data_4IVE
# 
_entry.id   4IVE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IVE         
RCSB  RCSB077257   
WWPDB D_1000077257 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          JCSG-424003 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        4IVE 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-22 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Joint Center for Structural Genomics (JCSG)' 1 
'Partnership for T-Cell Biology (TCELL)'      2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of a polyadenylate-binding protein 3 (PABPC3) from Homo sapiens at 2.30 A resolution' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Joint Center for Structural Genomics (JCSG)' 1 
primary 'Partnership for T-Cell Biology (TCELL)'      2 
# 
_cell.entry_id           4IVE 
_cell.length_a           67.395 
_cell.length_b           67.395 
_cell.length_c           101.380 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IVE 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Polyadenylate-binding protein 3' 10708.643 4   ? ? 'PABC domain residues 535-631' ? 
2 non-polymer syn 'CHLORIDE ION'                    35.453    2   ? ? ?                              ? 
3 water       nat water                             18.015    133 ? ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PABP-3, Poly(A)-binding protein 3, Testis-specific poly(A)-binding protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GQGQETLTASRLASAPPQKQKQ(MSE)LGERLFPLIQA(MSE)HPTLAGKITG(MSE)LLEIDNSELLY(MSE)LESPES
LRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQ
AKEATQKAVNSATGVPTV
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         JCSG-424003 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  GLN n 
1 3  GLY n 
1 4  GLN n 
1 5  GLU n 
1 6  THR n 
1 7  LEU n 
1 8  THR n 
1 9  ALA n 
1 10 SER n 
1 11 ARG n 
1 12 LEU n 
1 13 ALA n 
1 14 SER n 
1 15 ALA n 
1 16 PRO n 
1 17 PRO n 
1 18 GLN n 
1 19 LYS n 
1 20 GLN n 
1 21 LYS n 
1 22 GLN n 
1 23 MSE n 
1 24 LEU n 
1 25 GLY n 
1 26 GLU n 
1 27 ARG n 
1 28 LEU n 
1 29 PHE n 
1 30 PRO n 
1 31 LEU n 
1 32 ILE n 
1 33 GLN n 
1 34 ALA n 
1 35 MSE n 
1 36 HIS n 
1 37 PRO n 
1 38 THR n 
1 39 LEU n 
1 40 ALA n 
1 41 GLY n 
1 42 LYS n 
1 43 ILE n 
1 44 THR n 
1 45 GLY n 
1 46 MSE n 
1 47 LEU n 
1 48 LEU n 
1 49 GLU n 
1 50 ILE n 
1 51 ASP n 
1 52 ASN n 
1 53 SER n 
1 54 GLU n 
1 55 LEU n 
1 56 LEU n 
1 57 TYR n 
1 58 MSE n 
1 59 LEU n 
1 60 GLU n 
1 61 SER n 
1 62 PRO n 
1 63 GLU n 
1 64 SER n 
1 65 LEU n 
1 66 ARG n 
1 67 SER n 
1 68 LYS n 
1 69 VAL n 
1 70 ASP n 
1 71 GLU n 
1 72 ALA n 
1 73 VAL n 
1 74 ALA n 
1 75 VAL n 
1 76 LEU n 
1 77 GLN n 
1 78 ALA n 
1 79 HIS n 
1 80 GLN n 
1 81 ALA n 
1 82 LYS n 
1 83 GLU n 
1 84 ALA n 
1 85 THR n 
1 86 GLN n 
1 87 LYS n 
1 88 ALA n 
1 89 VAL n 
1 90 ASN n 
1 91 SER n 
1 92 ALA n 
1 93 THR n 
1 94 GLY n 
1 95 VAL n 
1 96 PRO n 
1 97 THR n 
1 98 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BC027617, PABP3, PABPC3, PABPL3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia Coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PB1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       SpeedET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PABP3_HUMAN 
_struct_ref.pdbx_db_accession          Q9H361 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQA
KEATQKAVNSATGVPTV
;
_struct_ref.pdbx_align_begin           535 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IVE A 2 ? 98 ? Q9H361 535 ? 631 ? 535 631 
2 1 4IVE B 2 ? 98 ? Q9H361 535 ? 631 ? 535 631 
3 1 4IVE C 2 ? 98 ? Q9H361 535 ? 631 ? 535 631 
4 1 4IVE D 2 ? 98 ? Q9H361 535 ? 631 ? 535 631 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IVE GLY A 1 ? UNP Q9H361 ? ? 'leader sequence' 0 1 
2 4IVE GLY B 1 ? UNP Q9H361 ? ? 'leader sequence' 0 2 
3 4IVE GLY C 1 ? UNP Q9H361 ? ? 'leader sequence' 0 3 
4 4IVE GLY D 1 ? UNP Q9H361 ? ? 'leader sequence' 0 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ? 'Cl -1'          35.453  
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          4IVE 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.62 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'26.00% polyethylene glycol 6000, 0.1M MES pH 5.62, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.details                'KOHZU: Double Crystal Si(111)' 
_diffrn_detector.pdbx_collection_date   2012-10-17 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.979493 1.0 
2 0.918401 1.0 
3 0.979284 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_wavelength_list        0.979493,0.918401,0.979284 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.entry_id                     4IVE 
_reflns.d_resolution_high            2.30 
_reflns.d_resolution_low             43.128 
_reflns.number_obs                   20106 
_reflns.pdbx_Rmerge_I_obs            0.097 
_reflns.pdbx_netI_over_sigmaI        12.030 
_reflns.percent_possible_obs         99.500 
_reflns.B_iso_Wilson_estimate        47.537 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.300 2.380  12727 ? 1919 0.756 2.4  ? ? ? ? ? 97.800  1  1 
2.380 2.480  16104 ? 2117 0.575 3.4  ? ? ? ? ? 100.000 2  1 
2.480 2.590  14903 ? 1960 0.421 4.5  ? ? ? ? ? 100.000 3  1 
2.590 2.730  15557 ? 2043 0.304 6.1  ? ? ? ? ? 100.000 4  1 
2.730 2.900  15261 ? 2001 0.213 8.3  ? ? ? ? ? 100.000 5  1 
2.900 3.120  14880 ? 1962 0.143 11.9 ? ? ? ? ? 100.000 6  1 
3.120 3.430  14875 ? 1996 0.107 15.5 ? ? ? ? ? 100.000 7  1 
3.430 3.930  12657 ? 2004 0.090 19.0 ? ? ? ? ? 98.000  8  1 
3.930 4.930  13918 ? 1987 0.063 23.6 ? ? ? ? ? 99.800  9  1 
4.930 43.128 15126 ? 2103 0.053 25.0 ? ? ? ? ? 99.700  10 1 
# 
_refine.entry_id                                 4IVE 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             43.128 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.5800 
_refine.ls_number_reflns_obs                     20056 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;1. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. 2. CHLORIDE IONS MODELED ARE PRESENT IN CRYSTALLIZATION BUFFER. 3. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 4. THE MAD PHASES WERE USED AS RESTRAINTS DURING REFINEMENT. 5.  NCS RESTRAINTS WERE APPLIED USING BUSTER'S LSSR RESTRAINT REPRESENTATION (-AUTONCS).
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2011 
_refine.ls_R_factor_R_work                       0.2005 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2121 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0700 
_refine.ls_number_reflns_R_free                  1016 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               56.6623 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -5.0464 
_refine.aniso_B[2][2]                            -5.0464 
_refine.aniso_B[3][3]                            10.0927 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9279 
_refine.correlation_coeff_Fo_to_Fc_free          0.9277 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                165.610 
_refine.B_iso_min                                19.820 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.370 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4IVE 
_refine_analyze.Luzzati_coordinate_error_obs    0.357 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2310 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               2445 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        43.128 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_dihedral_angle_d        1208 ?     ? 2.000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           63   ?     ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              354  ?     ? 5.000  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      2422 ?     ? 20.000 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 334  ?     ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?    ?     ? ?      ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      2964 ?     ? 4.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_bond_d                  2422 0.010 ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               3292 1.050 ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           ?    2.180 ? ?      ?            'X-RAY DIFFRACTION' 
t_other_torsion           ?    2.670 ? ?      ?            'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.3000 
_refine_ls_shell.d_res_low                        2.4200 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.percent_reflns_obs               99.5800 
_refine_ls_shell.number_reflns_R_work             2747 
_refine_ls_shell.R_factor_all                     0.2015 
_refine_ls_shell.R_factor_R_work                  0.1995 
_refine_ls_shell.R_factor_R_free                  0.2442 
_refine_ls_shell.percent_reflns_R_free            4.5800 
_refine_ls_shell.number_reflns_R_free             132 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2879 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IVE 
_struct.title                     
'Crystal structure of a polyadenylate-binding protein 3 (PABPC3) from Homo sapiens at 2.30 A resolution' 
_struct.pdbx_descriptor           'Polyadenylate-binding protein 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;PABP unique domain, PF00658 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA-BINDING PROTEIN, RNA BINDING PROTEIN, Partnership for T-Cell Biology, TCELL
;
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.entry_id        4IVE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 8  ? SER A 14 ? THR A 541 SER A 547 1 ? 7  
HELX_P HELX_P2  2  PRO A 16 ? HIS A 36 ? PRO A 549 HIS A 569 1 ? 21 
HELX_P HELX_P3  3  LEU A 39 ? LEU A 48 ? LEU A 572 LEU A 581 1 ? 10 
HELX_P HELX_P4  4  ASP A 51 ? GLU A 60 ? ASP A 584 GLU A 593 1 ? 10 
HELX_P HELX_P5  5  SER A 61 ? GLN A 77 ? SER A 594 GLN A 610 1 ? 17 
HELX_P HELX_P6  6  THR B 8  ? ALA B 15 ? THR B 541 ALA B 548 1 ? 8  
HELX_P HELX_P7  7  PRO B 16 ? GLN B 18 ? PRO B 549 GLN B 551 5 ? 3  
HELX_P HELX_P8  8  LYS B 19 ? HIS B 36 ? LYS B 552 HIS B 569 1 ? 18 
HELX_P HELX_P9  9  LEU B 39 ? LEU B 48 ? LEU B 572 LEU B 581 1 ? 10 
HELX_P HELX_P10 10 ASP B 51 ? SER B 61 ? ASP B 584 SER B 594 1 ? 11 
HELX_P HELX_P11 11 SER B 61 ? GLN B 77 ? SER B 594 GLN B 610 1 ? 17 
HELX_P HELX_P12 12 THR C 8  ? SER C 14 ? THR C 541 SER C 547 1 ? 7  
HELX_P HELX_P13 13 PRO C 16 ? HIS C 36 ? PRO C 549 HIS C 569 1 ? 21 
HELX_P HELX_P14 14 LEU C 39 ? LEU C 48 ? LEU C 572 LEU C 581 1 ? 10 
HELX_P HELX_P15 15 ASP C 51 ? LEU C 59 ? ASP C 584 LEU C 592 1 ? 9  
HELX_P HELX_P16 16 SER C 61 ? GLN C 77 ? SER C 594 GLN C 610 1 ? 17 
HELX_P HELX_P17 17 THR D 8  ? ALA D 15 ? THR D 541 ALA D 548 1 ? 8  
HELX_P HELX_P18 18 PRO D 16 ? GLN D 18 ? PRO D 549 GLN D 551 5 ? 3  
HELX_P HELX_P19 19 LYS D 19 ? ALA D 34 ? LYS D 552 ALA D 567 1 ? 16 
HELX_P HELX_P20 20 LEU D 39 ? LEU D 48 ? LEU D 572 LEU D 581 1 ? 10 
HELX_P HELX_P21 21 ASP D 51 ? SER D 61 ? ASP D 584 SER D 594 1 ? 11 
HELX_P HELX_P22 22 SER D 61 ? GLN D 77 ? SER D 594 GLN D 610 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A GLN 22 C ? ? ? 1_555 A MSE 23 N ? ? A GLN 555 A MSE 556 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale2  covale ? ? A MSE 23 C ? ? ? 1_555 A LEU 24 N ? ? A MSE 556 A LEU 557 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3  covale ? ? A ALA 34 C ? ? ? 1_555 A MSE 35 N ? ? A ALA 567 A MSE 568 1_555 ? ? ? ? ? ? ? 1.364 ? 
covale4  covale ? ? A MSE 35 C ? ? ? 1_555 A HIS 36 N ? ? A MSE 568 A HIS 569 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale5  covale ? ? A GLY 45 C ? ? ? 1_555 A MSE 46 N ? ? A GLY 578 A MSE 579 1_555 ? ? ? ? ? ? ? 1.353 ? 
covale6  covale ? ? A MSE 46 C ? ? ? 1_555 A LEU 47 N ? ? A MSE 579 A LEU 580 1_555 ? ? ? ? ? ? ? 1.346 ? 
covale7  covale ? ? A TYR 57 C ? ? ? 1_555 A MSE 58 N ? ? A TYR 590 A MSE 591 1_555 ? ? ? ? ? ? ? 1.350 ? 
covale8  covale ? ? A MSE 58 C ? ? ? 1_555 A LEU 59 N ? ? A MSE 591 A LEU 592 1_555 ? ? ? ? ? ? ? 1.354 ? 
covale9  covale ? ? B GLN 22 C ? ? ? 1_555 B MSE 23 N ? ? B GLN 555 B MSE 556 1_555 ? ? ? ? ? ? ? 1.348 ? 
covale10 covale ? ? B MSE 23 C ? ? ? 1_555 B LEU 24 N ? ? B MSE 556 B LEU 557 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale11 covale ? ? B ALA 34 C ? ? ? 1_555 B MSE 35 N ? ? B ALA 567 B MSE 568 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale12 covale ? ? B MSE 35 C ? ? ? 1_555 B HIS 36 N ? ? B MSE 568 B HIS 569 1_555 ? ? ? ? ? ? ? 1.353 ? 
covale13 covale ? ? B GLY 45 C ? ? ? 1_555 B MSE 46 N ? ? B GLY 578 B MSE 579 1_555 ? ? ? ? ? ? ? 1.355 ? 
covale14 covale ? ? B MSE 46 C ? ? ? 1_555 B LEU 47 N ? ? B MSE 579 B LEU 580 1_555 ? ? ? ? ? ? ? 1.355 ? 
covale15 covale ? ? B TYR 57 C ? ? ? 1_555 B MSE 58 N ? ? B TYR 590 B MSE 591 1_555 ? ? ? ? ? ? ? 1.345 ? 
covale16 covale ? ? B MSE 58 C ? ? ? 1_555 B LEU 59 N ? ? B MSE 591 B LEU 592 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale17 covale ? ? C GLN 22 C ? ? ? 1_555 C MSE 23 N ? ? C GLN 555 C MSE 556 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale18 covale ? ? C MSE 23 C ? ? ? 1_555 C LEU 24 N ? ? C MSE 556 C LEU 557 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19 covale ? ? C ALA 34 C ? ? ? 1_555 C MSE 35 N ? ? C ALA 567 C MSE 568 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale20 covale ? ? C MSE 35 C ? ? ? 1_555 C HIS 36 N ? ? C MSE 568 C HIS 569 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale21 covale ? ? C GLY 45 C ? ? ? 1_555 C MSE 46 N ? ? C GLY 578 C MSE 579 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale22 covale ? ? C MSE 46 C ? ? ? 1_555 C LEU 47 N ? ? C MSE 579 C LEU 580 1_555 ? ? ? ? ? ? ? 1.362 ? 
covale23 covale ? ? C TYR 57 C ? ? ? 1_555 C MSE 58 N ? ? C TYR 590 C MSE 591 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale24 covale ? ? C MSE 58 C ? ? ? 1_555 C LEU 59 N ? ? C MSE 591 C LEU 592 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale25 covale ? ? D GLN 22 C ? ? ? 1_555 D MSE 23 N ? ? D GLN 555 D MSE 556 1_555 ? ? ? ? ? ? ? 1.348 ? 
covale26 covale ? ? D MSE 23 C ? ? ? 1_555 D LEU 24 N ? ? D MSE 556 D LEU 557 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale27 covale ? ? D ALA 34 C ? ? ? 1_555 D MSE 35 N ? ? D ALA 567 D MSE 568 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale28 covale ? ? D MSE 35 C ? ? ? 1_555 D HIS 36 N ? ? D MSE 568 D HIS 569 1_555 ? ? ? ? ? ? ? 1.351 ? 
covale29 covale ? ? D GLY 45 C ? ? ? 1_555 D MSE 46 N ? ? D GLY 578 D MSE 579 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale30 covale ? ? D MSE 46 C ? ? ? 1_555 D LEU 47 N ? ? D MSE 579 D LEU 580 1_555 ? ? ? ? ? ? ? 1.358 ? 
covale31 covale ? ? D TYR 57 C ? ? ? 1_555 D MSE 58 N ? ? D TYR 590 D MSE 591 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale32 covale ? ? D MSE 58 C ? ? ? 1_555 D LEU 59 N ? ? D MSE 591 D LEU 592 1_555 ? ? ? ? ? ? ? 1.352 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 701' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL C 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 HIS A 36 ? HIS A 569 . ? 1_555 ? 
