.00 66.91  ? 179 GLU C OE2   1 
ATOM   4906 N  N     . ALA C 1 104 ? 10.004  22.052  4.095   1.00 44.83  ? 180 ALA C N     1 
ATOM   4907 C  CA    . ALA C 1 104 ? 8.560   21.937  3.947   1.00 44.16  ? 180 ALA C CA    1 
ATOM   4908 C  C     . ALA C 1 104 ? 7.998   20.581  4.399   1.00 49.76  ? 180 ALA C C     1 
ATOM   4909 O  O     . ALA C 1 104 ? 6.890   20.498  4.936   1.00 49.37  ? 180 ALA C O     1 
ATOM   4910 C  CB    . ALA C 1 104 ? 8.174   22.233  2.495   1.00 42.56  ? 180 ALA C CB    1 
ATOM   4911 N  N     . GLY C 1 105 ? 8.772   19.522  4.187   1.00 47.94  ? 181 GLY C N     1 
ATOM   4912 C  CA    . GLY C 1 105 ? 8.318   18.171  4.462   1.00 42.55  ? 181 GLY C CA    1 
ATOM   4913 C  C     . GLY C 1 105 ? 9.088   17.187  3.597   1.00 44.88  ? 181 GLY C C     1 
ATOM   4914 O  O     . GLY C 1 105 ? 9.781   17.598  2.673   1.00 44.41  ? 181 GLY C O     1 
ATOM   4915 N  N     . PRO C 1 106 ? 8.972   15.885  3.896   1.00 48.18  ? 182 PRO C N     1 
ATOM   4916 C  CA    . PRO C 1 106 ? 9.742   14.832  3.219   1.00 45.45  ? 182 PRO C CA    1 
ATOM   4917 C  C     . PRO C 1 106 ? 9.688   14.949  1.704   1.00 44.50  ? 182 PRO C C     1 
ATOM   4918 O  O     . PRO C 1 106 ? 8.613   15.129  1.121   1.00 42.84  ? 182 PRO C O     1 
ATOM   4919 C  CB    . PRO C 1 106 ? 9.066   13.549  3.696   1.00 44.24  ? 182 PRO C CB    1 
ATOM   4920 C  CG    . PRO C 1 106 ? 8.532   13.906  5.046   1.00 44.99  ? 182 PRO C CG    1 
ATOM   4921 C  CD    . PRO C 1 106 ? 8.085   15.336  4.938   1.00 44.22  ? 182 PRO C CD    1 
ATOM   4922 N  N     . PHE C 1 107 ? 10.857  14.880  1.076   1.00 39.15  ? 183 PHE C N     1 
ATOM   4923 C  CA    . PHE C 1 107 ? 10.954  15.096  -0.361  1.00 44.02  ? 183 PHE C CA    1 
ATOM   4924 C  C     . PHE C 1 107 ? 11.370  13.800  -1.073  1.00 44.15  ? 183 PHE C C     1 
ATOM   4925 O  O     . PHE C 1 107 ? 12.442  13.234  -0.813  1.00 40.43  ? 183 PHE C O     1 
ATOM   4926 C  CB    . PHE C 1 107 ? 11.901  16.272  -0.682  1.00 39.81  ? 183 PHE C CB    1 
ATOM   4927 C  CG    . PHE C 1 107 ? 11.864  16.704  -2.121  1.00 40.60  ? 183 PHE C CG    1 
ATOM   4928 C  CD1   . PHE C 1 107 ? 10.881  17.570  -2.574  1.00 40.70  ? 183 PHE C CD1   1 
ATOM   4929 C  CD2   . PHE C 1 107 ? 12.802  16.229  -3.027  1.00 44.41  ? 183 PHE C CD2   1 
ATOM   4930 C  CE1   . PHE C 1 107 ? 10.834  17.970  -3.903  1.00 40.11  ? 183 PHE C CE1   1 
ATOM   4931 C  CE2   . PHE C 1 107 ? 12.762  16.623  -4.352  1.00 46.28  ? 183 PHE C CE2   1 
ATOM   4932 C  CZ    . PHE C 1 107 ? 11.771  17.501  -4.791  1.00 50.01  ? 183 PHE C CZ    1 
ATOM   4933 N  N     . HIS C 1 108 ? 10.491  13.323  -1.949  1.00 47.13  ? 184 HIS C N     1 
ATOM   4934 C  CA    . HIS C 1 108 ? 10.697  12.060  -2.647  1.00 41.43  ? 184 HIS C CA    1 
ATOM   4935 C  C     . HIS C 1 108 ? 11.289  12.297  -4.030  1.00 39.64  ? 184 HIS C C     1 
ATOM   4936 O  O     . HIS C 1 108 ? 10.585  12.613  -4.986  1.00 39.79  ? 184 HIS C O     1 
ATOM   4937 C  CB    . HIS C 1 108 ? 9.390   11.266  -2.751  1.00 37.82  ? 184 HIS C CB    1 
ATOM   4938 C  CG    . HIS C 1 108 ? 9.551   9.927   -3.409  1.00 45.96  ? 184 HIS C CG    1 
ATOM   4939 N  ND1   . HIS C 1 108 ? 8.661   9.445   -4.344  1.00 42.97  ? 184 HIS C ND1   1 
ATOM   4940 C  CD2   . HIS C 1 108 ? 10.508  8.976   -3.273  1.00 37.05  ? 184 HIS C CD2   1 
ATOM   4941 C  CE1   . HIS C 1 108 ? 9.056   8.251   -4.750  1.00 44.41  ? 184 HIS C CE1   1 
ATOM   4942 N  NE2   . HIS C 1 108 ? 10.168  7.940   -4.108  1.00 45.33  ? 184 HIS C NE2   1 
ATOM   4943 N  N     . VAL C 1 109 ? 12.600  12.135  -4.116  1.00 35.43  ? 185 VAL C N     1 
ATOM   4944 C  CA    . VAL C 1 109 ? 13.330  12.336  -5.352  1.00 38.98  ? 185 VAL C CA    1 
ATOM   4945 C  C     . VAL C 1 109 ? 12.952  11.327  -6.425  1.00 40.45  ? 185 VAL C C     1 
ATOM   4946 O  O     . VAL C 1 109 ? 12.674  11.709  -7.557  1.00 37.83  ? 185 VAL C O     1 
ATOM   4947 C  CB    . VAL C 1 109 ? 14.842  12.256  -5.097  1.00 41.32  ? 185 VAL C CB    1 
ATOM   4948 C  CG1   . VAL C 1 109 ? 15.604  12.169  -6.414  1.00 32.40  ? 185 VAL C CG1   1 
ATOM   4949 C  CG2   . VAL C 1 109 ? 15.291  13.450  -4.247  1.00 33.20  ? 185 VAL C CG2   1 
ATOM   4950 N  N     . ALA C 1 110 ? 12.928  10.043  -6.057  1.00 38.26  ? 186 ALA C N     1 
ATOM   4951 C  CA    . ALA C 1 110 ? 12.692  8.949   -7.002  1.00 39.41  ? 186 ALA C CA    1 
ATOM   4952 C  C     . ALA C 1 110 ? 11.211  8.756   -7.307  1.00 43.72  ? 186 ALA C C     1 
ATOM   4953 O  O     . ALA C 1 110 ? 10.706  7.632   -7.262  1.00 39.38  ? 186 ALA C O     1 
ATOM   4954 C  CB    . ALA C 1 110 ? 13.289  7.661   -6.473  1.00 35.54  ? 186 ALA C CB    1 
ATOM   4955 N  N     . SER C 1 111 ? 10.540  9.865   -7.612  1.00 40.16  ? 187 SER C N     1 
ATOM   4956 C  CA    . SER C 1 111 ? 9.109   9.926   -7.932  1.00 45.27  ? 187 SER C CA    1 
ATOM   4957 C  C     . SER C 1 111 ? 8.609   8.833   -8.879  1.00 44.65  ? 187 SER C C     1 
ATOM   4958 O  O     . SER C 1 111 ? 9.305   8.465   -9.822  1.00 44.13  ? 187 SER C O     1 
ATOM   4959 C  CB    . SER C 1 111 ? 8.805   11.295  -8.561  1.00 46.38  ? 187 SER C CB    1 
ATOM   4960 O  OG    . SER C 1 111 ? 7.454   11.407  -8.979  1.00 48.42  ? 187 SER C OG    1 
ATOM   4961 N  N     . PRO C 1 112 ? 7.374   8.352   -8.655  1.00 48.31  ? 188 PRO C N     1 
ATOM   4962 C  CA    . PRO C 1 112 ? 6.707   7.366   -9.522  1.00 44.29  ? 188 PRO C CA    1 
ATOM   4963 C  C     . PRO C 1 112 ? 6.569   7.836   -10.976 1.00 50.25  ? 188 PRO C C     1 
ATOM   4964 O  O     . PRO C 1 112 ? 6.390   7.033   -11.901 1.00 46.29  ? 188 PRO C O     1 
ATOM   4965 C  CB    . PRO C 1 112 ? 5.325   7.203   -8.874  1.00 40.45  ? 188 PRO C CB    1 
ATOM   4966 C  CG    . PRO C 1 112 ? 5.178   8.368   -7.944  1.00 47.23  ? 188 PRO C CG    1 
ATOM   4967 C  CD    . PRO C 1 112 ? 6.552   8.697   -7.484  1.00 46.42  ? 188 PRO C CD    1 
ATOM   4968 N  N     . GLU C 1 113 ? 6.666   9.142   -11.176 1.00 47.15  ? 189 GLU C N     1 
ATOM   4969 C  CA    . GLU C 1 113 ? 6.570   9.720   -12.501 1.00 46.90  ? 189 GLU C CA    1 
ATOM   4970 C  C     . GLU C 1 113 ? 7.918   9.631   -13.231 1.00 47.68  ? 189 GLU C C     1 
ATOM   4971 O  O     . GLU C 1 113 ? 7.988   9.740   -14.456 1.00 48.92  ? 189 GLU C O     1 
ATOM   4972 C  CB    . GLU C 1 113 ? 6.091   11.166  -12.357 1.00 49.23  ? 189 GLU C CB    1 
ATOM   4973 C  CG    . GLU C 1 113 ? 6.234   12.028  -13.578 1.00 56.57  ? 189 GLU C CG    1 
ATOM   4974 C  CD    . GLU C 1 113 ? 6.194   13.508  -13.237 1.00 67.80  ? 189 GLU C CD    1 
ATOM   4975 O  OE1   . GLU C 1 113 ? 5.669   13.856  -12.148 1.00 61.10  ? 189 GLU C OE1   1 
ATOM   4976 O  OE2   . GLU C 1 113 ? 6.694   14.315  -14.057 1.00 58.91  ? 189 GLU C OE2   1 
ATOM   4977 N  N     . LEU C 1 114 ? 8.989   9.403   -12.473 1.00 46.86  ? 190 LEU C N     1 
ATOM   4978 C  CA    . LEU C 1 114 ? 10.341  9.398   -13.030 1.00 40.21  ? 190 LEU C CA    1 
ATOM   4979 C  C     . LEU C 1 114 ? 11.007  8.024   -12.914 1.00 46.35  ? 190 LEU C C     1 
ATOM   4980 O  O     . LEU C 1 114 ? 11.853  7.654   -13.743 1.00 44.83  ? 190 LEU C O     1 
ATOM   4981 C  CB    . LEU C 1 114 ? 11.214  10.442  -12.323 1.00 46.40  ? 190 LEU C CB    1 
ATOM   4982 C  CG    . LEU C 1 114 ? 11.211  11.926  -12.733 1.00 53.84  ? 190 LEU C CG    1 
ATOM   4983 C  CD1   . LEU C 1 114 ? 10.066  12.308  -13.665 1.00 44.48  ? 190 LEU C CD1   1 
ATOM   4984 C  CD2   . LEU C 1 114 ? 11.210  12.802  -11.495 1.00 41.98  ? 190 LEU C CD2   1 
ATOM   4985 N  N     . HIS C 1 115 ? 10.633  7.276   -11.877 1.00 39.60  ? 191 HIS C N     1 
ATOM   4986 C  CA    . HIS C 1 115 ? 11.233  5.972   -11.618 1.00 39.28  ? 191 HIS C CA    1 
ATOM   4987 C  C     . HIS C 1 115 ? 10.932  5.013   -12.777 1.00 39.53  ? 191 HIS C C     1 
ATOM   4988 O  O     . HIS C 1 115 ? 9.805   4.954   -13.264 1.00 44.99  ? 191 HIS C O     1 
ATOM   4989 C  CB    . HIS C 1 115 ? 10.720  5.403   -10.296 1.00 40.83  ? 191 HIS C CB    1 
ATOM   4990 C  CG    . HIS C 1 115 ? 11.522  4.246   -9.793  1.00 41.49  ? 191 HIS C CG    1 
ATOM   4991 N  ND1   . HIS C 1 115 ? 11.361  2.962   -10.275 1.00 40.80  ? 191 HIS C ND1   1 
ATOM   4992 C  CD2   . HIS C 1 115 ? 12.512  4.180   -8.872  1.00 40.60  ? 191 HIS C CD2   1 
ATOM   4993 C  CE1   . HIS C 1 115 ? 12.206  2.155   -9.662  1.00 38.60  ? 191 HIS C CE1   1 
ATOM   4994 N  NE2   . HIS C 1 115 ? 12.919  2.868   -8.808  1.00 38.20  ? 191 HIS C NE2   1 
ATOM   4995 N  N     . PRO C 1 116 ? 11.942  4.267   -13.236 1.00 44.20  ? 192 PRO C N     1 
ATOM   4996 C  CA    . PRO C 1 116 ? 11.711  3.408   -14.405 1.00 39.26  ? 192 PRO C CA    1 
ATOM   4997 C  C     . PRO C 1 116 ? 10.804  2.206   -14.135 1.00 38.05  ? 192 PRO C C     1 
ATOM   4998 O  O     . PRO C 1 116 ? 10.221  1.700   -15.091 1.00 39.69  ? 192 PRO C O     1 
ATOM   4999 C  CB    . PRO C 1 116 ? 13.121  2.946   -14.778 1.00 32.24  ? 192 PRO C CB    1 
ATOM   5000 C  CG    . PRO C 1 116 ? 13.873  2.997   -13.522 1.00 35.51  ? 192 PRO C CG    1 
ATOM   5001 C  CD    . PRO C 1 116 ? 13.332  4.183   -12.758 1.00 40.13  ? 192 PRO C CD    1 
ATOM   5002 N  N     . LEU C 1 117 ? 10.669  1.783   -12.877 1.00 37.65  ? 193 LEU C N     1 
ATOM   5003 C  CA    . LEU C 1 117 ? 9.946   0.551   -12.529 1.00 34.35  ? 193 LEU C CA    1 
ATOM   5004 C  C     . LEU C 1 117 ? 8.616   0.755   -11.803 1.00 43.55  ? 193 LEU C C     1 
ATOM   5005 O  O     . LEU C 1 117 ? 7.628   0.072   -12.088 1.00 41.81  ? 193 LEU C O     1 
ATOM   5006 C  CB    . LEU C 1 117 ? 10.826  -0.348  -11.651 1.00 31.08  ? 193 LEU C CB    1 
ATOM   5007 C  CG    . LEU C 1 117 ? 11.617  -1.512  -12.242 1.00 39.87  ? 193 LEU C CG    1 
ATOM   5008 C  CD1   . LEU C 1 117 ? 11.901  -1.328  -13.733 1.00 35.19  ? 193 LEU C CD1   1 
ATOM   5009 C  CD2   . LEU C 1 117 ? 12.903  -1.713  -11.455 1.00 34.70  ? 193 LEU C CD2   1 
ATOM   5010 N  N     . TYR C 1 118 ? 8.597   1.673   -10.842 1.00 40.40  ? 194 TYR C N     1 
ATOM   5011 C  CA    . TYR C 1 118 ? 7.465   1.785   -9.928  1.00 36.91  ? 194 TYR C CA    1 
ATOM   5012 C  C     . TYR C 1 118 ? 6.736   3.096   -10.111 1.00 42.41  ? 194 TYR C C     1 
ATOM   5013 O  O     . TYR C 1 118 ? 7.337   4.159   -9.975  1.00 38.10  ? 194 TYR C O     1 
ATOM   5014 C  CB    . TYR C 1 118 ? 7.945   1.627   -8.484  1.00 37.17  ? 194 TYR C CB    1 
ATOM   5015 C  CG    . TYR C 1 118 ? 8.772   0.379   -8.299  1.00 38.40  ? 194 TYR C CG    1 
ATOM   5016 C  CD1   . TYR C 1 118 ? 8.295   -0.862  -8.721  1.00 35.40  ? 194 TYR C CD1   1 
ATOM   5017 C  CD2   . TYR C 1 118 ? 10.047  0.444   -7.764  1.00 34.71  ? 194 TYR C CD2   1 
ATOM   5018 C  CE1   . TYR C 1 118 ? 9.051   -2.007  -8.573  1.00 33.89  ? 194 TYR C CE1   1 
ATOM   5019 C  CE2   . TYR C 1 118 ? 10.808  -0.691  -7.616  1.00 41.65  ? 194 TYR C CE2   1 
ATOM   5020 C  CZ    . TYR C 1 118 ? 10.306  -1.917  -8.027  1.00 38.89  ? 194 TYR C CZ    1 
ATOM   5021 O  OH    . TYR C 1 118 ? 11.070  -3.048  -7.872  1.00 34.17  ? 194 TYR C OH    1 
ATOM   5022 N  N     . HIS C 1 119 ? 5.441   3.010   -10.413 1.00 40.05  ? 195 HIS C N     1 
ATOM   5023 C  CA    . HIS C 1 119 ? 4.673   4.182   -10.813 1.00 41.58  ? 195 HIS C CA    1 
ATOM   5024 C  C     . HIS C 1 119 ? 3.425   4.486   -9.954  1.00 44.14  ? 195 HIS C C     1 
ATOM   5025 O  O     . HIS C 1 119 ? 2.678   5.405   -10.277 1.00 46.49  ? 195 HIS C O     1 
ATOM   5026 C  CB    . HIS C 1 119 ? 4.243   4.072   -12.287 1.00 38.63  ? 195 HIS C CB    1 
ATOM   5027 C  CG    . HIS C 1 119 ? 5.340   3.671   -13.226 1.00 42.56  ? 195 HIS C CG    1 
ATOM   5028 N  ND1   . HIS C 1 119 ? 6.648   4.081   -13.073 1.00 44.40  ? 195 HIS C ND1   1 
ATOM   5029 C  CD2   . HIS C 1 119 ? 5.318   2.896   -14.337 1.00 38.47  ? 195 HIS C CD2   1 
ATOM   5030 C  CE1   . HIS C 1 119 ? 7.384   3.569   -14.043 1.00 39.96  ? 195 HIS C CE1   1 
ATOM   5031 N  NE2   . HIS C 1 119 ? 6.602   2.843   -14.821 1.00 40.64  ? 195 HIS C NE2   1 
ATOM   5032 N  N     . TYR C 1 120 ? 3.173   3.731   -8.887  1.00 41.75  ? 196 TYR C N     1 
ATOM   5033 C  CA    . TYR C 1 120 ? 1.991   4.023   -8.062  1.00 48.08  ? 196 TYR C CA    1 
ATOM   5034 C  C     . TYR C 1 120 ? 2.141   5.302   -7.216  1.00 45.52  ? 196 TYR C C     1 
ATOM   5035 O  O     . TYR C 1 120 ? 3.244   5.648   -6.815  1.00 47.71  ? 196 TYR C O     1 
ATOM   5036 C  CB    . TYR C 1 120 ? 1.563   2.813   -7.219  1.00 44.23  ? 196 TYR C CB    1 
ATOM   5037 C  CG    . TYR C 1 120 ? 2.595   2.242   -6.260  1.00 50.32  ? 196 TYR C CG    1 
ATOM   5038 C  CD1   . TYR C 1 120 ? 3.594   1.381   -6.712  1.00 43.24  ? 196 TYR C CD1   1 
ATOM   5039 C  CD2   . TYR C 1 120 ? 2.530   2.514   -4.891  1.00 47.28  ? 196 TYR C CD2   1 
ATOM   5040 C  CE1   . TYR C 1 120 ? 4.527   0.835   -5.835  1.00 40.02  ? 196 TYR C CE1   1 
ATOM   5041 C  CE2   . TYR C 1 120 ? 3.451   1.969   -4.000  1.00 43.67  ? 196 TYR C CE2   1 
ATOM   5042 C  CZ    . TYR C 1 120 ? 4.450   1.134   -4.476  1.00 52.29  ? 196 TYR C CZ    1 
ATOM   5043 O  OH    . TYR C 1 120 ? 5.370   0.595   -3.595  1.00 47.55  ? 196 TYR C OH    1 
ATOM   5044 N  N     . LYS C 1 121 ? 1.040   6.011   -6.961  1.00 52.63  ? 197 LYS C N     1 
ATOM   5045 C  CA    . LYS C 1 121 ? 1.121   7.336   -6.316  1.00 56.88  ? 197 LYS C CA    1 
ATOM   5046 C  C     . LYS C 1 121 ? 1.688   7.293   -4.898  1.00 52.26  ? 197 LYS C C     1 
ATOM   5047 O  O     . LYS C 1 121 ? 2.306   8.244   -4.437  1.00 51.31  ? 197 LYS C O     1 
ATOM   5048 C  CB    . LYS C 1 121 ? -0.230  8.064   -6.326  1.00 57.42  ? 197 LYS C CB    1 
ATOM   5049 C  CG    . LYS C 1 121 ? -1.439  7.159   -6.391  1.00 63.48  ? 197 LYS C CG    1 
ATOM   5050 C  CD    . LYS C 1 121 ? -2.715  7.921   -6.068  1.00 72.69  ? 197 LYS C CD    1 
ATOM   5051 C  CE    . LYS C 1 121 ? -3.951  7.038   -6.222  1.00 79.48  ? 197 LYS C CE    1 
ATOM   5052 N  NZ    . LYS C 1 121 ? -4.242  6.736   -7.653  1.00 77.20  ? 197 LYS C NZ    1 
ATOM   5053 N  N     . THR C 1 122 ? 1.482   6.164   -4.239  1.00 44.75  ? 198 THR C N     1 
ATOM   5054 C  CA    . THR C 1 122 ? 1.927   5.906   -2.876  1.00 50.50  ? 198 THR C CA    1 
ATOM   5055 C  C     . THR C 1 122 ? 3.438   5.594   -2.799  1.00 51.08  ? 198 THR C C     1 
ATOM   5056 O  O     . THR C 1 122 ? 4.037   5.596   -1.723  1.00 50.10  ? 198 THR C O     1 
ATOM   5057 C  CB    . THR C 1 122 ? 1.040   4.752   -2.297  1.00 51.87  ? 198 THR C CB    1 
ATOM   5058 O  OG1   . THR C 1 122 ? -0.089  5.327   -1.641  1.00 62.65  ? 198 THR C OG1   1 
ATOM   5059 C  CG2   . THR C 1 122 ? 1.775   3.838   -1.333  1.00 50.46  ? 198 THR C CG2   1 
ATOM   5060 N  N     . TYR C 1 123 ? 4.066   5.363   -3.951  1.00 50.64  ? 199 TYR C N     1 
ATOM   5061 C  CA    . TYR C 1 123 ? 5.455   4.896   -3.967  1.00 46.20  ? 199 TYR C CA    1 
ATOM   5062 C  C     . TYR C 1 123 ? 6.424   5.912   -3.383  1.00 44.23  ? 199 TYR C C     1 
ATOM   5063 O  O     . TYR C 1 123 ? 6.517   7.042   -3.865  1.00 41.33  ? 199 TYR C O     1 
ATOM   5064 C  CB    . TYR C 1 123 ? 5.909   4.484   -5.378  1.00 40.93  ? 199 TYR C CB    1 
ATOM   5065 C  CG    . TYR C 1 123 ? 7.341   4.002   -5.401  1.00 38.77  ? 199 TYR C CG    1 
ATOM   5066 C  CD1   . TYR C 1 123 ? 7.687   2.763   -4.872  1.00 41.06  ? 199 TYR C CD1   1 
ATOM   5067 C  CD2   . TYR C 1 123 ? 8.351   4.786   -5.937  1.00 38.24  ? 199 TYR C CD2   1 
ATOM   5068 C  CE1   . TYR C 1 123 ? 9.009   2.322   -4.875  1.00 41.47  ? 199 TYR C CE1   1 
ATOM   5069 C  CE2   . TYR C 1 123 ? 9.676   4.349   -5.955  1.00 43.00  ? 199 TYR C CE2   1 
ATOM   5070 C  CZ    . TYR C 1 123 ? 9.998   3.118   -5.420  1.00 41.14  ? 199 TYR C CZ    1 
ATOM   5071 O  OH    . TYR C 1 123 ? 11.309  2.693   -5.423  1.00 38.62  ? 199 TYR C OH    1 
ATOM   5072 N  N     . VAL C 1 124 ? 7.164   5.504   -2.359  1.00 36.43  ? 200 VAL C N     1 
ATOM   5073 C  CA    . VAL C 1 124 ? 8.079   6.428   -1.699  1.00 40.65  ? 200 VAL C CA    1 
ATOM   5074 C  C     . VAL C 1 124 ? 9.523   5.877   -1.576  1.00 44.06  ? 200 VAL C C     1 
ATOM   5075 O  O     . VAL C 1 124 ? 10.359  6.422   -0.851  1.00 41.95  ? 200 VAL C O     1 
ATOM   5076 C  CB    . VAL C 1 124 ? 7.465   6.927   -0.346  1.00 38.34  ? 200 VAL C CB    1 
ATOM   5077 C  CG1   . VAL C 1 124 ? 7.792   5.992   0.807   1.00 39.82  ? 200 VAL C CG1   1 
ATOM   5078 C  CG2   . VAL C 1 124 ? 7.918   8.313   -0.052  1.00 49.47  ? 200 VAL C CG2   1 
ATOM   5079 N  N     . GLY C 1 125 ? 9.814   4.815   -2.332  1.00 43.42  ? 201 GLY C N     1 
ATOM   5080 C  CA    . GLY C 1 125 ? 11.107  4.151   -2.280  1.00 40.98  ? 201 GLY C CA    1 
ATOM   5081 C  C     . GLY C 1 125 ? 12.202  4.775   -3.135  1.00 44.45  ? 201 GLY C C     1 
ATOM   5082 O  O     . GLY C 1 125 ? 11.979  5.784   -3.808  1.00 40.18  ? 201 GLY C O     1 
ATOM   5083 N  N     . GLY C 1 126 ? 13.393  4.184   -3.094  1.00 38.74  ? 202 GLY C N     1 
ATOM   5084 C  CA    . GLY C 1 126 ? 14.490  4.625   -3.939  1.00 37.07  ? 202 GLY C CA    1 
ATOM   5085 C  C     . GLY C 1 126 ? 15.369  5.704   -3.343  1.00 36.37  ? 202 GLY C C     1 
ATOM   5086 O  O     . GLY C 1 126 ? 16.467  5.430   -2.860  1.00 36.04  ? 202 GLY C O     1 
ATOM   5087 N  N     . ILE C 1 127 ? 14.899  6.943   -3.414  1.00 40.07  ? 203 ILE C N     1 
ATOM   5088 C  CA    . ILE C 1 127 ? 15.596  8.082   -2.826  1.00 38.21  ? 203 ILE C CA    1 
ATOM   5089 C  C     . ILE C 1 127 ? 14.589  9.002   -2.126  1.00 43.10  ? 203 ILE C C     1 
ATOM   5090 O  O     . ILE C 1 127 ? 13.672  9.532   -2.756  1.00 41.42  ? 203 ILE C O     1 
ATOM   5091 C  CB    . ILE C 1 127 ? 16.346  8.907   -3.877  1.00 40.60  ? 203 ILE C CB    1 
ATOM   5092 C  CG1   . ILE C 1 127 ? 17.267  8.019   -4.718  1.00 38.56  ? 203 ILE C CG1   1 
ATOM   5093 C  CG2   . ILE C 1 127 ? 17.140  10.007  -3.203  1.00 31.03  ? 203 ILE C CG2   1 
ATOM   5094 C  CD1   . ILE C 1 127 ? 17.559  8.590   -6.072  1.00 33.39  ? 203 ILE C CD1   1 
ATOM   5095 N  N     . LEU C 1 128 ? 14.758  9.189   -0.825  1.00 40.52  ? 204 LEU C N     1 
ATOM   5096 C  CA    . LEU C 1 128 ? 13.780  9.941   -0.041  1.00 44.69  ? 204 LEU C CA    1 
ATOM   5097 C  C     . LEU C 1 128 ? 14.490  10.744  1.035   1.00 40.37  ? 204 LEU C C     1 
ATOM   5098 O  O     . LEU C 1 128 ? 15.224  10.183  1.866   1.00 36.04  ? 204 LEU C O     1 
ATOM   5099 C  CB    . LEU C 1 128 ? 12.752  8.986   0.589   1.00 41.73  ? 204 LEU C CB    1 
ATOM   5100 C  CG    . LEU C 1 128 ? 11.613  9.533   1.456   1.00 40.31  ? 204 LEU C CG    1 
ATOM   5101 C  CD1   . LEU C 1 128 ? 10.699  10.470  0.689   1.00 38.28  ? 204 LEU C CD1   1 
ATOM   5102 C  CD2   . LEU C 1 128 ? 10.826  8.371   2.010   1.00 40.97  ? 204 LEU C CD2   1 
ATOM   5103 N  N     . LEU C 1 129 ? 14.260  12.055  1.014   1.00 41.39  ? 205 LEU C N     1 
ATOM   5104 C  CA    . LEU C 1 129 ? 14.919  12.992  1.925   1.00 41.65  ? 205 LEU C CA    1 
ATOM   5105 C  C     . LEU C 1 129 ? 14.001  13.503  3.054   1.00 44.38  ? 205 LEU C C     1 
ATOM   5106 O  O     . LEU C 1 129 ? 12.831  13.839  2.831   1.00 44.45  ? 205 LEU C O     1 
ATOM   5107 C  CB    . LEU C 1 129 ? 15.481  14.185  1.125   1.00 37.81  ? 205 LEU C CB    1 
ATOM   5108 C  CG    . LEU C 1 129 ? 16.774  13.927  0.336   1.00 39.83  ? 205 LEU C CG    1 
ATOM   5109 C  CD1   . LEU C 1 129 ? 16.625  12.848  -0.742  1.00 37.21  ? 205 LEU C CD1   1 
ATOM   5110 C  CD2   . LEU C 1 129 ? 17.294  15.198  -0.285  1.00 36.96  ? 205 LEU C CD2   1 
ATOM   5111 N  N     . LEU C 1 130 ? 14.548  13.570  4.264   1.00 44.34  ? 206 LEU C N     1 
ATOM   5112 C  CA    . LEU C 1 130 ? 13.848  14.143  5.412   1.00 38.62  ? 206 LEU C CA    1 
ATOM   5113 C  C     . LEU C 1 130 ? 14.801  14.963  6.290   1.00 45.67  ? 206 LEU C C     1 
ATOM   5114 O  O     . LEU C 1 130 ? 15.990  14.667  6.380   1.00 42.60  ? 206 LEU C O     1 
ATOM   5115 C  CB    . LEU C 1 130 ? 13.183  13.052  6.260   1.00 37.47  ? 206 LEU C CB    1 
ATOM   5116 C  CG    . LEU C 1 130 ? 12.041  12.225  5.656   1.00 45.32  ? 206 LEU C CG    1 
ATOM   5117 C  CD1   . LEU C 1 130 ? 12.580  11.004  4.893   1.00 40.68  ? 206 LEU C CD1   1 
ATOM   5118 C  CD2   . LEU C 1 130 ? 11.071  11.792  6.724   1.00 39.76  ? 206 LEU C CD2   1 
ATOM   5119 N  N     . SER C 1 131 ? 14.281  15.997  6.941   1.00 41.47  ? 207 SER C N     1 
ATOM   5120 C  CA    . SER C 1 131 ? 15.048  16.670  7.980   1.00 42.17  ? 207 SER C CA    1 
ATOM   5121 C  C     . SER C 1 131 ? 15.138  15.702  9.137   1.00 39.87  ? 207 SER C C     1 
ATOM   5122 O  O     . SER C 1 131 ? 14.292  14.810  9.253   1.00 44.31  ? 207 SER C O     1 
ATOM   5123 C  CB    . SER C 1 131 ? 14.334  17.942  8.440   1.00 42.04  ? 207 SER C CB    1 
ATOM   5124 O  OG    . SER C 1 131 ? 13.081  17.623  9.019   1.00 45.11  ? 207 SER C OG    1 
ATOM   5125 N  N     . LYS C 1 132 ? 16.153  15.857  9.987   1.00 44.50  ? 208 LYS C N     1 
ATOM   5126 C  CA    . LYS C 1 132 ? 16.228  15.072  11.224  1.00 43.35  ? 208 LYS C CA    1 
ATOM   5127 C  C     . LYS C 1 132 ? 14.938  15.208  12.016  1.00 43.76  ? 208 LYS C C     1 
ATOM   5128 O  O     . LYS C 1 132 ? 14.424  14.229  12.553  1.00 47.69  ? 208 LYS C O     1 
ATOM   5129 C  CB    . LYS C 1 132 ? 17.402  15.516  12.102  1.00 50.34  ? 208 LYS C CB    1 
ATOM   5130 C  CG    . LYS C 1 132 ? 18.713  14.782  11.844  1.00 56.22  ? 208 LYS C CG    1 
ATOM   5131 C  CD    . LYS C 1 132 ? 19.570  14.774  13.105  1.00 64.17  ? 208 LYS C CD    1 
ATOM   5132 C  CE    . LYS C 1 132 ? 20.687  13.744  13.036  1.00 63.18  ? 208 LYS C CE    1 
ATOM   5133 N  NZ    . LYS C 1 132 ? 21.187  13.389  14.401  1.00 69.52  ? 208 LYS C NZ    1 
ATOM   5134 N  N     . GLN C 1 133 ? 14.417  16.432  12.076  1.00 49.39  ? 209 GLN C N     1 
ATOM   5135 C  CA    . GLN C 1 133 ? 13.180  16.715  12.799  1.00 53.22  ? 209 GLN C CA    1 
ATOM   5136 C  C     . GLN C 1 133 ? 11.996  15.860  12.314  1.00 51.29  ? 209 GLN C C     1 
ATOM   5137 O  O     . GLN C 1 133 ? 11.339  15.189  13.115  1.00 49.21  ? 209 GLN C O     1 
ATOM   5138 C  CB    . GLN C 1 133 ? 12.867  18.215  12.733  1.00 58.74  ? 209 GLN C CB    1 
ATOM   5139 C  CG    . GLN C 1 133 ? 11.481  18.628  13.216  1.00 60.84  ? 209 GLN C CG    1 
ATOM   5140 C  CD    . GLN C 1 133 ? 11.238  20.122  13.018  1.00 73.75  ? 209 GLN C CD    1 
ATOM   5141 O  OE1   . GLN C 1 133 ? 11.986  20.951  13.536  1.00 84.72  ? 209 GLN C OE1   1 
ATOM   5142 N  NE2   . GLN C 1 133 ? 10.202  20.470  12.252  1.00 65.21  ? 209 GLN C NE2   1 
ATOM   5143 N  N     . HIS C 1 134 ? 11.738  15.859  11.009  1.00 50.20  ? 210 HIS C N     1 
ATOM   5144 C  CA    . HIS C 1 134 ? 10.654  15.034  10.474  1.00 45.51  ? 210 HIS C CA    1 
ATOM   5145 C  C     . HIS C 1 134 ? 10.905  13.536  10.585  1.00 52.25  ? 210 HIS C C     1 
ATOM   5146 O  O     . HIS C 1 134 ? 9.961   12.770  10.760  1.00 52.96  ? 210 HIS C O     1 
ATOM   5147 C  CB    . HIS C 1 134 ? 10.329  15.405  9.037   1.00 42.26  ? 210 HIS C CB    1 
ATOM   5148 C  CG    . HIS C 1 134 ? 9.753   16.774  8.899   1.00 48.44  ? 210 HIS C CG    1 
ATOM   5149 N  ND1   . HIS C 1 134 ? 9.706   17.446  7.695   1.00 49.04  ? 210 HIS C ND1   1 
ATOM   5150 C  CD2   . HIS C 1 134 ? 9.211   17.606  9.820   1.00 44.48  ? 210 HIS C CD2   1 
ATOM   5151 C  CE1   . HIS C 1 134 ? 9.161   18.635  7.882   1.00 51.96  ? 210 HIS C CE1   1 
ATOM   5152 N  NE2   . HIS C 1 134 ? 8.852   18.756  9.162   1.00 51.32  ? 210 HIS C NE2   1 
ATOM   5153 N  N     . TYR C 1 135 ? 12.161  13.107  10.486  1.00 48.05  ? 211 TYR C N     1 
ATOM   5154 C  CA    . TYR C 1 135 ? 12.445  11.683  10.641  1.00 46.64  ? 211 TYR C CA    1 
ATOM   5155 C  C     . TYR C 1 135 ? 12.199  11.250  12.099  1.00 42.36  ? 211 TYR C C     1 
ATOM   5156 O  O     . TYR C 1 135 ? 11.672  10.170  12.346  1.00 45.60  ? 211 TYR C O     1 
ATOM   5157 C  CB    . TYR C 1 135 ? 13.862  11.335  10.144  1.00 45.99  ? 211 TYR C CB    1 
ATOM   5158 C  CG    . TYR C 1 135 ? 14.125  9.852   9.912   1.00 37.19  ? 211 TYR C CG    1 
ATOM   5159 C  CD1   . TYR C 1 135 ? 13.888  9.260   8.675   1.00 43.20  ? 211 TYR C CD1   1 
ATOM   5160 C  CD2   . TYR C 1 135 ? 14.631  9.054   10.926  1.00 38.12  ? 211 TYR C CD2   1 
ATOM   5161 C  CE1   . TYR C 1 135 ? 14.131  7.900   8.468   1.00 38.30  ? 211 TYR C CE1   1 
ATOM   5162 C  CE2   . TYR C 1 135 ? 14.885  7.713   10.735  1.00 39.17  ? 211 TYR C CE2   1 
ATOM   5163 C  CZ    . TYR C 1 135 ? 14.632  7.135   9.508   1.00 42.44  ? 211 TYR C CZ    1 
ATOM   5164 O  OH    . TYR C 1 135 ? 14.886  5.789   9.337   1.00 36.56  ? 211 TYR C OH    1 
ATOM   5165 N  N     . ARG C 1 136 ? 12.561  12.103  13.055  1.00 53.21  ? 212 ARG C N     1 
ATOM   5166 C  CA    . ARG C 1 136 ? 12.272  11.859  14.473  1.00 51.30  ? 212 ARG C CA    1 
ATOM   5167 C  C     . ARG C 1 136 ? 10.762  11.789  14.703  1.00 45.42  ? 212 ARG C C     1 
ATOM   5168 O  O     . ARG C 1 136 ? 10.257  10.899  15.380  1.00 44.06  ? 212 ARG C O     1 
ATOM   5169 C  CB    . ARG C 1 136 ? 12.861  12.974  15.350  1.00 52.19  ? 212 ARG C CB    1 
ATOM   5170 C  CG    . ARG C 1 136 ? 14.372  12.917  15.569  1.00 51.38  ? 212 ARG C CG    1 
ATOM   5171 C  CD    . ARG C 1 136 ? 14.737  11.953  16.692  1.00 59.65  ? 212 ARG C CD    1 
ATOM   5172 N  NE    . ARG C 1 136 ? 16.178  11.704  16.752  1.00 68.14  ? 212 ARG C NE    1 
ATOM   5173 C  CZ    . ARG C 1 136 ? 16.743  10.689  17.407  1.00 69.06  ? 212 ARG C CZ    1 
ATOM   5174 N  NH1   . ARG C 1 136 ? 15.987  9.817   18.075  1.00 61.53  ? 212 ARG C NH1   1 
ATOM   5175 N  NH2   . ARG C 1 136 ? 18.067  10.543  17.394  1.00 62.99  ? 212 ARG C NH2   1 
ATOM   5176 N  N     . LEU C 1 137 ? 10.052  12.737  14.114  1.00 46.70  ? 213 LEU C N     1 
ATOM   5177 C  CA    . LEU C 1 137 ? 8.605   12.833  14.245  1.00 51.70  ? 213 LEU C CA    1 
ATOM   5178 C  C     . LEU C 1 137 ? 7.899   11.523  13.895  1.00 52.05  ? 213 LEU C C     1 
ATOM   5179 O  O     . LEU C 1 137 ? 6.981   11.097  14.616  1.00 49.41  ? 213 LEU C O     1 
ATOM   5180 C  CB    . LEU C 1 137 ? 8.092   13.978  13.365  1.00 49.70  ? 213 LEU C CB    1 
ATOM   5181 C  CG    . LEU C 1 137 ? 6.706   14.557  13.630  1.00 56.60  ? 213 LEU C CG    1 
ATOM   5182 C  CD1   . LEU C 1 137 ? 6.652   15.182  15.012  1.00 53.29  ? 213 LEU C CD1   1 
ATOM   5183 C  CD2   . LEU C 1 137 ? 6.365   15.570  12.555  1.00 44.00  ? 213 LEU C CD2   1 
ATOM   5184 N  N     . CYS C 1 138 ? 8.341   10.888  12.803  1.00 45.89  ? 214 CYS C N     1 
ATOM   5185 C  CA    . CYS C 1 138 ? 7.783   9.611   12.340  1.00 41.02  ? 214 CYS C CA    1 
ATOM   5186 C  C     . CYS C 1 138 ? 8.319   8.416   13.095  1.00 43.69  ? 214 CYS C C     1 
ATOM   5187 O  O     . CYS C 1 138 ? 7.931   7.287   12.798  1.00 52.42  ? 214 CYS C O     1 
ATOM   5188 C  CB    . CYS C 1 138 ? 8.130   9.359   10.873  1.00 50.32  ? 214 CYS C CB    1 
ATOM   5189 S  SG    . CYS C 1 138 ? 7.555   10.547  9.700   1.00 47.90  ? 214 CYS C SG    1 
ATOM   5190 N  N     . ASN C 1 139 ? 9.218   8.641   14.047  1.00 43.75  ? 215 ASN C N     1 
ATOM   5191 C  CA    . ASN C 1 139 ? 9.921   7.532   14.703  1.00 48.59  ? 215 ASN C CA    1 
ATOM   5192 C  C     . ASN C 1 139 ? 10.668  6.668   13.684  1.00 47.80  ? 215 ASN C C     1 
ATOM   5193 O  O     . ASN C 1 139 ? 10.795  5.444   13.841  1.00 45.11  ? 215 ASN C O     1 
ATOM   5194 C  CB    . ASN C 1 139 ? 8.984   6.654   15.562  1.00 33.38  ? 215 ASN C CB    1 
ATOM   5195 C  CG    . ASN C 1 139 ? 9.754   5.758   16.516  1.00 41.44  ? 215 ASN C CG    1 
ATOM   5196 O  OD1   . ASN C 1 139 ? 10.865  6.101   16.924  1.00 45.53  ? 215 ASN C OD1   1 
ATOM   5197 N  ND2   . ASN C 1 139 ? 9.195   4.590   16.845  1.00 42.28  ? 215 ASN C ND2   1 
ATOM   5198 N  N     . GLY C 1 140 ? 11.155  7.313   12.632  1.00 45.56  ? 216 GLY C N     1 
ATOM   5199 C  CA    . GLY C 1 140 ? 11.914  6.620   11.608  1.00 43.14  ? 216 GLY C CA    1 
ATOM   5200 C  C     . GLY C 1 140 ? 11.100  5.578   10.880  1.00 45.90  ? 216 GLY C C     1 
ATOM   5201 O  O     . GLY C 1 140 ? 9.888   5.725   10.715  1.00 44.10  ? 216 GLY C O     1 
ATOM   5202 N  N     . MET C 1 141 ? 11.767  4.512   10.449  1.00 43.73  ? 217 MET C N     1 
ATOM   5203 C  CA    . MET C 1 141 ? 11.092  3.460   9.706   1.00 45.90  ? 217 MET C CA    1 
ATOM   5204 C  C     . MET C 1 141 ? 10.830  2.267   10.608  1.00 45.85  ? 217 MET C C     1 
ATOM   5205 O  O     . MET C 1 141 ? 11.438  2.132   11.666  1.00 43.04  ? 217 MET C O     1 
ATOM   5206 C  CB    . MET C 1 141 ? 11.922  3.041   8.489   1.00 41.85  ? 217 MET C CB    1 
ATOM   5207 C  CG    . MET C 1 141 ? 12.332  4.230   7.608   1.00 43.97  ? 217 MET C CG    1 
ATOM   5208 S  SD    . MET C 1 141 ? 13.150  3.765   6.066   1.00 43.43  ? 217 MET C SD    1 
ATOM   5209 C  CE    . MET C 1 141 ? 11.749  3.403   5.015   1.00 35.25  ? 217 MET C CE    1 
ATOM   5210 N  N     . SER C 1 142 ? 9.915   1.411   10.182  1.00 48.46  ? 218 SER C N     1 
ATOM   5211 C  CA    . SER C 1 142 ? 9.695   0.140   10.844  1.00 43.64  ? 218 SER C CA    1 
ATOM   5212 C  C     . SER C 1 142 ? 10.915  -0.747  10.729  1.00 49.22  ? 218 SER C C     1 
ATOM   5213 O  O     . SER C 1 142 ? 11.688  -0.638  9.771   1.00 44.56  ? 218 SER C O     1 
ATOM   5214 C  CB    . SER C 1 142 ? 8.516   -0.592  10.225  1.00 41.22  ? 218 SER C CB    1 
ATOM   5215 O  OG    . SER C 1 142 ? 8.563   -1.946  10.615  1.00 45.83  ? 218 SER C OG    1 
ATOM   5216 N  N     . ASN C 1 143 ? 11.067  -1.651  11.691  1.00 40.81  ? 219 ASN C N     1 
ATOM   5217 C  CA    . ASN C 1 143 ? 12.184  -2.577  11.675  1.00 45.91  ? 219 ASN C CA    1 
ATOM   5218 C  C     . ASN C 1 143 ? 11.721  -3.969  11.309  1.00 39.50  ? 219 ASN C C     1 
ATOM   5219 O  O     . ASN C 1 143 ? 12.524  -4.890  11.269  1.00 42.93  ? 219 ASN C O     1 
ATOM   5220 C  CB    . ASN C 1 143 ? 12.874  -2.622  13.037  1.00 42.01  ? 219 ASN C CB    1 
ATOM   5221 C  CG    . ASN C 1 143 ? 13.307  -1.260  13.515  1.00 49.63  ? 219 ASN C CG    1 
ATOM   5222 O  OD1   . ASN C 1 143 ? 14.013  -0.537  12.810  1.00 50.04  ? 219 ASN C OD1   1 
ATOM   5223 N  ND2   . ASN C 1 143 ? 12.879  -0.894  14.722  1.00 50.65  ? 219 ASN C ND2   1 
ATOM   5224 N  N     . ARG C 1 144 ? 10.426  -4.097  11.024  1.00 45.19  ? 220 ARG C N     1 
ATOM   5225 C  CA    . ARG C 1 144 ? 9.759   -5.394  10.894  1.00 42.96  ? 220 ARG C CA    1 
ATOM   5226 C  C     . ARG C 1 144 ? 9.815   -5.985  9.486   1.00 47.00  ? 220 ARG C C     1 
ATOM   5227 O  O     . ARG C 1 144 ? 9.302   -7.079  9.246   1.00 48.94  ? 220 ARG C O     1 
ATOM   5228 C  CB    . ARG C 1 144 ? 8.298   -5.280  11.346  1.00 48.31  ? 220 ARG C CB    1 
ATOM   5229 C  CG    . ARG C 1 144 ? 8.121   -4.972  12.835  1.00 55.65  ? 220 ARG C CG    1 
ATOM   5230 C  CD    . ARG C 1 144 ? 6.645   -4.791  13.242  1.00 57.40  ? 220 ARG C CD    1 
ATOM   5231 N  NE    . ARG C 1 144 ? 5.818   -5.979  13.006  1.00 56.80  ? 220 ARG C NE    1 
ATOM   5232 C  CZ    . ARG C 1 144 ? 5.758   -7.035  13.818  1.00 62.61  ? 220 ARG C CZ    1 
ATOM   5233 N  NH1   . ARG C 1 144 ? 6.486   -7.074  14.930  1.00 60.57  ? 220 ARG C NH1   1 
ATOM   5234 N  NH2   . ARG C 1 144 ? 4.976   -8.063  13.512  1.00 62.94  ? 220 ARG C NH2   1 
ATOM   5235 N  N     . PHE C 1 145 ? 10.450  -5.275  8.560   1.00 47.37  ? 221 PHE C N     1 
ATOM   5236 C  CA    . PHE C 1 145 ? 10.467  -5.705  7.166   1.00 44.85  ? 221 PHE C CA    1 
ATOM   5237 C  C     . PHE C 1 145 ? 11.784  -6.337  6.759   1.00 45.96  ? 221 PHE C C     1 
ATOM   5238 O  O     . PHE C 1 145 ? 12.797  -5.649  6.598   1.00 44.45  ? 221 PHE C O     1 
ATOM   5239 C  CB    . PHE C 1 145 ? 10.106  -4.549  6.241   1.00 40.50  ? 221 PHE C CB    1 
ATOM   5240 C  CG    . PHE C 1 145 ? 8.715   -4.049  6.446   1.00 45.37  ? 221 PHE C CG    1 
ATOM   5241 C  CD1   . PHE C 1 145 ? 8.442   -3.105  7.426   1.00 44.20  ? 221 PHE C CD1   1 
ATOM   5242 C  CD2   . PHE C 1 145 ? 7.671   -4.540  5.683   1.00 41.51  ? 221 PHE C CD2   1 
ATOM   5243 C  CE1   . PHE C 1 145 ? 7.156   -2.651  7.633   1.00 44.23  ? 221 PHE C CE1   1 
ATOM   5244 C  CE2   . PHE C 1 145 ? 6.380   -4.090  5.884   1.00 54.34  ? 221 PHE C CE2   1 
ATOM   5245 C  CZ    . PHE C 1 145 ? 6.121   -3.141  6.866   1.00 49.99  ? 221 PHE C CZ    1 
ATOM   5246 N  N     . TRP C 1 146 ? 11.749  -7.658  6.600   1.00 40.50  ? 222 TRP C N     1 
ATOM   5247 C  CA    . TRP C 1 146 ? 12.911  -8.443  6.221   1.00 44.16  ? 222 TRP C CA    1 
ATOM   5248 C  C     . TRP C 1 146 ? 12.653  -8.989  4.826   1.00 48.89  ? 222 TRP C C     1 
ATOM   5249 O  O     . TRP C 1 146 ? 11.584  -9.546  4.556   1.00 46.75  ? 222 TRP C O     1 
ATOM   5250 C  CB    . TRP C 1 146 ? 13.141  -9.596  7.210   1.00 42.80  ? 222 TRP C CB    1 
ATOM   5251 C  CG    . TRP C 1 146 ? 13.292  -9.144  8.638   1.00 47.71  ? 222 TRP C CG    1 
ATOM   5252 C  CD1   . TRP C 1 146 ? 12.288  -8.987  9.558   1.00 48.88  ? 222 TRP C CD1   1 
ATOM   5253 C  CD2   . TRP C 1 146 ? 14.512  -8.795  9.314   1.00 49.11  ? 222 TRP C CD2   1 
ATOM   5254 N  NE1   . TRP C 1 146 ? 12.808  -8.564  10.760  1.00 47.81  ? 222 TRP C NE1   1 
ATOM   5255 C  CE2   . TRP C 1 146 ? 14.167  -8.438  10.641  1.00 51.95  ? 222 TRP C CE2   1 
ATOM   5256 C  CE3   . TRP C 1 146 ? 15.860  -8.756  8.931   1.00 45.77  ? 222 TRP C CE3   1 
ATOM   5257 C  CZ2   . TRP C 1 146 ? 15.123  -8.036  11.584  1.00 42.70  ? 222 TRP C CZ2   1 
ATOM   5258 C  CZ3   . TRP C 1 146 ? 16.808  -8.359  9.867   1.00 41.74  ? 222 TRP C CZ3   1 
ATOM   5259 C  CH2   . TRP C 1 146 ? 16.431  -8.003  11.180  1.00 45.73  ? 222 TRP C CH2   1 
ATOM   5260 N  N     . GLY C 1 147 ? 13.630  -8.818  3.939   1.00 44.28  ? 223 GLY C N     1 
ATOM   5261 C  CA    . GLY C 1 147 ? 13.454  -9.176  2.551   1.00 34.74  ? 223 GLY C CA    1 
ATOM   5262 C  C     . GLY C 1 147 ? 12.849  -7.996  1.818   1.00 38.18  ? 223 GLY C C     1 
ATOM   5263 O  O     . GLY C 1 147 ? 12.435  -7.020  2.436   1.00 42.71  ? 223 GLY C O     1 
ATOM   5264 N  N     . TRP C 1 148 ? 12.792  -8.092  0.496   1.00 40.89  ? 224 TRP C N     1 
ATOM   5265 C  CA    . TRP C 1 148 ? 12.263  -7.029  -0.347  1.00 42.77  ? 224 TRP C CA    1 
ATOM   5266 C  C     . TRP C 1 148 ? 10.802  -6.734  -0.043  1.00 39.96  ? 224 TRP C C     1 
ATOM   5267 O  O     . TRP C 1 148 ? 10.054  -7.627  0.324   1.00 37.87  ? 224 TRP C O     1 
ATOM   5268 C  CB    . TRP C 1 148 ? 12.383  -7.465  -1.809  1.00 38.06  ? 224 TRP C CB    1 
ATOM   5269 C  CG    . TRP C 1 148 ? 12.010  -6.401  -2.819  1.00 40.62  ? 224 TRP C CG    1 
ATOM   5270 C  CD1   . TRP C 1 148 ? 12.859  -5.522  -3.438  1.00 36.59  ? 224 TRP C CD1   1 
ATOM   5271 C  CD2   . TRP C 1 148 ? 10.701  -6.138  -3.352  1.00 35.66  ? 224 TRP C CD2   1 
ATOM   5272 N  NE1   . TRP C 1 148 ? 12.157  -4.728  -4.316  1.00 36.96  ? 224 TRP C NE1   1 
ATOM   5273 C  CE2   . TRP C 1 148 ? 10.835  -5.085  -4.287  1.00 35.47  ? 224 TRP C CE2   1 
ATOM   5274 C  CE3   . TRP C 1 148 ? 9.433   -6.694  -3.136  1.00 34.62  ? 224 TRP C CE3   1 
ATOM   5275 C  CZ2   . TRP C 1 148 ? 9.747   -4.567  -4.998  1.00 34.32  ? 224 TRP C CZ2   1 
ATOM   5276 C  CZ3   . TRP C 1 148 ? 8.350   -6.172  -3.826  1.00 35.81  ? 224 TRP C CZ3   1 
ATOM   5277 C  CH2   . TRP C 1 148 ? 8.516   -5.111  -4.752  1.00 38.08  ? 224 TRP C CH2   1 
ATOM   5278 N  N     . GLY C 1 149 ? 10.394  -5.480  -0.209  1.00 48.02  ? 225 GLY C N     1 
ATOM   5279 C  CA    . GLY C 1 149 ? 8.980   -5.139  -0.194  1.00 41.81  ? 225 GLY C CA    1 
ATOM   5280 C  C     . GLY C 1 149 ? 8.422   -4.406  1.010   1.00 44.70  ? 225 GLY C C     1 
ATOM   5281 O  O     . GLY C 1 149 ? 8.839   -4.627  2.136   1.00 47.65  ? 225 GLY C O     1 
ATOM   5282 N  N     . ARG C 1 150 ? 7.491   -3.498  0.737   1.00 50.97  ? 226 ARG C N     1 
ATOM   5283 C  CA    . ARG C 1 150 ? 6.551   -2.970  1.729   1.00 53.57  ? 226 ARG C CA    1 
ATOM   5284 C  C     . ARG C 1 150 ? 7.074   -2.071  2.857   1.00 47.29  ? 226 ARG C C     1 
ATOM   5285 O  O     . ARG C 1 150 ? 6.278   -1.488  3.585   1.00 44.80  ? 226 ARG C O     1 
ATOM   5286 C  CB    . ARG C 1 150 ? 5.714   -4.110  2.315   1.00 55.21  ? 226 ARG C CB    1 
ATOM   5287 C  CG    . ARG C 1 150 ? 4.832   -4.803  1.294   1.00 61.68  ? 226 ARG C CG    1 
ATOM   5288 C  CD    . ARG C 1 150 ? 3.798   -3.873  0.677   1.00 63.21  ? 226 ARG C CD    1 
ATOM   5289 N  NE    . ARG C 1 150 ? 3.005   -3.174  1.690   1.00 76.02  ? 226 ARG C NE    1 
ATOM   5290 C  CZ    . ARG C 1 150 ? 1.968   -2.378  1.424   1.00 75.27  ? 226 ARG C CZ    1 
ATOM   5291 N  NH1   . ARG C 1 150 ? 1.569   -2.179  0.171   1.00 65.62  ? 226 ARG C NH1   1 
ATOM   5292 N  NH2   . ARG C 1 150 ? 1.317   -1.785  2.417   1.00 75.04  ? 226 ARG C NH2   1 
ATOM   5293 N  N     . GLU C 1 151 ? 8.387   -1.960  3.019   1.00 43.55  ? 227 GLU C N     1 
ATOM   5294 C  CA    . GLU C 1 151 ? 8.928   -1.101  4.068   1.00 35.56  ? 227 GLU C CA    1 
ATOM   5295 C  C     . GLU C 1 151 ? 8.726   0.387   3.712   1.00 45.55  ? 227 GLU C C     1 
ATOM   5296 O  O     . GLU C 1 151 ? 8.626   1.243   4.592   1.00 39.12  ? 227 GLU C O     1 
ATOM   5297 C  CB    . GLU C 1 151 ? 10.410  -1.412  4.317   1.00 40.34  ? 227 GLU C CB    1 
ATOM   5298 C  CG    . GLU C 1 151 ? 11.410  -0.587  3.459   1.00 42.62  ? 227 GLU C CG    1 
ATOM   5299 C  CD    . GLU C 1 151 ? 11.471  -1.002  1.982   1.00 41.91  ? 227 GLU C CD    1 
ATOM   5300 O  OE1   . GLU C 1 151 ? 10.918  -2.068  1.623   1.00 43.65  ? 227 GLU C OE1   1 
ATOM   5301 O  OE2   . GLU C 1 151 ? 12.093  -0.264  1.179   1.00 39.60  ? 227 GLU C OE2   1 
ATOM   5302 N  N     . ASP C 1 152 ? 8.660   0.690   2.418   1.00 44.12  ? 228 ASP C N     1 
ATOM   5303 C  CA    . ASP C 1 152 ? 8.442   2.061   1.970   1.00 42.32  ? 228 ASP C CA    1 
ATOM   5304 C  C     . ASP C 1 152 ? 6.957   2.436   2.023   1.00 45.88  ? 228 ASP C C     1 
ATOM   5305 O  O     . ASP C 1 152 ? 6.604   3.538   2.439   1.00 45.76  ? 228 ASP C O     1 
ATOM   5306 C  CB    . ASP C 1 152 ? 9.036   2.294   0.568   1.00 39.23  ? 228 ASP C CB    1 
ATOM   5307 C  CG    . ASP C 1 152 ? 8.813   1.114   -0.368  1.00 49.41  ? 228 ASP C CG    1 
ATOM   5308 O  OD1   . ASP C 1 152 ? 8.003   0.206   -0.019  1.00 40.10  ? 228 ASP C OD1   1 
ATOM   5309 O  OD2   . ASP C 1 152 ? 9.448   1.106   -1.456  1.00 43.43  ? 228 ASP C OD2   1 
ATOM   5310 N  N     . ASP C 1 153 ? 6.087   1.514   1.623   1.00 43.15  ? 229 ASP C N     1 
ATOM   5311 C  CA    . ASP C 1 153 ? 4.651   1.729   1.742   1.00 40.86  ? 229 ASP C CA    1 
ATOM   5312 C  C     . ASP C 1 153 ? 4.240   1.957   3.205   1.00 48.40  ? 229 ASP C C     1 
ATOM   5313 O  O     . ASP C 1 153 ? 3.364   2.774   3.486   1.00 44.91  ? 229 ASP C O     1 
ATOM   5314 C  CB    . ASP C 1 153 ? 3.888   0.549   1.156   1.00 46.08  ? 229 ASP C CB    1 
ATOM   5315 C  CG    . ASP C 1 153 ? 4.361   0.183   -0.232  1.00 45.52  ? 229 ASP C CG    1 
ATOM   5316 O  OD1   . ASP C 1 153 ? 4.819   1.075   -0.971  1.00 49.85  ? 229 ASP C OD1   1 
ATOM   5317 O  OD2   . ASP C 1 153 ? 4.274   -0.998  -0.586  1.00 49.53  ? 229 ASP C OD2   1 
ATOM   5318 N  N     . GLU C 1 154 ? 4.884   1.246   4.129   1.00 42.13  ? 230 GLU C N     1 
ATOM   5319 C  CA    . GLU C 1 154 ? 4.628   1.434   5.554   1.00 49.90  ? 230 GLU C CA    1 
ATOM   5320 C  C     . GLU C 1 154 ? 5.068   2.826   6.019   1.00 49.40  ? 230 GLU C C     1 
ATOM   5321 O  O     . GLU C 1 154 ? 4.355   3.515   6.758   1.00 50.00  ? 230 GLU C O     1 
ATOM   5322 C  CB    . GLU C 1 154 ? 5.352   0.366   6.364   1.00 49.87  ? 230 GLU C CB    1 
ATOM   5323 C  CG    . GLU C 1 154 ? 4.756   0.108   7.745   1.00 54.73  ? 230 GLU C CG    1 
ATOM   5324 C  CD    . GLU C 1 154 ? 5.339   1.002   8.827   1.00 55.75  ? 230 GLU C CD    1 
ATOM   5325 O  OE1   . GLU C 1 154 ? 4.750   1.062   9.923   1.00 60.70  ? 230 GLU C OE1   1 
ATOM   5326 O  OE2   . GLU C 1 154 ? 6.386   1.640   8.591   1.00 57.93  ? 230 GLU C OE2   1 
ATOM   5327 N  N     . PHE C 1 155 ? 6.247   3.236   5.568   1.00 53.87  ? 231 PHE C N     1 
ATOM   5328 C  CA    . PHE C 1 155 ? 6.805   4.526   5.942   1.00 43.22  ? 231 PHE C CA    1 
ATOM   5329 C  C     . PHE C 1 155 ? 5.966   5.659   5.379   1.00 46.18  ? 231 PHE C C     1 
ATOM   5330 O  O     . PHE C 1 155 ? 5.840   6.712   6.008   1.00 53.78  ? 231 PHE C O     1 
ATOM   5331 C  CB    . PHE C 1 155 ? 8.252   4.628   5.463   1.00 48.53  ? 231 PHE C CB    1 
ATOM   5332 C  CG    . PHE C 1 155 ? 8.972   5.854   5.948   1.00 48.28  ? 231 PHE C CG    1 
ATOM   5333 C  CD1   . PHE C 1 155 ? 9.168   6.074   7.304   1.00 46.37  ? 231 PHE C CD1   1 
ATOM   5334 C  CD2   . PHE C 1 155 ? 9.468   6.771   5.050   1.00 39.05  ? 231 PHE C CD2   1 
ATOM   5335 C  CE1   . PHE C 1 155 ? 9.839   7.201   7.756   1.00 42.03  ? 231 PHE C CE1   1 
ATOM   5336 C  CE2   . PHE C 1 155 ? 10.147  7.898   5.493   1.00 51.37  ? 231 PHE C CE2   1 
ATOM   5337 C  CZ    . PHE C 1 155 ? 10.333  8.108   6.856   1.00 47.79  ? 231 PHE C CZ    1 
ATOM   5338 N  N     . TYR C 1 156 ? 5.393   5.449   4.196   1.00 48.98  ? 232 TYR C N     1 
ATOM   5339 C  CA    . TYR C 1 156 ? 4.501   6.442   3.600   1.00 45.70  ? 232 TYR C CA    1 
ATOM   5340 C  C     . TYR C 1 156 ? 3.363   6.755   4.560   1.00 48.94  ? 232 TYR C C     1 
ATOM   5341 O  O     . TYR C 1 156 ? 3.032   7.919   4.784   1.00 49.76  ? 232 TYR C O     1 
ATOM   5342 C  CB    . TYR C 1 156 ? 3.919   5.955   2.274   1.00 44.79  ? 232 TYR C CB    1 
ATOM   5343 C  CG    . TYR C 1 156 ? 2.801   6.837   1.761   1.00 48.84  ? 232 TYR C CG    1 
ATOM   5344 C  CD1   . TYR C 1 156 ? 3.084   8.000   1.056   1.00 50.82  ? 232 TYR C CD1   1 
ATOM   5345 C  CD2   . TYR C 1 156 ? 1.465   6.511   1.978   1.00 51.34  ? 232 TYR C CD2   1 
ATOM   5346 C  CE1   . TYR C 1 156 ? 2.076   8.819   0.589   1.00 51.47  ? 232 TYR C CE1   1 
ATOM   5347 C  CE2   . TYR C 1 156 ? 0.441   7.331   1.508   1.00 55.29  ? 232 TYR C CE2   1 
ATOM   5348 C  CZ    . TYR C 1 156 ? 0.758   8.488   0.818   1.00 58.31  ? 232 TYR C CZ    1 
ATOM   5349 O  OH    . TYR C 1 156 ? -0.237  9.320   0.342   1.00 59.40  ? 232 TYR C OH    1 
ATOM   5350 N  N     . ARG C 1 157 ? 2.777   5.702   5.124   1.00 50.58  ? 233 ARG C N     1 
ATOM   5351 C  CA    . ARG C 1 157 ? 1.653   5.842   6.049   1.00 54.04  ? 233 ARG C CA    1 
ATOM   5352 C  C     . ARG C 1 157 ? 2.049   6.574   7.329   1.00 54.26  ? 233 ARG C C     1 
ATOM   5353 O  O     . ARG C 1 157 ? 1.282   7.384   7.842   1.00 53.85  ? 233 ARG C O     1 
ATOM   5354 C  CB    . ARG C 1 157 ? 1.015   4.479   6.346   1.00 48.40  ? 233 ARG C CB    1 
ATOM   5355 C  CG    . ARG C 1 157 ? 0.310   3.889   5.124   1.00 50.49  ? 233 ARG C CG    1 
ATOM   5356 C  CD    . ARG C 1 157 ? -0.458  2.615   5.446   1.00 68.55  ? 233 ARG C CD    1 
ATOM   5357 N  NE    . ARG C 1 157 ? 0.408   1.450   5.655   1.00 69.12  ? 233 ARG C NE    1 
ATOM   5358 C  CZ    . ARG C 1 157 ? 0.644   0.505   4.740   1.00 75.48  ? 233 ARG C CZ    1 
ATOM   5359 N  NH1   . ARG C 1 157 ? 0.082   0.577   3.533   1.00 69.63  ? 233 ARG C NH1   1 
ATOM   5360 N  NH2   . ARG C 1 157 ? 1.447   -0.517  5.033   1.00 71.55  ? 233 ARG C NH2   1 
ATOM   5361 N  N     . ARG C 1 158 ? 3.253   6.299   7.822   1.00 55.40  ? 234 ARG C N     1 
ATOM   5362 C  CA    . ARG C 1 158 ? 3.820   7.056   8.931   1.00 45.87  ? 234 ARG C CA    1 
ATOM   5363 C  C     . ARG C 1 158 ? 3.901   8.543   8.598   1.00 52.32  ? 234 ARG C C     1 
ATOM   5364 O  O     . ARG C 1 158 ? 3.600   9.394   9.440   1.00 53.94  ? 234 ARG C O     1 
ATOM   5365 C  CB    . ARG C 1 158 ? 5.220   6.552   9.287   1.00 37.99  ? 234 ARG C CB    1 
ATOM   5366 C  CG    . ARG C 1 158 ? 5.269   5.149   9.834   1.00 47.51  ? 234 ARG C CG    1 
ATOM   5367 C  CD    . ARG C 1 158 ? 6.617   4.857   10.488  1.00 42.18  ? 234 ARG C CD    1 
ATOM   5368 N  NE    . ARG C 1 158 ? 6.616   3.536   11.109  1.00 42.53  ? 234 ARG C NE    1 
ATOM   5369 C  CZ    . ARG C 1 158 ? 7.414   3.171   12.108  1.00 46.51  ? 234 ARG C CZ    1 
ATOM   5370 N  NH1   . ARG C 1 158 ? 8.288   4.036   12.616  1.00 41.44  ? 234 ARG C NH1   1 
ATOM   5371 N  NH2   . ARG C 1 158 ? 7.328   1.942   12.611  1.00 44.44  ? 234 ARG C NH2   1 
ATOM   5372 N  N     . ILE C 1 159 ? 4.324   8.851   7.375   1.00 53.51  ? 235 ILE C N     1 
ATOM   5373 C  CA    . ILE C 1 159 ? 4.498   10.239  6.964   1.00 48.88  ? 235 ILE C CA    1 
ATOM   5374 C  C     . ILE C 1 159 ? 3.182   10.994  7.045   1.00 52.78  ? 235 ILE C C     1 
ATOM   5375 O  O     . ILE C 1 159 ? 3.087   12.007  7.737   1.00 58.13  ? 235 ILE C O     1 
ATOM   5376 C  CB    . ILE C 1 159 ? 5.101   10.367  5.540   1.00 48.31  ? 235 ILE C CB    1 
ATOM   5377 C  CG1   . ILE C 1 159 ? 6.563   9.905   5.548   1.00 51.21  ? 235 ILE C CG1   1 
ATOM   5378 C  CG2   . ILE C 1 159 ? 4.990   11.812  5.031   1.00 41.51  ? 235 ILE C CG2   1 
ATOM   5379 C  CD1   . ILE C 1 159 ? 7.230   9.919   4.181   1.00 46.43  ? 235 ILE C CD1   1 
ATOM   5380 N  N     . LYS C 1 160 ? 2.166   10.491  6.351   1.00 57.52  ? 236 LYS C N     1 
ATOM   5381 C  CA    . LYS C 1 160 ? 0.861   11.145  6.337   1.00 64.99  ? 236 LYS C CA    1 
ATOM   5382 C  C     . LYS C 1 160 ? 0.201   11.092  7.724   1.00 62.47  ? 236 LYS C C     1 
ATOM   5383 O  O     . LYS C 1 160 ? -0.474  12.037  8.145   1.00 56.60  ? 236 LYS C O     1 
ATOM   5384 C  CB    . LYS C 1 160 ? -0.040  10.548  5.243   1.00 60.88  ? 236 LYS C CB    1 
ATOM   5385 C  CG    . LYS C 1 160 ? 0.458   10.817  3.803   1.00 59.70  ? 236 LYS C CG    1 
ATOM   5386 C  CD    . LYS C 1 160 ? 0.629   12.315  3.511   1.00 62.20  ? 236 LYS C CD    1 
ATOM   5387 C  CE    . LYS C 1 160 ? 1.060   12.568  2.060   1.00 66.86  ? 236 LYS C CE    1 
ATOM   5388 N  NZ    . LYS C 1 160 ? 1.335   14.019  1.721   1.00 59.37  ? 236 LYS C NZ    1 
ATOM   5389 N  N     . GLY C 1 161 ? 0.445   9.998   8.441   1.00 55.01  ? 237 GLY C N     1 
ATOM   5390 C  CA    . GLY C 1 161 ? -0.074  9.824   9.781   1.00 52.60  ? 237 GLY C CA    1 
ATOM   5391 C  C     . GLY C 1 161 ? 0.615   10.686  10.825  1.00 59.35  ? 237 GLY C C     1 
ATOM   5392 O  O     . GLY C 1 161 ? 0.289   10.629  12.006  1.00 65.20  ? 237 GLY C O     1 
ATOM   5393 N  N     . ALA C 1 162 ? 1.580   11.484  10.401  1.00 56.21  ? 238 ALA C N     1 
ATOM   5394 C  CA    . ALA C 1 162 ? 2.249   12.373  11.326  1.00 49.66  ? 238 ALA C CA    1 
ATOM   5395 C  C     . ALA C 1 162 ? 1.952   13.808  10.918  1.00 51.84  ? 238 ALA C C     1 
ATOM   5396 O  O     . ALA C 1 162 ? 2.527   14.757  11.456  1.00 52.74  ? 238 ALA C O     1 
ATOM   5397 C  CB    . ALA C 1 162 ? 3.738   12.098  11.344  1.00 41.97  ? 238 ALA C CB    1 
ATOM   5398 N  N     . GLY C 1 163 ? 1.044   13.960  9.956   1.00 51.37  ? 239 GLY C N     1 
ATOM   5399 C  CA    . GLY C 1 163 ? 0.633   15.277  9.496   1.00 48.11  ? 239 GLY C CA    1 
ATOM   5400 C  C     . GLY C 1 163 ? 1.572   15.919  8.494   1.00 48.83  ? 239 GLY C C     1 
ATOM   5401 O  O     . GLY C 1 163 ? 1.400   17.076  8.106   1.00 47.89  ? 239 GLY C O     1 
ATOM   5402 N  N     . LEU C 1 164 ? 2.568   15.160  8.056   1.00 54.44  ? 240 LEU C N     1 
ATOM   5403 C  CA    . LEU C 1 164 ? 3.573   15.688  7.151   1.00 46.46  ? 240 LEU C CA    1 
ATOM   5404 C  C     . LEU C 1 164 ? 3.098   15.661  5.709   1.00 43.21  ? 240 LEU C C     1 
ATOM   5405 O  O     . LEU C 1 164 ? 2.316   14.807  5.318   1.00 54.34  ? 240 LEU C O     1 
ATOM   5406 C  CB    . LEU C 1 164 ? 4.876   14.915  7.307   1.00 55.79  ? 240 LEU C CB    1 
ATOM   5407 C  CG    . LEU C 1 164 ? 5.534   15.088  8.678   1.00 51.65  ? 240 LEU C CG    1 
ATOM   5408 C  CD1   . LEU C 1 164 ? 6.852   14.324  8.728   1.00 52.49  ? 240 LEU C CD1   1 
ATOM   5409 C  CD2   . LEU C 1 164 ? 5.736   16.573  8.995   1.00 47.33  ? 240 LEU C CD2   1 
ATOM   5410 N  N     . GLN C 1 165 ? 3.554   16.625  4.924   1.00 49.41  ? 241 GLN C N     1 
ATOM   5411 C  CA    . GLN C 1 165 ? 3.241   16.637  3.510   1.00 49.78  ? 241 GLN C CA    1 
ATOM   5412 C  C     . GLN C 1 165 ? 4.417   16.032  2.763   1.00 48.28  ? 241 GLN C C     1 
ATOM   5413 O  O     . GLN C 1 165 ? 5.569   16.227  3.137   1.00 52.39  ? 241 GLN C O     1 
ATOM   5414 C  CB    . GLN C 1 165 ? 2.949   18.059  3.026   1.00 49.42  ? 241 GLN C CB    1 
ATOM   5415 C  CG    . GLN C 1 165 ? 2.637   18.161  1.529   1.00 58.32  ? 241 GLN C CG    1 
ATOM   5416 C  CD    . GLN C 1 165 ? 1.849   19.411  1.188   1.00 71.71  ? 241 GLN C CD    1 
ATOM   5417 O  OE1   . GLN C 1 165 ? 1.027   19.867  1.986   1.00 82.00  ? 241 GLN C OE1   1 
ATOM   5418 N  NE2   . GLN C 1 165 ? 2.101   19.981  0.004   1.00 62.34  ? 241 GLN C NE2   1 
ATOM   5419 N  N     . LEU C 1 166 ? 4.122   15.273  1.721   1.00 54.28  ? 242 LEU C N     1 
ATOM   5420 C  CA    . LEU C 1 166 ? 5.157   14.609  0.943   1.00 49.55  ? 242 LEU C CA    1 
ATOM   5421 C  C     . LEU C 1 166 ? 5.318   15.422  -0.321  1.00 44.10  ? 242 LEU C C     1 
ATOM   5422 O  O     . LEU C 1 166 ? 4.328   15.785  -0.950  1.00 47.09  ? 242 LEU C O     1 
ATOM   5423 C  CB    . LEU C 1 166 ? 4.713   13.172  0.639   1.00 52.20  ? 242 LEU C CB    1 
ATOM   5424 C  CG    . LEU C 1 166 ? 5.615   12.081  0.050   1.00 52.91  ? 242 LEU C CG    1 
ATOM   5425 C  CD1   . LEU C 1 166 ? 5.370   11.948  -1.432  1.00 45.10  ? 242 LEU C CD1   1 
ATOM   5426 C  CD2   . LEU C 1 166 ? 7.078   12.358  0.341   1.00 47.03  ? 242 LEU C CD2   1 
ATOM   5427 N  N     . PHE C 1 167 ? 6.554   15.751  -0.679  1.00 48.81  ? 243 PHE C N     1 
ATOM   5428 C  CA    . PHE C 1 167 ? 6.798   16.525  -1.897  1.00 44.84  ? 243 PHE C CA    1 
ATOM   5429 C  C     . PHE C 1 167 ? 7.566   15.714  -2.932  1.00 45.44  ? 243 PHE C C     1 
ATOM   5430 O  O     . PHE C 1 167 ? 8.272   14.769  -2.591  1.00 45.97  ? 243 PHE C O     1 
ATOM   5431 C  CB    . PHE C 1 167 ? 7.553   17.821  -1.588  1.00 47.14  ? 243 PHE C CB    1 
ATOM   5432 C  CG    . PHE C 1 167 ? 6.761   18.794  -0.782  1.00 45.89  ? 243 PHE C CG    1 
ATOM   5433 C  CD1   . PHE C 1 167 ? 5.959   19.730  -1.404  1.00 49.89  ? 243 PHE C CD1   1 
ATOM   5434 C  CD2   . PHE C 1 167 ? 6.801   18.761  0.601   1.00 47.88  ? 243 PHE C CD2   1 
ATOM   5435 C  CE1   . PHE C 1 167 ? 5.212   20.623  -0.664  1.00 46.67  ? 243 PHE C CE1   1 
ATOM   5436 C  CE2   . PHE C 1 167 ? 6.061   19.652  1.345   1.00 54.54  ? 243 PHE C CE2   1 
ATOM   5437 C  CZ    . PHE C 1 167 ? 5.268   20.585  0.710   1.00 50.76  ? 243 PHE C CZ    1 
ATOM   5438 N  N     . ARG C 1 168 ? 7.423   16.099  -4.196  1.00 49.39  ? 244 ARG C N     1 
ATOM   5439 C  CA    . ARG C 1 168 ? 8.128   15.449  -5.294  1.00 48.93  ? 244 ARG C CA    1 
ATOM   5440 C  C     . ARG C 1 168 ? 8.550   16.504  -6.294  1.00 50.46  ? 244 ARG C C     1 
ATOM   5441 O  O     . ARG C 1 168 ? 7.996   17.597  -6.284  1.00 53.18  ? 244 ARG C O     1 
ATOM   5442 C  CB    . ARG C 1 168 ? 7.222   14.421  -5.966  1.00 51.77  ? 244 ARG C CB    1 
ATOM   5443 C  CG    . ARG C 1 168 ? 7.151   13.120  -5.219  1.00 47.12  ? 244 ARG C CG    1 
ATOM   5444 C  CD    . ARG C 1 168 ? 5.940   12.351  -5.634  1.00 45.79  ? 244 ARG C CD    1 
ATOM   5445 N  NE    . ARG C 1 168 ? 5.879   11.097  -4.908  1.00 53.02  ? 244 ARG C NE    1 
ATOM   5446 C  CZ    . ARG C 1 168 ? 4.762   10.413  -4.730  1.00 53.77  ? 244 ARG C CZ    1 
ATOM   5447 N  NH1   . ARG C 1 168 ? 3.628   10.881  -5.232  1.00 56.59  ? 244 ARG C NH1   1 
ATOM   5448 N  NH2   . ARG C 1 168 ? 4.785   9.274   -4.052  1.00 48.64  ? 244 ARG C NH2   1 
ATOM   5449 N  N     . PRO C 1 169 ? 9.536   16.183  -7.157  1.00 55.37  ? 245 PRO C N     1 
ATOM   5450 C  CA    . PRO C 1 169 ? 9.983   17.135  -8.182  1.00 50.46  ? 245 PRO C CA    1 
ATOM   5451 C  C     . PRO C 1 169 ? 8.854   17.533  -9.121  1.00 49.76  ? 245 PRO C C     1 
ATOM   5452 O  O     . PRO C 1 169 ? 8.092   16.677  -9.537  1.00 50.70  ? 245 PRO C O     1 
ATOM   5453 C  CB    . PRO C 1 169 ? 11.029  16.337  -8.964  1.00 46.53  ? 245 PRO C CB    1 
ATOM   5454 C  CG    . PRO C 1 169 ? 11.527  15.306  -8.004  1.00 44.04  ? 245 PRO C CG    1 
ATOM   5455 C  CD    . PRO C 1 169 ? 10.352  14.954  -7.149  1.00 45.96  ? 245 PRO C CD    1 
ATOM   5456 N  N     . SER C 1 170 ? 8.741   18.817  -9.444  1.00 57.23  ? 246 SER C N     1 
ATOM   5457 C  CA    . SER C 1 170 ? 7.824   19.242  -10.500 1.00 53.24  ? 246 SER C CA    1 
ATOM   5458 C  C     . SER C 1 170 ? 8.625   19.800  -11.678 1.00 48.93  ? 246 SER C C     1 
ATOM   5459 O  O     . SER C 1 170 ? 9.688   20.388  -11.484 1.00 55.17  ? 246 SER C O     1 
ATOM   5460 C  CB    . SER C 1 170 ? 6.810   20.267  -9.976  1.00 60.88  ? 246 SER C CB    1 
ATOM   5461 O  OG    . SER C 1 170 ? 7.441   21.487  -9.630  1.00 63.29  ? 246 SER C OG    1 
ATOM   5462 N  N     . GLY C 1 171 ? 8.141   19.576  -12.898 1.00 49.80  ? 247 GLY C N     1 
ATOM   5463 C  CA    . GLY C 1 171 ? 8.775   20.142  -14.082 1.00 50.46  ? 247 GLY C CA    1 
ATOM   5464 C  C     . GLY C 1 171 ? 9.972   19.394  -14.646 1.00 56.02  ? 247 GLY C C     1 
ATOM   5465 O  O     . GLY C 1 171 ? 10.668  19.891  -15.540 1.00 52.60  ? 247 GLY C O     1 
ATOM   5466 N  N     . ILE C 1 172 ? 10.226  18.202  -14.121 1.00 52.58  ? 248 ILE C N     1 
ATOM   5467 C  CA    . ILE C 1 172 ? 11.261  17.344  -14.674 1.00 50.15  ? 248 ILE C CA    1 
ATOM   5468 C  C     . ILE C 1 172 ? 10.804  16.835  -16.038 1.00 50.26  ? 248 ILE C C     1 
ATOM   5469 O  O     . ILE C 1 172 ? 9.664   16.398  -16.200 1.00 50.50  ? 248 ILE C O     1 
ATOM   5470 C  CB    . ILE C 1 172 ? 11.548  16.148  -13.738 1.00 61.78  ? 248 ILE C CB    1 
ATOM   5471 C  CG1   . ILE C 1 172 ? 11.980  16.654  -12.356 1.00 52.46  ? 248 ILE C CG1   1 
ATOM   5472 C  CG2   . ILE C 1 172 ? 12.596  15.213  -14.348 1.00 52.24  ? 248 ILE C CG2   1 
ATOM   5473 C  CD1   . ILE C 1 172 ? 13.171  17.589  -12.395 1.00 47.61  ? 248 ILE C CD1   1 
ATOM   5474 N  N     . THR C 1 173 ? 11.693  16.895  -17.019 1.00 53.10  ? 249 THR C N     1 
ATOM   5475 C  CA    . THR C 1 173 ? 11.334  16.546  -18.388 1.00 52.04  ? 249 THR C CA    1 
ATOM   5476 C  C     . THR C 1 173 ? 12.098  15.309  -18.878 1.00 55.91  ? 249 THR C C     1 
ATOM   5477 O  O     . THR C 1 173 ? 11.920  14.866  -20.010 1.00 58.30  ? 249 THR C O     1 
ATOM   5478 C  CB    . THR C 1 173 ? 11.610  17.743  -19.343 1.00 52.91  ? 249 THR C CB    1 
ATOM   5479 O  OG1   . THR C 1 173 ? 13.022  17.918  -19.508 1.00 48.06  ? 249 THR C OG1   1 
ATOM   5480 C  CG2   . THR C 1 173 ? 11.026  19.025  -18.771 1.00 46.67  ? 249 THR C CG2   1 
ATOM   5481 N  N     . THR C 1 174 ? 12.947  14.754  -18.019 1.00 60.28  ? 250 THR C N     1 
ATOM   5482 C  CA    . THR C 1 174 ? 13.831  13.658  -18.417 1.00 53.98  ? 250 THR C CA    1 
ATOM   5483 C  C     . THR C 1 174 ? 13.201  12.265  -18.315 1.00 53.00  ? 250 THR C C     1 
ATOM   5484 O  O     . THR C 1 174 ? 13.838  11.265  -18.666 1.00 51.33  ? 250 THR C O     1 
ATOM   5485 C  CB    . THR C 1 174 ? 15.163  13.691  -17.640 1.00 51.99  ? 250 THR C CB    1 
ATOM   5486 O  OG1   . THR C 1 174 ? 14.896  13.869  -16.242 1.00 57.09  ? 250 THR C OG1   1 
ATOM   5487 C  CG2   . THR C 1 174 ? 16.037  14.842  -18.141 1.00 49.83  ? 250 THR C CG2   1 
ATOM   5488 N  N     . GLY C 1 175 ? 11.959  12.203  -17.842 1.00 52.42  ? 251 GLY C N     1 
ATOM   5489 C  CA    . GLY C 1 175 ? 11.191  10.968  -17.856 1.00 50.52  ? 251 GLY C CA    1 
ATOM   5490 C  C     . GLY C 1 175 ? 11.896  9.793   -17.214 1.00 52.53  ? 251 GLY C C     1 
ATOM   5491 O  O     . GLY C 1 175 ? 12.403  9.909   -16.102 1.00 60.46  ? 251 GLY C O     1 
ATOM   5492 N  N     . TYR C 1 176 ? 11.946  8.667   -17.921 1.00 55.02  ? 252 TYR C N     1 
ATOM   5493 C  CA    . TYR C 1 176 ? 12.538  7.440   -17.381 1.00 55.41  ? 252 TYR C CA    1 
ATOM   5494 C  C     . TYR C 1 176 ? 14.044  7.411   -17.558 1.00 50.99  ? 252 TYR C C     1 
ATOM   5495 O  O     . TYR C 1 176 ? 14.688  6.395   -17.298 1.00 56.83  ? 252 TYR C O     1 
ATOM   5496 C  CB    . TYR C 1 176 ? 11.913  6.193   -18.011 1.00 45.41  ? 252 TYR C CB    1 
ATOM   5497 C  CG    . TYR C 1 176 ? 10.460  6.001   -17.646 1.00 49.42  ? 252 TYR C CG    1 
ATOM   5498 C  CD1   . TYR C 1 176 ? 9.942   6.540   -16.472 1.00 48.26  ? 252 TYR C CD1   1 
ATOM   5499 C  CD2   . TYR C 1 176 ? 9.598   5.292   -18.479 1.00 51.96  ? 252 TYR C CD2   1 
ATOM   5500 C  CE1   . TYR C 1 176 ? 8.603   6.375   -16.131 1.00 47.52  ? 252 TYR C CE1   1 
ATOM   5501 C  CE2   . TYR C 1 176 ? 8.256   5.118   -18.144 1.00 53.23  ? 252 TYR C CE2   1 
ATOM   5502 C  CZ    . TYR C 1 176 ? 7.768   5.663   -16.971 1.00 46.30  ? 252 TYR C CZ    1 
ATOM   5503 O  OH    . TYR C 1 176 ? 6.444   5.505   -16.639 1.00 51.66  ? 252 TYR C OH    1 
ATOM   5504 N  N     . LYS C 1 177 ? 14.603  8.533   -17.988 1.00 47.39  ? 253 LYS C N     1 
ATOM   5505 C  CA    . LYS C 1 177 ? 16.050  8.663   -18.071 1.00 54.37  ? 253 LYS C CA    1 
ATOM   5506 C  C     . LYS C 1 177 ? 16.576  9.671   -17.044 1.00 46.40  ? 253 LYS C C     1 
ATOM   5507 O  O     . LYS C 1 177 ? 17.703  10.157  -17.149 1.00 54.59  ? 253 LYS C O     1 
ATOM   5508 C  CB    . LYS C 1 177 ? 16.481  9.014   -19.500 1.00 52.27  ? 253 LYS C CB    1 
ATOM   5509 C  CG    . LYS C 1 177 ? 16.029  7.963   -20.507 1.00 58.16  ? 253 LYS C CG    1 
ATOM   5510 C  CD    . LYS C 1 177 ? 16.763  8.043   -21.830 1.00 67.63  ? 253 LYS C CD    1 
ATOM   5511 C  CE    . LYS C 1 177 ? 16.524  6.769   -22.647 1.00 70.45  ? 253 LYS C CE    1 
ATOM   5512 N  NZ    . LYS C 1 177 ? 17.226  6.781   -23.965 1.00 70.73  ? 253 LYS C NZ    1 
ATOM   5513 N  N     . THR C 1 178 ? 15.750  9.966   -16.045 1.00 49.30  ? 254 THR C N     1 
ATOM   5514 C  CA    . THR C 1 178 ? 16.124  10.868  -14.954 1.00 45.57  ? 254 THR C CA    1 
ATOM   5515 C  C     . THR C 1 178 ? 17.137  10.176  -14.051 1.00 45.14  ? 254 THR C C     1 
ATOM   5516 O  O     . THR C 1 178 ? 17.986  10.818  -13.432 1.00 41.93  ? 254 THR C O     1 
ATOM   5517 C  CB    . THR C 1 178 ? 14.890  11.238  -14.131 1.00 46.51  ? 254 THR C CB    1 
ATOM   5518 O  OG1   . THR C 1 178 ? 13.962  11.933  -14.970 1.00 49.58  ? 254 THR C OG1   1 
ATOM   5519 C  CG2   . THR C 1 178 ? 15.260  12.109  -12.932 1.00 45.00  ? 254 THR C CG2   1 
ATOM   5520 N  N     . PHE C 1 179 ? 17.040  8.849   -14.000 1.00 49.37  ? 255 PHE C N     1 
ATOM   5521 C  CA    . PHE C 1 179 ? 17.934  8.026   -13.198 1.00 39.15  ? 255 PHE C CA    1 
ATOM   5522 C  C     . PHE C 1 179 ? 18.552  6.919   -14.029 1.00 40.13  ? 255 PHE C C     1 
ATOM   5523 O  O     . PHE C 1 179 ? 17.916  6.387   -14.943 1.00 41.04  ? 255 PHE C O     1 
ATOM   5524 C  CB    . PHE C 1 179 ? 17.167  7.380   -12.040 1.00 33.75  ? 255 PHE C CB    1 
ATOM   5525 C  CG    . PHE C 1 179 ? 16.477  8.359   -11.156 1.00 39.53  ? 255 PHE C CG    1 
ATOM   5526 C  CD1   . PHE C 1 179 ? 17.188  9.075   -10.210 1.00 37.37  ? 255 PHE C CD1   1 
ATOM   5527 C  CD2   . PHE C 1 179 ? 15.114  8.565   -11.263 1.00 39.84  ? 255 PHE C CD2   1 
ATOM   5528 C  CE1   . PHE C 1 179 ? 16.551  9.991   -9.389  1.00 38.86  ? 255 PHE C CE1   1 
ATOM   5529 C  CE2   . PHE C 1 179 ? 14.471  9.480   -10.438 1.00 45.35  ? 255 PHE C CE2   1 
ATOM   5530 C  CZ    . PHE C 1 179 ? 15.193  10.195  -9.506  1.00 37.43  ? 255 PHE C CZ    1 
ATOM   5531 N  N     . ARG C 1 180 ? 19.789  6.562   -13.701 1.00 36.99  ? 256 ARG C N     1 
ATOM   5532 C  CA    . ARG C 1 180 ? 20.325  5.298   -14.159 1.00 43.87  ? 256 ARG C CA    1 
ATOM   5533 C  C     . ARG C 1 180 ? 20.135  4.240   -13.078 1.00 43.18  ? 256 ARG C C     1 
ATOM   5534 O  O     . ARG C 1 180 ? 20.711  4.330   -11.994 1.00 42.34  ? 256 ARG C O     1 
ATOM   5535 C  CB    . ARG C 1 180 ? 21.799  5.398   -14.540 1.00 46.52  ? 256 ARG C CB    1 
ATOM   5536 C  CG    . ARG C 1 180 ? 22.347  4.071   -15.065 1.00 42.55  ? 256 ARG C CG    1 
ATOM   5537 C  CD    . ARG C 1 180 ? 23.307  4.266   -16.238 1.00 58.35  ? 256 ARG C CD    1 
ATOM   5538 N  NE    . ARG C 1 180 ? 24.206  5.398   -16.020 1.00 67.30  ? 256 ARG C NE    1 
ATOM   5539 C  CZ    . ARG C 1 180 ? 24.162  6.543   -16.702 1.00 66.53  ? 256 ARG C CZ    1 
ATOM   5540 N  NH1   . ARG C 1 180 ? 23.266  6.715   -17.674 1.00 61.41  ? 256 ARG C NH1   1 
ATOM   5541 N  NH2   . ARG C 1 180 ? 25.025  7.516   -16.420 1.00 65.28  ? 256 ARG C NH2   1 
ATOM   5542 N  N     . HIS C 1 181 ? 19.322  3.239   -13.385 1.00 40.05  ? 257 HIS C N     1 
ATOM   5543 C  CA    . HIS C 1 181 ? 19.083  2.143   -12.469 1.00 38.11  ? 257 HIS C CA    1 
ATOM   5544 C  C     . HIS C 1 181 ? 20.006  0.978   -12.817 1.00 41.03  ? 257 HIS C C     1 
ATOM   5545 O  O     . HIS C 1 181 ? 19.694  0.158   -13.674 1.00 36.38  ? 257 HIS C O     1 
ATOM   5546 C  CB    . HIS C 1 181 ? 17.617  1.715   -12.516 1.00 38.98  ? 257 HIS C CB    1 
ATOM   5547 C  CG    . HIS C 1 181 ? 17.222  0.808   -11.392 1.00 38.02  ? 257 HIS C CG    1 
ATOM   5548 N  ND1   . HIS C 1 181 ? 16.115  -0.006  -11.448 1.00 41.05  ? 257 HIS C ND1   1 
ATOM   5549 C  CD2   . HIS C 1 181 ? 17.787  0.591   -10.183 1.00 37.72  ? 257 HIS C CD2   1 
ATOM   5550 C  CE1   . HIS C 1 181 ? 16.017  -0.692  -10.323 1.00 40.04  ? 257 HIS C CE1   1 
ATOM   5551 N  NE2   . HIS C 1 181 ? 17.019  -0.342  -9.536  1.00 38.97  ? 257 HIS C NE2   1 
ATOM   5552 N  N     . LEU C 1 182 ? 21.147  0.928   -12.136 1.00 41.03  ? 258 LEU C N     1 
ATOM   5553 C  CA    . LEU C 1 182 ? 22.166  -0.089  -12.345 1.00 39.42  ? 258 LEU C CA    1 
ATOM   5554 C  C     . LEU C 1 182 ? 21.764  -1.415  -11.688 1.00 46.01  ? 258 LEU C C     1 
ATOM   5555 O  O     . LEU C 1 182 ? 22.360  -1.819  -10.691 1.00 44.42  ? 258 LEU C O     1 
ATOM   5556 C  CB    . LEU C 1 182 ? 23.496  0.392   -11.735 1.00 42.58  ? 258 LEU C CB    1 
ATOM   5557 C  CG    . LEU C 1 182 ? 24.094  1.740   -12.172 1.00 48.07  ? 258 LEU C CG    1 
ATOM   5558 C  CD1   . LEU C 1 182 ? 25.322  2.063   -11.359 1.00 45.93  ? 258 LEU C CD1   1 
ATOM   5559 C  CD2   . LEU C 1 182 ? 24.477  1.713   -13.649 1.00 54.82  ? 258 LEU C CD2   1 
ATOM   5560 N  N     . HIS C 1 183 ? 20.776  -2.106  -12.242 1.00 39.68  ? 259 HIS C N     1 
ATOM   5561 C  CA    . HIS C 1 183 ? 20.209  -3.247  -11.540 1.00 37.66  ? 259 HIS C CA    1 
ATOM   5562 C  C     . HIS C 1 183 ? 19.778  -4.309  -12.511 1.00 40.34  ? 259 HIS C C     1 
ATOM   5563 O  O     . HIS C 1 183 ? 18.650  -4.297  -12.980 1.00 42.77  ? 259 HIS C O     1 
ATOM   5564 C  CB    . HIS C 1 183 ? 19.019  -2.817  -10.660 1.00 39.99  ? 259 HIS C CB    1 
ATOM   5565 C  CG    . HIS C 1 183 ? 18.503  -3.898  -9.748  1.00 40.20  ? 259 HIS C CG    1 
ATOM   5566 N  ND1   . HIS C 1 183 ? 17.829  -3.624  -8.577  1.00 34.29  ? 259 HIS C ND1   1 
ATOM   5567 C  CD2   . HIS C 1 183 ? 18.550  -5.251  -9.842  1.00 42.18  ? 259 HIS C CD2   1 
ATOM   5568 C  CE1   . HIS C 1 183 ? 17.499  -4.755  -7.980  1.00 36.58  ? 259 HIS C CE1   1 
ATOM   5569 N  NE2   . HIS C 1 183 ? 17.923  -5.758  -8.728  1.00 43.31  ? 259 HIS C NE2   1 
ATOM   5570 N  N     . ASP C 1 184 ? 20.694  -5.223  -12.810 1.00 43.22  ? 260 ASP C N     1 
ATOM   5571 C  CA    . ASP C 1 184 ? 20.412  -6.368  -13.654 1.00 45.20  ? 260 ASP C CA    1 
ATOM   5572 C  C     . ASP C 1 184 ? 19.509  -7.313  -12.869 1.00 48.09  ? 260 ASP C C     1 
ATOM   5573 O  O     . ASP C 1 184 ? 19.946  -7.925  -11.893 1.00 47.39  ? 260 ASP C O     1 
ATOM   5574 C  CB    . ASP C 1 184 ? 21.732  -7.056  -14.022 1.00 51.63  ? 260 ASP C CB    1 
ATOM   5575 C  CG    . ASP C 1 184 ? 21.563  -8.177  -15.048 1.00 59.31  ? 260 ASP C CG    1 
ATOM   5576 O  OD1   . ASP C 1 184 ? 20.583  -8.955  -14.959 1.00 57.68  ? 260 ASP C OD1   1 
ATOM   5577 O  OD2   . ASP C 1 184 ? 22.437  -8.283  -15.940 1.00 61.22  ? 260 ASP C OD2   1 
ATOM   5578 N  N     . PRO C 1 185 ? 18.242  -7.441  -13.295 1.00 53.80  ? 261 PRO C N     1 
ATOM   5579 C  CA    . PRO C 1 185 ? 17.279  -8.234  -12.514 1.00 50.14  ? 261 PRO C CA    1 
ATOM   5580 C  C     . PRO C 1 185 ? 17.621  -9.726  -12.491 1.00 60.14  ? 261 PRO C C     1 
ATOM   5581 O  O     . PRO C 1 185 ? 17.134  -10.439 -11.605 1.00 56.32  ? 261 PRO C O     1 
ATOM   5582 C  CB    . PRO C 1 185 ? 15.946  -7.981  -13.229 1.00 51.84  ? 261 PRO C CB    1 
ATOM   5583 C  CG    . PRO C 1 185 ? 16.330  -7.586  -14.634 1.00 54.51  ? 261 PRO C CG    1 
ATOM   5584 C  CD    . PRO C 1 185 ? 17.648  -6.871  -14.522 1.00 52.11  ? 261 PRO C CD    1 
ATOM   5585 N  N     . ALA C 1 186 ? 18.453  -10.172 -13.438 1.00 58.60  ? 262 ALA C N     1 
ATOM   5586 C  CA    . ALA C 1 186 ? 18.932  -11.555 -13.470 1.00 64.63  ? 262 ALA C CA    1 
ATOM   5587 C  C     . ALA C 1 186 ? 19.985  -11.825 -12.392 1.00 62.70  ? 262 ALA C C     1 
ATOM   5588 O  O     . ALA C 1 186 ? 19.955  -12.865 -11.727 1.00 60.91  ? 262 ALA C O     1 
ATOM   5589 C  CB    . ALA C 1 186 ? 19.493  -11.892 -14.850 1.00 53.39  ? 262 ALA C CB    1 
ATOM   5590 N  N     . TRP C 1 187 ? 20.897  -10.869 -12.221 1.00 54.37  ? 263 TRP C N     1 
ATOM   5591 C  CA    . TRP C 1 187 ? 22.077  -11.019 -11.368 1.00 47.74  ? 263 TRP C CA    1 
ATOM   5592 C  C     . TRP C 1 187 ? 21.833  -10.550 -9.931  1.00 49.07  ? 263 TRP C C     1 
ATOM   5593 O  O     . TRP C 1 187 ? 22.343  -11.141 -8.977  1.00 44.16  ? 263 TRP C O     1 
ATOM   5594 C  CB    . TRP C 1 187 ? 23.233  -10.213 -11.983 1.00 49.03  ? 263 TRP C CB    1 
ATOM   5595 C  CG    . TRP C 1 187 ? 24.584  -10.503 -11.407 1.00 48.26  ? 263 TRP C CG    1 
ATOM   5596 C  CD1   . TRP C 1 187 ? 25.373  -9.650  -10.701 1.00 40.46  ? 263 TRP C CD1   1 
ATOM   5597 C  CD2   . TRP C 1 187 ? 25.307  -11.739 -11.495 1.00 50.18  ? 263 TRP C CD2   1 
ATOM   5598 N  NE1   . TRP C 1 187 ? 26.544  -10.275 -10.339 1.00 45.10  ? 263 TRP C NE1   1 
ATOM   5599 C  CE2   . TRP C 1 187 ? 26.526  -11.559 -10.813 1.00 47.66  ? 263 TRP C CE2   1 
ATOM   5600 C  CE3   . TRP C 1 187 ? 25.040  -12.979 -12.084 1.00 49.17  ? 263 TRP C CE3   1 
ATOM   5601 C  CZ2   . TRP C 1 187 ? 27.483  -12.570 -10.712 1.00 52.26  ? 263 TRP C CZ2   1 
ATOM   5602 C  CZ3   . TRP C 1 187 ? 25.987  -13.987 -11.979 1.00 51.75  ? 263 TRP C CZ3   1 
ATOM   5603 C  CH2   . TRP C 1 187 ? 27.195  -13.775 -11.298 1.00 48.54  ? 263 TRP C CH2   1 
ATOM   5604 N  N     . ARG C 1 188 ? 21.085  -9.455  -9.788  1.00 49.15  ? 264 ARG C N     1 
ATOM   5605 C  CA    . ARG C 1 188 ? 20.722  -8.920  -8.476  1.00 49.95  ? 264 ARG C CA    1 
ATOM   5606 C  C     . ARG C 1 188 ? 19.261  -9.259  -8.202  1.00 48.04  ? 264 ARG C C     1 
ATOM   5607 O  O     . ARG C 1 188 ? 18.374  -8.416  -8.329  1.00 49.15  ? 264 ARG C O     1 
ATOM   5608 C  CB    . ARG C 1 188 ? 20.944  -7.402  -8.429  1.00 45.96  ? 264 ARG C CB    1 
ATOM   5609 C  CG    . ARG C 1 188 ? 22.356  -6.966  -8.834  1.00 44.05  ? 264 ARG C CG    1 
ATOM   5610 C  CD    . ARG C 1 188 ? 23.397  -7.528  -7.884  1.00 39.38  ? 264 ARG C CD    1 
ATOM   5611 N  NE    . ARG C 1 188 ? 24.675  -6.832  -7.994  1.00 34.80  ? 264 ARG C NE    1 
ATOM   5612 C  CZ    . ARG C 1 188 ? 25.796  -7.248  -7.416  1.00 40.37  ? 264 ARG C CZ    1 
ATOM   5613 N  NH1   . ARG C 1 188 ? 25.808  -8.376  -6.712  1.00 43.99  ? 264 ARG C NH1   1 
ATOM   5614 N  NH2   . ARG C 1 188 ? 26.911  -6.552  -7.560  1.00 39.72  ? 264 ARG C NH2   1 
ATOM   5615 N  N     . LYS C 1 189 ? 19.024  -10.515 -7.852  1.00 46.15  ? 265 LYS C N     1 
ATOM   5616 C  CA    . LYS C 1 189 ? 17.677  -11.025 -7.687  1.00 53.60  ? 265 LYS C CA    1 
ATOM   5617 C  C     . LYS C 1 189 ? 17.038  -10.438 -6.435  1.00 48.62  ? 265 LYS C C     1 
ATOM   5618 O  O     . LYS C 1 189 ? 17.679  -10.306 -5.399  1.00 46.69  ? 265 LYS C O     1 
ATOM   5619 C  CB    . LYS C 1 189 ? 17.704  -12.556 -7.629  1.00 54.06  ? 265 LYS C CB    1 
ATOM   5620 C  CG    . LYS C 1 189 ? 16.333  -13.210 -7.479  1.00 70.66  ? 265 LYS C CG    1 
ATOM   5621 C  CD    . LYS C 1 189 ? 15.412  -12.913 -8.664  1.00 71.64  ? 265 LYS C CD    1 
ATOM   5622 C  CE    . LYS C 1 189 ? 13.994  -13.433 -8.414  1.00 71.61  ? 265 LYS C CE    1 
ATOM   5623 N  NZ    . LYS C 1 189 ? 13.305  -12.707 -7.284  1.00 67.29  ? 265 LYS C NZ    1 
ATOM   5624 N  N     . ARG C 1 190 ? 15.774  -10.059 -6.544  1.00 45.58  ? 266 ARG C N     1 
ATOM   5625 C  CA    . ARG C 1 190 ? 15.055  -9.535  -5.400  1.00 41.87  ? 266 ARG C CA    1 
ATOM   5626 C  C     . ARG C 1 190 ? 14.514  -10.664 -4.542  1.00 46.56  ? 266 ARG C C     1 
ATOM   5627 O  O     . ARG C 1 190 ? 13.916  -11.614 -5.049  1.00 48.22  ? 266 ARG C O     1 
ATOM   5628 C  CB    . ARG C 1 190 ? 13.915  -8.635  -5.851  1.00 41.01  ? 266 ARG C CB    1 
ATOM   5629 C  CG    . ARG C 1 190 ? 14.392  -7.370  -6.496  1.00 42.60  ? 266 ARG C CG    1 
ATOM   5630 C  CD    . ARG C 1 190 ? 13.270  -6.709  -7.234  1.00 40.00  ? 266 ARG C CD    1 
ATOM   5631 N  NE    . ARG C 1 190 ? 13.698  -5.426  -7.758  1.00 38.61  ? 266 ARG C NE    1 
ATOM   5632 C  CZ    . ARG C 1 190 ? 14.236  -5.251  -8.961  1.00 40.76  ? 266 ARG C CZ    1 
ATOM   5633 N  NH1   . ARG C 1 190 ? 14.403  -6.292  -9.770  1.00 37.25  ? 266 ARG C NH1   1 
ATOM   5634 N  NH2   . ARG C 1 190 ? 14.602  -4.031  -9.351  1.00 28.44  ? 266 ARG C NH2   1 
ATOM   5635 N  N     . ASP C 1 191 ? 14.729  -10.537 -3.239  1.00 43.63  ? 267 ASP C N     1 
ATOM   5636 C  CA    . ASP C 1 191 ? 14.285  -11.518 -2.274  1.00 37.64  ? 267 ASP C CA    1 
ATOM   5637 C  C     . ASP C 1 191 ? 12.825  -11.270 -1.924  1.00 45.25  ? 267 ASP C C     1 
ATOM   5638 O  O     . ASP C 1 191 ? 12.509  -10.688 -0.884  1.00 45.82  ? 267 ASP C O     1 
ATOM   5639 C  CB    . ASP C 1 191 ? 15.164  -11.444 -1.027  1.00 41.89  ? 267 ASP C CB    1 
ATOM   5640 C  CG    . ASP C 1 191 ? 14.748  -12.446 0.044   1.00 52.72  ? 267 ASP C CG    1 
ATOM   5641 O  OD1   . ASP C 1 191 ? 13.904  -13.328 -0.236  1.00 49.09  ? 267 ASP C OD1   1 
ATOM   5642 O  OD2   . ASP C 1 191 ? 15.266  -12.350 1.174   1.00 48.59  ? 267 ASP C OD2   1 
ATOM   5643 N  N     . GLN C 1 192 ? 11.937  -11.727 -2.798  1.00 46.19  ? 268 GLN C N     1 
ATOM   5644 C  CA    . GLN C 1 192 ? 10.515  -11.427 -2.683  1.00 44.33  ? 268 GLN C CA    1 
ATOM   5645 C  C     . GLN C 1 192 ? 9.681   -12.557 -2.086  1.00 56.59  ? 268 GLN C C     1 
ATOM   5646 O  O     . GLN C 1 192 ? 8.469   -12.409 -1.931  1.00 61.93  ? 268 GLN C O     1 
ATOM   5647 C  CB    . GLN C 1 192 ? 9.967   -11.023 -4.053  1.00 40.88  ? 268 GLN C CB    1 
ATOM   5648 C  CG    . GLN C 1 192 ? 10.643  -9.772  -4.581  1.00 47.68  ? 268 GLN C CG    1 
ATOM   5649 C  CD    . GLN C 1 192 ? 10.248  -9.411  -5.992  1.00 44.61  ? 268 GLN C CD    1 
ATOM   5650 O  OE1   . GLN C 1 192 ? 10.246  -10.258 -6.885  1.00 43.58  ? 268 GLN C OE1   1 
ATOM   5651 N  NE2   . GLN C 1 192 ? 9.919   -8.136  -6.205  1.00 39.67  ? 268 GLN C NE2   1 
ATOM   5652 N  N     . LYS C 1 193 ? 10.323  -13.676 -1.754  1.00 51.59  ? 269 LYS C N     1 
ATOM   5653 C  CA    . LYS C 1 193 ? 9.625   -14.809 -1.145  1.00 63.28  ? 269 LYS C CA    1 
ATOM   5654 C  C     . LYS C 1 193 ? 8.869   -14.417 0.127   1.00 65.86  ? 269 LYS C C     1 
ATOM   5655 O  O     . LYS C 1 193 ? 9.454   -13.881 1.067   1.00 61.32  ? 269 LYS C O     1 
ATOM   5656 C  CB    . LYS C 1 193 ? 10.613  -15.932 -0.824  1.00 72.95  ? 269 LYS C CB    1 
ATOM   5657 C  CG    . LYS C 1 193 ? 10.153  -17.317 -1.247  1.00 80.84  ? 269 LYS C CG    1 
ATOM   5658 C  CD    . LYS C 1 193 ? 9.872   -17.374 -2.747  1.00 80.28  ? 269 LYS C CD    1 
ATOM   5659 C  CE    . LYS C 1 193 ? 9.734   -18.811 -3.240  1.00 82.85  ? 269 LYS C CE    1 
ATOM   5660 N  NZ    . LYS C 1 193 ? 11.046  -19.514 -3.272  1.00 86.62  ? 269 LYS C NZ    1 
ATOM   5661 N  N     . ARG C 1 194 ? 7.565   -14.676 0.144   1.00 73.15  ? 270 ARG C N     1 
ATOM   5662 C  CA    . ARG C 1 194 ? 6.749   -14.436 1.336   1.00 72.90  ? 270 ARG C CA    1 
ATOM   5663 C  C     . ARG C 1 194 ? 6.599   -15.699 2.195   1.00 73.14  ? 270 ARG C C     1 
ATOM   5664 O  O     . ARG C 1 194 ? 6.296   -16.781 1.687   1.00 74.89  ? 270 ARG C O     1 
ATOM   5665 C  CB    . ARG C 1 194 ? 5.382   -13.843 0.967   1.00 68.56  ? 270 ARG C CB    1 
ATOM   5666 C  CG    . ARG C 1 194 ? 5.441   -12.357 0.673   1.00 66.82  ? 270 ARG C CG    1 
ATOM   5667 C  CD    . ARG C 1 194 ? 6.415   -11.717 1.633   1.00 72.29  ? 270 ARG C CD    1 
ATOM   5668 N  NE    . ARG C 1 194 ? 6.565   -10.283 1.441   1.00 74.63  ? 270 ARG C NE    1 
ATOM   5669 C  CZ    . ARG C 1 194 ? 7.721   -9.677  1.182   1.00 74.27  ? 270 ARG C CZ    1 
ATOM   5670 N  NH1   . ARG C 1 194 ? 8.854   -10.377 1.063   1.00 64.11  ? 270 ARG C NH1   1 
ATOM   5671 N  NH2   . ARG C 1 194 ? 7.739   -8.359  1.037   1.00 70.07  ? 270 ARG C NH2   1 
ATOM   5672 N  N     . ILE C 1 195 ? 6.825   -15.544 3.497   1.00 72.50  ? 271 ILE C N     1 
ATOM   5673 C  CA    . ILE C 1 195 ? 6.901   -16.674 4.423   1.00 79.50  ? 271 ILE C CA    1 
ATOM   5674 C  C     . ILE C 1 195 ? 5.833   -16.618 5.515   1.00 80.82  ? 271 ILE C C     1 
ATOM   5675 O  O     . ILE C 1 195 ? 5.909   -15.775 6.412   1.00 79.07  ? 271 ILE C O     1 
ATOM   5676 C  CB    . ILE C 1 195 ? 8.287   -16.721 5.122   1.00 80.22  ? 271 ILE C CB    1 
ATOM   5677 C  CG1   . ILE C 1 195 ? 9.421   -16.650 4.088   1.00 74.52  ? 271 ILE C CG1   1 
ATOM   5678 C  CG2   . ILE C 1 195 ? 8.397   -17.951 6.018   1.00 64.84  ? 271 ILE C CG2   1 
ATOM   5679 C  CD1   . ILE C 1 195 ? 10.811  -16.863 4.662   1.00 67.93  ? 271 ILE C CD1   1 
ATOM   5680 N  N     . ALA C 1 196 ? 4.856   -17.523 5.448   1.00 81.62  ? 272 ALA C N     1 
ATOM   5681 C  CA    . ALA C 1 196 ? 3.818   -17.634 6.482   1.00 78.61  ? 272 ALA C CA    1 
ATOM   5682 C  C     . ALA C 1 196 ? 3.131   -16.310 6.772   1.00 79.40  ? 272 ALA C C     1 
ATOM   5683 O  O     . ALA C 1 196 ? 2.612   -15.655 5.869   1.00 86.57  ? 272 ALA C O     1 
ATOM   5684 C  CB    . ALA C 1 196 ? 4.398   -18.215 7.775   1.00 72.01  ? 272 ALA C CB    1 
ATOM   5685 N  N     . ALA C 1 197 ? 3.151   -15.931 8.045   1.00 72.11  ? 273 ALA C N     1 
ATOM   5686 C  CA    . ALA C 1 197 ? 2.515   -14.715 8.520   1.00 65.39  ? 273 ALA C CA    1 
ATOM   5687 C  C     . ALA C 1 197 ? 2.897   -13.464 7.717   1.00 74.46  ? 273 ALA C C     1 
ATOM   5688 O  O     . ALA C 1 197 ? 2.057   -12.593 7.491   1.00 76.48  ? 273 ALA C O     1 
ATOM   5689 C  CB    . ALA C 1 197 ? 2.832   -14.524 9.994   1.00 67.58  ? 273 ALA C CB    1 
ATOM   5690 N  N     . GLN C 1 198 ? 4.162   -13.392 7.298   1.00 76.62  ? 274 GLN C N     1 
ATOM   5691 C  CA    . GLN C 1 198 ? 4.739   -12.239 6.584   1.00 74.29  ? 274 GLN C CA    1 
ATOM   5692 C  C     . GLN C 1 198 ? 3.897   -11.716 5.420   1.00 79.80  ? 274 GLN C C     1 
ATOM   5693 O  O     . GLN C 1 198 ? 3.935   -10.523 5.116   1.00 81.26  ? 274 GLN C O     1 
ATOM   5694 C  CB    . GLN C 1 198 ? 6.157   -12.569 6.080   1.00 67.11  ? 274 GLN C CB    1 
ATOM   5695 C  CG    . GLN C 1 198 ? 6.911   -11.377 5.475   1.00 61.66  ? 274 GLN C CG    1 
ATOM   5696 C  CD    . GLN C 1 198 ? 8.202   -11.776 4.762   1.00 66.76  ? 274 GLN C CD    1 
ATOM   5697 O  OE1   . GLN C 1 198 ? 8.402   -12.947 4.418   1.00 67.52  ? 274 GLN C OE1   1 
ATOM   5698 N  NE2   . GLN C 1 198 ? 9.083   -10.798 4.534   1.00 59.30  ? 274 GLN C NE2   1 
ATOM   5699 N  N     . LYS C 1 199 ? 3.142   -12.605 4.776   1.00 80.64  ? 275 LYS C N     1 
ATOM   5700 C  CA    . LYS C 1 199 ? 2.277   -12.215 3.664   1.00 82.71  ? 275 LYS C CA    1 
ATOM   5701 C  C     . LYS C 1 199 ? 1.197   -11.219 4.096   1.00 84.74  ? 275 LYS C C     1 
ATOM   5702 O  O     . LYS C 1 199 ? 0.716   -10.429 3.286   1.00 90.02  ? 275 LYS C O     1 
ATOM   5703 C  CB    . LYS C 1 199 ? 1.658   -13.442 2.978   1.00 86.71  ? 275 LYS C CB    1 
ATOM   5704 C  CG    . LYS C 1 199 ? 0.870   -13.124 1.705   1.00 80.55  ? 275 LYS C CG    1 
ATOM   5705 C  CD    . LYS C 1 199 ? 0.481   -14.396 0.953   1.00 89.81  ? 275 LYS C CD    1 
ATOM   5706 C  CE    . LYS C 1 199 ? -0.361  -14.082 -0.280  1.00 83.90  ? 275 LYS C CE    1 
ATOM   5707 N  NZ    . LYS C 1 199 ? -0.653  -15.292 -1.104  1.00 72.46  ? 275 LYS C NZ    1 
ATOM   5708 N  N     . GLN C 1 200 ? 0.831   -11.228 5.375   1.00 82.49  ? 276 GLN C N     1 
ATOM   5709 C  CA    . GLN C 1 200 ? -0.150  -10.257 5.857   1.00 81.62  ? 276 GLN C CA    1 
ATOM   5710 C  C     . GLN C 1 200 ? 0.400   -9.260  6.884   1.00 83.91  ? 276 GLN C C     1 
ATOM   5711 O  O     . GLN C 1 200 ? -0.048  -8.112  6.925   1.00 81.94  ? 276 GLN C O     1 
ATOM   5712 C  CB    . GLN C 1 200 ? -1.414  -10.981 6.313   1.00 63.77  ? 276 GLN C CB    1 
ATOM   5713 C  CG    . GLN C 1 200 ? -1.616  -12.231 5.423   1.00 73.93  ? 276 GLN C CG    1 
ATOM   5714 C  CD    . GLN C 1 200 ? -1.039  -13.424 6.051   1.00 71.46  ? 276 GLN C CD    1 
ATOM   5715 O  OE1   . GLN C 1 200 ? -0.762  -14.466 5.402   1.00 72.46  ? 276 GLN C OE1   1 
ATOM   5716 N  NE2   . GLN C 1 200 ? -0.894  -13.329 7.371   1.00 72.48  ? 276 GLN C NE2   1 
ATOM   5717 N  N     . GLU C 1 201 ? 1.393   -9.682  7.673   1.00 85.24  ? 277 GLU C N     1 
ATOM   5718 C  CA    . GLU C 1 201 ? 2.181   -8.751  8.492   1.00 82.77  ? 277 GLU C CA    1 
ATOM   5719 C  C     . GLU C 1 201 ? 3.063   -7.891  7.593   1.00 86.20  ? 277 GLU C C     1 
ATOM   5720 O  O     . GLU C 1 201 ? 4.268   -7.788  7.815   1.00 87.71  ? 277 GLU C O     1 
ATOM   5721 C  CB    . GLU C 1 201 ? 3.092   -9.495  9.477   1.00 83.36  ? 277 GLU C CB    1 
ATOM   5722 C  CG    . GLU C 1 201 ? 2.376   -10.403 10.445  1.00 79.95  ? 277 GLU C CG    1 
ATOM   5723 C  CD    . GLU C 1 201 ? 1.170   -9.735  11.045  1.00 91.85  ? 277 GLU C CD    1 
ATOM   5724 O  OE1   . GLU C 1 201 ? 1.349   -8.785  11.839  1.00 90.13  ? 277 GLU C OE1   1 
ATOM   5725 O  OE2   . GLU C 1 201 ? 0.043   -10.153 10.706  1.00 95.21  ? 277 GLU C OE2   1 
ATOM   5726 N  N     . GLN C 1 202 ? 2.457   -7.265  6.591   1.00 90.86  ? 278 GLN C N     1 
ATOM   5727 C  CA    . GLN C 1 202 ? 3.190   -6.604  5.522   1.00 81.40  ? 278 GLN C CA    1 
ATOM   5728 C  C     . GLN C 1 202 ? 2.458   -5.314  5.174   1.00 82.42  ? 278 GLN C C     1 
ATOM   5729 O  O     . GLN C 1 202 ? 3.080   -4.285  4.881   1.00 75.82  ? 278 GLN C O     1 
ATOM   5730 C  CB    . GLN C 1 202 ? 3.228   -7.523  4.298   1.00 80.07  ? 278 GLN C CB    1 
ATOM   5731 C  CG    . GLN C 1 202 ? 4.569   -7.619  3.600   1.00 74.92  ? 278 GLN C CG    1 
ATOM   5732 C  CD    . GLN C 1 202 ? 4.424   -8.012  2.130   1.00 85.30  ? 278 GLN C CD    1 
ATOM   5733 O  OE1   . GLN C 1 202 ? 5.363   -7.869  1.342   1.00 76.04  ? 278 GLN C OE1   1 
ATOM   5734 N  NE2   . GLN C 1 202 ? 3.242   -8.505  1.756   1.00 82.64  ? 278 GLN C NE2   1 
ATOM   5735 N  N     . PHE C 1 203 ? 1.126   -5.382  5.224   1.00 86.28  ? 279 PHE C N     1 
ATOM   5736 C  CA    . PHE C 1 203 ? 0.264   -4.258  4.851   1.00 89.82  ? 279 PHE C CA    1 
ATOM   5737 C  C     . PHE C 1 203 ? -0.286  -3.507  6.073   1.00 86.53  ? 279 PHE C C     1 
ATOM   5738 O  O     . PHE C 1 203 ? -1.309  -2.813  5.983   1.00 78.04  ? 279 PHE C O     1 
ATOM   5739 C  CB    . PHE C 1 203 ? -0.893  -4.735  3.960   1.00 84.31  ? 279 PHE C CB    1 
ATOM   5740 C  CG    . PHE C 1 203 ? -0.463  -5.629  2.827   1.00 86.75  ? 279 PHE C CG    1 
ATOM   5741 C  CD1   . PHE C 1 203 ? 0.079   -5.091  1.668   1.00 83.74  ? 279 PHE C CD1   1 
ATOM   5742 C  CD2   . PHE C 1 203 ? -0.609  -7.009  2.919   1.00 82.05  ? 279 PHE C CD2   1 
ATOM   5743 C  CE1   . PHE C 1 203 ? 0.476   -5.912  0.623   1.00 83.39  ? 279 PHE C CE1   1 
ATOM   5744 C  CE2   . PHE C 1 203 ? -0.220  -7.833  1.876   1.00 84.22  ? 279 PHE C CE2   1 
ATOM   5745 C  CZ    . PHE C 1 203 ? 0.324   -7.286  0.727   1.00 82.57  ? 279 PHE C CZ    1 
ATOM   5746 N  N     . LYS C 1 204 ? 0.395   -3.648  7.209   1.00 82.11  ? 280 LYS C N     1 
ATOM   5747 C  CA    . LYS C 1 204 ? -0.009  -2.949  8.428   1.00 83.10  ? 280 LYS C CA    1 
ATOM   5748 C  C     . LYS C 1 204 ? 1.052   -1.965  8.931   1.00 79.44  ? 280 LYS C C     1 
ATOM   5749 O  O     . LYS C 1 204 ? 2.250   -2.247  8.892   1.00 71.98  ? 280 LYS C O     1 
ATOM   5750 C  CB    . LYS C 1 204 ? -0.401  -3.942  9.530   1.00 76.21  ? 280 LYS C CB    1 
ATOM   5751 C  CG    . LYS C 1 204 ? 0.657   -4.968  9.884   1.00 73.43  ? 280 LYS C CG    1 
ATOM   5752 C  CD    . LYS C 1 204 ? 0.050   -6.039  10.766  1.00 82.83  ? 280 LYS C CD    1 
ATOM   5753 C  CE    . LYS C 1 204 ? -1.244  -6.557  10.156  1.00 79.58  ? 280 LYS C CE    1 
ATOM   5754 N  NZ    . LYS C 1 204 ? -1.929  -7.530  11.044  1.00 81.17  ? 280 LYS C NZ    1 
ATOM   5755 N  N     . VAL C 1 205 ? 0.599   -0.802  9.391   1.00 81.61  ? 281 VAL C N     1 
ATOM   5756 C  CA    . VAL C 1 205 ? 1.495   0.178   9.990   1.00 77.94  ? 281 VAL C CA    1 
ATOM   5757 C  C     . VAL C 1 205 ? 1.944   -0.334  11.362  1.00 75.42  ? 281 VAL C C     1 
ATOM   5758 O  O     . VAL C 1 205 ? 1.138   -0.843  12.147  1.00 74.57  ? 281 VAL C O     1 
ATOM   5759 C  CB    . VAL C 1 205 ? 0.814   1.572   10.142  1.00 78.50  ? 281 VAL C CB    1 
ATOM   5760 C  CG1   . VAL C 1 205 ? 1.862   2.693   10.273  1.00 72.16  ? 281 VAL C CG1   1 
ATOM   5761 C  CG2   . VAL C 1 205 ? -0.122  1.850   8.973   1.00 71.55  ? 281 VAL C CG2   1 
ATOM   5762 N  N     . ASP C 1 206 ? 3.239   -0.234  11.636  1.00 75.39  ? 282 ASP C N     1 
ATOM   5763 C  CA    . ASP C 1 206 ? 3.722   -0.460  12.989  1.00 71.56  ? 282 ASP C CA    1 
ATOM   5764 C  C     . ASP C 1 206 ? 3.782   0.882   13.688  1.00 69.50  ? 282 ASP C C     1 
ATOM   5765 O  O     . ASP C 1 206 ? 4.582   1.748   13.333  1.00 64.36  ? 282 ASP C O     1 
ATOM   5766 C  CB    . ASP C 1 206 ? 5.105   -1.114  13.007  1.00 65.88  ? 282 ASP C CB    1 
ATOM   5767 C  CG    . ASP C 1 206 ? 5.502   -1.588  14.398  1.00 74.47  ? 282 ASP C CG    1 
ATOM   5768 O  OD1   . ASP C 1 206 ? 4.679   -2.272  15.068  1.00 74.34  ? 282 ASP C OD1   1 
ATOM   5769 O  OD2   . ASP C 1 206 ? 6.634   -1.266  14.823  1.00 69.00  ? 282 ASP C OD2   1 
ATOM   5770 N  N     . ARG C 1 207 ? 2.923   1.067   14.675  1.00 72.14  ? 283 ARG C N     1 
ATOM   5771 C  CA    . ARG C 1 207 ? 2.964   2.300   15.434  1.00 70.37  ? 283 ARG C CA    1 
ATOM   5772 C  C     . ARG C 1 207 ? 3.542   2.014   16.823  1.00 72.69  ? 283 ARG C C     1 
ATOM   5773 O  O     . ARG C 1 207 ? 3.356   2.791   17.757  1.00 74.42  ? 283 ARG C O     1 
ATOM   5774 C  CB    . ARG C 1 207 ? 1.570   2.933   15.486  1.00 65.89  ? 283 ARG C CB    1 
ATOM   5775 C  CG    . ARG C 1 207 ? 0.861   2.946   14.133  1.00 74.00  ? 283 ARG C CG    1 
ATOM   5776 C  CD    . ARG C 1 207 ? -0.351  3.868   14.100  1.00 72.83  ? 283 ARG C CD    1 
ATOM   5777 N  NE    . ARG C 1 207 ? -0.013  5.242   14.483  1.00 86.55  ? 283 ARG C NE    1 
ATOM   5778 C  CZ    . ARG C 1 207 ? 0.530   6.153   13.673  1.00 84.42  ? 283 ARG C CZ    1 
ATOM   5779 N  NH1   . ARG C 1 207 ? 0.817   5.855   12.408  1.00 80.73  ? 283 ARG C NH1   1 
ATOM   5780 N  NH2   . ARG C 1 207 ? 0.797   7.369   14.135  1.00 78.28  ? 283 ARG C NH2   1 
ATOM   5781 N  N     . GLU C 1 208 ? 4.257   0.893   16.944  1.00 67.76  ? 284 GLU C N     1 
ATOM   5782 C  CA    . GLU C 1 208 ? 4.825   0.477   18.230  1.00 71.64  ? 284 GLU C CA    1 
ATOM   5783 C  C     . GLU C 1 208 ? 6.344   0.559   18.262  1.00 73.02  ? 284 GLU C C     1 
ATOM   5784 O  O     . GLU C 1 208 ? 6.949   0.595   19.336  1.00 69.46  ? 284 GLU C O     1 
ATOM   5785 C  CB    . GLU C 1 208 ? 4.412   -0.956  18.573  1.00 65.91  ? 284 GLU C CB    1 
ATOM   5786 C  CG    . GLU C 1 208 ? 2.919   -1.210  18.530  1.00 77.39  ? 284 GLU C CG    1 
ATOM   5787 C  CD    . GLU C 1 208 ? 2.521   -2.435  19.327  1.00 86.46  ? 284 GLU C CD    1 
ATOM   5788 O  OE1   . GLU C 1 208 ? 2.880   -3.554  18.896  1.00 89.05  ? 284 GLU C OE1   1 
ATOM   5789 O  OE2   . GLU C 1 208 ? 1.862   -2.276  20.384  1.00 83.89  ? 284 GLU C OE2   1 
ATOM   5790 N  N     . GLY C 1 209 ? 6.959   0.559   17.083  1.00 60.49  ? 285 GLY C N     1 
ATOM   5791 C  CA    . GLY C 1 209 ? 8.403   0.490   16.997  1.00 51.67  ? 285 GLY C CA    1 
ATOM   5792 C  C     . GLY C 1 209 ? 8.965   1.330   15.878  1.00 50.26  ? 285 GLY C C     1 
ATOM   5793 O  O     . GLY C 1 209 ? 8.225   1.902   15.075  1.00 47.06  ? 285 GLY C O     1 
ATOM   5794 N  N     . GLY C 1 210 ? 10.289  1.397   15.826  1.00 54.17  ? 286 GLY C N     1 
ATOM   5795 C  CA    . GLY C 1 210 ? 10.972  2.146   14.789  1.00 46.19  ? 286 GLY C CA    1 
ATOM   5796 C  C     . GLY C 1 210 ? 12.318  2.642   15.250  1.00 42.56  ? 286 GLY C C     1 
ATOM   5797 O  O     . GLY C 1 210 ? 13.148  1.873   15.734  1.00 44.68  ? 286 GLY C O     1 
ATOM   5798 N  N     . LEU C 1 211 ? 12.518  3.945   15.112  1.00 42.89  ? 287 LEU C N     1 
ATOM   5799 C  CA    . LEU C 1 211 ? 13.790  4.578   15.436  1.00 47.06  ? 287 LEU C CA    1 
ATOM   5800 C  C     . LEU C 1 211 ? 14.240  4.355   16.884  1.00 52.56  ? 287 LEU C C     1 
ATOM   5801 O  O     . LEU C 1 211 ? 15.433  4.213   17.148  1.00 50.97  ? 287 LEU C O     1 
ATOM   5802 C  CB    . LEU C 1 211 ? 13.705  6.068   15.138  1.00 45.45  ? 287 LEU C CB    1 
ATOM   5803 C  CG    . LEU C 1 211 ? 14.985  6.853   15.356  1.00 49.19  ? 287 LEU C CG    1 
ATOM   5804 C  CD1   . LEU C 1 211 ? 16.114  6.208   14.547  1.00 46.60  ? 287 LEU C CD1   1 
ATOM   5805 C  CD2   . LEU C 1 211 ? 14.751  8.304   14.959  1.00 42.00  ? 287 LEU C CD2   1 
ATOM   5806 N  N     . ASN C 1 212 ? 13.288  4.322   17.816  1.00 54.50  ? 288 ASN C N     1 
ATOM   5807 C  CA    . ASN C 1 212 ? 13.606  4.087   19.232  1.00 55.51  ? 288 ASN C CA    1 
ATOM   5808 C  C     . ASN C 1 212 ? 13.585  2.617   19.658  1.00 53.93  ? 288 ASN C C     1 
ATOM   5809 O  O     . ASN C 1 212 ? 13.750  2.295   20.830  1.00 59.96  ? 288 ASN C O     1 
ATOM   5810 C  CB    . ASN C 1 212 ? 12.700  4.922   20.151  1.00 51.60  ? 288 ASN C CB    1 
ATOM   5811 C  CG    . ASN C 1 212 ? 11.209  4.690   19.900  1.00 54.82  ? 288 ASN C CG    1 
ATOM   5812 O  OD1   . ASN C 1 212 ? 10.767  3.579   19.602  1.00 52.64  ? 288 ASN C OD1   1 
ATOM   5813 N  ND2   . ASN C 1 212 ? 10.429  5.754   20.027  1.00 57.68  ? 288 ASN C ND2   1 
ATOM   5814 N  N     . THR C 1 213 ? 13.415  1.729   18.690  1.00 60.76  ? 289 THR C N     1 
ATOM   5815 C  CA    . THR C 1 213 ? 13.217  0.311   18.953  1.00 47.68  ? 289 THR C CA    1 
ATOM   5816 C  C     . THR C 1 213 ? 14.377  -0.520  18.410  1.00 57.94  ? 289 THR C C     1 
ATOM   5817 O  O     . THR C 1 213 ? 14.695  -1.586  18.945  1.00 59.98  ? 289 THR C O     1 
ATOM   5818 C  CB    . THR C 1 213 ? 11.887  -0.125  18.305  1.00 47.73  ? 289 THR C CB    1 
ATOM   5819 O  OG1   . THR C 1 213 ? 10.834  0.055   19.256  1.00 68.02  ? 289 THR C OG1   1 
ATOM   5820 C  CG2   . THR C 1 213 ? 11.907  -1.573  17.825  1.00 54.01  ? 289 THR C CG2   1 
ATOM   5821 N  N     . VAL C 1 214 ? 15.028  -0.007  17.364  1.00 58.42  ? 290 VAL C N     1 
ATOM   5822 C  CA    . VAL C 1 214 ? 15.967  -0.808  16.573  1.00 53.49  ? 290 VAL C CA    1 
ATOM   5823 C  C     . VAL C 1 214 ? 17.084  -1.428  17.408  1.00 48.52  ? 290 VAL C C     1 
ATOM   5824 O  O     . VAL C 1 214 ? 17.768  -0.754  18.177  1.00 50.46  ? 290 VAL C O     1 
ATOM   5825 C  CB    . VAL C 1 214 ? 16.538  -0.026  15.349  1.00 52.36  ? 290 VAL C CB    1 
ATOM   5826 C  CG1   . VAL C 1 214 ? 17.365  1.174   15.795  1.00 47.02  ? 290 VAL C CG1   1 
ATOM   5827 C  CG2   . VAL C 1 214 ? 17.347  -0.954  14.451  1.00 40.41  ? 290 VAL C CG2   1 
ATOM   5828 N  N     . LYS C 1 215 ? 17.232  -2.738  17.274  1.00 50.24  ? 291 LYS C N     1 
ATOM   5829 C  CA    . LYS C 1 215 ? 18.251  -3.454  18.008  1.00 52.21  ? 291 LYS C CA    1 
ATOM   5830 C  C     . LYS C 1 215 ? 19.387  -3.759  17.045  1.00 52.10  ? 291 LYS C C     1 
ATOM   5831 O  O     . LYS C 1 215 ? 19.207  -4.481  16.063  1.00 47.59  ? 291 LYS C O     1 
ATOM   5832 C  CB    . LYS C 1 215 ? 17.685  -4.757  18.590  1.00 61.47  ? 291 LYS C CB    1 
ATOM   5833 C  CG    . LYS C 1 215 ? 16.405  -4.606  19.419  1.00 60.81  ? 291 LYS C CG    1 
ATOM   5834 C  CD    . LYS C 1 215 ? 16.599  -3.661  20.609  1.00 64.01  ? 291 LYS C CD    1 
ATOM   5835 C  CE    . LYS C 1 215 ? 15.397  -3.706  21.546  1.00 61.39  ? 291 LYS C CE    1 
ATOM   5836 N  NZ    . LYS C 1 215 ? 14.103  -3.618  20.800  1.00 60.23  ? 291 LYS C NZ    1 
ATOM   5837 N  N     . TYR C 1 216 ? 20.560  -3.212  17.321  1.00 43.23  ? 292 TYR C N     1 
ATOM   5838 C  CA    . TYR C 1 216 ? 21.682  -3.445  16.442  1.00 50.96  ? 292 TYR C CA    1 
ATOM   5839 C  C     . TYR C 1 216 ? 22.985  -3.339  17.192  1.00 48.93  ? 292 TYR C C     1 
ATOM   5840 O  O     . TYR C 1 216 ? 23.018  -3.079  18.382  1.00 44.84  ? 292 TYR C O     1 
ATOM   5841 C  CB    . TYR C 1 216 ? 21.672  -2.440  15.289  1.00 48.16  ? 292 TYR C CB    1 
ATOM   5842 C  CG    . TYR C 1 216 ? 21.976  -1.019  15.707  1.00 48.35  ? 292 TYR C CG    1 
ATOM   5843 C  CD1   . TYR C 1 216 ? 20.998  -0.225  16.301  1.00 44.78  ? 292 TYR C CD1   1 
ATOM   5844 C  CD2   . TYR C 1 216 ? 23.233  -0.466  15.500  1.00 44.24  ? 292 TYR C CD2   1 
ATOM   5845 C  CE1   . TYR C 1 216 ? 21.266  1.071   16.682  1.00 40.06  ? 292 TYR C CE1   1 
ATOM   5846 C  CE2   . TYR C 1 216 ? 23.511  0.836   15.878  1.00 43.97  ? 292 TYR C CE2   1 
ATOM   5847 C  CZ    . TYR C 1 216 ? 22.520  1.597   16.474  1.00 47.77  ? 292 TYR C CZ    1 
ATOM   5848 O  OH    . TYR C 1 216 ? 22.773  2.895   16.851  1.00 47.13  ? 292 TYR C OH    1 
ATOM   5849 N  N     . HIS C 1 217 ? 24.068  -3.532  16.465  1.00 47.02  ? 293 HIS C N     1 
ATOM   5850 C  CA    . HIS C 1 217 ? 25.387  -3.333  17.013  1.00 49.78  ? 293 HIS C CA    1 
ATOM   5851 C  C     . HIS C 1 217 ? 26.315  -2.981  15.831  1.00 52.73  ? 293 HIS C C     1 
ATOM   5852 O  O     . HIS C 1 217 ? 26.138  -3.494  14.723  1.00 48.55  ? 293 HIS C O     1 
ATOM   5853 C  CB    . HIS C 1 217 ? 25.762  -4.589  17.808  1.00 45.57  ? 293 HIS C CB    1 
ATOM   5854 C  CG    . HIS C 1 217 ? 27.198  -4.978  17.717  1.00 51.42  ? 293 HIS C CG    1 
ATOM   5855 N  ND1   . HIS C 1 217 ? 27.599  -6.199  17.217  1.00 58.95  ? 293 HIS C ND1   1 
ATOM   5856 C  CD2   . HIS C 1 217 ? 28.325  -4.327  18.083  1.00 59.47  ? 293 HIS C CD2   1 
ATOM   5857 C  CE1   . HIS C 1 217 ? 28.918  -6.274  17.262  1.00 66.22  ? 293 HIS C CE1   1 
ATOM   5858 N  NE2   . HIS C 1 217 ? 29.384  -5.151  17.780  1.00 62.97  ? 293 HIS C NE2   1 
ATOM   5859 N  N     . VAL C 1 218 ? 27.246  -2.050  16.029  1.00 55.80  ? 294 VAL C N     1 
ATOM   5860 C  CA    . VAL C 1 218 ? 28.185  -1.707  14.959  1.00 44.26  ? 294 VAL C CA    1 
ATOM   5861 C  C     . VAL C 1 218 ? 29.491  -2.469  15.131  1.00 52.60  ? 294 VAL C C     1 
ATOM   5862 O  O     . VAL C 1 218 ? 30.346  -2.083  15.926  1.00 57.02  ? 294 VAL C O     1 
ATOM   5863 C  CB    . VAL C 1 218 ? 28.462  -0.192  14.861  1.00 42.46  ? 294 VAL C CB    1 
ATOM   5864 C  CG1   . VAL C 1 218 ? 29.507  0.094   13.791  1.00 41.68  ? 294 VAL C CG1   1 
ATOM   5865 C  CG2   . VAL C 1 218 ? 27.184  0.555   14.537  1.00 42.87  ? 294 VAL C CG2   1 
ATOM   5866 N  N     . ALA C 1 219 ? 29.629  -3.557  14.375  1.00 50.80  ? 295 ALA C N     1 
ATOM   5867 C  CA    . ALA C 1 219 ? 30.828  -4.398  14.395  1.00 48.55  ? 295 ALA C CA    1 
ATOM   5868 C  C     . ALA C 1 219 ? 32.109  -3.655  14.034  1.00 45.49  ? 295 ALA C C     1 
ATOM   5869 O  O     . ALA C 1 219 ? 33.175  -3.956  14.570  1.00 48.79  ? 295 ALA C O     1 
ATOM   5870 C  CB    . ALA C 1 219 ? 30.645  -5.599  13.485  1.00 35.81  ? 295 ALA C CB    1 
ATOM   5871 N  N     . SER C 1 220 ? 32.009  -2.693  13.122  1.00 46.13  ? 296 SER C N     1 
ATOM   5872 C  CA    . SER C 1 220 ? 33.186  -1.941  12.680  1.00 43.90  ? 296 SER C CA    1 
ATOM   5873 C  C     . SER C 1 220 ? 32.815  -0.705  11.869  1.00 40.90  ? 296 SER C C     1 
ATOM   5874 O  O     . SER C 1 220 ? 31.709  -0.601  11.343  1.00 41.34  ? 296 SER C O     1 
ATOM   5875 C  CB    . SER C 1 220 ? 34.113  -2.828  11.845  1.00 44.09  ? 296 SER C CB    1 
ATOM   5876 O  OG    . SER C 1 220 ? 33.468  -3.230  10.653  1.00 50.88  ? 296 SER C OG    1 
ATOM   5877 N  N     . ARG C 1 221 ? 33.754  0.228   11.777  1.00 34.45  ? 297 ARG C N     1 
ATOM   5878 C  CA    . ARG C 1 221 ? 33.616  1.407   10.922  1.00 40.71  ? 297 ARG C CA    1 
ATOM   5879 C  C     . ARG C 1 221 ? 34.875  1.454   10.122  1.00 40.76  ? 297 ARG C C     1 
ATOM   5880 O  O     . ARG C 1 221 ? 35.958  1.291   10.682  1.00 48.46  ? 297 ARG C O     1 
ATOM   5881 C  CB    . ARG C 1 221 ? 33.537  2.696   11.747  1.00 33.87  ? 297 ARG C CB    1 
ATOM   5882 C  CG    . ARG C 1 221 ? 32.267  2.800   12.528  1.00 43.18  ? 297 ARG C CG    1 
ATOM   5883 C  CD    . ARG C 1 221 ? 32.270  3.869   13.599  1.00 51.89  ? 297 ARG C CD    1 
ATOM   5884 N  NE    . ARG C 1 221 ? 30.983  3.806   14.276  1.00 49.43  ? 297 ARG C NE    1 
ATOM   5885 C  CZ    . ARG C 1 221 ? 29.982  4.657   14.069  1.00 58.28  ? 297 ARG C CZ    1 
ATOM   5886 N  NH1   . ARG C 1 221 ? 30.131  5.706   13.245  1.00 42.96  ? 297 ARG C NH1   1 
ATOM   5887 N  NH2   . ARG C 1 221 ? 28.837  4.468   14.720  1.00 55.56  ? 297 ARG C NH2   1 
ATOM   5888 N  N     . THR C 1 222 ? 34.764  1.675   8.821   1.00 40.23  ? 298 THR C N     1 
ATOM   5889 C  CA    . THR C 1 222 ? 35.972  1.779   8.014   1.00 38.59  ? 298 THR C CA    1 
ATOM   5890 C  C     . THR C 1 222 ? 35.890  2.902   6.997   1.00 44.76  ? 298 THR C C     1 
ATOM   5891 O  O     . THR C 1 222 ? 34.874  3.065   6.313   1.00 45.32  ? 298 THR C O     1 
ATOM   5892 C  CB    . THR C 1 222 ? 36.350  0.416   7.369   1.00 42.47  ? 298 THR C CB    1 
ATOM   5893 O  OG1   . THR C 1 222 ? 36.886  0.620   6.058   1.00 48.21  ? 298 THR C OG1   1 
ATOM   5894 C  CG2   . THR C 1 222 ? 35.153  -0.491  7.289   1.00 43.58  ? 298 THR C CG2   1 
ATOM   5895 N  N     . ALA C 1 223 ? 36.956  3.698   6.920   1.00 46.74  ? 299 ALA C N     1 
ATOM   5896 C  CA    . ALA C 1 223 ? 37.013  4.773   5.941   1.00 45.91  ? 299 ALA C CA    1 
ATOM   5897 C  C     . ALA C 1 223 ? 37.333  4.180   4.579   1.00 48.73  ? 299 ALA C C     1 
ATOM   5898 O  O     . ALA C 1 223 ? 38.313  3.454   4.413   1.00 46.07  ? 299 ALA C O     1 
ATOM   5899 C  CB    . ALA C 1 223 ? 38.043  5.832   6.338   1.00 43.41  ? 299 ALA C CB    1 
ATOM   5900 N  N     . LEU C 1 224 ? 36.488  4.479   3.605   1.00 47.92  ? 300 LEU C N     1 
ATOM   5901 C  CA    . LEU C 1 224 ? 36.678  3.959   2.267   1.00 44.75  ? 300 LEU C CA    1 
ATOM   5902 C  C     . LEU C 1 224 ? 36.827  5.127   1.316   1.00 43.73  ? 300 LEU C C     1 
ATOM   5903 O  O     . LEU C 1 224 ? 36.132  6.129   1.448   1.00 47.34  ? 300 LEU C O     1 
ATOM   5904 C  CB    . LEU C 1 224 ? 35.474  3.115   1.855   1.00 45.26  ? 300 LEU C CB    1 
ATOM   5905 C  CG    . LEU C 1 224 ? 35.716  2.071   0.772   1.00 43.92  ? 300 LEU C CG    1 
ATOM   5906 C  CD1   . LEU C 1 224 ? 36.809  1.141   1.229   1.00 47.15  ? 300 LEU C CD1   1 
ATOM   5907 C  CD2   . LEU C 1 224 ? 34.445  1.294   0.506   1.00 37.38  ? 300 LEU C CD2   1 
ATOM   5908 N  N     . SER C 1 225 ? 37.748  5.007   0.370   1.00 44.02  ? 301 SER C N     1 
ATOM   5909 C  CA    . SER C 1 225 ? 37.871  5.990   -0.687  1.00 43.57  ? 301 SER C CA    1 
ATOM   5910 C  C     . SER C 1 225 ? 37.737  5.295   -2.048  1.00 48.36  ? 301 SER C C     1 
ATOM   5911 O  O     . SER C 1 225 ? 38.464  4.345   -2.351  1.00 50.46  ? 301 SER C O     1 
ATOM   5912 C  CB    . SER C 1 225 ? 39.200  6.719   -0.560  1.00 42.44  ? 301 SER C CB    1 
ATOM   5913 O  OG    . SER C 1 225 ? 39.254  7.806   -1.453  1.00 52.55  ? 301 SER C OG    1 
ATOM   5914 N  N     . VAL C 1 226 ? 36.787  5.754   -2.857  1.00 47.63  ? 302 VAL C N     1 
ATOM   5915 C  CA    . VAL C 1 226 ? 36.544  5.161   -4.168  1.00 50.46  ? 302 VAL C CA    1 
ATOM   5916 C  C     . VAL C 1 226 ? 36.854  6.176   -5.250  1.00 56.67  ? 302 VAL C C     1 
ATOM   5917 O  O     . VAL C 1 226 ? 36.065  7.094   -5.493  1.00 54.80  ? 302 VAL C O     1 
ATOM   5918 C  CB    . VAL C 1 226 ? 35.080  4.713   -4.325  1.00 51.76  ? 302 VAL C CB    1 
ATOM   5919 C  CG1   . VAL C 1 226 ? 34.823  4.187   -5.730  1.00 47.79  ? 302 VAL C CG1   1 
ATOM   5920 C  CG2   . VAL C 1 226 ? 34.737  3.674   -3.300  1.00 46.43  ? 302 VAL C CG2   1 
ATOM   5921 N  N     . GLY C 1 227 ? 38.011  6.019   -5.889  1.00 53.22  ? 303 GLY C N     1 
ATOM   5922 C  CA    . GLY C 1 227 ? 38.447  6.963   -6.898  1.00 49.15  ? 303 GLY C CA    1 
ATOM   5923 C  C     . GLY C 1 227 ? 38.580  8.365   -6.337  1.00 55.07  ? 303 GLY C C     1 
ATOM   5924 O  O     . GLY C 1 227 ? 38.249  9.348   -7.005  1.00 55.73  ? 303 GLY C O     1 
ATOM   5925 N  N     . GLY C 1 228 ? 39.063  8.457   -5.102  1.00 45.35  ? 304 GLY C N     1 
ATOM   5926 C  CA    . GLY C 1 228 ? 39.285  9.741   -4.461  1.00 44.75  ? 304 GLY C CA    1 
ATOM   5927 C  C     . GLY C 1 228 ? 38.089  10.233  -3.653  1.00 48.42  ? 304 GLY C C     1 
ATOM   5928 O  O     . GLY C 1 228 ? 38.234  11.072  -2.767  1.00 47.04  ? 304 GLY C O     1 
ATOM   5929 N  N     . ALA C 1 229 ? 36.908  9.714   -3.974  1.00 44.90  ? 305 ALA C N     1 
ATOM   5930 C  CA    . ALA C 1 229 ? 35.678  10.063  -3.274  1.00 42.55  ? 305 ALA C CA    1 
ATOM   5931 C  C     . ALA C 1 229 ? 35.538  9.267   -1.979  1.00 43.39  ? 305 ALA C C     1 
ATOM   5932 O  O     . ALA C 1 229 ? 35.489  8.040   -2.007  1.00 42.39  ? 305 ALA C O     1 
ATOM   5933 C  CB    . ALA C 1 229 ? 34.456  9.835   -4.178  1.00 36.21  ? 305 ALA C CB    1 
ATOM   5934 N  N     . PRO C 1 230 ? 35.471  9.975   -0.837  1.00 43.29  ? 306 PRO C N     1 
ATOM   5935 C  CA    . PRO C 1 230 ? 35.410  9.358   0.491   1.00 32.57  ? 306 PRO C CA    1 
ATOM   5936 C  C     . PRO C 1 230 ? 34.013  8.888   0.850   1.00 41.94  ? 306 PRO C C     1 
ATOM   5937 O  O     . PRO C 1 230 ? 33.025  9.458   0.386   1.00 45.98  ? 306 PRO C O     1 
ATOM   5938 C  CB    . PRO C 1 230 ? 35.778  10.523  1.418   1.00 44.00  ? 306 PRO C CB    1 
ATOM   5939 C  CG    . PRO C 1 230 ? 35.223  11.709  0.732   1.00 39.77  ? 306 PRO C CG    1 
ATOM   5940 C  CD    . PRO C 1 230 ? 35.471  11.449  -0.752  1.00 40.58  ? 306 PRO C CD    1 
ATOM   5941 N  N     . CYS C 1 231 ? 33.939  7.847   1.673   1.00 35.27  ? 307 CYS C N     1 
ATOM   5942 C  CA    . CYS C 1 231 ? 32.695  7.483   2.328   1.00 42.95  ? 307 CYS C CA    1 
ATOM   5943 C  C     . CYS C 1 231 ? 33.018  6.752   3.629   1.00 43.81  ? 307 CYS C C     1 
ATOM   5944 O  O     . CYS C 1 231 ? 34.190  6.524   3.944   1.00 43.54  ? 307 CYS C O     1 
ATOM   5945 C  CB    . CYS C 1 231 ? 31.801  6.643   1.409   1.00 45.72  ? 307 CYS C CB    1 
ATOM   5946 S  SG    . CYS C 1 231 ? 32.398  4.973   1.028   1.00 41.64  ? 307 CYS C SG    1 
ATOM   5947 N  N     . THR C 1 232 ? 31.983  6.393   4.381   1.00 43.03  ? 308 THR C N     1 
ATOM   5948 C  CA    . THR C 1 232 ? 32.150  5.658   5.626   1.00 34.94  ? 308 THR C CA    1 
ATOM   5949 C  C     . THR C 1 232 ? 31.343  4.356   5.590   1.00 38.61  ? 308 THR C C     1 
ATOM   5950 O  O     . THR C 1 232 ? 30.120  4.392   5.432   1.00 37.55  ? 308 THR C O     1 
ATOM   5951 C  CB    . THR C 1 232 ? 31.674  6.517   6.829   1.00 40.46  ? 308 THR C CB    1 
ATOM   5952 O  OG1   . THR C 1 232 ? 32.527  7.658   6.971   1.00 43.19  ? 308 THR C OG1   1 
ATOM   5953 C  CG2   . THR C 1 232 ? 31.683  5.697   8.135   1.00 43.22  ? 308 THR C CG2   1 
ATOM   5954 N  N     . VAL C 1 233 ? 32.013  3.209   5.725   1.00 37.92  ? 309 VAL C N     1 
ATOM   5955 C  CA    . VAL C 1 233 ? 31.298  1.929   5.788   1.00 34.23  ? 309 VAL C CA    1 
ATOM   5956 C  C     . VAL C 1 233 ? 31.008  1.546   7.236   1.00 38.16  ? 309 VAL C C     1 
ATOM   5957 O  O     . VAL C 1 233 ? 31.923  1.415   8.051   1.00 38.20  ? 309 VAL C O     1 
ATOM   5958 C  CB    . VAL C 1 233 ? 32.070  0.750   5.111   1.00 41.69  ? 309 VAL C CB    1 
ATOM   5959 C  CG1   . VAL C 1 233 ? 31.354  -0.564  5.372   1.00 35.18  ? 309 VAL C CG1   1 
ATOM   5960 C  CG2   . VAL C 1 233 ? 32.233  0.967   3.604   1.00 29.99  ? 309 VAL C CG2   1 
ATOM   5961 N  N     . LEU C 1 234 ? 29.730  1.382   7.555   1.00 36.70  ? 310 LEU C N     1 
ATOM   5962 C  CA    . LEU C 1 234 ? 29.325  0.852   8.849   1.00 41.42  ? 310 LEU C CA    1 
ATOM   5963 C  C     . LEU C 1 234 ? 28.914  -0.615  8.687   1.00 38.77  ? 310 LEU C C     1 
ATOM   5964 O  O     . LEU C 1 234 ? 27.925  -0.921  8.011   1.00 37.29  ? 310 LEU C O     1 
ATOM   5965 C  CB    . LEU C 1 234 ? 28.155  1.657   9.444   1.00 34.54  ? 310 LEU C CB    1 
ATOM   5966 C  CG    . LEU C 1 234 ? 28.339  3.162   9.665   1.00 43.19  ? 310 LEU C CG    1 
ATOM   5967 C  CD1   . LEU C 1 234 ? 27.106  3.769   10.315  1.00 37.08  ? 310 LEU C CD1   1 
ATOM   5968 C  CD2   . LEU C 1 234 ? 29.567  3.433   10.505  1.00 36.69  ? 310 LEU C CD2   1 
ATOM   5969 N  N     . ASN C 1 235 ? 29.692  -1.519  9.277   1.00 40.15  ? 311 ASN C N     1 
ATOM   5970 C  CA    . ASN C 1 235 ? 29.276  -2.911  9.392   1.00 41.91  ? 311 ASN C CA    1 
ATOM   5971 C  C     . ASN C 1 235 ? 28.231  -3.057  10.499  1.00 42.55  ? 311 ASN C C     1 
ATOM   5972 O  O     . ASN C 1 235 ? 28.550  -2.975  11.681  1.00 39.76  ? 311 ASN C O     1 