2 AC1 2 THR A 38 ? THR A 571 . ? 1_555 ? 
3 AC2 3 HIS C 36 ? HIS C 569 . ? 1_555 ? 
4 AC2 3 PRO C 37 ? PRO C 570 . ? 1_555 ? 
5 AC2 3 THR C 38 ? THR C 571 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4IVE 
_atom_sites.fract_transf_matrix[1][1]   0.014838 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014838 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009864 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 4  ? 48.186 -3.241  34.250 1.00 83.82  ? 537 GLN A N   1 
ATOM   2    C  CA  . GLN A 1 4  ? 46.740 -3.482  34.320 1.00 80.66  ? 537 GLN A CA  1 
ATOM   3    C  C   . GLN A 1 4  ? 46.138 -3.691  32.915 1.00 79.76  ? 537 GLN A C   1 
ATOM   4    O  O   . GLN A 1 4  ? 46.386 -2.906  31.988 1.00 78.54  ? 537 GLN A O   1 
ATOM   5    C  CB  . GLN A 1 4  ? 46.014 -2.345  35.056 1.00 79.41  ? 537 GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 4  ? 44.620 -2.740  35.544 1.00 97.44  ? 537 GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 4  ? 44.066 -1.783  36.566 1.00 118.48 ? 537 GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 4  ? 43.893 -0.582  36.312 1.00 113.03 ? 537 GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 4  ? 43.739 -2.308  37.737 1.00 112.32 ? 537 GLN A NE2 1 
ATOM   10   N  N   . GLU A 1 5  ? 45.336 -4.765  32.792 1.00 72.84  ? 538 GLU A N   1 
ATOM   11   C  CA  . GLU A 1 5  ? 44.688 -5.216  31.565 1.00 70.22  ? 538 GLU A CA  1 
ATOM   12   C  C   . GLU A 1 5  ? 43.610 -4.268  31.060 1.00 65.39  ? 538 GLU A C   1 
ATOM   13   O  O   . GLU A 1 5  ? 42.860 -3.681  31.847 1.00 62.87  ? 538 GLU A O   1 
ATOM   14   C  CB  . GLU A 1 5  ? 44.049 -6.597  31.783 1.00 73.97  ? 538 GLU A CB  1 
ATOM   15   C  CG  . GLU A 1 5  ? 45.048 -7.705  32.078 1.00 91.61  ? 538 GLU A CG  1 
ATOM   16   C  CD  . GLU A 1 5  ? 44.631 -9.117  31.708 1.00 127.14 ? 538 GLU A CD  1 
ATOM   17   O  OE1 . GLU A 1 5  ? 43.435 -9.338  31.404 1.00 127.47 ? 538 GLU A OE1 1 
ATOM   18   O  OE2 . GLU A 1 5  ? 45.511 -10.007 31.723 1.00 130.02 ? 538 GLU A OE2 1 
ATOM   19   N  N   . THR A 1 6  ? 43.506 -4.181  29.719 1.00 57.45  ? 539 THR A N   1 
ATOM   20   C  CA  . THR A 1 6  ? 42.463 -3.438  29.007 1.00 52.85  ? 539 THR A CA  1 
ATOM   21   C  C   . THR A 1 6  ? 41.168 -4.269  29.110 1.00 52.06  ? 539 THR A C   1 
ATOM   22   O  O   . THR A 1 6  ? 41.153 -5.440  28.696 1.00 53.70  ? 539 THR A O   1 
ATOM   23   C  CB  . THR A 1 6  ? 42.889 -3.180  27.535 1.00 57.32  ? 539 THR A CB  1 
ATOM   24   O  OG1 . THR A 1 6  ? 44.173 -2.563  27.504 1.00 59.61  ? 539 THR A OG1 1 
ATOM   25   C  CG2 . THR A 1 6  ? 41.863 -2.345  26.742 1.00 48.76  ? 539 THR A CG2 1 
ATOM   26   N  N   . LEU A 1 7  ? 40.115 -3.687  29.705 1.00 43.62  ? 540 LEU A N   1 
ATOM   27   C  CA  . LEU A 1 7  ? 38.819 -4.346  29.809 1.00 44.07  ? 540 LEU A CA  1 
ATOM   28   C  C   . LEU A 1 7  ? 38.135 -4.286  28.461 1.00 48.19  ? 540 LEU A C   1 
ATOM   29   O  O   . LEU A 1 7  ? 38.251 -3.267  27.775 1.00 46.91  ? 540 LEU A O   1 
ATOM   30   C  CB  . LEU A 1 7  ? 37.930 -3.668  30.871 1.00 42.93  ? 540 LEU A CB  1 
ATOM   31   C  CG  . LEU A 1 7  ? 38.215 -3.906  32.356 1.00 47.86  ? 540 LEU A CG  1 
ATOM   32   C  CD1 . LEU A 1 7  ? 37.202 -3.164  33.217 1.00 44.76  ? 540 LEU A CD1 1 
ATOM   33   C  CD2 . LEU A 1 7  ? 38.195 -5.418  32.691 1.00 54.73  ? 540 LEU A CD2 1 
ATOM   34   N  N   . THR A 1 8  ? 37.475 -5.376  28.041 1.00 46.35  ? 541 THR A N   1 
ATOM   35   C  CA  . THR A 1 8  ? 36.753 -5.363  26.766 1.00 47.05  ? 541 THR A CA  1 
ATOM   36   C  C   . THR A 1 8  ? 35.309 -5.786  26.966 1.00 51.77  ? 541 THR A C   1 
ATOM   37   O  O   . THR A 1 8  ? 34.969 -6.455  27.949 1.00 51.23  ? 541 THR A O   1 
ATOM   38   C  CB  . THR A 1 8  ? 37.417 -6.206  25.686 1.00 53.69  ? 541 THR A CB  1 
ATOM   39   O  OG1 . THR A 1 8  ? 37.467 -7.565  26.101 1.00 56.99  ? 541 THR A OG1 1 
ATOM   40   C  CG2 . THR A 1 8  ? 38.776 -5.683  25.279 1.00 49.30  ? 541 THR A CG2 1 
ATOM   41   N  N   . ALA A 1 9  ? 34.461 -5.386  26.020 1.00 49.62  ? 542 ALA A N   1 
ATOM   42   C  CA  . ALA A 1 9  ? 33.044 -5.706  26.013 1.00 51.91  ? 542 ALA A CA  1 
ATOM   43   C  C   . ALA A 1 9  ? 32.820 -7.240  26.107 1.00 60.36  ? 542 ALA A C   1 
ATOM   44   O  O   . ALA A 1 9  ? 31.983 -7.666  26.903 1.00 62.21  ? 542 ALA A O   1 
ATOM   45   C  CB  . ALA A 1 9  ? 32.396 -5.136  24.754 1.00 53.75  ? 542 ALA A CB  1 
ATOM   46   N  N   . SER A 1 10 ? 33.610 -8.054  25.370 1.00 58.52  ? 543 SER A N   1 
ATOM   47   C  CA  . SER A 1 10 ? 33.495 -9.520  25.372 1.00 63.42  ? 543 SER A CA  1 
ATOM   48   C  C   . SER A 1 10 ? 33.889 -10.131 26.727 1.00 68.85  ? 543 SER A C   1 
ATOM   49   O  O   . SER A 1 10 ? 33.227 -11.072 27.188 1.00 72.58  ? 543 SER A O   1 
ATOM   50   C  CB  . SER A 1 10 ? 34.336 -10.133 24.254 1.00 69.82  ? 543 SER A CB  1 
ATOM   51   O  OG  . SER A 1 10 ? 35.718 -9.834  24.390 1.00 78.02  ? 543 SER A OG  1 
ATOM   52   N  N   . ARG A 1 11 ? 34.965 -9.599  27.347 1.00 62.61  ? 544 ARG A N   1 
ATOM   53   C  CA  . ARG A 1 11 ? 35.449 -10.029 28.660 1.00 63.18  ? 544 ARG A CA  1 
ATOM   54   C  C   . ARG A 1 11 ? 34.448 -9.667  29.765 1.00 66.26  ? 544 ARG A C   1 
ATOM   55   O  O   . ARG A 1 11 ? 34.335 -10.403 30.744 1.00 69.71  ? 544 ARG A O   1 
ATOM   56   C  CB  . ARG A 1 11 ? 36.817 -9.418  28.976 1.00 62.88  ? 544 ARG A CB  1 
ATOM   57   C  CG  . ARG A 1 11 ? 37.982 -10.159 28.318 1.00 80.34  ? 544 ARG A CG  1 
ATOM   58   C  CD  . ARG A 1 11 ? 39.098 -10.489 29.302 1.00 97.61  ? 544 ARG A CD  1 
ATOM   59   N  NE  . ARG A 1 11 ? 39.839 -9.306  29.758 1.00 108.85 ? 544 ARG A NE  1 
ATOM   60   C  CZ  . ARG A 1 11 ? 39.808 -8.829  31.001 1.00 125.37 ? 544 ARG A CZ  1 
ATOM   61   N  NH1 . ARG A 1 11 ? 39.064 -9.420  31.931 1.00 115.38 ? 544 ARG A NH1 1 
ATOM   62   N  NH2 . ARG A 1 11 ? 40.524 -7.760  31.325 1.00 110.17 ? 544 ARG A NH2 1 
ATOM   63   N  N   . LEU A 1 12 ? 33.723 -8.546  29.612 1.00 57.74  ? 545 LEU A N   1 
ATOM   64   C  CA  . LEU A 1 12 ? 32.727 -8.128  30.593 1.00 55.71  ? 545 LEU A CA  1 
ATOM   65   C  C   . LEU A 1 12 ? 31.451 -8.937  30.434 1.00 66.09  ? 545 LEU A C   1 
ATOM   66   O  O   . LEU A 1 12 ? 30.887 -9.373  31.436 1.00 67.20  ? 545 LEU A O   1 
ATOM   67   C  CB  . LEU A 1 12 ? 32.420 -6.632  30.484 1.00 51.28  ? 545 LEU A CB  1 
ATOM   68   C  CG  . LEU A 1 12 ? 33.483 -5.687  31.009 1.00 50.55  ? 545 LEU A CG  1 
ATOM   69   C  CD1 . LEU A 1 12 ? 33.166 -4.264  30.620 1.00 47.48  ? 545 LEU A CD1 1 
ATOM   70   C  CD2 . LEU A 1 12 ? 33.645 -5.805  32.503 1.00 49.87  ? 545 LEU A CD2 1 
ATOM   71   N  N   . ALA A 1 13 ? 31.030 -9.192  29.174 1.00 65.92  ? 546 ALA A N   1 
ATOM   72   C  CA  . ALA A 1 13 ? 29.827 -9.963  28.846 1.00 70.44  ? 546 ALA A CA  1 
ATOM   73   C  C   . ALA A 1 13 ? 29.842 -11.368 29.465 1.00 78.92  ? 546 ALA A C   1 
ATOM   74   O  O   . ALA A 1 13 ? 28.770 -11.907 29.745 1.00 81.52  ? 546 ALA A O   1 
ATOM   75   C  CB  . ALA A 1 13 ? 29.662 -10.065 27.343 1.00 73.34  ? 546 ALA A CB  1 
ATOM   76   N  N   . SER A 1 14 ? 31.044 -11.935 29.711 1.00 76.27  ? 547 SER A N   1 
ATOM   77   C  CA  . SER A 1 14 ? 31.227 -13.265 30.311 1.00 80.92  ? 547 SER A CA  1 
ATOM   78   C  C   . SER A 1 14 ? 30.914 -13.292 31.838 1.00 83.75  ? 547 SER A C   1 
ATOM   79   O  O   . SER A 1 14 ? 30.615 -14.355 32.393 1.00 88.00  ? 547 SER A O   1 
ATOM   80   C  CB  . SER A 1 14 ? 32.651 -13.761 30.060 1.00 86.42  ? 547 SER A CB  1 
ATOM   81   O  OG  . SER A 1 14 ? 33.613 -12.983 30.755 1.00 92.94  ? 547 SER A OG  1 
ATOM   82   N  N   . ALA A 1 15 ? 30.984 -12.128 32.500 1.00 74.27  ? 548 ALA A N   1 
ATOM   83   C  CA  . ALA A 1 15 ? 30.734 -12.000 33.933 1.00 72.36  ? 548 ALA A CA  1 
ATOM   84   C  C   . ALA A 1 15 ? 29.289 -11.566 34.233 1.00 74.52  ? 548 ALA A C   1 
ATOM   85   O  O   . ALA A 1 15 ? 28.672 -10.933 33.375 1.00 72.50  ? 548 ALA A O   1 
ATOM   86   C  CB  . ALA A 1 15 ? 31.705 -10.994 34.523 1.00 68.17  ? 548 ALA A CB  1 
ATOM   87   N  N   . PRO A 1 16 ? 28.735 -11.860 35.447 1.00 71.69  ? 549 PRO A N   1 
ATOM   88   C  CA  . PRO A 1 16 ? 27.368 -11.394 35.775 1.00 71.46  ? 549 PRO A CA  1 
ATOM   89   C  C   . PRO A 1 16 ? 27.234 -9.860  35.712 1.00 69.91  ? 549 PRO A C   1 
ATOM   90   O  O   . PRO A 1 16 ? 28.212 -9.152  35.962 1.00 65.07  ? 549 PRO A O   1 
ATOM   91   C  CB  . PRO A 1 16 ? 27.151 -11.905 37.204 1.00 75.32  ? 549 PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 16 ? 28.104 -13.030 37.353 1.00 82.58  ? 549 PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 16 ? 29.315 -12.612 36.577 1.00 74.84  ? 549 PRO A CD  1 
ATOM   94   N  N   . PRO A 1 17 ? 26.039 -9.330  35.359 1.00 67.23  ? 550 PRO A N   1 
ATOM   95   C  CA  . PRO A 1 17 ? 25.885 -7.870  35.185 1.00 62.83  ? 550 PRO A CA  1 
ATOM   96   C  C   . PRO A 1 17 ? 26.410 -6.993  36.329 1.00 62.77  ? 550 PRO A C   1 
ATOM   97   O  O   . PRO A 1 17 ? 27.093 -6.007  36.046 1.00 58.39  ? 550 PRO A O   1 
ATOM   98   C  CB  . PRO A 1 17 ? 24.373 -7.694  35.023 1.00 67.35  ? 550 PRO A CB  1 
ATOM   99   C  CG  . PRO A 1 17 ? 23.917 -8.963  34.435 1.00 76.87  ? 550 PRO A CG  1 
ATOM   100  C  CD  . PRO A 1 17 ? 24.791 -10.042 35.008 1.00 73.57  ? 550 PRO A CD  1 
ATOM   101  N  N   . GLN A 1 18 ? 26.102 -7.340  37.600 1.00 61.06  ? 551 GLN A N   1 
ATOM   102  C  CA  . GLN A 1 18 ? 26.554 -6.579  38.775 1.00 57.60  ? 551 GLN A CA  1 
ATOM   103  C  C   . GLN A 1 18 ? 28.068 -6.658  38.932 1.00 57.27  ? 551 GLN A C   1 
ATOM   104  O  O   . GLN A 1 18 ? 28.673 -5.697  39.418 1.00 52.54  ? 551 GLN A O   1 
ATOM   105  C  CB  . GLN A 1 18 ? 25.867 -7.042  40.071 1.00 61.62  ? 551 GLN A CB  1 
ATOM   106  C  CG  . GLN A 1 18 ? 24.889 -6.010  40.667 1.00 87.65  ? 551 GLN A CG  1 
ATOM   107  C  CD  . GLN A 1 18 ? 25.421 -4.599  40.873 1.00 109.14 ? 551 GLN A CD  1 
ATOM   108  O  OE1 . GLN A 1 18 ? 24.792 -3.617  40.449 1.00 104.04 ? 551 GLN A OE1 1 
ATOM   109  N  NE2 . GLN A 1 18 ? 26.565 -4.455  41.548 1.00 100.43 ? 551 GLN A NE2 1 
ATOM   110  N  N   . LYS A 1 19 ? 28.673 -7.790  38.498 1.00 55.56  ? 552 LYS A N   1 
ATOM   111  C  CA  . LYS A 1 19 ? 30.117 -7.976  38.528 1.00 54.45  ? 552 LYS A CA  1 
ATOM   112  C  C   . LYS A 1 19 ? 30.770 -7.066  37.475 1.00 52.57  ? 552 LYS A C   1 
ATOM   113  O  O   . LYS A 1 19 ? 31.830 -6.510  37.757 1.00 49.03  ? 552 LYS A O   1 
ATOM   114  C  CB  . LYS A 1 19 ? 30.510 -9.457  38.333 1.00 62.08  ? 552 LYS A CB  1 
ATOM   115  C  CG  . LYS A 1 19 ? 31.987 -9.768  38.628 1.00 82.38  ? 552 LYS A CG  1 
ATOM   116  C  CD  . LYS A 1 19 ? 32.339 -9.695  40.126 1.00 96.30  ? 552 LYS A CD  1 
ATOM   117  C  CE  . LYS A 1 19 ? 33.789 -9.336  40.359 1.00 105.59 ? 552 LYS A CE  1 
ATOM   118  N  NZ  . LYS A 1 19 ? 34.050 -7.884  40.155 1.00 106.56 ? 552 LYS A NZ  1 
ATOM   119  N  N   . GLN A 1 20 ? 30.114 -6.874  36.298 1.00 48.54  ? 553 GLN A N   1 
ATOM   120  C  CA  . GLN A 1 20 ? 30.582 -5.976  35.217 1.00 44.78  ? 553 GLN A CA  1 
ATOM   121  C  C   . GLN A 1 20 ? 30.725 -4.548  35.764 1.00 45.37  ? 553 GLN A C   1 
ATOM   122  O  O   . GLN A 1 20 ? 31.795 -3.939  35.637 1.00 42.77  ? 553 GLN A O   1 
ATOM   123  C  CB  . GLN A 1 20 ? 29.616 -5.990  34.016 1.00 46.79  ? 553 GLN A CB  1 
ATOM   124  C  CG  . GLN A 1 20 ? 29.610 -7.295  33.232 1.00 60.29  ? 553 GLN A CG  1 
ATOM   125  C  CD  . GLN A 1 20 ? 28.457 -7.430  32.250 1.00 69.31  ? 553 GLN A CD  1 
ATOM   126  O  OE1 . GLN A 1 20 ? 28.076 -6.501  31.528 1.00 60.04  ? 553 GLN A OE1 1 
ATOM   127  N  NE2 . GLN A 1 20 ? 27.888 -8.615  32.178 1.00 59.66  ? 553 GLN A NE2 1 