ATOM   5973 C  CB    . ASN C 1 235 ? 30.479  -3.816  9.630   1.00 41.61  ? 311 ASN C CB    1 
ATOM   5974 C  CG    . ASN C 1 235 ? 31.315  -4.005  8.372   1.00 45.97  ? 311 ASN C CG    1 
ATOM   5975 O  OD1   . ASN C 1 235 ? 31.061  -3.367  7.345   1.00 44.29  ? 311 ASN C OD1   1 
ATOM   5976 N  ND2   . ASN C 1 235 ? 32.312  -4.878  8.443   1.00 41.65  ? 311 ASN C ND2   1 
ATOM   5977 N  N     . ILE C 1 236 ? 26.978  -3.245  10.097  1.00 35.85  ? 312 ILE C N     1 
ATOM   5978 C  CA    . ILE C 1 236 ? 25.870  -3.260  11.036  1.00 40.97  ? 312 ILE C CA    1 
ATOM   5979 C  C     . ILE C 1 236 ? 25.334  -4.668  11.245  1.00 43.64  ? 312 ILE C C     1 
ATOM   5980 O  O     . ILE C 1 236 ? 24.950  -5.352  10.297  1.00 44.19  ? 312 ILE C O     1 
ATOM   5981 C  CB    . ILE C 1 236 ? 24.733  -2.352  10.547  1.00 40.20  ? 312 ILE C CB    1 
ATOM   5982 C  CG1   . ILE C 1 236 ? 25.201  -0.898  10.507  1.00 33.73  ? 312 ILE C CG1   1 
ATOM   5983 C  CG2   . ILE C 1 236 ? 23.520  -2.499  11.426  1.00 45.81  ? 312 ILE C CG2   1 
ATOM   5984 C  CD1   . ILE C 1 236 ? 24.480  -0.087  9.471   1.00 38.96  ? 312 ILE C CD1   1 
ATOM   5985 N  N     . MET C 1 237 ? 25.326  -5.102  12.498  1.00 50.56  ? 313 MET C N     1 
ATOM   5986 C  CA    . MET C 1 237 ? 24.734  -6.382  12.854  1.00 47.28  ? 313 MET C CA    1 
ATOM   5987 C  C     . MET C 1 237 ? 23.347  -6.135  13.418  1.00 40.21  ? 313 MET C C     1 
ATOM   5988 O  O     . MET C 1 237 ? 23.200  -5.675  14.544  1.00 51.49  ? 313 MET C O     1 
ATOM   5989 C  CB    . MET C 1 237 ? 25.597  -7.094  13.880  1.00 47.13  ? 313 MET C CB    1 
ATOM   5990 C  CG    . MET C 1 237 ? 25.633  -8.592  13.688  1.00 61.51  ? 313 MET C CG    1 
ATOM   5991 S  SD    . MET C 1 237 ? 27.230  -9.092  13.042  1.00 64.68  ? 313 MET C SD    1 
ATOM   5992 C  CE    . MET C 1 237 ? 28.294  -8.266  14.225  1.00 61.43  ? 313 MET C CE    1 
ATOM   5993 N  N     . LEU C 1 238 ? 22.331  -6.422  12.617  1.00 41.88  ? 314 LEU C N     1 
ATOM   5994 C  CA    . LEU C 1 238 ? 20.952  -6.203  13.008  1.00 44.30  ? 314 LEU C CA    1 
ATOM   5995 C  C     . LEU C 1 238 ? 20.468  -7.353  13.856  1.00 49.83  ? 314 LEU C C     1 
ATOM   5996 O  O     . LEU C 1 238 ? 20.741  -8.521  13.570  1.00 49.39  ? 314 LEU C O     1 
ATOM   5997 C  CB    . LEU C 1 238 ? 20.052  -6.082  11.785  1.00 39.82  ? 314 LEU C CB    1 
ATOM   5998 C  CG    . LEU C 1 238 ? 20.231  -4.812  10.971  1.00 39.20  ? 314 LEU C CG    1 
ATOM   5999 C  CD1   . LEU C 1 238 ? 19.225  -4.786  9.835   1.00 37.80  ? 314 LEU C CD1   1 
ATOM   6000 C  CD2   . LEU C 1 238 ? 20.077  -3.607  11.888  1.00 39.66  ? 314 LEU C CD2   1 
ATOM   6001 N  N     . ASP C 1 239 ? 19.734  -7.025  14.905  1.00 48.55  ? 315 ASP C N     1 
ATOM   6002 C  CA    . ASP C 1 239 ? 19.205  -8.063  15.752  1.00 46.68  ? 315 ASP C CA    1 
ATOM   6003 C  C     . ASP C 1 239 ? 17.790  -8.391  15.302  1.00 55.16  ? 315 ASP C C     1 
ATOM   6004 O  O     . ASP C 1 239 ? 17.030  -7.502  14.931  1.00 54.67  ? 315 ASP C O     1 
ATOM   6005 C  CB    . ASP C 1 239 ? 19.219  -7.611  17.200  1.00 52.99  ? 315 ASP C CB    1 
ATOM   6006 C  CG    . ASP C 1 239 ? 18.734  -8.682  18.129  1.00 68.21  ? 315 ASP C CG    1 
ATOM   6007 O  OD1   . ASP C 1 239 ? 19.031  -9.867  17.851  1.00 77.04  ? 315 ASP C OD1   1 
ATOM   6008 O  OD2   . ASP C 1 239 ? 18.043  -8.344  19.115  1.00 71.31  ? 315 ASP C OD2   1 
ATOM   6009 N  N     . CYS C 1 240 ? 17.445  -9.674  15.314  1.00 58.58  ? 316 CYS C N     1 
ATOM   6010 C  CA    . CYS C 1 240 ? 16.084  -10.091 14.998  1.00 61.36  ? 316 CYS C CA    1 
ATOM   6011 C  C     . CYS C 1 240 ? 15.436  -10.824 16.176  1.00 63.05  ? 316 CYS C C     1 
ATOM   6012 O  O     . CYS C 1 240 ? 16.039  -11.717 16.781  1.00 55.37  ? 316 CYS C O     1 
ATOM   6013 C  CB    . CYS C 1 240 ? 16.060  -10.972 13.743  1.00 52.64  ? 316 CYS C CB    1 
ATOM   6014 S  SG    . CYS C 1 240 ? 14.452  -11.779 13.379  1.00 60.07  ? 316 CYS C SG    1 
ATOM   6015 N  N     . ASP C 1 241 ? 14.213  -10.419 16.501  1.00 58.11  ? 317 ASP C N     1 
ATOM   6016 C  CA    . ASP C 1 241 ? 13.365  -11.172 17.411  1.00 59.42  ? 317 ASP C CA    1 
ATOM   6017 C  C     . ASP C 1 241 ? 12.592  -12.199 16.594  1.00 55.63  ? 317 ASP C C     1 
ATOM   6018 O  O     . ASP C 1 241 ? 11.570  -11.887 15.975  1.00 52.43  ? 317 ASP C O     1 
ATOM   6019 C  CB    . ASP C 1 241 ? 12.405  -10.234 18.155  1.00 62.72  ? 317 ASP C CB    1 
ATOM   6020 C  CG    . ASP C 1 241 ? 11.425  -10.981 19.070  1.00 63.25  ? 317 ASP C CG    1 
ATOM   6021 O  OD1   . ASP C 1 241 ? 11.563  -12.211 19.258  1.00 61.53  ? 317 ASP C OD1   1 
ATOM   6022 O  OD2   . ASP C 1 241 ? 10.515  -10.320 19.612  1.00 63.50  ? 317 ASP C OD2   1 
ATOM   6023 N  N     . LYS C 1 242 ? 13.073  -13.435 16.602  1.00 60.30  ? 318 LYS C N     1 
ATOM   6024 C  CA    . LYS C 1 242 ? 12.442  -14.483 15.814  1.00 51.79  ? 318 LYS C CA    1 
ATOM   6025 C  C     . LYS C 1 242 ? 10.983  -14.729 16.226  1.00 62.44  ? 318 LYS C C     1 
ATOM   6026 O  O     . LYS C 1 242 ? 10.178  -15.227 15.432  1.00 56.35  ? 318 LYS C O     1 
ATOM   6027 C  CB    . LYS C 1 242 ? 13.268  -15.764 15.888  1.00 58.43  ? 318 LYS C CB    1 
ATOM   6028 C  CG    . LYS C 1 242 ? 14.732  -15.552 15.547  1.00 53.97  ? 318 LYS C CG    1 
ATOM   6029 C  CD    . LYS C 1 242 ? 15.316  -16.795 14.901  1.00 59.22  ? 318 LYS C CD    1 
ATOM   6030 C  CE    . LYS C 1 242 ? 16.782  -16.603 14.548  1.00 64.72  ? 318 LYS C CE    1 
ATOM   6031 N  NZ    . LYS C 1 242 ? 17.657  -16.478 15.749  1.00 60.70  ? 318 LYS C NZ    1 
ATOM   6032 N  N     . THR C 1 243 ? 10.636  -14.349 17.456  1.00 62.81  ? 319 THR C N     1 
ATOM   6033 C  CA    . THR C 1 243 ? 9.271   -14.532 17.948  1.00 63.09  ? 319 THR C CA    1 
ATOM   6034 C  C     . THR C 1 243 ? 8.301   -13.573 17.270  1.00 63.61  ? 319 THR C C     1 
ATOM   6035 O  O     . THR C 1 243 ? 7.232   -13.982 16.812  1.00 69.12  ? 319 THR C O     1 
ATOM   6036 C  CB    . THR C 1 243 ? 9.179   -14.363 19.484  1.00 65.96  ? 319 THR C CB    1 
ATOM   6037 O  OG1   . THR C 1 243 ? 9.817   -15.473 20.127  1.00 54.48  ? 319 THR C OG1   1 
ATOM   6038 C  CG2   . THR C 1 243 ? 7.726   -14.287 19.931  1.00 61.74  ? 319 THR C CG2   1 
ATOM   6039 N  N     . ALA C 1 244 ? 8.682   -12.301 17.198  1.00 58.74  ? 320 ALA C N     1 
ATOM   6040 C  CA    . ALA C 1 244 ? 7.812   -11.271 16.629  1.00 55.69  ? 320 ALA C CA    1 
ATOM   6041 C  C     . ALA C 1 244 ? 7.836   -11.254 15.099  1.00 61.19  ? 320 ALA C C     1 
ATOM   6042 O  O     . ALA C 1 244 ? 6.795   -11.124 14.451  1.00 61.65  ? 320 ALA C O     1 
ATOM   6043 C  CB    . ALA C 1 244 ? 8.178   -9.907  17.182  1.00 48.51  ? 320 ALA C CB    1 
ATOM   6044 N  N     . THR C 1 245 ? 9.026   -11.383 14.525  1.00 55.35  ? 321 THR C N     1 
ATOM   6045 C  CA    . THR C 1 245 ? 9.176   -11.365 13.072  1.00 60.43  ? 321 THR C CA    1 
ATOM   6046 C  C     . THR C 1 245 ? 10.028  -12.543 12.620  1.00 58.70  ? 321 THR C C     1 
ATOM   6047 O  O     . THR C 1 245 ? 11.213  -12.366 12.356  1.00 55.43  ? 321 THR C O     1 
ATOM   6048 C  CB    . THR C 1 245 ? 9.832   -10.038 12.574  1.00 59.12  ? 321 THR C CB    1 
ATOM   6049 O  OG1   . THR C 1 245 ? 11.133  -9.871  13.163  1.00 58.89  ? 321 THR C OG1   1 
ATOM   6050 C  CG2   . THR C 1 245 ? 8.969   -8.835  12.935  1.00 46.64  ? 321 THR C CG2   1 
ATOM   6051 N  N     . PRO C 1 246 ? 9.425   -13.751 12.544  1.00 59.84  ? 322 PRO C N     1 
ATOM   6052 C  CA    . PRO C 1 246 ? 10.137  -14.986 12.193  1.00 51.69  ? 322 PRO C CA    1 
ATOM   6053 C  C     . PRO C 1 246 ? 10.645  -14.983 10.767  1.00 55.93  ? 322 PRO C C     1 
ATOM   6054 O  O     . PRO C 1 246 ? 11.518  -15.785 10.434  1.00 59.16  ? 322 PRO C O     1 
ATOM   6055 C  CB    . PRO C 1 246 ? 9.059   -16.075 12.319  1.00 50.12  ? 322 PRO C CB    1 
ATOM   6056 C  CG    . PRO C 1 246 ? 7.966   -15.478 13.106  1.00 49.20  ? 322 PRO C CG    1 
ATOM   6057 C  CD    . PRO C 1 246 ? 8.009   -14.003 12.862  1.00 57.50  ? 322 PRO C CD    1 
ATOM   6058 N  N     . TRP C 1 247 ? 10.094  -14.113 9.926   1.00 53.14  ? 323 TRP C N     1 
ATOM   6059 C  CA    . TRP C 1 247 ? 10.447  -14.108 8.507   1.00 55.31  ? 323 TRP C CA    1 
ATOM   6060 C  C     . TRP C 1 247 ? 11.819  -13.472 8.245   1.00 56.52  ? 323 TRP C C     1 
ATOM   6061 O  O     . TRP C 1 247 ? 12.222  -13.280 7.100   1.00 57.46  ? 323 TRP C O     1 
ATOM   6062 C  CB    . TRP C 1 247 ? 9.354   -13.429 7.682   1.00 50.19  ? 323 TRP C CB    1 
ATOM   6063 C  CG    . TRP C 1 247 ? 8.936   -12.081 8.205   1.00 60.38  ? 323 TRP C CG    1 
ATOM   6064 C  CD1   . TRP C 1 247 ? 9.471   -10.865 7.871   1.00 54.26  ? 323 TRP C CD1   1 
ATOM   6065 C  CD2   . TRP C 1 247 ? 7.884   -11.811 9.143   1.00 56.60  ? 323 TRP C CD2   1 
ATOM   6066 N  NE1   . TRP C 1 247 ? 8.822   -9.860  8.549   1.00 51.73  ? 323 TRP C NE1   1 
ATOM   6067 C  CE2   . TRP C 1 247 ? 7.840   -10.415 9.333   1.00 62.98  ? 323 TRP C CE2   1 
ATOM   6068 C  CE3   . TRP C 1 247 ? 6.977   -12.615 9.841   1.00 54.10  ? 323 TRP C CE3   1 
ATOM   6069 C  CZ2   . TRP C 1 247 ? 6.924   -9.806  10.200  1.00 63.89  ? 323 TRP C CZ2   1 
ATOM   6070 C  CZ3   . TRP C 1 247 ? 6.073   -12.013 10.689  1.00 55.25  ? 323 TRP C CZ3   1 
ATOM   6071 C  CH2   . TRP C 1 247 ? 6.053   -10.623 10.865  1.00 59.09  ? 323 TRP C CH2   1 
ATOM   6072 N  N     . CYS C 1 248 ? 12.538  -13.170 9.321   1.00 55.35  ? 324 CYS C N     1 
ATOM   6073 C  CA    . CYS C 1 248 ? 13.868  -12.599 9.226   1.00 50.12  ? 324 CYS C CA    1 
ATOM   6074 C  C     . CYS C 1 248 ? 14.915  -13.605 8.744   1.00 52.24  ? 324 CYS C C     1 
ATOM   6075 O  O     . CYS C 1 248 ? 15.941  -13.209 8.197   1.00 49.10  ? 324 CYS C O     1 
ATOM   6076 C  CB    . CYS C 1 248 ? 14.281  -11.999 10.575  1.00 55.61  ? 324 CYS C CB    1 
ATOM   6077 S  SG    . CYS C 1 248 ? 14.612  -13.206 11.909  1.00 51.34  ? 324 CYS C SG    1 
ATOM   6078 N  N     . THR C 1 249 ? 14.662  -14.902 8.930   1.00 59.05  ? 325 THR C N     1 
ATOM   6079 C  CA    . THR C 1 249 ? 15.670  -15.914 8.584   1.00 52.05  ? 325 THR C CA    1 
ATOM   6080 C  C     . THR C 1 249 ? 15.488  -16.629 7.259   1.00 56.02  ? 325 THR C C     1 
ATOM   6081 O  O     . THR C 1 249 ? 14.397  -16.678 6.682   1.00 54.83  ? 325 THR C O     1 
ATOM   6082 C  CB    . THR C 1 249 ? 15.820  -17.030 9.652   1.00 46.29  ? 325 THR C CB    1 
ATOM   6083 O  OG1   . THR C 1 249 ? 14.534  -17.571 9.957   1.00 64.02  ? 325 THR C OG1   1 
ATOM   6084 C  CG2   . THR C 1 249 ? 16.470  -16.508 10.917  1.00 52.17  ? 325 THR C CG2   1 
ATOM   6085 N  N     . PHE C 1 250 ? 16.615  -17.185 6.817   1.00 67.89  ? 326 PHE C N     1 
ATOM   6086 C  CA    . PHE C 1 250 ? 16.729  -18.161 5.731   1.00 73.28  ? 326 PHE C CA    1 
ATOM   6087 C  C     . PHE C 1 250 ? 16.830  -17.475 4.358   1.00 75.19  ? 326 PHE C C     1 
ATOM   6088 O  O     . PHE C 1 250 ? 16.037  -17.688 3.434   1.00 81.47  ? 326 PHE C O     1 
ATOM   6089 C  CB    . PHE C 1 250 ? 15.821  -19.410 5.966   1.00 56.55  ? 326 PHE C CB    1 
ATOM   6090 C  CG    . PHE C 1 250 ? 14.812  -19.732 4.884   1.00 76.74  ? 326 PHE C CG    1 
ATOM   6091 C  CD1   . PHE C 1 250 ? 15.185  -20.429 3.736   1.00 84.02  ? 326 PHE C CD1   1 
ATOM   6092 C  CD2   . PHE C 1 250 ? 13.464  -19.453 5.077   1.00 74.69  ? 326 PHE C CD2   1 
ATOM   6093 C  CE1   . PHE C 1 250 ? 14.242  -20.759 2.761   1.00 82.04  ? 326 PHE C CE1   1 
ATOM   6094 C  CE2   . PHE C 1 250 ? 12.516  -19.790 4.116   1.00 73.49  ? 326 PHE C CE2   1 
ATOM   6095 C  CZ    . PHE C 1 250 ? 12.905  -20.441 2.957   1.00 84.08  ? 326 PHE C CZ    1 
ATOM   6096 N  N     . SER C 1 251 ? 17.858  -16.614 4.314   1.00 72.17  ? 327 SER C N     1 
ATOM   6097 C  CA    . SER C 1 251 ? 18.332  -15.817 3.161   1.00 63.37  ? 327 SER C CA    1 
ATOM   6098 C  C     . SER C 1 251 ? 19.229  -14.651 3.645   1.00 63.37  ? 327 SER C C     1 
ATOM   6099 O  O     . SER C 1 251 ? 19.394  -13.617 2.982   1.00 53.58  ? 327 SER C O     1 
ATOM   6100 C  CB    . SER C 1 251 ? 17.185  -15.277 2.299   1.00 61.67  ? 327 SER C CB    1 
ATOM   6101 O  OG    . SER C 1 251 ? 17.666  -14.452 1.248   1.00 73.14  ? 327 SER C OG    1 
ATOM   6102 O  OXT   . SER C 1 251 ? 19.819  -14.702 4.731   1.00 56.29  ? 327 SER C OXT   1 
ATOM   6103 N  N     . GLU D 1 9   ? 2.974   -3.072  -69.832 1.00 82.94  ? 85  GLU D N     1 
ATOM   6104 C  CA    . GLU D 1 9   ? 2.331   -2.068  -70.676 1.00 83.81  ? 85  GLU D CA    1 
ATOM   6105 C  C     . GLU D 1 9   ? 3.226   -1.643  -71.850 1.00 84.51  ? 85  GLU D C     1 
ATOM   6106 O  O     . GLU D 1 9   ? 2.735   -1.388  -72.954 1.00 81.79  ? 85  GLU D O     1 
ATOM   6107 C  CB    . GLU D 1 9   ? 1.955   -0.842  -69.837 1.00 83.04  ? 85  GLU D CB    1 
ATOM   6108 C  CG    . GLU D 1 9   ? 1.087   0.182   -70.560 1.00 74.17  ? 85  GLU D CG    1 
ATOM   6109 C  CD    . GLU D 1 9   ? -0.400  -0.114  -70.430 1.00 94.21  ? 85  GLU D CD    1 
ATOM   6110 O  OE1   . GLU D 1 9   ? -0.829  -1.235  -70.799 1.00 92.91  ? 85  GLU D OE1   1 
ATOM   6111 O  OE2   . GLU D 1 9   ? -1.136  0.778   -69.944 1.00 90.28  ? 85  GLU D OE2   1 
ATOM   6112 N  N     . GLU D 1 10  ? 4.536   -1.581  -71.602 1.00 75.71  ? 86  GLU D N     1 
ATOM   6113 C  CA    . GLU D 1 10  ? 5.500   -1.020  -72.556 1.00 78.89  ? 86  GLU D CA    1 
ATOM   6114 C  C     . GLU D 1 10  ? 5.681   -1.876  -73.815 1.00 85.81  ? 86  GLU D C     1 
ATOM   6115 O  O     . GLU D 1 10  ? 6.220   -2.985  -73.750 1.00 91.22  ? 86  GLU D O     1 
ATOM   6116 C  CB    . GLU D 1 10  ? 6.855   -0.789  -71.862 1.00 77.98  ? 86  GLU D CB    1 
ATOM   6117 C  CG    . GLU D 1 10  ? 7.812   0.182   -72.577 1.00 76.60  ? 86  GLU D CG    1 
ATOM   6118 C  CD    . GLU D 1 10  ? 9.079   0.471   -71.762 1.00 72.11  ? 86  GLU D CD    1 
ATOM   6119 O  OE1   . GLU D 1 10  ? 9.038   0.312   -70.525 1.00 79.81  ? 86  GLU D OE1   1 
ATOM   6120 O  OE2   . GLU D 1 10  ? 10.118  0.846   -72.351 1.00 60.56  ? 86  GLU D OE2   1 
ATOM   6121 N  N     . ASP D 1 11  ? 5.231   -1.351  -74.956 1.00 88.43  ? 87  ASP D N     1 
ATOM   6122 C  CA    . ASP D 1 11  ? 5.384   -2.024  -76.251 1.00 79.72  ? 87  ASP D CA    1 
ATOM   6123 C  C     . ASP D 1 11  ? 6.718   -1.695  -76.894 1.00 83.80  ? 87  ASP D C     1 
ATOM   6124 O  O     . ASP D 1 11  ? 7.608   -1.128  -76.263 1.00 84.56  ? 87  ASP D O     1 
ATOM   6125 C  CB    . ASP D 1 11  ? 4.295   -1.575  -77.226 1.00 80.68  ? 87  ASP D CB    1 
ATOM   6126 C  CG    . ASP D 1 11  ? 3.024   -2.382  -77.105 1.00 81.81  ? 87  ASP D CG    1 
ATOM   6127 O  OD1   . ASP D 1 11  ? 3.114   -3.604  -76.871 1.00 90.22  ? 87  ASP D OD1   1 
ATOM   6128 O  OD2   . ASP D 1 11  ? 1.931   -1.795  -77.259 1.00 79.61  ? 87  ASP D OD2   1 
ATOM   6129 N  N     . ALA D 1 12  ? 6.839   -2.053  -78.168 1.00 86.33  ? 88  ALA D N     1 
ATOM   6130 C  CA    . ALA D 1 12  ? 7.954   -1.606  -78.991 1.00 83.78  ? 88  ALA D CA    1 
ATOM   6131 C  C     . ALA D 1 12  ? 7.453   -0.487  -79.892 1.00 74.77  ? 88  ALA D C     1 
ATOM   6132 O  O     . ALA D 1 12  ? 8.228   0.174   -80.579 1.00 74.19  ? 88  ALA D O     1 
ATOM   6133 C  CB    . ALA D 1 12  ? 8.509   -2.751  -79.815 1.00 85.02  ? 88  ALA D CB    1 
ATOM   6134 N  N     . SER D 1 13  ? 6.141   -0.276  -79.872 1.00 72.99  ? 89  SER D N     1 
ATOM   6135 C  CA    . SER D 1 13  ? 5.525   0.810   -80.621 1.00 82.17  ? 89  SER D CA    1 
ATOM   6136 C  C     . SER D 1 13  ? 5.734   2.177   -79.946 1.00 87.90  ? 89  SER D C     1 
ATOM   6137 O  O     . SER D 1 13  ? 5.400   3.224   -80.516 1.00 83.99  ? 89  SER D O     1 
ATOM   6138 C  CB    . SER D 1 13  ? 4.031   0.533   -80.813 1.00 82.33  ? 89  SER D CB    1 
ATOM   6139 O  OG    . SER D 1 13  ? 3.398   0.243   -79.580 1.00 77.37  ? 89  SER D OG    1 
ATOM   6140 N  N     . TRP D 1 14  ? 6.292   2.152   -78.734 1.00 83.26  ? 90  TRP D N     1 
ATOM   6141 C  CA    . TRP D 1 14  ? 6.519   3.358   -77.934 1.00 77.72  ? 90  TRP D CA    1 
ATOM   6142 C  C     . TRP D 1 14  ? 7.820   4.033   -78.345 1.00 74.63  ? 90  TRP D C     1 
ATOM   6143 O  O     . TRP D 1 14  ? 8.786   3.345   -78.667 1.00 68.87  ? 90  TRP D O     1 
ATOM   6144 C  CB    . TRP D 1 14  ? 6.595   3.003   -76.444 1.00 69.13  ? 90  TRP D CB    1 
ATOM   6145 C  CG    . TRP D 1 14  ? 5.320   2.481   -75.861 1.00 73.52  ? 90  TRP D CG    1 
ATOM   6146 C  CD1   . TRP D 1 14  ? 4.272   1.923   -76.533 1.00 77.58  ? 90  TRP D CD1   1 
ATOM   6147 C  CD2   . TRP D 1 14  ? 4.956   2.480   -74.478 1.00 72.20  ? 90  TRP D CD2   1 
ATOM   6148 N  NE1   . TRP D 1 14  ? 3.279   1.567   -75.654 1.00 79.42  ? 90  TRP D NE1   1 
ATOM   6149 C  CE2   . TRP D 1 14  ? 3.673   1.902   -74.385 1.00 76.72  ? 90  TRP D CE2   1 
ATOM   6150 C  CE3   . TRP D 1 14  ? 5.589   2.910   -73.310 1.00 61.98  ? 90  TRP D CE3   1 
ATOM   6151 C  CZ2   . TRP D 1 14  ? 3.013   1.745   -73.169 1.00 64.63  ? 90  TRP D CZ2   1 
ATOM   6152 C  CZ3   . TRP D 1 14  ? 4.936   2.753   -72.107 1.00 65.16  ? 90  TRP D CZ3   1 
ATOM   6153 C  CH2   . TRP D 1 14  ? 3.660   2.173   -72.044 1.00 65.96  ? 90  TRP D CH2   1 
ATOM   6154 N  N     . GLY D 1 15  ? 7.854   5.366   -78.293 1.00 58.61  ? 91  GLY D N     1 
ATOM   6155 C  CA    . GLY D 1 15  ? 9.007   6.129   -78.746 1.00 53.29  ? 91  GLY D CA    1 
ATOM   6156 C  C     . GLY D 1 15  ? 10.324  5.769   -78.082 1.00 56.54  ? 91  GLY D C     1 
ATOM   6157 O  O     . GLY D 1 15  ? 10.336  5.160   -77.016 1.00 61.12  ? 91  GLY D O     1 
ATOM   6158 N  N     . PRO D 1 16  ? 11.450  6.154   -78.709 1.00 61.05  ? 92  PRO D N     1 
ATOM   6159 C  CA    . PRO D 1 16  ? 12.810  5.803   -78.269 1.00 50.61  ? 92  PRO D CA    1 
ATOM   6160 C  C     . PRO D 1 16  ? 13.269  6.499   -76.988 1.00 55.95  ? 92  PRO D C     1 
ATOM   6161 O  O     . PRO D 1 16  ? 14.086  5.950   -76.244 1.00 59.35  ? 92  PRO D O     1 
ATOM   6162 C  CB    . PRO D 1 16  ? 13.682  6.274   -79.437 1.00 49.76  ? 92  PRO D CB    1 
ATOM   6163 C  CG    . PRO D 1 16  ? 12.912  7.383   -80.055 1.00 57.62  ? 92  PRO D CG    1 
ATOM   6164 C  CD    . PRO D 1 16  ? 11.469  6.957   -79.946 1.00 64.94  ? 92  PRO D CD    1 
ATOM   6165 N  N     . HIS D 1 17  ? 12.752  7.694   -76.733 1.00 51.73  ? 93  HIS D N     1 
ATOM   6166 C  CA    . HIS D 1 17  ? 13.217  8.499   -75.609 1.00 50.07  ? 93  HIS D CA    1 
ATOM   6167 C  C     . HIS D 1 17  ? 12.699  8.032   -74.251 1.00 51.54  ? 93  HIS D C     1 
ATOM   6168 O  O     . HIS D 1 17  ? 11.499  7.824   -74.073 1.00 47.81  ? 93  HIS D O     1 
ATOM   6169 C  CB    . HIS D 1 17  ? 12.841  9.949   -75.854 1.00 50.79  ? 93  HIS D CB    1 
ATOM   6170 C  CG    . HIS D 1 17  ? 13.492  10.529  -77.068 1.00 47.35  ? 93  HIS D CG    1 
ATOM   6171 N  ND1   . HIS D 1 17  ? 12.773  11.085  -78.108 1.00 48.62  ? 93  HIS D ND1   1 
ATOM   6172 C  CD2   . HIS D 1 17  ? 14.798  10.629  -77.412 1.00 39.27  ? 93  HIS D CD2   1 
ATOM   6173 C  CE1   . HIS D 1 17  ? 13.611  11.519  -79.032 1.00 44.81  ? 93  HIS D CE1   1 
ATOM   6174 N  NE2   . HIS D 1 17  ? 14.844  11.250  -78.635 1.00 52.21  ? 93  HIS D NE2   1 
ATOM   6175 N  N     . ARG D 1 18  ? 13.618  7.862   -73.304 1.00 50.40  ? 94  ARG D N     1 
ATOM   6176 C  CA    . ARG D 1 18  ? 13.272  7.396   -71.966 1.00 53.58  ? 94  ARG D CA    1 
ATOM   6177 C  C     . ARG D 1 18  ? 13.259  8.539   -70.943 1.00 52.83  ? 94  ARG D C     1 
ATOM   6178 O  O     . ARG D 1 18  ? 14.294  9.160   -70.674 1.00 43.49  ? 94  ARG D O     1 
ATOM   6179 C  CB    . ARG D 1 18  ? 14.251  6.318   -71.504 1.00 49.21  ? 94  ARG D CB    1 
ATOM   6180 C  CG    . ARG D 1 18  ? 14.181  4.999   -72.278 1.00 67.83  ? 94  ARG D CG    1 
ATOM   6181 C  CD    . ARG D 1 18  ? 13.391  3.925   -71.509 1.00 71.59  ? 94  ARG D CD    1 
ATOM   6182 N  NE    . ARG D 1 18  ? 13.949  3.638   -70.188 1.00 73.88  ? 94  ARG D NE    1 
ATOM   6183 C  CZ    . ARG D 1 18  ? 13.267  3.072   -69.196 1.00 70.19  ? 94  ARG D CZ    1 
ATOM   6184 N  NH1   . ARG D 1 18  ? 11.993  2.736   -69.368 1.00 69.52  ? 94  ARG D NH1   1 
ATOM   6185 N  NH2   . ARG D 1 18  ? 13.858  2.842   -68.028 1.00 73.43  ? 94  ARG D NH2   1 
ATOM   6186 N  N     . LEU D 1 19  ? 12.090  8.774   -70.354 1.00 45.02  ? 95  LEU D N     1 
ATOM   6187 C  CA    . LEU D 1 19  ? 11.897  9.818   -69.345 1.00 36.92  ? 95  LEU D CA    1 
ATOM   6188 C  C     . LEU D 1 19  ? 12.222  9.374   -67.916 1.00 38.40  ? 95  LEU D C     1 
ATOM   6189 O  O     . LEU D 1 19  ? 11.611  8.459   -67.377 1.00 42.12  ? 95  LEU D O     1 
ATOM   6190 C  CB    . LEU D 1 19  ? 10.451  10.317  -69.404 1.00 35.93  ? 95  LEU D CB    1 
ATOM   6191 C  CG    . LEU D 1 19  ? 10.007  11.306  -68.316 1.00 41.04  ? 95  LEU D CG    1 
ATOM   6192 C  CD1   . LEU D 1 19  ? 10.848  12.571  -68.367 1.00 39.18  ? 95  LEU D CD1   1 
ATOM   6193 C  CD2   . LEU D 1 19  ? 8.525   11.625  -68.459 1.00 32.49  ? 95  LEU D CD2   1 
ATOM   6194 N  N     . ALA D 1 20  ? 13.190  10.018  -67.292 1.00 40.45  ? 96  ALA D N     1 
ATOM   6195 C  CA    . ALA D 1 20  ? 13.365  9.844   -65.864 1.00 41.15  ? 96  ALA D CA    1 
ATOM   6196 C  C     . ALA D 1 20  ? 12.459  10.859  -65.129 1.00 45.39  ? 96  ALA D C     1 
ATOM   6197 O  O     . ALA D 1 20  ? 12.684  12.060  -65.222 1.00 38.62  ? 96  ALA D O     1 
ATOM   6198 C  CB    . ALA D 1 20  ? 14.820  10.050  -65.484 1.00 38.83  ? 96  ALA D CB    1 
ATOM   6199 N  N     . VAL D 1 21  ? 11.422  10.384  -64.435 1.00 39.69  ? 97  VAL D N     1 
ATOM   6200 C  CA    . VAL D 1 21  ? 10.595  11.269  -63.612 1.00 37.98  ? 97  VAL D CA    1 
ATOM   6201 C  C     . VAL D 1 21  ? 11.261  11.447  -62.250 1.00 38.61  ? 97  VAL D C     1 
ATOM   6202 O  O     . VAL D 1 21  ? 11.439  10.477  -61.518 1.00 36.60  ? 97  VAL D O     1 
ATOM   6203 C  CB    . VAL D 1 21  ? 9.178   10.724  -63.419 1.00 39.03  ? 97  VAL D CB    1 
ATOM   6204 C  CG1   . VAL D 1 21  ? 8.353   11.684  -62.564 1.00 36.08  ? 97  VAL D CG1   1 
ATOM   6205 C  CG2   . VAL D 1 21  ? 8.517   10.479  -64.764 1.00 36.23  ? 97  VAL D CG2   1 
ATOM   6206 N  N     . LEU D 1 22  ? 11.642  12.682  -61.925 1.00 33.40  ? 98  LEU D N     1 
ATOM   6207 C  CA    . LEU D 1 22  ? 12.495  12.946  -60.770 1.00 36.87  ? 98  LEU D CA    1 
ATOM   6208 C  C     . LEU D 1 22  ? 11.695  13.632  -59.673 1.00 36.79  ? 98  LEU D C     1 
ATOM   6209 O  O     . LEU D 1 22  ? 11.404  14.823  -59.764 1.00 39.54  ? 98  LEU D O     1 
ATOM   6210 C  CB    . LEU D 1 22  ? 13.708  13.800  -61.173 1.00 35.92  ? 98  LEU D CB    1 
ATOM   6211 C  CG    . LEU D 1 22  ? 14.679  13.202  -62.204 1.00 33.57  ? 98  LEU D CG    1 
ATOM   6212 C  CD1   . LEU D 1 22  ? 15.875  14.109  -62.401 1.00 38.57  ? 98  LEU D CD1   1 
ATOM   6213 C  CD2   . LEU D 1 22  ? 15.156  11.805  -61.780 1.00 35.97  ? 98  LEU D CD2   1 
ATOM   6214 N  N     . VAL D 1 23  ? 11.336  12.869  -58.642 1.00 32.35  ? 99  VAL D N     1 
ATOM   6215 C  CA    . VAL D 1 23  ? 10.450  13.349  -57.603 1.00 32.18  ? 99  VAL D CA    1 
ATOM   6216 C  C     . VAL D 1 23  ? 11.215  13.696  -56.342 1.00 36.18  ? 99  VAL D C     1 
ATOM   6217 O  O     . VAL D 1 23  ? 11.652  12.806  -55.629 1.00 34.28  ? 99  VAL D O     1 
ATOM   6218 C  CB    . VAL D 1 23  ? 9.409   12.298  -57.242 1.00 42.66  ? 99  VAL D CB    1 
ATOM   6219 C  CG1   . VAL D 1 23  ? 8.411   12.877  -56.240 1.00 33.32  ? 99  VAL D CG1   1 
ATOM   6220 C  CG2   . VAL D 1 23  ? 8.715   11.776  -58.504 1.00 37.49  ? 99  VAL D CG2   1 
ATOM   6221 N  N     . PRO D 1 24  ? 11.386  15.001  -56.065 1.00 36.96  ? 100 PRO D N     1 
ATOM   6222 C  CA    . PRO D 1 24  ? 11.988  15.419  -54.793 1.00 39.51  ? 100 PRO D CA    1 
ATOM   6223 C  C     . PRO D 1 24  ? 11.043  15.001  -53.658 1.00 31.92  ? 100 PRO D C     1 
ATOM   6224 O  O     . PRO D 1 24  ? 9.826   15.191  -53.767 1.00 32.88  ? 100 PRO D O     1 
ATOM   6225 C  CB    . PRO D 1 24  ? 12.074  16.959  -54.927 1.00 32.65  ? 100 PRO D CB    1 
ATOM   6226 C  CG    . PRO D 1 24  ? 10.950  17.315  -55.823 1.00 31.39  ? 100 PRO D CG    1 
ATOM   6227 C  CD    . PRO D 1 24  ? 10.831  16.138  -56.818 1.00 34.37  ? 100 PRO D CD    1 
ATOM   6228 N  N     . PHE D 1 25  ? 11.575  14.416  -52.595 1.00 34.16  ? 101 PHE D N     1 
ATOM   6229 C  CA    . PHE D 1 25  ? 10.700  13.705  -51.661 1.00 36.87  ? 101 PHE D CA    1 
ATOM   6230 C  C     . PHE D 1 25  ? 11.228  13.660  -50.232 1.00 40.04  ? 101 PHE D C     1 
ATOM   6231 O  O     . PHE D 1 25  ? 12.428  13.432  -49.990 1.00 39.58  ? 101 PHE D O     1 
ATOM   6232 C  CB    . PHE D 1 25  ? 10.458  12.280  -52.174 1.00 35.56  ? 101 PHE D CB    1 
ATOM   6233 C  CG    . PHE D 1 25  ? 9.461   11.493  -51.367 1.00 38.45  ? 101 PHE D CG    1 
ATOM   6234 C  CD1   . PHE D 1 25  ? 8.108   11.526  -51.685 1.00 35.63  ? 101 PHE D CD1   1 
ATOM   6235 C  CD2   . PHE D 1 25  ? 9.876   10.695  -50.308 1.00 35.77  ? 101 PHE D CD2   1 
ATOM   6236 C  CE1   . PHE D 1 25  ? 7.186   10.787  -50.950 1.00 36.51  ? 101 PHE D CE1   1 
ATOM   6237 C  CE2   . PHE D 1 25  ? 8.960   9.963   -49.575 1.00 31.05  ? 101 PHE D CE2   1 
ATOM   6238 C  CZ    . PHE D 1 25  ? 7.614   10.009  -49.896 1.00 28.97  ? 101 PHE D CZ    1 
ATOM   6239 N  N     . ARG D 1 26  ? 10.312  13.885  -49.292 1.00 38.57  ? 102 ARG D N     1 
ATOM   6240 C  CA    . ARG D 1 26  ? 10.556  13.665  -47.868 1.00 37.33  ? 102 ARG D CA    1 
ATOM   6241 C  C     . ARG D 1 26  ? 9.242   13.838  -47.132 1.00 42.80  ? 102 ARG D C     1 
ATOM   6242 O  O     . ARG D 1 26  ? 8.620   14.906  -47.210 1.00 37.24  ? 102 ARG D O     1 
ATOM   6243 C  CB    . ARG D 1 26  ? 11.600  14.634  -47.293 1.00 39.72  ? 102 ARG D CB    1 
ATOM   6244 C  CG    . ARG D 1 26  ? 11.527  14.767  -45.756 1.00 41.45  ? 102 ARG D CG    1 
ATOM   6245 C  CD    . ARG D 1 26  ? 12.918  14.902  -45.146 1.00 40.82  ? 102 ARG D CD    1 
ATOM   6246 N  NE    . ARG D 1 26  ? 13.223  16.295  -44.870 1.00 49.51  ? 102 ARG D NE    1 
ATOM   6247 C  CZ    . ARG D 1 26  ? 14.443  16.797  -44.714 1.00 48.25  ? 102 ARG D CZ    1 
ATOM   6248 N  NH1   . ARG D 1 26  ? 15.519  16.022  -44.826 1.00 41.68  ? 102 ARG D NH1   1 
ATOM   6249 N  NH2   . ARG D 1 26  ? 14.579  18.092  -44.456 1.00 44.53  ? 102 ARG D NH2   1 
ATOM   6250 N  N     . GLU D 1 27  ? 8.821   12.781  -46.437 1.00 39.05  ? 103 GLU D N     1 
ATOM   6251 C  CA    . GLU D 1 27  ? 7.603   12.801  -45.621 1.00 31.91  ? 103 GLU D CA    1 
ATOM   6252 C  C     . GLU D 1 27  ? 6.340   13.154  -46.410 1.00 35.16  ? 103 GLU D C     1 
ATOM   6253 O  O     . GLU D 1 27  ? 5.576   14.030  -46.010 1.00 40.74  ? 103 GLU D O     1 
ATOM   6254 C  CB    . GLU D 1 27  ? 7.764   13.755  -44.435 1.00 39.84  ? 103 GLU D CB    1 
ATOM   6255 C  CG    . GLU D 1 27  ? 8.791   13.311  -43.394 1.00 46.13  ? 103 GLU D CG    1 
ATOM   6256 C  CD    . GLU D 1 27  ? 9.259   14.446  -42.489 1.00 53.31  ? 103 GLU D CD    1 
ATOM   6257 O  OE1   . GLU D 1 27  ? 8.470   15.383  -42.212 1.00 68.25  ? 103 GLU D OE1   1 
ATOM   6258 O  OE2   . GLU D 1 27  ? 10.429  14.407  -42.055 1.00 55.54  ? 103 GLU D OE2   1 
ATOM   6259 N  N     . ARG D 1 28  ? 6.120   12.474  -47.528 1.00 32.65  ? 104 ARG D N     1 
ATOM   6260 C  CA    . ARG D 1 28  ? 4.895   12.654  -48.298 1.00 36.46  ? 104 ARG D CA    1 
ATOM   6261 C  C     . ARG D 1 28  ? 4.325   11.279  -48.705 1.00 40.76  ? 104 ARG D C     1 
ATOM   6262 O  O     . ARG D 1 28  ? 3.884   11.086  -49.847 1.00 38.76  ? 104 ARG D O     1 
ATOM   6263 C  CB    . ARG D 1 28  ? 5.157   13.549  -49.536 1.00 37.50  ? 104 ARG D CB    1 
ATOM   6264 C  CG    . ARG D 1 28  ? 5.633   14.989  -49.210 1.00 32.95  ? 104 ARG D CG    1 
ATOM   6265 C  CD    . ARG D 1 28  ? 4.517   15.840  -48.583 1.00 35.37  ? 104 ARG D CD    1 
ATOM   6266 N  NE    . ARG D 1 28  ? 4.931   17.214  -48.298 1.00 37.86  ? 104 ARG D NE    1 
ATOM   6267 C  CZ    . ARG D 1 28  ? 5.566   17.607  -47.191 1.00 40.39  ? 104 ARG D CZ    1 
ATOM   6268 N  NH1   . ARG D 1 28  ? 5.880   16.737  -46.235 1.00 38.92  ? 104 ARG D NH1   1 
ATOM   6269 N  NH2   . ARG D 1 28  ? 5.894   18.882  -47.034 1.00 41.31  ? 104 ARG D NH2   1 
ATOM   6270 N  N     . PHE D 1 29  ? 4.334   10.337  -47.757 1.00 40.83  ? 105 PHE D N     1 
ATOM   6271 C  CA    . PHE D 1 29  ? 3.987   8.941   -48.026 1.00 37.65  ? 105 PHE D CA    1 
ATOM   6272 C  C     . PHE D 1 29  ? 2.621   8.850   -48.682 1.00 41.01  ? 105 PHE D C     1 
ATOM   6273 O  O     . PHE D 1 29  ? 2.450   8.199   -49.707 1.00 44.02  ? 105 PHE D O     1 
ATOM   6274 C  CB    . PHE D 1 29  ? 4.016   8.126   -46.728 1.00 40.70  ? 105 PHE D CB    1 
ATOM   6275 C  CG    . PHE D 1 29  ? 3.622   6.673   -46.898 1.00 44.60  ? 105 PHE D CG    1 
ATOM   6276 C  CD1   . PHE D 1 29  ? 4.423   5.795   -47.617 1.00 52.10  ? 105 PHE D CD1   1 
ATOM   6277 C  CD2   . PHE D 1 29  ? 2.467   6.182   -46.311 1.00 43.79  ? 105 PHE D CD2   1 
ATOM   6278 C  CE1   . PHE D 1 29  ? 4.068   4.455   -47.762 1.00 52.57  ? 105 PHE D CE1   1 
ATOM   6279 C  CE2   . PHE D 1 29  ? 2.109   4.857   -46.445 1.00 42.43  ? 105 PHE D CE2   1 
ATOM   6280 C  CZ    . PHE D 1 29  ? 2.911   3.987   -47.179 1.00 46.31  ? 105 PHE D CZ    1 
ATOM   6281 N  N     . GLU D 1 30  ? 1.662   9.544   -48.095 1.00 38.17  ? 106 GLU D N     1 
ATOM   6282 C  CA    . GLU D 1 30  ? 0.290   9.541   -48.568 1.00 42.70  ? 106 GLU D CA    1 
ATOM   6283 C  C     . GLU D 1 30  ? 0.211   9.983   -50.032 1.00 39.39  ? 106 GLU D C     1 
ATOM   6284 O  O     . GLU D 1 30  ? -0.405  9.307   -50.859 1.00 44.67  ? 106 GLU D O     1 
ATOM   6285 C  CB    . GLU D 1 30  ? -0.557  10.439  -47.657 1.00 36.32  ? 106 GLU D CB    1 
ATOM   6286 C  CG    . GLU D 1 30  ? -2.032  10.388  -47.916 1.00 40.66  ? 106 GLU D CG    1 
ATOM   6287 C  CD    . GLU D 1 30  ? -2.789  11.453  -47.121 1.00 60.25  ? 106 GLU D CD    1 
ATOM   6288 O  OE1   . GLU D 1 30  ? -2.220  11.993  -46.133 1.00 55.67  ? 106 GLU D OE1   1 
ATOM   6289 O  OE2   . GLU D 1 30  ? -3.949  11.753  -47.495 1.00 54.71  ? 106 GLU D OE2   1 
ATOM   6290 N  N     . GLU D 1 31  ? 0.858   11.104  -50.349 1.00 37.91  ? 107 GLU D N     1 
ATOM   6291 C  CA    . GLU D 1 31  ? 0.906   11.631  -51.713 1.00 32.44  ? 107 GLU D CA    1 
ATOM   6292 C  C     . GLU D 1 31  ? 1.589   10.669  -52.704 1.00 36.70  ? 107 GLU D C     1 
ATOM   6293 O  O     . GLU D 1 31  ? 1.144   10.509  -53.840 1.00 35.67  ? 107 GLU D O     1 
ATOM   6294 C  CB    . GLU D 1 31  ? 1.631   12.985  -51.730 1.00 33.76  ? 107 GLU D CB    1 
ATOM   6295 C  CG    . GLU D 1 31  ? 0.898   14.126  -51.019 1.00 33.42  ? 107 GLU D CG    1 
ATOM   6296 C  CD    . GLU D 1 31  ? 1.147   14.168  -49.502 1.00 41.50  ? 107 GLU D CD    1 
ATOM   6297 O  OE1   . GLU D 1 31  ? 1.601   13.155  -48.921 1.00 40.30  ? 107 GLU D OE1   1 
ATOM   6298 O  OE2   . GLU D 1 31  ? 0.881   15.228  -48.885 1.00 45.89  ? 107 GLU D OE2   1 
ATOM   6299 N  N     . LEU D 1 32  ? 2.671   10.038  -52.263 1.00 32.76  ? 108 LEU D N     1 
ATOM   6300 C  CA    . LEU D 1 32  ? 3.356   9.032   -53.059 1.00 37.53  ? 108 LEU D CA    1 
ATOM   6301 C  C     . LEU D 1 32  ? 2.420   7.905   -53.499 1.00 42.09  ? 108 LEU D C     1 
ATOM   6302 O  O     . LEU D 1 32  ? 2.497   7.459   -54.633 1.00 40.72  ? 108 LEU D O     1 
ATOM   6303 C  CB    . LEU D 1 32  ? 4.545   8.458   -52.293 1.00 31.99  ? 108 LEU D CB    1 
ATOM   6304 C  CG    . LEU D 1 32  ? 5.492   7.584   -53.121 1.00 39.23  ? 108 LEU D CG    1 
ATOM   6305 C  CD1   . LEU D 1 32  ? 6.062   8.386   -54.283 1.00 31.10  ? 108 LEU D CD1   1 
ATOM   6306 C  CD2   . LEU D 1 32  ? 6.617   7.033   -52.254 1.00 36.20  ? 108 LEU D CD2   1 
ATOM   6307 N  N     . LEU D 1 33  ? 1.533   7.460   -52.607 1.00 42.18  ? 109 LEU D N     1 
ATOM   6308 C  CA    . LEU D 1 33  ? 0.584   6.379   -52.917 1.00 44.63  ? 109 LEU D CA    1 
ATOM   6309 C  C     . LEU D 1 33  ? -0.347  6.735   -54.089 1.00 43.50  ? 109 LEU D C     1 
ATOM   6310 O  O     . LEU D 1 33  ? -0.782  5.859   -54.831 1.00 42.58  ? 109 LEU D O     1 
ATOM   6311 C  CB    . LEU D 1 33  ? -0.267  6.046   -51.687 1.00 40.20  ? 109 LEU D CB    1 
ATOM   6312 C  CG    . LEU D 1 33  ? 0.014   4.866   -50.754 1.00 50.04  ? 109 LEU D CG    1 
ATOM   6313 C  CD1   . LEU D 1 33  ? 1.485   4.522   -50.626 1.00 47.00  ? 109 LEU D CD1   1 
ATOM   6314 C  CD2   . LEU D 1 33  ? -0.608  5.140   -49.368 1.00 45.68  ? 109 LEU D CD2   1 
ATOM   6315 N  N     . VAL D 1 34  ? -0.670  8.016   -54.230 1.00 39.41  ? 110 VAL D N     1 
ATOM   6316 C  CA    . VAL D 1 34  ? -1.474  8.479   -55.356 1.00 41.44  ? 110 VAL D CA    1 
ATOM   6317 C  C     . VAL D 1 34  ? -0.601  8.737   -56.584 1.00 43.90  ? 110 VAL D C     1 
ATOM   6318 O  O     . VAL D 1 34  ? -1.026  8.488   -57.710 1.00 42.90  ? 110 VAL D O     1 
ATOM   6319 C  CB    . VAL D 1 34  ? -2.213  9.793   -55.043 1.00 43.41  ? 110 VAL D CB    1 
ATOM   6320 C  CG1   . VAL D 1 34  ? -3.140  10.160  -56.198 1.00 40.21  ? 110 VAL D CG1   1 
ATOM   6321 C  CG2   . VAL D 1 34  ? -2.994  9.682   -53.733 1.00 44.65  ? 110 VAL D CG2   1 
ATOM   6322 N  N     . PHE D 1 35  ? 0.621   9.220   -56.352 1.00 41.19  ? 111 PHE D N     1 
ATOM   6323 C  CA    . PHE D 1 35  ? 1.449   9.800   -57.414 1.00 41.29  ? 111 PHE D CA    1 
ATOM   6324 C  C     . PHE D 1 35  ? 1.962   8.742   -58.379 1.00 47.48  ? 111 PHE D C     1 
ATOM   6325 O  O     . PHE D 1 35  ? 1.888   8.920   -59.601 1.00 40.46  ? 111 PHE D O     1 
ATOM   6326 C  CB    . PHE D 1 35  ? 2.635   10.576  -56.827 1.00 33.94  ? 111 PHE D CB    1 
ATOM   6327 C  CG    . PHE D 1 35  ? 3.581   11.151  -57.878 1.00 41.26  ? 111 PHE D CG    1 
ATOM   6328 C  CD1   . PHE D 1 35  ? 4.661   10.410  -58.354 1.00 34.14  ? 111 PHE D CD1   1 
ATOM   6329 C  CD2   . PHE D 1 35  ? 3.394   12.434  -58.371 1.00 37.59  ? 111 PHE D CD2   1 
ATOM   6330 C  CE1   . PHE D 1 35  ? 5.521   10.935  -59.313 1.00 44.34  ? 111 PHE D CE1   1 
ATOM   6331 C  CE2   . PHE D 1 35  ? 4.256   12.969  -59.333 1.00 36.28  ? 111 PHE D CE2   1 
ATOM   6332 C  CZ    . PHE D 1 35  ? 5.318   12.224  -59.801 1.00 39.97  ? 111 PHE D CZ    1 
ATOM   6333 N  N     . VAL D 1 36  ? 2.490   7.651   -57.821 1.00 41.68  ? 112 VAL D N     1 
ATOM   6334 C  CA    . VAL D 1 36  ? 3.076   6.603   -58.632 1.00 38.53  ? 112 VAL D CA    1 
ATOM   6335 C  C     . VAL D 1 36  ? 2.058   5.948   -59.577 1.00 43.17  ? 112 VAL D C     1 
ATOM   6336 O  O     . VAL D 1 36  ? 2.270   5.951   -60.781 1.00 39.43  ? 112 VAL D O     1 
ATOM   6337 C  CB    . VAL D 1 36  ? 3.851   5.585   -57.793 1.00 43.40  ? 112 VAL D CB    1 
ATOM   6338 C  CG1   . VAL D 1 36  ? 4.505   4.551   -58.696 1.00 42.04  ? 112 VAL D CG1   1 
ATOM   6339 C  CG2   . VAL D 1 36  ? 4.892   6.297   -56.966 1.00 34.34  ? 112 VAL D CG2   1 
ATOM   6340 N  N     . PRO D 1 37  ? 0.939   5.411   -59.054 1.00 47.16  ? 113 PRO D N     1 
ATOM   6341 C  CA    . PRO D 1 37  ? 0.025   4.890   -60.079 1.00 46.89  ? 113 PRO D CA    1 
ATOM   6342 C  C     . PRO D 1 37  ? -0.565  5.949   -61.007 1.00 39.35  ? 113 PRO D C     1 
ATOM   6343 O  O     . PRO D 1 37  ? -0.811  5.634   -62.166 1.00 42.65  ? 113 PRO D O     1 
ATOM   6344 C  CB    . PRO D 1 37  ? -1.081  4.194   -59.266 1.00 41.17  ? 113 PRO D CB    1 
ATOM   6345 C  CG    . PRO D 1 37  ? -0.876  4.601   -57.872 1.00 42.12  ? 113 PRO D CG    1 
ATOM   6346 C  CD    . PRO D 1 37  ? 0.575   4.924   -57.718 1.00 41.88  ? 113 PRO D CD    1 
ATOM   6347 N  N     . HIS D 1 38  ? -0.775  7.175   -60.531 1.00 47.65  ? 114 HIS D N     1 
ATOM   6348 C  CA    . HIS D 1 38  ? -1.356  8.202   -61.394 1.00 36.73  ? 114 HIS D CA    1 
ATOM   6349 C  C     . HIS D 1 38  ? -0.452  8.464   -62.593 1.00 39.13  ? 114 HIS D C     1 
ATOM   6350 O  O     . HIS D 1 38  ? -0.922  8.553   -63.728 1.00 39.03  ? 114 HIS D O     1 
ATOM   6351 C  CB    . HIS D 1 38  ? -1.608  9.511   -60.642 1.00 38.58  ? 114 HIS D CB    1 
ATOM   6352 C  CG    . HIS D 1 38  ? -2.179  10.595  -61.507 1.00 38.36  ? 114 HIS D CG    1 
ATOM   6353 N  ND1   . HIS D 1 38  ? -3.514  10.947  -61.481 1.00 40.68  ? 114 HIS D ND1   1 
ATOM   6354 C  CD2   . HIS D 1 38  ? -1.601  11.387  -62.442 1.00 38.51  ? 114 HIS D CD2   1 
ATOM   6355 C  CE1   . HIS D 1 38  ? -3.731  11.910  -62.358 1.00 43.48  ? 114 HIS D CE1   1 
ATOM   6356 N  NE2   . HIS D 1 38  ? -2.587  12.198  -62.953 1.00 45.60  ? 114 HIS D NE2   1 
ATOM   6357 N  N     . MET D 1 39  ? 0.845   8.591   -62.332 1.00 36.58  ? 115 MET D N     1 
ATOM   6358 C  CA    . MET D 1 39  ? 1.800   8.927   -63.378 1.00 39.85  ? 115 MET D CA    1 
ATOM   6359 C  C     . MET D 1 39  ? 2.071   7.744   -64.320 1.00 47.17  ? 115 MET D C     1 
ATOM   6360 O  O     . MET D 1 39  ? 2.219   7.935   -65.537 1.00 40.31  ? 115 MET D O     1 
ATOM   6361 C  CB    . MET D 1 39  ? 3.106   9.476   -62.779 1.00 40.29  ? 115 MET D CB    1 
ATOM   6362 C  CG    . MET D 1 39  ? 2.946   10.800  -62.036 1.00 40.78  ? 115 MET D CG    1 
ATOM   6363 S  SD    . MET D 1 39  ? 2.121   12.048  -63.039 1.00 41.88  ? 115 MET D SD    1 
ATOM   6364 C  CE    . MET D 1 39  ? 3.328   12.258  -64.351 1.00 38.96  ? 115 MET D CE    1 
ATOM   6365 N  N     . ARG D 1 40  ? 2.118   6.524   -63.783 1.00 47.46  ? 116 ARG D N     1 
ATOM   6366 C  CA    . ARG D 1 40  ? 2.267   5.374   -64.671 1.00 41.57  ? 116 ARG D CA    1 
ATOM   6367 C  C     . ARG D 1 40  ? 1.125   5.308   -65.680 1.00 46.74  ? 116 ARG D C     1 
ATOM   6368 O  O     . ARG D 1 40  ? 1.363   5.207   -66.880 1.00 48.52  ? 116 ARG D O     1 
ATOM   6369 C  CB    . ARG D 1 40  ? 2.421   4.046   -63.943 1.00 41.68  ? 116 ARG D CB    1 
ATOM   6370 C  CG    . ARG D 1 40  ? 3.038   2.997   -64.878 1.00 49.53  ? 116 ARG D CG    1 
ATOM   6371 C  CD    . ARG D 1 40  ? 2.768   1.582   -64.450 1.00 53.54  ? 116 ARG D CD    1 
ATOM   6372 N  NE    . ARG D 1 40  ? 1.364   1.374   -64.125 1.00 58.39  ? 116 ARG D NE    1 
ATOM   6373 C  CZ    . ARG D 1 40  ? 0.843   0.185   -63.843 1.00 61.70  ? 116 ARG D CZ    1 
ATOM   6374 N  NH1   . ARG D 1 40  ? 1.616   -0.892  -63.879 1.00 58.31  ? 116 ARG D NH1   1 
ATOM   6375 N  NH2   . ARG D 1 40  ? -0.445  0.074   -63.540 1.00 63.79  ? 116 ARG D NH2   1 
ATOM   6376 N  N     . ARG D 1 41  ? -0.109  5.402   -65.205 1.00 43.29  ? 117 ARG D N     1 
ATOM   6377 C  CA    . ARG D 1 41  ? -1.251  5.418   -66.116 1.00 48.04  ? 117 ARG D CA    1 
ATOM   6378 C  C     . ARG D 1 41  ? -1.169  6.585   -67.131 1.00 57.15  ? 117 ARG D C     1 
ATOM   6379 O  O     . ARG D 1 41  ? -1.438  6.409   -68.320 1.00 54.01  ? 117 ARG D O     1 
ATOM   6380 C  CB    . ARG D 1 41  ? -2.554  5.501   -65.323 1.00 46.17  ? 117 ARG D CB    1 
ATOM   6381 C  CG    . ARG D 1 41  ? -3.716  4.798   -65.980 1.00 57.98  ? 117 ARG D CG    1 
ATOM   6382 C  CD    . ARG D 1 41  ? -5.039  5.283   -65.411 1.00 65.76  ? 117 ARG D CD    1 
ATOM   6383 N  NE    . ARG D 1 41  ? -5.506  6.484   -66.100 1.00 76.38  ? 117 ARG D NE    1 
ATOM   6384 C  CZ    . ARG D 1 41  ? -6.426  6.488   -67.063 1.00 77.88  ? 117 ARG D CZ    1 
ATOM   6385 N  NH1   . ARG D 1 41  ? -6.995  5.348   -67.450 1.00 71.82  ? 117 ARG D NH1   1 
ATOM   6386 N  NH2   . ARG D 1 41  ? -6.780  7.636   -67.637 1.00 71.35  ? 117 ARG D NH2   1 
ATOM   6387 N  N     . PHE D 1 42  ? -0.780  7.768   -66.654 1.00 49.64  ? 118 PHE D N     1 
ATOM   6388 C  CA    . PHE D 1 42  ? -0.797  8.978   -67.473 1.00 48.77  ? 118 PHE D CA    1 
ATOM   6389 C  C     . PHE D 1 42  ? 0.237   8.915   -68.599 1.00 46.50  ? 118 PHE D C     1 
ATOM   6390 O  O     . PHE D 1 42  ? -0.077  9.159   -69.764 1.00 40.33  ? 118 PHE D O     1 
ATOM   6391 C  CB    . PHE D 1 42  ? -0.570  10.219  -66.592 1.00 46.10  ? 118 PHE D CB    1 
ATOM   6392 C  CG    . PHE D 1 42  ? -0.533  11.522  -67.355 1.00 44.66  ? 118 PHE D CG    1 
ATOM   6393 C  CD1   . PHE D 1 42  ? -1.693  12.247  -67.566 1.00 45.58  ? 118 PHE D CD1   1 
ATOM   6394 C  CD2   . PHE D 1 42  ? 0.667   12.025  -67.842 1.00 43.40  ? 118 PHE D CD2   1 
ATOM   6395 C  CE1   . PHE D 1 42  ? -1.663  13.451  -68.264 1.00 52.81  ? 118 PHE D CE1   1 
ATOM   6396 C  CE2   . PHE D 1 42  ? 0.709   13.222  -68.535 1.00 46.20  ? 118 PHE D CE2   1 
ATOM   6397 C  CZ    . PHE D 1 42  ? -0.458  13.938  -68.752 1.00 46.85  ? 118 PHE D CZ    1 
ATOM   6398 N  N     . LEU D 1 43  ? 1.472   8.598   -68.232 1.00 43.32  ? 119 LEU D N     1 
ATOM   6399 C  CA    . LEU D 1 43  ? 2.543   8.474   -69.194 1.00 41.81  ? 119 LEU D CA    1 
ATOM   6400 C  C     . LEU D 1 43  ? 2.369   7.217   -70.078 1.00 56.39  ? 119 LEU D C     1 
ATOM   6401 O  O     . LEU D 1 43  ? 2.686   7.247   -71.269 1.00 50.87  ? 119 LEU D O     1 
ATOM   6402 C  CB    . LEU D 1 43  ? 3.897   8.458   -68.471 1.00 44.97  ? 119 LEU D CB    1 
ATOM   6403 C  CG    . LEU D 1 43  ? 4.274   9.751   -67.745 1.00 44.72  ? 119 LEU D CG    1 
ATOM   6404 C  CD1   . LEU D 1 43  ? 5.383   9.497   -66.730 1.00 43.40  ? 119 LEU D CD1   1 
ATOM   6405 C  CD2   . LEU D 1 43  ? 4.700   10.839  -68.740 1.00 34.56  ? 119 LEU D CD2   1 
ATOM   6406 N  N     . SER D 1 44  ? 1.864   6.120   -69.510 1.00 50.55  ? 120 SER D N     1 
ATOM   6407 C  CA    . SER D 1 44  ? 1.653   4.908   -70.307 1.00 55.39  ? 120 SER D CA    1 
ATOM   6408 C  C     . SER D 1 44  ? 0.624   5.110   -71.418 1.00 54.04  ? 120 SER D C     1 
ATOM   6409 O  O     . SER D 1 44  ? 0.791   4.593   -72.517 1.00 48.30  ? 120 SER D O     1 
ATOM   6410 C  CB    . SER D 1 44  ? 1.266   3.713   -69.433 1.00 49.20  ? 120 SER D CB    1 
ATOM   6411 O  OG    . SER D 1 44  ? 2.392   3.240   -68.712 1.00 53.05  ? 120 SER D OG    1 
ATOM   6412 N  N     . ARG D 1 45  ? -0.433  5.864   -71.133 1.00 47.64  ? 121 ARG D N     1 
ATOM   6413 C  CA    . ARG D 1 45  ? -1.444  6.143   -72.146 1.00 52.57  ? 121 ARG D CA    1 
ATOM   6414 C  C     . ARG D 1 45  ? -0.896  7.033   -73.266 1.00 62.41  ? 121 ARG D C     1 
ATOM   6415 O  O     . ARG D 1 45  ? -1.461  7.074   -74.361 1.00 59.47  ? 121 ARG D O     1 
ATOM   6416 C  CB    . ARG D 1 45  ? -2.675  6.796   -71.524 1.00 54.13  ? 121 ARG D CB    1 
ATOM   6417 C  CG    . ARG D 1 45  ? -3.527  5.845   -70.716 1.00 62.45  ? 121 ARG D CG    1 
ATOM   6418 C  CD    . ARG D 1 45  ? -4.617  6.588   -69.972 1.00 66.00  ? 121 ARG D CD    1 
ATOM   6419 N  NE    . ARG D 1 45  ? -5.401  7.439   -70.863 1.00 72.62  ? 121 ARG D NE    1 
ATOM   6420 C  CZ    . ARG D 1 45  ? -6.573  7.095   -71.387 1.00 83.52  ? 121 ARG D CZ    1 
ATOM   6421 N  NH1   . ARG D 1 45  ? -7.103  5.908   -71.107 1.00 79.97  ? 121 ARG D NH1   1 
ATOM   6422 N  NH2   . ARG D 1 45  ? -7.215  7.938   -72.190 1.00 81.99  ? 121 ARG D NH2   1 
ATOM   6423 N  N     . LYS D 1 46  ? 0.194   7.747   -72.982 1.00 52.23  ? 122 LYS D N     1 
ATOM   6424 C  CA    . LYS D 1 46  ? 0.860   8.582   -73.976 1.00 55.02  ? 122 LYS D CA    1 
ATOM   6425 C  C     . LYS D 1 46  ? 2.012   7.820   -74.635 1.00 58.16  ? 122 LYS D C     1 
ATOM   6426 O  O     . LYS D 1 46  ? 2.742   8.370   -75.458 1.00 67.09  ? 122 LYS D O     1 
ATOM   6427 C  CB    . LYS D 1 46  ? 1.360   9.887   -73.337 1.00 51.59  ? 122 LYS D CB    1 
ATOM   6428 C  CG    . LYS D 1 46  ? 0.231   10.757  -72.797 1.00 53.11  ? 122 LYS D CG    1 
ATOM   6429 C  CD    . LYS D 1 46  ? 0.725   11.798  -71.808 1.00 52.25  ? 122 LYS D CD    1 
ATOM   6430 C  CE    . LYS D 1 46  ? 1.204   13.059  -72.493 1.00 46.44  ? 122 LYS D CE    1 
ATOM   6431 N  NZ    . LYS D 1 46  ? 0.071   13.841  -73.051 1.00 46.04  ? 122 LYS D NZ    1 
ATOM   6432 N  N     . LYS D 1 47  ? 2.150   6.548   -74.269 1.00 55.47  ? 123 LYS D N     1 
ATOM   6433 C  CA    . LYS D 1 47  ? 3.227   5.683   -74.748 1.00 61.95  ? 123 LYS D CA    1 
ATOM   6434 C  C     . LYS D 1 47  ? 4.618   6.284   -74.558 1.00 58.67  ? 123 LYS D C     1 
ATOM   6435 O  O     . LYS D 1 47  ? 5.460   6.245   -75.458 1.00 58.22  ? 123 LYS D O     1 
ATOM   6436 C  CB    . LYS D 1 47  ? 3.001   5.259   -76.203 1.00 66.75  ? 123 LYS D CB    1 
ATOM   6437 C  CG    . LYS D 1 47  ? 1.781   4.365   -76.402 1.00 69.23  ? 123 LYS D CG    1 
ATOM   6438 C  CD    . LYS D 1 47  ? 1.682   3.866   -77.836 1.00 74.70  ? 123 LYS D CD    1 
ATOM   6439 C  CE    . LYS D 1 47  ? 0.503   2.921   -78.021 1.00 77.85  ? 123 LYS D CE    1 
ATOM   6440 N  NZ    . LYS D 1 47  ? 0.581   2.184   -79.318 1.00 83.92  ? 123 LYS D NZ    1 
ATOM   6441 N  N     . ILE D 1 48  ? 4.860   6.824   -73.370 1.00 47.89  ? 124 ILE D N     1 
ATOM   6442 C  CA    . ILE D 1 48  ? 6.176   7.356   -73.043 1.00 51.44  ? 124 ILE D CA    1 
ATOM   6443 C  C     . ILE D 1 48  ? 6.953   6.406   -72.141 1.00 41.41  ? 124 ILE D C     1 
ATOM   6444 O  O     . ILE D 1 48  ? 6.523   6.086   -71.041 1.00 51.53  ? 124 ILE D O     1 
ATOM   6445 C  CB    . ILE D 1 48  ? 6.073   8.739   -72.359 1.00 46.46  ? 124 ILE D CB    1 
ATOM   6446 C  CG1   . ILE D 1 48  ? 5.421   9.748   -73.303 1.00 49.75  ? 124 ILE D CG1   1 
ATOM   6447 C  CG2   . ILE D 1 48  ? 7.445   9.210   -71.884 1.00 41.94  ? 124 ILE D CG2   1 
ATOM   6448 C  CD1   . ILE D 1 48  ? 4.860   10.971  -72.600 1.00 52.82  ? 124 ILE D CD1   1 
ATOM   6449 N  N     . ARG D 1 49  ? 8.104   5.962   -72.605 1.00 45.59  ? 125 ARG D N     1 
ATOM   6450 C  CA    . ARG D 1 49  ? 8.970   5.159   -71.769 1.00 48.42  ? 125 ARG D CA    1 
ATOM   6451 C  C     . ARG D 1 49  ? 9.467   6.002   -70.613 1.00 45.00  ? 125 ARG D C     1 
ATOM   6452 O  O     . ARG D 1 49  ? 9.944   7.119   -70.812 1.00 52.48  ? 125 ARG D O     1 
ATOM   6453 C  CB    . ARG D 1 49  ? 10.151  4.626   -72.572 1.00 53.14  ? 125 ARG D CB    1 
ATOM   6454 C  CG    . ARG D 1 49  ? 9.743   3.767   -73.749 1.00 61.68  ? 125 ARG D CG    1 
ATOM   6455 C  CD    . ARG D 1 49  ? 10.941  3.245   -74.530 1.00 61.60  ? 125 ARG D CD    1 
ATOM   6456 N  NE    . ARG D 1 49  ? 10.503  2.754   -75.829 1.00 67.29  ? 125 ARG D NE    1 
ATOM   6457 C  CZ    . ARG D 1 49  ? 10.177  1.492   -76.080 1.00 66.93  ? 125 ARG D CZ    1 
ATOM   6458 N  NH1   . ARG D 1 49  ? 10.262  0.583   -75.122 1.00 68.13  ? 125 ARG D NH1   1 
ATOM   6459 N  NH2   . ARG D 1 49  ? 9.765   1.144   -77.290 1.00 70.06  ? 125 ARG D NH2   1 
ATOM   6460 N  N     . HIS D 1 50  ? 9.378   5.451   -69.410 1.00 40.99  ? 126 HIS D N     1 
ATOM   6461 C  CA    . HIS D 1 50  ? 9.732   6.187   -68.210 1.00 49.05  ? 126 HIS D CA    1 
ATOM   6462 C  C     . HIS D 1 50  ? 10.070  5.293   -67.009 1.00 53.13  ? 126 HIS D C     1 
ATOM   6463 O  O     . HIS D 1 50  ? 9.654   4.135   -66.926 1.00 49.85  ? 126 HIS D O     1 
ATOM   6464 C  CB    . HIS D 1 50  ? 8.572   7.100   -67.823 1.00 42.96  ? 126 HIS D CB    1 
ATOM   6465 C  CG    . HIS D 1 50  ? 7.344   6.354   -67.395 1.00 56.38  ? 126 HIS D CG    1 
ATOM   6466 N  ND1   . HIS D 1 50  ? 6.368   5.950   -68.283 1.00 53.43  ? 126 HIS D ND1   1 
ATOM   6467 C  CD2   . HIS D 1 50  ? 6.935   5.932   -66.173 1.00 44.81  ? 126 HIS D CD2   1 
ATOM   6468 C  CE1   . HIS D 1 50  ? 5.407   5.329   -67.626 1.00 43.55  ? 126 HIS D CE1   1 
ATOM   6469 N  NE2   . HIS D 1 50  ? 5.726   5.302   -66.345 1.00 44.26  ? 126 HIS D NE2   1 
ATOM   6470 N  N     . HIS D 1 51  ? 10.835  5.853   -66.083 1.00 45.50  ? 127 HIS D N     1 
ATOM   6471 C  CA    . HIS D 1 51  ? 10.982  5.282   -64.760 1.00 43.72  ? 127 HIS D CA    1 
ATOM   6472 C  C     . HIS D 1 51  ? 10.825  6.401   -63.700 1.00 46.18  ? 127 HIS D C     1 
ATOM   6473 O  O     . HIS D 1 51  ? 11.310  7.525   -63.878 1.00 39.89  ? 127 HIS D O     1 
ATOM   6474 C  CB    . HIS D 1 51  ? 12.324  4.571   -64.626 1.00 36.77  ? 127 HIS D CB    1 
ATOM   6475 C  CG    . HIS D 1 51  ? 12.467  3.795   -63.356 1.00 39.94  ? 127 HIS D CG    1 
ATOM   6476 N  ND1   . HIS D 1 51  ? 11.694  2.687   -63.072 1.00 46.94  ? 127 HIS D ND1   1 
ATOM   6477 C  CD2   . HIS D 1 51  ? 13.287  3.966   -62.293 1.00 43.10  ? 127 HIS D CD2   1 
ATOM   6478 C  CE1   . HIS D 1 51  ? 12.030  2.211   -61.884 1.00 41.58  ? 127 HIS D CE1   1 
ATOM   6479 N  NE2   . HIS D 1 51  ? 12.999  2.963   -61.393 1.00 49.22  ? 127 HIS D NE2   1 
ATOM   6480 N  N     . ILE D 1 52  ? 10.143  6.094   -62.603 1.00 42.35  ? 128 ILE D N     1 
ATOM   6481 C  CA    . ILE D 1 52  ? 9.934   7.075   -61.534 1.00 35.18  ? 128 ILE D CA    1 
ATOM   6482 C  C     . ILE D 1 52  ? 10.972  6.939   -60.425 1.00 37.42  ? 128 ILE D C     1 
ATOM   6483 O  O     . ILE D 1 52  ? 11.074  5.886   -59.792 1.00 40.26  ? 128 ILE D O     1 
ATOM   6484 C  CB    . ILE D 1 52  ? 8.515   6.971   -60.952 1.00 35.03  ? 128 ILE D CB    1 
ATOM   6485 C  CG1   . ILE D 1 52  ? 7.472   7.195   -62.058 1.00 32.28  ? 128 ILE D CG1   1 
ATOM   6486 C  CG2   . ILE D 1 52  ? 8.329   7.962   -59.804 1.00 31.48  ? 128 ILE D CG2   1 
ATOM   6487 C  CD1   . ILE D 1 52  ? 6.061   6.899   -61.639 1.00 36.75  ? 128 ILE D CD1   1 
ATOM   6488 N  N     . TYR D 1 53  ? 11.748  7.999   -60.204 1.00 38.35  ? 129 TYR D N     1 
ATOM   6489 C  CA    . TYR D 1 53  ? 12.751  8.034   -59.136 1.00 36.73  ? 129 TYR D CA    1 
ATOM   6490 C  C     . TYR D 1 53  ? 12.297  8.887   -57.920 1.00 38.33  ? 129 TYR D C     1 
ATOM   6491 O  O     . TYR D 1 53  ? 12.173  10.106  -58.009 1.00 33.26  ? 129 TYR D O     1 
ATOM   6492 C  CB    . TYR D 1 53  ? 14.086  8.568   -59.669 1.00 37.28  ? 129 TYR D CB    1 
ATOM   6493 C  CG    . TYR D 1 53  ? 14.737  7.704   -60.711 1.00 40.98  ? 129 TYR D CG    1 
ATOM   6494 C  CD1   . TYR D 1 53  ? 14.313  7.740   -62.039 1.00 40.62  ? 129 TYR D CD1   1 
ATOM   6495 C  CD2   . TYR D 1 53  ? 15.778  6.844   -60.372 1.00 42.31  ? 129 TYR D CD2   1 
ATOM   6496 C  CE1   . TYR D 1 53  ? 14.909  6.938   -63.004 1.00 43.39  ? 129 TYR D CE1   1 
ATOM   6497 C  CE2   . TYR D 1 53  ? 16.385  6.041   -61.329 1.00 40.38  ? 129 TYR D CE2   1 
ATOM   6498 C  CZ    . TYR D 1 53  ? 15.944  6.098   -62.643 1.00 42.46  ? 129 TYR D CZ    1 
ATOM   6499 O  OH    . TYR D 1 53  ? 16.528  5.302   -63.591 1.00 54.98  ? 129 TYR D OH    1 
ATOM   6500 N  N     . VAL D 1 54  ? 12.076  8.241   -56.784 1.00 40.64  ? 130 VAL D N     1 
ATOM   6501 C  CA    . VAL D 1 54  ? 11.695  8.939   -55.552 1.00 38.61  ? 130 VAL D CA    1 
ATOM   6502 C  C     . VAL D 1 54  ? 12.945  9.388   -54.799 1.00 38.16  ? 130 VAL D C     1 
ATOM   6503 O  O     . VAL D 1 54  ? 13.695  8.558   -54.262 1.00 38.18  ? 130 VAL D O     1 
ATOM   6504 C  CB    . VAL D 1 54  ? 10.848  8.020   -54.625 1.00 36.25  ? 130 VAL D CB    1 
ATOM   6505 C  CG1   . VAL D 1 54  ? 10.385  8.788   -53.393 1.00 38.65  ? 130 VAL D CG1   1 
ATOM   6506 C  CG2   . VAL D 1 54  ? 9.666   7.434   -55.382 1.00 29.20  ? 130 VAL D CG2   1 
ATOM   6507 N  N     . LEU D 1 55  ? 13.172  10.698  -54.760 1.00 34.27  ? 131 LEU D N     1 
ATOM   6508 C  CA    . LEU D 1 55  ? 14.428  11.233  -54.250 1.00 32.19  ? 131 LEU D CA    1 
ATOM   6509 C  C     . LEU D 1 55  ? 14.289  11.644  -52.785 1.00 40.74  ? 131 LEU D C     1 
ATOM   6510 O  O     . LEU D 1 55  ? 14.088  12.822  -52.447 1.00 42.69  ? 131 LEU D O     1 
ATOM   6511 C  CB    . LEU D 1 55  ? 14.910  12.388  -55.133 1.00 35.33  ? 131 LEU D CB    1 
ATOM   6512 C  CG    . LEU D 1 55  ? 14.967  12.013  -56.622 1.00 37.50  ? 131 LEU D CG    1 
ATOM   6513 C  CD1   . LEU D 1 55  ? 15.224  13.227  -57.531 1.00 38.60  ? 131 LEU D CD1   1 
ATOM   6514 C  CD2   . LEU D 1 55  ? 16.006  10.932  -56.862 1.00 43.20  ? 131 LEU D CD2   1 
ATOM   6515 N  N     . ASN D 1 56  ? 14.415  10.645  -51.921 1.00 40.33  ? 132 ASN D N     1 
ATOM   6516 C  CA    . ASN D 1 56  ? 14.101  10.767  -50.511 1.00 38.33  ? 132 ASN D CA    1 
ATOM   6517 C  C     . ASN D 1 56  ? 15.237  11.368  -49.685 1.00 43.83  ? 132 ASN D C     1 
ATOM   6518 O  O     . ASN D 1 56  ? 16.253  10.721  -49.464 1.00 44.50  ? 132 ASN D O     1 
ATOM   6519 C  CB    . ASN D 1 56  ? 13.752  9.388   -49.990 1.00 38.59  ? 132 ASN D CB    1 
ATOM   6520 C  CG    . ASN D 1 56  ? 13.115  9.417   -48.632 1.00 42.66  ? 132 ASN D CG    1 
ATOM   6521 O  OD1   . ASN D 1 56  ? 12.392  10.355  -48.282 1.00 40.45  ? 132 ASN D OD1   1 
ATOM   6522 N  ND2   . ASN D 1 56  ? 13.358  8.370   -47.858 1.00 42.62  ? 132 ASN D ND2   1 
ATOM   6523 N  N     . GLN D 1 57  ? 15.070  12.604  -49.218 1.00 39.03  ? 133 GLN D N     1 
ATOM   6524 C  CA    . GLN D 1 57  ? 16.138  13.238  -48.456 1.00 42.24  ? 133 GLN D CA    1 
ATOM   6525 C  C     . GLN D 1 57  ? 16.148  12.685  -47.038 1.00 39.27  ? 133 GLN D C     1 
ATOM   6526 O  O     . GLN D 1 57  ? 15.270  13.012  -46.250 1.00 44.56  ? 133 GLN D O     1 
ATOM   6527 C  CB    . GLN D 1 57  ? 15.958  14.754  -48.439 1.00 36.80  ? 133 GLN D CB    1 
ATOM   6528 C  CG    . GLN D 1 57  ? 17.146  15.535  -47.872 1.00 43.86  ? 133 GLN D CG    1 
ATOM   6529 C  CD    . GLN D 1 57  ? 16.944  17.055  -47.959 1.00 41.73  ? 133 GLN D CD    1 
ATOM   6530 O  OE1   . GLN D 1 57  ? 16.095  17.530  -48.705 1.00 38.01  ? 133 GLN D OE1   1 
ATOM   6531 N  NE2   . GLN D 1 57  ? 17.719  17.807  -47.189 1.00 41.28  ? 133 GLN D NE2   1 
ATOM   6532 N  N     . VAL D 1 58  ? 17.135  11.856  -46.703 1.00 37.95  ? 134 VAL D N     1 
ATOM   6533 C  CA    . VAL D 1 58  ? 17.106  11.182  -45.399 1.00 41.81  ? 134 VAL D CA    1 
ATOM   6534 C  C     . VAL D 1 58  ? 18.057  11.792  -44.375 1.00 46.02  ? 134 VAL D C     1 
ATOM   6535 O  O     . VAL D 1 58  ? 18.085  11.377  -43.209 1.00 48.84  ? 134 VAL D O     1 
ATOM   6536 C  CB    . VAL D 1 58  ? 17.281  9.645   -45.505 1.00 37.38  ? 134 VAL D CB    1 
ATOM   6537 C  CG1   . VAL D 1 58  ? 16.154  9.065   -46.332 1.00 41.84  ? 134 VAL D CG1   1 
ATOM   6538 C  CG2   . VAL D 1 58  ? 18.642  9.274   -46.111 1.00 34.68  ? 134 VAL D CG2   1 
ATOM   6539 N  N     . ASP D 1 59  ? 18.812  12.796  -44.810 1.00 47.70  ? 135 ASP D N     1 
ATOM   6540 C  CA    . ASP D 1 59  ? 19.620  13.595  -43.896 1.00 39.64  ? 135 ASP D CA    1 
ATOM   6541 C  C     . ASP D 1 59  ? 18.689  14.451  -43.081 1.00 42.84  ? 135 ASP D C     1 
ATOM   6542 O  O     . ASP D 1 59  ? 17.522  14.600  -43.429 1.00 47.46  ? 135 ASP D O     1 
ATOM   6543 C  CB    . ASP D 1 59  ? 20.609  14.477  -44.662 1.00 49.22  ? 135 ASP D CB    1 
ATOM   6544 C  CG    . ASP D 1 59  ? 19.929  15.371  -45.684 1.00 47.72  ? 135 ASP D CG    1 
ATOM   6545 O  OD1   . ASP D 1 59  ? 19.239  16.331  -45.271 1.00 52.12  ? 135 ASP D OD1   1 
ATOM   6546 O  OD2   . ASP D 1 59  ? 20.096  15.122  -46.900 1.00 45.98  ? 135 ASP D OD2   1 
ATOM   6547 N  N     . HIS D 1 60  ? 19.205  15.024  -42.001 1.00 46.60  ? 136 HIS D N     1 
ATOM   6548 C  CA    . HIS D 1 60  ? 18.384  15.818  -41.095 1.00 51.93  ? 136 HIS D CA    1 
ATOM   6549 C  C     . HIS D 1 60  ? 18.374  17.321  -41.450 1.00 54.05  ? 136 HIS D C     1 
ATOM   6550 O  O     . HIS D 1 60  ? 17.848  18.142  -40.700 1.00 49.15  ? 136 HIS D O     1 
ATOM   6551 C  CB    . HIS D 1 60  ? 18.839  15.602  -39.641 1.00 57.46  ? 136 HIS D CB    1 
ATOM   6552 C  CG    . HIS D 1 60  ? 18.446  14.272  -39.067 1.00 66.43  ? 136 HIS D CG    1 
ATOM   6553 N  ND1   . HIS D 1 60  ? 17.925  13.247  -39.833 1.00 56.87  ? 136 HIS D ND1   1 
ATOM   6554 C  CD2   . HIS D 1 60  ? 18.486  13.804  -37.795 1.00 65.08  ? 136 HIS D CD2   1 
ATOM   6555 C  CE1   . HIS D 1 60  ? 17.658  12.211  -39.059 1.00 50.95  ? 136 HIS D CE1   1 
ATOM   6556 N  NE2   . HIS D 1 60  ? 17.994  12.520  -37.820 1.00 60.66  ? 136 HIS D NE2   1 
ATOM   6557 N  N     . PHE D 1 61  ? 18.950  17.671  -42.597 1.00 51.06  ? 137 PHE D N     1 
ATOM   6558 C  CA    . PHE D 1 61  ? 18.976  19.059  -43.037 1.00 51.50  ? 137 PHE D CA    1 
ATOM   6559 C  C     . PHE D 1 61  ? 17.611  19.525  -43.553 1.00 50.83  ? 137 PHE D C     1 
ATOM   6560 O  O     . PHE D 1 61  ? 16.687  18.725  -43.717 1.00 42.84  ? 137 PHE D O     1 
ATOM   6561 C  CB    . PHE D 1 61  ? 20.047  19.267  -44.110 1.00 49.11  ? 137 PHE D CB    1 
ATOM   6562 C  CG    . PHE D 1 61  ? 21.457  19.078  -43.611 1.00 51.90  ? 137 PHE D CG    1 
ATOM   6563 C  CD1   . PHE D 1 61  ? 21.942  19.836  -42.553 1.00 49.20  ? 137 PHE D CD1   1 
ATOM   6564 C  CD2   . PHE D 1 61  ? 22.307  18.159  -44.218 1.00 52.22  ? 137 PHE D CD2   1 
ATOM   6565 C  CE1   . PHE D 1 61  ? 23.240  19.675  -42.103 1.00 52.60  ? 137 PHE D CE1   1 
ATOM   6566 C  CE2   . PHE D 1 61  ? 23.607  17.992  -43.775 1.00 48.00  ? 137 PHE D CE2   1 
ATOM   6567 C  CZ    . PHE D 1 61  ? 24.073  18.750  -42.712 1.00 52.48  ? 137 PHE D CZ    1 
ATOM   6568 N  N     . ARG D 1 62  ? 17.492  20.827  -43.794 1.00 45.38  ? 138 ARG D N     1 
ATOM   6569 C  CA    . ARG D 1 62  ? 16.272  21.391  -44.350 1.00 47.06  ? 138 ARG D CA    1 
ATOM   6570 C  C     . ARG D 1 62  ? 16.067  20.907  -45.778 1.00 38.41  ? 138 ARG D C     1 
ATOM   6571 O  O     . ARG D 1 62  ? 17.024  20.593  -46.475 1.00 41.47  ? 138 ARG D O     1 
ATOM   6572 C  CB    . ARG D 1 62  ? 16.306  22.921  -44.307 1.00 45.35  ? 138 ARG D CB    1 
ATOM   6573 C  CG    . ARG D 1 62  ? 16.337  23.484  -42.906 1.00 53.71  ? 138 ARG D CG    1 
ATOM   6574 C  CD    . ARG D 1 62  ? 15.489  24.734  -42.807 1.00 44.43  ? 138 ARG D CD    1 
ATOM   6575 N  NE    . ARG D 1 62  ? 16.213  25.899  -43.247 1.00 51.69  ? 138 ARG D NE    1 
ATOM   6576 C  CZ    . ARG D 1 62  ? 15.653  27.043  -43.613 1.00 43.69  ? 138 ARG D CZ    1 
ATOM   6577 N  NH1   . ARG D 1 62  ? 14.332  27.205  -43.619 1.00 39.37  ? 138 ARG D NH1   1 
ATOM   6578 N  NH2   . ARG D 1 62  ? 16.442  28.025  -43.979 1.00 48.25  ? 138 ARG D NH2   1 
ATOM   6579 N  N     . PHE D 1 63  ? 14.810  20.864  -46.205 1.00 34.58  ? 139 PHE D N     1 
ATOM   6580 C  CA    . PHE D 1 63  ? 14.459  20.304  -47.485 1.00 33.89  ? 139 PHE D CA    1 
ATOM   6581 C  C     . PHE D 1 63  ? 15.035  21.062  -48.699 1.00 45.19  ? 139 PHE D C     1 
ATOM   6582 O  O     . PHE D 1 63  ? 14.779  22.266  -48.899 1.00 33.02  ? 139 PHE D O     1 
ATOM   6583 C  CB    . PHE D 1 63  ? 12.949  20.127  -47.623 1.00 29.77  ? 139 PHE D CB    1 
ATOM   6584 C  CG    . PHE D 1 63  ? 12.576  19.239  -48.775 1.00 41.54  ? 139 PHE D CG    1 
ATOM   6585 C  CD1   . PHE D 1 63  ? 12.728  17.855  -48.680 1.00 38.67  ? 139 PHE D CD1   1 
ATOM   6586 C  CD2   . PHE D 1 63  ? 12.141  19.778  -49.971 1.00 34.21  ? 139 PHE D CD2   1 
ATOM   6587 C  CE1   . PHE D 1 63  ? 12.407  17.029  -49.747 1.00 34.89  ? 139 PHE D CE1   1 
ATOM   6588 C  CE2   . PHE D 1 63  ? 11.819  18.961  -51.036 1.00 39.09  ? 139 PHE D CE2   1 
ATOM   6589 C  CZ    . PHE D 1 63  ? 11.954  17.574  -50.922 1.00 36.02  ? 139 PHE D CZ    1 
ATOM   6590 N  N     . ASN D 1 64  ? 15.785  20.324  -49.519 1.00 32.99  ? 140 ASN D N     1 
ATOM   6591 C  CA    . ASN D 1 64  ? 16.565  20.914  -50.592 1.00 36.42  ? 140 ASN D CA    1 
ATOM   6592 C  C     . ASN D 1 64  ? 16.140  20.337  -51.940 1.00 37.80  ? 140 ASN D C     1 
ATOM   6593 O  O     . ASN D 1 64  ? 16.812  19.460  -52.497 1.00 39.39  ? 140 ASN D O     1 
ATOM   6594 C  CB    . ASN D 1 64  ? 18.056  20.687  -50.328 1.00 38.10  ? 140 ASN D CB    1 
ATOM   6595 C  CG    . ASN D 1 64  ? 18.954  21.544  -51.214 1.00 40.18  ? 140 ASN D CG    1 
ATOM   6596 O  OD1   . ASN D 1 64  ? 18.601  21.866  -52.341 1.00 39.50  ? 140 ASN D OD1   1 
ATOM   6597 N  ND2   . ASN D 1 64  ? 20.129  21.895  -50.707 1.00 38.28  ? 140 ASN D ND2   1 
ATOM   6598 N  N     . ARG D 1 65  ? 15.022  20.845  -52.461 1.00 34.85  ? 141 ARG D N     1 
ATOM   6599 C  CA    . ARG D 1 65  ? 14.425  20.322  -53.684 1.00 34.54  ? 141 ARG D CA    1 
ATOM   6600 C  C     . ARG D 1 65  ? 15.372  20.302  -54.891 1.00 37.45  ? 141 ARG D C     1 
ATOM   6601 O  O     . ARG D 1 65  ? 15.411  19.318  -55.626 1.00 38.60  ? 141 ARG D O     1 
ATOM   6602 C  CB    . ARG D 1 65  ? 13.153  21.084  -54.027 1.00 32.93  ? 141 ARG D CB    1 
ATOM   6603 C  CG    . ARG D 1 65  ? 12.558  20.738  -55.383 1.00 32.24  ? 141 ARG D CG    1 
ATOM   6604 C  CD    . ARG D 1 65  ? 11.302  21.543  -55.579 1.00 33.00  ? 141 ARG D CD    1 
ATOM   6605 N  NE    . ARG D 1 65  ? 10.564  21.196  -56.793 1.00 43.05  ? 141 ARG D NE    1 
ATOM   6606 C  CZ    . ARG D 1 65  ? 10.761  21.760  -57.988 1.00 45.36  ? 141 ARG D CZ    1 
ATOM   6607 N  NH1   . ARG D 1 65  ? 11.709  22.682  -58.147 1.00 42.18  ? 141 ARG D NH1   1 
ATOM   6608 N  NH2   . ARG D 1 65  ? 10.020  21.393  -59.032 1.00 37.07  ? 141 ARG D NH2   1 
ATOM   6609 N  N     . ALA D 1 66  ? 16.157  21.361  -55.070 1.00 39.10  ? 142 ALA D N     1 
ATOM   6610 C  CA    . ALA D 1 66  ? 17.046  21.447  -56.230 1.00 41.89  ? 142 ALA D CA    1 
ATOM   6611 C  C     . ALA D 1 66  ? 18.230  20.495  -56.114 1.00 40.68  ? 142 ALA D C     1 
ATOM   6612 O  O     . ALA D 1 66  ? 18.643  19.897  -57.106 1.00 38.96  ? 142 ALA D O     1 
ATOM   6613 C  CB    . ALA D 1 66  ? 17.527  22.898  -56.474 1.00 31.58  ? 142 ALA D CB    1 
ATOM   6614 N  N     . ALA D 1 67  ? 18.778  20.347  -54.912 1.00 40.53  ? 143 ALA D N     1 
ATOM   6615 C  CA    . ALA D 1 67  ? 19.900  19.429  -54.740 1.00 41.95  ? 143 ALA D CA    1 
ATOM   6616 C  C     . ALA D 1 67  ? 19.470  17.975  -55.007 1.00 42.57  ? 143 ALA D C     1 
ATOM   6617 O  O     . ALA D 1 67  ? 20.203  17.213  -55.636 1.00 41.88  ? 143 ALA D O     1 
ATOM   6618 C  CB    . ALA D 1 67  ? 20.532  19.581  -53.370 1.00 33.57  ? 143 ALA D CB    1 
ATOM   6619 N  N     . LEU D 1 68  ? 18.268  17.610  -54.572 1.00 41.74  ? 144 LEU D N     1 
ATOM   6620 C  CA    . LEU D 1 68  ? 17.739  16.271  -54.852 1.00 40.88  ? 144 LEU D CA    1 
ATOM   6621 C  C     . LEU D 1 68  ? 17.601  16.028  -56.356 1.00 43.09  ? 144 LEU D C     1 
ATOM   6622 O  O     . LEU D 1 68  ? 17.855  14.916  -56.843 1.00 42.17  ? 144 LEU D O     1 
ATOM   6623 C  CB    . LEU D 1 68  ? 16.391  16.058  -54.144 1.00 31.46  ? 144 LEU D CB    1 
ATOM   6624 C  CG    . LEU D 1 68  ? 16.460  16.214  -52.625 1.00 30.65  ? 144 LEU D CG    1 
ATOM   6625 C  CD1   . LEU D 1 68  ? 15.092  16.190  -51.999 1.00 33.03  ? 144 LEU D CD1   1 
ATOM   6626 C  CD2   . LEU D 1 68  ? 17.309  15.125  -52.040 1.00 42.31  ? 144 LEU D CD2   1 
ATOM   6627 N  N     . ILE D 1 69  ? 17.198  17.069  -57.086 1.00 38.37  ? 145 ILE D N     1 
ATOM   6628 C  CA    . ILE D 1 69  ? 17.031  16.970  -58.537 1.00 39.99  ? 145 ILE D CA    1 
ATOM   6629 C  C     . ILE D 1 69  ? 18.375  16.719  -59.216 1.00 41.95  ? 145 ILE D C     1 
ATOM   6630 O  O     . ILE D 1 69  ? 18.464  15.922  -60.147 1.00 41.97  ? 145 ILE D O     1 
ATOM   6631 C  CB    . ILE D 1 69  ? 16.349  18.227  -59.130 1.00 47.52  ? 145 ILE D CB    1 
ATOM   6632 C  CG1   . ILE D 1 69  ? 14.923  18.349  -58.594 1.00 39.95  ? 145 ILE D CG1   1 
ATOM   6633 C  CG2   . ILE D 1 69  ? 16.340  18.205  -60.677 1.00 31.55  ? 145 ILE D CG2   1 
ATOM   6634 C  CD1   . ILE D 1 69  ? 14.136  17.083  -58.730 1.00 42.85  ? 145 ILE D CD1   1 
ATOM   6635 N  N     . ASN D 1 70  ? 19.415  17.390  -58.730 1.00 41.68  ? 146 ASN D N     1 
ATOM   6636 C  CA    . ASN D 1 70  ? 20.767  17.144  -59.203 1.00 38.76  ? 146 ASN D CA    1 
ATOM   6637 C  C     . ASN D 1 70  ? 21.170  15.684  -58.995 1.00 41.97  ? 146 ASN D C     1 
ATOM   6638 O  O     . ASN D 1 70  ? 21.607  15.007  -59.932 1.00 39.95  ? 146 ASN D O     1 
ATOM   6639 C  CB    . ASN D 1 70  ? 21.758  18.069  -58.502 1.00 35.82  ? 146 ASN D CB    1 
ATOM   6640 C  CG    . ASN D 1 70  ? 21.764  19.492  -59.091 1.00 45.27  ? 146 ASN D CG    1 
ATOM   6641 O  OD1   . ASN D 1 70  ? 21.297  19.730  -60.218 1.00 35.11  ? 146 ASN D OD1   1 
ATOM   6642 N  ND2   . ASN D 1 70  ? 22.302  20.441  -58.321 1.00 39.42  ? 146 ASN D ND2   1 
ATOM   6643 N  N     . VAL D 1 71  ? 20.994  15.198  -57.768 1.00 45.34  ? 147 VAL D N     1 
ATOM   6644 C  CA    . VAL D 1 71  ? 21.298  13.805  -57.430 1.00 40.70  ? 147 VAL D CA    1 
ATOM   6645 C  C     . VAL D 1 71  ? 20.514  12.844  -58.327 1.00 39.38  ? 147 VAL D C     1 
ATOM   6646 O  O     . VAL D 1 71  ? 21.087  11.961  -58.959 1.00 42.22  ? 147 VAL D O     1 
ATOM   6647 C  CB    . VAL D 1 71  ? 21.006  13.519  -55.947 1.00 39.58  ? 147 VAL D CB    1 
ATOM   6648 C  CG1   . VAL D 1 71  ? 21.097  12.019  -55.654 1.00 36.94  ? 147 VAL D CG1   1 
ATOM   6649 C  CG2   . VAL D 1 71  ? 21.956  14.297  -55.071 1.00 35.80  ? 147 VAL D CG2   1 
ATOM   6650 N  N     . GLY D 1 72  ? 19.203  13.046  -58.395 1.00 39.86  ? 148 GLY D N     1 
ATOM   6651 C  CA    . GLY D 1 72  ? 18.365  12.303  -59.312 1.00 33.73  ? 148 GLY D CA    1 
ATOM   6652 C  C     . GLY D 1 72  ? 18.974  12.239  -60.700 1.00 48.10  ? 148 GLY D C     1 
ATOM   6653 O  O     . GLY D 1 72  ? 19.207  11.142  -61.209 1.00 44.20  ? 148 GLY D O     1 
ATOM   6654 N  N     . PHE D 1 73  ? 19.257  13.403  -61.296 1.00 43.92  ? 149 PHE D N     1 
ATOM   6655 C  CA    . PHE D 1 73  ? 19.871  13.467  -62.623 1.00 40.06  ? 149 PHE D CA    1 
ATOM   6656 C  C     . PHE D 1 73  ? 21.097  12.560  -62.738 1.00 43.46  ? 149 PHE D C     1 
ATOM   6657 O  O     . PHE D 1 73  ? 21.182  11.703  -63.620 1.00 43.32  ? 149 PHE D O     1 
ATOM   6658 C  CB    . PHE D 1 73  ? 20.272  14.900  -62.989 1.00 38.08  ? 149 PHE D CB    1 
ATOM   6659 C  CG    . PHE D 1 73  ? 20.809  15.023  -64.382 1.00 35.96  ? 149 PHE D CG    1 
ATOM   6660 C  CD1   . PHE D 1 73  ? 19.946  15.144  -65.455 1.00 31.03  ? 149 PHE D CD1   1 
ATOM   6661 C  CD2   . PHE D 1 73  ? 22.174  14.954  -64.622 1.00 39.58  ? 149 PHE D CD2   1 
ATOM   6662 C  CE1   . PHE D 1 73  ? 20.438  15.221  -66.747 1.00 42.17  ? 149 PHE D CE1   1 
ATOM   6663 C  CE2   . PHE D 1 73  ? 22.680  15.040  -65.912 1.00 41.97  ? 149 PHE D CE2   1 
ATOM   6664 C  CZ    . PHE D 1 73  ? 21.813  15.172  -66.977 1.00 44.07  ? 149 PHE D CZ    1 
ATOM   6665 N  N     . LEU D 1 74  ? 22.043  12.764  -61.830 1.00 44.70  ? 150 LEU D N     1 
ATOM   6666 C  CA    . LEU D 1 74  ? 23.251  11.962  -61.784 1.00 40.74  ? 150 LEU D CA    1 
ATOM   6667 C  C     . LEU D 1 74  ? 22.973  10.456  -61.706 1.00 50.85  ? 150 LEU D C     1 
ATOM   6668 O  O     . LEU D 1 74  ? 23.575  9.672   -62.441 1.00 51.62  ? 150 LEU D O     1 
ATOM   6669 C  CB    . LEU D 1 74  ? 24.097  12.402  -60.597 1.00 38.37  ? 150 LEU D CB    1 
ATOM   6670 C  CG    . LEU D 1 74  ? 24.781  13.740  -60.823 1.00 40.57  ? 150 LEU D CG    1 
ATOM   6671 C  CD1   . LEU D 1 74  ? 25.600  14.077  -59.611 1.00 43.29  ? 150 LEU D CD1   1 
ATOM   6672 C  CD2   . LEU D 1 74  ? 25.649  13.698  -62.104 1.00 39.64  ? 150 LEU D CD2   1 
ATOM   6673 N  N     . GLU D 1 75  ? 22.055  10.062  -60.823 1.00 45.42  ? 151 GLU D N     1 
ATOM   6674 C  CA    . GLU D 1 75  ? 21.767  8.651   -60.597 1.00 43.67  ? 151 GLU D CA    1 
ATOM   6675 C  C     . GLU D 1 75  ? 20.825  8.043   -61.634 1.00 44.60  ? 151 GLU D C     1 
ATOM   6676 O  O     . GLU D 1 75  ? 20.762  6.823   -61.761 1.00 52.66  ? 151 GLU D O     1 
ATOM   6677 C  CB    . GLU D 1 75  ? 21.183  8.448   -59.192 1.00 42.41  ? 151 GLU D CB    1 
ATOM   6678 C  CG    . GLU D 1 75  ? 22.086  8.906   -58.058 1.00 41.68  ? 151 GLU D CG    1 
ATOM   6679 C  CD    . GLU D 1 75  ? 23.227  7.941   -57.781 1.00 48.25  ? 151 GLU D CD    1 
ATOM   6680 O  OE1   . GLU D 1 75  ? 23.202  6.815   -58.333 1.00 54.49  ? 151 GLU D OE1   1 
ATOM   6681 O  OE2   . GLU D 1 75  ? 24.141  8.298   -57.002 1.00 49.07  ? 151 GLU D OE2   1 
ATOM   6682 N  N     . SER D 1 76  ? 20.081  8.877   -62.357 1.00 44.07  ? 152 SER D N     1 
ATOM   6683 C  CA    . SER D 1 76  ? 19.056  8.371   -63.272 1.00 42.39  ? 152 SER D CA    1 
ATOM   6684 C  C     . SER D 1 76  ? 19.738  7.645   -64.402 1.00 61.63  ? 152 SER D C     1 
ATOM   6685 O  O     . SER D 1 76  ? 20.499  8.256   -65.173 1.00 60.64  ? 152 SER D O     1 
ATOM   6686 C  CB    . SER D 1 76  ? 18.204  9.493   -63.862 1.00 46.87  ? 152 SER D CB    1 
ATOM   6687 O  OG    . SER D 1 76  ? 18.041  10.548  -62.944 1.00 59.00  ? 152 SER D OG    1 
ATOM   6688 N  N     . SER D 1 77  ? 19.431  6.349   -64.490 1.00 70.09  ? 153 SER D N     1 
ATOM   6689 C  CA    . SER D 1 77  ? 20.139  5.390   -65.338 1.00 71.67  ? 153 SER D CA    1 
ATOM   6690 C  C     . SER D 1 77  ? 20.521  5.956   -66.696 1.00 80.73  ? 153 SER D C     1 
ATOM   6691 O  O     . SER D 1 77  ? 19.777  6.735   -67.307 1.00 77.98  ? 153 SER D O     1 
ATOM   6692 C  CB    . SER D 1 77  ? 19.329  4.095   -65.518 1.00 56.32  ? 153 SER D CB    1 
ATOM   6693 O  OG    . SER D 1 77  ? 18.287  4.246   -66.470 1.00 59.11  ? 153 SER D OG    1 
ATOM   6694 N  N     . ASN D 1 78  ? 21.687  5.537   -67.171 1.00 77.71  ? 154 ASN D N     1 
ATOM   6695 C  CA    . ASN D 1 78  ? 22.145  5.880   -68.498 1.00 71.71  ? 154 ASN D CA    1 
ATOM   6696 C  C     . ASN D 1 78  ? 21.110  5.443   -69.548 1.00 75.06  ? 154 ASN D C     1 
ATOM   6697 O  O     . ASN D 1 78  ? 21.225  5.764   -70.736 1.00 80.71  ? 154 ASN D O     1 
ATOM   6698 C  CB    . ASN D 1 78  ? 23.520  5.254   -68.729 1.00 78.46  ? 154 ASN D CB    1 
ATOM   6699 C  CG    . ASN D 1 78  ? 24.447  5.421   -67.520 1.00 81.38  ? 154 ASN D CG    1 
ATOM   6700 O  OD1   . ASN D 1 78  ? 24.003  5.394   -66.370 1.00 80.54  ? 154 ASN D OD1   1 
ATOM   6701 N  ND2   . ASN D 1 78  ? 25.736  5.598   -67.780 1.00 75.40  ? 154 ASN D ND2   1 
ATOM   6702 N  N     . SER D 1 79  ? 20.089  4.724   -69.082 1.00 77.02  ? 155 SER D N     1 
ATOM   6703 C  CA    . SER D 1 79  ? 18.901  4.426   -69.872 1.00 80.31  ? 155 SER D CA    1 
ATOM   6704 C  C     . SER D 1 79  ? 17.794  5.468   -69.679 1.00 73.01  ? 155 SER D C     1 
ATOM   6705 O  O     . SER D 1 79  ? 16.611  5.130   -69.721 1.00 75.97  ? 155 SER D O     1 
ATOM   6706 C  CB    . SER D 1 79  ? 18.355  3.038   -69.529 1.00 75.49  ? 155 SER D CB    1 
ATOM   6707 O  OG    . SER D 1 79  ? 17.172  2.772   -70.265 1.00 74.32  ? 155 SER D OG    1 
ATOM   6708 N  N     . THR D 1 80  ? 18.174  6.721   -69.445 1.00 63.66  ? 156 THR D N     1 
ATOM   6709 C  CA    . THR D 1 80  ? 17.226  7.831   -69.545 1.00 62.30  ? 156 THR D CA    1 
ATOM   6710 C  C     . THR D 1 80  ? 17.796  8.951   -70.425 1.00 50.92  ? 156 THR D C     1 
ATOM   6711 O  O     . THR D 1 80  ? 18.987  9.258   -70.357 1.00 53.34  ? 156 THR D O     1 
ATOM   6712 C  CB    . THR D 1 80  ? 16.733  8.346   -68.152 1.00 56.07  ? 156 THR D CB    1 
ATOM   6713 O  OG1   . THR D 1 80  ? 17.839  8.461   -67.247 1.00 62.80  ? 156 THR D OG1   1 
ATOM   6714 C  CG2   . THR D 1 80  ? 15.709  7.373   -67.561 1.00 54.85  ? 156 THR D CG2   1 
ATOM   6715 N  N     . ASP D 1 81  ? 16.939  9.532   -71.263 1.00 45.88  ? 157 ASP D N     1 
ATOM   6716 C  CA    . ASP D 1 81  ? 17.356  10.550  -72.234 1.00 46.78  ? 157 ASP D CA    1 
ATOM   6717 C  C     . ASP D 1 81  ? 16.874  11.960  -71.860 1.00 53.63  ? 157 ASP D C     1 
ATOM   6718 O  O     . ASP D 1 81  ? 17.443  12.961  -72.312 1.00 51.89  ? 157 ASP D O     1 
ATOM   6719 C  CB    . ASP D 1 81  ? 16.855  10.182  -73.633 1.00 46.35  ? 157 ASP D CB    1 
ATOM   6720 C  CG    . ASP D 1 81  ? 17.159  8.730   -73.994 1.00 67.10  ? 157 ASP D CG    1 
ATOM   6721 O  OD1   . ASP D 1 81  ? 18.306  8.287   -73.748 1.00 68.26  ? 157 ASP D OD1   1 
ATOM   6722 O  OD2   . ASP D 1 81  ? 16.247  8.026   -74.496 1.00 64.71  ? 157 ASP D OD2   1 
ATOM   6723 N  N     . TYR D 1 82  ? 15.809  12.040  -71.063 1.00 41.88  ? 158 TYR D N     1 
ATOM   6724 C  CA    . TYR D 1 82  ? 15.402  13.315  -70.496 1.00 45.17  ? 158 TYR D CA    1 
ATOM   6725 C  C     . TYR D 1 82  ? 14.805  13.178  -69.112 1.00 49.05  ? 158 TYR D C     1 
ATOM   6726 O  O     . TYR D 1 82  ? 14.534  12.065  -68.651 1.00 41.77  ? 158 TYR D O     1 
ATOM   6727 C  CB    . TYR D 1 82  ? 14.469  14.103  -71.420 1.00 42.05  ? 158 TYR D CB    1 
ATOM   6728 C  CG    . TYR D 1 82  ? 13.098  13.530  -71.725 1.00 38.41  ? 158 TYR D CG    1 
ATOM   6729 C  CD1   . TYR D 1 82  ? 12.929  12.232  -72.180 1.00 36.42  ? 158 TYR D CD1   1 
ATOM   6730 C  CD2   . TYR D 1 82  ? 11.964  14.321  -71.589 1.00 40.23  ? 158 TYR D CD2   1 
ATOM   6731 C  CE1   . TYR D 1 82  ? 11.657  11.740  -72.490 1.00 33.64  ? 158 TYR D CE1   1 
ATOM   6732 C  CE2   . TYR D 1 82  ? 10.699  13.841  -71.887 1.00 39.64  ? 158 TYR D CE2   1 
ATOM   6733 C  CZ    . TYR D 1 82  ? 10.550  12.550  -72.343 1.00 35.73  ? 158 TYR D CZ    1 
ATOM   6734 O  OH    . TYR D 1 82  ? 9.277   12.099  -72.642 1.00 39.00  ? 158 TYR D OH    1 
ATOM   6735 N  N     . ILE D 1 83  ? 14.615  14.317  -68.450 1.00 41.54  ? 159 ILE D N     1 
ATOM   6736 C  CA    . ILE D 1 83  ? 14.064  14.324  -67.104 1.00 38.84  ? 159 ILE D CA    1 
ATOM   6737 C  C     . ILE D 1 83  ? 12.820  15.190  -66.971 1.00 45.19  ? 159 ILE D C     1 
ATOM   6738 O  O     . ILE D 1 83  ? 12.604  16.140  -67.729 1.00 45.93  ? 159 ILE D O     1 
ATOM   6739 C  CB    . ILE D 1 83  ? 15.090  14.802  -66.076 1.00 33.26  ? 159 ILE D CB    1 
ATOM   6740 C  CG1   . ILE D 1 83  ? 15.281  16.314  -66.195 1.00 42.72  ? 159 ILE D CG1   1 
ATOM   6741 C  CG2   . ILE D 1 83  ? 16.400  14.053  -66.237 1.00 35.58  ? 159 ILE D CG2   1 
ATOM   6742 C  CD1   . ILE D 1 83  ? 16.374  16.846  -65.313 1.00 44.48  ? 159 ILE D CD1   1 
ATOM   6743 N  N     . ALA D 1 84  ? 11.995  14.848  -65.993 1.00 43.12  ? 160 ALA D N     1 
ATOM   6744 C  CA    . ALA D 1 84  ? 10.900  15.706  -65.595 1.00 39.45  ? 160 ALA D CA    1 
ATOM   6745 C  C     . ALA D 1 84  ? 11.016  15.910  -64.098 1.00 39.99  ? 160 ALA D C     1 
ATOM   6746 O  O     . ALA D 1 84  ? 10.779  14.998  -63.314 1.00 36.41  ? 160 ALA D O     1 
ATOM   6747 C  CB    . ALA D 1 84  ? 9.548   15.086  -65.970 1.00 34.66  ? 160 ALA D CB    1 
ATOM   6748 N  N     . MET D 1 85  ? 11.463  17.096  -63.713 1.00 42.70  ? 161 MET D N     1 
ATOM   6749 C  CA    . MET D 1 85  ? 11.407  17.546  -62.337 1.00 31.46  ? 161 MET D CA    1 
ATOM   6750 C  C     . MET D 1 85  ? 9.936   17.521  -61.990 1.00 35.34  ? 161 MET D C     1 
ATOM   6751 O  O     . MET D 1 85  ? 9.157   18.231  -62.628 1.00 37.57  ? 161 MET D O     1 
ATOM   6752 C  CB    . MET D 1 85  ? 11.816  18.998  -62.335 1.00 51.07  ? 161 MET D CB    1 
ATOM   6753 C  CG    . MET D 1 85  ? 12.842  19.398  -61.358 1.00 48.06  ? 161 MET D CG    1 
ATOM   6754 S  SD    . MET D 1 85  ? 13.265  21.054  -61.884 1.00 38.33  ? 161 MET D SD    1 
ATOM   6755 C  CE    . MET D 1 85  ? 14.371  20.695  -63.259 1.00 36.34  ? 161 MET D CE    1 
ATOM   6756 N  N     . HIS D 1 86  ? 9.532   16.736  -60.994 1.00 34.12  ? 162 HIS D N     1 
ATOM   6757 C  CA    . HIS D 1 86  ? 8.098   16.552  -60.768 1.00 34.56  ? 162 HIS D CA    1 
ATOM   6758 C  C     . HIS D 1 86  ? 7.724   16.515  -59.276 1.00 41.90  ? 162 HIS D C     1 
ATOM   6759 O  O     . HIS D 1 86  ? 8.072   15.572  -58.564 1.00 36.82  ? 162 HIS D O     1 
ATOM   6760 C  CB    . HIS D 1 86  ? 7.636   15.279  -61.482 1.00 35.20  ? 162 HIS D CB    1 
ATOM   6761 C  CG    . HIS D 1 86  ? 6.255   15.361  -62.054 1.00 28.99  ? 162 HIS D CG    1 
ATOM   6762 N  ND1   . HIS D 1 86  ? 5.138   15.577  -61.279 1.00 27.76  ? 162 HIS D ND1   1 
ATOM   6763 C  CD2   . HIS D 1 86  ? 5.807   15.218  -63.323 1.00 33.23  ? 162 HIS D CD2   1 
ATOM   6764 C  CE1   . HIS D 1 86  ? 4.062   15.574  -62.043 1.00 28.04  ? 162 HIS D CE1   1 
ATOM   6765 N  NE2   . HIS D 1 86  ? 4.441   15.367  -63.291 1.00 33.81  ? 162 HIS D NE2   1 
ATOM   6766 N  N     . ASP D 1 87  ? 7.033   17.552  -58.802 1.00 38.44  ? 163 ASP D N     1 
ATOM   6767 C  CA    . ASP D 1 87  ? 6.557   17.575  -57.413 1.00 36.49  ? 163 ASP D CA    1 
ATOM   6768 C  C     . ASP D 1 87  ? 5.606   16.391  -57.179 1.00 37.41  ? 163 ASP D C     1 
ATOM   6769 O  O     . ASP D 1 87  ? 4.851   16.018  -58.082 1.00 39.61  ? 163 ASP D O     1 
ATOM   6770 C  CB    . ASP D 1 87  ? 5.844   18.902  -57.104 1.00 34.30  ? 163 ASP D CB    1 
ATOM   6771 C  CG    . ASP D 1 87  ? 6.795   20.104  -57.082 1.00 37.58  ? 163 ASP D CG    1 
ATOM   6772 O  OD1   . ASP D 1 87  ? 8.028   19.923  -57.201 1.00 35.01  ? 163 ASP D OD1   1 
ATOM   6773 O  OD2   . ASP D 1 87  ? 6.300   21.243  -56.910 1.00 38.50  ? 163 ASP D OD2   1 
ATOM   6774 N  N     . VAL D 1 88  ? 5.634   15.799  -55.983 1.00 38.40  ? 164 VAL D N     1 
ATOM   6775 C  CA    . VAL D 1 88  ? 4.873   14.561  -55.739 1.00 34.54  ? 164 VAL D CA    1 
ATOM   6776 C  C     . VAL D 1 88  ? 3.367   14.817  -55.602 1.00 43.73  ? 164 VAL D C     1 
ATOM   6777 O  O     . VAL D 1 88  ? 2.567   13.894  -55.720 1.00 35.46  ? 164 VAL D O     1 
ATOM   6778 C  CB    . VAL D 1 88  ? 5.379   13.811  -54.480 1.00 33.20  ? 164 VAL D CB    1 
ATOM   6779 C  CG1   . VAL D 1 88  ? 4.878   14.505  -53.232 1.00 32.57  ? 164 VAL D CG1   1 
ATOM   6780 C  CG2   . VAL D 1 88  ? 4.966   12.305  -54.491 1.00 27.82  ? 164 VAL D CG2   1 
ATOM   6781 N  N     . ASP D 1 89  ? 2.975   16.070  -55.371 1.00 42.62  ? 165 ASP D N     1 
ATOM   6782 C  CA    . ASP D 1 89  ? 1.573   16.377  -55.099 1.00 36.67  ? 165 ASP D CA    1 
ATOM   6783 C  C     . ASP D 1 89  ? 0.869   17.068  -56.266 1.00 47.46  ? 165 ASP D C     1 
ATOM   6784 O  O     . ASP D 1 89  ? -0.281  17.498  -56.150 1.00 44.19  ? 165 ASP D O     1 
ATOM   6785 C  CB    . ASP D 1 89  ? 1.449   17.256  -53.850 1.00 44.48  ? 165 ASP D CB    1 
ATOM   6786 C  CG    . ASP D 1 89  ? 2.205   18.568  -53.977 1.00 35.64  ? 165 ASP D CG    1 
ATOM   6787 O  OD1   . ASP D 1 89  ? 2.704   18.883  -55.073 1.00 36.30  ? 165 ASP D OD1   1 
ATOM   6788 O  OD2   . ASP D 1 89  ? 2.307   19.287  -52.967 1.00 39.42  ? 165 ASP D OD2   1 
ATOM   6789 N  N     . LEU D 1 90  ? 1.564   17.198  -57.385 1.00 40.63  ? 166 LEU D N     1 
ATOM   6790 C  CA    . LEU D 1 90  ? 1.016   17.960  -58.496 1.00 42.90  ? 166 LEU D CA    1 
ATOM   6791 C  C     . LEU D 1 90  ? 0.734   17.007  -59.650 1.00 40.14  ? 166 LEU D C     1 
ATOM   6792 O  O     . LEU D 1 90  ? 1.649   16.594  -60.354 1.00 43.27  ? 166 LEU D O     1 
ATOM   6793 C  CB    . LEU D 1 90  ? 1.998   19.061  -58.908 1.00 36.33  ? 166 LEU D CB    1 
ATOM   6794 C  CG    . LEU D 1 90  ? 1.470   20.208  -59.762 1.00 44.36  ? 166 LEU D CG    1 
ATOM   6795 C  CD1   . LEU D 1 90  ? 0.428   21.025  -59.003 1.00 42.11  ? 166 LEU D CD1   1 
ATOM   6796 C  CD2   . LEU D 1 90  ? 2.625   21.083  -60.211 1.00 32.77  ? 166 LEU D CD2   1 
ATOM   6797 N  N     . LEU D 1 91  ? -0.541  16.675  -59.840 1.00 40.73  ? 167 LEU D N     1 
ATOM   6798 C  CA    . LEU D 1 91  ? -0.948  15.623  -60.765 1.00 45.89  ? 167 LEU D CA    1 
ATOM   6799 C  C     . LEU D 1 91  ? -1.601  16.172  -62.020 1.00 40.71  ? 167 LEU D C     1 
ATOM   6800 O  O     . LEU D 1 91  ? -2.626  16.856  -61.945 1.00 42.14  ? 167 LEU D O     1 
ATOM   6801 C  CB    . LEU D 1 91  ? -1.928  14.663  -60.070 1.00 43.74  ? 167 LEU D CB    1 
ATOM   6802 C  CG    . LEU D 1 91  ? -1.448  14.104  -58.735 1.00 40.33  ? 167 LEU D CG    1 
ATOM   6803 C  CD1   . LEU D 1 91  ? -2.578  13.391  -58.043 1.00 47.25  ? 167 LEU D CD1   1 
ATOM   6804 C  CD2   . LEU D 1 91  ? -0.286  13.164  -58.953 1.00 38.07  ? 167 LEU D CD2   1 
ATOM   6805 N  N     . PRO D 1 92  ? -1.021  15.857  -63.187 1.00 41.58  ? 168 PRO D N     1 
ATOM   6806 C  CA    . PRO D 1 92  ? -1.650  16.322  -64.425 1.00 43.57  ? 168 PRO D CA    1 
ATOM   6807 C  C     . PRO D 1 92  ? -3.003  15.649  -64.638 1.00 44.45  ? 168 PRO D C     1 
ATOM   6808 O  O     . PRO D 1 92  ? -3.136  14.434  -64.488 1.00 49.83  ? 168 PRO D O     1 
ATOM   6809 C  CB    . PRO D 1 92  ? -0.639  15.938  -65.514 1.00 44.66  ? 168 PRO D CB    1 
ATOM   6810 C  CG    . PRO D 1 92  ? 0.241   14.894  -64.897 1.00 39.21  ? 168 PRO D CG    1 
ATOM   6811 C  CD    . PRO D 1 92  ? 0.263   15.170  -63.422 1.00 43.56  ? 168 PRO D CD    1 
ATOM   6812 N  N     . LEU D 1 93  ? -4.002  16.462  -64.957 1.00 44.49  ? 169 LEU D N     1 
ATOM   6813 C  CA    . LEU D 1 93  ? -5.365  15.998  -65.164 1.00 45.70  ? 169 LEU D CA    1 
ATOM   6814 C  C     . LEU D 1 93  ? -5.714  16.050  -66.636 1.00 44.28  ? 169 LEU D C     1 
ATOM   6815 O  O     . LEU D 1 93  ? -6.759  15.567  -67.049 1.00 50.22  ? 169 LEU D O     1 
ATOM   6816 C  CB    . LEU D 1 93  ? -6.335  16.908  -64.409 1.00 44.61  ? 169 LEU D CB    1 
ATOM   6817 C  CG    . LEU D 1 93  ? -6.270  16.824  -62.882 1.00 51.96  ? 169 LEU D CG    1 
ATOM   6818 C  CD1   . LEU D 1 93  ? -7.385  17.651  -62.226 1.00 40.07  ? 169 LEU D CD1   1 
ATOM   6819 C  CD2   . LEU D 1 93  ? -6.340  15.359  -62.462 1.00 43.75  ? 169 LEU D CD2   1 
ATOM   6820 N  N     . ASN D 1 94  ? -4.827  16.655  -67.417 1.00 49.63  ? 170 ASN D N     1 
ATOM   6821 C  CA    . ASN D 1 94  ? -5.109  17.019  -68.803 1.00 54.19  ? 170 ASN D CA    1 
ATOM   6822 C  C     . ASN D 1 94  ? -4.143  16.291  -69.698 1.00 50.87  ? 170 ASN D C     1 
ATOM   6823 O  O     . ASN D 1 94  ? -2.942  16.555  -69.666 1.00 54.18  ? 170 ASN D O     1 
ATOM   6824 C  CB    . ASN D 1 94  ? -4.943  18.536  -68.997 1.00 49.23  ? 170 ASN D CB    1 
ATOM   6825 C  CG    . ASN D 1 94  ? -5.600  19.047  -70.270 1.00 48.94  ? 170 ASN D CG    1 
ATOM   6826 O  OD1   . ASN D 1 94  ? -5.570  18.388  -71.304 1.00 54.60  ? 170 ASN D OD1   1 
ATOM   6827 N  ND2   . ASN D 1 94  ? -6.200  20.232  -70.195 1.00 49.81  ? 170 ASN D ND2   1 
ATOM   6828 N  N     . GLU D 1 95  ? -4.661  15.367  -70.494 1.00 54.05  ? 171 GLU D N     1 
ATOM   6829 C  CA    . GLU D 1 95  ? -3.803  14.575  -71.368 1.00 58.42  ? 171 GLU D CA    1 
ATOM   6830 C  C     . GLU D 1 95  ? -3.131  15.387  -72.481 1.00 53.84  ? 171 GLU D C     1 
ATOM   6831 O  O     . GLU D 1 95  ? -2.204  14.903  -73.119 1.00 55.53  ? 171 GLU D O     1 
ATOM   6832 C  CB    . GLU D 1 95  ? -4.579  13.410  -71.972 1.00 57.52  ? 171 GLU D CB    1 
ATOM   6833 C  CG    . GLU D 1 95  ? -4.818  12.263  -71.020 1.00 69.84  ? 171 GLU D CG    1 
ATOM   6834 C  CD    . GLU D 1 95  ? -5.332  11.030  -71.735 1.00 87.31  ? 171 GLU D CD    1 
ATOM   6835 O  OE1   . GLU D 1 95  ? -4.643  10.550  -72.668 1.00 83.66  ? 171 GLU D OE1   1 
ATOM   6836 O  OE2   . GLU D 1 95  ? -6.429  10.552  -71.373 1.00 88.10  ? 171 GLU D OE2   1 
ATOM   6837 N  N     . GLU D 1 96  ? -3.588  16.615  -72.713 1.00 55.73  ? 172 GLU D N     1 
ATOM   6838 C  CA    . GLU D 1 96  ? -3.008  17.440  -73.774 1.00 58.35  ? 172 GLU D CA    1 
ATOM   6839 C  C     . GLU D 1 96  ? -1.612  17.943  -73.419 1.00 54.07  ? 172 GLU D C     1 
ATOM   6840 O  O     . GLU D 1 96  ? -0.831  18.296  -74.305 1.00 57.39  ? 172 GLU D O     1 
ATOM   6841 C  CB    . GLU D 1 96  ? -3.915  18.628  -74.103 1.00 66.36  ? 172 GLU D CB    1 
ATOM   6842 C  CG    . GLU D 1 96  ? -5.320  18.256  -74.563 1.00 68.56  ? 172 GLU D CG    1 
ATOM   6843 C  CD    . GLU D 1 96  ? -5.395  17.889  -76.037 1.00 76.18  ? 172 GLU D CD    1 
ATOM   6844 O  OE1   . GLU D 1 96  ? -4.335  17.805  -76.701 1.00 78.66  ? 172 GLU D OE1   1 
ATOM   6845 O  OE2   . GLU D 1 96  ? -6.528  17.691  -76.529 1.00 78.36  ? 172 GLU D OE2   1 
ATOM   6846 N  N     . LEU D 1 97  ? -1.312  17.982  -72.123 1.00 47.60  ? 173 LEU D N     1 
ATOM   6847 C  CA    . LEU D 1 97  ? -0.003  18.414  -71.640 1.00 43.28  ? 173 LEU D CA    1 
ATOM   6848 C  C     . LEU D 1 97  ? 1.103   17.564  -72.233 1.00 49.67  ? 173 LEU D C     1 
ATOM   6849 O  O     . LEU D 1 97  ? 1.078   16.335  -72.135 1.00 49.39  ? 173 LEU D O     1 
ATOM   6850 C  CB    . LEU D 1 97  ? 0.063   18.354  -70.114 1.00 49.58  ? 173 LEU D CB    1 
ATOM   6851 C  CG    . LEU D 1 97  ? -0.944  19.214  -69.349 1.00 44.19  ? 173 LEU D CG    1 
ATOM   6852 C  CD1   . LEU D 1 97  ? -0.903  18.883  -67.886 1.00 42.33  ? 173 LEU D CD1   1 
ATOM   6853 C  CD2   . LEU D 1 97  ? -0.636  20.671  -69.566 1.00 45.32  ? 173 LEU D CD2   1 
ATOM   6854 N  N     . ASP D 1 98  ? 2.080   18.232  -72.835 1.00 46.24  ? 174 ASP D N     1 
ATOM   6855 C  CA    . ASP D 1 98  ? 3.151   17.579  -73.572 1.00 43.28  ? 174 ASP D CA    1 
ATOM   6856 C  C     . ASP D 1 98  ? 4.319   17.110  -72.689 1.00 45.27  ? 174 ASP D C     1 
ATOM   6857 O  O     . ASP D 1 98  ? 5.190   17.900  -72.323 1.00 42.39  ? 174 ASP D O     1 
ATOM   6858 C  CB    . ASP D 1 98  ? 3.661   18.531  -74.661 1.00 48.56  ? 174 ASP D CB    1 
ATOM   6859 C  CG    . ASP D 1 98  ? 4.458   17.821  -75.740 1.00 51.21  ? 174 ASP D CG    1 
ATOM   6860 O  OD1   . ASP D 1 98  ? 5.052   16.754  -75.455 1.00 53.67  ? 174 ASP D OD1   1 
ATOM   6861 O  OD2   . ASP D 1 98  ? 4.498   18.341  -76.877 1.00 55.91  ? 174 ASP D OD2   1 
ATOM   6862 N  N     . TYR D 1 99  ? 4.354   15.813  -72.388 1.00 47.95  ? 175 TYR D N     1 
ATOM   6863 C  CA    . TYR D 1 99  ? 5.480   15.218  -71.662 1.00 44.23  ? 175 TYR D CA    1 
ATOM   6864 C  C     . TYR D 1 99  ? 6.504   14.573  -72.606 1.00 45.57  ? 175 TYR D C     1 
ATOM   6865 O  O     . TYR D 1 99  ? 7.346   13.772  -72.183 1.00 40.90  ? 175 TYR D O     1 
ATOM   6866 C  CB    . TYR D 1 99  ? 4.988   14.189  -70.635 1.00 48.15  ? 175 TYR D CB    1 
ATOM   6867 C  CG    . TYR D 1 99  ? 4.507   14.768  -69.309 1.00 40.91  ? 175 TYR D CG    1 
ATOM   6868 C  CD1   . TYR D 1 99  ? 3.290   15.439  -69.216 1.00 48.39  ? 175 TYR D CD1   1 
ATOM   6869 C  CD2   . TYR D 1 99  ? 5.255   14.612  -68.148 1.00 44.67  ? 175 TYR D CD2   1 
ATOM   6870 C  CE1   . TYR D 1 99  ? 2.839   15.959  -68.004 1.00 44.33  ? 175 TYR D CE1   1 
ATOM   6871 C  CE2   . TYR D 1 99  ? 4.815   15.127  -66.926 1.00 41.60  ? 175 TYR D CE2   1 
ATOM   6872 C  CZ    . TYR D 1 99  ? 3.612   15.804  -66.864 1.00 42.14  ? 175 TYR D CZ    1 
ATOM   6873 O  OH    . TYR D 1 99  ? 3.171   16.311  -65.658 1.00 45.28  ? 175 TYR D OH    1 
ATOM   6874 N  N     . GLY D 1 100 ? 6.444   14.938  -73.885 1.00 48.90  ? 176 GLY D N     1 
ATOM   6875 C  CA    . GLY D 1 100 ? 7.384   14.414  -74.860 1.00 42.87  ? 176 GLY D CA    1 
ATOM   6876 C  C     . GLY D 1 100 ? 8.796   14.949  -74.690 1.00 44.43  ? 176 GLY D C     1 
ATOM   6877 O  O     . GLY D 1 100 ? 9.023   15.905  -73.957 1.00 43.62  ? 176 GLY D O     1 
ATOM   6878 N  N     . PHE D 1 101 ? 9.748   14.325  -75.375 1.00 43.32  ? 177 PHE D N     1 
ATOM   6879 C  CA    . PHE D 1 101 ? 11.135  14.789  -75.399 1.00 47.36  ? 177 PHE D CA    1 
ATOM   6880 C  C     . PHE D 1 101 ? 11.238  16.271  -75.853 1.00 48.08  ? 177 PHE D C     1 
ATOM   6881 O  O     . PHE D 1 101 ? 10.819  16.621  -76.961 1.00 51.43  ? 177 PHE D O     1 
ATOM   6882 C  CB    . PHE D 1 101 ? 11.952  13.872  -76.314 1.00 36.85  ? 177 PHE D CB    1 
ATOM   6883 C  CG    . PHE D 1 101 ? 13.433  14.120  -76.259 1.00 44.50  ? 177 PHE D CG    1 
ATOM   6884 C  CD1   . PHE D 1 101 ? 14.179  13.670  -75.182 1.00 32.34  ? 177 PHE D CD1   1 
ATOM   6885 C  CD2   . PHE D 1 101 ? 14.081  14.793  -77.293 1.00 39.46  ? 177 PHE D CD2   1 
ATOM   6886 C  CE1   . PHE D 1 101 ? 15.523  13.897  -75.112 1.00 33.58  ? 177 PHE D CE1   1 
ATOM   6887 C  CE2   . PHE D 1 101 ? 15.442  15.024  -77.235 1.00 36.11  ? 177 PHE D CE2   1 
ATOM   6888 C  CZ    . PHE D 1 101 ? 16.169  14.577  -76.154 1.00 37.61  ? 177 PHE D CZ    1 
ATOM   6889 N  N     . PRO D 1 102 ? 11.788  17.146  -74.993 1.00 45.63  ? 178 PRO D N     1 
ATOM   6890 C  CA    . PRO D 1 102 ? 11.780  18.581  -75.288 1.00 50.16  ? 178 PRO D CA    1 
ATOM   6891 C  C     . PRO D 1 102 ? 13.079  18.987  -75.991 1.00 48.95  ? 178 PRO D C     1 
ATOM   6892 O  O     . PRO D 1 102 ? 13.929  19.662  -75.388 1.00 41.48  ? 178 PRO D O     1 
ATOM   6893 C  CB    . PRO D 1 102 ? 11.707  19.202  -73.892 1.00 41.35  ? 178 PRO D CB    1 
ATOM   6894 C  CG    . PRO D 1 102 ? 12.535  18.251  -73.044 1.00 45.30  ? 178 PRO D CG    1 
ATOM   6895 C  CD    . PRO D 1 102 ? 12.436  16.872  -73.696 1.00 46.27  ? 178 PRO D CD    1 
ATOM   6896 N  N     . GLU D 1 103 ? 13.224  18.557  -77.247 1.00 52.42  ? 179 GLU D N     1 
ATOM   6897 C  CA    . GLU D 1 103 ? 14.427  18.820  -78.043 1.00 50.47  ? 179 GLU D CA    1 
ATOM   6898 C  C     . GLU D 1 103 ? 14.719  20.316  -78.179 1.00 46.65  ? 179 GLU D C     1 
ATOM   6899 O  O     . GLU D 1 103 ? 15.850  20.745  -77.937 1.00 49.14  ? 179 GLU D O     1 
ATOM   6900 C  CB    . GLU D 1 103 ? 14.337  18.143  -79.430 1.00 47.76  ? 179 GLU D CB    1 
ATOM   6901 C  CG    . GLU D 1 103 ? 15.345  18.643  -80.502 1.00 51.19  ? 179 GLU D CG    1 
ATOM   6902 C  CD    . GLU D 1 103 ? 16.805  18.260  -80.216 1.00 65.18  ? 179 GLU D CD    1 
ATOM   6903 O  OE1   . GLU D 1 103 ? 17.095  17.752  -79.105 1.00 64.48  ? 179 GLU D OE1   1 
ATOM   6904 O  OE2   . GLU D 1 103 ? 17.666  18.464  -81.111 1.00 64.28  ? 179 GLU D OE2   1 
ATOM   6905 N  N     . ALA D 1 104 ? 13.697  21.098  -78.534 1.00 40.89  ? 180 ALA D N     1 
ATOM   6906 C  CA    . ALA D 1 104 ? 13.854  22.551  -78.742 1.00 47.80  ? 180 ALA D CA    1 
ATOM   6907 C  C     . ALA D 1 104 ? 14.309  23.352  -77.520 1.00 48.94  ? 180 ALA D C     1 
ATOM   6908 O  O     . ALA D 1 104 ? 14.940  24.393  -77.665 1.00 58.70  ? 180 ALA D O     1 
ATOM   6909 C  CB    . ALA D 1 104 ? 12.569  23.159  -79.309 1.00 40.47  ? 180 ALA D CB    1 
ATOM   6910 N  N     . GLY D 1 105 ? 13.974  22.886  -76.321 1.00 47.34  ? 181 GLY D N     1 
ATOM   6911 C  CA    . GLY D 1 105 ? 14.331  23.598  -75.099 1.00 44.29  ? 181 GLY D CA    1 
ATOM   6912 C  C     . GLY D 1 105 ? 13.416  23.229  -73.940 1.00 44.01  ? 181 GLY D C     1 
ATOM   6913 O  O     . GLY D 1 105 ? 12.366  22.615  -74.162 1.00 40.23  ? 181 GLY D O     1 
ATOM   6914 N  N     . PRO D 1 106 ? 13.812  23.593  -72.704 1.00 43.77  ? 182 PRO D N     1 
ATOM   6915 C  CA    . PRO D 1 106 ? 13.093  23.184  -71.491 1.00 38.82  ? 182 PRO D CA    1 
ATOM   6916 C  C     . PRO D 1 106 ? 11.601  23.406  -71.615 1.00 37.18  ? 182 PRO D C     1 
ATOM   6917 O  O     . PRO D 1 106 ? 11.160  24.435  -72.099 1.00 39.40  ? 182 PRO D O     1 
ATOM   6918 C  CB    . PRO D 1 106 ? 13.705  24.066  -70.413 1.00 34.83  ? 182 PRO D CB    1 
ATOM   6919 C  CG    . PRO D 1 106 ? 15.136  24.241  -70.887 1.00 38.98  ? 182 PRO D CG    1 
ATOM   6920 C  CD    . PRO D 1 106 ? 15.045  24.336  -72.385 1.00 41.96  ? 182 PRO D CD    1 
ATOM   6921 N  N     . PHE D 1 107 ? 10.823  22.406  -71.224 1.00 40.62  ? 183 PHE D N     1 
ATOM   6922 C  CA    . PHE D 1 107 ? 9.379   22.523  -71.340 1.00 43.34  ? 183 PHE D CA    1 
ATOM   6923 C  C     . PHE D 1 107 ? 8.739   22.569  -69.961 1.00 39.27  ? 183 PHE D C     1 
ATOM   6924 O  O     . PHE D 1 107 ? 8.709   21.569  -69.235 1.00 45.14  ? 183 PHE D O     1 
ATOM   6925 C  CB    . PHE D 1 107 ? 8.788   21.378  -72.168 1.00 36.48  ? 183 PHE D CB    1 
ATOM   6926 C  CG    . PHE D 1 107 ? 7.348   21.576  -72.506 1.00 36.83  ? 183 PHE D CG    1 
ATOM   6927 C  CD1   . PHE D 1 107 ? 6.979   22.392  -73.560 1.00 33.40  ? 183 PHE D CD1   1 
ATOM   6928 C  CD2   . PHE D 1 107 ? 6.355   20.974  -71.750 1.00 37.05  ? 183 PHE D CD2   1 
ATOM   6929 C  CE1   . PHE D 1 107 ? 5.643   22.591  -73.877 1.00 36.03  ? 183 PHE D CE1   1 
ATOM   6930 C  CE2   . PHE D 1 107 ? 5.019   21.165  -72.061 1.00 40.22  ? 183 PHE D CE2   1 
ATOM   6931 C  CZ    . PHE D 1 107 ? 4.662   21.976  -73.131 1.00 40.66  ? 183 PHE D CZ    1 
ATOM   6932 N  N     . HIS D 1 108 ? 8.228   23.738  -69.616 1.00 39.06  ? 184 HIS D N     1 
ATOM   6933 C  CA    . HIS D 1 108 ? 7.578   23.956  -68.338 1.00 40.26  ? 184 HIS D CA    1 
ATOM   6934 C  C     . HIS D 1 108 ? 6.095   23.554  -68.381 1.00 38.26  ? 184 HIS D C     1 
ATOM   6935 O  O     . HIS D 1 108 ? 5.239   24.302  -68.842 1.00 39.12  ? 184 HIS D O     1 
ATOM   6936 C  CB    . HIS D 1 108 ? 7.732   25.414  -67.930 1.00 39.79  ? 184 HIS D CB    1 
ATOM   6937 C  CG    . HIS D 1 108 ? 7.185   25.715  -66.574 1.00 41.52  ? 184 HIS D CG    1 
ATOM   6938 N  ND1   . HIS D 1 108 ? 6.443   26.845  -66.306 1.00 41.31  ? 184 HIS D ND1   1 
ATOM   6939 C  CD2   . HIS D 1 108 ? 7.262   25.028  -65.409 1.00 37.42  ? 184 HIS D CD2   1 
ATOM   6940 C  CE1   . HIS D 1 108 ? 6.075   26.834  -65.038 1.00 41.20  ? 184 HIS D CE1   1 
ATOM   6941 N  NE2   . HIS D 1 108 ? 6.571   25.751  -64.468 1.00 39.94  ? 184 HIS D NE2   1 
ATOM   6942 N  N     . VAL D 1 109 ? 5.808   22.350  -67.906 1.00 39.85  ? 185 VAL D N     1 
ATOM   6943 C  CA    . VAL D 1 109 ? 4.450   21.840  -67.878 1.00 35.51  ? 185 VAL D CA    1 
ATOM   6944 C  C     . VAL D 1 109 ? 3.578   22.669  -66.916 1.00 39.65  ? 185 VAL D C     1 
ATOM   6945 O  O     . VAL D 1 109 ? 2.439   23.026  -67.240 1.00 35.39  ? 185 VAL D O     1 
ATOM   6946 C  CB    . VAL D 1 109 ? 4.447   20.342  -67.467 1.00 41.91  ? 185 VAL D CB    1 
ATOM   6947 C  CG1   . VAL D 1 109 ? 3.054   19.876  -67.025 1.00 34.36  ? 185 VAL D CG1   1 
ATOM   6948 C  CG2   . VAL D 1 109 ? 5.003   19.465  -68.604 1.00 36.57  ? 185 VAL D CG2   1 
ATOM   6949 N  N     . ALA D 1 110 ? 4.117   22.987  -65.743 1.00 35.14  ? 186 ALA D N     1 
ATOM   6950 C  CA    . ALA D 1 110 ? 3.309   23.602  -64.689 1.00 42.83  ? 186 ALA D CA    1 
ATOM   6951 C  C     . ALA D 1 110 ? 3.238   25.122  -64.826 1.00 40.55  ? 186 ALA D C     1 
ATOM   6952 O  O     . ALA D 1 110 ? 3.533   25.855  -63.887 1.00 38.60  ? 186 ALA D O     1 
ATOM   6953 C  CB    . ALA D 1 110 ? 3.831   23.204  -63.315 1.00 35.79  ? 186 ALA D CB    1 
ATOM   6954 N  N     . SER D 1 111 ? 2.836   25.569  -66.009 1.00 44.13  ? 187 SER D N     1 
ATOM   6955 C  CA    . SER D 1 111 ? 2.837   26.977  -66.392 1.00 42.01  ? 187 SER D CA    1 
ATOM   6956 C  C     . SER D 1 111 ? 2.102   27.906  -65.416 1.00 43.91  ? 187 SER D C     1 
ATOM   6957 O  O     . SER D 1 111 ? 1.094   27.515  -64.818 1.00 41.31  ? 187 SER D O     1 
ATOM   6958 C  CB    . SER D 1 111 ? 2.195   27.101  -67.769 1.00 41.31  ? 187 SER D CB    1 
ATOM   6959 O  OG    . SER D 1 111 ? 2.079   28.451  -68.148 1.00 42.00  ? 187 SER D OG    1 
ATOM   6960 N  N     . PRO D 1 112 ? 2.595   29.151  -65.272 1.00 38.48  ? 188 PRO D N     1 
ATOM   6961 C  CA    . PRO D 1 112 ? 1.910   30.184  -64.475 1.00 42.90  ? 188 PRO D CA    1 
ATOM   6962 C  C     . PRO D 1 112 ? 0.481   30.439  -64.946 1.00 36.31  ? 188 PRO D C     1 
ATOM   6963 O  O     . PRO D 1 112 ? -0.325  30.965  -64.194 1.00 46.53  ? 188 PRO D O     1 
ATOM   6964 C  CB    . PRO D 1 112 ? 2.775   31.436  -64.682 1.00 39.37  ? 188 PRO D CB    1 
ATOM   6965 C  CG    . PRO D 1 112 ? 3.630   31.127  -65.891 1.00 41.36  ? 188 PRO D CG    1 
ATOM   6966 C  CD    . PRO D 1 112 ? 3.852   29.648  -65.849 1.00 40.59  ? 188 PRO D CD    1 
ATOM   6967 N  N     . GLU D 1 113 ? 0.175   30.057  -66.177 1.00 40.13  ? 189 GLU D N     1 
ATOM   6968 C  CA    . GLU D 1 113 ? -1.184  30.132  -66.700 1.00 46.45  ? 189 GLU D CA    1 
ATOM   6969 C  C     . GLU D 1 113 ? -2.047  28.996  -66.135 1.00 47.09  ? 189 GLU D C     1 
ATOM   6970 O  O     . GLU D 1 113 ? -3.274  29.060  -66.170 1.00 52.56  ? 189 GLU D O     1 
ATOM   6971 C  CB    . GLU D 1 113 ? -1.150  30.057  -68.240 1.00 44.44  ? 189 GLU D CB    1 
ATOM   6972 C  CG    . GLU D 1 113 ? -2.522  30.103  -68.927 1.00 52.86  ? 189 GLU D CG    1 
ATOM   6973 C  CD    . GLU D 1 113 ? -2.540  29.468  -70.326 1.00 65.02  ? 189 GLU D CD    1 
ATOM   6974 O  OE1   . GLU D 1 113 ? -3.567  29.606  -71.027 1.00 69.91  ? 189 GLU D OE1   1 
ATOM   6975 O  OE2   . GLU D 1 113 ? -1.545  28.823  -70.728 1.00 56.47  ? 189 GLU D OE2   1 
ATOM   6976 N  N     . LEU D 1 114 ? -1.402  27.953  -65.618 1.00 46.06  ? 190 LEU D N     1 
ATOM   6977 C  CA    . LEU D 1 114 ? -2.098  26.706  -65.298 1.00 50.72  ? 190 LEU D CA    1 
ATOM   6978 C  C     . LEU D 1 114 ? -1.932  26.278  -63.850 1.00 48.07  ? 190 LEU D C     1 
ATOM   6979 O  O     . LEU D 1 114 ? -2.783  25.578  -63.313 1.00 48.29  ? 190 LEU D O     1 
ATOM   6980 C  CB    . LEU D 1 114 ? -1.591  25.569  -66.191 1.00 49.07  ? 190 LEU D CB    1 
ATOM   6981 C  CG    . LEU D 1 114 ? -2.217  25.279  -67.558 1.00 55.63  ? 190 LEU D CG    1 
ATOM   6982 C  CD1   . LEU D 1 114 ? -3.145  26.387  -68.030 1.00 51.54  ? 190 LEU D CD1   1 
ATOM   6983 C  CD2   . LEU D 1 114 ? -1.117  25.017  -68.575 1.00 42.65  ? 190 LEU D CD2   1 
ATOM   6984 N  N     . HIS D 1 115 ? -0.813  26.657  -63.242 1.00 46.26  ? 191 HIS D N     1 
ATOM   6985 C  CA    . HIS D 1 115 ? -0.545  26.308  -61.858 1.00 43.47  ? 191 HIS D CA    1 
ATOM   6986 C  C     . HIS D 1 115 ? -1.597  26.957  -60.979 1.00 45.41  ? 191 HIS D C     1 
ATOM   6987 O  O     . HIS D 1 115 ? -1.967  28.102  -61.211 1.00 47.60  ? 191 HIS D O     1 
ATOM   6988 C  CB    . HIS D 1 115 ? 0.856   26.764  -61.443 1.00 41.44  ? 191 HIS D CB    1 
ATOM   6989 C  CG    . HIS D 1 115 ? 1.364   26.092  -60.203 1.00 46.22  ? 191 HIS D CG    1 
ATOM   6990 N  ND1   . HIS D 1 115 ? 0.941   26.441  -58.938 1.00 43.47  ? 191 HIS D ND1   1 
ATOM   6991 C  CD2   . HIS D 1 115 ? 2.248   25.078  -60.040 1.00 43.46  ? 191 HIS D CD2   1 
ATOM   6992 C  CE1   . HIS D 1 115 ? 1.551   25.676  -58.047 1.00 43.91  ? 191 HIS D CE1   1 
ATOM   6993 N  NE2   . HIS D 1 115 ? 2.348   24.841  -58.691 1.00 43.51  ? 191 HIS D NE2   1 
ATOM   6994 N  N     . PRO D 1 116 ? -2.101  26.220  -59.971 1.00 48.85  ? 192 PRO D N     1 
ATOM   6995 C  CA    . PRO D 1 116 ? -3.176  26.770  -59.133 1.00 45.55  ? 192 PRO D CA    1 
ATOM   6996 C  C     . PRO D 1 116 ? -2.715  27.910  -58.226 1.00 36.65  ? 192 PRO D C     1 
ATOM   6997 O  O     . PRO D 1 116 ? -3.541  28.700  -57.801 1.00 39.07  ? 192 PRO D O     1 
ATOM   6998 C  CB    . PRO D 1 116 ? -3.612  25.560  -58.279 1.00 39.49  ? 192 PRO D CB    1 
ATOM   6999 C  CG    . PRO D 1 116 ? -2.393  24.708  -58.201 1.00 43.06  ? 192 PRO D CG    1 
ATOM   7000 C  CD    . PRO D 1 116 ? -1.749  24.843  -59.578 1.00 47.89  ? 192 PRO D CD    1 
ATOM   7001 N  N     . LEU D 1 117 ? -1.424  27.988  -57.930 1.00 42.75  ? 193 LEU D N     1 
ATOM   7002 C  CA    . LEU D 1 117 ? -0.927  28.947  -56.945 1.00 42.93  ? 193 LEU D CA    1 
ATOM   7003 C  C     . LEU D 1 117 ? 0.009   30.016  -57.516 1.00 45.29  ? 193 LEU D C     1 
ATOM   7004 O  O     . LEU D 1 117 ? -0.139  31.193  -57.215 1.00 45.07  ? 193 LEU D O     1 
ATOM   7005 C  CB    . LEU D 1 117 ? -0.214  28.210  -55.813 1.00 39.32  ? 193 LEU D CB    1 
ATOM   7006 C  CG    . LEU D 1 117 ? -0.893  28.026  -54.458 1.00 43.97  ? 193 LEU D CG    1 
ATOM   7007 C  CD1   . LEU D 1 117 ? -2.419  28.113  -54.538 1.00 37.53  ? 193 LEU D CD1   1 
ATOM   7008 C  CD2   . LEU D 1 117 ? -0.451  26.699  -53.897 1.00 36.12  ? 193 LEU D CD2   1 
ATOM   7009 N  N     . TYR D 1 118 ? 0.987   29.617  -58.323 1.00 43.39  ? 194 TYR D N     1 
ATOM   7010 C  CA    . TYR D 1 118 ? 1.986   30.582  -58.771 1.00 40.91  ? 194 TYR D CA    1 
ATOM   7011 C  C     . TYR D 1 118 ? 1.762   31.017  -60.217 1.00 43.83  ? 194 TYR D C     1 
ATOM   7012 O  O     . TYR D 1 118 ? 1.700   30.192  -61.133 1.00 41.94  ? 194 TYR D O     1 
ATOM   7013 C  CB    . TYR D 1 118 ? 3.401   30.049  -58.514 1.00 39.47  ? 194 TYR D CB    1 
ATOM   7014 C  CG    . TYR D 1 118 ? 3.512   29.454  -57.131 1.00 37.05  ? 194 TYR D CG    1 
ATOM   7015 C  CD1   . TYR D 1 118 ? 3.434   30.270  -55.998 1.00 38.49  ? 194 TYR D CD1   1 
ATOM   7016 C  CD2   . TYR D 1 118 ? 3.636   28.082  -56.946 1.00 37.71  ? 194 TYR D CD2   1 
ATOM   7017 C  CE1   . TYR D 1 118 ? 3.504   29.741  -54.725 1.00 38.68  ? 194 TYR D CE1   1 
ATOM   7018 C  CE2   . TYR D 1 118 ? 3.714   27.527  -55.666 1.00 38.08  ? 194 TYR D CE2   1 
ATOM   7019 C  CZ    . TYR D 1 118 ? 3.641   28.363  -54.557 1.00 44.83  ? 194 TYR D CZ    1 
ATOM   7020 O  OH    . TYR D 1 118 ? 3.712   27.831  -53.285 1.00 38.83  ? 194 TYR D OH    1 
ATOM   7021 N  N     . HIS D 1 119 ? 1.652   32.329  -60.404 1.00 45.30  ? 195 HIS D N     1 
ATOM   7022 C  CA    . HIS D 1 119 ? 1.231   32.893  -61.675 1.00 39.80  ? 195 HIS D CA    1 
ATOM   7023 C  C     . HIS D 1 119 ? 2.158   33.980  -62.205 1.00 38.76  ? 195 HIS D C     1 
ATOM   7024 O  O     . HIS D 1 119 ? 1.870   34.585  -63.227 1.00 41.13  ? 195 HIS D O     1 
ATOM   7025 C  CB    . HIS D 1 119 ? -0.193  33.446  -61.563 1.00 45.81  ? 195 HIS D CB    1 
ATOM   7026 C  CG    . HIS D 1 119 ? -1.167  32.482  -60.967 1.00 42.21  ? 195 HIS D CG    1 
ATOM   7027 N  ND1   . HIS D 1 119 ? -2.026  32.829  -59.945 1.00 45.93  ? 195 HIS D ND1   1 
ATOM   7028 C  CD2   . HIS D 1 119 ? -1.408  31.177  -61.236 1.00 45.65  ? 195 HIS D CD2   1 
ATOM   7029 C  CE1   . HIS D 1 119 ? -2.756  31.778  -59.611 1.00 45.55  ? 195 HIS D CE1   1 
ATOM   7030 N  NE2   . HIS D 1 119 ? -2.405  30.764  -60.383 1.00 49.91  ? 195 HIS D NE2   1 
ATOM   7031 N  N     . TYR D 1 120 ? 3.269   34.243  -61.530 1.00 33.70  ? 196 TYR D N     1 
ATOM   7032 C  CA    . TYR D 1 120 ? 4.204   35.203  -62.091 1.00 35.30  ? 196 TYR D CA    1 
ATOM   7033 C  C     . TYR D 1 120 ? 4.932   34.624  -63.334 1.00 38.46  ? 196 TYR D C     1 
ATOM   7034 O  O     . TYR D 1 120 ? 5.165   33.425  -63.420 1.00 39.03  ? 196 TYR D O     1 
ATOM   7035 C  CB    . TYR D 1 120 ? 5.163   35.728  -61.022 1.00 33.61  ? 196 TYR D CB    1 
ATOM   7036 C  CG    . TYR D 1 120 ? 6.078   34.702  -60.377 1.00 43.50  ? 196 TYR D CG    1 
ATOM   7037 C  CD1   . TYR D 1 120 ? 5.648   33.896  -59.316 1.00 41.42  ? 196 TYR D CD1   1 
ATOM   7038 C  CD2   . TYR D 1 120 ? 7.396   34.577  -60.799 1.00 38.20  ? 196 TYR D CD2   1 
ATOM   7039 C  CE1   . TYR D 1 120 ? 6.527   32.985  -58.708 1.00 35.03  ? 196 TYR D CE1   1 