ATOM   128  N  N   . LYS A 1 21 ? 29.646 -4.052  36.428 1.00 42.37  ? 554 LYS A N   1 
ATOM   129  C  CA  . LYS A 1 21 ? 29.552 -2.731  37.067 1.00 39.53  ? 554 LYS A CA  1 
ATOM   130  C  C   . LYS A 1 21 ? 30.621 -2.574  38.138 1.00 40.42  ? 554 LYS A C   1 
ATOM   131  O  O   . LYS A 1 21 ? 31.204 -1.502  38.230 1.00 38.67  ? 554 LYS A O   1 
ATOM   132  C  CB  . LYS A 1 21 ? 28.169 -2.508  37.673 1.00 43.01  ? 554 LYS A CB  1 
ATOM   133  C  CG  . LYS A 1 21 ? 27.094 -2.091  36.681 1.00 65.62  ? 554 LYS A CG  1 
ATOM   134  C  CD  . LYS A 1 21 ? 25.812 -1.744  37.464 1.00 83.53  ? 554 LYS A CD  1 
ATOM   135  C  CE  . LYS A 1 21 ? 24.759 -1.006  36.672 1.00 97.35  ? 554 LYS A CE  1 
ATOM   136  N  NZ  . LYS A 1 21 ? 23.730 -0.410  37.564 1.00 105.23 ? 554 LYS A NZ  1 
ATOM   137  N  N   . GLN A 1 22 ? 30.894 -3.639  38.922 1.00 37.42  ? 555 GLN A N   1 
ATOM   138  C  CA  A GLN A 1 22 ? 31.924 -3.616  39.956 0.50 36.64  ? 555 GLN A CA  1 
ATOM   139  C  CA  B GLN A 1 22 ? 31.927 -3.575  39.950 0.50 36.92  ? 555 GLN A CA  1 
ATOM   140  C  C   . GLN A 1 22 ? 33.317 -3.414  39.323 1.00 39.70  ? 555 GLN A C   1 
ATOM   141  O  O   . GLN A 1 22 ? 34.109 -2.614  39.821 1.00 36.30  ? 555 GLN A O   1 
ATOM   142  C  CB  A GLN A 1 22 ? 31.875 -4.908  40.794 0.50 40.84  ? 555 GLN A CB  1 
ATOM   143  C  CB  B GLN A 1 22 ? 31.895 -4.794  40.880 0.50 41.37  ? 555 GLN A CB  1 
ATOM   144  C  CG  A GLN A 1 22 ? 30.779 -4.903  41.867 0.50 42.30  ? 555 GLN A CG  1 
ATOM   145  C  CG  B GLN A 1 22 ? 32.301 -4.419  42.300 0.50 53.69  ? 555 GLN A CG  1 
ATOM   146  C  CD  A GLN A 1 22 ? 30.328 -6.272  42.337 0.50 54.13  ? 555 GLN A CD  1 
ATOM   147  C  CD  B GLN A 1 22 ? 33.057 -5.488  43.040 0.50 68.89  ? 555 GLN A CD  1 
ATOM   148  O  OE1 A GLN A 1 22 ? 29.134 -6.510  42.547 0.50 45.66  ? 555 GLN A OE1 1 
ATOM   149  O  OE1 B GLN A 1 22 ? 32.601 -6.629  43.183 0.50 68.07  ? 555 GLN A OE1 1 
ATOM   150  N  NE2 A GLN A 1 22 ? 31.261 -7.193  42.557 0.50 49.78  ? 555 GLN A NE2 1 
ATOM   151  N  NE2 B GLN A 1 22 ? 34.174 -5.097  43.636 0.50 56.62  ? 555 GLN A NE2 1 
HETATM 152  N  N   . MSE A 1 23 ? 33.599 -4.126  38.210 1.00 39.07  ? 556 MSE A N   1 
HETATM 153  C  CA  . MSE A 1 23 ? 34.879 -4.061  37.494 1.00 38.77  ? 556 MSE A CA  1 
HETATM 154  C  C   . MSE A 1 23 ? 35.099 -2.693  36.863 1.00 39.31  ? 556 MSE A C   1 
HETATM 155  O  O   . MSE A 1 23 ? 36.183 -2.122  36.990 1.00 38.79  ? 556 MSE A O   1 
HETATM 156  C  CB  . MSE A 1 23 ? 34.955 -5.165  36.455 1.00 43.75  ? 556 MSE A CB  1 
HETATM 157  C  CG  . MSE A 1 23 ? 35.097 -6.536  37.094 1.00 56.06  ? 556 MSE A CG  1 
HETATM 158  SE SE  . MSE A 1 23 ? 35.250 -8.009  35.837 0.75 70.59  ? 556 MSE A SE  1 
HETATM 159  C  CE  . MSE A 1 23 ? 33.451 -8.167  35.284 1.00 68.46  ? 556 MSE A CE  1 
ATOM   160  N  N   . LEU A 1 24 ? 34.057 -2.142  36.248 1.00 34.36  ? 557 LEU A N   1 
ATOM   161  C  CA  . LEU A 1 24 ? 34.118 -0.813  35.658 1.00 32.25  ? 557 LEU A CA  1 
ATOM   162  C  C   . LEU A 1 24 ? 34.217 0.256   36.756 1.00 36.26  ? 557 LEU A C   1 
ATOM   163  O  O   . LEU A 1 24 ? 34.998 1.191   36.622 1.00 36.20  ? 557 LEU A O   1 
ATOM   164  C  CB  . LEU A 1 24 ? 32.919 -0.569  34.736 1.00 32.79  ? 557 LEU A CB  1 
ATOM   165  C  CG  . LEU A 1 24 ? 32.957 -1.318  33.374 1.00 39.33  ? 557 LEU A CG  1 
ATOM   166  C  CD1 . LEU A 1 24 ? 31.580 -1.409  32.771 1.00 40.62  ? 557 LEU A CD1 1 
ATOM   167  C  CD2 . LEU A 1 24 ? 33.927 -0.651  32.368 1.00 38.36  ? 557 LEU A CD2 1 
ATOM   168  N  N   . GLY A 1 25 ? 33.475 0.070   37.847 1.00 33.70  ? 558 GLY A N   1 
ATOM   169  C  CA  . GLY A 1 25 ? 33.473 0.951   39.005 1.00 31.89  ? 558 GLY A CA  1 
ATOM   170  C  C   . GLY A 1 25 ? 34.841 1.075   39.647 1.00 37.30  ? 558 GLY A C   1 
ATOM   171  O  O   . GLY A 1 25 ? 35.238 2.180   40.008 1.00 37.26  ? 558 GLY A O   1 
ATOM   172  N  N   . GLU A 1 26 ? 35.586 -0.042  39.771 1.00 35.06  ? 559 GLU A N   1 
ATOM   173  C  CA  . GLU A 1 26 ? 36.941 -0.077  40.345 1.00 37.62  ? 559 GLU A CA  1 
ATOM   174  C  C   . GLU A 1 26 ? 37.919 0.790   39.537 1.00 39.25  ? 559 GLU A C   1 
ATOM   175  O  O   . GLU A 1 26 ? 38.846 1.342   40.114 1.00 39.19  ? 559 GLU A O   1 
ATOM   176  C  CB  . GLU A 1 26 ? 37.513 -1.525  40.434 1.00 42.39  ? 559 GLU A CB  1 
ATOM   177  C  CG  . GLU A 1 26 ? 36.893 -2.451  41.477 1.00 65.79  ? 559 GLU A CG  1 
ATOM   178  C  CD  . GLU A 1 26 ? 37.049 -2.230  42.979 1.00 109.63 ? 559 GLU A CD  1 
ATOM   179  O  OE1 . GLU A 1 26 ? 37.842 -1.352  43.393 1.00 114.32 ? 559 GLU A OE1 1 
ATOM   180  O  OE2 . GLU A 1 26 ? 36.371 -2.956  43.746 1.00 109.65 ? 559 GLU A OE2 1 
ATOM   181  N  N   . ARG A 1 27 ? 37.738 0.864   38.212 1.00 33.46  ? 560 ARG A N   1 
ATOM   182  C  CA  . ARG A 1 27 ? 38.583 1.673   37.355 1.00 32.46  ? 560 ARG A CA  1 
ATOM   183  C  C   . ARG A 1 27 ? 38.123 3.149   37.340 1.00 35.35  ? 560 ARG A C   1 
ATOM   184  O  O   . ARG A 1 27 ? 38.960 4.060   37.329 1.00 35.13  ? 560 ARG A O   1 
ATOM   185  C  CB  . ARG A 1 27 ? 38.580 1.123   35.918 1.00 33.35  ? 560 ARG A CB  1 
ATOM   186  C  CG  . ARG A 1 27 ? 38.835 -0.366  35.738 1.00 45.21  ? 560 ARG A CG  1 
ATOM   187  C  CD  . ARG A 1 27 ? 40.277 -0.706  35.871 1.00 56.41  ? 560 ARG A CD  1 
ATOM   188  N  NE  . ARG A 1 27 ? 40.513 -2.107  35.534 1.00 69.56  ? 560 ARG A NE  1 
ATOM   189  C  CZ  . ARG A 1 27 ? 41.006 -2.539  34.378 1.00 76.59  ? 560 ARG A CZ  1 
ATOM   190  N  NH1 . ARG A 1 27 ? 41.309 -1.677  33.412 1.00 54.78  ? 560 ARG A NH1 1 
ATOM   191  N  NH2 . ARG A 1 27 ? 41.209 -3.834  34.181 1.00 67.07  ? 560 ARG A NH2 1 
ATOM   192  N  N   . LEU A 1 28 ? 36.801 3.374   37.311 1.00 31.51  ? 561 LEU A N   1 
ATOM   193  C  CA  . LEU A 1 28 ? 36.205 4.706   37.232 1.00 31.47  ? 561 LEU A CA  1 
ATOM   194  C  C   . LEU A 1 28 ? 36.361 5.530   38.494 1.00 35.10  ? 561 LEU A C   1 
ATOM   195  O  O   . LEU A 1 28 ? 36.736 6.709   38.408 1.00 33.61  ? 561 LEU A O   1 
ATOM   196  C  CB  . LEU A 1 28 ? 34.718 4.611   36.913 1.00 31.70  ? 561 LEU A CB  1 
ATOM   197  C  CG  . LEU A 1 28 ? 34.391 4.343   35.463 1.00 38.58  ? 561 LEU A CG  1 
ATOM   198  C  CD1 . LEU A 1 28 ? 32.945 3.888   35.327 1.00 40.10  ? 561 LEU A CD1 1 
ATOM   199  C  CD2 . LEU A 1 28 ? 34.683 5.559   34.582 1.00 40.52  ? 561 LEU A CD2 1 
ATOM   200  N  N   . PHE A 1 29 ? 36.067 4.920   39.657 1.00 31.20  ? 562 PHE A N   1 
ATOM   201  C  CA  . PHE A 1 29 ? 36.069 5.599   40.951 1.00 30.48  ? 562 PHE A CA  1 
ATOM   202  C  C   . PHE A 1 29 ? 37.362 6.376   41.248 1.00 35.38  ? 562 PHE A C   1 
ATOM   203  O  O   . PHE A 1 29 ? 37.225 7.540   41.615 1.00 35.86  ? 562 PHE A O   1 
ATOM   204  C  CB  . PHE A 1 29 ? 35.754 4.659   42.129 1.00 31.77  ? 562 PHE A CB  1 
ATOM   205  C  CG  . PHE A 1 29 ? 35.647 5.430   43.426 1.00 33.13  ? 562 PHE A CG  1 
ATOM   206  C  CD1 . PHE A 1 29 ? 34.481 6.129   43.748 1.00 35.39  ? 562 PHE A CD1 1 
ATOM   207  C  CD2 . PHE A 1 29 ? 36.733 5.517   44.293 1.00 34.95  ? 562 PHE A CD2 1 
ATOM   208  C  CE1 . PHE A 1 29 ? 34.401 6.883   44.922 1.00 36.77  ? 562 PHE A CE1 1 
ATOM   209  C  CE2 . PHE A 1 29 ? 36.660 6.288   45.453 1.00 38.32  ? 562 PHE A CE2 1 
ATOM   210  C  CZ  . PHE A 1 29 ? 35.493 6.963   45.764 1.00 36.68  ? 562 PHE A CZ  1 
ATOM   211  N  N   . PRO A 1 30 ? 38.593 5.811   41.180 1.00 32.21  ? 563 PRO A N   1 
ATOM   212  C  CA  . PRO A 1 30 ? 39.776 6.631   41.502 1.00 33.13  ? 563 PRO A CA  1 
ATOM   213  C  C   . PRO A 1 30 ? 39.925 7.870   40.616 1.00 36.28  ? 563 PRO A C   1 
ATOM   214  O  O   . PRO A 1 30 ? 40.349 8.909   41.109 1.00 38.09  ? 563 PRO A O   1 
ATOM   215  C  CB  . PRO A 1 30 ? 40.958 5.677   41.286 1.00 35.41  ? 563 PRO A CB  1 
ATOM   216  C  CG  . PRO A 1 30 ? 40.386 4.335   41.199 1.00 39.50  ? 563 PRO A CG  1 
ATOM   217  C  CD  . PRO A 1 30 ? 38.986 4.455   40.738 1.00 33.26  ? 563 PRO A CD  1 
ATOM   218  N  N   . LEU A 1 31 ? 39.556 7.765   39.336 1.00 32.14  ? 564 LEU A N   1 
ATOM   219  C  CA  . LEU A 1 31 ? 39.653 8.864   38.370 1.00 31.92  ? 564 LEU A CA  1 
ATOM   220  C  C   . LEU A 1 31 ? 38.618 9.937   38.687 1.00 34.76  ? 564 LEU A C   1 
ATOM   221  O  O   . LEU A 1 31 ? 38.952 11.122  38.692 1.00 35.90  ? 564 LEU A O   1 
ATOM   222  C  CB  . LEU A 1 31 ? 39.492 8.367   36.907 1.00 30.54  ? 564 LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 31 ? 40.509 7.355   36.399 1.00 33.48  ? 564 LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 31 ? 40.101 6.799   35.040 1.00 31.87  ? 564 LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 31 ? 41.908 7.945   36.357 1.00 35.13  ? 564 LEU A CD2 1 
ATOM   226  N  N   . ILE A 1 32 ? 37.378 9.523   38.998 1.00 30.40  ? 565 ILE A N   1 
ATOM   227  C  CA  . ILE A 1 32 ? 36.290 10.455  39.330 1.00 30.37  ? 565 ILE A CA  1 
ATOM   228  C  C   . ILE A 1 32 ? 36.598 11.150  40.669 1.00 34.02  ? 565 ILE A C   1 
ATOM   229  O  O   . ILE A 1 32 ? 36.404 12.362  40.787 1.00 34.22  ? 565 ILE A O   1 
ATOM   230  C  CB  . ILE A 1 32 ? 34.911 9.742   39.318 1.00 31.70  ? 565 ILE A CB  1 
ATOM   231  C  CG1 . ILE A 1 32 ? 34.565 9.297   37.865 1.00 32.04  ? 565 ILE A CG1 1 
ATOM   232  C  CG2 . ILE A 1 32 ? 33.812 10.656  39.888 1.00 30.37  ? 565 ILE A CG2 1 
ATOM   233  C  CD1 . ILE A 1 32 ? 33.309 8.358   37.750 1.00 33.03  ? 565 ILE A CD1 1 
ATOM   234  N  N   . GLN A 1 33 ? 37.133 10.398  41.645 1.00 29.61  ? 566 GLN A N   1 
ATOM   235  C  CA  . GLN A 1 33 ? 37.505 10.945  42.936 1.00 30.30  ? 566 GLN A CA  1 
ATOM   236  C  C   . GLN A 1 33 ? 38.626 12.004  42.782 1.00 38.58  ? 566 GLN A C   1 
ATOM   237  O  O   . GLN A 1 33 ? 38.624 13.004  43.499 1.00 42.17  ? 566 GLN A O   1 
ATOM   238  C  CB  . GLN A 1 33 ? 37.931 9.813   43.862 1.00 30.78  ? 566 GLN A CB  1 
ATOM   239  C  CG  . GLN A 1 33 ? 38.293 10.274  45.268 1.00 33.16  ? 566 GLN A CG  1 
ATOM   240  C  CD  . GLN A 1 33 ? 38.712 9.134   46.160 1.00 44.48  ? 566 GLN A CD  1 
ATOM   241  O  OE1 . GLN A 1 33 ? 38.211 8.984   47.287 1.00 42.01  ? 566 GLN A OE1 1 
ATOM   242  N  NE2 . GLN A 1 33 ? 39.640 8.316   45.693 1.00 33.81  ? 566 GLN A NE2 1 
ATOM   243  N  N   . ALA A 1 34 ? 39.553 11.807  41.837 1.00 34.78  ? 567 ALA A N   1 
ATOM   244  C  CA  . ALA A 1 34 ? 40.618 12.775  41.587 1.00 37.67  ? 567 ALA A CA  1 
ATOM   245  C  C   . ALA A 1 34 ? 40.039 14.119  41.107 1.00 46.11  ? 567 ALA A C   1 
ATOM   246  O  O   . ALA A 1 34 ? 40.567 15.148  41.494 1.00 47.12  ? 567 ALA A O   1 
ATOM   247  C  CB  . ALA A 1 34 ? 41.603 12.221  40.572 1.00 37.88  ? 567 ALA A CB  1 
HETATM 248  N  N   . MSE A 1 35 ? 38.897 14.100  40.361 1.00 46.27  ? 568 MSE A N   1 
HETATM 249  C  CA  . MSE A 1 35 ? 38.171 15.281  39.834 1.00 49.09  ? 568 MSE A CA  1 
HETATM 250  C  C   . MSE A 1 35 ? 37.215 15.923  40.828 1.00 55.78  ? 568 MSE A C   1 
HETATM 251  O  O   . MSE A 1 35 ? 37.230 17.137  40.974 1.00 59.47  ? 568 MSE A O   1 
HETATM 252  C  CB  . MSE A 1 35 ? 37.338 14.912  38.604 1.00 49.95  ? 568 MSE A CB  1 
HETATM 253  C  CG  . MSE A 1 35 ? 38.092 14.232  37.508 1.00 55.58  ? 568 MSE A CG  1 
HETATM 254  SE SE  . MSE A 1 35 ? 36.852 13.919  36.030 0.75 62.69  ? 568 MSE A SE  1 
HETATM 255  C  CE  . MSE A 1 35 ? 37.881 12.752  35.112 1.00 57.79  ? 568 MSE A CE  1 
ATOM   256  N  N   . HIS A 1 36 ? 36.312 15.128  41.411 1.00 51.67  ? 569 HIS A N   1 
ATOM   257  C  CA  . HIS A 1 36 ? 35.295 15.557  42.374 1.00 53.06  ? 569 HIS A CA  1 
ATOM   258  C  C   . HIS A 1 36 ? 35.270 14.619  43.546 1.00 53.97  ? 569 HIS A C   1 
ATOM   259  O  O   . HIS A 1 36 ? 34.415 13.738  43.576 1.00 51.91  ? 569 HIS A O   1 
ATOM   260  C  CB  . HIS A 1 36 ? 33.904 15.583  41.725 1.00 54.60  ? 569 HIS A CB  1 
ATOM   261  C  CG  . HIS A 1 36 ? 33.741 16.673  40.740 1.00 60.85  ? 569 HIS A CG  1 
ATOM   262  N  ND1 . HIS A 1 36 ? 33.169 17.873  41.098 1.00 65.89  ? 569 HIS A ND1 1 
ATOM   263  C  CD2 . HIS A 1 36 ? 34.113 16.720  39.440 1.00 63.36  ? 569 HIS A CD2 1 
ATOM   264  C  CE1 . HIS A 1 36 ? 33.216 18.622  40.009 1.00 67.79  ? 569 HIS A CE1 1 
ATOM   265  N  NE2 . HIS A 1 36 ? 33.773 17.966  38.982 1.00 66.61  ? 569 HIS A NE2 1 
ATOM   266  N  N   . PRO A 1 37 ? 36.181 14.777  44.521 1.00 52.22  ? 570 PRO A N   1 
ATOM   267  C  CA  . PRO A 1 37 ? 36.215 13.834  45.655 1.00 52.07  ? 570 PRO A CA  1 
ATOM   268  C  C   . PRO A 1 37 ? 34.930 13.751  46.505 1.00 59.17  ? 570 PRO A C   1 
ATOM   269  O  O   . PRO A 1 37 ? 34.629 12.664  47.014 1.00 57.73  ? 570 PRO A O   1 
ATOM   270  C  CB  . PRO A 1 37 ? 37.384 14.344  46.501 1.00 55.86  ? 570 PRO A CB  1 
ATOM   271  C  CG  . PRO A 1 37 ? 37.602 15.765  46.067 1.00 61.98  ? 570 PRO A CG  1 
ATOM   272  C  CD  . PRO A 1 37 ? 37.261 15.781  44.620 1.00 56.13  ? 570 PRO A CD  1 
ATOM   273  N  N   . THR A 1 38 ? 34.186 14.871  46.666 1.00 59.31  ? 571 THR A N   1 
ATOM   274  C  CA  . THR A 1 38 ? 32.977 14.917  47.517 1.00 60.36  ? 571 THR A CA  1 
ATOM   275  C  C   . THR A 1 38 ? 31.801 14.148  46.894 1.00 60.15  ? 571 THR A C   1 
ATOM   276  O  O   . THR A 1 38 ? 31.084 13.444  47.608 1.00 60.69  ? 571 THR A O   1 
ATOM   277  C  CB  . THR A 1 38 ? 32.568 16.380  47.844 1.00 75.35  ? 571 THR A CB  1 
ATOM   278  O  OG1 . THR A 1 38 ? 33.684 17.088  48.389 1.00 79.34  ? 571 THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 38 ? 31.402 16.469  48.824 1.00 76.26  ? 571 THR A CG2 1 
ATOM   280  N  N   . LEU A 1 39 ? 31.599 14.283  45.585 1.00 52.25  ? 572 LEU A N   1 
ATOM   281  C  CA  . LEU A 1 39 ? 30.468 13.631  44.946 1.00 49.45  ? 572 LEU A CA  1 
ATOM   282  C  C   . LEU A 1 39 ? 30.845 12.338  44.211 1.00 45.28  ? 572 LEU A C   1 
ATOM   283  O  O   . LEU A 1 39 ? 29.975 11.741  43.574 1.00 41.53  ? 572 LEU A O   1 
ATOM   284  C  CB  . LEU A 1 39 ? 29.854 14.633  43.959 1.00 51.49  ? 572 LEU A CB  1 
ATOM   285  C  CG  . LEU A 1 39 ? 29.301 15.942  44.552 1.00 59.09  ? 572 LEU A CG  1 
ATOM   286  C  CD1 . LEU A 1 39 ? 29.099 16.993  43.461 1.00 61.03  ? 572 LEU A CD1 1 
ATOM   287  C  CD2 . LEU A 1 39 ? 28.019 15.692  45.385 1.00 59.67  ? 572 LEU A CD2 1 
ATOM   288  N  N   . ALA A 1 40 ? 32.126 11.900  44.328 1.00 39.94  ? 573 ALA A N   1 
ATOM   289  C  CA  . ALA A 1 40 ? 32.732 10.762  43.625 1.00 38.12  ? 573 ALA A CA  1 
ATOM   290  C  C   . ALA A 1 40 ? 31.871 9.523   43.623 1.00 39.27  ? 573 ALA A C   1 
ATOM   291  O  O   . ALA A 1 40 ? 31.651 8.964   42.552 1.00 39.10  ? 573 ALA A O   1 
ATOM   292  C  CB  . ALA A 1 40 ? 34.106 10.435  44.213 1.00 39.00  ? 573 ALA A CB  1 
ATOM   293  N  N   . GLY A 1 41 ? 31.411 9.105   44.802 1.00 35.66  ? 574 GLY A N   1 
ATOM   294  C  CA  . GLY A 1 41 ? 30.581 7.913   44.981 1.00 34.85  ? 574 GLY A CA  1 
ATOM   295  C  C   . GLY A 1 41 ? 29.281 7.983   44.201 1.00 38.56  ? 574 GLY A C   1 
ATOM   296  O  O   . GLY A 1 41 ? 28.925 7.034   43.500 1.00 38.88  ? 574 GLY A O   1 
ATOM   297  N  N   . LYS A 1 42 ? 28.605 9.145   44.264 1.00 34.29  ? 575 LYS A N   1 
ATOM   298  C  CA  . LYS A 1 42 ? 27.342 9.430   43.572 1.00 34.27  ? 575 LYS A CA  1 
ATOM   299  C  C   . LYS A 1 42 ? 27.538 9.497   42.076 1.00 37.46  ? 575 LYS A C   1 
ATOM   300  O  O   . LYS A 1 42 ? 26.771 8.873   41.357 1.00 37.06  ? 575 LYS A O   1 
ATOM   301  C  CB  . LYS A 1 42 ? 26.725 10.733  44.068 1.00 37.19  ? 575 LYS A CB  1 
ATOM   302  C  CG  . LYS A 1 42 ? 26.250 10.686  45.503 1.00 43.02  ? 575 LYS A CG  1 
ATOM   303  C  CD  . LYS A 1 42 ? 25.731 12.067  45.851 1.00 59.71  ? 575 LYS A CD  1 
ATOM   304  C  CE  . LYS A 1 42 ? 25.183 12.146  47.246 1.00 72.32  ? 575 LYS A CE  1 
ATOM   305  N  NZ  . LYS A 1 42 ? 24.399 13.388  47.440 1.00 84.59  ? 575 LYS A NZ  1 
ATOM   306  N  N   . ILE A 1 43 ? 28.577 10.224  41.605 1.00 35.18  ? 576 ILE A N   1 
ATOM   307  C  CA  . ILE A 1 43 ? 28.906 10.366  40.176 1.00 35.30  ? 576 ILE A CA  1 
ATOM   308  C  C   . ILE A 1 43 ? 29.227 8.995   39.593 1.00 38.52  ? 576 ILE A C   1 
ATOM   309  O  O   . ILE A 1 43 ? 28.693 8.671   38.533 1.00 39.94  ? 576 ILE A O   1 
ATOM   310  C  CB  . ILE A 1 43 ? 30.068 11.376  39.931 1.00 38.05  ? 576 ILE A CB  1 
ATOM   311  C  CG1 . ILE A 1 43 ? 29.696 12.782  40.438 1.00 39.75  ? 576 ILE A CG1 1 
ATOM   312  C  CG2 . ILE A 1 43 ? 30.503 11.405  38.451 1.00 37.16  ? 576 ILE A CG2 1 
ATOM   313  C  CD1 . ILE A 1 43 ? 30.883 13.736  40.584 1.00 42.13  ? 576 ILE A CD1 1 
ATOM   314  N  N   . THR A 1 44 ? 30.039 8.181   40.308 1.00 33.45  ? 577 THR A N   1 
ATOM   315  C  CA  . THR A 1 44 ? 30.430 6.840   39.873 1.00 33.52  ? 577 THR A CA  1 
ATOM   316  C  C   . THR A 1 44 ? 29.202 5.982   39.688 1.00 39.61  ? 577 THR A C   1 
ATOM   317  O  O   . THR A 1 44 ? 29.046 5.393   38.618 1.00 41.62  ? 577 THR A O   1 
ATOM   318  C  CB  . THR A 1 44 ? 31.454 6.184   40.826 1.00 37.28  ? 577 THR A CB  1 
ATOM   319  O  OG1 . THR A 1 44 ? 32.602 7.030   40.893 1.00 36.08  ? 577 THR A OG1 1 
ATOM   320  C  CG2 . THR A 1 44 ? 31.886 4.782   40.350 1.00 31.47  ? 577 THR A CG2 1 
ATOM   321  N  N   . GLY A 1 45 ? 28.336 5.948   40.695 1.00 36.23  ? 578 GLY A N   1 
ATOM   322  C  CA  . GLY A 1 45 ? 27.086 5.194   40.647 1.00 36.51  ? 578 GLY A CA  1 
ATOM   323  C  C   . GLY A 1 45 ? 26.226 5.554   39.452 1.00 40.29  ? 578 GLY A C   1 
ATOM   324  O  O   . GLY A 1 45 ? 25.663 4.663   38.812 1.00 40.18  ? 578 GLY A O   1 
HETATM 325  N  N   . MSE A 1 46 ? 26.150 6.869   39.142 1.00 36.97  ? 579 MSE A N   1 
HETATM 326  C  CA  A MSE A 1 46 ? 25.357 7.379   38.040 0.50 37.77  ? 579 MSE A CA  1 
HETATM 327  C  CA  B MSE A 1 46 ? 25.376 7.422   38.035 0.50 39.07  ? 579 MSE A CA  1 
HETATM 328  C  C   . MSE A 1 46 ? 25.961 6.984   36.699 1.00 40.91  ? 579 MSE A C   1 
HETATM 329  O  O   . MSE A 1 46 ? 25.238 6.472   35.844 1.00 40.65  ? 579 MSE A O   1 
HETATM 330  C  CB  A MSE A 1 46 ? 25.210 8.894   38.127 0.50 40.87  ? 579 MSE A CB  1 
HETATM 331  C  CB  B MSE A 1 46 ? 25.351 8.959   38.107 0.50 43.01  ? 579 MSE A CB  1 
HETATM 332  C  CG  A MSE A 1 46 ? 24.043 9.390   37.306 0.50 51.25  ? 579 MSE A CG  1 
HETATM 333  C  CG  B MSE A 1 46 ? 24.416 9.522   39.152 0.50 53.51  ? 579 MSE A CG  1 
HETATM 334  SE SE  A MSE A 1 46 ? 24.018 11.296  36.988 0.37 61.94  ? 579 MSE A SE  1 
HETATM 335  SE SE  B MSE A 1 46 ? 24.260 11.477  39.164 0.38 65.73  ? 579 MSE A SE  1 
HETATM 336  C  CE  A MSE A 1 46 ? 23.753 11.930  38.818 0.50 58.84  ? 579 MSE A CE  1 
HETATM 337  C  CE  B MSE A 1 46 ? 24.008 11.763  37.305 0.50 64.51  ? 579 MSE A CE  1 
ATOM   338  N  N   . LEU A 1 47 ? 27.275 7.210   36.517 1.00 35.64  ? 580 LEU A N   1 
ATOM   339  C  CA  . LEU A 1 47 ? 27.984 6.889   35.280 1.00 35.22  ? 580 LEU A CA  1 
ATOM   340  C  C   . LEU A 1 47 ? 27.997 5.396   35.008 1.00 37.96  ? 580 LEU A C   1 
ATOM   341  O  O   . LEU A 1 47 ? 28.032 5.030   33.849 1.00 39.30  ? 580 LEU A O   1 
ATOM   342  C  CB  . LEU A 1 47 ? 29.420 7.457   35.254 1.00 33.67  ? 580 LEU A CB  1 
ATOM   343  C  CG  . LEU A 1 47 ? 29.584 9.000   35.335 1.00 38.24  ? 580 LEU A CG  1 
ATOM   344  C  CD1 . LEU A 1 47 ? 30.980 9.407   34.929 1.00 37.47  ? 580 LEU A CD1 1 
ATOM   345  C  CD2 . LEU A 1 47 ? 28.640 9.715   34.432 1.00 40.52  ? 580 LEU A CD2 1 
ATOM   346  N  N   . LEU A 1 48 ? 27.873 4.544   36.039 1.00 33.16  ? 581 LEU A N   1 
ATOM   347  C  CA  . LEU A 1 48 ? 27.830 3.088   35.858 1.00 33.79  ? 581 LEU A CA  1 
ATOM   348  C  C   . LEU A 1 48 ? 26.551 2.607   35.175 1.00 43.36  ? 581 LEU A C   1 
ATOM   349  O  O   . LEU A 1 48 ? 26.471 1.437   34.797 1.00 46.44  ? 581 LEU A O   1 
ATOM   350  C  CB  . LEU A 1 48 ? 28.017 2.357   37.188 1.00 33.04  ? 581 LEU A CB  1 
ATOM   351  C  CG  . LEU A 1 48 ? 29.472 2.312   37.666 1.00 35.87  ? 581 LEU A CG  1 
ATOM   352  C  CD1 . LEU A 1 48 ? 29.551 1.821   39.077 1.00 36.06  ? 581 LEU A CD1 1 
ATOM   353  C  CD2 . LEU A 1 48 ? 30.328 1.461   36.747 1.00 38.14  ? 581 LEU A CD2 1 
ATOM   354  N  N   . GLU A 1 49 ? 25.566 3.496   34.980 1.00 40.83  ? 582 GLU A N   1 
ATOM   355  C  CA  . GLU A 1 49 ? 24.328 3.157   34.285 1.00 42.79  ? 582 GLU A CA  1 
ATOM   356  C  C   . GLU A 1 49 ? 24.530 3.217   32.772 1.00 46.85  ? 582 GLU A C   1 
ATOM   357  O  O   . GLU A 1 49 ? 23.746 2.619   32.032 1.00 49.62  ? 582 GLU A O   1 
ATOM   358  C  CB  . GLU A 1 49 ? 23.194 4.084   34.716 1.00 46.07  ? 582 GLU A CB  1 
ATOM   359  C  CG  . GLU A 1 49 ? 22.812 3.939   36.186 1.00 54.62  ? 582 GLU A CG  1 
ATOM   360  C  CD  . GLU A 1 49 ? 22.096 2.672   36.627 1.00 84.41  ? 582 GLU A CD  1 
ATOM   361  O  OE1 . GLU A 1 49 ? 21.753 1.827   35.765 1.00 69.49  ? 582 GLU A OE1 1 
ATOM   362  O  OE2 . GLU A 1 49 ? 21.877 2.527   37.853 1.00 92.28  ? 582 GLU A OE2 1 
ATOM   363  N  N   . ILE A 1 50 ? 25.586 3.935   32.315 1.00 40.62  ? 583 ILE A N   1 
ATOM   364  C  CA  . ILE A 1 50 ? 25.958 4.066   30.906 1.00 41.59  ? 583 ILE A CA  1 
ATOM   365  C  C   . ILE A 1 50 ? 26.367 2.678   30.353 1.00 47.94  ? 583 ILE A C   1 
ATOM   366  O  O   . ILE A 1 50 ? 26.896 1.859   31.116 1.00 45.81  ? 583 ILE A O   1 
ATOM   367  C  CB  . ILE A 1 50 ? 27.099 5.114   30.770 1.00 41.92  ? 583 ILE A CB  1 
ATOM   368  C  CG1 . ILE A 1 50 ? 26.607 6.523   31.172 1.00 42.53  ? 583 ILE A CG1 1 
ATOM   369  C  CG2 . ILE A 1 50 ? 27.691 5.140   29.361 1.00 43.03  ? 583 ILE A CG2 1 
ATOM   370  C  CD1 . ILE A 1 50 ? 27.747 7.592   31.358 1.00 41.86  ? 583 ILE A CD1 1 
ATOM   371  N  N   . ASP A 1 51 ? 26.108 2.425   29.034 1.00 48.99  ? 584 ASP A N   1 
ATOM   372  C  CA  A ASP A 1 51 ? 26.464 1.171   28.374 0.50 50.15  ? 584 ASP A CA  1 
ATOM   373  C  CA  B ASP A 1 51 ? 26.474 1.167   28.364 0.50 49.90  ? 584 ASP A CA  1 
ATOM   374  C  C   . ASP A 1 51 ? 27.966 0.916   28.537 1.00 50.06  ? 584 ASP A C   1 
ATOM   375  O  O   . ASP A 1 51 ? 28.761 1.853   28.465 1.00 46.77  ? 584 ASP A O   1 
ATOM   376  C  CB  A ASP A 1 51 ? 26.028 1.168   26.891 0.50 55.81  ? 584 ASP A CB  1 
ATOM   377  C  CB  B ASP A 1 51 ? 26.091 1.185   26.865 0.50 55.14  ? 584 ASP A CB  1 
ATOM   378  C  CG  A ASP A 1 51 ? 26.773 2.103   25.957 0.50 69.78  ? 584 ASP A CG  1 
ATOM   379  C  CG  B ASP A 1 51 ? 26.326 -0.123  26.112 0.50 68.68  ? 584 ASP A CG  1 
ATOM   380  O  OD1 A ASP A 1 51 ? 27.904 1.760   25.559 0.50 69.95  ? 584 ASP A OD1 1 
ATOM   381  O  OD1 B ASP A 1 51 ? 25.713 -1.149  26.489 0.50 72.23  ? 584 ASP A OD1 1 
ATOM   382  O  OD2 A ASP A 1 51 ? 26.166 3.104   25.507 0.50 78.49  ? 584 ASP A OD2 1 
ATOM   383  O  OD2 B ASP A 1 51 ? 27.083 -0.108  25.113 0.50 71.85  ? 584 ASP A OD2 1 
ATOM   384  N  N   . ASN A 1 52 ? 28.333 -0.343  28.792 1.00 46.80  ? 585 ASN A N   1 
ATOM   385  C  CA  . ASN A 1 52 ? 29.697 -0.810  29.011 1.00 44.53  ? 585 ASN A CA  1 
ATOM   386  C  C   . ASN A 1 52 ? 30.682 -0.359  27.937 1.00 47.04  ? 585 ASN A C   1 
ATOM   387  O  O   . ASN A 1 52 ? 31.796 0.011   28.293 1.00 45.53  ? 585 ASN A O   1 
ATOM   388  C  CB  . ASN A 1 52 ? 29.729 -2.337  29.141 1.00 46.45  ? 585 ASN A CB  1 
ATOM   389  C  CG  . ASN A 1 52 ? 29.140 -2.854  30.425 1.00 55.62  ? 585 ASN A CG  1 
ATOM   390  O  OD1 . ASN A 1 52 ? 28.734 -2.104  31.326 1.00 48.94  ? 585 ASN A OD1 1 
ATOM   391  N  ND2 . ASN A 1 52 ? 29.081 -4.161  30.532 1.00 48.44  ? 585 ASN A ND2 1 