ATOM   7040 C  CE2   . TYR D 1 120 ? 8.257   33.672  -60.220 1.00 39.43  ? 196 TYR D CE2   1 
ATOM   7041 C  CZ    . TYR D 1 120 ? 7.829   32.882  -59.180 1.00 39.01  ? 196 TYR D CZ    1 
ATOM   7042 O  OH    . TYR D 1 120 ? 8.741   32.021  -58.620 1.00 36.14  ? 196 TYR D OH    1 
ATOM   7043 N  N     . LYS D 1 121 ? 5.263   35.484  -64.296 1.00 42.81  ? 197 LYS D N     1 
ATOM   7044 C  CA    . LYS D 1 121 ? 5.702   35.052  -65.632 1.00 39.43  ? 197 LYS D CA    1 
ATOM   7045 C  C     . LYS D 1 121 ? 6.894   34.105  -65.655 1.00 35.60  ? 197 LYS D C     1 
ATOM   7046 O  O     . LYS D 1 121 ? 6.954   33.212  -66.489 1.00 39.92  ? 197 LYS D O     1 
ATOM   7047 C  CB    . LYS D 1 121 ? 6.023   36.265  -66.526 1.00 34.62  ? 197 LYS D CB    1 
ATOM   7048 C  CG    . LYS D 1 121 ? 4.803   37.072  -66.963 1.00 44.25  ? 197 LYS D CG    1 
ATOM   7049 C  CD    . LYS D 1 121 ? 5.208   38.310  -67.776 1.00 51.82  ? 197 LYS D CD    1 
ATOM   7050 C  CE    . LYS D 1 121 ? 5.879   39.363  -66.892 1.00 42.99  ? 197 LYS D CE    1 
ATOM   7051 N  NZ    . LYS D 1 121 ? 6.194   40.621  -67.636 1.00 44.56  ? 197 LYS D NZ    1 
ATOM   7052 N  N     . THR D 1 122 ? 7.852   34.322  -64.761 1.00 34.23  ? 198 THR D N     1 
ATOM   7053 C  CA    . THR D 1 122 ? 9.090   33.561  -64.780 1.00 32.16  ? 198 THR D CA    1 
ATOM   7054 C  C     . THR D 1 122 ? 9.092   32.358  -63.828 1.00 37.01  ? 198 THR D C     1 
ATOM   7055 O  O     . THR D 1 122 ? 10.155  31.809  -63.537 1.00 34.28  ? 198 THR D O     1 
ATOM   7056 C  CB    . THR D 1 122 ? 10.233  34.433  -64.345 1.00 36.39  ? 198 THR D CB    1 
ATOM   7057 O  OG1   . THR D 1 122 ? 9.896   34.993  -63.070 1.00 38.26  ? 198 THR D OG1   1 
ATOM   7058 C  CG2   . THR D 1 122 ? 10.489  35.530  -65.360 1.00 27.36  ? 198 THR D CG2   1 
ATOM   7059 N  N     . TYR D 1 123 ? 7.917   31.979  -63.327 1.00 29.87  ? 199 TYR D N     1 
ATOM   7060 C  CA    . TYR D 1 123 ? 7.783   30.817  -62.464 1.00 38.48  ? 199 TYR D CA    1 
ATOM   7061 C  C     . TYR D 1 123 ? 8.043   29.533  -63.234 1.00 36.93  ? 199 TYR D C     1 
ATOM   7062 O  O     . TYR D 1 123 ? 7.306   29.210  -64.163 1.00 34.60  ? 199 TYR D O     1 
ATOM   7063 C  CB    . TYR D 1 123 ? 6.377   30.752  -61.873 1.00 32.13  ? 199 TYR D CB    1 
ATOM   7064 C  CG    . TYR D 1 123 ? 6.140   29.494  -61.067 1.00 40.90  ? 199 TYR D CG    1 
ATOM   7065 C  CD1   . TYR D 1 123 ? 6.854   29.254  -59.892 1.00 38.96  ? 199 TYR D CD1   1 
ATOM   7066 C  CD2   . TYR D 1 123 ? 5.197   28.546  -61.472 1.00 34.42  ? 199 TYR D CD2   1 
ATOM   7067 C  CE1   . TYR D 1 123 ? 6.632   28.100  -59.134 1.00 34.68  ? 199 TYR D CE1   1 
ATOM   7068 C  CE2   . TYR D 1 123 ? 4.972   27.397  -60.723 1.00 43.91  ? 199 TYR D CE2   1 
ATOM   7069 C  CZ    . TYR D 1 123 ? 5.692   27.176  -59.563 1.00 39.24  ? 199 TYR D CZ    1 
ATOM   7070 O  OH    . TYR D 1 123 ? 5.472   26.028  -58.839 1.00 37.82  ? 199 TYR D OH    1 
ATOM   7071 N  N     . VAL D 1 124 ? 9.079   28.798  -62.848 1.00 34.90  ? 200 VAL D N     1 
ATOM   7072 C  CA    . VAL D 1 124 ? 9.340   27.499  -63.459 1.00 28.83  ? 200 VAL D CA    1 
ATOM   7073 C  C     . VAL D 1 124 ? 9.292   26.299  -62.489 1.00 40.08  ? 200 VAL D C     1 
ATOM   7074 O  O     . VAL D 1 124 ? 10.002  25.303  -62.690 1.00 41.14  ? 200 VAL D O     1 
ATOM   7075 C  CB    . VAL D 1 124 ? 10.663  27.488  -64.240 1.00 34.13  ? 200 VAL D CB    1 
ATOM   7076 C  CG1   . VAL D 1 124 ? 10.535  28.351  -65.490 1.00 30.48  ? 200 VAL D CG1   1 
ATOM   7077 C  CG2   . VAL D 1 124 ? 11.830  27.922  -63.342 1.00 27.02  ? 200 VAL D CG2   1 
ATOM   7078 N  N     . GLY D 1 125 ? 8.448   26.372  -61.457 1.00 38.91  ? 201 GLY D N     1 
ATOM   7079 C  CA    . GLY D 1 125 ? 8.352   25.276  -60.494 1.00 37.54  ? 201 GLY D CA    1 
ATOM   7080 C  C     . GLY D 1 125 ? 7.297   24.229  -60.819 1.00 36.76  ? 201 GLY D C     1 
ATOM   7081 O  O     . GLY D 1 125 ? 6.631   24.288  -61.846 1.00 35.62  ? 201 GLY D O     1 
ATOM   7082 N  N     . GLY D 1 126 ? 7.133   23.257  -59.933 1.00 37.18  ? 202 GLY D N     1 
ATOM   7083 C  CA    . GLY D 1 126 ? 6.121   22.242  -60.141 1.00 36.92  ? 202 GLY D CA    1 
ATOM   7084 C  C     . GLY D 1 126 ? 6.590   21.093  -61.024 1.00 43.63  ? 202 GLY D C     1 
ATOM   7085 O  O     . GLY D 1 126 ? 7.053   20.064  -60.510 1.00 38.97  ? 202 GLY D O     1 
ATOM   7086 N  N     . ILE D 1 127 ? 6.454   21.263  -62.344 1.00 35.08  ? 203 ILE D N     1 
ATOM   7087 C  CA    . ILE D 1 127 ? 6.817   20.235  -63.315 1.00 36.22  ? 203 ILE D CA    1 
ATOM   7088 C  C     . ILE D 1 127 ? 7.629   20.834  -64.474 1.00 43.79  ? 203 ILE D C     1 
ATOM   7089 O  O     . ILE D 1 127 ? 7.118   21.630  -65.259 1.00 43.59  ? 203 ILE D O     1 
ATOM   7090 C  CB    . ILE D 1 127 ? 5.577   19.510  -63.863 1.00 36.54  ? 203 ILE D CB    1 
ATOM   7091 C  CG1   . ILE D 1 127 ? 4.728   18.940  -62.715 1.00 35.14  ? 203 ILE D CG1   1 
ATOM   7092 C  CG2   . ILE D 1 127 ? 6.012   18.382  -64.792 1.00 38.86  ? 203 ILE D CG2   1 
ATOM   7093 C  CD1   . ILE D 1 127 ? 3.274   18.677  -63.082 1.00 33.38  ? 203 ILE D CD1   1 
ATOM   7094 N  N     . LEU D 1 128 ? 8.898   20.453  -64.576 1.00 37.89  ? 204 LEU D N     1 
ATOM   7095 C  CA    . LEU D 1 128 ? 9.777   21.050  -65.571 1.00 45.21  ? 204 LEU D CA    1 
ATOM   7096 C  C     . LEU D 1 128 ? 10.641  19.998  -66.295 1.00 45.18  ? 204 LEU D C     1 
ATOM   7097 O  O     . LEU D 1 128 ? 11.406  19.267  -65.662 1.00 39.78  ? 204 LEU D O     1 
ATOM   7098 C  CB    . LEU D 1 128 ? 10.649  22.116  -64.912 1.00 34.65  ? 204 LEU D CB    1 
ATOM   7099 C  CG    . LEU D 1 128 ? 11.629  22.910  -65.757 1.00 31.91  ? 204 LEU D CG    1 
ATOM   7100 C  CD1   . LEU D 1 128 ? 10.883  23.813  -66.726 1.00 36.90  ? 204 LEU D CD1   1 
ATOM   7101 C  CD2   . LEU D 1 128 ? 12.540  23.689  -64.845 1.00 28.04  ? 204 LEU D CD2   1 
ATOM   7102 N  N     . LEU D 1 129 ? 10.515  19.948  -67.622 1.00 41.68  ? 205 LEU D N     1 
ATOM   7103 C  CA    . LEU D 1 129 ? 11.203  18.939  -68.436 1.00 44.36  ? 205 LEU D CA    1 
ATOM   7104 C  C     . LEU D 1 129 ? 12.414  19.503  -69.161 1.00 42.95  ? 205 LEU D C     1 
ATOM   7105 O  O     . LEU D 1 129 ? 12.345  20.581  -69.753 1.00 50.35  ? 205 LEU D O     1 
ATOM   7106 C  CB    . LEU D 1 129 ? 10.251  18.339  -69.468 1.00 42.21  ? 205 LEU D CB    1 
ATOM   7107 C  CG    . LEU D 1 129 ? 9.246   17.294  -68.982 1.00 41.94  ? 205 LEU D CG    1 
ATOM   7108 C  CD1   . LEU D 1 129 ? 8.182   17.917  -68.098 1.00 33.96  ? 205 LEU D CD1   1 
ATOM   7109 C  CD2   . LEU D 1 129 ? 8.605   16.605  -70.169 1.00 42.61  ? 205 LEU D CD2   1 
ATOM   7110 N  N     . LEU D 1 130 ? 13.530  18.787  -69.097 1.00 41.48  ? 206 LEU D N     1 
ATOM   7111 C  CA    . LEU D 1 130 ? 14.711  19.152  -69.862 1.00 37.62  ? 206 LEU D CA    1 
ATOM   7112 C  C     . LEU D 1 130 ? 15.317  17.890  -70.455 1.00 50.13  ? 206 LEU D C     1 
ATOM   7113 O  O     . LEU D 1 130 ? 15.226  16.815  -69.852 1.00 37.67  ? 206 LEU D O     1 
ATOM   7114 C  CB    . LEU D 1 130 ? 15.760  19.833  -68.983 1.00 35.36  ? 206 LEU D CB    1 
ATOM   7115 C  CG    . LEU D 1 130 ? 15.510  21.213  -68.367 1.00 40.36  ? 206 LEU D CG    1 
ATOM   7116 C  CD1   . LEU D 1 130 ? 14.674  21.093  -67.089 1.00 32.31  ? 206 LEU D CD1   1 
ATOM   7117 C  CD2   . LEU D 1 130 ? 16.843  21.909  -68.090 1.00 35.29  ? 206 LEU D CD2   1 
ATOM   7118 N  N     . SER D 1 131 ? 15.941  18.026  -71.625 1.00 36.30  ? 207 SER D N     1 
ATOM   7119 C  CA    . SER D 1 131 ? 16.749  16.958  -72.181 1.00 40.00  ? 207 SER D CA    1 
ATOM   7120 C  C     . SER D 1 131 ? 18.007  16.863  -71.329 1.00 42.60  ? 207 SER D C     1 
ATOM   7121 O  O     . SER D 1 131 ? 18.374  17.831  -70.670 1.00 36.90  ? 207 SER D O     1 
ATOM   7122 C  CB    . SER D 1 131 ? 17.109  17.255  -73.643 1.00 43.16  ? 207 SER D CB    1 
ATOM   7123 O  OG    . SER D 1 131 ? 17.870  18.450  -73.761 1.00 43.18  ? 207 SER D OG    1 
ATOM   7124 N  N     . LYS D 1 132 ? 18.659  15.701  -71.325 1.00 41.86  ? 208 LYS D N     1 
ATOM   7125 C  CA    . LYS D 1 132 ? 19.900  15.560  -70.571 1.00 42.18  ? 208 LYS D CA    1 
ATOM   7126 C  C     . LYS D 1 132 ? 20.925  16.596  -71.017 1.00 50.13  ? 208 LYS D C     1 
ATOM   7127 O  O     . LYS D 1 132 ? 21.565  17.247  -70.179 1.00 49.97  ? 208 LYS D O     1 
ATOM   7128 C  CB    . LYS D 1 132 ? 20.452  14.144  -70.679 1.00 38.70  ? 208 LYS D CB    1 
ATOM   7129 C  CG    . LYS D 1 132 ? 19.580  13.125  -69.920 1.00 55.95  ? 208 LYS D CG    1 
ATOM   7130 C  CD    . LYS D 1 132 ? 20.399  12.038  -69.225 1.00 54.52  ? 208 LYS D CD    1 
ATOM   7131 C  CE    . LYS D 1 132 ? 19.586  11.351  -68.127 1.00 55.55  ? 208 LYS D CE    1 
ATOM   7132 N  NZ    . LYS D 1 132 ? 20.400  10.324  -67.410 1.00 68.19  ? 208 LYS D NZ    1 
ATOM   7133 N  N     . GLN D 1 133 ? 21.041  16.767  -72.335 1.00 40.30  ? 209 GLN D N     1 
ATOM   7134 C  CA    . GLN D 1 133 ? 21.911  17.779  -72.927 1.00 40.23  ? 209 GLN D CA    1 
ATOM   7135 C  C     . GLN D 1 133 ? 21.669  19.178  -72.323 1.00 43.26  ? 209 GLN D C     1 
ATOM   7136 O  O     . GLN D 1 133 ? 22.597  19.801  -71.795 1.00 48.16  ? 209 GLN D O     1 
ATOM   7137 C  CB    . GLN D 1 133 ? 21.744  17.767  -74.453 1.00 41.99  ? 209 GLN D CB    1 
ATOM   7138 C  CG    . GLN D 1 133 ? 22.291  18.975  -75.185 1.00 55.19  ? 209 GLN D CG    1 
ATOM   7139 C  CD    . GLN D 1 133 ? 22.077  18.881  -76.689 1.00 66.25  ? 209 GLN D CD    1 
ATOM   7140 O  OE1   . GLN D 1 133 ? 22.573  17.958  -77.340 1.00 73.50  ? 209 GLN D OE1   1 
ATOM   7141 N  NE2   . GLN D 1 133 ? 21.331  19.832  -77.247 1.00 63.34  ? 209 GLN D NE2   1 
ATOM   7142 N  N     . HIS D 1 134 ? 20.428  19.660  -72.359 1.00 38.97  ? 210 HIS D N     1 
ATOM   7143 C  CA    . HIS D 1 134 ? 20.140  20.988  -71.796 1.00 45.29  ? 210 HIS D CA    1 
ATOM   7144 C  C     . HIS D 1 134 ? 20.343  21.078  -70.282 1.00 45.62  ? 210 HIS D C     1 
ATOM   7145 O  O     . HIS D 1 134 ? 20.775  22.119  -69.782 1.00 48.79  ? 210 HIS D O     1 
ATOM   7146 C  CB    . HIS D 1 134 ? 18.739  21.484  -72.181 1.00 44.71  ? 210 HIS D CB    1 
ATOM   7147 C  CG    . HIS D 1 134 ? 18.600  21.823  -73.631 1.00 47.05  ? 210 HIS D CG    1 
ATOM   7148 N  ND1   . HIS D 1 134 ? 17.376  21.968  -74.250 1.00 46.83  ? 210 HIS D ND1   1 
ATOM   7149 C  CD2   . HIS D 1 134 ? 19.534  22.035  -74.589 1.00 42.19  ? 210 HIS D CD2   1 
ATOM   7150 C  CE1   . HIS D 1 134 ? 17.561  22.255  -75.527 1.00 47.23  ? 210 HIS D CE1   1 
ATOM   7151 N  NE2   . HIS D 1 134 ? 18.861  22.304  -75.757 1.00 47.01  ? 210 HIS D NE2   1 
ATOM   7152 N  N     . TYR D 1 135 ? 20.044  20.003  -69.549 1.00 40.37  ? 211 TYR D N     1 
ATOM   7153 C  CA    . TYR D 1 135 ? 20.246  20.031  -68.106 1.00 39.82  ? 211 TYR D CA    1 
ATOM   7154 C  C     . TYR D 1 135 ? 21.729  20.179  -67.776 1.00 40.26  ? 211 TYR D C     1 
ATOM   7155 O  O     . TYR D 1 135 ? 22.099  20.966  -66.894 1.00 44.18  ? 211 TYR D O     1 
ATOM   7156 C  CB    . TYR D 1 135 ? 19.647  18.791  -67.419 1.00 41.16  ? 211 TYR D CB    1 
ATOM   7157 C  CG    . TYR D 1 135 ? 19.565  18.919  -65.905 1.00 37.37  ? 211 TYR D CG    1 
ATOM   7158 C  CD1   . TYR D 1 135 ? 18.456  19.516  -65.295 1.00 45.63  ? 211 TYR D CD1   1 
ATOM   7159 C  CD2   . TYR D 1 135 ? 20.595  18.458  -65.090 1.00 36.50  ? 211 TYR D CD2   1 
ATOM   7160 C  CE1   . TYR D 1 135 ? 18.369  19.641  -63.907 1.00 39.93  ? 211 TYR D CE1   1 
ATOM   7161 C  CE2   . TYR D 1 135 ? 20.517  18.557  -63.706 1.00 39.95  ? 211 TYR D CE2   1 
ATOM   7162 C  CZ    . TYR D 1 135 ? 19.407  19.164  -63.120 1.00 44.73  ? 211 TYR D CZ    1 
ATOM   7163 O  OH    . TYR D 1 135 ? 19.338  19.299  -61.752 1.00 40.29  ? 211 TYR D OH    1 
ATOM   7164 N  N     . ARG D 1 136 ? 22.569  19.434  -68.498 1.00 44.32  ? 212 ARG D N     1 
ATOM   7165 C  CA    . ARG D 1 136 ? 24.024  19.539  -68.358 1.00 48.04  ? 212 ARG D CA    1 
ATOM   7166 C  C     . ARG D 1 136 ? 24.512  20.937  -68.716 1.00 45.46  ? 212 ARG D C     1 
ATOM   7167 O  O     . ARG D 1 136 ? 25.342  21.518  -68.008 1.00 47.81  ? 212 ARG D O     1 
ATOM   7168 C  CB    . ARG D 1 136 ? 24.737  18.501  -69.231 1.00 46.80  ? 212 ARG D CB    1 
ATOM   7169 C  CG    . ARG D 1 136 ? 24.442  17.062  -68.828 1.00 56.34  ? 212 ARG D CG    1 
ATOM   7170 C  CD    . ARG D 1 136 ? 25.577  16.107  -69.205 1.00 58.84  ? 212 ARG D CD    1 
ATOM   7171 N  NE    . ARG D 1 136 ? 25.770  15.080  -68.181 1.00 59.23  ? 212 ARG D NE    1 
ATOM   7172 C  CZ    . ARG D 1 136 ? 26.368  15.288  -67.004 1.00 66.92  ? 212 ARG D CZ    1 
ATOM   7173 N  NH1   . ARG D 1 136 ? 26.844  16.491  -66.685 1.00 60.34  ? 212 ARG D NH1   1 
ATOM   7174 N  NH2   . ARG D 1 136 ? 26.485  14.288  -66.137 1.00 65.12  ? 212 ARG D NH2   1 
ATOM   7175 N  N     . LEU D 1 137 ? 23.986  21.474  -69.811 1.00 44.24  ? 213 LEU D N     1 
ATOM   7176 C  CA    . LEU D 1 137 ? 24.361  22.821  -70.266 1.00 49.76  ? 213 LEU D CA    1 
ATOM   7177 C  C     . LEU D 1 137 ? 24.165  23.913  -69.200 1.00 47.18  ? 213 LEU D C     1 
ATOM   7178 O  O     . LEU D 1 137 ? 24.993  24.809  -69.091 1.00 55.71  ? 213 LEU D O     1 
ATOM   7179 C  CB    . LEU D 1 137 ? 23.625  23.179  -71.560 1.00 46.80  ? 213 LEU D CB    1 
ATOM   7180 C  CG    . LEU D 1 137 ? 24.001  24.517  -72.201 1.00 59.02  ? 213 LEU D CG    1 
ATOM   7181 C  CD1   . LEU D 1 137 ? 25.460  24.512  -72.622 1.00 48.92  ? 213 LEU D CD1   1 
ATOM   7182 C  CD2   . LEU D 1 137 ? 23.087  24.803  -73.381 1.00 49.52  ? 213 LEU D CD2   1 
ATOM   7183 N  N     . CYS D 1 138 ? 23.096  23.823  -68.402 1.00 47.68  ? 214 CYS D N     1 
ATOM   7184 C  CA    . CYS D 1 138 ? 22.878  24.755  -67.279 1.00 42.90  ? 214 CYS D CA    1 
ATOM   7185 C  C     . CYS D 1 138 ? 23.673  24.410  -66.020 1.00 38.76  ? 214 CYS D C     1 
ATOM   7186 O  O     . CYS D 1 138 ? 23.524  25.079  -65.002 1.00 42.11  ? 214 CYS D O     1 
ATOM   7187 C  CB    . CYS D 1 138 ? 21.406  24.801  -66.856 1.00 36.89  ? 214 CYS D CB    1 
ATOM   7188 S  SG    . CYS D 1 138 ? 20.182  25.039  -68.139 1.00 47.02  ? 214 CYS D SG    1 
ATOM   7189 N  N     . ASN D 1 139 ? 24.485  23.361  -66.077 1.00 44.57  ? 215 ASN D N     1 
ATOM   7190 C  CA    . ASN D 1 139 ? 25.106  22.795  -64.878 1.00 45.82  ? 215 ASN D CA    1 
ATOM   7191 C  C     . ASN D 1 139 ? 24.046  22.437  -63.832 1.00 44.91  ? 215 ASN D C     1 
ATOM   7192 O  O     . ASN D 1 139 ? 24.231  22.667  -62.625 1.00 45.97  ? 215 ASN D O     1 
ATOM   7193 C  CB    . ASN D 1 139 ? 26.163  23.738  -64.270 1.00 39.80  ? 215 ASN D CB    1 
ATOM   7194 C  CG    . ASN D 1 139 ? 27.044  23.028  -63.235 1.00 48.24  ? 215 ASN D CG    1 
ATOM   7195 O  OD1   . ASN D 1 139 ? 27.245  21.814  -63.314 1.00 51.45  ? 215 ASN D OD1   1 
ATOM   7196 N  ND2   . ASN D 1 139 ? 27.548  23.772  -62.259 1.00 49.05  ? 215 ASN D ND2   1 
ATOM   7197 N  N     . GLY D 1 140 ? 22.920  21.900  -64.291 1.00 41.28  ? 216 GLY D N     1 
ATOM   7198 C  CA    . GLY D 1 140 ? 21.843  21.547  -63.374 1.00 41.29  ? 216 GLY D CA    1 
ATOM   7199 C  C     . GLY D 1 140 ? 21.354  22.720  -62.544 1.00 39.14  ? 216 GLY D C     1 
ATOM   7200 O  O     . GLY D 1 140 ? 21.332  23.849  -63.027 1.00 39.55  ? 216 GLY D O     1 
ATOM   7201 N  N     . MET D 1 141 ? 20.972  22.455  -61.296 1.00 40.34  ? 217 MET D N     1 
ATOM   7202 C  CA    . MET D 1 141 ? 20.405  23.476  -60.416 1.00 36.09  ? 217 MET D CA    1 
ATOM   7203 C  C     . MET D 1 141 ? 21.393  23.826  -59.315 1.00 44.89  ? 217 MET D C     1 
ATOM   7204 O  O     . MET D 1 141 ? 22.398  23.136  -59.131 1.00 42.18  ? 217 MET D O     1 
ATOM   7205 C  CB    . MET D 1 141 ? 19.086  23.001  -59.800 1.00 34.72  ? 217 MET D CB    1 
ATOM   7206 C  CG    . MET D 1 141 ? 18.086  22.476  -60.812 1.00 39.00  ? 217 MET D CG    1 
ATOM   7207 S  SD    . MET D 1 141 ? 16.502  21.959  -60.097 1.00 42.41  ? 217 MET D SD    1 
ATOM   7208 C  CE    . MET D 1 141 ? 15.858  23.571  -59.595 1.00 37.43  ? 217 MET D CE    1 
ATOM   7209 N  N     . SER D 1 142 ? 21.112  24.908  -58.594 1.00 38.86  ? 218 SER D N     1 
ATOM   7210 C  CA    . SER D 1 142 ? 21.901  25.271  -57.425 1.00 41.80  ? 218 SER D CA    1 
ATOM   7211 C  C     . SER D 1 142 ? 21.683  24.288  -56.263 1.00 43.86  ? 218 SER D C     1 
ATOM   7212 O  O     . SER D 1 142 ? 20.590  23.732  -56.097 1.00 41.89  ? 218 SER D O     1 
ATOM   7213 C  CB    . SER D 1 142 ? 21.546  26.689  -56.966 1.00 38.35  ? 218 SER D CB    1 
ATOM   7214 O  OG    . SER D 1 142 ? 22.305  27.055  -55.822 1.00 39.42  ? 218 SER D OG    1 
ATOM   7215 N  N     . ASN D 1 143 ? 22.720  24.092  -55.454 1.00 41.47  ? 219 ASN D N     1 
ATOM   7216 C  CA    . ASN D 1 143 ? 22.616  23.268  -54.261 1.00 38.42  ? 219 ASN D CA    1 
ATOM   7217 C  C     . ASN D 1 143 ? 22.485  24.123  -53.006 1.00 43.27  ? 219 ASN D C     1 
ATOM   7218 O  O     . ASN D 1 143 ? 22.402  23.596  -51.894 1.00 46.94  ? 219 ASN D O     1 
ATOM   7219 C  CB    . ASN D 1 143 ? 23.832  22.340  -54.118 1.00 38.61  ? 219 ASN D CB    1 
ATOM   7220 C  CG    . ASN D 1 143 ? 24.063  21.460  -55.346 1.00 43.40  ? 219 ASN D CG    1 
ATOM   7221 O  OD1   . ASN D 1 143 ? 23.150  20.793  -55.850 1.00 39.49  ? 219 ASN D OD1   1 
ATOM   7222 N  ND2   . ASN D 1 143 ? 25.297  21.466  -55.837 1.00 40.94  ? 219 ASN D ND2   1 
ATOM   7223 N  N     . ARG D 1 144 ? 22.457  25.442  -53.181 1.00 45.67  ? 220 ARG D N     1 
ATOM   7224 C  CA    . ARG D 1 144 ? 22.495  26.377  -52.046 1.00 43.07  ? 220 ARG D CA    1 
ATOM   7225 C  C     . ARG D 1 144 ? 21.137  26.670  -51.399 1.00 47.14  ? 220 ARG D C     1 
ATOM   7226 O  O     . ARG D 1 144 ? 21.070  27.378  -50.390 1.00 46.91  ? 220 ARG D O     1 
ATOM   7227 C  CB    . ARG D 1 144 ? 23.150  27.703  -52.464 1.00 51.96  ? 220 ARG D CB    1 
ATOM   7228 C  CG    . ARG D 1 144 ? 24.581  27.574  -52.985 1.00 52.71  ? 220 ARG D CG    1 
ATOM   7229 C  CD    . ARG D 1 144 ? 25.137  28.921  -53.428 1.00 55.20  ? 220 ARG D CD    1 
ATOM   7230 N  NE    . ARG D 1 144 ? 25.034  29.914  -52.362 1.00 60.96  ? 220 ARG D NE    1 
ATOM   7231 C  CZ    . ARG D 1 144 ? 25.993  30.161  -51.473 1.00 65.44  ? 220 ARG D CZ    1 
ATOM   7232 N  NH1   . ARG D 1 144 ? 27.140  29.487  -51.528 1.00 60.52  ? 220 ARG D NH1   1 
ATOM   7233 N  NH2   . ARG D 1 144 ? 25.802  31.082  -50.529 1.00 55.32  ? 220 ARG D NH2   1 
ATOM   7234 N  N     . PHE D 1 145 ? 20.057  26.133  -51.964 1.00 45.82  ? 221 PHE D N     1 
ATOM   7235 C  CA    . PHE D 1 145 ? 18.715  26.464  -51.475 1.00 40.05  ? 221 PHE D CA    1 
ATOM   7236 C  C     . PHE D 1 145 ? 18.120  25.421  -50.487 1.00 50.54  ? 221 PHE D C     1 
ATOM   7237 O  O     . PHE D 1 145 ? 17.683  24.321  -50.883 1.00 45.78  ? 221 PHE D O     1 
ATOM   7238 C  CB    . PHE D 1 145 ? 17.788  26.756  -52.663 1.00 41.49  ? 221 PHE D CB    1 
ATOM   7239 C  CG    . PHE D 1 145 ? 18.174  28.005  -53.445 1.00 41.74  ? 221 PHE D CG    1 
ATOM   7240 C  CD1   . PHE D 1 145 ? 19.097  27.942  -54.479 1.00 40.03  ? 221 PHE D CD1   1 
ATOM   7241 C  CD2   . PHE D 1 145 ? 17.626  29.242  -53.123 1.00 43.68  ? 221 PHE D CD2   1 
ATOM   7242 C  CE1   . PHE D 1 145 ? 19.460  29.083  -55.192 1.00 41.07  ? 221 PHE D CE1   1 
ATOM   7243 C  CE2   . PHE D 1 145 ? 17.985  30.394  -53.821 1.00 45.18  ? 221 PHE D CE2   1 
ATOM   7244 C  CZ    . PHE D 1 145 ? 18.908  30.315  -54.865 1.00 40.44  ? 221 PHE D CZ    1 
ATOM   7245 N  N     . TRP D 1 146 ? 18.124  25.775  -49.199 1.00 42.54  ? 222 TRP D N     1 
ATOM   7246 C  CA    . TRP D 1 146 ? 17.603  24.917  -48.136 1.00 44.45  ? 222 TRP D CA    1 
ATOM   7247 C  C     . TRP D 1 146 ? 16.314  25.518  -47.586 1.00 45.73  ? 222 TRP D C     1 
ATOM   7248 O  O     . TRP D 1 146 ? 16.299  26.659  -47.116 1.00 49.04  ? 222 TRP D O     1 
ATOM   7249 C  CB    . TRP D 1 146 ? 18.623  24.768  -47.004 1.00 45.31  ? 222 TRP D CB    1 
ATOM   7250 C  CG    . TRP D 1 146 ? 19.950  24.300  -47.462 1.00 47.14  ? 222 TRP D CG    1 
ATOM   7251 C  CD1   . TRP D 1 146 ? 20.995  25.078  -47.878 1.00 46.68  ? 222 TRP D CD1   1 
ATOM   7252 C  CD2   . TRP D 1 146 ? 20.392  22.937  -47.575 1.00 51.43  ? 222 TRP D CD2   1 
ATOM   7253 N  NE1   . TRP D 1 146 ? 22.058  24.284  -48.244 1.00 50.04  ? 222 TRP D NE1   1 
ATOM   7254 C  CE2   . TRP D 1 146 ? 21.711  22.964  -48.069 1.00 52.41  ? 222 TRP D CE2   1 
ATOM   7255 C  CE3   . TRP D 1 146 ? 19.799  21.695  -47.307 1.00 50.39  ? 222 TRP D CE3   1 
ATOM   7256 C  CZ2   . TRP D 1 146 ? 22.448  21.801  -48.294 1.00 47.44  ? 222 TRP D CZ2   1 
ATOM   7257 C  CZ3   . TRP D 1 146 ? 20.534  20.543  -47.537 1.00 46.96  ? 222 TRP D CZ3   1 
ATOM   7258 C  CH2   . TRP D 1 146 ? 21.841  20.606  -48.021 1.00 46.51  ? 222 TRP D CH2   1 
ATOM   7259 N  N     . GLY D 1 147 ? 15.233  24.752  -47.633 1.00 39.28  ? 223 GLY D N     1 
ATOM   7260 C  CA    . GLY D 1 147 ? 13.932  25.276  -47.261 1.00 41.01  ? 223 GLY D CA    1 
ATOM   7261 C  C     . GLY D 1 147 ? 13.169  25.638  -48.516 1.00 38.94  ? 223 GLY D C     1 
ATOM   7262 O  O     . GLY D 1 147 ? 13.739  25.670  -49.601 1.00 41.98  ? 223 GLY D O     1 
ATOM   7263 N  N     . TRP D 1 148 ? 11.879  25.898  -48.371 1.00 36.27  ? 224 TRP D N     1 
ATOM   7264 C  CA    . TRP D 1 148 ? 11.037  26.287  -49.494 1.00 39.75  ? 224 TRP D CA    1 
ATOM   7265 C  C     . TRP D 1 148 ? 11.549  27.590  -50.150 1.00 41.66  ? 224 TRP D C     1 
ATOM   7266 O  O     . TRP D 1 148 ? 12.091  28.454  -49.466 1.00 40.45  ? 224 TRP D O     1 
ATOM   7267 C  CB    . TRP D 1 148 ? 9.587   26.449  -48.995 1.00 37.49  ? 224 TRP D CB    1 
ATOM   7268 C  CG    . TRP D 1 148 ? 8.601   26.872  -50.052 1.00 37.37  ? 224 TRP D CG    1 
ATOM   7269 C  CD1   . TRP D 1 148 ? 7.720   26.062  -50.724 1.00 35.54  ? 224 TRP D CD1   1 
ATOM   7270 C  CD2   . TRP D 1 148 ? 8.383   28.204  -50.551 1.00 32.28  ? 224 TRP D CD2   1 
ATOM   7271 N  NE1   . TRP D 1 148 ? 6.980   26.807  -51.613 1.00 42.33  ? 224 TRP D NE1   1 
ATOM   7272 C  CE2   . TRP D 1 148 ? 7.367   28.124  -51.526 1.00 34.26  ? 224 TRP D CE2   1 
ATOM   7273 C  CE3   . TRP D 1 148 ? 8.949   29.456  -50.266 1.00 43.41  ? 224 TRP D CE3   1 
ATOM   7274 C  CZ2   . TRP D 1 148 ? 6.912   29.244  -52.226 1.00 38.08  ? 224 TRP D CZ2   1 
ATOM   7275 C  CZ3   . TRP D 1 148 ? 8.504   30.571  -50.971 1.00 34.00  ? 224 TRP D CZ3   1 
ATOM   7276 C  CH2   . TRP D 1 148 ? 7.490   30.455  -51.937 1.00 40.50  ? 224 TRP D CH2   1 
ATOM   7277 N  N     . GLY D 1 149 ? 11.400  27.719  -51.469 1.00 42.34  ? 225 GLY D N     1 
ATOM   7278 C  CA    . GLY D 1 149 ? 11.609  29.002  -52.135 1.00 34.29  ? 225 GLY D CA    1 
ATOM   7279 C  C     . GLY D 1 149 ? 12.828  29.244  -53.006 1.00 38.31  ? 225 GLY D C     1 
ATOM   7280 O  O     . GLY D 1 149 ? 13.941  28.837  -52.672 1.00 41.64  ? 225 GLY D O     1 
ATOM   7281 N  N     . ARG D 1 150 ? 12.587  29.897  -54.144 1.00 36.34  ? 226 ARG D N     1 
ATOM   7282 C  CA    . ARG D 1 150 ? 13.618  30.586  -54.934 1.00 36.04  ? 226 ARG D CA    1 
ATOM   7283 C  C     . ARG D 1 150 ? 14.561  29.728  -55.788 1.00 43.09  ? 226 ARG D C     1 
ATOM   7284 O  O     . ARG D 1 150 ? 15.264  30.273  -56.637 1.00 37.85  ? 226 ARG D O     1 
ATOM   7285 C  CB    . ARG D 1 150 ? 14.462  31.510  -54.058 1.00 39.56  ? 226 ARG D CB    1 
ATOM   7286 C  CG    . ARG D 1 150 ? 13.732  32.705  -53.448 1.00 45.99  ? 226 ARG D CG    1 
ATOM   7287 C  CD    . ARG D 1 150 ? 12.587  33.208  -54.311 1.00 35.05  ? 226 ARG D CD    1 
ATOM   7288 N  NE    . ARG D 1 150 ? 11.375  33.179  -53.519 1.00 40.05  ? 226 ARG D NE    1 
ATOM   7289 C  CZ    . ARG D 1 150 ? 10.145  33.140  -54.015 1.00 39.42  ? 226 ARG D CZ    1 
ATOM   7290 N  NH1   . ARG D 1 150 ? 9.942   33.143  -55.322 1.00 28.06  ? 226 ARG D NH1   1 
ATOM   7291 N  NH2   . ARG D 1 150 ? 9.116   33.106  -53.182 1.00 34.67  ? 226 ARG D NH2   1 
ATOM   7292 N  N     . GLU D 1 151 ? 14.590  28.411  -55.570 1.00 35.74  ? 227 GLU D N     1 
ATOM   7293 C  CA    . GLU D 1 151 ? 15.545  27.569  -56.281 1.00 34.99  ? 227 GLU D CA    1 
ATOM   7294 C  C     . GLU D 1 151 ? 15.121  27.412  -57.740 1.00 36.22  ? 227 GLU D C     1 
ATOM   7295 O  O     . GLU D 1 151 ? 15.951  27.321  -58.636 1.00 38.10  ? 227 GLU D O     1 
ATOM   7296 C  CB    . GLU D 1 151 ? 15.731  26.212  -55.578 1.00 37.07  ? 227 GLU D CB    1 
ATOM   7297 C  CG    . GLU D 1 151 ? 14.752  25.109  -55.992 1.00 30.53  ? 227 GLU D CG    1 
ATOM   7298 C  CD    . GLU D 1 151 ? 13.301  25.387  -55.612 1.00 37.87  ? 227 GLU D CD    1 
ATOM   7299 O  OE1   . GLU D 1 151 ? 13.024  26.232  -54.717 1.00 36.09  ? 227 GLU D OE1   1 
ATOM   7300 O  OE2   . GLU D 1 151 ? 12.429  24.743  -56.225 1.00 29.31  ? 227 GLU D OE2   1 
ATOM   7301 N  N     . ASP D 1 152 ? 13.819  27.409  -57.982 1.00 34.11  ? 228 ASP D N     1 
ATOM   7302 C  CA    . ASP D 1 152 ? 13.329  27.414  -59.348 1.00 30.16  ? 228 ASP D CA    1 
ATOM   7303 C  C     . ASP D 1 152 ? 13.624  28.780  -60.022 1.00 39.45  ? 228 ASP D C     1 
ATOM   7304 O  O     . ASP D 1 152 ? 14.026  28.836  -61.186 1.00 34.70  ? 228 ASP D O     1 
ATOM   7305 C  CB    . ASP D 1 152 ? 11.835  27.082  -59.356 1.00 30.48  ? 228 ASP D CB    1 
ATOM   7306 C  CG    . ASP D 1 152 ? 11.076  27.797  -58.255 1.00 39.51  ? 228 ASP D CG    1 
ATOM   7307 O  OD1   . ASP D 1 152 ? 11.721  28.528  -57.465 1.00 37.72  ? 228 ASP D OD1   1 
ATOM   7308 O  OD2   . ASP D 1 152 ? 9.836   27.634  -58.186 1.00 36.87  ? 228 ASP D OD2   1 
ATOM   7309 N  N     . ASP D 1 153 ? 13.448  29.869  -59.278 1.00 34.04  ? 229 ASP D N     1 
ATOM   7310 C  CA    . ASP D 1 153 ? 13.760  31.207  -59.795 1.00 38.89  ? 229 ASP D CA    1 
ATOM   7311 C  C     . ASP D 1 153 ? 15.231  31.324  -60.183 1.00 41.49  ? 229 ASP D C     1 
ATOM   7312 O  O     . ASP D 1 153 ? 15.560  31.872  -61.229 1.00 39.45  ? 229 ASP D O     1 
ATOM   7313 C  CB    . ASP D 1 153 ? 13.380  32.299  -58.783 1.00 33.43  ? 229 ASP D CB    1 
ATOM   7314 C  CG    . ASP D 1 153 ? 11.887  32.305  -58.460 1.00 37.18  ? 229 ASP D CG    1 
ATOM   7315 O  OD1   . ASP D 1 153 ? 11.067  32.063  -59.372 1.00 35.13  ? 229 ASP D OD1   1 
ATOM   7316 O  OD2   . ASP D 1 153 ? 11.531  32.543  -57.292 1.00 37.69  ? 229 ASP D OD2   1 
ATOM   7317 N  N     . GLU D 1 154 ? 16.119  30.794  -59.350 1.00 45.74  ? 230 GLU D N     1 
ATOM   7318 C  CA    . GLU D 1 154 ? 17.534  30.799  -59.686 1.00 39.52  ? 230 GLU D CA    1 
ATOM   7319 C  C     . GLU D 1 154 ? 17.786  29.974  -60.962 1.00 45.88  ? 230 GLU D C     1 
ATOM   7320 O  O     . GLU D 1 154 ? 18.634  30.321  -61.787 1.00 46.99  ? 230 GLU D O     1 
ATOM   7321 C  CB    . GLU D 1 154 ? 18.353  30.257  -58.514 1.00 46.94  ? 230 GLU D CB    1 
ATOM   7322 C  CG    . GLU D 1 154 ? 19.840  30.594  -58.547 1.00 44.19  ? 230 GLU D CG    1 
ATOM   7323 C  CD    . GLU D 1 154 ? 20.662  29.552  -59.266 1.00 46.93  ? 230 GLU D CD    1 
ATOM   7324 O  OE1   . GLU D 1 154 ? 21.905  29.577  -59.146 1.00 54.97  ? 230 GLU D OE1   1 
ATOM   7325 O  OE2   . GLU D 1 154 ? 20.073  28.694  -59.945 1.00 46.40  ? 230 GLU D OE2   1 
ATOM   7326 N  N     . PHE D 1 155 ? 17.042  28.886  -61.127 1.00 41.49  ? 231 PHE D N     1 
ATOM   7327 C  CA    . PHE D 1 155 ? 17.248  27.990  -62.265 1.00 45.05  ? 231 PHE D CA    1 
ATOM   7328 C  C     . PHE D 1 155 ? 16.716  28.573  -63.565 1.00 39.34  ? 231 PHE D C     1 
ATOM   7329 O  O     . PHE D 1 155 ? 17.188  28.232  -64.650 1.00 37.41  ? 231 PHE D O     1 
ATOM   7330 C  CB    . PHE D 1 155 ? 16.588  26.636  -62.006 1.00 34.13  ? 231 PHE D CB    1 
ATOM   7331 C  CG    . PHE D 1 155 ? 16.888  25.613  -63.044 1.00 31.97  ? 231 PHE D CG    1 
ATOM   7332 C  CD1   . PHE D 1 155 ? 18.186  25.164  -63.233 1.00 33.96  ? 231 PHE D CD1   1 
ATOM   7333 C  CD2   . PHE D 1 155 ? 15.876  25.074  -63.818 1.00 36.77  ? 231 PHE D CD2   1 
ATOM   7334 C  CE1   . PHE D 1 155 ? 18.471  24.204  -64.180 1.00 33.30  ? 231 PHE D CE1   1 
ATOM   7335 C  CE2   . PHE D 1 155 ? 16.155  24.095  -64.767 1.00 35.11  ? 231 PHE D CE2   1 
ATOM   7336 C  CZ    . PHE D 1 155 ? 17.450  23.665  -64.945 1.00 36.58  ? 231 PHE D CZ    1 
ATOM   7337 N  N     . TYR D 1 156 ? 15.707  29.425  -63.449 1.00 40.09  ? 232 TYR D N     1 
ATOM   7338 C  CA    . TYR D 1 156 ? 15.203  30.164  -64.594 1.00 43.33  ? 232 TYR D CA    1 
ATOM   7339 C  C     . TYR D 1 156 ? 16.312  31.083  -65.121 1.00 41.45  ? 232 TYR D C     1 
ATOM   7340 O  O     . TYR D 1 156 ? 16.433  31.302  -66.325 1.00 42.16  ? 232 TYR D O     1 
ATOM   7341 C  CB    . TYR D 1 156 ? 13.949  30.966  -64.217 1.00 37.32  ? 232 TYR D CB    1 
ATOM   7342 C  CG    . TYR D 1 156 ? 13.411  31.819  -65.347 1.00 42.68  ? 232 TYR D CG    1 
ATOM   7343 C  CD1   . TYR D 1 156 ? 13.885  33.118  -65.570 1.00 33.92  ? 232 TYR D CD1   1 
ATOM   7344 C  CD2   . TYR D 1 156 ? 12.435  31.322  -66.194 1.00 41.98  ? 232 TYR D CD2   1 
ATOM   7345 C  CE1   . TYR D 1 156 ? 13.399  33.879  -66.619 1.00 39.28  ? 232 TYR D CE1   1 
ATOM   7346 C  CE2   . TYR D 1 156 ? 11.938  32.067  -67.232 1.00 40.62  ? 232 TYR D CE2   1 
ATOM   7347 C  CZ    . TYR D 1 156 ? 12.418  33.345  -67.445 1.00 47.96  ? 232 TYR D CZ    1 
ATOM   7348 O  OH    . TYR D 1 156 ? 11.899  34.066  -68.492 1.00 40.49  ? 232 TYR D OH    1 
ATOM   7349 N  N     . ARG D 1 157 ? 17.132  31.605  -64.216 1.00 39.87  ? 233 ARG D N     1 
ATOM   7350 C  CA    . ARG D 1 157 ? 18.274  32.406  -64.634 1.00 43.48  ? 233 ARG D CA    1 
ATOM   7351 C  C     . ARG D 1 157 ? 19.275  31.580  -65.435 1.00 44.75  ? 233 ARG D C     1 
ATOM   7352 O  O     . ARG D 1 157 ? 19.809  32.044  -66.444 1.00 49.03  ? 233 ARG D O     1 
ATOM   7353 C  CB    . ARG D 1 157 ? 18.946  33.072  -63.436 1.00 41.27  ? 233 ARG D CB    1 
ATOM   7354 C  CG    . ARG D 1 157 ? 18.071  34.151  -62.790 1.00 54.21  ? 233 ARG D CG    1 
ATOM   7355 C  CD    . ARG D 1 157 ? 18.802  34.902  -61.681 1.00 56.29  ? 233 ARG D CD    1 
ATOM   7356 N  NE    . ARG D 1 157 ? 18.072  36.105  -61.293 1.00 70.63  ? 233 ARG D NE    1 
ATOM   7357 C  CZ    . ARG D 1 157 ? 18.369  36.872  -60.246 1.00 73.62  ? 233 ARG D CZ    1 
ATOM   7358 N  NH1   . ARG D 1 157 ? 19.395  36.567  -59.456 1.00 57.70  ? 233 ARG D NH1   1 
ATOM   7359 N  NH2   . ARG D 1 157 ? 17.629  37.947  -59.987 1.00 74.19  ? 233 ARG D NH2   1 
ATOM   7360 N  N     . ARG D 1 158 ? 19.520  30.352  -64.991 1.00 44.35  ? 234 ARG D N     1 
ATOM   7361 C  CA    . ARG D 1 158 ? 20.485  29.477  -65.655 1.00 38.14  ? 234 ARG D CA    1 
ATOM   7362 C  C     . ARG D 1 158 ? 20.076  29.128  -67.079 1.00 39.76  ? 234 ARG D C     1 
ATOM   7363 O  O     . ARG D 1 158 ? 20.900  29.167  -68.001 1.00 47.13  ? 234 ARG D O     1 
ATOM   7364 C  CB    . ARG D 1 158 ? 20.675  28.207  -64.848 1.00 43.64  ? 234 ARG D CB    1 
ATOM   7365 C  CG    . ARG D 1 158 ? 21.237  28.457  -63.486 1.00 41.07  ? 234 ARG D CG    1 
ATOM   7366 C  CD    . ARG D 1 158 ? 21.550  27.138  -62.825 1.00 39.84  ? 234 ARG D CD    1 
ATOM   7367 N  NE    . ARG D 1 158 ? 22.218  27.369  -61.560 1.00 40.83  ? 234 ARG D NE    1 
ATOM   7368 C  CZ    . ARG D 1 158 ? 23.222  26.640  -61.109 1.00 42.58  ? 234 ARG D CZ    1 
ATOM   7369 N  NH1   . ARG D 1 158 ? 23.665  25.608  -61.814 1.00 49.73  ? 234 ARG D NH1   1 
ATOM   7370 N  NH2   . ARG D 1 158 ? 23.773  26.939  -59.946 1.00 45.33  ? 234 ARG D NH2   1 
ATOM   7371 N  N     . ILE D 1 159 ? 18.803  28.777  -67.239 1.00 35.59  ? 235 ILE D N     1 
ATOM   7372 C  CA    . ILE D 1 159 ? 18.188  28.532  -68.536 1.00 29.99  ? 235 ILE D CA    1 
ATOM   7373 C  C     . ILE D 1 159 ? 18.400  29.708  -69.519 1.00 47.78  ? 235 ILE D C     1 
ATOM   7374 O  O     . ILE D 1 159 ? 19.024  29.533  -70.583 1.00 44.82  ? 235 ILE D O     1 
ATOM   7375 C  CB    . ILE D 1 159 ? 16.685  28.228  -68.358 1.00 33.51  ? 235 ILE D CB    1 
ATOM   7376 C  CG1   . ILE D 1 159 ? 16.505  26.905  -67.585 1.00 40.00  ? 235 ILE D CG1   1 
ATOM   7377 C  CG2   . ILE D 1 159 ? 15.970  28.172  -69.696 1.00 38.30  ? 235 ILE D CG2   1 
ATOM   7378 C  CD1   . ILE D 1 159 ? 15.054  26.539  -67.266 1.00 34.67  ? 235 ILE D CD1   1 
ATOM   7379 N  N     . LYS D 1 160 ? 17.905  30.898  -69.156 1.00 45.33  ? 236 LYS D N     1 
ATOM   7380 C  CA    . LYS D 1 160 ? 18.089  32.113  -69.972 1.00 42.74  ? 236 LYS D CA    1 
ATOM   7381 C  C     . LYS D 1 160 ? 19.566  32.440  -70.205 1.00 43.70  ? 236 LYS D C     1 
ATOM   7382 O  O     . LYS D 1 160 ? 19.959  32.764  -71.326 1.00 45.50  ? 236 LYS D O     1 
ATOM   7383 C  CB    . LYS D 1 160 ? 17.365  33.322  -69.366 1.00 42.80  ? 236 LYS D CB    1 
ATOM   7384 C  CG    . LYS D 1 160 ? 15.839  33.223  -69.413 1.00 45.44  ? 236 LYS D CG    1 
ATOM   7385 C  CD    . LYS D 1 160 ? 15.371  32.819  -70.803 1.00 49.33  ? 236 LYS D CD    1 
ATOM   7386 C  CE    . LYS D 1 160 ? 13.927  32.331  -70.790 1.00 47.08  ? 236 LYS D CE    1 
ATOM   7387 N  NZ    . LYS D 1 160 ? 12.975  33.454  -70.570 1.00 49.40  ? 236 LYS D NZ    1 
ATOM   7388 N  N     . GLY D 1 161 ? 20.368  32.341  -69.145 1.00 37.44  ? 237 GLY D N     1 
ATOM   7389 C  CA    . GLY D 1 161 ? 21.811  32.481  -69.230 1.00 41.86  ? 237 GLY D CA    1 
ATOM   7390 C  C     . GLY D 1 161 ? 22.475  31.616  -70.297 1.00 47.99  ? 237 GLY D C     1 
ATOM   7391 O  O     . GLY D 1 161 ? 23.330  32.090  -71.039 1.00 53.78  ? 237 GLY D O     1 
ATOM   7392 N  N     . ALA D 1 162 ? 22.087  30.347  -70.382 1.00 51.97  ? 238 ALA D N     1 
ATOM   7393 C  CA    . ALA D 1 162 ? 22.657  29.446  -71.383 1.00 52.17  ? 238 ALA D CA    1 
ATOM   7394 C  C     . ALA D 1 162 ? 22.112  29.722  -72.783 1.00 54.38  ? 238 ALA D C     1 
ATOM   7395 O  O     . ALA D 1 162 ? 22.494  29.053  -73.737 1.00 54.32  ? 238 ALA D O     1 
ATOM   7396 C  CB    . ALA D 1 162 ? 22.412  27.988  -71.001 1.00 52.16  ? 238 ALA D CB    1 
ATOM   7397 N  N     . GLY D 1 163 ? 21.221  30.703  -72.904 1.00 46.02  ? 239 GLY D N     1 
ATOM   7398 C  CA    . GLY D 1 163 ? 20.611  31.012  -74.184 1.00 43.66  ? 239 GLY D CA    1 
ATOM   7399 C  C     . GLY D 1 163 ? 19.546  30.044  -74.678 1.00 54.97  ? 239 GLY D C     1 
ATOM   7400 O  O     . GLY D 1 163 ? 19.273  29.983  -75.881 1.00 48.43  ? 239 GLY D O     1 
ATOM   7401 N  N     . LEU D 1 164 ? 18.924  29.298  -73.764 1.00 50.64  ? 240 LEU D N     1 
ATOM   7402 C  CA    . LEU D 1 164 ? 17.888  28.343  -74.161 1.00 47.88  ? 240 LEU D CA    1 
ATOM   7403 C  C     . LEU D 1 164 ? 16.522  29.005  -74.156 1.00 46.72  ? 240 LEU D C     1 
ATOM   7404 O  O     . LEU D 1 164 ? 16.293  29.986  -73.449 1.00 51.25  ? 240 LEU D O     1 
ATOM   7405 C  CB    . LEU D 1 164 ? 17.872  27.123  -73.238 1.00 43.13  ? 240 LEU D CB    1 
ATOM   7406 C  CG    . LEU D 1 164 ? 19.173  26.326  -73.109 1.00 51.40  ? 240 LEU D CG    1 
ATOM   7407 C  CD1   . LEU D 1 164 ? 19.078  25.408  -71.889 1.00 50.10  ? 240 LEU D CD1   1 
ATOM   7408 C  CD2   . LEU D 1 164 ? 19.489  25.514  -74.383 1.00 40.21  ? 240 LEU D CD2   1 
ATOM   7409 N  N     . GLN D 1 165 ? 15.614  28.466  -74.953 1.00 45.26  ? 241 GLN D N     1 
ATOM   7410 C  CA    . GLN D 1 165 ? 14.264  28.987  -75.013 1.00 48.67  ? 241 GLN D CA    1 
ATOM   7411 C  C     . GLN D 1 165 ? 13.355  28.143  -74.110 1.00 54.08  ? 241 GLN D C     1 
ATOM   7412 O  O     . GLN D 1 165 ? 13.443  26.909  -74.103 1.00 52.01  ? 241 GLN D O     1 
ATOM   7413 C  CB    . GLN D 1 165 ? 13.775  28.971  -76.462 1.00 53.85  ? 241 GLN D CB    1 
ATOM   7414 C  CG    . GLN D 1 165 ? 12.442  29.670  -76.686 1.00 65.00  ? 241 GLN D CG    1 
ATOM   7415 C  CD    . GLN D 1 165 ? 12.027  29.673  -78.152 1.00 74.23  ? 241 GLN D CD    1 
ATOM   7416 O  OE1   . GLN D 1 165 ? 12.836  29.384  -79.038 1.00 75.97  ? 241 GLN D OE1   1 
ATOM   7417 N  NE2   . GLN D 1 165 ? 10.758  29.989  -78.410 1.00 75.81  ? 241 GLN D NE2   1 
ATOM   7418 N  N     . LEU D 1 166 ? 12.497  28.812  -73.345 1.00 46.48  ? 242 LEU D N     1 
ATOM   7419 C  CA    . LEU D 1 166 ? 11.589  28.146  -72.422 1.00 43.34  ? 242 LEU D CA    1 
ATOM   7420 C  C     . LEU D 1 166 ? 10.247  27.977  -73.113 1.00 49.06  ? 242 LEU D C     1 
ATOM   7421 O  O     . LEU D 1 166 ? 9.694   28.935  -73.639 1.00 56.04  ? 242 LEU D O     1 
ATOM   7422 C  CB    . LEU D 1 166 ? 11.403  28.992  -71.159 1.00 40.97  ? 242 LEU D CB    1 
ATOM   7423 C  CG    . LEU D 1 166 ? 11.029  28.388  -69.798 1.00 45.97  ? 242 LEU D CG    1 
ATOM   7424 C  CD1   . LEU D 1 166 ? 9.976   29.234  -69.074 1.00 45.00  ? 242 LEU D CD1   1 
ATOM   7425 C  CD2   . LEU D 1 166 ? 10.608  26.913  -69.875 1.00 46.65  ? 242 LEU D CD2   1 
ATOM   7426 N  N     . PHE D 1 167 ? 9.716   26.763  -73.110 1.00 41.32  ? 243 PHE D N     1 
ATOM   7427 C  CA    . PHE D 1 167 ? 8.422   26.532  -73.728 1.00 43.72  ? 243 PHE D CA    1 
ATOM   7428 C  C     . PHE D 1 167 ? 7.365   26.145  -72.706 1.00 42.57  ? 243 PHE D C     1 
ATOM   7429 O  O     . PHE D 1 167 ? 7.670   25.576  -71.663 1.00 42.77  ? 243 PHE D O     1 
ATOM   7430 C  CB    . PHE D 1 167 ? 8.541   25.443  -74.797 1.00 45.89  ? 243 PHE D CB    1 
ATOM   7431 C  CG    . PHE D 1 167 ? 9.497   25.786  -75.904 1.00 44.69  ? 243 PHE D CG    1 
ATOM   7432 C  CD1   . PHE D 1 167 ? 10.855  25.524  -75.773 1.00 44.07  ? 243 PHE D CD1   1 
ATOM   7433 C  CD2   . PHE D 1 167 ? 9.037   26.361  -77.074 1.00 43.99  ? 243 PHE D CD2   1 
ATOM   7434 C  CE1   . PHE D 1 167 ? 11.737  25.826  -76.792 1.00 51.04  ? 243 PHE D CE1   1 
ATOM   7435 C  CE2   . PHE D 1 167 ? 9.912   26.666  -78.102 1.00 49.98  ? 243 PHE D CE2   1 
ATOM   7436 C  CZ    . PHE D 1 167 ? 11.266  26.397  -77.960 1.00 52.32  ? 243 PHE D CZ    1 
ATOM   7437 N  N     . ARG D 1 168 ? 6.113   26.448  -73.016 1.00 45.58  ? 244 ARG D N     1 
ATOM   7438 C  CA    . ARG D 1 168 ? 5.005   26.080  -72.146 1.00 45.14  ? 244 ARG D CA    1 
ATOM   7439 C  C     . ARG D 1 168 ? 3.822   25.590  -72.965 1.00 44.52  ? 244 ARG D C     1 
ATOM   7440 O  O     . ARG D 1 168 ? 3.725   25.891  -74.146 1.00 48.69  ? 244 ARG D O     1 
ATOM   7441 C  CB    . ARG D 1 168 ? 4.600   27.272  -71.270 1.00 42.66  ? 244 ARG D CB    1 
ATOM   7442 C  CG    . ARG D 1 168 ? 5.664   27.643  -70.272 1.00 39.21  ? 244 ARG D CG    1 
ATOM   7443 C  CD    . ARG D 1 168 ? 5.239   28.831  -69.474 1.00 45.93  ? 244 ARG D CD    1 
ATOM   7444 N  NE    . ARG D 1 168 ? 6.150   29.096  -68.374 1.00 40.55  ? 244 ARG D NE    1 
ATOM   7445 C  CZ    . ARG D 1 168 ? 6.616   30.301  -68.078 1.00 46.34  ? 244 ARG D CZ    1 
ATOM   7446 N  NH1   . ARG D 1 168 ? 6.259   31.345  -68.816 1.00 50.67  ? 244 ARG D NH1   1 
ATOM   7447 N  NH2   . ARG D 1 168 ? 7.433   30.464  -67.043 1.00 42.18  ? 244 ARG D NH2   1 
ATOM   7448 N  N     . PRO D 1 169 ? 2.927   24.809  -72.342 1.00 51.92  ? 245 PRO D N     1 
ATOM   7449 C  CA    . PRO D 1 169 ? 1.733   24.369  -73.064 1.00 47.62  ? 245 PRO D CA    1 
ATOM   7450 C  C     . PRO D 1 169 ? 0.979   25.533  -73.704 1.00 53.78  ? 245 PRO D C     1 
ATOM   7451 O  O     . PRO D 1 169 ? 0.853   26.617  -73.110 1.00 56.73  ? 245 PRO D O     1 
ATOM   7452 C  CB    . PRO D 1 169 ? 0.881   23.737  -71.960 1.00 48.37  ? 245 PRO D CB    1 
ATOM   7453 C  CG    . PRO D 1 169 ? 1.877   23.224  -70.979 1.00 48.54  ? 245 PRO D CG    1 
ATOM   7454 C  CD    . PRO D 1 169 ? 3.015   24.209  -70.997 1.00 43.76  ? 245 PRO D CD    1 
ATOM   7455 N  N     . SER D 1 170 ? 0.496   25.308  -74.920 1.00 52.58  ? 246 SER D N     1 
ATOM   7456 C  CA    . SER D 1 170 ? -0.400  26.251  -75.573 1.00 54.77  ? 246 SER D CA    1 
ATOM   7457 C  C     . SER D 1 170 ? -1.676  25.510  -75.938 1.00 55.11  ? 246 SER D C     1 
ATOM   7458 O  O     . SER D 1 170 ? -1.651  24.304  -76.195 1.00 59.53  ? 246 SER D O     1 
ATOM   7459 C  CB    . SER D 1 170 ? 0.250   26.835  -76.826 1.00 55.67  ? 246 SER D CB    1 
ATOM   7460 O  OG    . SER D 1 170 ? 0.519   25.804  -77.752 1.00 58.14  ? 246 SER D OG    1 
ATOM   7461 N  N     . GLY D 1 171 ? -2.792  26.224  -75.948 1.00 51.69  ? 247 GLY D N     1 
ATOM   7462 C  CA    . GLY D 1 171 ? -4.051  25.625  -76.337 1.00 55.66  ? 247 GLY D CA    1 
ATOM   7463 C  C     . GLY D 1 171 ? -4.760  24.886  -75.221 1.00 60.86  ? 247 GLY D C     1 
ATOM   7464 O  O     . GLY D 1 171 ? -5.782  24.241  -75.460 1.00 58.79  ? 247 GLY D O     1 
ATOM   7465 N  N     . ILE D 1 172 ? -4.230  24.977  -74.004 1.00 60.39  ? 248 ILE D N     1 
ATOM   7466 C  CA    . ILE D 1 172 ? -4.856  24.323  -72.853 1.00 57.27  ? 248 ILE D CA    1 
ATOM   7467 C  C     . ILE D 1 172 ? -6.048  25.135  -72.343 1.00 61.55  ? 248 ILE D C     1 
ATOM   7468 O  O     . ILE D 1 172 ? -5.931  26.328  -72.068 1.00 56.13  ? 248 ILE D O     1 
ATOM   7469 C  CB    . ILE D 1 172 ? -3.852  24.107  -71.718 1.00 52.78  ? 248 ILE D CB    1 
ATOM   7470 C  CG1   . ILE D 1 172 ? -2.697  23.240  -72.202 1.00 51.42  ? 248 ILE D CG1   1 
ATOM   7471 C  CG2   . ILE D 1 172 ? -4.527  23.458  -70.530 1.00 52.40  ? 248 ILE D CG2   1 
ATOM   7472 C  CD1   . ILE D 1 172 ? -3.093  21.803  -72.497 1.00 55.52  ? 248 ILE D CD1   1 
ATOM   7473 N  N     . THR D 1 173 ? -7.196  24.480  -72.214 1.00 63.65  ? 249 THR D N     1 
ATOM   7474 C  CA    . THR D 1 173 ? -8.435  25.170  -71.868 1.00 56.32  ? 249 THR D CA    1 
ATOM   7475 C  C     . THR D 1 173 ? -8.830  24.972  -70.410 1.00 58.77  ? 249 THR D C     1 
ATOM   7476 O  O     . THR D 1 173 ? -9.779  25.588  -69.941 1.00 60.59  ? 249 THR D O     1 
ATOM   7477 C  CB    . THR D 1 173 ? -9.606  24.666  -72.736 1.00 61.33  ? 249 THR D CB    1 
ATOM   7478 O  OG1   . THR D 1 173 ? -10.086 23.413  -72.221 1.00 70.29  ? 249 THR D OG1   1 
ATOM   7479 C  CG2   . THR D 1 173 ? -9.157  24.474  -74.176 1.00 55.19  ? 249 THR D CG2   1 
ATOM   7480 N  N     . THR D 1 174 ? -8.109  24.116  -69.694 1.00 58.77  ? 250 THR D N     1 
ATOM   7481 C  CA    . THR D 1 174 ? -8.551  23.688  -68.363 1.00 55.59  ? 250 THR D CA    1 
ATOM   7482 C  C     . THR D 1 174 ? -8.133  24.598  -67.204 1.00 52.03  ? 250 THR D C     1 
ATOM   7483 O  O     . THR D 1 174 ? -8.502  24.345  -66.057 1.00 55.66  ? 250 THR D O     1 
ATOM   7484 C  CB    . THR D 1 174 ? -8.126  22.230  -68.061 1.00 55.81  ? 250 THR D CB    1 
ATOM   7485 O  OG1   . THR D 1 174 ? -6.737  22.051  -68.387 1.00 55.09  ? 250 THR D OG1   1 
ATOM   7486 C  CG2   . THR D 1 174 ? -8.970  21.253  -68.880 1.00 56.71  ? 250 THR D CG2   1 
ATOM   7487 N  N     . GLY D 1 175 ? -7.366  25.642  -67.497 1.00 55.68  ? 251 GLY D N     1 
ATOM   7488 C  CA    . GLY D 1 175 ? -7.022  26.639  -66.495 1.00 51.85  ? 251 GLY D CA    1 
ATOM   7489 C  C     . GLY D 1 175 ? -6.398  26.094  -65.221 1.00 51.14  ? 251 GLY D C     1 
ATOM   7490 O  O     . GLY D 1 175 ? -5.498  25.266  -65.274 1.00 53.38  ? 251 GLY D O     1 
ATOM   7491 N  N     . TYR D 1 176 ? -6.885  26.560  -64.074 1.00 54.51  ? 252 TYR D N     1 
ATOM   7492 C  CA    . TYR D 1 176 ? -6.344  26.153  -62.776 1.00 51.25  ? 252 TYR D CA    1 
ATOM   7493 C  C     . TYR D 1 176 ? -6.877  24.802  -62.329 1.00 50.69  ? 252 TYR D C     1 
ATOM   7494 O  O     . TYR D 1 176 ? -6.609  24.356  -61.214 1.00 51.68  ? 252 TYR D O     1 
ATOM   7495 C  CB    . TYR D 1 176 ? -6.639  27.209  -61.713 1.00 49.73  ? 252 TYR D CB    1 
ATOM   7496 C  CG    . TYR D 1 176 ? -6.084  28.566  -62.067 1.00 53.02  ? 252 TYR D CG    1 
ATOM   7497 C  CD1   . TYR D 1 176 ? -4.878  28.681  -62.746 1.00 53.33  ? 252 TYR D CD1   1 
ATOM   7498 C  CD2   . TYR D 1 176 ? -6.766  29.727  -61.742 1.00 50.81  ? 252 TYR D CD2   1 
ATOM   7499 C  CE1   . TYR D 1 176 ? -4.359  29.915  -63.091 1.00 50.71  ? 252 TYR D CE1   1 
ATOM   7500 C  CE2   . TYR D 1 176 ? -6.256  30.969  -62.079 1.00 57.00  ? 252 TYR D CE2   1 
ATOM   7501 C  CZ    . TYR D 1 176 ? -5.050  31.058  -62.756 1.00 57.09  ? 252 TYR D CZ    1 
ATOM   7502 O  OH    . TYR D 1 176 ? -4.521  32.286  -63.103 1.00 54.50  ? 252 TYR D OH    1 
ATOM   7503 N  N     . LYS D 1 177 ? -7.640  24.157  -63.201 1.00 49.55  ? 253 LYS D N     1 
ATOM   7504 C  CA    . LYS D 1 177 ? -8.068  22.789  -62.962 1.00 56.87  ? 253 LYS D CA    1 
ATOM   7505 C  C     . LYS D 1 177 ? -7.291  21.812  -63.859 1.00 54.46  ? 253 LYS D C     1 
ATOM   7506 O  O     . LYS D 1 177 ? -7.726  20.678  -64.095 1.00 51.97  ? 253 LYS D O     1 
ATOM   7507 C  CB    . LYS D 1 177 ? -9.579  22.663  -63.155 1.00 58.57  ? 253 LYS D CB    1 
ATOM   7508 C  CG    . LYS D 1 177 ? -10.374 23.469  -62.135 1.00 58.58  ? 253 LYS D CG    1 
ATOM   7509 C  CD    . LYS D 1 177 ? -11.873 23.247  -62.272 1.00 72.19  ? 253 LYS D CD    1 
ATOM   7510 C  CE    . LYS D 1 177 ? -12.291 21.924  -61.647 1.00 82.47  ? 253 LYS D CE    1 
ATOM   7511 N  NZ    . LYS D 1 177 ? -11.999 21.901  -60.182 1.00 84.30  ? 253 LYS D NZ    1 
ATOM   7512 N  N     . THR D 1 178 ? -6.133  22.265  -64.341 1.00 48.96  ? 254 THR D N     1 
ATOM   7513 C  CA    . THR D 1 178 ? -5.280  21.447  -65.197 1.00 50.31  ? 254 THR D CA    1 
ATOM   7514 C  C     . THR D 1 178 ? -4.559  20.395  -64.366 1.00 46.89  ? 254 THR D C     1 
ATOM   7515 O  O     . THR D 1 178 ? -4.334  19.275  -64.824 1.00 46.82  ? 254 THR D O     1 
ATOM   7516 C  CB    . THR D 1 178 ? -4.247  22.306  -65.960 1.00 50.59  ? 254 THR D CB    1 
ATOM   7517 O  OG1   . THR D 1 178 ? -4.934  23.270  -66.766 1.00 53.19  ? 254 THR D OG1   1 
ATOM   7518 C  CG2   . THR D 1 178 ? -3.366  21.441  -66.859 1.00 46.05  ? 254 THR D CG2   1 
ATOM   7519 N  N     . PHE D 1 179 ? -4.208  20.773  -63.140 1.00 42.64  ? 255 PHE D N     1 
ATOM   7520 C  CA    . PHE D 1 179 ? -3.539  19.882  -62.208 1.00 43.71  ? 255 PHE D CA    1 
ATOM   7521 C  C     . PHE D 1 179 ? -4.351  19.710  -60.936 1.00 43.74  ? 255 PHE D C     1 
ATOM   7522 O  O     . PHE D 1 179 ? -5.132  20.589  -60.567 1.00 46.01  ? 255 PHE D O     1 
ATOM   7523 C  CB    . PHE D 1 179 ? -2.171  20.442  -61.812 1.00 39.94  ? 255 PHE D CB    1 
ATOM   7524 C  CG    . PHE D 1 179 ? -1.264  20.687  -62.965 1.00 43.52  ? 255 PHE D CG    1 
ATOM   7525 C  CD1   . PHE D 1 179 ? -0.599  19.636  -63.568 1.00 41.72  ? 255 PHE D CD1   1 
ATOM   7526 C  CD2   . PHE D 1 179 ? -1.065  21.974  -63.448 1.00 39.72  ? 255 PHE D CD2   1 
ATOM   7527 C  CE1   . PHE D 1 179 ? 0.239   19.861  -64.643 1.00 45.74  ? 255 PHE D CE1   1 
ATOM   7528 C  CE2   . PHE D 1 179 ? -0.226  22.199  -64.514 1.00 43.21  ? 255 PHE D CE2   1 
ATOM   7529 C  CZ    . PHE D 1 179 ? 0.426   21.135  -65.117 1.00 39.86  ? 255 PHE D CZ    1 
ATOM   7530 N  N     . ARG D 1 180 ? -4.176  18.567  -60.274 1.00 46.83  ? 256 ARG D N     1 
ATOM   7531 C  CA    A ARG D 1 180 ? -4.670  18.398  -58.914 0.56 44.64  ? 256 ARG D CA    1 
ATOM   7532 C  CA    B ARG D 1 180 ? -4.670  18.406  -58.913 0.44 44.65  ? 256 ARG D CA    1 
ATOM   7533 C  C     . ARG D 1 180 ? -3.527  18.693  -57.949 1.00 44.81  ? 256 ARG D C     1 
ATOM   7534 O  O     . ARG D 1 180 ? -2.429  18.146  -58.087 1.00 42.71  ? 256 ARG D O     1 
ATOM   7535 C  CB    A ARG D 1 180 ? -5.210  16.983  -58.690 0.56 46.60  ? 256 ARG D CB    1 
ATOM   7536 C  CB    B ARG D 1 180 ? -5.234  17.005  -58.669 0.44 46.60  ? 256 ARG D CB    1 
ATOM   7537 C  CG    A ARG D 1 180 ? -5.787  16.756  -57.290 0.56 47.17  ? 256 ARG D CG    1 
ATOM   7538 C  CG    B ARG D 1 180 ? -5.743  16.817  -57.240 0.44 47.16  ? 256 ARG D CG    1 
ATOM   7539 C  CD    A ARG D 1 180 ? -6.682  15.520  -57.242 0.56 48.70  ? 256 ARG D CD    1 
ATOM   7540 C  CD    B ARG D 1 180 ? -6.693  15.632  -57.089 0.44 48.64  ? 256 ARG D CD    1 
ATOM   7541 N  NE    A ARG D 1 180 ? -7.787  15.627  -58.193 0.56 49.12  ? 256 ARG D NE    1 
ATOM   7542 N  NE    B ARG D 1 180 ? -6.013  14.345  -56.957 0.44 47.69  ? 256 ARG D NE    1 
ATOM   7543 C  CZ    A ARG D 1 180 ? -8.093  14.704  -59.098 0.56 45.61  ? 256 ARG D CZ    1 
ATOM   7544 C  CZ    B ARG D 1 180 ? -5.371  13.952  -55.863 0.44 48.87  ? 256 ARG D CZ    1 
ATOM   7545 N  NH1   A ARG D 1 180 ? -9.115  14.908  -59.918 0.56 42.16  ? 256 ARG D NH1   1 
ATOM   7546 N  NH1   B ARG D 1 180 ? -4.793  12.767  -55.811 0.44 47.98  ? 256 ARG D NH1   1 
ATOM   7547 N  NH2   A ARG D 1 180 ? -7.384  13.581  -59.182 0.56 46.37  ? 256 ARG D NH2   1 
ATOM   7548 N  NH2   B ARG D 1 180 ? -5.300  14.749  -54.818 0.44 52.48  ? 256 ARG D NH2   1 
ATOM   7549 N  N     . HIS D 1 181 ? -3.774  19.573  -56.988 1.00 41.60  ? 257 HIS D N     1 
ATOM   7550 C  CA    . HIS D 1 181 ? -2.742  19.930  -56.022 1.00 43.64  ? 257 HIS D CA    1 
ATOM   7551 C  C     . HIS D 1 181 ? -3.313  19.771  -54.635 1.00 42.99  ? 257 HIS D C     1 
ATOM   7552 O  O     . HIS D 1 181 ? -3.675  20.759  -53.999 1.00 48.23  ? 257 HIS D O     1 
ATOM   7553 C  CB    . HIS D 1 181 ? -2.289  21.384  -56.228 1.00 38.84  ? 257 HIS D CB    1 
ATOM   7554 C  CG    . HIS D 1 181 ? -1.089  21.779  -55.419 1.00 37.50  ? 257 HIS D CG    1 
ATOM   7555 N  ND1   . HIS D 1 181 ? -0.987  23.003  -54.787 1.00 42.60  ? 257 HIS D ND1   1 
ATOM   7556 C  CD2   . HIS D 1 181 ? 0.075   21.133  -55.168 1.00 39.30  ? 257 HIS D CD2   1 
ATOM   7557 C  CE1   . HIS D 1 181 ? 0.179   23.082  -54.168 1.00 40.03  ? 257 HIS D CE1   1 
ATOM   7558 N  NE2   . HIS D 1 181 ? 0.842   21.959  -54.380 1.00 30.22  ? 257 HIS D NE2   1 
ATOM   7559 N  N     . LEU D 1 182 ? -3.412  18.539  -54.155 1.00 52.03  ? 258 LEU D N     1 
ATOM   7560 C  CA    . LEU D 1 182 ? -3.970  18.353  -52.817 1.00 58.63  ? 258 LEU D CA    1 
ATOM   7561 C  C     . LEU D 1 182 ? -2.897  18.604  -51.758 1.00 51.51  ? 258 LEU D C     1 
ATOM   7562 O  O     . LEU D 1 182 ? -2.250  17.680  -51.253 1.00 55.24  ? 258 LEU D O     1 
ATOM   7563 C  CB    . LEU D 1 182 ? -4.671  16.997  -52.669 1.00 61.09  ? 258 LEU D CB    1 
ATOM   7564 C  CG    . LEU D 1 182 ? -6.206  17.117  -52.587 1.00 64.66  ? 258 LEU D CG    1 
ATOM   7565 C  CD1   . LEU D 1 182 ? -6.803  17.839  -53.797 1.00 47.79  ? 258 LEU D CD1   1 
ATOM   7566 C  CD2   . LEU D 1 182 ? -6.876  15.758  -52.388 1.00 66.80  ? 258 LEU D CD2   1 
ATOM   7567 N  N     . HIS D 1 183 ? -2.719  19.886  -51.451 1.00 35.38  ? 259 HIS D N     1 
ATOM   7568 C  CA    . HIS D 1 183 ? -1.673  20.354  -50.558 1.00 40.91  ? 259 HIS D CA    1 
ATOM   7569 C  C     . HIS D 1 183 ? -2.307  21.309  -49.550 1.00 42.23  ? 259 HIS D C     1 
ATOM   7570 O  O     . HIS D 1 183 ? -2.554  22.475  -49.858 1.00 49.47  ? 259 HIS D O     1 
ATOM   7571 C  CB    . HIS D 1 183 ? -0.563  21.066  -51.363 1.00 35.69  ? 259 HIS D CB    1 
ATOM   7572 C  CG    . HIS D 1 183 ? 0.592   21.543  -50.531 1.00 33.30  ? 259 HIS D CG    1 
ATOM   7573 N  ND1   . HIS D 1 183 ? 1.820   21.850  -51.074 1.00 33.77  ? 259 HIS D ND1   1 
ATOM   7574 C  CD2   . HIS D 1 183 ? 0.708   21.772  -49.201 1.00 41.35  ? 259 HIS D CD2   1 
ATOM   7575 C  CE1   . HIS D 1 183 ? 2.644   22.240  -50.118 1.00 32.29  ? 259 HIS D CE1   1 
ATOM   7576 N  NE2   . HIS D 1 183 ? 1.993   22.202  -48.969 1.00 36.16  ? 259 HIS D NE2   1 
ATOM   7577 N  N     . ASP D 1 184 ? -2.573  20.807  -48.350 1.00 47.63  ? 260 ASP D N     1 
ATOM   7578 C  CA    . ASP D 1 184 ? -3.104  21.620  -47.257 1.00 40.76  ? 260 ASP D CA    1 
ATOM   7579 C  C     . ASP D 1 184 ? -1.954  22.312  -46.549 1.00 46.36  ? 260 ASP D C     1 
ATOM   7580 O  O     . ASP D 1 184 ? -1.144  21.637  -45.900 1.00 42.70  ? 260 ASP D O     1 
ATOM   7581 C  CB    . ASP D 1 184 ? -3.829  20.722  -46.260 1.00 45.26  ? 260 ASP D CB    1 
ATOM   7582 C  CG    . ASP D 1 184 ? -4.649  21.500  -45.229 1.00 46.94  ? 260 ASP D CG    1 
ATOM   7583 O  OD1   . ASP D 1 184 ? -4.302  22.649  -44.866 1.00 46.79  ? 260 ASP D OD1   1 
ATOM   7584 O  OD2   . ASP D 1 184 ? -5.654  20.920  -44.767 1.00 58.92  ? 260 ASP D OD2   1 
ATOM   7585 N  N     . PRO D 1 185 ? -1.892  23.659  -46.646 1.00 46.78  ? 261 PRO D N     1 
ATOM   7586 C  CA    . PRO D 1 185 ? -0.790  24.438  -46.051 1.00 38.49  ? 261 PRO D CA    1 
ATOM   7587 C  C     . PRO D 1 185 ? -0.667  24.268  -44.535 1.00 43.36  ? 261 PRO D C     1 
ATOM   7588 O  O     . PRO D 1 185 ? 0.425   24.466  -43.999 1.00 47.61  ? 261 PRO D O     1 
ATOM   7589 C  CB    . PRO D 1 185 ? -1.109  25.897  -46.439 1.00 39.76  ? 261 PRO D CB    1 
ATOM   7590 C  CG    . PRO D 1 185 ? -2.550  25.899  -46.885 1.00 37.80  ? 261 PRO D CG    1 
ATOM   7591 C  CD    . PRO D 1 185 ? -2.845  24.503  -47.391 1.00 45.99  ? 261 PRO D CD    1 
ATOM   7592 N  N     . ALA D 1 186 ? -1.745  23.881  -43.856 1.00 40.76  ? 262 ALA D N     1 
ATOM   7593 C  CA    . ALA D 1 186 ? -1.662  23.622  -42.416 1.00 52.32  ? 262 ALA D CA    1 
ATOM   7594 C  C     . ALA D 1 186 ? -1.048  22.250  -42.122 1.00 56.80  ? 262 ALA D C     1 
ATOM   7595 O  O     . ALA D 1 186 ? -0.363  22.068  -41.114 1.00 61.06  ? 262 ALA D O     1 
ATOM   7596 C  CB    . ALA D 1 186 ? -3.041  23.747  -41.746 1.00 40.81  ? 262 ALA D CB    1 
ATOM   7597 N  N     . TRP D 1 187 ? -1.296  21.287  -43.006 1.00 50.55  ? 263 TRP D N     1 
ATOM   7598 C  CA    . TRP D 1 187 ? -0.804  19.926  -42.807 1.00 40.75  ? 263 TRP D CA    1 
ATOM   7599 C  C     . TRP D 1 187 ? 0.592   19.715  -43.396 1.00 51.62  ? 263 TRP D C     1 
ATOM   7600 O  O     . TRP D 1 187 ? 1.467   19.135  -42.747 1.00 46.13  ? 263 TRP D O     1 
ATOM   7601 C  CB    . TRP D 1 187 ? -1.787  18.911  -43.396 1.00 40.03  ? 263 TRP D CB    1 
ATOM   7602 C  CG    . TRP D 1 187 ? -1.440  17.492  -43.046 1.00 50.15  ? 263 TRP D CG    1 
ATOM   7603 C  CD1   . TRP D 1 187 ? -1.027  16.511  -43.901 1.00 45.19  ? 263 TRP D CD1   1 
ATOM   7604 C  CD2   . TRP D 1 187 ? -1.461  16.906  -41.740 1.00 49.13  ? 263 TRP D CD2   1 
ATOM   7605 N  NE1   . TRP D 1 187 ? -0.800  15.345  -43.209 1.00 50.65  ? 263 TRP D NE1   1 
ATOM   7606 C  CE2   . TRP D 1 187 ? -1.059  15.558  -41.880 1.00 51.02  ? 263 TRP D CE2   1 
ATOM   7607 C  CE3   . TRP D 1 187 ? -1.795  17.385  -40.466 1.00 43.87  ? 263 TRP D CE3   1 
ATOM   7608 C  CZ2   . TRP D 1 187 ? -0.976  14.678  -40.792 1.00 51.86  ? 263 TRP D CZ2   1 
ATOM   7609 C  CZ3   . TRP D 1 187 ? -1.715  16.516  -39.386 1.00 50.69  ? 263 TRP D CZ3   1 
ATOM   7610 C  CH2   . TRP D 1 187 ? -1.307  15.171  -39.556 1.00 44.28  ? 263 TRP D CH2   1 
ATOM   7611 N  N     . ARG D 1 188 ? 0.791   20.168  -44.635 1.00 48.00  ? 264 ARG D N     1 
ATOM   7612 C  CA    . ARG D 1 188 ? 2.110   20.129  -45.249 1.00 45.16  ? 264 ARG D CA    1 
ATOM   7613 C  C     . ARG D 1 188 ? 2.672   21.548  -45.268 1.00 50.05  ? 264 ARG D C     1 
ATOM   7614 O  O     . ARG D 1 188 ? 2.552   22.272  -46.268 1.00 48.40  ? 264 ARG D O     1 
ATOM   7615 C  CB    . ARG D 1 188 ? 2.054   19.526  -46.668 1.00 46.39  ? 264 ARG D CB    1 
ATOM   7616 C  CG    . ARG D 1 188 ? 1.387   18.133  -46.765 1.00 47.10  ? 264 ARG D CG    1 
ATOM   7617 C  CD    . ARG D 1 188 ? 2.041   17.138  -45.826 1.00 45.29  ? 264 ARG D CD    1 
ATOM   7618 N  NE    . ARG D 1 188 ? 1.789   15.740  -46.183 1.00 40.05  ? 264 ARG D NE    1 
ATOM   7619 C  CZ    . ARG D 1 188 ? 2.244   14.708  -45.476 1.00 44.42  ? 264 ARG D CZ    1 
ATOM   7620 N  NH1   . ARG D 1 188 ? 2.964   14.938  -44.385 1.00 38.78  ? 264 ARG D NH1   1 
ATOM   7621 N  NH2   . ARG D 1 188 ? 1.990   13.451  -45.854 1.00 42.75  ? 264 ARG D NH2   1 
ATOM   7622 N  N     . LYS D 1 189 ? 3.284   21.936  -44.152 1.00 45.74  ? 265 LYS D N     1 
ATOM   7623 C  CA    . LYS D 1 189 ? 3.743   23.305  -43.940 1.00 45.42  ? 265 LYS D CA    1 
ATOM   7624 C  C     . LYS D 1 189 ? 4.991   23.619  -44.743 1.00 48.17  ? 265 LYS D C     1 
ATOM   7625 O  O     . LYS D 1 189 ? 5.993   22.911  -44.637 1.00 43.95  ? 265 LYS D O     1 
ATOM   7626 C  CB    . LYS D 1 189 ? 4.064   23.537  -42.462 1.00 49.56  ? 265 LYS D CB    1 
ATOM   7627 C  CG    . LYS D 1 189 ? 2.910   23.334  -41.511 1.00 54.88  ? 265 LYS D CG    1 
ATOM   7628 C  CD    . LYS D 1 189 ? 3.419   23.259  -40.074 1.00 67.06  ? 265 LYS D CD    1 
ATOM   7629 C  CE    . LYS D 1 189 ? 2.422   23.869  -39.091 1.00 69.77  ? 265 LYS D CE    1 
ATOM   7630 N  NZ    . LYS D 1 189 ? 1.102   23.171  -39.125 1.00 70.32  ? 265 LYS D NZ    1 
ATOM   7631 N  N     . ARG D 1 190 ? 4.942   24.701  -45.515 1.00 40.67  ? 266 ARG D N     1 
ATOM   7632 C  CA    . ARG D 1 190 ? 6.115   25.142  -46.239 1.00 35.83  ? 266 ARG D CA    1 
ATOM   7633 C  C     . ARG D 1 190 ? 7.123   25.747  -45.276 1.00 39.19  ? 266 ARG D C     1 
ATOM   7634 O  O     . ARG D 1 190 ? 6.788   26.589  -44.447 1.00 47.90  ? 266 ARG D O     1 
ATOM   7635 C  CB    . ARG D 1 190 ? 5.733   26.119  -47.351 1.00 38.46  ? 266 ARG D CB    1 
ATOM   7636 C  CG    . ARG D 1 190 ? 4.703   25.531  -48.278 1.00 36.59  ? 266 ARG D CG    1 
ATOM   7637 C  CD    . ARG D 1 190 ? 4.194   26.531  -49.252 1.00 32.07  ? 266 ARG D CD    1 
ATOM   7638 N  NE    . ARG D 1 190 ? 3.412   25.881  -50.293 1.00 29.81  ? 266 ARG D NE    1 
ATOM   7639 C  CZ    . ARG D 1 190 ? 2.095   25.770  -50.254 1.00 35.99  ? 266 ARG D CZ    1 
ATOM   7640 N  NH1   . ARG D 1 190 ? 1.434   26.267  -49.223 1.00 41.22  ? 266 ARG D NH1   1 
ATOM   7641 N  NH2   . ARG D 1 190 ? 1.436   25.167  -51.237 1.00 35.38  ? 266 ARG D NH2   1 
ATOM   7642 N  N     . ASP D 1 191 ? 8.358   25.283  -45.377 1.00 36.53  ? 267 ASP D N     1 
ATOM   7643 C  CA    . ASP D 1 191 ? 9.429   25.754  -44.530 1.00 37.19  ? 267 ASP D CA    1 
ATOM   7644 C  C     . ASP D 1 191 ? 9.999   27.061  -45.108 1.00 47.01  ? 267 ASP D C     1 
ATOM   7645 O  O     . ASP D 1 191 ? 11.048  27.073  -45.758 1.00 43.75  ? 267 ASP D O     1 
ATOM   7646 C  CB    . ASP D 1 191 ? 10.486  24.660  -44.429 1.00 33.40  ? 267 ASP D CB    1 
ATOM   7647 C  CG    . ASP D 1 191 ? 11.687  25.075  -43.613 1.00 45.62  ? 267 ASP D CG    1 
ATOM   7648 O  OD1   . ASP D 1 191 ? 11.673  26.145  -42.966 1.00 50.18  ? 267 ASP D OD1   1 
ATOM   7649 O  OD2   . ASP D 1 191 ? 12.652  24.307  -43.608 1.00 37.40  ? 267 ASP D OD2   1 
ATOM   7650 N  N     . GLN D 1 192 ? 9.294   28.159  -44.840 1.00 45.97  ? 268 GLN D N     1 
ATOM   7651 C  CA    . GLN D 1 192 ? 9.559   29.448  -45.471 1.00 46.51  ? 268 GLN D CA    1 
ATOM   7652 C  C     . GLN D 1 192 ? 10.442  30.383  -44.673 1.00 48.06  ? 268 GLN D C     1 
ATOM   7653 O  O     . GLN D 1 192 ? 10.853  31.411  -45.193 1.00 47.44  ? 268 GLN D O     1 
ATOM   7654 C  CB    . GLN D 1 192 ? 8.240   30.144  -45.814 1.00 34.62  ? 268 GLN D CB    1 
ATOM   7655 C  CG    . GLN D 1 192 ? 7.617   29.539  -47.037 1.00 42.05  ? 268 GLN D CG    1 
ATOM   7656 C  CD    . GLN D 1 192 ? 6.194   29.951  -47.247 1.00 39.44  ? 268 GLN D CD    1 
ATOM   7657 O  OE1   . GLN D 1 192 ? 5.470   30.217  -46.295 1.00 39.64  ? 268 GLN D OE1   1 
ATOM   7658 N  NE2   . GLN D 1 192 ? 5.777   30.010  -48.510 1.00 37.36  ? 268 GLN D NE2   1 
ATOM   7659 N  N     . LYS D 1 193 ? 10.737  30.028  -43.427 1.00 51.44  ? 269 LYS D N     1 
ATOM   7660 C  CA    . LYS D 1 193 ? 11.586  30.857  -42.570 1.00 52.85  ? 269 LYS D CA    1 
ATOM   7661 C  C     . LYS D 1 193 ? 12.917  31.229  -43.244 1.00 53.87  ? 269 LYS D C     1 
ATOM   7662 O  O     . LYS D 1 193 ? 13.524  30.420  -43.946 1.00 52.68  ? 269 LYS D O     1 
ATOM   7663 C  CB    . LYS D 1 193 ? 11.845  30.151  -41.232 1.00 55.30  ? 269 LYS D CB    1 
ATOM   7664 C  CG    . LYS D 1 193 ? 12.615  30.979  -40.206 1.00 50.14  ? 269 LYS D CG    1 
ATOM   7665 C  CD    . LYS D 1 193 ? 13.392  30.076  -39.248 1.00 59.26  ? 269 LYS D CD    1 
ATOM   7666 C  CE    . LYS D 1 193 ? 13.906  30.832  -38.022 1.00 67.63  ? 269 LYS D CE    1 
ATOM   7667 N  NZ    . LYS D 1 193 ? 12.851  30.985  -36.970 1.00 71.26  ? 269 LYS D NZ    1 
ATOM   7668 N  N     . ARG D 1 194 ? 13.350  32.471  -43.044 1.00 52.26  ? 270 ARG D N     1 
ATOM   7669 C  CA    . ARG D 1 194 ? 14.623  32.949  -43.567 1.00 51.18  ? 270 ARG D CA    1 
ATOM   7670 C  C     . ARG D 1 194 ? 15.606  33.150  -42.416 1.00 51.32  ? 270 ARG D C     1 
ATOM   7671 O  O     . ARG D 1 194 ? 15.508  34.129  -41.681 1.00 60.99  ? 270 ARG D O     1 
ATOM   7672 C  CB    . ARG D 1 194 ? 14.417  34.279  -44.311 1.00 55.30  ? 270 ARG D CB    1 
ATOM   7673 C  CG    . ARG D 1 194 ? 14.147  34.149  -45.796 1.00 50.74  ? 270 ARG D CG    1 
ATOM   7674 C  CD    . ARG D 1 194 ? 13.297  32.948  -46.092 1.00 53.03  ? 270 ARG D CD    1 
ATOM   7675 N  NE    . ARG D 1 194 ? 13.561  32.395  -47.401 1.00 52.72  ? 270 ARG D NE    1 
ATOM   7676 C  CZ    . ARG D 1 194 ? 13.631  31.092  -47.671 1.00 59.89  ? 270 ARG D CZ    1 
ATOM   7677 N  NH1   . ARG D 1 194 ? 13.461  30.180  -46.714 1.00 48.23  ? 270 ARG D NH1   1 
ATOM   7678 N  NH2   . ARG D 1 194 ? 13.877  30.705  -48.917 1.00 50.72  ? 270 ARG D NH2   1 
ATOM   7679 N  N     . ILE D 1 195 ? 16.551  32.234  -42.263 1.00 49.45  ? 271 ILE D N     1 
ATOM   7680 C  CA    . ILE D 1 195 ? 17.512  32.297  -41.162 1.00 56.29  ? 271 ILE D CA    1 
ATOM   7681 C  C     . ILE D 1 195 ? 18.744  33.111  -41.542 1.00 55.99  ? 271 ILE D C     1 
ATOM   7682 O  O     . ILE D 1 195 ? 19.526  32.700  -42.418 1.00 55.23  ? 271 ILE D O     1 
ATOM   7683 C  CB    . ILE D 1 195 ? 17.991  30.886  -40.732 1.00 54.14  ? 271 ILE D CB    1 
ATOM   7684 C  CG1   . ILE D 1 195 ? 16.805  29.970  -40.433 1.00 53.94  ? 271 ILE D CG1   1 
ATOM   7685 C  CG2   . ILE D 1 195 ? 18.932  30.971  -39.535 1.00 41.40  ? 271 ILE D CG2   1 
ATOM   7686 C  CD1   . ILE D 1 195 ? 17.190  28.483  -40.351 1.00 56.05  ? 271 ILE D CD1   1 
ATOM   7687 N  N     . ALA D 1 196 ? 18.912  34.252  -40.866 1.00 59.02  ? 272 ALA D N     1 
ATOM   7688 C  CA    . ALA D 1 196 ? 20.029  35.179  -41.099 1.00 52.17  ? 272 ALA D CA    1 
ATOM   7689 C  C     . ALA D 1 196 ? 20.177  35.593  -42.565 1.00 53.19  ? 272 ALA D C     1 
ATOM   7690 O  O     . ALA D 1 196 ? 19.243  36.124  -43.163 1.00 57.96  ? 272 ALA D O     1 
ATOM   7691 C  CB    . ALA D 1 196 ? 21.340  34.595  -40.568 1.00 56.34  ? 272 ALA D CB    1 
ATOM   7692 N  N     . ALA D 1 197 ? 21.349  35.326  -43.137 1.00 50.92  ? 273 ALA D N     1 
ATOM   7693 C  CA    . ALA D 1 197 ? 21.680  35.778  -44.491 1.00 54.70  ? 273 ALA D CA    1 
ATOM   7694 C  C     . ALA D 1 197 ? 20.945  35.042  -45.609 1.00 54.73  ? 273 ALA D C     1 
ATOM   7695 O  O     . ALA D 1 197 ? 21.157  35.340  -46.787 1.00 60.31  ? 273 ALA D O     1 
ATOM   7696 C  CB    . ALA D 1 197 ? 23.193  35.706  -44.731 1.00 52.84  ? 273 ALA D CB    1 
ATOM   7697 N  N     . GLN D 1 198 ? 20.100  34.079  -45.251 1.00 58.09  ? 274 GLN D N     1 
ATOM   7698 C  CA    . GLN D 1 198 ? 19.301  33.371  -46.247 1.00 55.52  ? 274 GLN D CA    1 
ATOM   7699 C  C     . GLN D 1 198 ? 18.317  34.315  -46.936 1.00 53.90  ? 274 GLN D C     1 
ATOM   7700 O  O     . GLN D 1 198 ? 18.074  34.202  -48.153 1.00 46.33  ? 274 GLN D O     1 
ATOM   7701 C  CB    . GLN D 1 198 ? 18.542  32.204  -45.610 1.00 53.82  ? 274 GLN D CB    1 
ATOM   7702 C  CG    . GLN D 1 198 ? 17.699  31.394  -46.597 1.00 48.59  ? 274 GLN D CG    1 
ATOM   7703 C  CD    . GLN D 1 198 ? 16.980  30.243  -45.925 1.00 50.56  ? 274 GLN D CD    1 
ATOM   7704 O  OE1   . GLN D 1 198 ? 16.766  30.266  -44.714 1.00 50.22  ? 274 GLN D OE1   1 
ATOM   7705 N  NE2   . GLN D 1 198 ? 16.616  29.225  -46.699 1.00 43.38  ? 274 GLN D NE2   1 
ATOM   7706 N  N     . LYS D 1 199 ? 17.770  35.241  -46.142 1.00 56.25  ? 275 LYS D N     1 
ATOM   7707 C  CA    . LYS D 1 199 ? 16.857  36.289  -46.606 1.00 54.45  ? 275 LYS D CA    1 
ATOM   7708 C  C     . LYS D 1 199 ? 17.437  37.045  -47.791 1.00 54.40  ? 275 LYS D C     1 
ATOM   7709 O  O     . LYS D 1 199 ? 16.747  37.282  -48.776 1.00 54.69  ? 275 LYS D O     1 
ATOM   7710 C  CB    . LYS D 1 199 ? 16.517  37.236  -45.448 1.00 53.81  ? 275 LYS D CB    1 
ATOM   7711 C  CG    . LYS D 1 199 ? 15.585  38.402  -45.789 1.00 56.14  ? 275 LYS D CG    1 
ATOM   7712 C  CD    . LYS D 1 199 ? 15.278  39.228  -44.531 1.00 52.82  ? 275 LYS D CD    1 
ATOM   7713 C  CE    . LYS D 1 199 ? 14.692  40.608  -44.879 1.00 67.76  ? 275 LYS D CE    1 
ATOM   7714 N  NZ    . LYS D 1 199 ? 13.194  40.650  -44.951 1.00 59.02  ? 275 LYS D NZ    1 
ATOM   7715 N  N     . GLN D 1 200 ? 18.718  37.396  -47.705 1.00 50.25  ? 276 GLN D N     1 
ATOM   7716 C  CA    . GLN D 1 200 ? 19.388  38.039  -48.823 1.00 55.22  ? 276 GLN D CA    1 
ATOM   7717 C  C     . GLN D 1 200 ? 19.917  37.046  -49.878 1.00 56.42  ? 276 GLN D C     1 
ATOM   7718 O  O     . GLN D 1 200 ? 19.810  37.317  -51.078 1.00 51.47  ? 276 GLN D O     1 
ATOM   7719 C  CB    . GLN D 1 200 ? 20.499  38.994  -48.335 1.00 50.52  ? 276 GLN D CB    1 
ATOM   7720 C  CG    . GLN D 1 200 ? 20.007  40.174  -47.431 1.00 51.30  ? 276 GLN D CG    1 
ATOM   7721 C  CD    . GLN D 1 200 ? 19.802  39.688  -46.041 1.00 52.35  ? 276 GLN D CD    1 
ATOM   7722 O  OE1   . GLN D 1 200 ? 20.251  38.600  -45.715 1.00 56.89  ? 276 GLN D OE1   1 
ATOM   7723 N  NE2   . GLN D 1 200 ? 19.112  40.438  -45.215 1.00 56.12  ? 276 GLN D NE2   1 
ATOM   7724 N  N     . GLU D 1 201 ? 20.458  35.900  -49.445 1.00 50.65  ? 277 GLU D N     1 
ATOM   7725 C  CA    . GLU D 1 201 ? 21.094  34.946  -50.380 1.00 56.39  ? 277 GLU D CA    1 
ATOM   7726 C  C     . GLU D 1 201 ? 20.145  34.221  -51.343 1.00 50.62  ? 277 GLU D C     1 
ATOM   7727 O  O     . GLU D 1 201 ? 20.550  33.829  -52.438 1.00 55.35  ? 277 GLU D O     1 
ATOM   7728 C  CB    . GLU D 1 201 ? 21.955  33.920  -49.643 1.00 53.72  ? 277 GLU D CB    1 
ATOM   7729 C  CG    . GLU D 1 201 ? 23.234  34.489  -49.027 1.00 60.78  ? 277 GLU D CG    1 
ATOM   7730 C  CD    . GLU D 1 201 ? 24.261  34.935  -50.061 1.00 64.49  ? 277 GLU D CD    1 
ATOM   7731 O  OE1   . GLU D 1 201 ? 24.407  34.267  -51.113 1.00 65.80  ? 277 GLU D OE1   1 
ATOM   7732 O  OE2   . GLU D 1 201 ? 24.922  35.966  -49.815 1.00 70.68  ? 277 GLU D OE2   1 
ATOM   7733 N  N     . GLN D 1 202 ? 18.885  34.062  -50.950 1.00 48.75  ? 278 GLN D N     1 
ATOM   7734 C  CA    . GLN D 1 202 ? 17.874  33.436  -51.813 1.00 46.60  ? 278 GLN D CA    1 
ATOM   7735 C  C     . GLN D 1 202 ? 17.646  34.148  -53.160 1.00 50.98  ? 278 GLN D C     1 
ATOM   7736 O  O     . GLN D 1 202 ? 17.140  33.540  -54.103 1.00 49.43  ? 278 GLN D O     1 
ATOM   7737 C  CB    . GLN D 1 202 ? 16.539  33.319  -51.063 1.00 49.04  ? 278 GLN D CB    1 
ATOM   7738 C  CG    . GLN D 1 202 ? 15.969  34.648  -50.598 1.00 43.70  ? 278 GLN D CG    1 
ATOM   7739 C  CD    . GLN D 1 202 ? 14.581  34.514  -49.992 1.00 50.67  ? 278 GLN D CD    1 
ATOM   7740 O  OE1   . GLN D 1 202 ? 13.856  33.555  -50.270 1.00 47.06  ? 278 GLN D OE1   1 
ATOM   7741 N  NE2   . GLN D 1 202 ? 14.204  35.484  -49.152 1.00 52.37  ? 278 GLN D NE2   1 
ATOM   7742 N  N     . PHE D 1 203 ? 18.007  35.431  -53.247 1.00 50.19  ? 279 PHE D N     1 
ATOM   7743 C  CA    . PHE D 1 203 ? 17.801  36.203  -54.474 1.00 47.36  ? 279 PHE D CA    1 
ATOM   7744 C  C     . PHE D 1 203 ? 19.027  36.235  -55.385 1.00 48.48  ? 279 PHE D C     1 
ATOM   7745 O  O     . PHE D 1 203 ? 18.940  36.666  -56.534 1.00 51.76  ? 279 PHE D O     1 
ATOM   7746 C  CB    . PHE D 1 203 ? 17.345  37.625  -54.142 1.00 44.76  ? 279 PHE D CB    1 
ATOM   7747 C  CG    . PHE D 1 203 ? 16.045  37.670  -53.421 1.00 47.39  ? 279 PHE D CG    1 
ATOM   7748 C  CD1   . PHE D 1 203 ? 14.881  37.246  -54.049 1.00 40.43  ? 279 PHE D CD1   1 
ATOM   7749 C  CD2   . PHE D 1 203 ? 15.985  38.096  -52.101 1.00 42.89  ? 279 PHE D CD2   1 
ATOM   7750 C  CE1   . PHE D 1 203 ? 13.673  37.261  -53.376 1.00 40.64  ? 279 PHE D CE1   1 
ATOM   7751 C  CE2   . PHE D 1 203 ? 14.788  38.122  -51.428 1.00 41.59  ? 279 PHE D CE2   1 
ATOM   7752 C  CZ    . PHE D 1 203 ? 13.627  37.709  -52.068 1.00 46.46  ? 279 PHE D CZ    1 
ATOM   7753 N  N     . LYS D 1 204 ? 20.161  35.769  -54.870 1.00 52.82  ? 280 LYS D N     1 
ATOM   7754 C  CA    . LYS D 1 204 ? 21.409  35.776  -55.626 1.00 49.97  ? 280 LYS D CA    1 
ATOM   7755 C  C     . LYS D 1 204 ? 21.539  34.592  -56.572 1.00 52.85  ? 280 LYS D C     1 
ATOM   7756 O  O     . LYS D 1 204 ? 21.162  33.464  -56.240 1.00 55.67  ? 280 LYS D O     1 
ATOM   7757 C  CB    . LYS D 1 204 ? 22.613  35.814  -54.682 1.00 55.36  ? 280 LYS D CB    1 
ATOM   7758 C  CG    . LYS D 1 204 ? 22.691  37.083  -53.861 1.00 52.45  ? 280 LYS D CG    1 
ATOM   7759 C  CD    . LYS D 1 204 ? 24.003  37.201  -53.103 1.00 59.16  ? 280 LYS D CD    1 
ATOM   7760 C  CE    . LYS D 1 204 ? 24.005  38.454  -52.228 1.00 70.71  ? 280 LYS D CE    1 
ATOM   7761 N  NZ    . LYS D 1 204 ? 23.591  39.684  -52.984 1.00 61.47  ? 280 LYS D NZ    1 
ATOM   7762 N  N     . VAL D 1 205 ? 22.060  34.868  -57.761 1.00 54.53  ? 281 VAL D N     1 
ATOM   7763 C  CA    . VAL D 1 205 ? 22.429  33.823  -58.705 1.00 56.56  ? 281 VAL D CA    1 
ATOM   7764 C  C     . VAL D 1 205 ? 23.654  33.086  -58.154 1.00 59.07  ? 281 VAL D C     1 
ATOM   7765 O  O     . VAL D 1 205 ? 24.492  33.670  -57.468 1.00 64.42  ? 281 VAL D O     1 
ATOM   7766 C  CB    . VAL D 1 205 ? 22.747  34.408  -60.111 1.00 54.32  ? 281 VAL D CB    1 
ATOM   7767 C  CG1   . VAL D 1 205 ? 24.016  35.220  -60.069 1.00 56.83  ? 281 VAL D CG1   1 
ATOM   7768 C  CG2   . VAL D 1 205 ? 22.879  33.301  -61.142 1.00 62.41  ? 281 VAL D CG2   1 
ATOM   7769 N  N     . ASP D 1 206 ? 23.745  31.794  -58.432 1.00 62.74  ? 282 ASP D N     1 
ATOM   7770 C  CA    . ASP D 1 206 ? 24.874  31.005  -57.976 1.00 60.54  ? 282 ASP D CA    1 
ATOM   7771 C  C     . ASP D 1 206 ? 25.593  30.449  -59.207 1.00 67.02  ? 282 ASP D C     1 
ATOM   7772 O  O     . ASP D 1 206 ? 25.191  29.433  -59.775 1.00 71.55  ? 282 ASP D O     1 
ATOM   7773 C  CB    . ASP D 1 206 ? 24.381  29.928  -56.991 1.00 56.81  ? 282 ASP D CB    1 
ATOM   7774 C  CG    . ASP D 1 206 ? 25.185  28.647  -57.047 1.00 63.25  ? 282 ASP D CG    1 
ATOM   7775 O  OD1   . ASP D 1 206 ? 26.393  28.651  -56.714 1.00 70.25  ? 282 ASP D OD1   1 
ATOM   7776 O  OD2   . ASP D 1 206 ? 24.586  27.619  -57.416 1.00 59.57  ? 282 ASP D OD2   1 
ATOM   7777 N  N     . ARG D 1 207 ? 26.641  31.144  -59.644 1.00 62.02  ? 283 ARG D N     1 
ATOM   7778 C  CA    . ARG D 1 207 ? 27.282  30.807  -60.914 1.00 70.72  ? 283 ARG D CA    1 
ATOM   7779 C  C     . ARG D 1 207 ? 28.113  29.528  -60.839 1.00 75.99  ? 283 ARG D C     1 
ATOM   7780 O  O     . ARG D 1 207 ? 27.921  28.596  -61.631 1.00 70.95  ? 283 ARG D O     1 
ATOM   7781 C  CB    . ARG D 1 207 ? 28.126  31.974  -61.434 1.00 75.31  ? 283 ARG D CB    1 
ATOM   7782 C  CG    . ARG D 1 207 ? 27.340  33.011  -62.241 1.00 82.85  ? 283 ARG D CG    1 
ATOM   7783 C  CD    . ARG D 1 207 ? 26.732  32.422  -63.524 1.00 84.70  ? 283 ARG D CD    1 
ATOM   7784 N  NE    . ARG D 1 207 ? 25.269  32.513  -63.527 1.00 88.30  ? 283 ARG D NE    1 
ATOM   7785 C  CZ    . ARG D 1 207 ? 24.482  32.178  -64.551 1.00 90.19  ? 283 ARG D CZ    1 
ATOM   7786 N  NH1   . ARG D 1 207 ? 25.004  31.722  -65.691 1.00 76.12  ? 283 ARG D NH1   1 
ATOM   7787 N  NH2   . ARG D 1 207 ? 23.160  32.302  -64.431 1.00 69.10  ? 283 ARG D NH2   1 
ATOM   7788 N  N     . GLU D 1 208 ? 29.021  29.482  -59.873 1.00 74.26  ? 284 GLU D N     1 
ATOM   7789 C  CA    . GLU D 1 208 ? 29.915  28.340  -59.723 1.00 75.70  ? 284 GLU D CA    1 
ATOM   7790 C  C     . GLU D 1 208 ? 29.193  27.010  -59.420 1.00 71.69  ? 284 GLU D C     1 
ATOM   7791 O  O     . GLU D 1 208 ? 29.238  26.080  -60.227 1.00 70.55  ? 284 GLU D O     1 
ATOM   7792 C  CB    . GLU D 1 208 ? 30.978  28.644  -58.666 1.00 77.45  ? 284 GLU D CB    1 
ATOM   7793 C  CG    . GLU D 1 208 ? 30.440  29.306  -57.412 1.00 76.07  ? 284 GLU D CG    1 
ATOM   7794 C  CD    . GLU D 1 208 ? 31.476  29.354  -56.307 1.00 91.37  ? 284 GLU D CD    1 
ATOM   7795 O  OE1   . GLU D 1 208 ? 32.645  29.678  -56.612 1.00 95.85  ? 284 GLU D OE1   1 
ATOM   7796 O  OE2   . GLU D 1 208 ? 31.129  29.053  -55.143 1.00 81.95  ? 284 GLU D OE2   1 
ATOM   7797 N  N     . GLY D 1 209 ? 28.528  26.931  -58.268 1.00 72.17  ? 285 GLY D N     1 
ATOM   7798 C  CA    . GLY D 1 209 ? 27.882  25.706  -57.826 1.00 60.44  ? 285 GLY D CA    1 
ATOM   7799 C  C     . GLY D 1 209 ? 26.873  25.117  -58.798 1.00 57.52  ? 285 GLY D C     1 
ATOM   7800 O  O     . GLY D 1 209 ? 26.337  25.816  -59.650 1.00 57.14  ? 285 GLY D O     1 
ATOM   7801 N  N     . GLY D 1 210 ? 26.616  23.819  -58.677 1.00 55.84  ? 286 GLY D N     1 
ATOM   7802 C  CA    . GLY D 1 210 ? 25.597  23.177  -59.484 1.00 45.81  ? 286 GLY D CA    1 
ATOM   7803 C  C     . GLY D 1 210 ? 25.636  21.660  -59.520 1.00 52.20  ? 286 GLY D C     1 
ATOM   7804 O  O     . GLY D 1 210 ? 25.965  20.982  -58.537 1.00 51.80  ? 286 GLY D O     1 
ATOM   7805 N  N     . LEU D 1 211 ? 25.261  21.128  -60.674 1.00 44.68  ? 287 LEU D N     1 
ATOM   7806 C  CA    . LEU D 1 211 ? 25.253  19.699  -60.904 1.00 50.76  ? 287 LEU D CA    1 
ATOM   7807 C  C     . LEU D 1 211 ? 26.642  19.119  -60.669 1.00 56.68  ? 287 LEU D C     1 
ATOM   7808 O  O     . LEU D 1 211 ? 26.784  18.016  -60.120 1.00 56.60  ? 287 LEU D O     1 
ATOM   7809 C  CB    . LEU D 1 211 ? 24.784  19.421  -62.328 1.00 38.73  ? 287 LEU D CB    1 
ATOM   7810 C  CG    . LEU D 1 211 ? 24.917  18.009  -62.873 1.00 49.79  ? 287 LEU D CG    1 
ATOM   7811 C  CD1   . LEU D 1 211 ? 24.005  17.002  -62.131 1.00 41.64  ? 287 LEU D CD1   1 
ATOM   7812 C  CD2   . LEU D 1 211 ? 24.606  18.058  -64.352 1.00 42.63  ? 287 LEU D CD2   1 
ATOM   7813 N  N     . ASN D 1 212 ? 27.660  19.889  -61.055 1.00 55.72  ? 288 ASN D N     1 
ATOM   7814 C  CA    . ASN D 1 212 ? 29.051  19.463  -60.933 1.00 54.05  ? 288 ASN D CA    1 
ATOM   7815 C  C     . ASN D 1 212 ? 29.653  19.648  -59.545 1.00 51.07  ? 288 ASN D C     1 
ATOM   7816 O  O     . ASN D 1 212 ? 30.807  19.298  -59.323 1.00 57.84  ? 288 ASN D O     1 
ATOM   7817 C  CB    . ASN D 1 212 ? 29.942  20.136  -61.997 1.00 54.29  ? 288 ASN D CB    1 
ATOM   7818 C  CG    . ASN D 1 212 ? 29.914  21.662  -61.929 1.00 63.31  ? 288 ASN D CG    1 
ATOM   7819 O  OD1   . ASN D 1 212 ? 29.447  22.258  -60.956 1.00 60.33  ? 288 ASN D OD1   1 
ATOM   7820 N  ND2   . ASN D 1 212 ? 30.419  22.301  -62.980 1.00 67.30  ? 288 ASN D ND2   1 
ATOM   7821 N  N     . THR D 1 213 ? 28.883  20.194  -58.609 1.00 49.47  ? 289 THR D N     1 
ATOM   7822 C  CA    . THR D 1 213 ? 29.413  20.413  -57.270 1.00 47.07  ? 289 THR D CA    1 
ATOM   7823 C  C     . THR D 1 213 ? 28.605  19.718  -56.180 1.00 51.11  ? 289 THR D C     1 
ATOM   7824 O  O     . THR D 1 213 ? 28.959  19.798  -54.999 1.00 54.28  ? 289 THR D O     1 
ATOM   7825 C  CB    . THR D 1 213 ? 29.543  21.918  -56.938 1.00 53.11  ? 289 THR D CB    1 
ATOM   7826 O  OG1   . THR D 1 213 ? 30.508  22.092  -55.896 1.00 71.25  ? 289 THR D OG1   1 
ATOM   7827 C  CG2   . THR D 1 213 ? 28.240  22.478  -56.460 1.00 47.15  ? 289 THR D CG2   1 
ATOM   7828 N  N     . VAL D 1 214 ? 27.530  19.035  -56.572 1.00 46.90  ? 290 VAL D N     1 
ATOM   7829 C  CA    . VAL D 1 214 ? 26.628  18.418  -55.593 1.00 50.66  ? 290 VAL D CA    1 
ATOM   7830 C  C     . VAL D 1 214 ? 27.318  17.313  -54.768 1.00 52.75  ? 290 VAL D C     1 
ATOM   7831 O  O     . VAL D 1 214 ? 27.944  16.399  -55.320 1.00 52.10  ? 290 VAL D O     1 
ATOM   7832 C  CB    . VAL D 1 214 ? 25.267  17.956  -56.234 1.00 40.42  ? 290 VAL D CB    1 
ATOM   7833 C  CG1   . VAL D 1 214 ? 25.456  16.775  -57.154 1.00 48.70  ? 290 VAL D CG1   1 
ATOM   7834 C  CG2   . VAL D 1 214 ? 24.244  17.648  -55.158 1.00 39.88  ? 290 VAL D CG2   1 
ATOM   7835 N  N     . LYS D 1 215 ? 27.226  17.433  -53.443 1.00 53.94  ? 291 LYS D N     1 
ATOM   7836 C  CA    . LYS D 1 215 ? 27.902  16.520  -52.525 1.00 51.05  ? 291 LYS D CA    1 
ATOM   7837 C  C     . LYS D 1 215 ? 26.879  15.638  -51.833 1.00 58.99  ? 291 LYS D C     1 
ATOM   7838 O  O     . LYS D 1 215 ? 26.028  16.134  -51.088 1.00 57.35  ? 291 LYS D O     1 
ATOM   7839 C  CB    . LYS D 1 215 ? 28.668  17.295  -51.451 1.00 59.96  ? 291 LYS D CB    1 
ATOM   7840 C  CG    . LYS D 1 215 ? 29.641  18.337  -51.972 1.00 70.59  ? 291 LYS D CG    1 
ATOM   7841 C  CD    . LYS D 1 215 ? 30.903  17.697  -52.531 1.00 72.03  ? 291 LYS D CD    1 
ATOM   7842 C  CE    . LYS D 1 215 ? 31.965  18.755  -52.802 1.00 69.19  ? 291 LYS D CE    1 
ATOM   7843 N  NZ    . LYS D 1 215 ? 33.274  18.154  -53.182 1.00 68.20  ? 291 LYS D NZ    1 
ATOM   7844 N  N     . TYR D 1 216 ? 26.974  14.330  -52.045 1.00 52.33  ? 292 TYR D N     1 
ATOM   7845 C  CA    . TYR D 1 216 ? 25.983  13.433  -51.476 1.00 53.29  ? 292 TYR D CA    1 
ATOM   7846 C  C     . TYR D 1 216 ? 26.454  11.994  -51.423 1.00 53.01  ? 292 TYR D C     1 
ATOM   7847 O  O     . TYR D 1 216 ? 27.524  11.658  -51.921 1.00 54.23  ? 292 TYR D O     1 
ATOM   7848 C  CB    . TYR D 1 216 ? 24.709  13.490  -52.313 1.00 44.34  ? 292 TYR D CB    1 
ATOM   7849 C  CG    . TYR D 1 216 ? 24.840  12.800  -53.652 1.00 55.00  ? 292 TYR D CG    1 
ATOM   7850 C  CD1   . TYR D 1 216 ? 25.426  13.445  -54.740 1.00 48.79  ? 292 TYR D CD1   1 
ATOM   7851 C  CD2   . TYR D 1 216 ? 24.375  11.501  -53.831 1.00 56.87  ? 292 TYR D CD2   1 
ATOM   7852 C  CE1   . TYR D 1 216 ? 25.533  12.816  -55.966 1.00 46.05  ? 292 TYR D CE1   1 
ATOM   7853 C  CE2   . TYR D 1 216 ? 24.489  10.860  -55.052 1.00 55.80  ? 292 TYR D CE2   1 
ATOM   7854 C  CZ    . TYR D 1 216 ? 25.068  11.517  -56.117 1.00 50.83  ? 292 TYR D CZ    1 
ATOM   7855 O  OH    . TYR D 1 216 ? 25.168  10.861  -57.332 1.00 46.45  ? 292 TYR D OH    1 
ATOM   7856 N  N     . HIS D 1 217 ? 25.631  11.147  -50.814 1.00 55.00  ? 293 HIS D N     1 
ATOM   7857 C  CA    . HIS D 1 217 ? 25.709  9.714   -51.058 1.00 57.77  ? 293 HIS D CA    1 
ATOM   7858 C  C     . HIS D 1 217 ? 24.351  9.037   -50.943 1.00 52.66  ? 293 HIS D C     1 
ATOM   7859 O  O     . HIS D 1 217 ? 23.479  9.471   -50.178 1.00 53.35  ? 293 HIS D O     1 
ATOM   7860 C  CB    . HIS D 1 217 ? 26.754  9.027   -50.168 1.00 59.29  ? 293 HIS D CB    1 
ATOM   7861 C  CG    . HIS D 1 217 ? 26.387  8.974   -48.720 1.00 60.73  ? 293 HIS D CG    1 
ATOM   7862 N  ND1   . HIS D 1 217 ? 25.936  7.820   -48.112 1.00 65.45  ? 293 HIS D ND1   1 
ATOM   7863 C  CD2   . HIS D 1 217 ? 26.425  9.922   -47.754 1.00 64.78  ? 293 HIS D CD2   1 
ATOM   7864 C  CE1   . HIS D 1 217 ? 25.702  8.064   -46.834 1.00 67.98  ? 293 HIS D CE1   1 
ATOM   7865 N  NE2   . HIS D 1 217 ? 25.990  9.332   -46.591 1.00 72.86  ? 293 HIS D NE2   1 
ATOM   7866 N  N     . VAL D 1 218 ? 24.174  7.982   -51.729 1.00 47.11  ? 294 VAL D N     1 
ATOM   7867 C  CA    . VAL D 1 218 ? 22.985  7.158   -51.632 1.00 51.63  ? 294 VAL D CA    1 
ATOM   7868 C  C     . VAL D 1 218 ? 23.204  6.137   -50.524 1.00 48.75  ? 294 VAL D C     1 
ATOM   7869 O  O     . VAL D 1 218 ? 24.048  5.255   -50.655 1.00 52.60  ? 294 VAL D O     1 
ATOM   7870 C  CB    . VAL D 1 218 ? 22.713  6.442   -52.949 1.00 48.30  ? 294 VAL D CB    1 
ATOM   7871 C  CG1   . VAL D 1 218 ? 21.513  5.519   -52.818 1.00 41.72  ? 294 VAL D CG1   1 
ATOM   7872 C  CG2   . VAL D 1 218 ? 22.503  7.459   -54.056 1.00 48.36  ? 294 VAL D CG2   1 
ATOM   7873 N  N     . ALA D 1 219 ? 22.459  6.284   -49.427 1.00 52.55  ? 295 ALA D N     1 
ATOM   7874 C  CA    . ALA D 1 219 ? 22.560  5.399   -48.260 1.00 48.89  ? 295 ALA D CA    1 
ATOM   7875 C  C     . ALA D 1 219 ? 21.963  4.034   -48.559 1.00 49.70  ? 295 ALA D C     1 
ATOM   7876 O  O     . ALA D 1 219 ? 22.536  2.999   -48.203 1.00 49.10  ? 295 ALA D O     1 
ATOM   7877 C  CB    . ALA D 1 219 ? 21.873  6.014   -47.065 1.00 38.06  ? 295 ALA D CB    1 
ATOM   7878 N  N     . SER D 1 220 ? 20.806  4.038   -49.212 1.00 49.53  ? 296 SER D N     1 
ATOM   7879 C  CA    . SER D 1 220 ? 20.183  2.799   -49.658 1.00 44.45  ? 296 SER D CA    1 
ATOM   7880 C  C     . SER D 1 220 ? 19.380  3.038   -50.918 1.00 47.18  ? 296 SER D C     1 
ATOM   7881 O  O     . SER D 1 220 ? 19.104  4.172   -51.301 1.00 48.37  ? 296 SER D O     1 
ATOM   7882 C  CB    . SER D 1 220 ? 19.236  2.247   -48.593 1.00 42.34  ? 296 SER D CB    1 
ATOM   7883 O  OG    . SER D 1 220 ? 18.019  2.976   -48.605 1.00 42.01  ? 296 SER D OG    1 
ATOM   7884 N  N     . ARG D 1 221 ? 18.964  1.941   -51.524 1.00 42.16  ? 297 ARG D N     1 
ATOM   7885 C  CA    A ARG D 1 221 ? 18.206  1.975   -52.754 0.48 42.06  ? 297 ARG D CA    1 
ATOM   7886 C  CA    B ARG D 1 221 ? 18.214  1.967   -52.768 0.52 42.05  ? 297 ARG D CA    1 
ATOM   7887 C  C     . ARG D 1 221 ? 17.131  0.907   -52.604 1.00 48.19  ? 297 ARG D C     1 
ATOM   7888 O  O     . ARG D 1 221 ? 17.428  -0.236  -52.266 1.00 53.11  ? 297 ARG D O     1 
ATOM   7889 C  CB    A ARG D 1 221 ? 19.152  1.653   -53.907 0.48 41.91  ? 297 ARG D CB    1 
ATOM   7890 C  CB    B ARG D 1 221 ? 19.145  1.615   -53.940 0.52 41.91  ? 297 ARG D CB    1 
ATOM   7891 C  CG    A ARG D 1 221 ? 18.660  1.950   -55.293 0.48 42.24  ? 297 ARG D CG    1 
ATOM   7892 C  CG    B ARG D 1 221 ? 18.994  2.467   -55.188 0.52 42.54  ? 297 ARG D CG    1 
ATOM   7893 C  CD    A ARG D 1 221 ? 19.818  1.731   -56.264 0.48 47.46  ? 297 ARG D CD    1 
ATOM   7894 C  CD    B ARG D 1 221 ? 20.059  2.151   -56.260 0.52 47.96  ? 297 ARG D CD    1 
ATOM   7895 N  NE    A ARG D 1 221 ? 21.024  2.437   -55.822 0.48 46.75  ? 297 ARG D NE    1 
ATOM   7896 N  NE    B ARG D 1 221 ? 20.116  3.132   -57.356 0.52 39.93  ? 297 ARG D NE    1 
ATOM   7897 C  CZ    A ARG D 1 221 ? 21.536  3.497   -56.441 0.48 45.11  ? 297 ARG D CZ    1 
ATOM   7898 C  CZ    B ARG D 1 221 ? 21.077  4.045   -57.496 0.52 44.03  ? 297 ARG D CZ    1 
ATOM   7899 N  NH1   A ARG D 1 221 ? 20.952  3.960   -57.541 0.48 43.92  ? 297 ARG D NH1   1 
ATOM   7900 N  NH1   B ARG D 1 221 ? 22.067  4.120   -56.610 0.52 43.77  ? 297 ARG D NH1   1 
ATOM   7901 N  NH2   A ARG D 1 221 ? 22.633  4.087   -55.969 0.48 41.02  ? 297 ARG D NH2   1 
ATOM   7902 N  NH2   B ARG D 1 221 ? 21.054  4.890   -58.522 0.52 45.43  ? 297 ARG D NH2   1 
ATOM   7903 N  N     . THR D 1 222 ? 15.876  1.275   -52.819 1.00 43.66  ? 298 THR D N     1 
ATOM   7904 C  CA    . THR D 1 222 ? 14.795  0.322   -52.605 1.00 46.50  ? 298 THR D CA    1 
ATOM   7905 C  C     . THR D 1 222 ? 13.829  0.258   -53.770 1.00 46.73  ? 298 THR D C     1 
ATOM   7906 O  O     . THR D 1 222 ? 13.306  1.287   -54.198 1.00 43.19  ? 298 THR D O     1 
ATOM   7907 C  CB    . THR D 1 222 ? 13.951  0.688   -51.363 1.00 42.70  ? 298 THR D CB    1 
ATOM   7908 O  OG1   . THR D 1 222 ? 14.807  1.014   -50.260 1.00 44.13  ? 298 THR D OG1   1 
ATOM   7909 C  CG2   . THR D 1 222 ? 13.054  -0.480  -50.988 1.00 42.50  ? 298 THR D CG2   1 
ATOM   7910 N  N     . ALA D 1 223 ? 13.565  -0.947  -54.265 1.00 39.30  ? 299 ALA D N     1 
ATOM   7911 C  CA    . ALA D 1 223 ? 12.557  -1.114  -55.306 1.00 41.66  ? 299 ALA D CA    1 
ATOM   7912 C  C     . ALA D 1 223 ? 11.193  -1.078  -54.652 1.00 43.93  ? 299 ALA D C     1 
ATOM   7913 O  O     . ALA D 1 223 ? 10.988  -1.668  -53.602 1.00 50.31  ? 299 ALA D O     1 
ATOM   7914 C  CB    . ALA D 1 223 ? 12.757  -2.415  -56.063 1.00 47.68  ? 299 ALA D CB    1 
ATOM   7915 N  N     . LEU D 1 224 ? 10.260  -0.369  -55.265 1.00 44.23  ? 300 LEU D N     1 
ATOM   7916 C  CA    . LEU D 1 224 ? 8.974   -0.150  -54.645 1.00 42.74  ? 300 LEU D CA    1 
ATOM   7917 C  C     . LEU D 1 224 ? 7.901   -0.264  -55.692 1.00 43.21  ? 300 LEU D C     1 
ATOM   7918 O  O     . LEU D 1 224 ? 8.078   0.177   -56.825 1.00 53.24  ? 300 LEU D O     1 
ATOM   7919 C  CB    . LEU D 1 224 ? 8.932   1.247   -54.016 1.00 44.03  ? 300 LEU D CB    1 
ATOM   7920 C  CG    . LEU D 1 224 ? 7.765   1.550   -53.083 1.00 35.57  ? 300 LEU D CG    1 
ATOM   7921 C  CD1   . LEU D 1 224 ? 7.835   0.628   -51.870 1.00 46.27  ? 300 LEU D CD1   1 
ATOM   7922 C  CD2   . LEU D 1 224 ? 7.798   2.994   -52.650 1.00 38.55  ? 300 LEU D CD2   1 
ATOM   7923 N  N     . SER D 1 225 ? 6.778   -0.849  -55.313 1.00 40.79  ? 301 SER D N     1 
ATOM   7924 C  CA    . SER D 1 225 ? 5.683   -1.046  -56.240 1.00 42.98  ? 301 SER D CA    1 
ATOM   7925 C  C     . SER D 1 225 ? 4.402   -0.544  -55.581 1.00 41.94  ? 301 SER D C     1 
ATOM   7926 O  O     . SER D 1 225 ? 4.112   -0.890  -54.442 1.00 51.75  ? 301 SER D O     1 
ATOM   7927 C  CB    . SER D 1 225 ? 5.583   -2.531  -56.604 1.00 44.45  ? 301 SER D CB    1 
ATOM   7928 O  OG    . SER D 1 225 ? 4.606   -2.731  -57.602 1.00 57.73  ? 301 SER D OG    1 
ATOM   7929 N  N     . VAL D 1 226 ? 3.642   0.283   -56.283 1.00 43.33  ? 302 VAL D N     1 
ATOM   7930 C  CA    . VAL D 1 226 ? 2.490   0.947   -55.685 1.00 43.28  ? 302 VAL D CA    1 
ATOM   7931 C  C     . VAL D 1 226 ? 1.274   0.765   -56.582 1.00 48.71  ? 302 VAL D C     1 
ATOM   7932 O  O     . VAL D 1 226 ? 1.176   1.386   -57.638 1.00 53.82  ? 302 VAL D O     1 
ATOM   7933 C  CB    . VAL D 1 226 ? 2.768   2.459   -55.504 1.00 46.60  ? 302 VAL D CB    1 
ATOM   7934 C  CG1   . VAL D 1 226 ? 1.599   3.146   -54.823 1.00 38.57  ? 302 VAL D CG1   1 
ATOM   7935 C  CG2   . VAL D 1 226 ? 4.069   2.680   -54.729 1.00 37.95  ? 302 VAL D CG2   1 
ATOM   7936 N  N     . GLY D 1 227 ? 0.354   -0.100  -56.183 1.00 45.60  ? 303 GLY D N     1 
ATOM   7937 C  CA    . GLY D 1 227 ? -0.759  -0.443  -57.051 1.00 50.19  ? 303 GLY D CA    1 
ATOM   7938 C  C     . GLY D 1 227 ? -0.294  -1.242  -58.258 1.00 55.77  ? 303 GLY D C     1 
ATOM   7939 O  O     . GLY D 1 227 ? -1.025  -1.411  -59.239 1.00 55.43  ? 303 GLY D O     1 
ATOM   7940 N  N     . GLY D 1 228 ? 0.930   -1.754  -58.176 1.00 52.14  ? 304 GLY D N     1 
ATOM   7941 C  CA    . GLY D 1 228 ? 1.533   -2.473  -59.279 1.00 46.89  ? 304 GLY D CA    1 
ATOM   7942 C  C     . GLY D 1 228 ? 2.354   -1.547  -60.157 1.00 48.55  ? 304 GLY D C     1 
ATOM   7943 O  O     . GLY D 1 228 ? 3.046   -1.993  -61.070 1.00 47.77  ? 304 GLY D O     1 
ATOM   7944 N  N     . ALA D 1 229 ? 2.277   -0.249  -59.872 1.00 50.26  ? 305 ALA D N     1 
ATOM   7945 C  CA    . ALA D 1 229 ? 3.082   0.743   -60.573 1.00 38.33  ? 305 ALA D CA    1 
ATOM   7946 C  C     . ALA D 1 229 ? 4.479   0.836   -59.952 1.00 37.95  ? 305 ALA D C     1 
ATOM   7947 O  O     . ALA D 1 229 ? 4.627   1.107   -58.771 1.00 43.96  ? 305 ALA D O     1 
ATOM   7948 C  CB    . ALA D 1 229 ? 2.381   2.080   -60.557 1.00 43.85  ? 305 ALA D CB    1 
ATOM   7949 N  N     . PRO D 1 230 ? 5.521   0.586   -60.749 1.00 41.10  ? 306 PRO D N     1 
ATOM   7950 C  CA    . PRO D 1 230 ? 6.854   0.505   -60.140 1.00 37.09  ? 306 PRO D CA    1 
ATOM   7951 C  C     . PRO D 1 230 ? 7.515   1.865   -59.930 1.00 42.91  ? 306 PRO D C     1 
ATOM   7952 O  O     . PRO D 1 230 ? 7.191   2.829   -60.626 1.00 39.62  ? 306 PRO D O     1 
ATOM   7953 C  CB    . PRO D 1 230 ? 7.657   -0.295  -61.182 1.00 42.20  ? 306 PRO D CB    1 
ATOM   7954 C  CG    . PRO D 1 230 ? 7.008   0.064   -62.493 1.00 38.15  ? 306 PRO D CG    1 
ATOM   7955 C  CD    . PRO D 1 230 ? 5.532   0.259   -62.190 1.00 35.11  ? 306 PRO D CD    1 
ATOM   7956 N  N     . CYS D 1 231 ? 8.440   1.927   -58.976 1.00 34.56  ? 307 CYS D N     1 
ATOM   7957 C  CA    . CYS D 1 231 ? 9.321   3.065   -58.839 1.00 39.51  ? 307 CYS D CA    1 
ATOM   7958 C  C     . CYS D 1 231 ? 10.536  2.662   -58.024 1.00 37.12  ? 307 CYS D C     1 
ATOM   7959 O  O     . CYS D 1 231 ? 10.511  1.645   -57.339 1.00 37.46  ? 307 CYS D O     1 
ATOM   7960 C  CB    . CYS D 1 231 ? 8.595   4.269   -58.203 1.00 48.12  ? 307 CYS D CB    1 
ATOM   7961 S  SG    . CYS D 1 231 ? 8.330   4.179   -56.415 1.00 40.76  ? 307 CYS D SG    1 
ATOM   7962 N  N     . THR D 1 232 ? 11.597  3.460   -58.114 1.00 39.64  ? 308 THR D N     1 
ATOM   7963 C  CA    . THR D 1 232 ? 12.813  3.255   -57.332 1.00 38.99  ? 308 THR D CA    1 
ATOM   7964 C  C     . THR D 1 232 ? 12.914  4.351   -56.273 1.00 43.83  ? 308 THR D C     1 
ATOM   7965 O  O     . THR D 1 232 ? 12.801  5.538   -56.587 1.00 39.49  ? 308 THR D O     1 
ATOM   7966 C  CB    . THR D 1 232 ? 14.081  3.340   -58.226 1.00 36.79  ? 308 THR D CB    1 
ATOM   7967 O  OG1   . THR D 1 232 ? 14.031  2.337   -59.254 1.00 39.04  ? 308 THR D OG1   1 
ATOM   7968 C  CG2   . THR D 1 232 ? 15.347  3.155   -57.395 1.00 28.87  ? 308 THR D CG2   1 
ATOM   7969 N  N     . VAL D 1 233 ? 13.122  3.957   -55.021 1.00 38.56  ? 309 VAL D N     1 
ATOM   7970 C  CA    . VAL D 1 233 ? 13.336  4.918   -53.963 1.00 35.64  ? 309 VAL D CA    1 
ATOM   7971 C  C     . VAL D 1 233 ? 14.833  5.042   -53.746 1.00 35.81  ? 309 VAL D C     1 
ATOM   7972 O  O     . VAL D 1 233 ? 15.523  4.043   -53.611 1.00 48.81  ? 309 VAL D O     1 
ATOM   7973 C  CB    . VAL D 1 233 ? 12.645  4.489   -52.630 1.00 38.33  ? 309 VAL D CB    1 
ATOM   7974 C  CG1   . VAL D 1 233 ? 12.955  5.487   -51.517 1.00 35.04  ? 309 VAL D CG1   1 
ATOM   7975 C  CG2   . VAL D 1 233 ? 11.147  4.365   -52.816 1.00 32.90  ? 309 VAL D CG2   1 
ATOM   7976 N  N     . LEU D 1 234 ? 15.340  6.267   -53.724 1.00 39.06  ? 310 LEU D N     1 
ATOM   7977 C  CA    . LEU D 1 234 ? 16.736  6.495   -53.388 1.00 42.06  ? 310 LEU D CA    1 
ATOM   7978 C  C     . LEU D 1 234 ? 16.748  7.236   -52.075 1.00 41.53  ? 310 LEU D C     1 
ATOM   7979 O  O     . LEU D 1 234 ? 16.198  8.336   -51.980 1.00 44.43  ? 310 LEU D O     1 
ATOM   7980 C  CB    . LEU D 1 234 ? 17.455  7.341   -54.465 1.00 42.32  ? 310 LEU D CB    1 
ATOM   7981 C  CG    . LEU D 1 234 ? 17.431  6.904   -55.939 1.00 41.25  ? 310 LEU D CG    1 
ATOM   7982 C  CD1   . LEU D 1 234 ? 18.396  7.724   -56.778 1.00 41.62  ? 310 LEU D CD1   1 
ATOM   7983 C  CD2   . LEU D 1 234 ? 17.772  5.446   -56.081 1.00 36.23  ? 310 LEU D CD2   1 
ATOM   7984 N  N     . ASN D 1 235 ? 17.348  6.636   -51.056 1.00 36.19  ? 311 ASN D N     1 
ATOM   7985 C  CA    . ASN D 1 235 ? 17.525  7.325   -49.794 1.00 42.86  ? 311 ASN D CA    1 
ATOM   7986 C  C     . ASN D 1 235 ? 18.780  8.150   -49.923 1.00 42.10  ? 311 ASN D C     1 
ATOM   7987 O  O     . ASN D 1 235 ? 19.867  7.600   -50.036 1.00 46.24  ? 311 ASN D O     1 
ATOM   7988 C  CB    . ASN D 1 235 ? 17.640  6.338   -48.625 1.00 40.08  ? 311 ASN D CB    1 
ATOM   7989 C  CG    . ASN D 1 235 ? 16.280  5.882   -48.104 1.00 42.47  ? 311 ASN D CG    1 
ATOM   7990 O  OD1   . ASN D 1 235 ? 15.255  6.070   -48.764 1.00 39.22  ? 311 ASN D OD1   1 
ATOM   7991 N  ND2   . ASN D 1 235 ? 16.270  5.281   -46.911 1.00 38.08  ? 311 ASN D ND2   1 
ATOM   7992 N  N     . ILE D 1 236 ? 18.627  9.471   -49.926 1.00 42.80  ? 312 ILE D N     1 
ATOM   7993 C  CA    . ILE D 1 236 ? 19.741  10.370  -50.223 1.00 39.14  ? 312 ILE D CA    1 
ATOM   7994 C  C     . ILE D 1 236 ? 20.222  11.134  -48.987 1.00 39.25  ? 312 ILE D C     1 
ATOM   7995 O  O     . ILE D 1 236 ? 19.420  11.734  -48.268 1.00 42.89  ? 312 ILE D O     1 
ATOM   7996 C  CB    . ILE D 1 236 ? 19.348  11.351  -51.349 1.00 45.98  ? 312 ILE D CB    1 
ATOM   7997 C  CG1   . ILE D 1 236 ? 18.896  10.566  -52.582 1.00 39.31  ? 312 ILE D CG1   1 
ATOM   7998 C  CG2   . ILE D 1 236 ? 20.494  12.300  -51.689 1.00 41.94  ? 312 ILE D CG2   1 
ATOM   7999 C  CD1   . ILE D 1 236 ? 18.247  11.413  -53.642 1.00 38.68  ? 312 ILE D CD1   1 
ATOM   8000 N  N     . MET D 1 237 ? 21.529  11.089  -48.727 1.00 41.69  ? 313 MET D N     1 
ATOM   8001 C  CA    . MET D 1 237 ? 22.130  11.923  -47.686 1.00 47.44  ? 313 MET D CA    1 
ATOM   8002 C  C     . MET D 1 237 ? 22.907  13.060  -48.345 1.00 51.40  ? 313 MET D C     1 
ATOM   8003 O  O     . MET D 1 237 ? 23.990  12.839  -48.905 1.00 49.03  ? 313 MET D O     1 
ATOM   8004 C  CB    . MET D 1 237 ? 23.063  11.112  -46.775 1.00 53.28  ? 313 MET D CB    1 
ATOM   8005 C  CG    . MET D 1 237 ? 22.382  10.075  -45.881 1.00 51.52  ? 313 MET D CG    1 
ATOM   8006 S  SD    . MET D 1 237 ? 21.911  10.728  -44.265 1.00 64.06  ? 313 MET D SD    1 
ATOM   8007 C  CE    . MET D 1 237 ? 23.506  11.158  -43.581 1.00 54.85  ? 313 MET D CE    1 
ATOM   8008 N  N     . LEU D 1 238 ? 22.342  14.268  -48.295 1.00 52.29  ? 314 LEU D N     1 
ATOM   8009 C  CA    . LEU D 1 238 ? 22.990  15.455  -48.858 1.00 48.68  ? 314 LEU D CA    1 
ATOM   8010 C  C     . LEU D 1 238 ? 23.955  16.037  -47.843 1.00 48.16  ? 314 LEU D C     1 
ATOM   8011 O  O     . LEU D 1 238 ? 23.636  16.138  -46.657 1.00 53.05  ? 314 LEU D O     1 
ATOM   8012 C  CB    . LEU D 1 238 ? 21.951  16.523  -49.208 1.00 46.08  ? 314 LEU D CB    1 
ATOM   8013 C  CG    . LEU D 1 238 ? 20.847  16.190  -50.209 1.00 45.45  ? 314 LEU D CG    1 
ATOM   8014 C  CD1   . LEU D 1 238 ? 19.812  17.307  -50.249 1.00 44.39  ? 314 LEU D CD1   1 
ATOM   8015 C  CD2   . LEU D 1 238 ? 21.435  15.945  -51.597 1.00 41.03  ? 314 LEU D CD2   1 
ATOM   8016 N  N     . ASP D 1 239 ? 25.135  16.434  -48.295 1.00 53.25  ? 315 ASP D N     1 
ATOM   8017 C  CA    . ASP D 1 239 ? 26.050  17.103  -47.384 1.00 62.39  ? 315 ASP D CA    1 
ATOM   8018 C  C     . ASP D 1 239 ? 25.800  18.611  -47.394 1.00 59.10  ? 315 ASP D C     1 
ATOM   8019 O  O     . ASP D 1 239 ? 25.272  19.156  -48.365 1.00 52.83  ? 315 ASP D O     1 
ATOM   8020 C  CB    . ASP D 1 239 ? 27.512  16.787  -47.711 1.00 64.40  ? 315 ASP D CB    1 
ATOM   8021 C  CG    . ASP D 1 239 ? 28.468  17.404  -46.704 1.00 75.95  ? 315 ASP D CG    1 
ATOM   8022 O  OD1   . ASP D 1 239 ? 28.094  17.472  -45.503 1.00 73.46  ? 315 ASP D OD1   1 
ATOM   8023 O  OD2   . ASP D 1 239 ? 29.568  17.846  -47.112 1.00 75.48  ? 315 ASP D OD2   1 
ATOM   8024 N  N     . CYS D 1 240 ? 26.163  19.274  -46.302 1.00 59.65  ? 316 CYS D N     1 
ATOM   8025 C  CA    . CYS D 1 240 ? 26.001  20.714  -46.205 1.00 58.59  ? 316 CYS D CA    1 
ATOM   8026 C  C     . CYS D 1 240 ? 27.226  21.402  -45.613 1.00 67.00  ? 316 CYS D C     1 
ATOM   8027 O  O     . CYS D 1 240 ? 27.567  21.195  -44.441 1.00 63.52  ? 316 CYS D O     1 
ATOM   8028 C  CB    . CYS D 1 240 ? 24.771  21.068  -45.377 1.00 54.83  ? 316 CYS D CB    1 
ATOM   8029 S  SG    . CYS D 1 240 ? 24.680  22.850  -44.979 1.00 72.07  ? 316 CYS D SG    1 
ATOM   8030 N  N     . ASP D 1 241 ? 27.874  22.221  -46.440 1.00 68.58  ? 317 ASP D N     1 
ATOM   8031 C  CA    . ASP D 1 241 ? 28.943  23.115  -46.006 1.00 64.93  ? 317 ASP D CA    1 
ATOM   8032 C  C     . ASP D 1 241 ? 28.310  24.216  -45.168 1.00 61.42  ? 317 ASP D C     1 
ATOM   8033 O  O     . ASP D 1 241 ? 27.727  25.145  -45.714 1.00 67.48  ? 317 ASP D O     1 
ATOM   8034 C  CB    . ASP D 1 241 ? 29.638  23.713  -47.235 1.00 63.33  ? 317 ASP D CB    1 
ATOM   8035 C  CG    . ASP D 1 241 ? 30.806  24.626  -46.878 1.00 70.66  ? 317 ASP D CG    1 
ATOM   8036 O  OD1   . ASP D 1 241 ? 30.868  25.136  -45.736 1.00 72.22  ? 317 ASP D OD1   1 
ATOM   8037 O  OD2   . ASP D 1 241 ? 31.666  24.844  -47.759 1.00 69.72  ? 317 ASP D OD2   1 
ATOM   8038 N  N     . LYS D 1 242 ? 28.432  24.118  -43.848 1.00 65.78  ? 318 LYS D N     1 
ATOM   8039 C  CA    . LYS D 1 242 ? 27.695  25.002  -42.940 1.00 66.95  ? 318 LYS D CA    1 
ATOM   8040 C  C     . LYS D 1 242 ? 28.285  26.404  -42.843 1.00 65.79  ? 318 LYS D C     1 
ATOM   8041 O  O     . LYS D 1 242 ? 27.789  27.253  -42.096 1.00 63.39  ? 318 LYS D O     1 
ATOM   8042 C  CB    . LYS D 1 242 ? 27.584  24.380  -41.541 1.00 68.61  ? 318 LYS D CB    1 
ATOM   8043 C  CG    . LYS D 1 242 ? 26.216  23.777  -41.231 1.00 67.98  ? 318 LYS D CG    1 
ATOM   8044 C  CD    . LYS D 1 242 ? 26.227  22.944  -39.954 1.00 74.22  ? 318 LYS D CD    1 
ATOM   8045 C  CE    . LYS D 1 242 ? 26.792  21.537  -40.181 1.00 77.18  ? 318 LYS D CE    1 
ATOM   8046 N  NZ    . LYS D 1 242 ? 28.261  21.519  -40.453 1.00 76.36  ? 318 LYS D NZ    1 
ATOM   8047 N  N     . THR D 1 243 ? 29.353  26.639  -43.589 1.00 64.58  ? 319 THR D N     1 
ATOM   8048 C  CA    . THR D 1 243 ? 29.998  27.938  -43.572 1.00 68.82  ? 319 THR D CA    1 
ATOM   8049 C  C     . THR D 1 243 ? 29.677  28.684  -44.861 1.00 70.28  ? 319 THR D C     1 
ATOM   8050 O  O     . THR D 1 243 ? 29.612  29.911  -44.872 1.00 74.79  ? 319 THR D O     1 
ATOM   8051 C  CB    . THR D 1 243 ? 31.518  27.809  -43.361 1.00 70.90  ? 319 THR D CB    1 
ATOM   8052 O  OG1   . THR D 1 243 ? 32.069  26.962  -44.374 1.00 69.74  ? 319 THR D OG1   1 
ATOM   8053 C  CG2   . THR D 1 243 ? 31.814  27.198  -41.991 1.00 65.32  ? 319 THR D CG2   1 
ATOM   8054 N  N     . ALA D 1 244 ? 29.463  27.934  -45.940 1.00 67.50  ? 320 ALA D N     1 
ATOM   8055 C  CA    . ALA D 1 244 ? 28.982  28.505  -47.198 1.00 65.55  ? 320 ALA D CA    1 
ATOM   8056 C  C     . ALA D 1 244 ? 27.477  28.803  -47.128 1.00 69.36  ? 320 ALA D C     1 
ATOM   8057 O  O     . ALA D 1 244 ? 27.020  29.870  -47.556 1.00 63.51  ? 320 ALA D O     1 
ATOM   8058 C  CB    . ALA D 1 244 ? 29.286  27.566  -48.367 1.00 56.22  ? 320 ALA D CB    1 
ATOM   8059 N  N     . THR D 1 245 ? 26.714  27.851  -46.590 1.00 57.70  ? 321 THR D N     1 
ATOM   8060 C  CA    . THR D 1 245 ? 25.264  27.972  -46.500 1.00 49.46  ? 321 THR D CA    1 
ATOM   8061 C  C     . THR D 1 245 ? 24.799  27.482  -45.138 1.00 56.19  ? 321 THR D C     1 
ATOM   8062 O  O     . THR D 1 245 ? 24.321  26.358  -45.024 1.00 55.41  ? 321 THR D O     1 
ATOM   8063 C  CB    . THR D 1 245 ? 24.556  27.109  -47.566 1.00 56.96  ? 321 THR D CB    1 
ATOM   8064 O  OG1   . THR D 1 245 ? 24.880  25.722  -47.365 1.00 61.97  ? 321 THR D OG1   1 
ATOM   8065 C  CG2   . THR D 1 245 ? 24.959  27.516  -48.975 1.00 54.17  ? 321 THR D CG2   1 
ATOM   8066 N  N     . PRO D 1 246 ? 24.943  28.318  -44.095 1.00 56.90  ? 322 PRO D N     1 
ATOM   8067 C  CA    . PRO D 1 246 ? 24.611  27.908  -42.718 1.00 58.21  ? 322 PRO D CA    1 
ATOM   8068 C  C     . PRO D 1 246 ? 23.111  27.754  -42.441 1.00 53.56  ? 322 PRO D C     1 
ATOM   8069 O  O     . PRO D 1 246 ? 22.735  27.296  -41.362 1.00 60.67  ? 322 PRO D O     1 
ATOM   8070 C  CB    . PRO D 1 246 ? 25.192  29.038  -41.860 1.00 53.14  ? 322 PRO D CB    1 
ATOM   8071 C  CG    . PRO D 1 246 ? 25.244  30.213  -42.771 1.00 52.75  ? 322 PRO D CG    1 
ATOM   8072 C  CD    . PRO D 1 246 ? 25.529  29.666  -44.144 1.00 50.73  ? 322 PRO D CD    1 
ATOM   8073 N  N     . TRP D 1 247 ? 22.273  28.127  -43.400 1.00 48.59  ? 323 TRP D N     1 
ATOM   8074 C  CA    . TRP D 1 247 ? 20.827  28.003  -43.252 1.00 55.89  ? 323 TRP D CA    1 
ATOM   8075 C  C     . TRP D 1 247 ? 20.312  26.601  -43.627 1.00 55.21  ? 323 TRP D C     1 
ATOM   8076 O  O     . TRP D 1 247 ? 19.117  26.412  -43.867 1.00 48.20  ? 323 TRP D O     1 
ATOM   8077 C  CB    . TRP D 1 247 ? 20.120  29.058  -44.102 1.00 46.14  ? 323 TRP D CB    1 
ATOM   8078 C  CG    . TRP D 1 247 ? 20.602  29.073  -45.524 1.00 52.08  ? 323 TRP D CG    1 
ATOM   8079 C  CD1   . TRP D 1 247 ? 20.160  28.284  -46.553 1.00 56.13  ? 323 TRP D CD1   1 
ATOM   8080 C  CD2   . TRP D 1 247 ? 21.628  29.911  -46.076 1.00 53.15  ? 323 TRP D CD2   1 
ATOM   8081 N  NE1   . TRP D 1 247 ? 20.849  28.578  -47.712 1.00 53.25  ? 323 TRP D NE1   1 
ATOM   8082 C  CE2   . TRP D 1 247 ? 21.752  29.577  -47.447 1.00 57.90  ? 323 TRP D CE2   1 
ATOM   8083 C  CE3   . TRP D 1 247 ? 22.455  30.906  -45.548 1.00 51.97  ? 323 TRP D CE3   1 
ATOM   8084 C  CZ2   . TRP D 1 247 ? 22.665  30.209  -48.291 1.00 51.04  ? 323 TRP D CZ2   1 
ATOM   8085 C  CZ3   . TRP D 1 247 ? 23.365  31.533  -46.391 1.00 50.76  ? 323 TRP D CZ3   1 
ATOM   8086 C  CH2   . TRP D 1 247 ? 23.461  31.181  -47.745 1.00 56.38  ? 323 TRP D CH2   1 
ATOM   8087 N  N     . CYS D 1 248 ? 21.211  25.625  -43.687 1.00 53.88  ? 324 CYS D N     1 
ATOM   8088 C  CA    . CYS D 1 248 ? 20.798  24.250  -43.954 1.00 56.91  ? 324 CYS D CA    1 
ATOM   8089 C  C     . CYS D 1 248 ? 20.249  23.584  -42.696 1.00 56.47  ? 324 CYS D C     1 
ATOM   8090 O  O     . CYS D 1 248 ? 19.380  22.716  -42.783 1.00 55.08  ? 324 CYS D O     1 
ATOM   8091 C  CB    . CYS D 1 248 ? 21.951  23.434  -44.534 1.00 50.88  ? 324 CYS D CB    1 
ATOM   8092 S  SG    . CYS D 1 248 ? 23.416  23.418  -43.501 1.00 56.75  ? 324 CYS D SG    1 
ATOM   8093 N  N     . THR D 1 249 ? 20.742  24.010  -41.531 1.00 60.08  ? 325 THR D N     1 
ATOM   8094 C  CA    . THR D 1 249 ? 20.341  23.427  -40.250 1.00 57.18  ? 325 THR D CA    1 
ATOM   8095 C  C     . THR D 1 249 ? 19.157  24.184  -39.645 1.00 64.96  ? 325 THR D C     1 
ATOM   8096 O  O     . THR D 1 249 ? 18.486  24.930  -40.350 1.00 68.77  ? 325 THR D O     1 
ATOM   8097 C  CB    . THR D 1 249 ? 21.522  23.414  -39.264 1.00 61.11  ? 325 THR D CB    1 
ATOM   8098 O  OG1   . THR D 1 249 ? 22.753  23.392  -39.995 1.00 69.47  ? 325 THR D OG1   1 
ATOM   8099 C  CG2   . THR D 1 249 ? 21.468  22.181  -38.366 1.00 73.60  ? 325 THR D CG2   1 
ATOM   8100 N  N     . PHE D 1 250 ? 18.901  23.978  -38.350 1.00 77.25  ? 326 PHE D N     1 
ATOM   8101 C  CA    . PHE D 1 250 ? 17.849  24.692  -37.605 1.00 76.09  ? 326 PHE D CA    1 
ATOM   8102 C  C     . PHE D 1 250 ? 16.437  24.326  -38.100 1.00 80.42  ? 326 PHE D C     1 
ATOM   8103 O  O     . PHE D 1 250 ? 15.480  25.093  -37.904 1.00 75.57  ? 326 PHE D O     1 
ATOM   8104 C  CB    . PHE D 1 250 ? 18.097  26.211  -37.642 1.00 80.48  ? 326 PHE D CB    1 
ATOM   8105 C  CG    . PHE D 1 250 ? 17.318  26.997  -36.620 1.00 79.93  ? 326 PHE D CG    1 
ATOM   8106 C  CD1   . PHE D 1 250 ? 16.752  26.379  -35.517 1.00 84.38  ? 326 PHE D CD1   1 