ATOM   392  N  N   . SER A 1 53 ? 30.294 -0.362  26.659 1.00 45.01  ? 586 SER A N   1 
ATOM   393  C  CA  . SER A 1 53 ? 31.202 0.057   25.589 1.00 45.07  ? 586 SER A CA  1 
ATOM   394  C  C   . SER A 1 53 ? 31.532 1.549   25.669 1.00 46.64  ? 586 SER A C   1 
ATOM   395  O  O   . SER A 1 53 ? 32.686 1.918   25.451 1.00 45.41  ? 586 SER A O   1 
ATOM   396  C  CB  . SER A 1 53 ? 30.640 -0.300  24.222 1.00 50.80  ? 586 SER A CB  1 
ATOM   397  O  OG  . SER A 1 53 ? 30.863 -1.688  24.040 1.00 61.39  ? 586 SER A OG  1 
ATOM   398  N  N   . GLU A 1 54 ? 30.545 2.391   26.025 1.00 43.11  ? 587 GLU A N   1 
ATOM   399  C  CA  . GLU A 1 54 ? 30.769 3.823   26.182 1.00 41.43  ? 587 GLU A CA  1 
ATOM   400  C  C   . GLU A 1 54 ? 31.650 4.082   27.437 1.00 40.99  ? 587 GLU A C   1 
ATOM   401  O  O   . GLU A 1 54 ? 32.543 4.937   27.388 1.00 39.56  ? 587 GLU A O   1 
ATOM   402  C  CB  . GLU A 1 54 ? 29.443 4.591   26.227 1.00 44.27  ? 587 GLU A CB  1 
ATOM   403  C  CG  . GLU A 1 54 ? 29.585 6.114   26.221 1.00 53.27  ? 587 GLU A CG  1 
ATOM   404  C  CD  . GLU A 1 54 ? 30.391 6.805   25.127 1.00 72.92  ? 587 GLU A CD  1 
ATOM   405  O  OE1 . GLU A 1 54 ? 30.495 6.260   24.002 1.00 58.51  ? 587 GLU A OE1 1 
ATOM   406  O  OE2 . GLU A 1 54 ? 30.899 7.918   25.398 1.00 69.34  ? 587 GLU A OE2 1 
ATOM   407  N  N   . LEU A 1 55 ? 31.463 3.290   28.501 1.00 35.70  ? 588 LEU A N   1 
ATOM   408  C  CA  . LEU A 1 55 ? 32.273 3.373   29.714 1.00 34.20  ? 588 LEU A CA  1 
ATOM   409  C  C   . LEU A 1 55 ? 33.743 3.004   29.435 1.00 38.92  ? 588 LEU A C   1 
ATOM   410  O  O   . LEU A 1 55 ? 34.657 3.671   29.951 1.00 38.86  ? 588 LEU A O   1 
ATOM   411  C  CB  . LEU A 1 55 ? 31.692 2.452   30.802 1.00 34.33  ? 588 LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 55 ? 30.457 2.980   31.549 1.00 39.11  ? 588 LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 55 ? 29.929 1.949   32.532 1.00 38.64  ? 588 LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 55 ? 30.767 4.291   32.277 1.00 40.94  ? 588 LEU A CD2 1 
ATOM   415  N  N   . LEU A 1 56 ? 33.976 1.965   28.602 1.00 35.42  ? 589 LEU A N   1 
ATOM   416  C  CA  . LEU A 1 56 ? 35.326 1.520   28.231 1.00 34.97  ? 589 LEU A CA  1 
ATOM   417  C  C   . LEU A 1 56 ? 36.035 2.601   27.428 1.00 39.68  ? 589 LEU A C   1 
ATOM   418  O  O   . LEU A 1 56 ? 37.228 2.830   27.631 1.00 39.11  ? 589 LEU A O   1 
ATOM   419  C  CB  . LEU A 1 56 ? 35.303 0.187   27.456 1.00 36.12  ? 589 LEU A CB  1 
ATOM   420  C  CG  . LEU A 1 56 ? 34.898 -1.030  28.295 1.00 39.47  ? 589 LEU A CG  1 
ATOM   421  C  CD1 . LEU A 1 56 ? 34.514 -2.169  27.418 1.00 42.27  ? 589 LEU A CD1 1 
ATOM   422  C  CD2 . LEU A 1 56 ? 35.966 -1.422  29.270 1.00 36.69  ? 589 LEU A CD2 1 
ATOM   423  N  N   . TYR A 1 57 ? 35.292 3.296   26.553 1.00 37.09  ? 590 TYR A N   1 
ATOM   424  C  CA  . TYR A 1 57 ? 35.820 4.420   25.785 1.00 36.89  ? 590 TYR A CA  1 
ATOM   425  C  C   . TYR A 1 57 ? 36.263 5.548   26.746 1.00 39.04  ? 590 TYR A C   1 
ATOM   426  O  O   . TYR A 1 57 ? 37.390 6.025   26.645 1.00 38.10  ? 590 TYR A O   1 
ATOM   427  C  CB  . TYR A 1 57 ? 34.775 4.920   24.768 1.00 39.36  ? 590 TYR A CB  1 
ATOM   428  C  CG  . TYR A 1 57 ? 35.183 6.214   24.101 1.00 40.97  ? 590 TYR A CG  1 
ATOM   429  C  CD1 . TYR A 1 57 ? 36.167 6.232   23.114 1.00 42.61  ? 590 TYR A CD1 1 
ATOM   430  C  CD2 . TYR A 1 57 ? 34.633 7.429   24.498 1.00 41.38  ? 590 TYR A CD2 1 
ATOM   431  C  CE1 . TYR A 1 57 ? 36.582 7.426   22.529 1.00 44.94  ? 590 TYR A CE1 1 
ATOM   432  C  CE2 . TYR A 1 57 ? 35.038 8.629   23.916 1.00 43.78  ? 590 TYR A CE2 1 
ATOM   433  C  CZ  . TYR A 1 57 ? 36.013 8.623   22.932 1.00 53.50  ? 590 TYR A CZ  1 
ATOM   434  O  OH  . TYR A 1 57 ? 36.414 9.802   22.342 1.00 61.62  ? 590 TYR A OH  1 
HETATM 435  N  N   . MSE A 1 58 ? 35.370 5.946   27.677 1.00 36.83  ? 591 MSE A N   1 
HETATM 436  C  CA  A MSE A 1 58 ? 35.642 6.990   28.672 0.50 33.86  ? 591 MSE A CA  1 
HETATM 437  C  CA  B MSE A 1 58 ? 35.645 6.978   28.684 0.50 38.12  ? 591 MSE A CA  1 
HETATM 438  C  C   . MSE A 1 58 ? 36.863 6.643   29.561 1.00 39.48  ? 591 MSE A C   1 
HETATM 439  O  O   . MSE A 1 58 ? 37.612 7.552   29.944 1.00 40.87  ? 591 MSE A O   1 
HETATM 440  C  CB  A MSE A 1 58 ? 34.408 7.237   29.538 0.50 33.87  ? 591 MSE A CB  1 
HETATM 441  C  CB  B MSE A 1 58 ? 34.436 7.175   29.579 0.50 41.40  ? 591 MSE A CB  1 
HETATM 442  C  CG  A MSE A 1 58 ? 33.277 7.951   28.793 0.50 40.32  ? 591 MSE A CG  1 
HETATM 443  C  CG  B MSE A 1 58 ? 33.377 8.050   28.970 0.50 52.90  ? 591 MSE A CG  1 
HETATM 444  SE SE  A MSE A 1 58 ? 31.505 7.467   29.485 0.38 45.85  ? 591 MSE A SE  1 
HETATM 445  SE SE  B MSE A 1 58 ? 31.955 8.147   30.270 0.37 63.76  ? 591 MSE A SE  1 
HETATM 446  C  CE  A MSE A 1 58 ? 31.736 7.885   31.490 0.50 40.35  ? 591 MSE A CE  1 
HETATM 447  C  CE  B MSE A 1 58 ? 30.856 6.868   29.553 0.50 61.78  ? 591 MSE A CE  1 
ATOM   448  N  N   . LEU A 1 59 ? 37.075 5.345   29.882 1.00 33.91  ? 592 LEU A N   1 
ATOM   449  C  CA  . LEU A 1 59 ? 38.226 4.917   30.681 1.00 32.73  ? 592 LEU A CA  1 
ATOM   450  C  C   . LEU A 1 59 ? 39.546 5.139   29.937 1.00 36.41  ? 592 LEU A C   1 
ATOM   451  O  O   . LEU A 1 59 ? 40.606 5.184   30.570 1.00 37.37  ? 592 LEU A O   1 
ATOM   452  C  CB  . LEU A 1 59 ? 38.103 3.436   31.096 1.00 32.59  ? 592 LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 59 ? 37.208 3.166   32.300 1.00 37.32  ? 592 LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 59 ? 36.929 1.685   32.452 1.00 38.51  ? 592 LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 59 ? 37.808 3.757   33.599 1.00 35.73  ? 592 LEU A CD2 1 
ATOM   456  N  N   . GLU A 1 60 ? 39.482 5.306   28.612 1.00 33.47  ? 593 GLU A N   1 
ATOM   457  C  CA  . GLU A 1 60 ? 40.664 5.553   27.775 1.00 35.17  ? 593 GLU A CA  1 
ATOM   458  C  C   . GLU A 1 60 ? 40.641 6.967   27.163 1.00 40.59  ? 593 GLU A C   1 
ATOM   459  O  O   . GLU A 1 60 ? 41.547 7.327   26.397 1.00 40.27  ? 593 GLU A O   1 
ATOM   460  C  CB  . GLU A 1 60 ? 40.738 4.513   26.644 1.00 37.34  ? 593 GLU A CB  1 
ATOM   461  C  CG  . GLU A 1 60 ? 41.089 3.116   27.112 1.00 45.98  ? 593 GLU A CG  1 
ATOM   462  C  CD  . GLU A 1 60 ? 41.111 2.068   26.016 1.00 58.72  ? 593 GLU A CD  1 
ATOM   463  O  OE1 . GLU A 1 60 ? 41.592 2.387   24.906 1.00 44.97  ? 593 GLU A OE1 1 
ATOM   464  O  OE2 . GLU A 1 60 ? 40.676 0.920   26.273 1.00 49.48  ? 593 GLU A OE2 1 
ATOM   465  N  N   . SER A 1 61 ? 39.588 7.750   27.460 1.00 37.08  ? 594 SER A N   1 
ATOM   466  C  CA  . SER A 1 61 ? 39.448 9.099   26.900 1.00 39.09  ? 594 SER A CA  1 
ATOM   467  C  C   . SER A 1 61 ? 39.176 10.105  28.050 1.00 44.22  ? 594 SER A C   1 
ATOM   468  O  O   . SER A 1 61 ? 38.018 10.335  28.428 1.00 43.57  ? 594 SER A O   1 
ATOM   469  C  CB  . SER A 1 61 ? 38.363 9.132   25.825 1.00 42.34  ? 594 SER A CB  1 
ATOM   470  O  OG  . SER A 1 61 ? 38.180 10.439  25.302 1.00 55.30  ? 594 SER A OG  1 
ATOM   471  N  N   . PRO A 1 62 ? 40.263 10.691  28.623 1.00 41.52  ? 595 PRO A N   1 
ATOM   472  C  CA  . PRO A 1 62 ? 40.106 11.597  29.778 1.00 41.33  ? 595 PRO A CA  1 
ATOM   473  C  C   . PRO A 1 62 ? 39.183 12.790  29.530 1.00 47.17  ? 595 PRO A C   1 
ATOM   474  O  O   . PRO A 1 62 ? 38.460 13.211  30.446 1.00 47.43  ? 595 PRO A O   1 
ATOM   475  C  CB  . PRO A 1 62 ? 41.543 12.044  30.058 1.00 43.89  ? 595 PRO A CB  1 
ATOM   476  C  CG  . PRO A 1 62 ? 42.374 10.849  29.597 1.00 47.00  ? 595 PRO A CG  1 
ATOM   477  C  CD  . PRO A 1 62 ? 41.695 10.473  28.321 1.00 42.88  ? 595 PRO A CD  1 
ATOM   478  N  N   . GLU A 1 63 ? 39.167 13.284  28.296 1.00 45.13  ? 596 GLU A N   1 
ATOM   479  C  CA  . GLU A 1 63 ? 38.320 14.382  27.845 1.00 48.16  ? 596 GLU A CA  1 
ATOM   480  C  C   . GLU A 1 63 ? 36.833 14.021  27.956 1.00 48.16  ? 596 GLU A C   1 
ATOM   481  O  O   . GLU A 1 63 ? 36.045 14.824  28.446 1.00 48.46  ? 596 GLU A O   1 
ATOM   482  C  CB  . GLU A 1 63 ? 38.663 14.721  26.383 1.00 52.90  ? 596 GLU A CB  1 
ATOM   483  C  CG  . GLU A 1 63 ? 39.197 16.125  26.181 1.00 73.91  ? 596 GLU A CG  1 
ATOM   484  C  CD  . GLU A 1 63 ? 39.265 16.564  24.727 1.00 111.91 ? 596 GLU A CD  1 
ATOM   485  O  OE1 . GLU A 1 63 ? 39.912 15.858  23.918 1.00 109.84 ? 596 GLU A OE1 1 
ATOM   486  O  OE2 . GLU A 1 63 ? 38.684 17.626  24.400 1.00 114.34 ? 596 GLU A OE2 1 
ATOM   487  N  N   . SER A 1 64 ? 36.469 12.806  27.517 1.00 42.52  ? 597 SER A N   1 
ATOM   488  C  CA  . SER A 1 64 ? 35.100 12.297  27.516 1.00 42.06  ? 597 SER A CA  1 
ATOM   489  C  C   . SER A 1 64 ? 34.641 11.972  28.895 1.00 44.91  ? 597 SER A C   1 
ATOM   490  O  O   . SER A 1 64 ? 33.473 12.212  29.197 1.00 47.00  ? 597 SER A O   1 
ATOM   491  C  CB  . SER A 1 64 ? 34.967 11.068  26.625 1.00 44.60  ? 597 SER A CB  1 
ATOM   492  O  OG  . SER A 1 64 ? 35.352 11.404  25.302 1.00 56.71  ? 597 SER A OG  1 
ATOM   493  N  N   . LEU A 1 65 ? 35.534 11.437  29.745 1.00 38.49  ? 598 LEU A N   1 
ATOM   494  C  CA  . LEU A 1 65 ? 35.179 11.126  31.118 1.00 35.81  ? 598 LEU A CA  1 
ATOM   495  C  C   . LEU A 1 65 ? 34.849 12.418  31.865 1.00 40.68  ? 598 LEU A C   1 
ATOM   496  O  O   . LEU A 1 65 ? 33.825 12.455  32.554 1.00 40.93  ? 598 LEU A O   1 
ATOM   497  C  CB  . LEU A 1 65 ? 36.285 10.316  31.824 1.00 33.76  ? 598 LEU A CB  1 
ATOM   498  C  CG  . LEU A 1 65 ? 36.049 10.007  33.329 1.00 36.45  ? 598 LEU A CG  1 
ATOM   499  C  CD1 . LEU A 1 65 ? 34.773 9.204   33.559 1.00 35.59  ? 598 LEU A CD1 1 
ATOM   500  C  CD2 . LEU A 1 65 ? 37.247 9.336   33.960 1.00 35.24  ? 598 LEU A CD2 1 
ATOM   501  N  N   . ARG A 1 66 ? 35.683 13.471  31.692 1.00 38.83  ? 599 ARG A N   1 
ATOM   502  C  CA  A ARG A 1 66 ? 35.501 14.767  32.349 0.50 41.08  ? 599 ARG A CA  1 
ATOM   503  C  CA  B ARG A 1 66 ? 35.491 14.783  32.321 0.50 41.12  ? 599 ARG A CA  1 
ATOM   504  C  C   . ARG A 1 66 ? 34.145 15.408  31.953 1.00 48.01  ? 599 ARG A C   1 
ATOM   505  O  O   . ARG A 1 66 ? 33.449 15.919  32.833 1.00 48.09  ? 599 ARG A O   1 
ATOM   506  C  CB  A ARG A 1 66 ? 36.690 15.711  32.041 0.50 43.18  ? 599 ARG A CB  1 
ATOM   507  C  CB  B ARG A 1 66 ? 36.608 15.740  31.902 0.50 43.19  ? 599 ARG A CB  1 
ATOM   508  C  CG  A ARG A 1 66 ? 36.488 17.185  32.436 0.50 56.02  ? 599 ARG A CG  1 
ATOM   509  C  CG  B ARG A 1 66 ? 36.503 17.170  32.480 0.50 54.53  ? 599 ARG A CG  1 
ATOM   510  C  CD  A ARG A 1 66 ? 37.649 17.773  33.235 0.50 64.27  ? 599 ARG A CD  1 
ATOM   511  C  CD  B ARG A 1 66 ? 37.789 17.947  32.251 0.50 61.95  ? 599 ARG A CD  1 
ATOM   512  N  NE  A ARG A 1 66 ? 37.543 17.476  34.666 0.50 65.31  ? 599 ARG A NE  1 
ATOM   513  N  NE  B ARG A 1 66 ? 38.915 17.021  32.159 0.50 57.11  ? 599 ARG A NE  1 
ATOM   514  C  CZ  A ARG A 1 66 ? 36.803 18.169  35.527 0.50 77.86  ? 599 ARG A CZ  1 
ATOM   515  C  CZ  B ARG A 1 66 ? 39.620 16.593  33.196 0.50 60.75  ? 599 ARG A CZ  1 
ATOM   516  N  NH1 A ARG A 1 66 ? 36.097 19.214  35.117 0.50 68.42  ? 599 ARG A NH1 1 
ATOM   517  N  NH1 B ARG A 1 66 ? 39.403 17.093  34.408 0.50 45.05  ? 599 ARG A NH1 1 
ATOM   518  N  NH2 A ARG A 1 66 ? 36.757 17.816  36.802 0.50 64.15  ? 599 ARG A NH2 1 
ATOM   519  N  NH2 B ARG A 1 66 ? 40.561 15.671  33.028 0.50 37.60  ? 599 ARG A NH2 1 
ATOM   520  N  N   . SER A 1 67 ? 33.777 15.385  30.647 1.00 45.24  ? 600 SER A N   1 
ATOM   521  C  CA  . SER A 1 67 ? 32.517 15.975  30.202 1.00 47.58  ? 600 SER A CA  1 
ATOM   522  C  C   . SER A 1 67 ? 31.318 15.207  30.757 1.00 47.72  ? 600 SER A C   1 
ATOM   523  O  O   . SER A 1 67 ? 30.321 15.839  31.095 1.00 50.05  ? 600 SER A O   1 