ATOM   8107 C  CD2   . PHE D 1 250 ? 17.149  28.369  -36.774 1.00 79.68  ? 326 PHE D CD2   1 
ATOM   8108 C  CE1   . PHE D 1 250 ? 16.035  27.117  -34.586 1.00 88.69  ? 326 PHE D CE1   1 
ATOM   8109 C  CE2   . PHE D 1 250 ? 16.428  29.112  -35.852 1.00 69.82  ? 326 PHE D CE2   1 
ATOM   8110 C  CZ    . PHE D 1 250 ? 15.875  28.487  -34.756 1.00 81.40  ? 326 PHE D CZ    1 
ATOM   8111 N  N     . SER D 1 251 ? 16.349  23.153  -38.746 1.00 80.84  ? 327 SER D N     1 
ATOM   8112 C  CA    . SER D 1 251 ? 15.096  22.469  -39.138 1.00 75.10  ? 327 SER D CA    1 
ATOM   8113 C  C     . SER D 1 251 ? 15.362  21.180  -39.947 1.00 69.06  ? 327 SER D C     1 
ATOM   8114 O  O     . SER D 1 251 ? 16.436  20.580  -39.846 1.00 69.95  ? 327 SER D O     1 
ATOM   8115 C  CB    . SER D 1 251 ? 14.139  23.387  -39.913 1.00 78.01  ? 327 SER D CB    1 
ATOM   8116 O  OG    . SER D 1 251 ? 12.945  22.703  -40.272 1.00 79.55  ? 327 SER D OG    1 
ATOM   8117 O  OXT   . SER D 1 251 ? 14.525  20.690  -40.721 1.00 64.31  ? 327 SER D OXT   1 
HETATM 8118 MN MN    . MN  E 2 .   ? 9.707   3.714   -31.192 1.00 38.21  ? 401 MN  A MN    1 
HETATM 8119 N  N1    . UDP F 3 .   ? 3.740   5.701   -34.917 1.00 34.89  ? 402 UDP A N1    1 
HETATM 8120 C  C2    . UDP F 3 .   ? 3.746   6.273   -36.181 1.00 31.04  ? 402 UDP A C2    1 
HETATM 8121 N  N3    . UDP F 3 .   ? 3.728   7.646   -36.342 1.00 40.07  ? 402 UDP A N3    1 
HETATM 8122 C  C4    . UDP F 3 .   ? 3.692   8.455   -35.227 1.00 41.60  ? 402 UDP A C4    1 
HETATM 8123 C  C5    . UDP F 3 .   ? 3.666   7.897   -33.941 1.00 33.81  ? 402 UDP A C5    1 
HETATM 8124 C  C6    . UDP F 3 .   ? 3.845   6.512   -33.812 1.00 39.14  ? 402 UDP A C6    1 
HETATM 8125 O  O2    . UDP F 3 .   ? 3.772   5.579   -37.193 1.00 37.66  ? 402 UDP A O2    1 
HETATM 8126 O  O4    . UDP F 3 .   ? 3.672   9.658   -35.404 1.00 38.32  ? 402 UDP A O4    1 
HETATM 8127 C  "C1'" . UDP F 3 .   ? 3.728   4.221   -34.776 1.00 36.52  ? 402 UDP A "C1'" 1 
HETATM 8128 C  "C2'" . UDP F 3 .   ? 5.040   3.591   -35.209 1.00 37.99  ? 402 UDP A "C2'" 1 
HETATM 8129 O  "O2'" . UDP F 3 .   ? 4.743   2.297   -35.703 1.00 34.23  ? 402 UDP A "O2'" 1 
HETATM 8130 C  "C3'" . UDP F 3 .   ? 5.797   3.516   -33.916 1.00 33.41  ? 402 UDP A "C3'" 1 
HETATM 8131 C  "C4'" . UDP F 3 .   ? 4.679   3.137   -32.942 1.00 33.55  ? 402 UDP A "C4'" 1 
HETATM 8132 O  "O4'" . UDP F 3 .   ? 3.532   3.808   -33.434 1.00 37.34  ? 402 UDP A "O4'" 1 
HETATM 8133 O  "O3'" . UDP F 3 .   ? 6.854   2.593   -34.024 1.00 31.99  ? 402 UDP A "O3'" 1 
HETATM 8134 C  "C5'" . UDP F 3 .   ? 4.943   3.580   -31.504 1.00 38.58  ? 402 UDP A "C5'" 1 
HETATM 8135 O  "O5'" . UDP F 3 .   ? 5.342   4.943   -31.475 1.00 33.53  ? 402 UDP A "O5'" 1 
HETATM 8136 P  PA    . UDP F 3 .   ? 6.784   5.307   -30.855 1.00 37.09  ? 402 UDP A PA    1 
HETATM 8137 O  O1A   . UDP F 3 .   ? 7.822   4.550   -31.617 1.00 32.60  ? 402 UDP A O1A   1 
HETATM 8138 O  O2A   . UDP F 3 .   ? 7.009   6.770   -30.873 1.00 36.59  ? 402 UDP A O2A   1 
HETATM 8139 O  O3A   . UDP F 3 .   ? 6.718   4.763   -29.340 1.00 31.77  ? 402 UDP A O3A   1 
HETATM 8140 P  PB    . UDP F 3 .   ? 7.992   4.290   -28.477 1.00 40.31  ? 402 UDP A PB    1 
HETATM 8141 O  O1B   . UDP F 3 .   ? 9.235   4.350   -29.281 1.00 31.75  ? 402 UDP A O1B   1 
HETATM 8142 O  O2B   . UDP F 3 .   ? 8.072   5.189   -27.293 1.00 39.88  ? 402 UDP A O2B   1 
HETATM 8143 O  O3B   . UDP F 3 .   ? 7.821   2.883   -28.029 1.00 34.58  ? 402 UDP A O3B   1 
HETATM 8144 C  C     . TRS G 4 .   ? 3.599   3.456   -26.507 1.00 39.21  ? 403 TRS A C     1 
HETATM 8145 C  C1    . TRS G 4 .   ? 3.022   4.546   -25.599 1.00 32.02  ? 403 TRS A C1    1 
HETATM 8146 C  C2    . TRS G 4 .   ? 5.055   3.277   -26.054 1.00 33.46  ? 403 TRS A C2    1 
HETATM 8147 C  C3    . TRS G 4 .   ? 3.402   3.878   -27.967 1.00 24.07  ? 403 TRS A C3    1 
HETATM 8148 N  N     . TRS G 4 .   ? 2.885   2.185   -26.369 1.00 26.12  ? 403 TRS A N     1 
HETATM 8149 O  O1    . TRS G 4 .   ? 1.868   5.082   -26.201 1.00 34.81  ? 403 TRS A O1    1 
HETATM 8150 O  O2    . TRS G 4 .   ? 5.625   2.038   -26.409 1.00 40.56  ? 403 TRS A O2    1 
HETATM 8151 O  O3    . TRS G 4 .   ? 4.650   4.306   -28.417 1.00 42.34  ? 403 TRS A O3    1 
HETATM 8152 MN MN    . MN  H 2 .   ? -29.035 -19.580 2.082   1.00 41.41  ? 401 MN  B MN    1 
HETATM 8153 N  N1    . UDP I 3 .   ? -30.702 -16.239 -4.210  1.00 41.46  ? 402 UDP B N1    1 
HETATM 8154 C  C2    . UDP I 3 .   ? -31.495 -15.131 -4.319  1.00 35.18  ? 402 UDP B C2    1 
HETATM 8155 N  N3    . UDP I 3 .   ? -32.835 -15.232 -4.622  1.00 32.66  ? 402 UDP B N3    1 
HETATM 8156 C  C4    . UDP I 3 .   ? -33.402 -16.458 -4.833  1.00 41.42  ? 402 UDP B C4    1 
HETATM 8157 C  C5    . UDP I 3 .   ? -32.601 -17.606 -4.737  1.00 35.45  ? 402 UDP B C5    1 
HETATM 8158 C  C6    . UDP I 3 .   ? -31.307 -17.478 -4.223  1.00 35.51  ? 402 UDP B C6    1 
HETATM 8159 O  O2    . UDP I 3 .   ? -30.995 -14.033 -4.133  1.00 42.89  ? 402 UDP B O2    1 
HETATM 8160 O  O4    . UDP I 3 .   ? -34.603 -16.493 -5.100  1.00 42.00  ? 402 UDP B O4    1 
HETATM 8161 C  "C1'" . UDP I 3 .   ? -29.263 -16.011 -3.908  1.00 36.69  ? 402 UDP B "C1'" 1 
HETATM 8162 C  "C2'" . UDP I 3 .   ? -28.999 -15.516 -2.505  1.00 43.16  ? 402 UDP B "C2'" 1 
HETATM 8163 O  "O2'" . UDP I 3 .   ? -27.795 -14.774 -2.579  1.00 37.17  ? 402 UDP B "O2'" 1 
HETATM 8164 C  "C3'" . UDP I 3 .   ? -28.777 -16.805 -1.744  1.00 35.27  ? 402 UDP B "C3'" 1 
HETATM 8165 C  "C4'" . UDP I 3 .   ? -27.959 -17.578 -2.772  1.00 35.62  ? 402 UDP B "C4'" 1 
HETATM 8166 O  "O4'" . UDP I 3 .   ? -28.509 -17.199 -4.022  1.00 31.81  ? 402 UDP B "O4'" 1 
HETATM 8167 O  "O3'" . UDP I 3 .   ? -28.089 -16.581 -0.536  1.00 30.12  ? 402 UDP B "O3'" 1 
HETATM 8168 C  "C5'" . UDP I 3 .   ? -28.030 -19.091 -2.600  1.00 37.15  ? 402 UDP B "C5'" 1 
HETATM 8169 O  "O5'" . UDP I 3 .   ? -29.392 -19.419 -2.504  1.00 42.53  ? 402 UDP B "O5'" 1 
HETATM 8170 P  PA    . UDP I 3 .   ? -29.944 -20.164 -1.197  1.00 41.18  ? 402 UDP B PA    1 
HETATM 8171 O  O1A   . UDP I 3 .   ? -29.637 -19.347 -0.001  1.00 35.70  ? 402 UDP B O1A   1 
HETATM 8172 O  O2A   . UDP I 3 .   ? -31.383 -20.404 -1.371  1.00 44.16  ? 402 UDP B O2A   1 
HETATM 8173 O  O3A   . UDP I 3 .   ? -29.084 -21.527 -1.202  1.00 42.10  ? 402 UDP B O3A   1 
HETATM 8174 P  PB    . UDP I 3 .   ? -28.587 -22.331 0.104   1.00 45.78  ? 402 UDP B PB    1 
HETATM 8175 O  O1B   . UDP I 3 .   ? -29.062 -21.643 1.333   1.00 39.60  ? 402 UDP B O1B   1 
HETATM 8176 O  O2B   . UDP I 3 .   ? -29.151 -23.698 -0.013  1.00 41.55  ? 402 UDP B O2B   1 
HETATM 8177 O  O3B   . UDP I 3 .   ? -27.102 -22.421 0.160   1.00 43.38  ? 402 UDP B O3B   1 
HETATM 8178 C  C     . TRS J 4 .   ? -26.372 -23.932 -3.656  1.00 40.89  ? 403 TRS B C     1 
HETATM 8179 C  C1    . TRS J 4 .   ? -25.986 -24.606 -2.344  1.00 39.04  ? 403 TRS B C1    1 
HETATM 8180 C  C2    . TRS J 4 .   ? -27.395 -22.827 -3.403  1.00 43.57  ? 403 TRS B C2    1 
HETATM 8181 C  C3    . TRS J 4 .   ? -26.966 -24.927 -4.640  1.00 43.53  ? 403 TRS B C3    1 
HETATM 8182 N  N     . TRS J 4 .   ? -25.155 -23.358 -4.248  1.00 40.74  ? 403 TRS B N     1 
HETATM 8183 O  O1    . TRS J 4 .   ? -25.575 -23.646 -1.382  1.00 39.92  ? 403 TRS B O1    1 
HETATM 8184 O  O2    . TRS J 4 .   ? -27.674 -22.135 -4.600  1.00 41.27  ? 403 TRS B O2    1 
HETATM 8185 O  O3    . TRS J 4 .   ? -27.672 -24.255 -5.662  1.00 39.77  ? 403 TRS B O3    1 
HETATM 8186 MN MN    . MN  K 2 .   ? 17.363  -1.562  -7.558  1.00 36.87  ? 401 MN  C MN    1 
HETATM 8187 N  N1    . UDP L 3 .   ? 20.236  -3.619  -1.191  1.00 36.42  ? 402 UDP C N1    1 
HETATM 8188 C  C2    . UDP L 3 .   ? 21.493  -4.213  -1.041  1.00 39.42  ? 402 UDP C C2    1 
HETATM 8189 N  N3    . UDP L 3 .   ? 21.627  -5.591  -1.051  1.00 39.18  ? 402 UDP C N3    1 
HETATM 8190 C  C4    . UDP L 3 .   ? 20.505  -6.380  -1.203  1.00 35.94  ? 402 UDP C C4    1 
HETATM 8191 C  C5    . UDP L 3 .   ? 19.243  -5.801  -1.344  1.00 31.74  ? 402 UDP C C5    1 
HETATM 8192 C  C6    . UDP L 3 .   ? 19.142  -4.406  -1.441  1.00 37.28  ? 402 UDP C C6    1 
HETATM 8193 O  O2    . UDP L 3 .   ? 22.517  -3.537  -0.899  1.00 36.90  ? 402 UDP C O2    1 
HETATM 8194 O  O4    . UDP L 3 .   ? 20.643  -7.596  -1.215  1.00 36.72  ? 402 UDP C O4    1 
HETATM 8195 C  "C1'" . UDP L 3 .   ? 20.092  -2.148  -1.157  1.00 34.08  ? 402 UDP C "C1'" 1 
HETATM 8196 C  "C2'" . UDP L 3 .   ? 20.646  -1.516  -2.411  1.00 36.12  ? 402 UDP C "C2'" 1 
HETATM 8197 O  "O2'" . UDP L 3 .   ? 21.073  -0.215  -2.058  1.00 37.75  ? 402 UDP C "O2'" 1 
HETATM 8198 C  "C3'" . UDP L 3 .   ? 19.424  -1.416  -3.287  1.00 36.79  ? 402 UDP C "C3'" 1 
HETATM 8199 C  "C4'" . UDP L 3 .   ? 18.355  -1.025  -2.255  1.00 34.85  ? 402 UDP C "C4'" 1 
HETATM 8200 O  "O4'" . UDP L 3 .   ? 18.725  -1.762  -1.100  1.00 34.81  ? 402 UDP C "O4'" 1 
HETATM 8201 O  "O3'" . UDP L 3 .   ? 19.637  -0.488  -4.330  1.00 34.87  ? 402 UDP C "O3'" 1 
HETATM 8202 C  "C5'" . UDP L 3 .   ? 16.927  -1.382  -2.683  1.00 33.18  ? 402 UDP C "C5'" 1 
HETATM 8203 O  "O5'" . UDP L 3 .   ? 16.983  -2.720  -3.146  1.00 42.45  ? 402 UDP C "O5'" 1 
HETATM 8204 P  PA    . UDP L 3 .   ? 16.583  -3.144  -4.643  1.00 38.76  ? 402 UDP C PA    1 
HETATM 8205 O  O1A   . UDP L 3 .   ? 17.472  -2.442  -5.596  1.00 39.27  ? 402 UDP C O1A   1 
HETATM 8206 O  O2A   . UDP L 3 .   ? 16.670  -4.614  -4.764  1.00 36.50  ? 402 UDP C O2A   1 
HETATM 8207 O  O3A   . UDP L 3 .   ? 15.076  -2.626  -4.850  1.00 32.63  ? 402 UDP C O3A   1 
HETATM 8208 P  PB    . UDP L 3 .   ? 14.400  -2.014  -6.185  1.00 40.98  ? 402 UDP C PB    1 
HETATM 8209 O  O1B   . UDP L 3 .   ? 15.315  -1.931  -7.366  1.00 36.18  ? 402 UDP C O1B   1 
HETATM 8210 O  O2B   . UDP L 3 .   ? 13.221  -2.866  -6.492  1.00 39.89  ? 402 UDP C O2B   1 
HETATM 8211 O  O3B   . UDP L 3 .   ? 13.862  -0.658  -5.918  1.00 36.13  ? 402 UDP C O3B   1 
HETATM 8212 C  C     . TRS M 4 .   ? 11.776  -1.187  -2.373  1.00 43.11  ? 403 TRS C C     1 
HETATM 8213 C  C1    . TRS M 4 .   ? 10.782  -2.235  -1.849  1.00 39.87  ? 403 TRS C C1    1 
HETATM 8214 C  C2    . TRS M 4 .   ? 11.366  -0.794  -3.788  1.00 39.73  ? 403 TRS C C2    1 
HETATM 8215 C  C3    . TRS M 4 .   ? 13.209  -1.712  -2.406  1.00 41.22  ? 403 TRS C C3    1 
HETATM 8216 N  N     . TRS M 4 .   ? 11.748  -0.008  -1.499  1.00 35.88  ? 403 TRS C N     1 
HETATM 8217 O  O1    . TRS M 4 .   ? 11.263  -2.867  -0.681  1.00 32.41  ? 403 TRS C O1    1 
HETATM 8218 O  O2    . TRS M 4 .   ? 12.168  0.261   -4.269  1.00 44.47  ? 403 TRS C O2    1 
HETATM 8219 O  O3    . TRS M 4 .   ? 13.669  -1.973  -1.096  1.00 41.10  ? 403 TRS C O3    1 
HETATM 8220 MN MN    . MN  N 2 .   ? 2.725   21.607  -53.191 1.00 33.55  ? 401 MN  D MN    1 
HETATM 8221 N  N1    . UDP O 3 .   ? 8.720   18.219  -50.771 1.00 40.30  ? 402 UDP D N1    1 
HETATM 8222 C  C2    . UDP O 3 .   ? 8.814   17.134  -49.935 1.00 33.09  ? 402 UDP D C2    1 
HETATM 8223 N  N3    . UDP O 3 .   ? 8.927   17.290  -48.571 1.00 33.74  ? 402 UDP D N3    1 
HETATM 8224 C  C4    . UDP O 3 .   ? 8.963   18.530  -48.002 1.00 39.99  ? 402 UDP D C4    1 
HETATM 8225 C  C5    . UDP O 3 .   ? 8.881   19.656  -48.829 1.00 33.00  ? 402 UDP D C5    1 
HETATM 8226 C  C6    . UDP O 3 .   ? 8.681   19.468  -50.199 1.00 36.38  ? 402 UDP D C6    1 
HETATM 8227 O  O2    . UDP O 3 .   ? 8.785   16.004  -50.399 1.00 38.49  ? 402 UDP D O2    1 
HETATM 8228 O  O4    . UDP O 3 .   ? 9.067   18.601  -46.781 1.00 38.80  ? 402 UDP D O4    1 
HETATM 8229 C  "C1'" . UDP O 3 .   ? 8.626   18.005  -52.250 1.00 35.82  ? 402 UDP D "C1'" 1 
HETATM 8230 C  "C2'" . UDP O 3 .   ? 7.295   17.438  -52.705 1.00 34.15  ? 402 UDP D "C2'" 1 
HETATM 8231 O  "O2'" . UDP O 3 .   ? 7.486   16.667  -53.887 1.00 31.28  ? 402 UDP D "O2'" 1 
HETATM 8232 C  "C3'" . UDP O 3 .   ? 6.528   18.695  -53.012 1.00 27.84  ? 402 UDP D "C3'" 1 
HETATM 8233 C  "C4'" . UDP O 3 .   ? 7.607   19.513  -53.700 1.00 30.91  ? 402 UDP D "C4'" 1 
HETATM 8234 O  "O4'" . UDP O 3 .   ? 8.772   19.235  -52.945 1.00 35.85  ? 402 UDP D "O4'" 1 
HETATM 8235 O  "O3'" . UDP O 3 .   ? 5.419   18.439  -53.843 1.00 34.48  ? 402 UDP D "O3'" 1 
HETATM 8236 C  "C5'" . UDP O 3 .   ? 7.346   21.018  -53.726 1.00 34.87  ? 402 UDP D "C5'" 1 
HETATM 8237 O  "O5'" . UDP O 3 .   ? 7.231   21.478  -52.395 1.00 31.56  ? 402 UDP D "O5'" 1 
HETATM 8238 P  PA    . UDP O 3 .   ? 5.882   22.236  -51.969 1.00 38.58  ? 402 UDP D PA    1 
HETATM 8239 O  O1A   . UDP O 3 .   ? 4.682   21.434  -52.303 1.00 27.39  ? 402 UDP D O1A   1 
HETATM 8240 O  O2A   . UDP O 3 .   ? 5.982   22.583  -50.539 1.00 36.96  ? 402 UDP D O2A   1 
HETATM 8241 O  O3A   . UDP O 3 .   ? 5.903   23.585  -52.879 1.00 38.22  ? 402 UDP D O3A   1 
HETATM 8242 P  PB    . UDP O 3 .   ? 4.632   24.329  -53.547 1.00 38.08  ? 402 UDP D PB    1 
HETATM 8243 O  O1B   . UDP O 3 .   ? 3.325   23.686  -53.257 1.00 34.34  ? 402 UDP D O1B   1 
HETATM 8244 O  O2B   . UDP O 3 .   ? 4.601   25.721  -53.026 1.00 41.44  ? 402 UDP D O2B   1 
HETATM 8245 O  O3B   . UDP O 3 .   ? 4.842   24.309  -55.006 1.00 36.12  ? 402 UDP D O3B   1 
HETATM 8246 C  C     . TRS P 4 .   ? 8.990   25.922  -54.856 1.00 36.36  ? 403 TRS D C     1 
HETATM 8247 C  C1    . TRS P 4 .   ? 7.769   26.765  -55.192 1.00 32.14  ? 403 TRS D C1    1 
HETATM 8248 C  C2    . TRS P 4 .   ? 9.678   25.564  -56.151 1.00 35.11  ? 403 TRS D C2    1 
HETATM 8249 C  C3    . TRS P 4 .   ? 8.496   24.682  -54.102 1.00 34.57  ? 403 TRS D C3    1 
HETATM 8250 N  N     . TRS P 4 .   ? 10.022  26.612  -54.075 1.00 31.19  ? 403 TRS D N     1 
HETATM 8251 O  O1    . TRS P 4 .   ? 6.888   25.978  -55.987 1.00 32.31  ? 403 TRS D O1    1 
HETATM 8252 O  O2    . TRS P 4 .   ? 9.003   24.520  -56.805 1.00 49.96  ? 403 TRS D O2    1 
HETATM 8253 O  O3    . TRS P 4 .   ? 9.555   23.787  -53.904 1.00 37.48  ? 403 TRS D O3    1 
HETATM 8254 O  O     . HOH Q 5 .   ? 8.540   1.760   -30.901 1.00 32.82  ? 501 HOH A O     1 
HETATM 8255 O  O     . HOH Q 5 .   ? -1.937  9.340   -24.920 1.00 42.26  ? 502 HOH A O     1 
HETATM 8256 O  O     . HOH Q 5 .   ? -17.140 -1.640  -34.053 1.00 52.98  ? 503 HOH A O     1 
HETATM 8257 O  O     . HOH Q 5 .   ? 14.533  -10.460 -41.001 0.84 46.20  ? 504 HOH A O     1 
HETATM 8258 O  O     . HOH Q 5 .   ? 2.670   -17.402 -50.614 1.00 54.16  ? 505 HOH A O     1 
HETATM 8259 O  O     . HOH Q 5 .   ? -11.548 -6.589  -19.946 1.00 38.98  ? 506 HOH A O     1 
HETATM 8260 O  O     . HOH Q 5 .   ? -2.128  -24.818 -47.533 1.00 33.84  ? 507 HOH A O     1 
HETATM 8261 O  O     . HOH Q 5 .   ? 8.784   -26.303 -44.259 1.00 43.25  ? 508 HOH A O     1 
HETATM 8262 O  O     . HOH Q 5 .   ? -7.617  -19.410 -42.144 1.00 39.83  ? 509 HOH A O     1 
HETATM 8263 O  O     . HOH Q 5 .   ? -6.062  -20.908 -40.422 1.00 40.16  ? 510 HOH A O     1 
HETATM 8264 O  O     . HOH Q 5 .   ? 10.731  -11.868 -20.992 1.00 38.94  ? 511 HOH A O     1 
HETATM 8265 O  O     . HOH Q 5 .   ? 1.642   -1.264  -21.053 0.83 40.45  ? 512 HOH A O     1 
HETATM 8266 O  O     . HOH Q 5 .   ? 8.795   -15.230 -19.305 1.00 47.83  ? 513 HOH A O     1 
HETATM 8267 O  O     . HOH Q 5 .   ? 4.368   0.582   -28.575 1.00 33.98  ? 514 HOH A O     1 
HETATM 8268 O  O     . HOH Q 5 .   ? -4.128  -14.689 -27.502 1.00 31.46  ? 515 HOH A O     1 
HETATM 8269 O  O     . HOH Q 5 .   ? -6.769  5.143   -28.180 1.00 34.66  ? 516 HOH A O     1 
HETATM 8270 O  O     . HOH Q 5 .   ? -0.659  6.955   -30.172 1.00 29.86  ? 517 HOH A O     1 
HETATM 8271 O  O     . HOH Q 5 .   ? -1.305  6.248   -27.322 1.00 33.53  ? 518 HOH A O     1 
HETATM 8272 O  O     . HOH Q 5 .   ? 16.028  -4.974  -27.381 1.00 44.67  ? 519 HOH A O     1 
HETATM 8273 O  O     . HOH Q 5 .   ? 1.351   -20.203 -39.697 1.00 37.19  ? 520 HOH A O     1 
HETATM 8274 O  O     . HOH Q 5 .   ? -6.175  0.552   -24.728 1.00 30.70  ? 521 HOH A O     1 
HETATM 8275 O  O     . HOH Q 5 .   ? -5.220  -16.645 -20.767 1.00 33.74  ? 522 HOH A O     1 
HETATM 8276 O  O     . HOH Q 5 .   ? -3.491  5.357   -28.738 1.00 34.33  ? 523 HOH A O     1 
HETATM 8277 O  O     . HOH Q 5 .   ? 18.219  -16.202 -27.017 1.00 45.40  ? 524 HOH A O     1 
HETATM 8278 O  O     . HOH Q 5 .   ? -0.720  -12.543 -16.596 1.00 33.22  ? 525 HOH A O     1 
HETATM 8279 O  O     . HOH Q 5 .   ? -4.288  3.417   -49.004 0.82 41.39  ? 526 HOH A O     1 
HETATM 8280 O  O     . HOH Q 5 .   ? 1.782   -8.996  -46.519 1.00 38.23  ? 527 HOH A O     1 
HETATM 8281 O  O     . HOH Q 5 .   ? 5.776   -21.184 -31.756 1.00 45.47  ? 528 HOH A O     1 
HETATM 8282 O  O     . HOH Q 5 .   ? 13.477  -14.278 -21.835 1.00 47.63  ? 529 HOH A O     1 
HETATM 8283 O  O     . HOH Q 5 .   ? -12.635 3.678   -26.221 1.00 41.21  ? 530 HOH A O     1 
HETATM 8284 O  O     . HOH Q 5 .   ? 8.862   0.508   -28.716 1.00 37.34  ? 531 HOH A O     1 
HETATM 8285 O  O     . HOH Q 5 .   ? 9.400   -23.550 -45.565 1.00 44.50  ? 532 HOH A O     1 
HETATM 8286 O  O     . HOH Q 5 .   ? -6.369  8.469   -48.523 1.00 44.38  ? 533 HOH A O     1 
HETATM 8287 O  O     . HOH Q 5 .   ? -3.501  -1.075  -54.772 1.00 48.86  ? 534 HOH A O     1 
HETATM 8288 O  O     . HOH Q 5 .   ? -14.353 2.479   -44.630 1.00 50.15  ? 535 HOH A O     1 
HETATM 8289 O  O     . HOH Q 5 .   ? 0.625   12.710  -32.642 1.00 44.12  ? 536 HOH A O     1 
HETATM 8290 O  O     . HOH Q 5 .   ? 15.822  2.637   -28.047 1.00 45.03  ? 537 HOH A O     1 
HETATM 8291 O  O     . HOH Q 5 .   ? -7.107  -20.386 -48.055 1.00 50.97  ? 538 HOH A O     1 
HETATM 8292 O  O     . HOH Q 5 .   ? -8.017  -7.787  -45.835 1.00 51.53  ? 539 HOH A O     1 
HETATM 8293 O  O     . HOH Q 5 .   ? 17.593  -2.749  -28.846 1.00 52.71  ? 540 HOH A O     1 
HETATM 8294 O  O     . HOH Q 5 .   ? 13.414  11.339  -44.513 1.00 49.14  ? 541 HOH A O     1 
HETATM 8295 O  O     . HOH Q 5 .   ? 2.318   -11.593 -47.184 1.00 46.05  ? 542 HOH A O     1 
HETATM 8296 O  O     . HOH Q 5 .   ? -1.230  -21.299 -16.781 1.00 46.10  ? 543 HOH A O     1 
HETATM 8297 O  O     . HOH Q 5 .   ? 18.278  -11.851 -22.347 1.00 46.38  ? 544 HOH A O     1 
HETATM 8298 O  O     . HOH Q 5 .   ? 7.556   -18.495 -33.498 1.00 39.19  ? 545 HOH A O     1 
HETATM 8299 O  O     . HOH Q 5 .   ? -14.687 4.385   -27.551 1.00 53.09  ? 546 HOH A O     1 
HETATM 8300 O  O     . HOH Q 5 .   ? 9.600   5.514   -34.904 1.00 45.41  ? 547 HOH A O     1 
HETATM 8301 O  O     . HOH Q 5 .   ? -16.687 2.542   -41.351 1.00 56.98  ? 548 HOH A O     1 
HETATM 8302 O  O     . HOH Q 5 .   ? 2.278   -15.898 -17.517 1.00 38.99  ? 549 HOH A O     1 
HETATM 8303 O  O     . HOH Q 5 .   ? -8.947  2.089   -52.561 1.00 50.13  ? 550 HOH A O     1 
HETATM 8304 O  O     . HOH Q 5 .   ? 18.299  -0.648  -31.038 1.00 48.66  ? 551 HOH A O     1 
HETATM 8305 O  O     . HOH Q 5 .   ? 7.856   9.492   -43.532 1.00 40.86  ? 552 HOH A O     1 
HETATM 8306 O  O     . HOH Q 5 .   ? 9.918   -6.338  -15.206 1.00 58.92  ? 553 HOH A O     1 
HETATM 8307 O  O     . HOH Q 5 .   ? -4.382  -18.919 -17.757 1.00 36.84  ? 554 HOH A O     1 
HETATM 8308 O  O     . HOH Q 5 .   ? -4.562  6.420   -51.581 1.00 43.35  ? 555 HOH A O     1 
HETATM 8309 O  O     . HOH Q 5 .   ? 13.895  -6.742  -50.033 1.00 45.79  ? 556 HOH A O     1 
HETATM 8310 O  O     . HOH Q 5 .   ? 2.224   6.000   -31.102 1.00 44.17  ? 557 HOH A O     1 
HETATM 8311 O  O     . HOH Q 5 .   ? 0.850   -0.477  -17.122 1.00 48.96  ? 558 HOH A O     1 
HETATM 8312 O  O     . HOH Q 5 .   ? 2.253   4.782   -21.510 1.00 45.75  ? 559 HOH A O     1 
HETATM 8313 O  O     . HOH Q 5 .   ? 4.636   -23.345 -38.837 1.00 36.37  ? 560 HOH A O     1 
HETATM 8314 O  O     . HOH Q 5 .   ? -0.089  -21.099 -26.623 1.00 39.91  ? 561 HOH A O     1 
HETATM 8315 O  O     . HOH Q 5 .   ? 4.095   -2.231  -13.798 1.00 43.88  ? 562 HOH A O     1 
HETATM 8316 O  O     . HOH Q 5 .   ? -5.597  -3.249  -13.223 1.00 57.83  ? 563 HOH A O     1 
HETATM 8317 O  O     . HOH Q 5 .   ? 7.612   -2.758  -12.745 1.00 39.15  ? 564 HOH A O     1 
HETATM 8318 O  O     . HOH Q 5 .   ? -9.031  -16.974 -32.137 1.00 50.66  ? 565 HOH A O     1 
HETATM 8319 O  O     . HOH Q 5 .   ? 1.291   10.397  -45.159 1.00 42.95  ? 566 HOH A O     1 
HETATM 8320 O  O     . HOH Q 5 .   ? -6.436  -11.543 -14.514 1.00 44.60  ? 567 HOH A O     1 
HETATM 8321 O  O     . HOH Q 5 .   ? 5.128   -11.453 -46.503 1.00 45.94  ? 568 HOH A O     1 
HETATM 8322 O  O     . HOH Q 5 .   ? 5.768   -8.743  -46.834 1.00 42.80  ? 569 HOH A O     1 
HETATM 8323 O  O     . HOH Q 5 .   ? 16.610  -5.542  -41.704 1.00 50.10  ? 570 HOH A O     1 
HETATM 8324 O  O     . HOH Q 5 .   ? 9.780   -16.550 -27.199 1.00 37.41  ? 571 HOH A O     1 
HETATM 8325 O  O     . HOH Q 5 .   ? 8.870   -18.258 -25.221 1.00 43.43  ? 572 HOH A O     1 
HETATM 8326 O  O     . HOH Q 5 .   ? -1.810  -0.576  -16.144 1.00 50.84  ? 573 HOH A O     1 
HETATM 8327 O  O     . HOH Q 5 .   ? 1.782   -28.616 -41.641 1.00 39.80  ? 574 HOH A O     1 
HETATM 8328 O  O     . HOH Q 5 .   ? 7.529   -20.443 -35.518 1.00 40.57  ? 575 HOH A O     1 
HETATM 8329 O  O     . HOH Q 5 .   ? 10.252  -20.293 -35.056 1.00 36.08  ? 576 HOH A O     1 
HETATM 8330 O  O     . HOH Q 5 .   ? 1.022   -2.940  -27.538 1.00 29.10  ? 577 HOH A O     1 
HETATM 8331 O  O     . HOH Q 5 .   ? -4.599  -19.930 -15.336 1.00 42.01  ? 578 HOH A O     1 
HETATM 8332 O  O     . HOH Q 5 .   ? -6.898  -17.479 -17.822 1.00 37.45  ? 579 HOH A O     1 
HETATM 8333 O  O     . HOH Q 5 .   ? 1.053   12.588  -35.553 1.00 50.87  ? 580 HOH A O     1 
HETATM 8334 O  O     . HOH Q 5 .   ? 1.925   8.287   -43.446 1.00 39.60  ? 581 HOH A O     1 
HETATM 8335 O  O     . HOH Q 5 .   ? 3.028   -15.904 -29.809 1.00 33.29  ? 582 HOH A O     1 
HETATM 8336 O  O     . HOH Q 5 .   ? -13.881 -14.464 -31.802 1.00 54.36  ? 583 HOH A O     1 
HETATM 8337 O  O     . HOH Q 5 .   ? 3.709   2.774   -22.355 1.00 47.06  ? 584 HOH A O     1 
HETATM 8338 O  O     . HOH Q 5 .   ? 14.895  3.209   -45.156 1.00 40.03  ? 585 HOH A O     1 
HETATM 8339 O  O     . HOH R 5 .   ? -26.972 -19.235 1.222   1.00 36.37  ? 501 HOH B O     1 
HETATM 8340 O  O     . HOH R 5 .   ? -23.763 -4.742  -20.702 1.00 42.34  ? 502 HOH B O     1 
HETATM 8341 O  O     . HOH R 5 .   ? -18.844 -30.671 8.335   1.00 48.41  ? 503 HOH B O     1 
HETATM 8342 O  O     . HOH R 5 .   ? -32.437 -6.211  7.532   1.00 46.18  ? 504 HOH B O     1 
HETATM 8343 O  O     . HOH R 5 .   ? -34.272 -20.006 -1.717  1.00 44.40  ? 505 HOH B O     1 
HETATM 8344 O  O     . HOH R 5 .   ? -34.922 -8.227  -6.098  1.00 36.17  ? 506 HOH B O     1 
HETATM 8345 O  O     . HOH R 5 .   ? -7.751  -18.758 -7.696  1.00 41.26  ? 507 HOH B O     1 
HETATM 8346 O  O     . HOH R 5 .   ? -21.055 -21.573 10.027  1.00 51.96  ? 508 HOH B O     1 
HETATM 8347 O  O     . HOH R 5 .   ? -26.539 -21.875 -14.512 1.00 35.56  ? 509 HOH B O     1 
HETATM 8348 O  O     . HOH R 5 .   ? -27.526 -21.579 -11.407 1.00 35.42  ? 510 HOH B O     1 
HETATM 8349 O  O     . HOH R 5 .   ? -28.513 -23.549 -9.169  1.00 35.95  ? 511 HOH B O     1 
HETATM 8350 O  O     . HOH R 5 .   ? -21.225 -24.666 -13.164 1.00 39.27  ? 512 HOH B O     1 
HETATM 8351 O  O     . HOH R 5 .   ? -30.185 -1.371  -11.462 1.00 35.27  ? 513 HOH B O     1 
HETATM 8352 O  O     . HOH R 5 .   ? -29.941 -20.637 -8.758  1.00 37.37  ? 514 HOH B O     1 
HETATM 8353 O  O     . HOH R 5 .   ? -32.165 -22.502 5.694   1.00 49.78  ? 515 HOH B O     1 
HETATM 8354 O  O     . HOH R 5 .   ? -16.546 -14.310 -21.954 1.00 39.43  ? 516 HOH B O     1 
HETATM 8355 O  O     . HOH R 5 .   ? -18.661 -1.765  -2.379  1.00 44.13  ? 517 HOH B O     1 
HETATM 8356 O  O     . HOH R 5 .   ? -30.290 -31.377 -6.515  1.00 45.52  ? 518 HOH B O     1 
HETATM 8357 O  O     . HOH R 5 .   ? -20.260 -27.948 -4.669  1.00 44.01  ? 519 HOH B O     1 
HETATM 8358 O  O     . HOH R 5 .   ? -13.988 -18.308 -21.711 0.75 39.17  ? 520 HOH B O     1 
HETATM 8359 O  O     . HOH R 5 .   ? -35.616 -9.454  -9.394  0.83 34.53  ? 521 HOH B O     1 
HETATM 8360 O  O     . HOH R 5 .   ? 0.579   -10.146 -5.204  1.00 50.19  ? 522 HOH B O     1 
HETATM 8361 O  O     . HOH R 5 .   ? -26.068 -5.260  -21.541 1.00 41.93  ? 523 HOH B O     1 
HETATM 8362 O  O     . HOH R 5 .   ? -35.738 -19.072 -6.030  1.00 43.42  ? 524 HOH B O     1 
HETATM 8363 O  O     . HOH R 5 .   ? -35.090 -12.332 -20.316 1.00 50.20  ? 525 HOH B O     1 
HETATM 8364 O  O     . HOH R 5 .   ? -26.403 -28.083 -4.505  1.00 37.13  ? 526 HOH B O     1 
HETATM 8365 O  O     . HOH R 5 .   ? -8.886  -18.639 6.420   1.00 53.00  ? 527 HOH B O     1 
HETATM 8366 O  O     . HOH R 5 .   ? -23.691 -22.948 -20.075 1.00 42.10  ? 528 HOH B O     1 
HETATM 8367 O  O     . HOH R 5 .   ? -27.094 5.359   -9.795  1.00 51.91  ? 529 HOH B O     1 
HETATM 8368 O  O     . HOH R 5 .   ? -13.403 -32.930 -13.581 1.00 45.27  ? 530 HOH B O     1 
HETATM 8369 O  O     . HOH R 5 .   ? -24.972 -29.611 -17.429 1.00 52.18  ? 531 HOH B O     1 
HETATM 8370 O  O     . HOH R 5 .   ? -24.381 -21.144 -2.451  1.00 36.07  ? 532 HOH B O     1 
HETATM 8371 O  O     . HOH R 5 .   ? -34.807 -15.205 -23.309 1.00 56.10  ? 533 HOH B O     1 
HETATM 8372 O  O     . HOH R 5 .   ? -22.606 -31.744 -12.854 1.00 47.25  ? 534 HOH B O     1 
HETATM 8373 O  O     . HOH R 5 .   ? -16.202 -26.628 -19.280 1.00 50.41  ? 535 HOH B O     1 
HETATM 8374 O  O     . HOH R 5 .   ? -10.264 -24.746 9.394   1.00 60.61  ? 536 HOH B O     1 
HETATM 8375 O  O     . HOH R 5 .   ? -19.994 -21.493 -5.105  1.00 44.24  ? 537 HOH B O     1 
HETATM 8376 O  O     . HOH R 5 .   ? -27.481 -10.741 4.816   1.00 49.11  ? 538 HOH B O     1 
HETATM 8377 O  O     . HOH R 5 .   ? -11.830 -19.772 -21.335 1.00 40.35  ? 539 HOH B O     1 
HETATM 8378 O  O     . HOH R 5 .   ? -13.736 -25.515 13.066  1.00 62.68  ? 540 HOH B O     1 
HETATM 8379 O  O     . HOH R 5 .   ? -9.862  -18.045 -22.274 1.00 49.13  ? 541 HOH B O     1 
HETATM 8380 O  O     . HOH R 5 .   ? -35.201 -1.268  -11.059 1.00 44.83  ? 542 HOH B O     1 
HETATM 8381 O  O     . HOH R 5 .   ? -6.754  -5.628  -1.440  1.00 56.24  ? 543 HOH B O     1 
HETATM 8382 O  O     . HOH R 5 .   ? -28.088 -16.402 -19.768 1.00 49.22  ? 544 HOH B O     1 
HETATM 8383 O  O     . HOH R 5 .   ? -27.865 -30.727 4.453   1.00 50.89  ? 545 HOH B O     1 
HETATM 8384 O  O     . HOH R 5 .   ? -19.612 -32.520 -8.738  1.00 40.69  ? 546 HOH B O     1 
HETATM 8385 O  O     . HOH R 5 .   ? -31.487 -27.284 2.177   1.00 46.00  ? 547 HOH B O     1 
HETATM 8386 O  O     . HOH R 5 .   ? -16.088 -32.720 4.752   1.00 48.17  ? 548 HOH B O     1 
HETATM 8387 O  O     . HOH R 5 .   ? -32.265 -17.432 -0.084  1.00 44.27  ? 549 HOH B O     1 
HETATM 8388 O  O     . HOH R 5 .   ? -13.352 -6.663  -15.649 1.00 40.63  ? 550 HOH B O     1 
HETATM 8389 O  O     . HOH R 5 .   ? -3.511  -6.141  -2.437  1.00 63.03  ? 551 HOH B O     1 
HETATM 8390 O  O     . HOH R 5 .   ? -7.895  -12.359 4.256   1.00 52.31  ? 552 HOH B O     1 
HETATM 8391 O  O     . HOH R 5 .   ? -18.716 -16.660 15.944  1.00 43.96  ? 553 HOH B O     1 
HETATM 8392 O  O     . HOH R 5 .   ? -28.628 -22.774 8.199   1.00 51.56  ? 554 HOH B O     1 
HETATM 8393 O  O     . HOH R 5 .   ? -32.335 -21.067 -4.486  1.00 38.26  ? 555 HOH B O     1 
HETATM 8394 O  O     . HOH R 5 .   ? -10.158 -19.473 14.011  1.00 67.01  ? 556 HOH B O     1 
HETATM 8395 O  O     . HOH R 5 .   ? -30.481 -26.278 -10.417 1.00 36.72  ? 557 HOH B O     1 
HETATM 8396 O  O     . HOH R 5 .   ? -9.396  0.355   -4.194  1.00 67.20  ? 558 HOH B O     1 
HETATM 8397 O  O     . HOH R 5 .   ? -14.511 2.339   -7.974  1.00 62.32  ? 559 HOH B O     1 
HETATM 8398 O  O     . HOH R 5 .   ? -31.838 -16.169 2.462   1.00 40.94  ? 560 HOH B O     1 
HETATM 8399 O  O     . HOH R 5 .   ? -6.661  -12.789 -12.312 1.00 44.27  ? 561 HOH B O     1 
HETATM 8400 O  O     . HOH R 5 .   ? -5.437  -18.833 2.062   1.00 53.80  ? 562 HOH B O     1 
HETATM 8401 O  O     . HOH R 5 .   ? -12.607 -41.059 0.588   1.00 43.63  ? 563 HOH B O     1 
HETATM 8402 O  O     . HOH R 5 .   ? -28.202 -12.063 7.304   1.00 53.57  ? 564 HOH B O     1 
HETATM 8403 O  O     . HOH R 5 .   ? -32.974 -15.270 4.485   1.00 48.71  ? 565 HOH B O     1 
HETATM 8404 O  O     . HOH R 5 .   ? -17.822 -1.040  -11.531 1.00 40.67  ? 566 HOH B O     1 
HETATM 8405 O  O     . HOH S 5 .   ? 16.886  0.594   -6.349  1.00 33.08  ? 501 HOH C O     1 
HETATM 8406 O  O     . HOH S 5 .   ? 33.953  4.710   -10.167 1.00 41.03  ? 502 HOH C O     1 
HETATM 8407 O  O     . HOH S 5 .   ? 14.965  17.894  -1.031  1.00 50.20  ? 503 HOH C O     1 
HETATM 8408 O  O     . HOH S 5 .   ? 32.274  26.786  6.467   1.00 46.43  ? 504 HOH C O     1 
HETATM 8409 O  O     . HOH S 5 .   ? 14.888  -4.809  2.537   1.00 37.65  ? 505 HOH C O     1 
HETATM 8410 O  O     . HOH S 5 .   ? 12.084  -4.215  2.701   1.00 39.75  ? 506 HOH C O     1 
HETATM 8411 O  O     . HOH S 5 .   ? 12.027  -3.090  8.352   1.00 41.36  ? 507 HOH C O     1 
HETATM 8412 O  O     . HOH S 5 .   ? 6.173   3.450   -0.914  1.00 43.77  ? 508 HOH C O     1 
HETATM 8413 O  O     . HOH S 5 .   ? 13.276  -3.066  5.185   1.00 40.23  ? 509 HOH C O     1 
HETATM 8414 O  O     . HOH S 5 .   ? 12.191  5.238   0.444   1.00 37.14  ? 510 HOH C O     1 
HETATM 8415 O  O     . HOH S 5 .   ? 11.650  16.586  5.795   1.00 41.81  ? 511 HOH C O     1 
HETATM 8416 O  O     . HOH S 5 .   ? 24.431  22.359  1.807   1.00 43.28  ? 512 HOH C O     1 
HETATM 8417 O  O     . HOH S 5 .   ? 32.057  13.619  -0.933  1.00 46.85  ? 513 HOH C O     1 
HETATM 8418 O  O     . HOH S 5 .   ? 17.289  -10.721 1.592   1.00 44.80  ? 514 HOH C O     1 
HETATM 8419 O  O     . HOH S 5 .   ? 10.954  1.493   -17.540 1.00 44.31  ? 515 HOH C O     1 
HETATM 8420 O  O     . HOH S 5 .   ? 13.364  18.645  -7.972  1.00 40.11  ? 516 HOH C O     1 
HETATM 8421 O  O     . HOH S 5 .   ? 14.628  1.583   -7.081  1.00 37.18  ? 517 HOH C O     1 
HETATM 8422 O  O     . HOH S 5 .   ? 31.475  10.929  2.122   1.00 45.01  ? 518 HOH C O     1 
HETATM 8423 O  O     . HOH S 5 .   ? 8.807   1.565   7.611   1.00 45.92  ? 519 HOH C O     1 
HETATM 8424 O  O     . HOH S 5 .   ? 21.356  22.566  -4.329  1.00 55.56  ? 520 HOH C O     1 
HETATM 8425 O  O     . HOH S 5 .   ? 40.401  4.654   3.183   1.00 47.66  ? 521 HOH C O     1 
HETATM 8426 O  O     . HOH S 5 .   ? 9.293   -1.601  13.861  1.00 51.95  ? 522 HOH C O     1 
HETATM 8427 O  O     . HOH S 5 .   ? 27.427  12.920  -11.203 1.00 51.28  ? 523 HOH C O     1 
HETATM 8428 O  O     . HOH S 5 .   ? 27.154  -0.618  18.111  1.00 49.81  ? 524 HOH C O     1 
HETATM 8429 O  O     . HOH S 5 .   ? 7.415   14.011  -9.849  1.00 47.13  ? 525 HOH C O     1 
HETATM 8430 O  O     . HOH S 5 .   ? 14.261  1.539   -2.678  1.00 40.35  ? 526 HOH C O     1 
HETATM 8431 O  O     . HOH S 5 .   ? 25.792  21.637  11.034  1.00 47.92  ? 527 HOH C O     1 
HETATM 8432 O  O     . HOH S 5 .   ? 3.290   8.168   12.136  1.00 55.29  ? 528 HOH C O     1 
HETATM 8433 O  O     . HOH S 5 .   ? 40.341  6.329   -4.264  1.00 47.73  ? 529 HOH C O     1 
HETATM 8434 O  O     . HOH S 5 .   ? 24.368  25.495  -1.192  1.00 46.80  ? 530 HOH C O     1 
HETATM 8435 O  O     . HOH S 5 .   ? 33.847  12.203  -7.835  1.00 50.20  ? 531 HOH C O     1 
HETATM 8436 O  O     . HOH S 5 .   ? 17.298  22.926  -3.667  1.00 43.43  ? 532 HOH C O     1 
HETATM 8437 O  O     . HOH S 5 .   ? 21.823  -3.424  -8.038  1.00 40.23  ? 533 HOH C O     1 
HETATM 8438 O  O     . HOH S 5 .   ? 21.841  24.771  3.104   1.00 40.66  ? 534 HOH C O     1 
HETATM 8439 O  O     . HOH S 5 .   ? 38.977  2.808   8.407   1.00 48.77  ? 535 HOH C O     1 
HETATM 8440 O  O     . HOH S 5 .   ? 31.954  22.274  11.510  1.00 62.65  ? 536 HOH C O     1 
HETATM 8441 O  O     . HOH S 5 .   ? 18.889  23.603  0.335   1.00 46.44  ? 537 HOH C O     1 
HETATM 8442 O  O     . HOH S 5 .   ? 19.524  11.569  -18.897 1.00 50.21  ? 538 HOH C O     1 
HETATM 8443 O  O     . HOH S 5 .   ? 4.907   17.530  -4.857  1.00 57.49  ? 539 HOH C O     1 
HETATM 8444 O  O     . HOH S 5 .   ? 9.556   -7.097  3.303   1.00 48.02  ? 540 HOH C O     1 
HETATM 8445 O  O     . HOH S 5 .   ? 8.949   -8.046  5.639   1.00 49.96  ? 541 HOH C O     1 
HETATM 8446 O  O     . HOH S 5 .   ? 35.798  -0.075  13.327  1.00 46.82  ? 542 HOH C O     1 
HETATM 8447 O  O     . HOH S 5 .   ? 16.186  4.232   -18.174 1.00 51.00  ? 543 HOH C O     1 
HETATM 8448 O  O     . HOH S 5 .   ? 10.649  -5.107  -9.508  1.00 42.78  ? 544 HOH C O     1 
HETATM 8449 O  O     . HOH S 5 .   ? 14.697  7.550   -14.427 1.00 43.96  ? 545 HOH C O     1 
HETATM 8450 O  O     . HOH S 5 .   ? 15.640  19.267  11.138  1.00 55.84  ? 546 HOH C O     1 
HETATM 8451 O  O     . HOH S 5 .   ? 3.653   -9.923  -1.387  1.00 52.57  ? 547 HOH C O     1 
HETATM 8452 O  O     . HOH S 5 .   ? 1.764   -2.807  13.608  1.00 73.30  ? 548 HOH C O     1 
HETATM 8453 O  O     . HOH S 5 .   ? 4.826   -1.290  -8.837  1.00 50.75  ? 549 HOH C O     1 
HETATM 8454 O  O     . HOH S 5 .   ? 4.034   0.751   -10.589 1.00 42.91  ? 550 HOH C O     1 
HETATM 8455 O  O     . HOH S 5 .   ? 23.153  -4.771  -11.471 1.00 48.21  ? 551 HOH C O     1 
HETATM 8456 O  O     . HOH S 5 .   ? 7.678   -0.431  -3.169  1.00 45.48  ? 552 HOH C O     1 
HETATM 8457 O  O     . HOH S 5 .   ? 10.697  19.546  1.130   1.00 48.98  ? 553 HOH C O     1 
HETATM 8458 O  O     . HOH S 5 .   ? 14.992  -0.409  -13.785 1.00 39.79  ? 554 HOH C O     1 
HETATM 8459 O  O     . HOH S 5 .   ? 33.558  24.097  8.730   1.00 61.15  ? 555 HOH C O     1 
HETATM 8460 O  O     . HOH S 5 .   ? 32.855  8.777   9.557   1.00 52.67  ? 556 HOH C O     1 
HETATM 8461 O  O     . HOH S 5 .   ? 26.542  6.307   -14.764 1.00 50.85  ? 557 HOH C O     1 
HETATM 8462 O  O     . HOH S 5 .   ? 11.256  21.472  -4.192  1.00 45.31  ? 558 HOH C O     1 
HETATM 8463 O  O     . HOH S 5 .   ? 30.574  7.407   -11.239 1.00 37.33  ? 559 HOH C O     1 
HETATM 8464 O  O     . HOH S 5 .   ? 4.161   7.197   -19.301 1.00 53.87  ? 560 HOH C O     1 
HETATM 8465 O  O     . HOH S 5 .   ? 4.224   4.583   -18.579 1.00 52.89  ? 561 HOH C O     1 
HETATM 8466 O  O     . HOH S 5 .   ? 8.221   16.425  -12.608 1.00 56.44  ? 562 HOH C O     1 
HETATM 8467 O  O     . HOH S 5 .   ? 15.976  -5.756  -2.340  1.00 33.12  ? 563 HOH C O     1 
HETATM 8468 O  O     . HOH S 5 .   ? 14.382  -9.719  -9.040  1.00 53.85  ? 564 HOH C O     1 
HETATM 8469 O  O     . HOH T 5 .   ? 3.672   21.222  -55.375 1.00 28.60  ? 501 HOH D O     1 
HETATM 8470 O  O     . HOH T 5 .   ? 18.390  33.683  -57.901 1.00 45.37  ? 502 HOH D O     1 
HETATM 8471 O  O     . HOH T 5 .   ? 16.472  32.885  -56.586 1.00 45.36  ? 503 HOH D O     1 
HETATM 8472 O  O     . HOH T 5 .   ? 5.549   -3.088  -60.155 1.00 46.03  ? 504 HOH D O     1 
HETATM 8473 O  O     . HOH T 5 .   ? -6.819  21.626  -72.975 1.00 54.02  ? 505 HOH D O     1 
HETATM 8474 O  O     . HOH T 5 .   ? -2.544  32.665  -64.745 1.00 46.76  ? 506 HOH D O     1 
HETATM 8475 O  O     . HOH T 5 .   ? 25.418  6.475   -55.956 1.00 54.13  ? 507 HOH D O     1 
HETATM 8476 O  O     . HOH T 5 .   ? -4.119  23.553  -62.152 1.00 44.96  ? 508 HOH D O     1 
HETATM 8477 O  O     . HOH T 5 .   ? 0.853   27.881  -70.682 1.00 47.21  ? 509 HOH D O     1 
HETATM 8478 O  O     . HOH T 5 .   ? 10.318  10.452  -46.306 1.00 42.38  ? 510 HOH D O     1 
HETATM 8479 O  O     . HOH T 5 .   ? 8.519   3.827   -62.815 1.00 40.83  ? 511 HOH D O     1 
HETATM 8480 O  O     . HOH T 5 .   ? 12.484  21.920  -44.718 1.00 39.72  ? 512 HOH D O     1 
HETATM 8481 O  O     . HOH T 5 .   ? 19.579  24.017  -53.737 1.00 39.59  ? 513 HOH D O     1 
HETATM 8482 O  O     . HOH T 5 .   ? 15.156  20.506  -73.183 1.00 42.03  ? 514 HOH D O     1 
HETATM 8483 O  O     . HOH T 5 .   ? 14.019  25.658  -52.387 1.00 33.48  ? 515 HOH D O     1 
HETATM 8484 O  O     . HOH T 5 .   ? 16.003  23.484  -53.406 1.00 30.03  ? 516 HOH D O     1 
HETATM 8485 O  O     . HOH T 5 .   ? -2.922  8.220   -50.515 1.00 39.08  ? 517 HOH D O     1 
HETATM 8486 O  O     . HOH T 5 .   ? 26.599  20.596  -71.691 1.00 46.82  ? 518 HOH D O     1 
HETATM 8487 O  O     . HOH T 5 .   ? -1.187  34.392  -58.025 1.00 41.29  ? 519 HOH D O     1 
HETATM 8488 O  O     . HOH T 5 .   ? 4.900   38.412  -63.530 1.00 38.96  ? 520 HOH D O     1 
HETATM 8489 O  O     . HOH T 5 .   ? 12.284  31.484  -73.817 1.00 43.59  ? 521 HOH D O     1 
HETATM 8490 O  O     . HOH T 5 .   ? 24.733  5.031   -59.718 1.00 47.59  ? 522 HOH D O     1 
HETATM 8491 O  O     . HOH T 5 .   ? -1.016  24.626  -50.797 1.00 43.79  ? 523 HOH D O     1 
HETATM 8492 O  O     . HOH T 5 .   ? -1.687  26.699  -72.636 1.00 54.83  ? 524 HOH D O     1 
HETATM 8493 O  O     . HOH T 5 .   ? 2.176   -2.728  -55.600 1.00 44.18  ? 525 HOH D O     1 
HETATM 8494 O  O     . HOH T 5 .   ? 11.076  33.387  -50.675 1.00 40.89  ? 526 HOH D O     1 
HETATM 8495 O  O     . HOH T 5 .   ? -3.094  4.659   -55.236 1.00 42.75  ? 527 HOH D O     1 
HETATM 8496 O  O     . HOH T 5 .   ? 13.933  -0.070  -58.465 1.00 42.56  ? 528 HOH D O     1 
HETATM 8497 O  O     . HOH T 5 .   ? 7.612   18.195  -73.048 1.00 47.87  ? 529 HOH D O     1 
HETATM 8498 O  O     . HOH T 5 .   ? 1.147   20.729  -73.697 1.00 45.63  ? 530 HOH D O     1 
HETATM 8499 O  O     . HOH T 5 .   ? 10.028  30.140  -54.641 1.00 40.66  ? 531 HOH D O     1 
HETATM 8500 O  O     . HOH T 5 .   ? 18.620  26.268  -59.219 0.82 37.30  ? 532 HOH D O     1 
HETATM 8501 O  O     . HOH T 5 .   ? 5.710   21.857  -47.964 1.00 45.20  ? 533 HOH D O     1 
HETATM 8502 O  O     . HOH T 5 .   ? 15.942  3.271   -50.247 1.00 41.11  ? 534 HOH D O     1 
HETATM 8503 O  O     . HOH T 5 .   ? 8.528   29.938  -56.711 1.00 41.29  ? 535 HOH D O     1 
HETATM 8504 O  O     . HOH T 5 .   ? 3.869   23.254  -56.890 1.00 34.73  ? 536 HOH D O     1 
HETATM 8505 O  O     . HOH T 5 .   ? -1.682  18.298  -47.479 1.00 44.50  ? 537 HOH D O     1 
HETATM 8506 O  O     . HOH T 5 .   ? 6.588   20.126  -44.742 1.00 43.20  ? 538 HOH D O     1 
HETATM 8507 O  O     . HOH T 5 .   ? 17.763  19.140  -76.803 1.00 48.93  ? 539 HOH D O     1 
HETATM 8508 O  O     . HOH T 5 .   ? 18.442  4.855   -45.406 1.00 49.57  ? 540 HOH D O     1 
HETATM 8509 O  O     . HOH T 5 .   ? -5.595  30.469  -66.582 1.00 62.49  ? 541 HOH D O     1 
HETATM 8510 O  O     . HOH T 5 .   ? 10.093  27.465  -41.519 1.00 50.61  ? 542 HOH D O     1 
HETATM 8511 O  O     . HOH T 5 .   ? 10.948  23.150  -61.166 1.00 36.90  ? 543 HOH D O     1 
HETATM 8512 O  O     . HOH T 5 .   ? 7.624   23.091  -57.428 1.00 31.37  ? 544 HOH D O     1 
HETATM 8513 O  O     . HOH T 5 .   ? 2.171   18.147  -50.433 1.00 40.39  ? 545 HOH D O     1 
HETATM 8514 O  O     . HOH T 5 .   ? -5.618  29.808  -69.545 1.00 61.38  ? 546 HOH D O     1 
HETATM 8515 O  O     . HOH T 5 .   ? 4.372   19.245  -49.853 1.00 37.96  ? 547 HOH D O     1 
HETATM 8516 O  O     . HOH T 5 .   ? 2.673   11.162  -76.523 1.00 58.67  ? 548 HOH D O     1 
HETATM 8517 O  O     . HOH T 5 .   ? 16.852  32.478  -73.964 1.00 52.20  ? 549 HOH D O     1 
HETATM 8518 O  O     . HOH T 5 .   ? -5.145  10.010  -59.398 1.00 51.39  ? 550 HOH D O     1 
HETATM 8519 O  O     . HOH T 5 .   ? 10.278  9.050   -77.671 1.00 47.60  ? 551 HOH D O     1 
HETATM 8520 O  O     . HOH T 5 .   ? 30.305  12.274  -50.524 1.00 55.31  ? 552 HOH D O     1 
HETATM 8521 O  O     . HOH T 5 .   ? -0.078  17.004  -76.877 1.00 61.56  ? 553 HOH D O     1 
HETATM 8522 O  O     . HOH T 5 .   ? -4.156  5.571   -61.480 1.00 55.80  ? 554 HOH D O     1 
HETATM 8523 O  O     . HOH T 5 .   ? 13.178  22.572  -51.005 1.00 39.39  ? 555 HOH D O     1 
HETATM 8524 O  O     . HOH T 5 .   ? 20.044  4.303   -61.575 1.00 51.21  ? 556 HOH D O     1 
HETATM 8525 O  O     . HOH T 5 .   ? 22.568  9.902   -66.097 1.00 50.99  ? 557 HOH D O     1 
HETATM 8526 O  O     . HOH T 5 .   ? 14.206  34.379  -61.634 1.00 32.05  ? 558 HOH D O     1 
HETATM 8527 O  O     . HOH T 5 .   ? 9.083   33.471  -68.905 1.00 42.89  ? 559 HOH D O     1 
HETATM 8528 O  O     . HOH T 5 .   ? 20.730  34.719  -66.526 1.00 49.09  ? 560 HOH D O     1 
HETATM 8529 O  O     . HOH T 5 .   ? 23.726  33.418  -42.479 1.00 55.60  ? 561 HOH D O     1 
HETATM 8530 O  O     . HOH T 5 .   ? 1.840   34.357  -58.038 1.00 32.33  ? 562 HOH D O     1 
HETATM 8531 O  O     . HOH T 5 .   ? -3.461  24.558  -54.947 1.00 47.06  ? 563 HOH D O     1 
HETATM 8532 O  O     . HOH T 5 .   ? 11.682  34.046  -61.582 1.00 38.82  ? 564 HOH D O     1 
HETATM 8533 O  O     . HOH T 5 .   ? 17.414  5.107   -72.899 1.00 61.79  ? 565 HOH D O     1 
HETATM 8534 O  O     . HOH T 5 .   ? 15.192  28.338  -49.918 1.00 39.02  ? 566 HOH D O     1 
HETATM 8535 O  O     . HOH T 5 .   ? 19.361  22.659  -78.565 1.00 51.74  ? 567 HOH D O     1 
HETATM 8536 O  O     . HOH T 5 .   ? 12.234  34.740  -42.016 1.00 53.76  ? 568 HOH D O     1 
HETATM 8537 O  O     . HOH T 5 .   ? 15.428  36.699  -42.076 1.00 54.67  ? 569 HOH D O     1 
HETATM 8538 O  O     . HOH T 5 .   ? 10.537  21.887  -75.572 1.00 39.23  ? 570 HOH D O     1 
HETATM 8539 O  O     . HOH T 5 .   ? 9.368   7.294   -75.040 1.00 49.94  ? 571 HOH D O     1 
HETATM 8540 O  O     . HOH T 5 .   ? 8.541   37.381  -62.924 1.00 40.37  ? 572 HOH D O     1 
HETATM 8541 O  O     . HOH T 5 .   ? 6.288   43.227  -69.139 1.00 35.04  ? 573 HOH D O     1 
HETATM 8542 O  O     . HOH T 5 .   ? 8.333   22.878  -49.888 1.00 38.87  ? 574 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   77  ?   ?   ?   A . n 
A 1 2   SER 2   78  ?   ?   ?   A . n 
A 1 3   ASP 3   79  ?   ?   ?   A . n 
A 1 4   ILE 4   80  ?   ?   ?   A . n 
A 1 5   PRO 5   81  ?   ?   ?   A . n 
A 1 6   GLU 6   82  82  GLU GLU A . n 
A 1 7   HIS 7   83  83  HIS HIS A . n 
A 1 8   TRP 8   84  84  TRP TRP A . n 
A 1 9   GLU 9   85  85  GLU GLU A . n 
A 1 10  GLU 10  86  86  GLU GLU A . n 
A 1 11  ASP 11  87  87  ASP ASP A . n 
A 1 12  ALA 12  88  88  ALA ALA A . n 
A 1 13  SER 13  89  89  SER SER A . n 
A 1 14  TRP 14  90  90  TRP TRP A . n 
A 1 15  GLY 15  91  91  GLY GLY A . n 
A 1 16  PRO 16  92  92  PRO PRO A . n 
A 1 17  HIS 17  93  93  HIS HIS A . n 
A 1 18  ARG 18  94  94  ARG ARG A . n 
A 1 19  LEU 19  95  95  LEU LEU A . n 
A 1 20  ALA 20  96  96  ALA ALA A . n 
A 1 21  VAL 21  97  97  VAL VAL A . n 
A 1 22  LEU 22  98  98  LEU LEU A . n 
A 1 23  VAL 23  99  99  VAL VAL A . n 
A 1 24  PRO 24  100 100 PRO PRO A . n 
A 1 25  PHE 25  101 101 PHE PHE A . n 
A 1 26  ARG 26  102 102 ARG ARG A . n 
A 1 27  GLU 27  103 103 GLU GLU A . n 
A 1 28  ARG 28  104 104 ARG ARG A . n 
A 1 29  PHE 29  105 105 PHE PHE A . n 
A 1 30  GLU 30  106 106 GLU GLU A . n 
A 1 31  GLU 31  107 107 GLU GLU A . n 
A 1 32  LEU 32  108 108 LEU LEU A . n 
A 1 33  LEU 33  109 109 LEU LEU A . n 
A 1 34  VAL 34  110 110 VAL VAL A . n 
A 1 35  PHE 35  111 111 PHE PHE A . n 
A 1 36  VAL 36  112 112 VAL VAL A . n 
A 1 37  PRO 37  113 113 PRO PRO A . n 
A 1 38  HIS 38  114 114 HIS HIS A . n 
A 1 39  MET 39  115 115 MET MET A . n 
A 1 40  ARG 40  116 116 ARG ARG A . n 
A 1 41  ARG 41  117 117 ARG ARG A . n 
A 1 42  PHE 42  118 118 PHE PHE A . n 
A 1 43  LEU 43  119 119 LEU LEU A . n 
A 1 44  SER 44  120 120 SER SER A . n 
A 1 45  ARG 45  121 121 ARG ARG A . n 
A 1 46  LYS 46  122 122 LYS LYS A . n 
A 1 47  LYS 47  123 123 LYS LYS A . n 
A 1 48  ILE 48  124 124 ILE ILE A . n 
A 1 49  ARG 49  125 125 ARG ARG A . n 
A 1 50  HIS 50  126 126 HIS HIS A . n 
A 1 51  HIS 51  127 127 HIS HIS A . n 
A 1 52  ILE 52  128 128 ILE ILE A . n 
A 1 53  TYR 53  129 129 TYR TYR A . n 
A 1 54  VAL 54  130 130 VAL VAL A . n 
A 1 55  LEU 55  131 131 LEU LEU A . n 
A 1 56  ASN 56  132 132 ASN ASN A . n 
A 1 57  GLN 57  133 133 GLN GLN A . n 
A 1 58  VAL 58  134 134 VAL VAL A . n 
A 1 59  ASP 59  135 135 ASP ASP A . n 
A 1 60  HIS 60  136 136 HIS HIS A . n 
A 1 61  PHE 61  137 137 PHE PHE A . n 
A 1 62  ARG 62  138 138 ARG ARG A . n 
A 1 63  PHE 63  139 139 PHE PHE A . n 
A 1 64  ASN 64  140 140 ASN ASN A . n 
A 1 65  ARG 65  141 141 ARG ARG A . n 
A 1 66  ALA 66  142 142 ALA ALA A . n 
A 1 67  ALA 67  143 143 ALA ALA A . n 
A 1 68  LEU 68  144 144 LEU LEU A . n 
A 1 69  ILE 69  145 145 ILE ILE A . n 
A 1 70  ASN 70  146 146 ASN ASN A . n 
A 1 71  VAL 71  147 147 VAL VAL A . n 
A 1 72  GLY 72  148 148 GLY GLY A . n 
A 1 73  PHE 73  149 149 PHE PHE A . n 
A 1 74  LEU 74  150 150 LEU LEU A . n 
A 1 75  GLU 75  151 151 GLU GLU A . n 
A 1 76  SER 76  152 152 SER SER A . n 
A 1 77  SER 77  153 153 SER SER A . n 
A 1 78  ASN 78  154 154 ASN ASN A . n 
A 1 79  SER 79  155 155 SER SER A . n 
A 1 80  THR 80  156 156 THR THR A . n 
A 1 81  ASP 81  157 157 ASP ASP A . n 
A 1 82  TYR 82  158 158 TYR TYR A . n 
A 1 83  ILE 83  159 159 ILE ILE A . n 
A 1 84  ALA 84  160 160 ALA ALA A . n 
A 1 85  MET 85  161 161 MET MET A . n 
A 1 86  HIS 86  162 162 HIS HIS A . n 
A 1 87  ASP 87  163 163 ASP ASP A . n 
A 1 88  VAL 88  164 164 VAL VAL A . n 
A 1 89  ASP 89  165 165 ASP ASP A . n 
A 1 90  LEU 90  166 166 LEU LEU A . n 
A 1 91  LEU 91  167 167 LEU LEU A . n 
A 1 92  PRO 92  168 168 PRO PRO A . n 
A 1 93  LEU 93  169 169 LEU LEU A . n 
A 1 94  ASN 94  170 170 ASN ASN A . n 
A 1 95  GLU 95  171 171 GLU GLU A . n 
A 1 96  GLU 96  172 172 GLU GLU A . n 
A 1 97  LEU 97  173 173 LEU LEU A . n 
A 1 98  ASP 98  174 174 ASP ASP A . n 
A 1 99  TYR 99  175 175 TYR TYR A . n 
A 1 100 GLY 100 176 176 GLY GLY A . n 
A 1 101 PHE 101 177 177 PHE PHE A . n 
A 1 102 PRO 102 178 178 PRO PRO A . n 
A 1 103 GLU 103 179 179 GLU GLU A . n 
A 1 104 ALA 104 180 180 ALA ALA A . n 
A 1 105 GLY 105 181 181 GLY GLY A . n 
A 1 106 PRO 106 182 182 PRO PRO A . n 
A 1 107 PHE 107 183 183 PHE PHE A . n 
A 1 108 HIS 108 184 184 HIS HIS A . n 
A 1 109 VAL 109 185 185 VAL VAL A . n 
A 1 110 ALA 110 186 186 ALA ALA A . n 
A 1 111 SER 111 187 187 SER SER A . n 
A 1 112 PRO 112 188 188 PRO PRO A . n 
A 1 113 GLU 113 189 189 GLU GLU A . n 
A 1 114 LEU 114 190 190 LEU LEU A . n 
A 1 115 HIS 115 191 191 HIS HIS A . n 
A 1 116 PRO 116 192 192 PRO PRO A . n 
A 1 117 LEU 117 193 193 LEU LEU A . n 
A 1 118 TYR 118 194 194 TYR TYR A . n 
A 1 119 HIS 119 195 195 HIS HIS A . n 
A 1 120 TYR 120 196 196 TYR TYR A . n 
A 1 121 LYS 121 197 197 LYS LYS A . n 
A 1 122 THR 122 198 198 THR THR A . n 
A 1 123 TYR 123 199 199 TYR TYR A . n 
A 1 124 VAL 124 200 200 VAL VAL A . n 
A 1 125 GLY 125 201 201 GLY GLY A . n 
A 1 126 GLY 126 202 202 GLY GLY A . n 
A 1 127 ILE 127 203 203 ILE ILE A . n 
A 1 128 LEU 128 204 204 LEU LEU A . n 
A 1 129 LEU 129 205 205 LEU LEU A . n 
A 1 130 LEU 130 206 206 LEU LEU A . n 
A 1 131 SER 131 207 207 SER SER A . n 
A 1 132 LYS 132 208 208 LYS LYS A . n 
A 1 133 GLN 133 209 209 GLN GLN A . n 
A 1 134 HIS 134 210 210 HIS HIS A . n 
A 1 135 TYR 135 211 211 TYR TYR A . n 
A 1 136 ARG 136 212 212 ARG ARG A . n 
A 1 137 LEU 137 213 213 LEU LEU A . n 
A 1 138 CYS 138 214 214 CYS CYS A . n 
A 1 139 ASN 139 215 215 ASN ASN A . n 
A 1 140 GLY 140 216 216 GLY GLY A . n 
A 1 141 MET 141 217 217 MET MET A . n 
A 1 142 SER 142 218 218 SER SER A . n 
A 1 143 ASN 143 219 219 ASN ASN A . n 
A 1 144 ARG 144 220 220 ARG ARG A . n 
A 1 145 PHE 145 221 221 PHE PHE A . n 
A 1 146 TRP 146 222 222 TRP TRP A . n 
A 1 147 GLY 147 223 223 GLY GLY A . n 
A 1 148 TRP 148 224 224 TRP TRP A . n 
A 1 149 GLY 149 225 225 GLY GLY A . n 
A 1 150 ARG 150 226 226 ARG ARG A . n 
A 1 151 GLU 151 227 227 GLU GLU A . n 
A 1 152 ASP 152 228 228 ASP ASP A . n 
A 1 153 ASP 153 229 229 ASP ASP A . n 
A 1 154 GLU 154 230 230 GLU GLU A . n 
A 1 155 PHE 155 231 231 PHE PHE A . n 
A 1 156 TYR 156 232 232 TYR TYR A . n 
A 1 157 ARG 157 233 233 ARG ARG A . n 
A 1 158 ARG 158 234 234 ARG ARG A . n 
A 1 159 ILE 159 235 235 ILE ILE A . n 
A 1 160 LYS 160 236 236 LYS LYS A . n 
A 1 161 GLY 161 237 237 GLY GLY A . n 
A 1 162 ALA 162 238 238 ALA ALA A . n 
A 1 163 GLY 163 239 239 GLY GLY A . n 
A 1 164 LEU 164 240 240 LEU LEU A . n 
A 1 165 GLN 165 241 241 GLN GLN A . n 
A 1 166 LEU 166 242 242 LEU LEU A . n 
A 1 167 PHE 167 243 243 PHE PHE A . n 
A 1 168 ARG 168 244 244 ARG ARG A . n 
A 1 169 PRO 169 245 245 PRO PRO A . n 
A 1 170 SER 170 246 246 SER SER A . n 
A 1 171 GLY 171 247 247 GLY GLY A . n 
A 1 172 ILE 172 248 248 ILE ILE A . n 
A 1 173 THR 173 249 249 THR THR A . n 
A 1 174 THR 174 250 250 THR THR A . n 
A 1 175 GLY 175 251 251 GLY GLY A . n 
A 1 176 TYR 176 252 252 TYR TYR A . n 
A 1 177 LYS 177 253 253 LYS LYS A . n 
A 1 178 THR 178 254 254 THR THR A . n 
A 1 179 PHE 179 255 255 PHE PHE A . n 
A 1 180 ARG 180 256 256 ARG ARG A . n 
A 1 181 HIS 181 257 257 HIS HIS A . n 
A 1 182 LEU 182 258 258 LEU LEU A . n 
A 1 183 HIS 183 259 259 HIS HIS A . n 
A 1 184 ASP 184 260 260 ASP ASP A . n 
A 1 185 PRO 185 261 261 PRO PRO A . n 
A 1 186 ALA 186 262 262 ALA ALA A . n 
A 1 187 TRP 187 263 263 TRP TRP A . n 
A 1 188 ARG 188 264 264 ARG ARG A . n 
A 1 189 LYS 189 265 265 LYS LYS A . n 
A 1 190 ARG 190 266 266 ARG ARG A . n 
A 1 191 ASP 191 267 267 ASP ASP A . n 
A 1 192 GLN 192 268 268 GLN GLN A . n 
A 1 193 LYS 193 269 269 LYS LYS A . n 
A 1 194 ARG 194 270 270 ARG ARG A . n 
A 1 195 ILE 195 271 271 ILE ILE A . n 
A 1 196 ALA 196 272 272 ALA ALA A . n 
A 1 197 ALA 197 273 273 ALA ALA A . n 
A 1 198 GLN 198 274 274 GLN GLN A . n 
A 1 199 LYS 199 275 275 LYS LYS A . n 
A 1 200 GLN 200 276 276 GLN GLN A . n 
A 1 201 GLU 201 277 277 GLU GLU A . n 
A 1 202 GLN 202 278 278 GLN GLN A . n 
A 1 203 PHE 203 279 279 PHE PHE A . n 
A 1 204 LYS 204 280 280 LYS LYS A . n 
A 1 205 VAL 205 281 281 VAL VAL A . n 
A 1 206 ASP 206 282 282 ASP ASP A . n 
A 1 207 ARG 207 283 283 ARG ARG A . n 
A 1 208 GLU 208 284 284 GLU GLU A . n 
A 1 209 GLY 209 285 285 GLY GLY A . n 
A 1 210 GLY 210 286 286 GLY GLY A . n 
A 1 211 LEU 211 287 287 LEU LEU A . n 
A 1 212 ASN 212 288 288 ASN ASN A . n 
A 1 213 THR 213 289 289 THR THR A . n 
A 1 214 VAL 214 290 290 VAL VAL A . n 
A 1 215 LYS 215 291 291 LYS LYS A . n 
A 1 216 TYR 216 292 292 TYR TYR A . n 
A 1 217 HIS 217 293 293 HIS HIS A . n 
A 1 218 VAL 218 294 294 VAL VAL A . n 
A 1 219 ALA 219 295 295 ALA ALA A . n 
A 1 220 SER 220 296 296 SER SER A . n 
A 1 221 ARG 221 297 297 ARG ARG A . n 
A 1 222 THR 222 298 298 THR THR A . n 
A 1 223 ALA 223 299 299 ALA ALA A . n 
A 1 224 LEU 224 300 300 LEU LEU A . n 
A 1 225 SER 225 301 301 SER SER A . n 
A 1 226 VAL 226 302 302 VAL VAL A . n 
A 1 227 GLY 227 303 303 GLY GLY A . n 
A 1 228 GLY 228 304 304 GLY GLY A . n 
A 1 229 ALA 229 305 305 ALA ALA A . n 
A 1 230 PRO 230 306 306 PRO PRO A . n 
A 1 231 CYS 231 307 307 CYS CYS A . n 
A 1 232 THR 232 308 308 THR THR A . n 
A 1 233 VAL 233 309 309 VAL VAL A . n 
A 1 234 LEU 234 310 310 LEU LEU A . n 
A 1 235 ASN 235 311 311 ASN ASN A . n 
A 1 236 ILE 236 312 312 ILE ILE A . n 