ATOM   524  C  CB  . SER A 1 67 ? 32.456 16.099  28.678 1.00 54.46  ? 600 SER A CB  1 
ATOM   525  O  OG  . SER A 1 67 ? 32.506 14.839  28.033 1.00 67.24  ? 600 SER A OG  1 
ATOM   526  N  N   . LYS A 1 68 ? 31.429 13.877  30.910 1.00 40.91  ? 601 LYS A N   1 
ATOM   527  C  CA  . LYS A 1 68 ? 30.363 13.046  31.490 1.00 39.77  ? 601 LYS A CA  1 
ATOM   528  C  C   . LYS A 1 68 ? 30.252 13.300  32.979 1.00 43.92  ? 601 LYS A C   1 
ATOM   529  O  O   . LYS A 1 68 ? 29.136 13.373  33.486 1.00 45.34  ? 601 LYS A O   1 
ATOM   530  C  CB  . LYS A 1 68 ? 30.569 11.544  31.208 1.00 39.43  ? 601 LYS A CB  1 
ATOM   531  C  CG  . LYS A 1 68 ? 30.287 11.168  29.755 1.00 44.84  ? 601 LYS A CG  1 
ATOM   532  C  CD  . LYS A 1 68 ? 28.814 11.291  29.431 1.00 52.15  ? 601 LYS A CD  1 
ATOM   533  C  CE  . LYS A 1 68 ? 28.494 11.025  27.996 1.00 50.03  ? 601 LYS A CE  1 
ATOM   534  N  NZ  . LYS A 1 68 ? 27.141 11.509  27.661 1.00 58.11  ? 601 LYS A NZ  1 
ATOM   535  N  N   . VAL A 1 69 ? 31.397 13.474  33.673 1.00 38.00  ? 602 VAL A N   1 
ATOM   536  C  CA  . VAL A 1 69 ? 31.440 13.805  35.097 1.00 36.75  ? 602 VAL A CA  1 
ATOM   537  C  C   . VAL A 1 69 ? 30.723 15.165  35.323 1.00 44.51  ? 602 VAL A C   1 
ATOM   538  O  O   . VAL A 1 69 ? 29.856 15.247  36.193 1.00 44.68  ? 602 VAL A O   1 
ATOM   539  C  CB  . VAL A 1 69 ? 32.898 13.764  35.654 1.00 38.25  ? 602 VAL A CB  1 
ATOM   540  C  CG1 . VAL A 1 69 ? 33.010 14.454  37.007 1.00 38.12  ? 602 VAL A CG1 1 
ATOM   541  C  CG2 . VAL A 1 69 ? 33.389 12.325  35.764 1.00 35.01  ? 602 VAL A CG2 1 
ATOM   542  N  N   . ASP A 1 70 ? 31.021 16.183  34.491 1.00 44.49  ? 603 ASP A N   1 
ATOM   543  C  CA  . ASP A 1 70 ? 30.392 17.514  34.532 1.00 48.51  ? 603 ASP A CA  1 
ATOM   544  C  C   . ASP A 1 70 ? 28.869 17.427  34.299 1.00 52.88  ? 603 ASP A C   1 
ATOM   545  O  O   . ASP A 1 70 ? 28.103 18.130  34.971 1.00 54.84  ? 603 ASP A O   1 
ATOM   546  C  CB  . ASP A 1 70 ? 31.034 18.466  33.500 1.00 53.96  ? 603 ASP A CB  1 
ATOM   547  C  CG  . ASP A 1 70 ? 32.478 18.880  33.802 1.00 72.04  ? 603 ASP A CG  1 
ATOM   548  O  OD1 . ASP A 1 70 ? 32.932 18.685  34.971 1.00 71.77  ? 603 ASP A OD1 1 
ATOM   549  O  OD2 . ASP A 1 70 ? 33.160 19.406  32.872 1.00 80.11  ? 603 ASP A OD2 1 
ATOM   550  N  N   . GLU A 1 71 ? 28.435 16.542  33.382 1.00 47.50  ? 604 GLU A N   1 
ATOM   551  C  CA  . GLU A 1 71 ? 27.017 16.302  33.110 1.00 48.91  ? 604 GLU A CA  1 
ATOM   552  C  C   . GLU A 1 71 ? 26.335 15.660  34.324 1.00 51.04  ? 604 GLU A C   1 
ATOM   553  O  O   . GLU A 1 71 ? 25.218 16.042  34.665 1.00 53.60  ? 604 GLU A O   1 
ATOM   554  C  CB  . GLU A 1 71 ? 26.837 15.417  31.869 1.00 50.15  ? 604 GLU A CB  1 
ATOM   555  C  CG  . GLU A 1 71 ? 27.019 16.147  30.548 1.00 62.02  ? 604 GLU A CG  1 
ATOM   556  C  CD  . GLU A 1 71 ? 26.659 15.310  29.336 1.00 82.60  ? 604 GLU A CD  1 
ATOM   557  O  OE1 . GLU A 1 71 ? 27.388 14.337  29.044 1.00 57.11  ? 604 GLU A OE1 1 
ATOM   558  O  OE2 . GLU A 1 71 ? 25.638 15.619  28.681 1.00 94.35  ? 604 GLU A OE2 1 
ATOM   559  N  N   . ALA A 1 72 ? 27.025 14.712  34.996 1.00 44.57  ? 605 ALA A N   1 
ATOM   560  C  CA  . ALA A 1 72 ? 26.528 14.027  36.188 1.00 42.38  ? 605 ALA A CA  1 
ATOM   561  C  C   . ALA A 1 72 ? 26.410 15.012  37.340 1.00 48.52  ? 605 ALA A C   1 
ATOM   562  O  O   . ALA A 1 72 ? 25.408 14.997  38.055 1.00 48.73  ? 605 ALA A O   1 
ATOM   563  C  CB  . ALA A 1 72 ? 27.447 12.874  36.559 1.00 39.41  ? 605 ALA A CB  1 
ATOM   564  N  N   . VAL A 1 73 ? 27.408 15.916  37.475 1.00 46.63  ? 606 VAL A N   1 
ATOM   565  C  CA  . VAL A 1 73 ? 27.463 16.972  38.498 1.00 47.89  ? 606 VAL A CA  1 
ATOM   566  C  C   . VAL A 1 73 ? 26.247 17.893  38.335 1.00 57.05  ? 606 VAL A C   1 
ATOM   567  O  O   . VAL A 1 73 ? 25.638 18.263  39.335 1.00 58.90  ? 606 VAL A O   1 
ATOM   568  C  CB  . VAL A 1 73 ? 28.809 17.743  38.450 1.00 50.88  ? 606 VAL A CB  1 
ATOM   569  C  CG1 . VAL A 1 73 ? 28.746 19.062  39.213 1.00 54.00  ? 606 VAL A CG1 1 
ATOM   570  C  CG2 . VAL A 1 73 ? 29.936 16.881  38.990 1.00 46.49  ? 606 VAL A CG2 1 
ATOM   571  N  N   . ALA A 1 74 ? 25.865 18.214  37.090 1.00 56.27  ? 607 ALA A N   1 
ATOM   572  C  CA  . ALA A 1 74 ? 24.699 19.055  36.811 1.00 60.59  ? 607 ALA A CA  1 
ATOM   573  C  C   . ALA A 1 74 ? 23.411 18.362  37.259 1.00 64.54  ? 607 ALA A C   1 
ATOM   574  O  O   . ALA A 1 74 ? 22.532 19.025  37.814 1.00 68.56  ? 607 ALA A O   1 
ATOM   575  C  CB  . ALA A 1 74 ? 24.631 19.397  35.326 1.00 63.94  ? 607 ALA A CB  1 
ATOM   576  N  N   . VAL A 1 75 ? 23.322 17.028  37.057 1.00 57.23  ? 608 VAL A N   1 
ATOM   577  C  CA  . VAL A 1 75 ? 22.167 16.213  37.450 1.00 56.93  ? 608 VAL A CA  1 
ATOM   578  C  C   . VAL A 1 75 ? 22.012 16.236  38.997 1.00 58.43  ? 608 VAL A C   1 
ATOM   579  O  O   . VAL A 1 75 ? 20.897 16.352  39.495 1.00 59.18  ? 608 VAL A O   1 
ATOM   580  C  CB  . VAL A 1 75 ? 22.255 14.757  36.910 1.00 58.06  ? 608 VAL A CB  1 
ATOM   581  C  CG1 . VAL A 1 75 ? 21.065 13.925  37.378 1.00 59.39  ? 608 VAL A CG1 1 
ATOM   582  C  CG2 . VAL A 1 75 ? 22.364 14.706  35.390 1.00 58.50  ? 608 VAL A CG2 1 
ATOM   583  N  N   . LEU A 1 76 ? 23.129 16.175  39.731 1.00 53.01  ? 609 LEU A N   1 
ATOM   584  C  CA  . LEU A 1 76 ? 23.162 16.167  41.200 1.00 52.55  ? 609 LEU A CA  1 
ATOM   585  C  C   . LEU A 1 76 ? 22.853 17.509  41.840 1.00 62.93  ? 609 LEU A C   1 
ATOM   586  O  O   . LEU A 1 76 ? 22.460 17.532  43.009 1.00 64.82  ? 609 LEU A O   1 
ATOM   587  C  CB  . LEU A 1 76 ? 24.534 15.701  41.691 1.00 48.69  ? 609 LEU A CB  1 
ATOM   588  C  CG  . LEU A 1 76 ? 24.844 14.227  41.482 1.00 49.28  ? 609 LEU A CG  1 
ATOM   589  C  CD1 . LEU A 1 76 ? 26.284 13.945  41.751 1.00 46.66  ? 609 LEU A CD1 1 
ATOM   590  C  CD2 . LEU A 1 76 ? 23.982 13.334  42.360 1.00 49.71  ? 609 LEU A CD2 1 
ATOM   591  N  N   . GLN A 1 77 ? 23.041 18.621  41.100 1.00 62.71  ? 610 GLN A N   1 
ATOM   592  C  CA  . GLN A 1 77 ? 22.811 19.986  41.581 1.00 66.01  ? 610 GLN A CA  1 
ATOM   593  C  C   . GLN A 1 77 ? 21.346 20.227  41.903 1.00 72.12  ? 610 GLN A C   1 
ATOM   594  O  O   . GLN A 1 77 ? 20.477 20.012  41.061 1.00 73.12  ? 610 GLN A O   1 
ATOM   595  C  CB  . GLN A 1 77 ? 23.299 21.014  40.552 1.00 70.24  ? 610 GLN A CB  1 
ATOM   596  C  CG  . GLN A 1 77 ? 23.418 22.425  41.118 1.00 89.46  ? 610 GLN A CG  1 
ATOM   597  C  CD  . GLN A 1 77 ? 23.546 23.449  40.026 1.00 120.38 ? 610 GLN A CD  1 
ATOM   598  O  OE1 . GLN A 1 77 ? 24.583 23.554  39.368 1.00 120.61 ? 610 GLN A OE1 1 
ATOM   599  N  NE2 . GLN A 1 77 ? 22.498 24.235  39.811 1.00 116.51 ? 610 GLN A NE2 1 
ATOM   600  N  N   . ALA A 1 78 ? 21.090 20.672  43.129 1.00 70.35  ? 611 ALA A N   1 
ATOM   601  C  CA  . ALA A 1 78 ? 19.753 20.984  43.625 1.00 74.34  ? 611 ALA A CA  1 
ATOM   602  C  C   . ALA A 1 78 ? 19.223 22.310  43.059 1.00 85.23  ? 611 ALA A C   1 
ATOM   603  O  O   . ALA A 1 78 ? 20.004 23.149  42.600 1.00 86.37  ? 611 ALA A O   1 
ATOM   604  C  CB  . ALA A 1 78 ? 19.777 21.049  45.145 1.00 74.70  ? 611 ALA A CB  1 
ATOM   605  N  N   . HIS A 1 79 ? 17.881 22.480  43.105 1.00 86.14  ? 612 HIS A N   1 
ATOM   606  C  CA  . HIS A 1 79 ? 17.111 23.669  42.716 1.00 97.94  ? 612 HIS A CA  1 
ATOM   607  C  C   . HIS A 1 79 ? 16.529 24.318  43.965 1.00 122.02 ? 612 HIS A C   1 
ATOM   608  O  O   . HIS A 1 79 ? 16.016 23.620  44.844 1.00 88.26  ? 612 HIS A O   1 
ATOM   609  C  CB  . HIS A 1 79 ? 15.983 23.305  41.734 1.00 101.24 ? 612 HIS A CB  1 
ATOM   610  N  N   . GLU B 1 5  ? -1.396 8.077   48.114 1.00 93.09  ? 538 GLU B N   1 
ATOM   611  C  CA  . GLU B 1 5  ? -0.681 8.849   49.131 1.00 90.60  ? 538 GLU B CA  1 
ATOM   612  C  C   . GLU B 1 5  ? 0.536  9.580   48.536 1.00 90.44  ? 538 GLU B C   1 
ATOM   613  O  O   . GLU B 1 5  ? 1.157  9.082   47.588 1.00 89.25  ? 538 GLU B O   1 
ATOM   614  C  CB  . GLU B 1 5  ? -0.231 7.946   50.297 1.00 90.46  ? 538 GLU B CB  1 
ATOM   615  N  N   . THR B 1 6  ? 0.860  10.774  49.098 1.00 83.76  ? 539 THR B N   1 
ATOM   616  C  CA  . THR B 1 6  ? 2.016  11.600  48.714 1.00 78.95  ? 539 THR B CA  1 
ATOM   617  C  C   . THR B 1 6  ? 3.078  11.439  49.806 1.00 73.84  ? 539 THR B C   1 
ATOM   618  O  O   . THR B 1 6  ? 2.776  11.538  51.007 1.00 74.14  ? 539 THR B O   1 
ATOM   619  C  CB  . THR B 1 6  ? 1.612  13.072  48.449 1.00 90.24  ? 539 THR B CB  1 
ATOM   620  O  OG1 . THR B 1 6  ? 0.925  13.131  47.200 1.00 96.37  ? 539 THR B OG1 1 
ATOM   621  C  CG2 . THR B 1 6  ? 2.813  14.032  48.390 1.00 84.76  ? 539 THR B CG2 1 
ATOM   622  N  N   . LEU B 1 7  ? 4.316  11.158  49.374 1.00 62.09  ? 540 LEU B N   1 
ATOM   623  C  CA  . LEU B 1 7  ? 5.436  10.953  50.271 1.00 56.99  ? 540 LEU B CA  1 
ATOM   624  C  C   . LEU B 1 7  ? 5.934  12.299  50.809 1.00 57.87  ? 540 LEU B C   1 
ATOM   625  O  O   . LEU B 1 7  ? 6.463  13.124  50.058 1.00 57.17  ? 540 LEU B O   1 
ATOM   626  C  CB  . LEU B 1 7  ? 6.564  10.175  49.558 1.00 53.67  ? 540 LEU B CB  1 
ATOM   627  C  CG  . LEU B 1 7  ? 7.787  9.777   50.394 1.00 54.47  ? 540 LEU B CG  1 
ATOM   628  C  CD1 . LEU B 1 7  ? 7.395  8.932   51.593 1.00 53.69  ? 540 LEU B CD1 1 
ATOM   629  C  CD2 . LEU B 1 7  ? 8.807  9.047   49.535 1.00 55.44  ? 540 LEU B CD2 1 
ATOM   630  N  N   . THR B 1 8  ? 5.728  12.521  52.109 1.00 52.37  ? 541 THR B N   1 
ATOM   631  C  CA  . THR B 1 8  ? 6.183  13.731  52.790 1.00 51.10  ? 541 THR B CA  1 
ATOM   632  C  C   . THR B 1 8  ? 7.589  13.490  53.291 1.00 50.59  ? 541 THR B C   1 
ATOM   633  O  O   . THR B 1 8  ? 7.995  12.331  53.437 1.00 47.38  ? 541 THR B O   1 
ATOM   634  C  CB  . THR B 1 8  ? 5.235  14.107  53.943 1.00 58.24  ? 541 THR B CB  1 
ATOM   635  O  OG1 . THR B 1 8  ? 5.307  13.109  54.964 1.00 53.33  ? 541 THR B OG1 1 
ATOM   636  C  CG2 . THR B 1 8  ? 3.780  14.326  53.486 1.00 55.85  ? 541 THR B CG2 1 
ATOM   637  N  N   . ALA B 1 9  ? 8.334  14.572  53.575 1.00 47.51  ? 542 ALA B N   1 
ATOM   638  C  CA  . ALA B 1 9  ? 9.681  14.478  54.136 1.00 44.99  ? 542 ALA B CA  1 
ATOM   639  C  C   . ALA B 1 9  ? 9.638  13.832  55.529 1.00 48.09  ? 542 ALA B C   1 
ATOM   640  O  O   . ALA B 1 9  ? 10.514 13.034  55.842 1.00 46.14  ? 542 ALA B O   1 
ATOM   641  C  CB  . ALA B 1 9  ? 10.319 15.850  54.207 1.00 46.82  ? 542 ALA B CB  1 
ATOM   642  N  N   . SER B 1 10 ? 8.589  14.119  56.333 1.00 47.50  ? 543 SER B N   1 
ATOM   643  C  CA  . SER B 1 10 ? 8.455  13.520  57.663 1.00 48.14  ? 543 SER B CA  1 
ATOM   644  C  C   . SER B 1 10 ? 8.188  12.011  57.560 1.00 51.33  ? 543 SER B C   1 
ATOM   645  O  O   . SER B 1 10 ? 8.736  11.258  58.361 1.00 51.19  ? 543 SER B O   1 
ATOM   646  C  CB  . SER B 1 10 ? 7.385  14.211  58.508 1.00 52.19  ? 543 SER B CB  1 
ATOM   647  O  OG  . SER B 1 10 ? 6.127  14.296  57.870 1.00 64.91  ? 543 SER B OG  1 
ATOM   648  N  N   . ARG B 1 11 ? 7.392  11.568  56.580 1.00 47.54  ? 544 ARG B N   1 
ATOM   649  C  CA  . ARG B 1 11 ? 7.098  10.143  56.408 1.00 48.07  ? 544 ARG B CA  1 
ATOM   650  C  C   . ARG B 1 11 ? 8.377  9.388   55.989 1.00 47.62  ? 544 ARG B C   1 
ATOM   651  O  O   . ARG B 1 11 ? 8.649  8.324   56.546 1.00 47.28  ? 544 ARG B O   1 
ATOM   652  C  CB  . ARG B 1 11 ? 5.925  9.920   55.417 1.00 52.27  ? 544 ARG B CB  1 
ATOM   653  C  CG  . ARG B 1 11 ? 5.731  8.483   54.889 1.00 73.15  ? 544 ARG B CG  1 
ATOM   654  C  CD  . ARG B 1 11 ? 5.212  7.480   55.914 1.00 95.73  ? 544 ARG B CD  1 
ATOM   655  N  NE  . ARG B 1 11 ? 5.498  6.098   55.506 1.00 110.93 ? 544 ARG B NE  1 
ATOM   656  C  CZ  . ARG B 1 11 ? 6.453  5.333   56.033 1.00 123.53 ? 544 ARG B CZ  1 
ATOM   657  N  NH1 . ARG B 1 11 ? 7.218  5.794   57.016 1.00 107.24 ? 544 ARG B NH1 1 
ATOM   658  N  NH2 . ARG B 1 11 ? 6.639  4.096   55.590 1.00 109.98 ? 544 ARG B NH2 1 
ATOM   659  N  N   . LEU B 1 12 ? 9.171  9.958   55.061 1.00 41.46  ? 545 LEU B N   1 
ATOM   660  C  CA  . LEU B 1 12 ? 10.429 9.366   54.621 1.00 39.54  ? 545 LEU B CA  1 
ATOM   661  C  C   . LEU B 1 12 ? 11.432 9.295   55.789 1.00 44.63  ? 545 LEU B C   1 
ATOM   662  O  O   . LEU B 1 12 ? 12.061 8.252   55.968 1.00 44.15  ? 545 LEU B O   1 
ATOM   663  C  CB  . LEU B 1 12 ? 11.033 10.145  53.436 1.00 38.31  ? 545 LEU B CB  1 
ATOM   664  C  CG  . LEU B 1 12 ? 12.296 9.508   52.796 1.00 40.68  ? 545 LEU B CG  1 
ATOM   665  C  CD1 . LEU B 1 12 ? 11.943 8.345   51.874 1.00 40.12  ? 545 LEU B CD1 1 
ATOM   666  C  CD2 . LEU B 1 12 ? 13.115 10.531  52.045 1.00 40.18  ? 545 LEU B CD2 1 
ATOM   667  N  N   . ALA B 1 13 ? 11.527 10.374  56.608 1.00 41.81  ? 546 ALA B N   1 
ATOM   668  C  CA  . ALA B 1 13 ? 12.431 10.455  57.757 1.00 42.35  ? 546 ALA B CA  1 
ATOM   669  C  C   . ALA B 1 13 ? 12.102 9.428   58.841 1.00 46.63  ? 546 ALA B C   1 
ATOM   670  O  O   . ALA B 1 13 ? 13.008 8.989   59.541 1.00 47.54  ? 546 ALA B O   1 
ATOM   671  C  CB  . ALA B 1 13 ? 12.405 11.855  58.350 1.00 44.42  ? 546 ALA B CB  1 
ATOM   672  N  N   . SER B 1 14 ? 10.832 9.033   58.962 1.00 43.66  ? 547 SER B N   1 
ATOM   673  C  CA  . SER B 1 14 ? 10.360 8.060   59.956 1.00 45.52  ? 547 SER B CA  1 
ATOM   674  C  C   . SER B 1 14 ? 10.659 6.602   59.537 1.00 50.63  ? 547 SER B C   1 
ATOM   675  O  O   . SER B 1 14 ? 10.595 5.699   60.378 1.00 52.84  ? 547 SER B O   1 
ATOM   676  C  CB  . SER B 1 14 ? 8.866  8.241   60.220 1.00 49.70  ? 547 SER B CB  1 
ATOM   677  O  OG  . SER B 1 14 ? 8.108  7.647   59.183 1.00 62.74  ? 547 SER B OG  1 
ATOM   678  N  N   . ALA B 1 15 ? 10.977 6.381   58.242 1.00 45.22  ? 548 ALA B N   1 
ATOM   679  C  CA  . ALA B 1 15 ? 11.325 5.074   57.682 1.00 44.20  ? 548 ALA B CA  1 
ATOM   680  C  C   . ALA B 1 15 ? 12.806 4.737   57.961 1.00 48.69  ? 548 ALA B C   1 
ATOM   681  O  O   . ALA B 1 15 ? 13.624 5.663   58.036 1.00 46.34  ? 548 ALA B O   1 
ATOM   682  C  CB  . ALA B 1 15 ? 11.066 5.070   56.189 1.00 42.71  ? 548 ALA B CB  1 
ATOM   683  N  N   . PRO B 1 16 ? 13.188 3.437   58.109 1.00 46.96  ? 549 PRO B N   1 
ATOM   684  C  CA  . PRO B 1 16 ? 14.619 3.119   58.326 1.00 45.67  ? 549 PRO B CA  1 
ATOM   685  C  C   . PRO B 1 16 ? 15.484 3.609   57.168 1.00 42.71  ? 549 PRO B C   1 
ATOM   686  O  O   . PRO B 1 16 ? 15.016 3.577   56.029 1.00 41.39  ? 549 PRO B O   1 
ATOM   687  C  CB  . PRO B 1 16 ? 14.648 1.584   58.398 1.00 49.77  ? 549 PRO B CB  1 
ATOM   688  C  CG  . PRO B 1 16 ? 13.240 1.166   58.639 1.00 56.24  ? 549 PRO B CG  1 
ATOM   689  C  CD  . PRO B 1 16 ? 12.368 2.207   58.016 1.00 50.20  ? 549 PRO B CD  1 
ATOM   690  N  N   . PRO B 1 17 ? 16.736 4.052   57.420 1.00 36.80  ? 550 PRO B N   1 
ATOM   691  C  CA  . PRO B 1 17 ? 17.594 4.509   56.307 1.00 34.56  ? 550 PRO B CA  1 
ATOM   692  C  C   . PRO B 1 17 ? 17.763 3.457   55.199 1.00 39.12  ? 550 PRO B C   1 
ATOM   693  O  O   . PRO B 1 17 ? 17.833 3.823   54.022 1.00 36.84  ? 550 PRO B O   1 
ATOM   694  C  CB  . PRO B 1 17 ? 18.926 4.823   56.992 1.00 36.90  ? 550 PRO B CB  1 
ATOM   695  C  CG  . PRO B 1 17 ? 18.553 5.104   58.413 1.00 42.58  ? 550 PRO B CG  1 
ATOM   696  C  CD  . PRO B 1 17 ? 17.431 4.166   58.720 1.00 39.12  ? 550 PRO B CD  1 
ATOM   697  N  N   . GLN B 1 18 ? 17.735 2.148   55.562 1.00 37.91  ? 551 GLN B N   1 
ATOM   698  C  CA  . GLN B 1 18 ? 17.844 1.049   54.591 1.00 37.50  ? 551 GLN B CA  1 
ATOM   699  C  C   . GLN B 1 18 ? 16.731 1.073   53.568 1.00 42.42  ? 551 GLN B C   1 
ATOM   700  O  O   . GLN B 1 18 ? 16.950 0.560   52.475 1.00 43.23  ? 551 GLN B O   1 
ATOM   701  C  CB  . GLN B 1 18 ? 17.831 -0.323  55.281 1.00 40.74  ? 551 GLN B CB  1 
ATOM   702  C  CG  . GLN B 1 18 ? 19.011 -0.593  56.189 1.00 38.45  ? 551 GLN B CG  1 
ATOM   703  C  CD  . GLN B 1 18 ? 18.755 -0.215  57.615 1.00 50.21  ? 551 GLN B CD  1 
ATOM   704  O  OE1 . GLN B 1 18 ? 18.067 0.763   57.943 1.00 48.44  ? 551 GLN B OE1 1 
ATOM   705  N  NE2 . GLN B 1 18 ? 19.369 -0.947  58.499 1.00 43.83  ? 551 GLN B NE2 1 
ATOM   706  N  N   . LYS B 1 19 ? 15.549 1.662   53.895 1.00 39.73  ? 552 LYS B N   1 
ATOM   707  C  CA  . LYS B 1 19 ? 14.365 1.643   53.003 1.00 40.62  ? 552 LYS B CA  1 
ATOM   708  C  C   . LYS B 1 19 ? 14.101 2.927   52.211 1.00 43.67  ? 552 LYS B C   1 
ATOM   709  O  O   . LYS B 1 19 ? 13.302 2.902   51.269 1.00 43.36  ? 552 LYS B O   1 
ATOM   710  C  CB  . LYS B 1 19 ? 13.078 1.325   53.811 1.00 45.27  ? 552 LYS B CB  1 
ATOM   711  C  CG  . LYS B 1 19 ? 13.103 0.015   54.618 1.00 70.17  ? 552 LYS B CG  1 
ATOM   712  C  CD  . LYS B 1 19 ? 13.146 -1.258  53.752 1.00 86.48  ? 552 LYS B CD  1 
ATOM   713  C  CE  . LYS B 1 19 ? 13.907 -2.381  54.427 1.00 103.10 ? 552 LYS B CE  1 
ATOM   714  N  NZ  . LYS B 1 19 ? 15.051 -2.861  53.598 1.00 112.63 ? 552 LYS B NZ  1 
ATOM   715  N  N   . GLN B 1 20 ? 14.761 4.029   52.575 1.00 39.19  ? 553 GLN B N   1 
ATOM   716  C  CA  . GLN B 1 20 ? 14.504 5.337   51.982 1.00 37.59  ? 553 GLN B CA  1 
ATOM   717  C  C   . GLN B 1 20 ? 14.741 5.448   50.454 1.00 39.04  ? 553 GLN B C   1 
ATOM   718  O  O   . GLN B 1 20 ? 13.861 5.989   49.790 1.00 39.09  ? 553 GLN B O   1 
ATOM   719  C  CB  . GLN B 1 20 ? 15.271 6.422   52.727 1.00 38.24  ? 553 GLN B CB  1 
ATOM   720  C  CG  . GLN B 1 20 ? 14.717 6.609   54.144 1.00 34.46  ? 553 GLN B CG  1 
ATOM   721  C  CD  . GLN B 1 20 ? 15.545 7.537   54.988 1.00 41.88  ? 553 GLN B CD  1 
ATOM   722  O  OE1 . GLN B 1 20 ? 16.673 7.907   54.665 1.00 43.23  ? 553 GLN B OE1 1 
ATOM   723  N  NE2 . GLN B 1 20 ? 15.051 7.840   56.146 1.00 36.17  ? 553 GLN B NE2 1 
ATOM   724  N  N   . LYS B 1 21 ? 15.885 4.986   49.900 1.00 34.02  ? 554 LYS B N   1 
ATOM   725  C  CA  . LYS B 1 21 ? 16.085 5.065   48.444 1.00 33.03  ? 554 LYS B CA  1 
ATOM   726  C  C   . LYS B 1 21 ? 15.072 4.162   47.708 1.00 40.20  ? 554 LYS B C   1 
ATOM   727  O  O   . LYS B 1 21 ? 14.562 4.560   46.666 1.00 38.89  ? 554 LYS B O   1 
ATOM   728  C  CB  . LYS B 1 21 ? 17.521 4.723   48.024 1.00 33.07  ? 554 LYS B CB  1 
ATOM   729  C  CG  . LYS B 1 21 ? 18.587 5.727   48.490 1.00 35.69  ? 554 LYS B CG  1 
ATOM   730  C  CD  . LYS B 1 21 ? 18.479 7.111   47.842 1.00 31.98  ? 554 LYS B CD  1 
ATOM   731  C  CE  . LYS B 1 21 ? 19.652 7.977   48.195 1.00 32.23  ? 554 LYS B CE  1 
ATOM   732  N  NZ  . LYS B 1 21 ? 19.465 9.346   47.656 1.00 37.19  ? 554 LYS B NZ  1 
ATOM   733  N  N   . GLN B 1 22 ? 14.753 2.982   48.277 1.00 40.77  ? 555 GLN B N   1 
ATOM   734  C  CA  . GLN B 1 22 ? 13.773 2.044   47.725 1.00 43.38  ? 555 GLN B CA  1 
ATOM   735  C  C   . GLN B 1 22 ? 12.406 2.731   47.628 1.00 48.80  ? 555 GLN B C   1 
ATOM   736  O  O   . GLN B 1 22 ? 11.794 2.695   46.567 1.00 50.01  ? 555 GLN B O   1 
ATOM   737  C  CB  . GLN B 1 22 ? 13.697 0.757   48.587 1.00 47.22  ? 555 GLN B CB  1 
ATOM   738  C  CG  . GLN B 1 22 ? 12.758 -0.336  48.050 1.00 70.38  ? 555 GLN B CG  1 
ATOM   739  C  CD  . GLN B 1 22 ? 13.172 -0.864  46.693 1.00 96.20  ? 555 GLN B CD  1 
ATOM   740  O  OE1 . GLN B 1 22 ? 14.223 -1.498  46.541 1.00 93.68  ? 555 GLN B OE1 1 
ATOM   741  N  NE2 . GLN B 1 22 ? 12.352 -0.621  45.674 1.00 88.76  ? 555 GLN B NE2 1 
HETATM 742  N  N   . MSE B 1 23 ? 11.965 3.404   48.709 1.00 44.62  ? 556 MSE B N   1 
HETATM 743  C  CA  . MSE B 1 23 ? 10.700 4.131   48.746 1.00 45.54  ? 556 MSE B CA  1 
HETATM 744  C  C   . MSE B 1 23 ? 10.662 5.239   47.727 1.00 47.52  ? 556 MSE B C   1 
HETATM 745  O  O   . MSE B 1 23 ? 9.632  5.430   47.096 1.00 48.90  ? 556 MSE B O   1 
HETATM 746  C  CB  . MSE B 1 23 ? 10.441 4.734   50.127 1.00 48.59  ? 556 MSE B CB  1 
HETATM 747  C  CG  . MSE B 1 23 ? 10.068 3.717   51.168 1.00 57.96  ? 556 MSE B CG  1 
HETATM 748  SE SE  . MSE B 1 23 ? 9.894  4.593   52.888 0.75 67.02  ? 556 MSE B SE  1 
HETATM 749  C  CE  . MSE B 1 23 ? 8.117  5.416   52.685 1.00 64.71  ? 556 MSE B CE  1 
ATOM   750  N  N   . LEU B 1 24 ? 11.761 5.986   47.575 1.00 41.26  ? 557 LEU B N   1 
ATOM   751  C  CA  . LEU B 1 24 ? 11.806 7.068   46.598 1.00 40.44  ? 557 LEU B CA  1 
ATOM   752  C  C   . LEU B 1 24 ? 11.776 6.515   45.170 1.00 46.09  ? 557 LEU B C   1 
ATOM   753  O  O   . LEU B 1 24 ? 11.116 7.101   44.321 1.00 47.37  ? 557 LEU B O   1 
ATOM   754  C  CB  . LEU B 1 24 ? 13.020 7.968   46.811 1.00 38.02  ? 557 LEU B CB  1 
ATOM   755  C  CG  . LEU B 1 24 ? 12.954 8.878   48.022 1.00 40.80  ? 557 LEU B CG  1 
ATOM   756  C  CD1 . LEU B 1 24 ? 14.322 9.311   48.413 1.00 39.40  ? 557 LEU B CD1 1 
ATOM   757  C  CD2 . LEU B 1 24 ? 12.090 10.086  47.771 1.00 41.17  ? 557 LEU B CD2 1 
ATOM   758  N  N   . GLY B 1 25 ? 12.436 5.379   44.950 1.00 43.70  ? 558 GLY B N   1 
ATOM   759  C  CA  . GLY B 1 25 ? 12.486 4.696   43.661 1.00 45.07  ? 558 GLY B CA  1 
ATOM   760  C  C   . GLY B 1 25 ? 11.121 4.236   43.190 1.00 52.78  ? 558 GLY B C   1 
ATOM   761  O  O   . GLY B 1 25 ? 10.776 4.427   42.023 1.00 53.98  ? 558 GLY B O   1 
ATOM   762  N  N   . GLU B 1 26 ? 10.316 3.676   44.118 1.00 51.29  ? 559 GLU B N   1 
ATOM   763  C  CA  . GLU B 1 26 ? 8.949  3.197   43.877 1.00 53.70  ? 559 GLU B CA  1 
ATOM   764  C  C   . GLU B 1 26 ? 8.027  4.336   43.425 1.00 59.10  ? 559 GLU B C   1 
ATOM   765  O  O   . GLU B 1 26 ? 7.116  4.090   42.640 1.00 60.82  ? 559 GLU B O   1 
ATOM   766  C  CB  . GLU B 1 26 ? 8.377  2.515   45.127 1.00 56.22  ? 559 GLU B CB  1 
ATOM   767  C  CG  . GLU B 1 26 ? 8.968  1.128   45.353 1.00 68.17  ? 559 GLU B CG  1 
ATOM   768  C  CD  . GLU B 1 26 ? 8.767  0.447   46.695 1.00 93.21  ? 559 GLU B CD  1 
ATOM   769  O  OE1 . GLU B 1 26 ? 8.476  1.142   47.699 1.00 105.38 ? 559 GLU B OE1 1 
ATOM   770  O  OE2 . GLU B 1 26 ? 8.985  -0.786  46.753 1.00 78.72  ? 559 GLU B OE2 1 
ATOM   771  N  N   . ARG B 1 27 ? 8.278  5.568   43.893 1.00 55.36  ? 560 ARG B N   1 
ATOM   772  C  CA  . ARG B 1 27 ? 7.498  6.742   43.511 1.00 57.08  ? 560 ARG B CA  1 
ATOM   773  C  C   . ARG B 1 27 ? 8.019  7.357   42.221 1.00 62.31  ? 560 ARG B C   1 
ATOM   774  O  O   . ARG B 1 27 ? 7.223  7.829   41.414 1.00 64.29  ? 560 ARG B O   1 
ATOM   775  C  CB  . ARG B 1 27 ? 7.492  7.826   44.613 1.00 56.56  ? 560 ARG B CB  1 
ATOM   776  C  CG  . ARG B 1 27 ? 7.175  7.385   46.045 1.00 66.42  ? 560 ARG B CG  1 
ATOM   777  C  CD  . ARG B 1 27 ? 5.852  6.695   46.216 1.00 73.54  ? 560 ARG B CD  1 
ATOM   778  N  NE  . ARG B 1 27 ? 5.360  6.785   47.585 1.00 80.89  ? 560 ARG B NE  1 
ATOM   779  C  CZ  . ARG B 1 27 ? 4.388  7.607   47.959 1.00 96.06  ? 560 ARG B CZ  1 
ATOM   780  N  NH1 . ARG B 1 27 ? 3.831  8.433   47.080 1.00 76.38  ? 560 ARG B NH1 1 
ATOM   781  N  NH2 . ARG B 1 27 ? 3.971  7.618   49.217 1.00 91.90  ? 560 ARG B NH2 1 
ATOM   782  N  N   . LEU B 1 28 ? 9.347  7.401   42.048 1.00 57.24  ? 561 LEU B N   1 
ATOM   783  C  CA  . LEU B 1 28 ? 9.971  8.002   40.879 1.00 57.42  ? 561 LEU B CA  1 
ATOM   784  C  C   . LEU B 1 28 ? 9.748  7.207   39.603 1.00 63.84  ? 561 LEU B C   1 
ATOM   785  O  O   . LEU B 1 28 ? 9.467  7.810   38.570 1.00 64.63  ? 561 LEU B O   1 
ATOM   786  C  CB  . LEU B 1 28 ? 11.472 8.166   41.090 1.00 55.02  ? 561 LEU B CB  1 
ATOM   787  C  CG  . LEU B 1 28 ? 11.898 9.353   41.903 1.00 59.18  ? 561 LEU B CG  1 
ATOM   788  C  CD1 . LEU B 1 28 ? 13.314 9.154   42.389 1.00 58.29  ? 561 LEU B CD1 1 