A 1 237 MET 237 313 313 MET MET A . n 
A 1 238 LEU 238 314 314 LEU LEU A . n 
A 1 239 ASP 239 315 315 ASP ASP A . n 
A 1 240 CYS 240 316 316 CYS CYS A . n 
A 1 241 ASP 241 317 317 ASP ASP A . n 
A 1 242 LYS 242 318 318 LYS LYS A . n 
A 1 243 THR 243 319 319 THR THR A . n 
A 1 244 ALA 244 320 320 ALA ALA A . n 
A 1 245 THR 245 321 321 THR THR A . n 
A 1 246 PRO 246 322 322 PRO PRO A . n 
A 1 247 TRP 247 323 323 TRP TRP A . n 
A 1 248 CYS 248 324 324 CYS CYS A . n 
A 1 249 THR 249 325 325 THR THR A . n 
A 1 250 PHE 250 326 326 PHE PHE A . n 
A 1 251 SER 251 327 327 SER SER A . n 
B 1 1   GLY 1   77  ?   ?   ?   B . n 
B 1 2   SER 2   78  ?   ?   ?   B . n 
B 1 3   ASP 3   79  ?   ?   ?   B . n 
B 1 4   ILE 4   80  ?   ?   ?   B . n 
B 1 5   PRO 5   81  ?   ?   ?   B . n 
B 1 6   GLU 6   82  ?   ?   ?   B . n 
B 1 7   HIS 7   83  ?   ?   ?   B . n 
B 1 8   TRP 8   84  ?   ?   ?   B . n 
B 1 9   GLU 9   85  ?   ?   ?   B . n 
B 1 10  GLU 10  86  ?   ?   ?   B . n 
B 1 11  ASP 11  87  ?   ?   ?   B . n 
B 1 12  ALA 12  88  88  ALA ALA B . n 
B 1 13  SER 13  89  89  SER SER B . n 
B 1 14  TRP 14  90  90  TRP TRP B . n 
B 1 15  GLY 15  91  91  GLY GLY B . n 
B 1 16  PRO 16  92  92  PRO PRO B . n 
B 1 17  HIS 17  93  93  HIS HIS B . n 
B 1 18  ARG 18  94  94  ARG ARG B . n 
B 1 19  LEU 19  95  95  LEU LEU B . n 
B 1 20  ALA 20  96  96  ALA ALA B . n 
B 1 21  VAL 21  97  97  VAL VAL B . n 
B 1 22  LEU 22  98  98  LEU LEU B . n 
B 1 23  VAL 23  99  99  VAL VAL B . n 
B 1 24  PRO 24  100 100 PRO PRO B . n 
B 1 25  PHE 25  101 101 PHE PHE B . n 
B 1 26  ARG 26  102 102 ARG ARG B . n 
B 1 27  GLU 27  103 103 GLU GLU B . n 
B 1 28  ARG 28  104 104 ARG ARG B . n 
B 1 29  PHE 29  105 105 PHE PHE B . n 
B 1 30  GLU 30  106 106 GLU GLU B . n 
B 1 31  GLU 31  107 107 GLU GLU B . n 
B 1 32  LEU 32  108 108 LEU LEU B . n 
B 1 33  LEU 33  109 109 LEU LEU B . n 
B 1 34  VAL 34  110 110 VAL VAL B . n 
B 1 35  PHE 35  111 111 PHE PHE B . n 
B 1 36  VAL 36  112 112 VAL VAL B . n 
B 1 37  PRO 37  113 113 PRO PRO B . n 
B 1 38  HIS 38  114 114 HIS HIS B . n 
B 1 39  MET 39  115 115 MET MET B . n 
B 1 40  ARG 40  116 116 ARG ARG B . n 
B 1 41  ARG 41  117 117 ARG ARG B . n 
B 1 42  PHE 42  118 118 PHE PHE B . n 
B 1 43  LEU 43  119 119 LEU LEU B . n 
B 1 44  SER 44  120 120 SER SER B . n 
B 1 45  ARG 45  121 121 ARG ARG B . n 
B 1 46  LYS 46  122 122 LYS LYS B . n 
B 1 47  LYS 47  123 123 LYS LYS B . n 
B 1 48  ILE 48  124 124 ILE ILE B . n 
B 1 49  ARG 49  125 125 ARG ARG B . n 
B 1 50  HIS 50  126 126 HIS HIS B . n 
B 1 51  HIS 51  127 127 HIS HIS B . n 
B 1 52  ILE 52  128 128 ILE ILE B . n 
B 1 53  TYR 53  129 129 TYR TYR B . n 
B 1 54  VAL 54  130 130 VAL VAL B . n 
B 1 55  LEU 55  131 131 LEU LEU B . n 
B 1 56  ASN 56  132 132 ASN ASN B . n 
B 1 57  GLN 57  133 133 GLN GLN B . n 
B 1 58  VAL 58  134 134 VAL VAL B . n 
B 1 59  ASP 59  135 135 ASP ASP B . n 
B 1 60  HIS 60  136 136 HIS HIS B . n 
B 1 61  PHE 61  137 137 PHE PHE B . n 
B 1 62  ARG 62  138 138 ARG ARG B . n 
B 1 63  PHE 63  139 139 PHE PHE B . n 
B 1 64  ASN 64  140 140 ASN ASN B . n 
B 1 65  ARG 65  141 141 ARG ARG B . n 
B 1 66  ALA 66  142 142 ALA ALA B . n 
B 1 67  ALA 67  143 143 ALA ALA B . n 
B 1 68  LEU 68  144 144 LEU LEU B . n 
B 1 69  ILE 69  145 145 ILE ILE B . n 
B 1 70  ASN 70  146 146 ASN ASN B . n 
B 1 71  VAL 71  147 147 VAL VAL B . n 
B 1 72  GLY 72  148 148 GLY GLY B . n 
B 1 73  PHE 73  149 149 PHE PHE B . n 
B 1 74  LEU 74  150 150 LEU LEU B . n 
B 1 75  GLU 75  151 151 GLU GLU B . n 
B 1 76  SER 76  152 152 SER SER B . n 
B 1 77  SER 77  153 153 SER SER B . n 
B 1 78  ASN 78  154 154 ASN ASN B . n 
B 1 79  SER 79  155 155 SER SER B . n 
B 1 80  THR 80  156 156 THR THR B . n 
B 1 81  ASP 81  157 157 ASP ASP B . n 
B 1 82  TYR 82  158 158 TYR TYR B . n 
B 1 83  ILE 83  159 159 ILE ILE B . n 
B 1 84  ALA 84  160 160 ALA ALA B . n 
B 1 85  MET 85  161 161 MET MET B . n 
B 1 86  HIS 86  162 162 HIS HIS B . n 
B 1 87  ASP 87  163 163 ASP ASP B . n 
B 1 88  VAL 88  164 164 VAL VAL B . n 
B 1 89  ASP 89  165 165 ASP ASP B . n 
B 1 90  LEU 90  166 166 LEU LEU B . n 
B 1 91  LEU 91  167 167 LEU LEU B . n 
B 1 92  PRO 92  168 168 PRO PRO B . n 
B 1 93  LEU 93  169 169 LEU LEU B . n 
B 1 94  ASN 94  170 170 ASN ASN B . n 
B 1 95  GLU 95  171 171 GLU GLU B . n 
B 1 96  GLU 96  172 172 GLU GLU B . n 
B 1 97  LEU 97  173 173 LEU LEU B . n 
B 1 98  ASP 98  174 174 ASP ASP B . n 
B 1 99  TYR 99  175 175 TYR TYR B . n 
B 1 100 GLY 100 176 176 GLY GLY B . n 
B 1 101 PHE 101 177 177 PHE PHE B . n 
B 1 102 PRO 102 178 178 PRO PRO B . n 
B 1 103 GLU 103 179 179 GLU GLU B . n 
B 1 104 ALA 104 180 180 ALA ALA B . n 
B 1 105 GLY 105 181 181 GLY GLY B . n 
B 1 106 PRO 106 182 182 PRO PRO B . n 
B 1 107 PHE 107 183 183 PHE PHE B . n 
B 1 108 HIS 108 184 184 HIS HIS B . n 
B 1 109 VAL 109 185 185 VAL VAL B . n 
B 1 110 ALA 110 186 186 ALA ALA B . n 
B 1 111 SER 111 187 187 SER SER B . n 
B 1 112 PRO 112 188 188 PRO PRO B . n 
B 1 113 GLU 113 189 189 GLU GLU B . n 
B 1 114 LEU 114 190 190 LEU LEU B . n 
B 1 115 HIS 115 191 191 HIS HIS B . n 
B 1 116 PRO 116 192 192 PRO PRO B . n 
B 1 117 LEU 117 193 193 LEU LEU B . n 
B 1 118 TYR 118 194 194 TYR TYR B . n 
B 1 119 HIS 119 195 195 HIS HIS B . n 
B 1 120 TYR 120 196 196 TYR TYR B . n 
B 1 121 LYS 121 197 197 LYS LYS B . n 
B 1 122 THR 122 198 198 THR THR B . n 
B 1 123 TYR 123 199 199 TYR TYR B . n 
B 1 124 VAL 124 200 200 VAL VAL B . n 
B 1 125 GLY 125 201 201 GLY GLY B . n 
B 1 126 GLY 126 202 202 GLY GLY B . n 
B 1 127 ILE 127 203 203 ILE ILE B . n 
B 1 128 LEU 128 204 204 LEU LEU B . n 
B 1 129 LEU 129 205 205 LEU LEU B . n 
B 1 130 LEU 130 206 206 LEU LEU B . n 
B 1 131 SER 131 207 207 SER SER B . n 
B 1 132 LYS 132 208 208 LYS LYS B . n 
B 1 133 GLN 133 209 209 GLN GLN B . n 
B 1 134 HIS 134 210 210 HIS HIS B . n 
B 1 135 TYR 135 211 211 TYR TYR B . n 
B 1 136 ARG 136 212 212 ARG ARG B . n 
B 1 137 LEU 137 213 213 LEU LEU B . n 
B 1 138 CYS 138 214 214 CYS CYS B . n 
B 1 139 ASN 139 215 215 ASN ASN B . n 
B 1 140 GLY 140 216 216 GLY GLY B . n 
B 1 141 MET 141 217 217 MET MET B . n 
B 1 142 SER 142 218 218 SER SER B . n 
B 1 143 ASN 143 219 219 ASN ASN B . n 
B 1 144 ARG 144 220 220 ARG ARG B . n 
B 1 145 PHE 145 221 221 PHE PHE B . n 
B 1 146 TRP 146 222 222 TRP TRP B . n 
B 1 147 GLY 147 223 223 GLY GLY B . n 
B 1 148 TRP 148 224 224 TRP TRP B . n 
B 1 149 GLY 149 225 225 GLY GLY B . n 
B 1 150 ARG 150 226 226 ARG ARG B . n 
B 1 151 GLU 151 227 227 GLU GLU B . n 
B 1 152 ASP 152 228 228 ASP ASP B . n 
B 1 153 ASP 153 229 229 ASP ASP B . n 
B 1 154 GLU 154 230 230 GLU GLU B . n 
B 1 155 PHE 155 231 231 PHE PHE B . n 
B 1 156 TYR 156 232 232 TYR TYR B . n 
B 1 157 ARG 157 233 233 ARG ARG B . n 
B 1 158 ARG 158 234 234 ARG ARG B . n 
B 1 159 ILE 159 235 235 ILE ILE B . n 
B 1 160 LYS 160 236 236 LYS LYS B . n 
B 1 161 GLY 161 237 237 GLY GLY B . n 
B 1 162 ALA 162 238 238 ALA ALA B . n 
B 1 163 GLY 163 239 239 GLY GLY B . n 
B 1 164 LEU 164 240 240 LEU LEU B . n 
B 1 165 GLN 165 241 241 GLN GLN B . n 
B 1 166 LEU 166 242 242 LEU LEU B . n 
B 1 167 PHE 167 243 243 PHE PHE B . n 
B 1 168 ARG 168 244 244 ARG ARG B . n 
B 1 169 PRO 169 245 245 PRO PRO B . n 
B 1 170 SER 170 246 246 SER SER B . n 
B 1 171 GLY 171 247 247 GLY GLY B . n 
B 1 172 ILE 172 248 248 ILE ILE B . n 
B 1 173 THR 173 249 249 THR THR B . n 
B 1 174 THR 174 250 250 THR THR B . n 
B 1 175 GLY 175 251 251 GLY GLY B . n 
B 1 176 TYR 176 252 252 TYR TYR B . n 
B 1 177 LYS 177 253 253 LYS LYS B . n 
B 1 178 THR 178 254 254 THR THR B . n 
B 1 179 PHE 179 255 255 PHE PHE B . n 
B 1 180 ARG 180 256 256 ARG ARG B . n 
B 1 181 HIS 181 257 257 HIS HIS B . n 
B 1 182 LEU 182 258 258 LEU LEU B . n 
B 1 183 HIS 183 259 259 HIS HIS B . n 
B 1 184 ASP 184 260 260 ASP ASP B . n 
B 1 185 PRO 185 261 261 PRO PRO B . n 
B 1 186 ALA 186 262 262 ALA ALA B . n 
B 1 187 TRP 187 263 263 TRP TRP B . n 
B 1 188 ARG 188 264 264 ARG ARG B . n 
B 1 189 LYS 189 265 265 LYS LYS B . n 
B 1 190 ARG 190 266 266 ARG ARG B . n 
B 1 191 ASP 191 267 267 ASP ASP B . n 
B 1 192 GLN 192 268 268 GLN GLN B . n 
B 1 193 LYS 193 269 269 LYS LYS B . n 
B 1 194 ARG 194 270 270 ARG ARG B . n 
B 1 195 ILE 195 271 271 ILE ILE B . n 
B 1 196 ALA 196 272 272 ALA ALA B . n 
B 1 197 ALA 197 273 273 ALA ALA B . n 
B 1 198 GLN 198 274 274 GLN GLN B . n 
B 1 199 LYS 199 275 275 LYS LYS B . n 
B 1 200 GLN 200 276 276 GLN GLN B . n 
B 1 201 GLU 201 277 277 GLU GLU B . n 
B 1 202 GLN 202 278 278 GLN GLN B . n 
B 1 203 PHE 203 279 279 PHE PHE B . n 
B 1 204 LYS 204 280 280 LYS LYS B . n 
B 1 205 VAL 205 281 281 VAL VAL B . n 
B 1 206 ASP 206 282 282 ASP ASP B . n 
B 1 207 ARG 207 283 283 ARG ARG B . n 
B 1 208 GLU 208 284 284 GLU GLU B . n 
B 1 209 GLY 209 285 285 GLY GLY B . n 
B 1 210 GLY 210 286 286 GLY GLY B . n 
B 1 211 LEU 211 287 287 LEU LEU B . n 
B 1 212 ASN 212 288 288 ASN ASN B . n 
B 1 213 THR 213 289 289 THR THR B . n 
B 1 214 VAL 214 290 290 VAL VAL B . n 
B 1 215 LYS 215 291 291 LYS LYS B . n 
B 1 216 TYR 216 292 292 TYR TYR B . n 
B 1 217 HIS 217 293 293 HIS HIS B . n 
B 1 218 VAL 218 294 294 VAL VAL B . n 
B 1 219 ALA 219 295 295 ALA ALA B . n 
B 1 220 SER 220 296 296 SER SER B . n 
B 1 221 ARG 221 297 297 ARG ARG B . n 
B 1 222 THR 222 298 298 THR THR B . n 
B 1 223 ALA 223 299 299 ALA ALA B . n 
B 1 224 LEU 224 300 300 LEU LEU B . n 
B 1 225 SER 225 301 301 SER SER B . n 
B 1 226 VAL 226 302 302 VAL VAL B . n 
B 1 227 GLY 227 303 303 GLY GLY B . n 
B 1 228 GLY 228 304 304 GLY GLY B . n 
B 1 229 ALA 229 305 305 ALA ALA B . n 
B 1 230 PRO 230 306 306 PRO PRO B . n 
B 1 231 CYS 231 307 307 CYS CYS B . n 
B 1 232 THR 232 308 308 THR THR B . n 
B 1 233 VAL 233 309 309 VAL VAL B . n 
B 1 234 LEU 234 310 310 LEU LEU B . n 
B 1 235 ASN 235 311 311 ASN ASN B . n 
B 1 236 ILE 236 312 312 ILE ILE B . n 
B 1 237 MET 237 313 313 MET MET B . n 
B 1 238 LEU 238 314 314 LEU LEU B . n 
B 1 239 ASP 239 315 315 ASP ASP B . n 
B 1 240 CYS 240 316 316 CYS CYS B . n 
B 1 241 ASP 241 317 317 ASP ASP B . n 
B 1 242 LYS 242 318 318 LYS LYS B . n 
B 1 243 THR 243 319 319 THR THR B . n 
B 1 244 ALA 244 320 320 ALA ALA B . n 
B 1 245 THR 245 321 321 THR THR B . n 
B 1 246 PRO 246 322 322 PRO PRO B . n 
B 1 247 TRP 247 323 323 TRP TRP B . n 
B 1 248 CYS 248 324 324 CYS CYS B . n 
B 1 249 THR 249 325 325 THR THR B . n 
B 1 250 PHE 250 326 326 PHE PHE B . n 
B 1 251 SER 251 327 327 SER SER B . n 
C 1 1   GLY 1   77  ?   ?   ?   C . n 
C 1 2   SER 2   78  ?   ?   ?   C . n 
C 1 3   ASP 3   79  79  ASP ASP C . n 
C 1 4   ILE 4   80  80  ILE ILE C . n 
C 1 5   PRO 5   81  81  PRO PRO C . n 
C 1 6   GLU 6   82  82  GLU GLU C . n 
C 1 7   HIS 7   83  83  HIS HIS C . n 
C 1 8   TRP 8   84  84  TRP TRP C . n 
C 1 9   GLU 9   85  85  GLU GLU C . n 
C 1 10  GLU 10  86  86  GLU GLU C . n 
C 1 11  ASP 11  87  87  ASP ASP C . n 
C 1 12  ALA 12  88  88  ALA ALA C . n 
C 1 13  SER 13  89  89  SER SER C . n 
C 1 14  TRP 14  90  90  TRP TRP C . n 
C 1 15  GLY 15  91  91  GLY GLY C . n 
C 1 16  PRO 16  92  92  PRO PRO C . n 
C 1 17  HIS 17  93  93  HIS HIS C . n 
C 1 18  ARG 18  94  94  ARG ARG C . n 
C 1 19  LEU 19  95  95  LEU LEU C . n 
C 1 20  ALA 20  96  96  ALA ALA C . n 
C 1 21  VAL 21  97  97  VAL VAL C . n 
C 1 22  LEU 22  98  98  LEU LEU C . n 
C 1 23  VAL 23  99  99  VAL VAL C . n 
C 1 24  PRO 24  100 100 PRO PRO C . n 
C 1 25  PHE 25  101 101 PHE PHE C . n 
C 1 26  ARG 26  102 102 ARG ARG C . n 
C 1 27  GLU 27  103 103 GLU GLU C . n 
C 1 28  ARG 28  104 104 ARG ARG C . n 
C 1 29  PHE 29  105 105 PHE PHE C . n 
C 1 30  GLU 30  106 106 GLU GLU C . n 
C 1 31  GLU 31  107 107 GLU GLU C . n 
C 1 32  LEU 32  108 108 LEU LEU C . n 
C 1 33  LEU 33  109 109 LEU LEU C . n 
C 1 34  VAL 34  110 110 VAL VAL C . n 
C 1 35  PHE 35  111 111 PHE PHE C . n 
C 1 36  VAL 36  112 112 VAL VAL C . n 
C 1 37  PRO 37  113 113 PRO PRO C . n 
C 1 38  HIS 38  114 114 HIS HIS C . n 
C 1 39  MET 39  115 115 MET MET C . n 
C 1 40  ARG 40  116 116 ARG ARG C . n 
C 1 41  ARG 41  117 117 ARG ARG C . n 
C 1 42  PHE 42  118 118 PHE PHE C . n 
C 1 43  LEU 43  119 119 LEU LEU C . n 
C 1 44  SER 44  120 120 SER SER C . n 
C 1 45  ARG 45  121 121 ARG ARG C . n 
C 1 46  LYS 46  122 122 LYS LYS C . n 
C 1 47  LYS 47  123 123 LYS LYS C . n 
C 1 48  ILE 48  124 124 ILE ILE C . n 
C 1 49  ARG 49  125 125 ARG ARG C . n 
C 1 50  HIS 50  126 126 HIS HIS C . n 
C 1 51  HIS 51  127 127 HIS HIS C . n 
C 1 52  ILE 52  128 128 ILE ILE C . n 
C 1 53  TYR 53  129 129 TYR TYR C . n 
C 1 54  VAL 54  130 130 VAL VAL C . n 
C 1 55  LEU 55  131 131 LEU LEU C . n 
C 1 56  ASN 56  132 132 ASN ASN C . n 
C 1 57  GLN 57  133 133 GLN GLN C . n 
C 1 58  VAL 58  134 134 VAL VAL C . n 
C 1 59  ASP 59  135 135 ASP ASP C . n 
C 1 60  HIS 60  136 136 HIS HIS C . n 
C 1 61  PHE 61  137 137 PHE PHE C . n 
C 1 62  ARG 62  138 138 ARG ARG C . n 
C 1 63  PHE 63  139 139 PHE PHE C . n 
C 1 64  ASN 64  140 140 ASN ASN C . n 
C 1 65  ARG 65  141 141 ARG ARG C . n 
C 1 66  ALA 66  142 142 ALA ALA C . n 
C 1 67  ALA 67  143 143 ALA ALA C . n 
C 1 68  LEU 68  144 144 LEU LEU C . n 
C 1 69  ILE 69  145 145 ILE ILE C . n 
C 1 70  ASN 70  146 146 ASN ASN C . n 
C 1 71  VAL 71  147 147 VAL VAL C . n 
C 1 72  GLY 72  148 148 GLY GLY C . n 
C 1 73  PHE 73  149 149 PHE PHE C . n 
C 1 74  LEU 74  150 150 LEU LEU C . n 
C 1 75  GLU 75  151 151 GLU GLU C . n 
C 1 76  SER 76  152 152 SER SER C . n 
C 1 77  SER 77  153 153 SER SER C . n 
C 1 78  ASN 78  154 154 ASN ASN C . n 
C 1 79  SER 79  155 155 SER SER C . n 
C 1 80  THR 80  156 156 THR THR C . n 
C 1 81  ASP 81  157 157 ASP ASP C . n 
C 1 82  TYR 82  158 158 TYR TYR C . n 
C 1 83  ILE 83  159 159 ILE ILE C . n 
C 1 84  ALA 84  160 160 ALA ALA C . n 
C 1 85  MET 85  161 161 MET MET C . n 
C 1 86  HIS 86  162 162 HIS HIS C . n 
C 1 87  ASP 87  163 163 ASP ASP C . n 
C 1 88  VAL 88  164 164 VAL VAL C . n 
C 1 89  ASP 89  165 165 ASP ASP C . n 
C 1 90  LEU 90  166 166 LEU LEU C . n 
C 1 91  LEU 91  167 167 LEU LEU C . n 
C 1 92  PRO 92  168 168 PRO PRO C . n 
C 1 93  LEU 93  169 169 LEU LEU C . n 
C 1 94  ASN 94  170 170 ASN ASN C . n 
C 1 95  GLU 95  171 171 GLU GLU C . n 
C 1 96  GLU 96  172 172 GLU GLU C . n 
C 1 97  LEU 97  173 173 LEU LEU C . n 
C 1 98  ASP 98  174 174 ASP ASP C . n 
C 1 99  TYR 99  175 175 TYR TYR C . n 
C 1 100 GLY 100 176 176 GLY GLY C . n 
C 1 101 PHE 101 177 177 PHE PHE C . n 
C 1 102 PRO 102 178 178 PRO PRO C . n 
C 1 103 GLU 103 179 179 GLU GLU C . n 
C 1 104 ALA 104 180 180 ALA ALA C . n 
C 1 105 GLY 105 181 181 GLY GLY C . n 
C 1 106 PRO 106 182 182 PRO PRO C . n 
C 1 107 PHE 107 183 183 PHE PHE C . n 
C 1 108 HIS 108 184 184 HIS HIS C . n 
C 1 109 VAL 109 185 185 VAL VAL C . n 
C 1 110 ALA 110 186 186 ALA ALA C . n 
C 1 111 SER 111 187 187 SER SER C . n 
C 1 112 PRO 112 188 188 PRO PRO C . n 
C 1 113 GLU 113 189 189 GLU GLU C . n 
C 1 114 LEU 114 190 190 LEU LEU C . n 
C 1 115 HIS 115 191 191 HIS HIS C . n 
C 1 116 PRO 116 192 192 PRO PRO C . n 
C 1 117 LEU 117 193 193 LEU LEU C . n 
C 1 118 TYR 118 194 194 TYR TYR C . n 
C 1 119 HIS 119 195 195 HIS HIS C . n 
C 1 120 TYR 120 196 196 TYR TYR C . n 
C 1 121 LYS 121 197 197 LYS LYS C . n 
C 1 122 THR 122 198 198 THR THR C . n 
C 1 123 TYR 123 199 199 TYR TYR C . n 
C 1 124 VAL 124 200 200 VAL VAL C . n 
C 1 125 GLY 125 201 201 GLY GLY C . n 
C 1 126 GLY 126 202 202 GLY GLY C . n 
C 1 127 ILE 127 203 203 ILE ILE C . n 
C 1 128 LEU 128 204 204 LEU LEU C . n 
C 1 129 LEU 129 205 205 LEU LEU C . n 
C 1 130 LEU 130 206 206 LEU LEU C . n 
C 1 131 SER 131 207 207 SER SER C . n 
C 1 132 LYS 132 208 208 LYS LYS C . n 
C 1 133 GLN 133 209 209 GLN GLN C . n 
C 1 134 HIS 134 210 210 HIS HIS C . n 
C 1 135 TYR 135 211 211 TYR TYR C . n 
C 1 136 ARG 136 212 212 ARG ARG C . n 
C 1 137 LEU 137 213 213 LEU LEU C . n 
C 1 138 CYS 138 214 214 CYS CYS C . n 
C 1 139 ASN 139 215 215 ASN ASN C . n 
C 1 140 GLY 140 216 216 GLY GLY C . n 
C 1 141 MET 141 217 217 MET MET C . n 
C 1 142 SER 142 218 218 SER SER C . n 
C 1 143 ASN 143 219 219 ASN ASN C . n 
C 1 144 ARG 144 220 220 ARG ARG C . n 
C 1 145 PHE 145 221 221 PHE PHE C . n 
C 1 146 TRP 146 222 222 TRP TRP C . n 
C 1 147 GLY 147 223 223 GLY GLY C . n 
C 1 148 TRP 148 224 224 TRP TRP C . n 
C 1 149 GLY 149 225 225 GLY GLY C . n 
C 1 150 ARG 150 226 226 ARG ARG C . n 
C 1 151 GLU 151 227 227 GLU GLU C . n 
C 1 152 ASP 152 228 228 ASP ASP C . n 
C 1 153 ASP 153 229 229 ASP ASP C . n 
C 1 154 GLU 154 230 230 GLU GLU C . n 
C 1 155 PHE 155 231 231 PHE PHE C . n 
C 1 156 TYR 156 232 232 TYR TYR C . n 
C 1 157 ARG 157 233 233 ARG ARG C . n 
C 1 158 ARG 158 234 234 ARG ARG C . n 
C 1 159 ILE 159 235 235 ILE ILE C . n 
C 1 160 LYS 160 236 236 LYS LYS C . n 
C 1 161 GLY 161 237 237 GLY GLY C . n 
C 1 162 ALA 162 238 238 ALA ALA C . n 
C 1 163 GLY 163 239 239 GLY GLY C . n 
C 1 164 LEU 164 240 240 LEU LEU C . n 
C 1 165 GLN 165 241 241 GLN GLN C . n 
C 1 166 LEU 166 242 242 LEU LEU C . n 
C 1 167 PHE 167 243 243 PHE PHE C . n 
C 1 168 ARG 168 244 244 ARG ARG C . n 
C 1 169 PRO 169 245 245 PRO PRO C . n 
C 1 170 SER 170 246 246 SER SER C . n 
C 1 171 GLY 171 247 247 GLY GLY C . n 
C 1 172 ILE 172 248 248 ILE ILE C . n 
C 1 173 THR 173 249 249 THR THR C . n 
C 1 174 THR 174 250 250 THR THR C . n 
C 1 175 GLY 175 251 251 GLY GLY C . n 
C 1 176 TYR 176 252 252 TYR TYR C . n 
C 1 177 LYS 177 253 253 LYS LYS C . n 
C 1 178 THR 178 254 254 THR THR C . n 
C 1 179 PHE 179 255 255 PHE PHE C . n 
C 1 180 ARG 180 256 256 ARG ARG C . n 
C 1 181 HIS 181 257 257 HIS HIS C . n 
C 1 182 LEU 182 258 258 LEU LEU C . n 
C 1 183 HIS 183 259 259 HIS HIS C . n 
C 1 184 ASP 184 260 260 ASP ASP C . n 
C 1 185 PRO 185 261 261 PRO PRO C . n 
C 1 186 ALA 186 262 262 ALA ALA C . n 
C 1 187 TRP 187 263 263 TRP TRP C . n 
C 1 188 ARG 188 264 264 ARG ARG C . n 
C 1 189 LYS 189 265 265 LYS LYS C . n 
C 1 190 ARG 190 266 266 ARG ARG C . n 
C 1 191 ASP 191 267 267 ASP ASP C . n 
C 1 192 GLN 192 268 268 GLN GLN C . n 
C 1 193 LYS 193 269 269 LYS LYS C . n 
C 1 194 ARG 194 270 270 ARG ARG C . n 
C 1 195 ILE 195 271 271 ILE ILE C . n 
C 1 196 ALA 196 272 272 ALA ALA C . n 
C 1 197 ALA 197 273 273 ALA ALA C . n 
C 1 198 GLN 198 274 274 GLN GLN C . n 
C 1 199 LYS 199 275 275 LYS LYS C . n 
C 1 200 GLN 200 276 276 GLN GLN C . n 
C 1 201 GLU 201 277 277 GLU GLU C . n 
C 1 202 GLN 202 278 278 GLN GLN C . n 
C 1 203 PHE 203 279 279 PHE PHE C . n 
C 1 204 LYS 204 280 280 LYS LYS C . n 
C 1 205 VAL 205 281 281 VAL VAL C . n 
C 1 206 ASP 206 282 282 ASP ASP C . n 
C 1 207 ARG 207 283 283 ARG ARG C . n 
C 1 208 GLU 208 284 284 GLU GLU C . n 
C 1 209 GLY 209 285 285 GLY GLY C . n 
C 1 210 GLY 210 286 286 GLY GLY C . n 
C 1 211 LEU 211 287 287 LEU LEU C . n 
C 1 212 ASN 212 288 288 ASN ASN C . n 
C 1 213 THR 213 289 289 THR THR C . n 
C 1 214 VAL 214 290 290 VAL VAL C . n 
C 1 215 LYS 215 291 291 LYS LYS C . n 
C 1 216 TYR 216 292 292 TYR TYR C . n 
C 1 217 HIS 217 293 293 HIS HIS C . n 
C 1 218 VAL 218 294 294 VAL VAL C . n 
C 1 219 ALA 219 295 295 ALA ALA C . n 
C 1 220 SER 220 296 296 SER SER C . n 
C 1 221 ARG 221 297 297 ARG ARG C . n 
C 1 222 THR 222 298 298 THR THR C . n 
C 1 223 ALA 223 299 299 ALA ALA C . n 
C 1 224 LEU 224 300 300 LEU LEU C . n 
C 1 225 SER 225 301 301 SER SER C . n 
C 1 226 VAL 226 302 302 VAL VAL C . n 
C 1 227 GLY 227 303 303 GLY GLY C . n 
C 1 228 GLY 228 304 304 GLY GLY C . n 
C 1 229 ALA 229 305 305 ALA ALA C . n 
C 1 230 PRO 230 306 306 PRO PRO C . n 
C 1 231 CYS 231 307 307 CYS CYS C . n 
C 1 232 THR 232 308 308 THR THR C . n 
C 1 233 VAL 233 309 309 VAL VAL C . n 
C 1 234 LEU 234 310 310 LEU LEU C . n 
C 1 235 ASN 235 311 311 ASN ASN C . n 
C 1 236 ILE 236 312 312 ILE ILE C . n 
C 1 237 MET 237 313 313 MET MET C . n 
C 1 238 LEU 238 314 314 LEU LEU C . n 
C 1 239 ASP 239 315 315 ASP ASP C . n 
C 1 240 CYS 240 316 316 CYS CYS C . n 
C 1 241 ASP 241 317 317 ASP ASP C . n 
C 1 242 LYS 242 318 318 LYS LYS C . n 
C 1 243 THR 243 319 319 THR THR C . n 
C 1 244 ALA 244 320 320 ALA ALA C . n 
C 1 245 THR 245 321 321 THR THR C . n 
C 1 246 PRO 246 322 322 PRO PRO C . n 
C 1 247 TRP 247 323 323 TRP TRP C . n 
C 1 248 CYS 248 324 324 CYS CYS C . n 
C 1 249 THR 249 325 325 THR THR C . n 
C 1 250 PHE 250 326 326 PHE PHE C . n 
C 1 251 SER 251 327 327 SER SER C . n 
D 1 1   GLY 1   77  ?   ?   ?   D . n 
D 1 2   SER 2   78  ?   ?   ?   D . n 
D 1 3   ASP 3   79  ?   ?   ?   D . n 
D 1 4   ILE 4   80  ?   ?   ?   D . n 
D 1 5   PRO 5   81  ?   ?   ?   D . n 
D 1 6   GLU 6   82  ?   ?   ?   D . n 
D 1 7   HIS 7   83  ?   ?   ?   D . n 
D 1 8   TRP 8   84  ?   ?   ?   D . n 
D 1 9   GLU 9   85  85  GLU GLU D . n 
D 1 10  GLU 10  86  86  GLU GLU D . n 
D 1 11  ASP 11  87  87  ASP ASP D . n 
D 1 12  ALA 12  88  88  ALA ALA D . n 
D 1 13  SER 13  89  89  SER SER D . n 
D 1 14  TRP 14  90  90  TRP TRP D . n 
D 1 15  GLY 15  91  91  GLY GLY D . n 
D 1 16  PRO 16  92  92  PRO PRO D . n 
D 1 17  HIS 17  93  93  HIS HIS D . n 
D 1 18  ARG 18  94  94  ARG ARG D . n 
D 1 19  LEU 19  95  95  LEU LEU D . n 
D 1 20  ALA 20  96  96  ALA ALA D . n 
D 1 21  VAL 21  97  97  VAL VAL D . n 
D 1 22  LEU 22  98  98  LEU LEU D . n 
D 1 23  VAL 23  99  99  VAL VAL D . n 
D 1 24  PRO 24  100 100 PRO PRO D . n 
D 1 25  PHE 25  101 101 PHE PHE D . n 
D 1 26  ARG 26  102 102 ARG ARG D . n 
D 1 27  GLU 27  103 103 GLU GLU D . n 
D 1 28  ARG 28  104 104 ARG ARG D . n 
D 1 29  PHE 29  105 105 PHE PHE D . n 
D 1 30  GLU 30  106 106 GLU GLU D . n 
D 1 31  GLU 31  107 107 GLU GLU D . n 
D 1 32  LEU 32  108 108 LEU LEU D . n 
D 1 33  LEU 33  109 109 LEU LEU D . n 
D 1 34  VAL 34  110 110 VAL VAL D . n 
D 1 35  PHE 35  111 111 PHE PHE D . n 
D 1 36  VAL 36  112 112 VAL VAL D . n 
D 1 37  PRO 37  113 113 PRO PRO D . n 
D 1 38  HIS 38  114 114 HIS HIS D . n 
D 1 39  MET 39  115 115 MET MET D . n 
D 1 40  ARG 40  116 116 ARG ARG D . n 
D 1 41  ARG 41  117 117 ARG ARG D . n 
D 1 42  PHE 42  118 118 PHE PHE D . n 
D 1 43  LEU 43  119 119 LEU LEU D . n 
D 1 44  SER 44  120 120 SER SER D . n 
D 1 45  ARG 45  121 121 ARG ARG D . n 
D 1 46  LYS 46  122 122 LYS LYS D . n 
D 1 47  LYS 47  123 123 LYS LYS D . n 
D 1 48  ILE 48  124 124 ILE ILE D . n 
D 1 49  ARG 49  125 125 ARG ARG D . n 
D 1 50  HIS 50  126 126 HIS HIS D . n 
D 1 51  HIS 51  127 127 HIS HIS D . n 
D 1 52  ILE 52  128 128 ILE ILE D . n 
D 1 53  TYR 53  129 129 TYR TYR D . n 
D 1 54  VAL 54  130 130 VAL VAL D . n 
D 1 55  LEU 55  131 131 LEU LEU D . n 
D 1 56  ASN 56  132 132 ASN ASN D . n 
D 1 57  GLN 57  133 133 GLN GLN D . n 
D 1 58  VAL 58  134 134 VAL VAL D . n 
D 1 59  ASP 59  135 135 ASP ASP D . n 
D 1 60  HIS 60  136 136 HIS HIS D . n 
D 1 61  PHE 61  137 137 PHE PHE D . n 
D 1 62  ARG 62  138 138 ARG ARG D . n 
D 1 63  PHE 63  139 139 PHE PHE D . n 
D 1 64  ASN 64  140 140 ASN ASN D . n 
D 1 65  ARG 65  141 141 ARG ARG D . n 
D 1 66  ALA 66  142 142 ALA ALA D . n 
D 1 67  ALA 67  143 143 ALA ALA D . n 
D 1 68  LEU 68  144 144 LEU LEU D . n 
D 1 69  ILE 69  145 145 ILE ILE D . n 
D 1 70  ASN 70  146 146 ASN ASN D . n 
D 1 71  VAL 71  147 147 VAL VAL D . n 
D 1 72  GLY 72  148 148 GLY GLY D . n 
D 1 73  PHE 73  149 149 PHE PHE D . n 
D 1 74  LEU 74  150 150 LEU LEU D . n 
D 1 75  GLU 75  151 151 GLU GLU D . n 
D 1 76  SER 76  152 152 SER SER D . n 
D 1 77  SER 77  153 153 SER SER D . n 
D 1 78  ASN 78  154 154 ASN ASN D . n 
D 1 79  SER 79  155 155 SER SER D . n 
D 1 80  THR 80  156 156 THR THR D . n 
D 1 81  ASP 81  157 157 ASP ASP D . n 
D 1 82  TYR 82  158 158 TYR TYR D . n 
D 1 83  ILE 83  159 159 ILE ILE D . n 
D 1 84  ALA 84  160 160 ALA ALA D . n 
D 1 85  MET 85  161 161 MET MET D . n 
D 1 86  HIS 86  162 162 HIS HIS D . n 
D 1 87  ASP 87  163 163 ASP ASP D . n 
D 1 88  VAL 88  164 164 VAL VAL D . n 
D 1 89  ASP 89  165 165 ASP ASP D . n 
D 1 90  LEU 90  166 166 LEU LEU D . n 
D 1 91  LEU 91  167 167 LEU LEU D . n 
D 1 92  PRO 92  168 168 PRO PRO D . n 
D 1 93  LEU 93  169 169 LEU LEU D . n 
D 1 94  ASN 94  170 170 ASN ASN D . n 
D 1 95  GLU 95  171 171 GLU GLU D . n 
D 1 96  GLU 96  172 172 GLU GLU D . n 
D 1 97  LEU 97  173 173 LEU LEU D . n 
D 1 98  ASP 98  174 174 ASP ASP D . n 
D 1 99  TYR 99  175 175 TYR TYR D . n 
D 1 100 GLY 100 176 176 GLY GLY D . n 
D 1 101 PHE 101 177 177 PHE PHE D . n 
D 1 102 PRO 102 178 178 PRO PRO D . n 
D 1 103 GLU 103 179 179 GLU GLU D . n 
D 1 104 ALA 104 180 180 ALA ALA D . n 
D 1 105 GLY 105 181 181 GLY GLY D . n 
D 1 106 PRO 106 182 182 PRO PRO D . n 
D 1 107 PHE 107 183 183 PHE PHE D . n 
D 1 108 HIS 108 184 184 HIS HIS D . n 
D 1 109 VAL 109 185 185 VAL VAL D . n 
D 1 110 ALA 110 186 186 ALA ALA D . n 
D 1 111 SER 111 187 187 SER SER D . n 
D 1 112 PRO 112 188 188 PRO PRO D . n 
D 1 113 GLU 113 189 189 GLU GLU D . n 
D 1 114 LEU 114 190 190 LEU LEU D . n 
D 1 115 HIS 115 191 191 HIS HIS D . n 
D 1 116 PRO 116 192 192 PRO PRO D . n 
D 1 117 LEU 117 193 193 LEU LEU D . n 
D 1 118 TYR 118 194 194 TYR TYR D . n 
D 1 119 HIS 119 195 195 HIS HIS D . n 
D 1 120 TYR 120 196 196 TYR TYR D . n 
D 1 121 LYS 121 197 197 LYS LYS D . n 
D 1 122 THR 122 198 198 THR THR D . n 
D 1 123 TYR 123 199 199 TYR TYR D . n 
D 1 124 VAL 124 200 200 VAL VAL D . n 
D 1 125 GLY 125 201 201 GLY GLY D . n 
D 1 126 GLY 126 202 202 GLY GLY D . n 
D 1 127 ILE 127 203 203 ILE ILE D . n 
D 1 128 LEU 128 204 204 LEU LEU D . n 
D 1 129 LEU 129 205 205 LEU LEU D . n 
D 1 130 LEU 130 206 206 LEU LEU D . n 
D 1 131 SER 131 207 207 SER SER D . n 
D 1 132 LYS 132 208 208 LYS LYS D . n 
D 1 133 GLN 133 209 209 GLN GLN D . n 
D 1 134 HIS 134 210 210 HIS HIS D . n 
D 1 135 TYR 135 211 211 TYR TYR D . n 
D 1 136 ARG 136 212 212 ARG ARG D . n 
D 1 137 LEU 137 213 213 LEU LEU D . n 
D 1 138 CYS 138 214 214 CYS CYS D . n 
D 1 139 ASN 139 215 215 ASN ASN D . n 
D 1 140 GLY 140 216 216 GLY GLY D . n 
D 1 141 MET 141 217 217 MET MET D . n 
D 1 142 SER 142 218 218 SER SER D . n 
D 1 143 ASN 143 219 219 ASN ASN D . n 
D 1 144 ARG 144 220 220 ARG ARG D . n 
D 1 145 PHE 145 221 221 PHE PHE D . n 
D 1 146 TRP 146 222 222 TRP TRP D . n 
D 1 147 GLY 147 223 223 GLY GLY D . n 
D 1 148 TRP 148 224 224 TRP TRP D . n 
D 1 149 GLY 149 225 225 GLY GLY D . n 
D 1 150 ARG 150 226 226 ARG ARG D . n 
D 1 151 GLU 151 227 227 GLU GLU D . n 
D 1 152 ASP 152 228 228 ASP ASP D . n 
D 1 153 ASP 153 229 229 ASP ASP D . n 
D 1 154 GLU 154 230 230 GLU GLU D . n 
D 1 155 PHE 155 231 231 PHE PHE D . n 
D 1 156 TYR 156 232 232 TYR TYR D . n 
D 1 157 ARG 157 233 233 ARG ARG D . n 
D 1 158 ARG 158 234 234 ARG ARG D . n 
D 1 159 ILE 159 235 235 ILE ILE D . n 
D 1 160 LYS 160 236 236 LYS LYS D . n 
D 1 161 GLY 161 237 237 GLY GLY D . n 
D 1 162 ALA 162 238 238 ALA ALA D . n 
D 1 163 GLY 163 239 239 GLY GLY D . n 
D 1 164 LEU 164 240 240 LEU LEU D . n 
D 1 165 GLN 165 241 241 GLN GLN D . n 
D 1 166 LEU 166 242 242 LEU LEU D . n 
D 1 167 PHE 167 243 243 PHE PHE D . n 
D 1 168 ARG 168 244 244 ARG ARG D . n 
D 1 169 PRO 169 245 245 PRO PRO D . n 
D 1 170 SER 170 246 246 SER SER D . n 
D 1 171 GLY 171 247 247 GLY GLY D . n 
D 1 172 ILE 172 248 248 ILE ILE D . n 
D 1 173 THR 173 249 249 THR THR D . n 
D 1 174 THR 174 250 250 THR THR D . n 
D 1 175 GLY 175 251 251 GLY GLY D . n 
D 1 176 TYR 176 252 252 TYR TYR D . n 
D 1 177 LYS 177 253 253 LYS LYS D . n 
D 1 178 THR 178 254 254 THR THR D . n 
D 1 179 PHE 179 255 255 PHE PHE D . n 
D 1 180 ARG 180 256 256 ARG ARG D . n 
D 1 181 HIS 181 257 257 HIS HIS D . n 
D 1 182 LEU 182 258 258 LEU LEU D . n 
D 1 183 HIS 183 259 259 HIS HIS D . n 
D 1 184 ASP 184 260 260 ASP ASP D . n 
D 1 185 PRO 185 261 261 PRO PRO D . n 
D 1 186 ALA 186 262 262 ALA ALA D . n 
D 1 187 TRP 187 263 263 TRP TRP D . n 
D 1 188 ARG 188 264 264 ARG ARG D . n 
D 1 189 LYS 189 265 265 LYS LYS D . n 
D 1 190 ARG 190 266 266 ARG ARG D . n 
D 1 191 ASP 191 267 267 ASP ASP D . n 
D 1 192 GLN 192 268 268 GLN GLN D . n 
D 1 193 LYS 193 269 269 LYS LYS D . n 
D 1 194 ARG 194 270 270 ARG ARG D . n 
D 1 195 ILE 195 271 271 ILE ILE D . n 
D 1 196 ALA 196 272 272 ALA ALA D . n 
D 1 197 ALA 197 273 273 ALA ALA D . n 
D 1 198 GLN 198 274 274 GLN GLN D . n 
D 1 199 LYS 199 275 275 LYS LYS D . n 
D 1 200 GLN 200 276 276 GLN GLN D . n 
D 1 201 GLU 201 277 277 GLU GLU D . n 
D 1 202 GLN 202 278 278 GLN GLN D . n 
D 1 203 PHE 203 279 279 PHE PHE D . n 
D 1 204 LYS 204 280 280 LYS LYS D . n 
D 1 205 VAL 205 281 281 VAL VAL D . n 
D 1 206 ASP 206 282 282 ASP ASP D . n 
D 1 207 ARG 207 283 283 ARG ARG D . n 
D 1 208 GLU 208 284 284 GLU GLU D . n 
D 1 209 GLY 209 285 285 GLY GLY D . n 
D 1 210 GLY 210 286 286 GLY GLY D . n 
D 1 211 LEU 211 287 287 LEU LEU D . n 
D 1 212 ASN 212 288 288 ASN ASN D . n 
D 1 213 THR 213 289 289 THR THR D . n 
D 1 214 VAL 214 290 290 VAL VAL D . n 
D 1 215 LYS 215 291 291 LYS LYS D . n 
D 1 216 TYR 216 292 292 TYR TYR D . n 
D 1 217 HIS 217 293 293 HIS HIS D . n 
D 1 218 VAL 218 294 294 VAL VAL D . n 
D 1 219 ALA 219 295 295 ALA ALA D . n 
D 1 220 SER 220 296 296 SER SER D . n 
D 1 221 ARG 221 297 297 ARG ARG D . n 
D 1 222 THR 222 298 298 THR THR D . n 
D 1 223 ALA 223 299 299 ALA ALA D . n 
D 1 224 LEU 224 300 300 LEU LEU D . n 
D 1 225 SER 225 301 301 SER SER D . n 
D 1 226 VAL 226 302 302 VAL VAL D . n 
D 1 227 GLY 227 303 303 GLY GLY D . n 
D 1 228 GLY 228 304 304 GLY GLY D . n 
D 1 229 ALA 229 305 305 ALA ALA D . n 
D 1 230 PRO 230 306 306 PRO PRO D . n 
D 1 231 CYS 231 307 307 CYS CYS D . n 
D 1 232 THR 232 308 308 THR THR D . n 
D 1 233 VAL 233 309 309 VAL VAL D . n 
D 1 234 LEU 234 310 310 LEU LEU D . n 
D 1 235 ASN 235 311 311 ASN ASN D . n 
D 1 236 ILE 236 312 312 ILE ILE D . n 
D 1 237 MET 237 313 313 MET MET D . n 
D 1 238 LEU 238 314 314 LEU LEU D . n 
D 1 239 ASP 239 315 315 ASP ASP D . n 
D 1 240 CYS 240 316 316 CYS CYS D . n 
D 1 241 ASP 241 317 317 ASP ASP D . n 
D 1 242 LYS 242 318 318 LYS LYS D . n 
D 1 243 THR 243 319 319 THR THR D . n 
D 1 244 ALA 244 320 320 ALA ALA D . n 
D 1 245 THR 245 321 321 THR THR D . n 
D 1 246 PRO 246 322 322 PRO PRO D . n 
D 1 247 TRP 247 323 323 TRP TRP D . n 
D 1 248 CYS 248 324 324 CYS CYS D . n 
D 1 249 THR 249 325 325 THR THR D . n 
D 1 250 PHE 250 326 326 PHE PHE D . n 
D 1 251 SER 251 327 327 SER SER D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 MN  1  401 330 MN  MN  A . 
F 3 UDP 1  402 331 UDP UDP A . 
G 4 TRS 1  403 1   TRS TRS A . 
H 2 MN  1  401 330 MN  MN  B . 
I 3 UDP 1  402 332 UDP UDP B . 
J 4 TRS 1  403 3   TRS TRS B . 
K 2 MN  1  401 330 MN  MN  C . 
L 3 UDP 1  402 331 UDP UDP C . 
M 4 TRS 1  403 4   TRS TRS C . 
N 2 MN  1  401 330 MN  MN  D . 
O 3 UDP 1  402 331 UDP UDP D . 
P 4 TRS 1  403 2   TRS TRS D . 
Q 5 HOH 1  501 332 HOH HOH A . 
Q 5 HOH 2  502 1   HOH HOH A . 
Q 5 HOH 3  503 4   HOH HOH A . 
Q 5 HOH 4  504 14  HOH HOH A . 
Q 5 HOH 5  505 17  HOH HOH A . 
Q 5 HOH 6  506 19  HOH HOH A . 
Q 5 HOH 7  507 20  HOH HOH A . 
Q 5 HOH 8  508 21  HOH HOH A . 
Q 5 HOH 9  509 22  HOH HOH A . 
Q 5 HOH 10 510 23  HOH HOH A . 
Q 5 HOH 11 511 24  HOH HOH A . 
Q 5 HOH 12 512 25  HOH HOH A . 
Q 5 HOH 13 513 26  HOH HOH A . 
Q 5 HOH 14 514 38  HOH HOH A . 
Q 5 HOH 15 515 40  HOH HOH A . 
Q 5 HOH 16 516 41  HOH HOH A . 
Q 5 HOH 17 517 43  HOH HOH A . 
Q 5 HOH 18 518 44  HOH HOH A . 
Q 5 HOH 19 519 45  HOH HOH A . 
Q 5 HOH 20 520 50  HOH HOH A . 
Q 5 HOH 21 521 54  HOH HOH A . 
Q 5 HOH 22 522 55  HOH HOH A . 
Q 5 HOH 23 523 59  HOH HOH A . 
Q 5 HOH 24 524 63  HOH HOH A . 
Q 5 HOH 25 525 69  HOH HOH A . 
Q 5 HOH 26 526 73  HOH HOH A . 
Q 5 HOH 27 527 74  HOH HOH A . 
Q 5 HOH 28 528 76  HOH HOH A . 
Q 5 HOH 29 529 86  HOH HOH A . 
Q 5 HOH 30 530 88  HOH HOH A . 
Q 5 HOH 31 531 92  HOH HOH A . 
Q 5 HOH 32 532 101 HOH HOH A . 
Q 5 HOH 33 533 105 HOH HOH A . 
Q 5 HOH 34 534 106 HOH HOH A . 
Q 5 HOH 35 535 110 HOH HOH A . 
Q 5 HOH 36 536 112 HOH HOH A . 
Q 5 HOH 37 537 118 HOH HOH A . 
Q 5 HOH 38 538 119 HOH HOH A . 
Q 5 HOH 39 539 123 HOH HOH A . 
Q 5 HOH 40 540 124 HOH HOH A . 
Q 5 HOH 41 541 131 HOH HOH A . 
Q 5 HOH 42 542 145 HOH HOH A . 
Q 5 HOH 43 543 146 HOH HOH A . 
Q 5 HOH 44 544 155 HOH HOH A . 
Q 5 HOH 45 545 160 HOH HOH A . 
Q 5 HOH 46 546 161 HOH HOH A . 
Q 5 HOH 47 547 164 HOH HOH A . 
Q 5 HOH 48 548 175 HOH HOH A . 
Q 5 HOH 49 549 182 HOH HOH A . 
Q 5 HOH 50 550 183 HOH HOH A . 
Q 5 HOH 51 551 186 HOH HOH A . 
Q 5 HOH 52 552 188 HOH HOH A . 
Q 5 HOH 53 553 189 HOH HOH A . 
Q 5 HOH 54 554 196 HOH HOH A . 
Q 5 HOH 55 555 198 HOH HOH A . 
Q 5 HOH 56 556 199 HOH HOH A . 
Q 5 HOH 57 557 212 HOH HOH A . 
Q 5 HOH 58 558 213 HOH HOH A . 
Q 5 HOH 59 559 214 HOH HOH A . 
Q 5 HOH 60 560 216 HOH HOH A . 
Q 5 HOH 61 561 224 HOH HOH A . 
Q 5 HOH 62 562 225 HOH HOH A . 
Q 5 HOH 63 563 226 HOH HOH A . 
Q 5 HOH 64 564 232 HOH HOH A . 
Q 5 HOH 65 565 234 HOH HOH A . 
Q 5 HOH 66 566 240 HOH HOH A . 
Q 5 HOH 67 567 244 HOH HOH A . 
Q 5 HOH 68 568 245 HOH HOH A . 
Q 5 HOH 69 569 246 HOH HOH A . 
Q 5 HOH 70 570 248 HOH HOH A . 
Q 5 HOH 71 571 250 HOH HOH A . 
Q 5 HOH 72 572 251 HOH HOH A . 
Q 5 HOH 73 573 259 HOH HOH A . 
Q 5 HOH 74 574 267 HOH HOH A . 
Q 5 HOH 75 575 272 HOH HOH A . 
Q 5 HOH 76 576 273 HOH HOH A . 
Q 5 HOH 77 577 279 HOH HOH A . 
Q 5 HOH 78 578 281 HOH HOH A . 
Q 5 HOH 79 579 283 HOH HOH A . 
Q 5 HOH 80 580 285 HOH HOH A . 
Q 5 HOH 81 581 286 HOH HOH A . 
Q 5 HOH 82 582 287 HOH HOH A . 
Q 5 HOH 83 583 289 HOH HOH A . 
Q 5 HOH 84 584 290 HOH HOH A . 
Q 5 HOH 85 585 295 HOH HOH A . 
R 5 HOH 1  501 333 HOH HOH B . 
R 5 HOH 2  502 8   HOH HOH B . 
R 5 HOH 3  503 10  HOH HOH B . 
R 5 HOH 4  504 15  HOH HOH B . 
R 5 HOH 5  505 18  HOH HOH B . 
R 5 HOH 6  506 27  HOH HOH B . 
R 5 HOH 7  507 28  HOH HOH B . 
R 5 HOH 8  508 29  HOH HOH B . 
R 5 HOH 9  509 39  HOH HOH B . 
R 5 HOH 10 510 48  HOH HOH B . 
R 5 HOH 11 511 49  HOH HOH B . 
R 5 HOH 12 512 51  HOH HOH B . 
R 5 HOH 13 513 53  HOH HOH B . 
R 5 HOH 14 514 62  HOH HOH B . 
R 5 HOH 15 515 77  HOH HOH B . 
R 5 HOH 16 516 78  HOH HOH B . 
R 5 HOH 17 517 81  HOH HOH B . 
R 5 HOH 18 518 83  HOH HOH B . 
R 5 HOH 19 519 84  HOH HOH B . 
R 5 HOH 20 520 87  HOH HOH B . 
R 5 HOH 21 521 89  HOH HOH B . 
R 5 HOH 22 522 94  HOH HOH B . 
R 5 HOH 23 523 98  HOH HOH B . 
R 5 HOH 24 524 107 HOH HOH B . 
R 5 HOH 25 525 108 HOH HOH B . 
R 5 HOH 26 526 115 HOH HOH B . 
R 5 HOH 27 527 121 HOH HOH B . 
R 5 HOH 28 528 122 HOH HOH B . 
R 5 HOH 29 529 125 HOH HOH B . 
R 5 HOH 30 530 127 HOH HOH B . 
R 5 HOH 31 531 133 HOH HOH B . 
R 5 HOH 32 532 135 HOH HOH B . 
R 5 HOH 33 533 137 HOH HOH B . 
R 5 HOH 34 534 140 HOH HOH B . 
R 5 HOH 35 535 150 HOH HOH B . 
R 5 HOH 36 536 152 HOH HOH B . 
R 5 HOH 37 537 157 HOH HOH B . 
R 5 HOH 38 538 162 HOH HOH B . 
R 5 HOH 39 539 163 HOH HOH B . 
R 5 HOH 40 540 165 HOH HOH B . 
R 5 HOH 41 541 167 HOH HOH B . 
R 5 HOH 42 542 168 HOH HOH B . 
R 5 HOH 43 543 171 HOH HOH B . 
R 5 HOH 44 544 172 HOH HOH B . 
R 5 HOH 45 545 176 HOH HOH B . 
R 5 HOH 46 546 179 HOH HOH B . 
R 5 HOH 47 547 185 HOH HOH B . 
R 5 HOH 48 548 194 HOH HOH B . 
R 5 HOH 49 549 195 HOH HOH B . 
R 5 HOH 50 550 197 HOH HOH B . 
R 5 HOH 51 551 200 HOH HOH B . 
R 5 HOH 52 552 201 HOH HOH B . 
R 5 HOH 53 553 202 HOH HOH B . 
R 5 HOH 54 554 203 HOH HOH B . 
R 5 HOH 55 555 217 HOH HOH B . 
R 5 HOH 56 556 218 HOH HOH B . 
R 5 HOH 57 557 219 HOH HOH B . 
R 5 HOH 58 558 228 HOH HOH B . 
R 5 HOH 59 559 229 HOH HOH B . 
R 5 HOH 60 560 235 HOH HOH B . 
R 5 HOH 61 561 243 HOH HOH B . 
R 5 HOH 62 562 247 HOH HOH B . 
R 5 HOH 63 563 256 HOH HOH B . 
R 5 HOH 64 564 274 HOH HOH B . 
R 5 HOH 65 565 291 HOH HOH B . 
R 5 HOH 66 566 294 HOH HOH B . 
S 5 HOH 1  501 332 HOH HOH C . 
S 5 HOH 2  502 11  HOH HOH C . 
S 5 HOH 3  503 16  HOH HOH C . 
S 5 HOH 4  504 30  HOH HOH C . 
S 5 HOH 5  505 31  HOH HOH C . 
S 5 HOH 6  506 32  HOH HOH C . 
S 5 HOH 7  507 46  HOH HOH C . 
S 5 HOH 8  508 52  HOH HOH C . 
S 5 HOH 9  509 60  HOH HOH C . 
S 5 HOH 10 510 61  HOH HOH C . 
S 5 HOH 11 511 65  HOH HOH C . 
S 5 HOH 12 512 66  HOH HOH C . 
S 5 HOH 13 513 68  HOH HOH C . 
S 5 HOH 14 514 70  HOH HOH C . 
S 5 HOH 15 515 72  HOH HOH C . 
S 5 HOH 16 516 75  HOH HOH C . 
S 5 HOH 17 517 79  HOH HOH C . 
S 5 HOH 18 518 80  HOH HOH C . 
S 5 HOH 19 519 82  HOH HOH C . 
S 5 HOH 20 520 91  HOH HOH C . 
S 5 HOH 21 521 95  HOH HOH C . 
S 5 HOH 22 522 99  HOH HOH C . 
S 5 HOH 23 523 104 HOH HOH C . 
S 5 HOH 24 524 109 HOH HOH C . 
S 5 HOH 25 525 111 HOH HOH C . 
S 5 HOH 26 526 116 HOH HOH C . 
S 5 HOH 27 527 120 HOH HOH C . 
S 5 HOH 28 528 129 HOH HOH C . 
S 5 HOH 29 529 132 HOH HOH C . 
S 5 HOH 30 530 144 HOH HOH C . 
S 5 HOH 31 531 151 HOH HOH C . 
S 5 HOH 32 532 156 HOH HOH C . 
S 5 HOH 33 533 158 HOH HOH C . 
S 5 HOH 34 534 159 HOH HOH C . 
S 5 HOH 35 535 178 HOH HOH C . 
S 5 HOH 36 536 180 HOH HOH C . 
S 5 HOH 37 537 184 HOH HOH C . 
S 5 HOH 38 538 190 HOH HOH C . 
S 5 HOH 39 539 191 HOH HOH C . 
S 5 HOH 40 540 204 HOH HOH C . 
S 5 HOH 41 541 205 HOH HOH C . 
S 5 HOH 42 542 206 HOH HOH C . 
S 5 HOH 43 543 220 HOH HOH C . 
S 5 HOH 44 544 233 HOH HOH C . 
S 5 HOH 45 545 236 HOH HOH C . 
S 5 HOH 46 546 237 HOH HOH C . 
S 5 HOH 47 547 238 HOH HOH C . 
S 5 HOH 48 548 239 HOH HOH C . 
S 5 HOH 49 549 252 HOH HOH C . 
S 5 HOH 50 550 253 HOH HOH C . 
S 5 HOH 51 551 254 HOH HOH C . 
S 5 HOH 52 552 255 HOH HOH C . 
S 5 HOH 53 553 257 HOH HOH C . 
S 5 HOH 54 554 258 HOH HOH C . 
S 5 HOH 55 555 261 HOH HOH C . 
S 5 HOH 56 556 262 HOH HOH C . 
S 5 HOH 57 557 266 HOH HOH C . 
S 5 HOH 58 558 268 HOH HOH C . 
S 5 HOH 59 559 269 HOH HOH C . 
S 5 HOH 60 560 277 HOH HOH C . 
S 5 HOH 61 561 278 HOH HOH C . 
S 5 HOH 62 562 280 HOH HOH C . 
S 5 HOH 63 563 293 HOH HOH C . 
S 5 HOH 64 564 296 HOH HOH C . 
T 5 HOH 1  501 332 HOH HOH D . 
T 5 HOH 2  502 2   HOH HOH D . 
T 5 HOH 3  503 3   HOH HOH D . 
T 5 HOH 4  504 5   HOH HOH D . 
T 5 HOH 5  505 6   HOH HOH D . 
T 5 HOH 6  506 7   HOH HOH D . 
T 5 HOH 7  507 9   HOH HOH D . 
T 5 HOH 8  508 12  HOH HOH D . 
T 5 HOH 9  509 13  HOH HOH D . 
T 5 HOH 10 510 33  HOH HOH D . 
T 5 HOH 11 511 34  HOH HOH D . 
T 5 HOH 12 512 35  HOH HOH D . 
T 5 HOH 13 513 36  HOH HOH D . 
T 5 HOH 14 514 37  HOH HOH D . 
T 5 HOH 15 515 47  HOH HOH D . 
T 5 HOH 16 516 56  HOH HOH D . 
T 5 HOH 17 517 58  HOH HOH D . 
T 5 HOH 18 518 64  HOH HOH D . 
T 5 HOH 19 519 67  HOH HOH D . 
T 5 HOH 20 520 71  HOH HOH D . 
T 5 HOH 21 521 85  HOH HOH D . 
T 5 HOH 22 522 90  HOH HOH D . 
T 5 HOH 23 523 93  HOH HOH D . 
T 5 HOH 24 524 96  HOH HOH D . 
T 5 HOH 25 525 97  HOH HOH D . 
T 5 HOH 26 526 100 HOH HOH D . 
T 5 HOH 27 527 102 HOH HOH D . 
T 5 HOH 28 528 103 HOH HOH D . 
T 5 HOH 29 529 113 HOH HOH D . 
T 5 HOH 30 530 114 HOH HOH D . 
T 5 HOH 31 531 117 HOH HOH D . 
T 5 HOH 32 532 126 HOH HOH D . 
T 5 HOH 33 533 130 HOH HOH D . 
T 5 HOH 34 534 134 HOH HOH D . 
T 5 HOH 35 535 136 HOH HOH D . 
T 5 HOH 36 536 138 HOH HOH D . 
T 5 HOH 37 537 139 HOH HOH D . 
T 5 HOH 38 538 141 HOH HOH D . 
T 5 HOH 39 539 142 HOH HOH D . 
T 5 HOH 40 540 143 HOH HOH D . 
T 5 HOH 41 541 147 HOH HOH D . 
T 5 HOH 42 542 149 HOH HOH D . 
T 5 HOH 43 543 153 HOH HOH D . 
T 5 HOH 44 544 154 HOH HOH D . 
T 5 HOH 45 545 166 HOH HOH D . 
T 5 HOH 46 546 169 HOH HOH D . 
T 5 HOH 47 547 170 HOH HOH D . 
T 5 HOH 48 548 174 HOH HOH D . 
T 5 HOH 49 549 177 HOH HOH D . 
T 5 HOH 50 550 181 HOH HOH D . 
T 5 HOH 51 551 187 HOH HOH D . 
T 5 HOH 52 552 192 HOH HOH D . 
T 5 HOH 53 553 193 HOH HOH D . 
T 5 HOH 54 554 207 HOH HOH D . 
T 5 HOH 55 555 208 HOH HOH D . 
T 5 HOH 56 556 209 HOH HOH D . 
T 5 HOH 57 557 210 HOH HOH D . 
T 5 HOH 58 558 211 HOH HOH D . 
T 5 HOH 59 559 215 HOH HOH D . 
T 5 HOH 60 560 221 HOH HOH D . 
T 5 HOH 61 561 222 HOH HOH D . 
T 5 HOH 62 562 223 HOH HOH D . 
T 5 HOH 63 563 230 HOH HOH D . 
T 5 HOH 64 564 231 HOH HOH D . 
T 5 HOH 65 565 241 HOH HOH D . 
T 5 HOH 66 566 242 HOH HOH D . 
T 5 HOH 67 567 249 HOH HOH D . 
T 5 HOH 68 568 263 HOH HOH D . 
T 5 HOH 69 569 264 HOH HOH D . 
T 5 HOH 70 570 270 HOH HOH D . 
T 5 HOH 71 571 282 HOH HOH D . 
T 5 HOH 72 572 284 HOH HOH D . 
T 5 HOH 73 573 288 HOH HOH D . 
T 5 HOH 74 574 297 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 author_defined_assembly   ?    monomeric 1 
4 author_defined_assembly   ?    monomeric 1 
5 software_defined_assembly PISA dimeric   2 
6 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F,G,Q           
2 1 B,H,I,J,R           
3 1 C,K,L,M,S           
4 1 D,N,O,P,T           
5 1 A,D,E,F,G,N,O,P,Q,T 
6 1 B,H,I,J,R           
6 2 C,K,L,M,S           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
5 'ABSA (A^2)' 4360  ? 
5 MORE         -36   ? 
5 'SSA (A^2)'  20540 ? 
6 'ABSA (A^2)' 4350  ? 
6 MORE         -34   ? 
6 'SSA (A^2)'  20530 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 1_455 x-1,y,z 1.0000000000 0.0000000000 0.0000000000 -67.1220000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1B ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O1A ? F UDP .   ? A UDP 402 ? 1_555 82.0  ? 
2  O1B ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O   ? Q HOH .   ? A HOH 501 ? 1_555 91.6  ? 
3  O1A ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 O   ? Q HOH .   ? A HOH 501 ? 1_555 84.7  ? 
4  O1B ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 NE2 ? A HIS 181 ? A HIS 257 ? 1_555 95.7  ? 
5  O1A ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 NE2 ? A HIS 181 ? A HIS 257 ? 1_555 174.0 ? 
6  O   ? Q HOH .   ? A HOH 501 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 NE2 ? A HIS 181 ? A HIS 257 ? 1_555 89.8  ? 
7  O1B ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 89  ? A ASP 165 ? 1_555 174.7 ? 
8  O1A ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 89  ? A ASP 165 ? 1_555 93.9  ? 
9  O   ? Q HOH .   ? A HOH 501 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 89  ? A ASP 165 ? 1_555 91.4  ? 
10 NE2 ? A HIS 181 ? A HIS 257 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 OD2 ? A ASP 89  ? A ASP 165 ? 1_555 88.7  ? 
11 O1B ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 ND1 ? A HIS 183 ? A HIS 259 ? 1_555 91.3  ? 
12 O1A ? F UDP .   ? A UDP 402 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 ND1 ? A HIS 183 ? A HIS 259 ? 1_555 90.9  ? 
13 O   ? Q HOH .   ? A HOH 501 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 ND1 ? A HIS 183 ? A HIS 259 ? 1_555 174.3 ? 
14 NE2 ? A HIS 181 ? A HIS 257 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 ND1 ? A HIS 183 ? A HIS 259 ? 1_555 94.7  ? 
15 OD2 ? A ASP 89  ? A ASP 165 ? 1_555 MN ? E MN . ? A MN 401 ? 1_555 ND1 ? A HIS 183 ? A HIS 259 ? 1_555 85.3  ? 
16 O1B ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 O1A ? L UDP .   ? C UDP 402 ? 1_555 83.9  ? 
17 O1B ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 OD2 ? C ASP 89  ? C ASP 165 ? 1_555 177.8 ? 
18 O1A ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 OD2 ? C ASP 89  ? C ASP 165 ? 1_555 95.2  ? 
19 O1B ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 ND1 ? C HIS 183 ? C HIS 259 ? 1_555 94.6  ? 
20 O1A ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 ND1 ? C HIS 183 ? C HIS 259 ? 1_555 91.5  ? 
21 OD2 ? C ASP 89  ? C ASP 165 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 ND1 ? C HIS 183 ? C HIS 259 ? 1_555 87.4  ? 
22 O1B ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 NE2 ? C HIS 181 ? C HIS 257 ? 1_555 91.5  ? 
23 O1A ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 NE2 ? C HIS 181 ? C HIS 257 ? 1_555 170.7 ? 
24 OD2 ? C ASP 89  ? C ASP 165 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 NE2 ? C HIS 181 ? C HIS 257 ? 1_555 89.2  ? 
25 ND1 ? C HIS 183 ? C HIS 259 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 NE2 ? C HIS 181 ? C HIS 257 ? 1_555 96.9  ? 
26 O1B ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 O   ? S HOH .   ? C HOH 501 ? 1_555 85.5  ? 
27 O1A ? L UDP .   ? C UDP 402 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 O   ? S HOH .   ? C HOH 501 ? 1_555 85.5  ? 
28 OD2 ? C ASP 89  ? C ASP 165 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 O   ? S HOH .   ? C HOH 501 ? 1_555 92.5  ? 
29 ND1 ? C HIS 183 ? C HIS 259 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 O   ? S HOH .   ? C HOH 501 ? 1_555 177.0 ? 
30 NE2 ? C HIS 181 ? C HIS 257 ? 1_555 MN ? K MN . ? C MN 401 ? 1_555 O   ? S HOH .   ? C HOH 501 ? 1_555 86.1  ? 
31 O1A ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 O1B ? O UDP .   ? D UDP 402 ? 1_555 80.7  ? 
32 O1A ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 NE2 ? D HIS 181 ? D HIS 257 ? 1_555 171.0 ? 
33 O1B ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 NE2 ? D HIS 181 ? D HIS 257 ? 1_555 93.8  ? 
34 O1A ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 ND1 ? D HIS 183 ? D HIS 259 ? 1_555 89.2  ? 
35 O1B ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 ND1 ? D HIS 183 ? D HIS 259 ? 1_555 92.0  ? 
36 NE2 ? D HIS 181 ? D HIS 257 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 ND1 ? D HIS 183 ? D HIS 259 ? 1_555 98.0  ? 
37 O1A ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 OD2 ? D ASP 89  ? D ASP 165 ? 1_555 92.4  ? 
38 O1B ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 OD2 ? D ASP 89  ? D ASP 165 ? 1_555 173.1 ? 
39 NE2 ? D HIS 181 ? D HIS 257 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 OD2 ? D ASP 89  ? D ASP 165 ? 1_555 93.2  ? 
40 ND1 ? D HIS 183 ? D HIS 259 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 OD2 ? D ASP 89  ? D ASP 165 ? 1_555 87.0  ? 
41 O1A ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 O   ? T HOH .   ? D HOH 501 ? 1_555 90.2  ? 
42 O1B ? O UDP .   ? D UDP 402 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 O   ? T HOH .   ? D HOH 501 ? 1_555 91.0  ? 
43 NE2 ? D HIS 181 ? D HIS 257 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 O   ? T HOH .   ? D HOH 501 ? 1_555 82.8  ? 
44 ND1 ? D HIS 183 ? D HIS 259 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 O   ? T HOH .   ? D HOH 501 ? 1_555 176.8 ? 
45 OD2 ? D ASP 89  ? D ASP 165 ? 1_555 MN ? N MN . ? D MN 401 ? 1_555 O   ? T HOH .   ? D HOH 501 ? 1_555 89.9  ? 
46 O1A ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 O1B ? I UDP .   ? B UDP 402 ? 1_555 76.8  ? 
47 O1A ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 O   ? R HOH .   ? B HOH 501 ? 1_555 82.7  ? 
48 O1B ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 O   ? R HOH .   ? B HOH 501 ? 1_555 91.4  ? 
49 O1A ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 ND1 ? B HIS 183 ? B HIS 259 ? 1_555 89.3  ? 
50 O1B ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 ND1 ? B HIS 183 ? B HIS 259 ? 1_555 87.8  ? 
51 O   ? R HOH .   ? B HOH 501 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 ND1 ? B HIS 183 ? B HIS 259 ? 1_555 171.9 ? 
52 O1A ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 NE2 ? B HIS 181 ? B HIS 257 ? 1_555 170.1 ? 
53 O1B ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 NE2 ? B HIS 181 ? B HIS 257 ? 1_555 99.1  ? 
54 O   ? R HOH .   ? B HOH 501 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 NE2 ? B HIS 181 ? B HIS 257 ? 1_555 88.5  ? 
55 ND1 ? B HIS 183 ? B HIS 259 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 NE2 ? B HIS 181 ? B HIS 257 ? 1_555 99.6  ? 
56 O1A ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 OD2 ? B ASP 89  ? B ASP 165 ? 1_555 90.1  ? 
57 O1B ? I UDP .   ? B UDP 402 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 OD2 ? B ASP 89  ? B ASP 165 ? 1_555 164.9 ? 
58 O   ? R HOH .   ? B HOH 501 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 OD2 ? B ASP 89  ? B ASP 165 ? 1_555 94.2  ? 
59 ND1 ? B HIS 183 ? B HIS 259 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 OD2 ? B ASP 89  ? B ASP 165 ? 1_555 84.7  ? 
60 NE2 ? B HIS 181 ? B HIS 257 ? 1_555 MN ? H MN . ? B MN 401 ? 1_555 OD2 ? B ASP 89  ? B ASP 165 ? 1_555 95.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-09-25 
2 'Structure model' 1 1 2015-02-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                           ? 1 
PHENIX   'model building'  .                           ? 2 
PHENIX   refinement        '(phenix.refine: 1.8_1069)' ? 3 
HKL-2000 'data reduction'  .                           ? 4 
HKL-2000 'data scaling'    .                           ? 5 
PHENIX   phasing           .                           ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O2  D TRS 403 ? ? O   D HOH 544 ? ? 2.08 
2 1 O   D GLY 148 ? ? OG  D SER 152 ? ? 2.17 
3 1 OE1 C GLU 151 ? ? NH2 C ARG 297 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             324 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             324 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.669 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.143 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 102 ? ? -165.54 118.91  
2  1 ASN A 154 ? ? -69.99  6.73    
3  1 ARG A 226 ? ? 73.87   -7.60   
4  1 ALA A 272 ? ? 57.14   -110.24 
5  1 VAL A 281 ? ? -106.70 67.02   
6  1 PHE A 326 ? ? 60.06   86.75   
7  1 ARG B 226 ? ? 70.76   -8.33   
8  1 ALA B 272 ? ? 49.36   -125.04 
9  1 THR B 325 ? ? -102.71 -157.79 
10 1 PHE B 326 ? ? 17.43   79.99   
11 1 ALA C 186 ? ? -80.93  48.21   
12 1 ARG C 226 ? ? 68.75   -9.95   
13 1 ARG C 264 ? ? -104.76 76.36   
14 1 ALA C 272 ? ? 52.31   -124.90 
15 1 GLU C 277 ? ? -69.87  52.01   
16 1 GLN C 278 ? ? -141.14 -36.99  
17 1 PHE C 326 ? ? 85.98   56.36   
18 1 ARG D 102 ? ? -172.17 120.87  
19 1 SER D 153 ? ? -39.77  143.91  
20 1 ASN D 154 ? ? -56.22  -6.90   
21 1 SER D 155 ? ? -91.67  32.34   
22 1 ARG D 226 ? ? 76.36   -13.56  
23 1 ALA D 272 ? ? 52.98   -121.92 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 77 ? A GLY 1  
2  1 Y 1 A SER 78 ? A SER 2  
3  1 Y 1 A ASP 79 ? A ASP 3  
4  1 Y 1 A ILE 80 ? A ILE 4  
5  1 Y 1 A PRO 81 ? A PRO 5  
6  1 Y 1 B GLY 77 ? B GLY 1  
7  1 Y 1 B SER 78 ? B SER 2  
8  1 Y 1 B ASP 79 ? B ASP 3  
9  1 Y 1 B ILE 80 ? B ILE 4  
10 1 Y 1 B PRO 81 ? B PRO 5  
11 1 Y 1 B GLU 82 ? B GLU 6  
12 1 Y 1 B HIS 83 ? B HIS 7  
13 1 Y 1 B TRP 84 ? B TRP 8  
14 1 Y 1 B GLU 85 ? B GLU 9  
15 1 Y 1 B GLU 86 ? B GLU 10 
16 1 Y 1 B ASP 87 ? B ASP 11 
17 1 Y 1 C GLY 77 ? C GLY 1  
18 1 Y 1 C SER 78 ? C SER 2  
19 1 Y 1 D GLY 77 ? D GLY 1  
20 1 Y 1 D SER 78 ? D SER 2  
21 1 Y 1 D ASP 79 ? D ASP 3  
22 1 Y 1 D ILE 80 ? D ILE 4  
23 1 Y 1 D PRO 81 ? D PRO 5  
24 1 Y 1 D GLU 82 ? D GLU 6  
25 1 Y 1 D HIS 83 ? D HIS 7  
26 1 Y 1 D TRP 84 ? D TRP 8  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'                     MN  
3 "URIDINE-5'-DIPHOSPHATE"                 UDP 
4 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 
5 water                                    HOH 
#