ATOM   789  C  CD2 . LEU B 1 28 ? 11.744 10.656  41.126 1.00 61.23  ? 561 LEU B CD2 1 
ATOM   790  N  N   . PHE B 1 29 ? 9.899  5.872   39.666 1.00 61.70  ? 562 PHE B N   1 
ATOM   791  C  CA  . PHE B 1 29 ? 9.798  4.996   38.505 1.00 64.76  ? 562 PHE B CA  1 
ATOM   792  C  C   . PHE B 1 29 ? 8.509  5.202   37.663 1.00 72.21  ? 562 PHE B C   1 
ATOM   793  O  O   . PHE B 1 29 ? 8.651  5.377   36.453 1.00 72.41  ? 562 PHE B O   1 
ATOM   794  C  CB  . PHE B 1 29 ? 9.951  3.506   38.876 1.00 67.68  ? 562 PHE B CB  1 
ATOM   795  C  CG  . PHE B 1 29 ? 9.957  2.634   37.640 1.00 72.03  ? 562 PHE B CG  1 
ATOM   796  C  CD1 . PHE B 1 29 ? 11.112 2.481   36.883 1.00 75.03  ? 562 PHE B CD1 1 
ATOM   797  C  CD2 . PHE B 1 29 ? 8.787  2.029   37.189 1.00 78.09  ? 562 PHE B CD2 1 
ATOM   798  C  CE1 . PHE B 1 29 ? 11.105 1.724   35.709 1.00 78.28  ? 562 PHE B CE1 1 
ATOM   799  C  CE2 . PHE B 1 29 ? 8.777  1.281   36.009 1.00 83.56  ? 562 PHE B CE2 1 
ATOM   800  C  CZ  . PHE B 1 29 ? 9.939  1.128   35.280 1.00 80.75  ? 562 PHE B CZ  1 
ATOM   801  N  N   . PRO B 1 30 ? 7.275  5.161   38.223 1.00 71.23  ? 563 PRO B N   1 
ATOM   802  C  CA  . PRO B 1 30 ? 6.084  5.346   37.370 1.00 73.97  ? 563 PRO B CA  1 
ATOM   803  C  C   . PRO B 1 30 ? 6.034  6.704   36.681 1.00 76.31  ? 563 PRO B C   1 
ATOM   804  O  O   . PRO B 1 30 ? 5.577  6.775   35.542 1.00 79.54  ? 563 PRO B O   1 
ATOM   805  C  CB  . PRO B 1 30 ? 4.912  5.196   38.343 1.00 77.63  ? 563 PRO B CB  1 
ATOM   806  C  CG  . PRO B 1 30 ? 5.472  4.516   39.537 1.00 80.68  ? 563 PRO B CG  1 
ATOM   807  C  CD  . PRO B 1 30 ? 6.887  4.961   39.634 1.00 72.93  ? 563 PRO B CD  1 
ATOM   808  N  N   . LEU B 1 31 ? 6.514  7.762   37.349 1.00 68.74  ? 564 LEU B N   1 
ATOM   809  C  CA  . LEU B 1 31 ? 6.536  9.115   36.805 1.00 69.37  ? 564 LEU B CA  1 
ATOM   810  C  C   . LEU B 1 31 ? 7.528  9.239   35.664 1.00 74.08  ? 564 LEU B C   1 
ATOM   811  O  O   . LEU B 1 31 ? 7.196  9.832   34.636 1.00 77.27  ? 564 LEU B O   1 
ATOM   812  C  CB  . LEU B 1 31 ? 6.865  10.142  37.895 1.00 67.96  ? 564 LEU B CB  1 
ATOM   813  C  CG  . LEU B 1 31 ? 5.828  10.335  39.007 1.00 73.49  ? 564 LEU B CG  1 
ATOM   814  C  CD1 . LEU B 1 31 ? 6.359  11.267  40.068 1.00 71.92  ? 564 LEU B CD1 1 
ATOM   815  C  CD2 . LEU B 1 31 ? 4.502  10.888  38.465 1.00 78.45  ? 564 LEU B CD2 1 
ATOM   816  N  N   . ILE B 1 32 ? 8.731  8.657   35.829 1.00 68.16  ? 565 ILE B N   1 
ATOM   817  C  CA  . ILE B 1 32 ? 9.781  8.673   34.809 1.00 67.46  ? 565 ILE B CA  1 
ATOM   818  C  C   . ILE B 1 32 ? 9.312  7.841   33.601 1.00 73.49  ? 565 ILE B C   1 
ATOM   819  O  O   . ILE B 1 32 ? 9.430  8.308   32.467 1.00 73.03  ? 565 ILE B O   1 
ATOM   820  C  CB  . ILE B 1 32 ? 11.144 8.207   35.395 1.00 67.08  ? 565 ILE B CB  1 
ATOM   821  C  CG1 . ILE B 1 32 ? 11.650 9.251   36.425 1.00 65.86  ? 565 ILE B CG1 1 
ATOM   822  C  CG2 . ILE B 1 32 ? 12.189 7.974   34.287 1.00 67.24  ? 565 ILE B CG2 1 
ATOM   823  C  CD1 . ILE B 1 32 ? 12.831 8.824   37.313 1.00 68.80  ? 565 ILE B CD1 1 
ATOM   824  N  N   . GLN B 1 33 ? 8.724  6.651   33.862 1.00 72.53  ? 566 GLN B N   1 
ATOM   825  C  CA  . GLN B 1 33 ? 8.200  5.745   32.845 1.00 76.03  ? 566 GLN B CA  1 
ATOM   826  C  C   . GLN B 1 33 ? 7.127  6.441   31.992 1.00 86.72  ? 566 GLN B C   1 
ATOM   827  O  O   . GLN B 1 33 ? 7.077  6.195   30.791 1.00 87.95  ? 566 GLN B O   1 
ATOM   828  C  CB  . GLN B 1 33 ? 7.647  4.471   33.493 1.00 77.62  ? 566 GLN B CB  1 
ATOM   829  C  CG  . GLN B 1 33 ? 7.229  3.393   32.499 1.00 85.06  ? 566 GLN B CG  1 
ATOM   830  C  CD  . GLN B 1 33 ? 6.728  2.151   33.186 1.00 93.78  ? 566 GLN B CD  1 
ATOM   831  O  OE1 . GLN B 1 33 ? 7.188  1.040   32.908 1.00 86.40  ? 566 GLN B OE1 1 
ATOM   832  N  NE2 . GLN B 1 33 ? 5.780  2.309   34.102 1.00 84.06  ? 566 GLN B NE2 1 
ATOM   833  N  N   . ALA B 1 34 ? 6.311  7.335   32.598 1.00 87.40  ? 567 ALA B N   1 
ATOM   834  C  CA  . ALA B 1 34 ? 5.270  8.092   31.889 1.00 92.30  ? 567 ALA B CA  1 
ATOM   835  C  C   . ALA B 1 34 ? 5.857  9.028   30.806 1.00 100.33 ? 567 ALA B C   1 
ATOM   836  O  O   . ALA B 1 34 ? 5.264  9.126   29.731 1.00 104.04 ? 567 ALA B O   1 
ATOM   837  C  CB  . ALA B 1 34 ? 4.431  8.894   32.871 1.00 93.62  ? 567 ALA B CB  1 
HETATM 838  N  N   . MSE B 1 35 ? 7.014  9.679   31.059 1.00 95.57  ? 568 MSE B N   1 
HETATM 839  C  CA  . MSE B 1 35 ? 7.625  10.593  30.078 1.00 97.47  ? 568 MSE B CA  1 
HETATM 840  C  C   . MSE B 1 35 ? 8.783  9.946   29.278 1.00 99.63  ? 568 MSE B C   1 
HETATM 841  O  O   . MSE B 1 35 ? 9.139  10.472  28.224 1.00 102.01 ? 568 MSE B O   1 
HETATM 842  C  CB  . MSE B 1 35 ? 8.091  11.907  30.742 1.00 99.45  ? 568 MSE B CB  1 
HETATM 843  C  CG  . MSE B 1 35 ? 9.177  11.737  31.803 1.00 103.15 ? 568 MSE B CG  1 
HETATM 844  SE SE  . MSE B 1 35 ? 9.452  13.352  32.880 0.75 112.13 ? 568 MSE B SE  1 
HETATM 845  C  CE  . MSE B 1 35 ? 8.021  13.109  34.222 1.00 108.76 ? 568 MSE B CE  1 
ATOM   846  N  N   . HIS B 1 36 ? 9.352  8.820   29.766 1.00 91.95  ? 569 HIS B N   1 
ATOM   847  C  CA  . HIS B 1 36 ? 10.458 8.089   29.124 1.00 89.99  ? 569 HIS B CA  1 
ATOM   848  C  C   . HIS B 1 36 ? 10.345 6.580   29.394 1.00 93.72  ? 569 HIS B C   1 
ATOM   849  O  O   . HIS B 1 36 ? 11.131 6.057   30.187 1.00 90.52  ? 569 HIS B O   1 
ATOM   850  C  CB  . HIS B 1 36 ? 11.794 8.611   29.647 1.00 87.38  ? 569 HIS B CB  1 
ATOM   851  C  CG  . HIS B 1 36 ? 12.596 9.305   28.617 1.00 91.93  ? 569 HIS B CG  1 
ATOM   852  N  ND1 . HIS B 1 36 ? 13.339 8.599   27.696 1.00 94.27  ? 569 HIS B ND1 1 
ATOM   853  C  CD2 . HIS B 1 36 ? 12.765 10.629  28.405 1.00 95.13  ? 569 HIS B CD2 1 
ATOM   854  C  CE1 . HIS B 1 36 ? 13.925 9.511   26.937 1.00 95.53  ? 569 HIS B CE1 1 
ATOM   855  N  NE2 . HIS B 1 36 ? 13.611 10.749  27.330 1.00 96.55  ? 569 HIS B NE2 1 
ATOM   856  N  N   . PRO B 1 37 ? 9.401  5.846   28.747 1.00 93.40  ? 570 PRO B N   1 
ATOM   857  C  CA  . PRO B 1 37 ? 9.229  4.413   29.082 1.00 93.06  ? 570 PRO B CA  1 
ATOM   858  C  C   . PRO B 1 37 ? 10.421 3.519   28.749 1.00 95.70  ? 570 PRO B C   1 
ATOM   859  O  O   . PRO B 1 37 ? 10.574 2.455   29.360 1.00 94.74  ? 570 PRO B O   1 
ATOM   860  C  CB  . PRO B 1 37 ? 8.002  4.001   28.265 1.00 98.66  ? 570 PRO B CB  1 
ATOM   861  C  CG  . PRO B 1 37 ? 7.902  5.017   27.185 1.00 105.12 ? 570 PRO B CG  1 
ATOM   862  C  CD  . PRO B 1 37 ? 8.389  6.293   27.769 1.00 98.42  ? 570 PRO B CD  1 
ATOM   863  N  N   . THR B 1 38 ? 11.261 3.978   27.809 1.00 91.89  ? 571 THR B N   1 
ATOM   864  C  CA  . THR B 1 38 ? 12.426 3.292   27.267 1.00 91.11  ? 571 THR B CA  1 
ATOM   865  C  C   . THR B 1 38 ? 13.475 2.974   28.387 1.00 91.68  ? 571 THR B C   1 
ATOM   866  O  O   . THR B 1 38 ? 13.446 1.862   28.935 1.00 91.63  ? 571 THR B O   1 
ATOM   867  C  CB  . THR B 1 38 ? 12.977 4.074   26.039 1.00 97.58  ? 571 THR B CB  1 
ATOM   868  O  OG1 . THR B 1 38 ? 14.248 3.561   25.649 1.00 97.40  ? 571 THR B OG1 1 
ATOM   869  C  CG2 . THR B 1 38 ? 13.054 5.587   26.255 1.00 93.90  ? 571 THR B CG2 1 
ATOM   870  N  N   . LEU B 1 39 ? 14.369 3.913   28.734 1.00 84.39  ? 572 LEU B N   1 
ATOM   871  C  CA  . LEU B 1 39 ? 15.394 3.629   29.728 1.00 81.05  ? 572 LEU B CA  1 
ATOM   872  C  C   . LEU B 1 39 ? 14.993 4.173   31.107 1.00 82.41  ? 572 LEU B C   1 
ATOM   873  O  O   . LEU B 1 39 ? 15.833 4.704   31.834 1.00 81.03  ? 572 LEU B O   1 
ATOM   874  C  CB  . LEU B 1 39 ? 16.737 4.196   29.258 1.00 80.73  ? 572 LEU B CB  1 
ATOM   875  C  CG  . LEU B 1 39 ? 17.233 3.656   27.920 1.00 87.40  ? 572 LEU B CG  1 
ATOM   876  C  CD1 . LEU B 1 39 ? 17.595 4.783   26.972 1.00 88.53  ? 572 LEU B CD1 1 
ATOM   877  C  CD2 . LEU B 1 39 ? 18.378 2.683   28.109 1.00 89.71  ? 572 LEU B CD2 1 
ATOM   878  N  N   . ALA B 1 40 ? 13.708 3.980   31.479 1.00 77.88  ? 573 ALA B N   1 
ATOM   879  C  CA  . ALA B 1 40 ? 13.097 4.413   32.739 1.00 75.11  ? 573 ALA B CA  1 
ATOM   880  C  C   . ALA B 1 40 ? 13.831 3.857   33.960 1.00 74.17  ? 573 ALA B C   1 
ATOM   881  O  O   . ALA B 1 40 ? 14.050 4.594   34.927 1.00 70.85  ? 573 ALA B O   1 
ATOM   882  C  CB  . ALA B 1 40 ? 11.640 3.977   32.778 1.00 77.72  ? 573 ALA B CB  1 
ATOM   883  N  N   . GLY B 1 41 ? 14.192 2.570   33.892 1.00 69.51  ? 574 GLY B N   1 
ATOM   884  C  CA  . GLY B 1 41 ? 14.907 1.868   34.949 1.00 67.09  ? 574 GLY B CA  1 
ATOM   885  C  C   . GLY B 1 41 ? 16.270 2.471   35.213 1.00 67.87  ? 574 GLY B C   1 
ATOM   886  O  O   . GLY B 1 41 ? 16.641 2.678   36.375 1.00 67.51  ? 574 GLY B O   1 
ATOM   887  N  N   . LYS B 1 42 ? 17.006 2.791   34.128 1.00 62.05  ? 575 LYS B N   1 
ATOM   888  C  CA  . LYS B 1 42 ? 18.330 3.404   34.191 1.00 59.44  ? 575 LYS B CA  1 
ATOM   889  C  C   . LYS B 1 42 ? 18.234 4.821   34.722 1.00 58.52  ? 575 LYS B C   1 
ATOM   890  O  O   . LYS B 1 42 ? 19.000 5.166   35.616 1.00 57.35  ? 575 LYS B O   1 
ATOM   891  C  CB  . LYS B 1 42 ? 19.032 3.394   32.828 1.00 62.43  ? 575 LYS B CB  1 
ATOM   892  C  CG  . LYS B 1 42 ? 19.753 2.100   32.555 1.00 66.36  ? 575 LYS B CG  1 
ATOM   893  C  CD  . LYS B 1 42 ? 20.530 2.166   31.273 1.00 75.52  ? 575 LYS B CD  1 
ATOM   894  C  CE  . LYS B 1 42 ? 21.150 0.823   30.957 1.00 92.60  ? 575 LYS B CE  1 
ATOM   895  N  NZ  . LYS B 1 42 ? 22.188 0.907   29.881 1.00 103.81 ? 575 LYS B NZ  1 
ATOM   896  N  N   . ILE B 1 43 ? 17.279 5.623   34.214 1.00 52.39  ? 576 ILE B N   1 
ATOM   897  C  CA  . ILE B 1 43 ? 17.079 7.012   34.647 1.00 50.51  ? 576 ILE B CA  1 
ATOM   898  C  C   . ILE B 1 43 ? 16.749 7.055   36.153 1.00 50.90  ? 576 ILE B C   1 
ATOM   899  O  O   . ILE B 1 43 ? 17.359 7.840   36.878 1.00 49.56  ? 576 ILE B O   1 
ATOM   900  C  CB  . ILE B 1 43 ? 16.008 7.742   33.788 1.00 54.80  ? 576 ILE B CB  1 
ATOM   901  C  CG1 . ILE B 1 43 ? 16.478 7.832   32.318 1.00 56.80  ? 576 ILE B CG1 1 
ATOM   902  C  CG2 . ILE B 1 43 ? 15.724 9.153   34.347 1.00 54.27  ? 576 ILE B CG2 1 
ATOM   903  C  CD1 . ILE B 1 43 ? 15.371 8.121   31.290 1.00 64.62  ? 576 ILE B CD1 1 
ATOM   904  N  N   . THR B 1 44 ? 15.840 6.179   36.617 1.00 47.01  ? 577 THR B N   1 
ATOM   905  C  CA  . THR B 1 44 ? 15.437 6.089   38.019 1.00 46.14  ? 577 THR B CA  1 
ATOM   906  C  C   . THR B 1 44 ? 16.660 5.824   38.892 1.00 48.29  ? 577 THR B C   1 
ATOM   907  O  O   . THR B 1 44 ? 16.891 6.570   39.852 1.00 46.12  ? 577 THR B O   1 
ATOM   908  C  CB  . THR B 1 44 ? 14.349 5.020   38.213 1.00 55.10  ? 577 THR B CB  1 
ATOM   909  O  OG1 . THR B 1 44 ? 13.228 5.380   37.410 1.00 57.71  ? 577 THR B OG1 1 
ATOM   910  C  CG2 . THR B 1 44 ? 13.913 4.874   39.680 1.00 49.69  ? 577 THR B CG2 1 
ATOM   911  N  N   . GLY B 1 45 ? 17.441 4.808   38.515 1.00 44.69  ? 578 GLY B N   1 
ATOM   912  C  CA  . GLY B 1 45 ? 18.651 4.415   39.225 1.00 43.75  ? 578 GLY B CA  1 
ATOM   913  C  C   . GLY B 1 45 ? 19.638 5.552   39.339 1.00 45.96  ? 578 GLY B C   1 
ATOM   914  O  O   . GLY B 1 45 ? 20.238 5.733   40.395 1.00 45.38  ? 578 GLY B O   1 
HETATM 915  N  N   . MSE B 1 46 ? 19.790 6.331   38.241 1.00 41.48  ? 579 MSE B N   1 
HETATM 916  C  CA  A MSE B 1 46 ? 20.696 7.484   38.179 0.50 39.32  ? 579 MSE B CA  1 
HETATM 917  C  CA  B MSE B 1 46 ? 20.697 7.476   38.167 0.50 41.79  ? 579 MSE B CA  1 
HETATM 918  C  C   . MSE B 1 46 ? 20.230 8.599   39.101 1.00 44.56  ? 579 MSE B C   1 
HETATM 919  O  O   . MSE B 1 46 ? 21.030 9.112   39.883 1.00 44.01  ? 579 MSE B O   1 
HETATM 920  C  CB  A MSE B 1 46 ? 20.787 8.008   36.743 0.50 41.21  ? 579 MSE B CB  1 
HETATM 921  C  CB  B MSE B 1 46 ? 20.804 7.990   36.720 0.50 45.61  ? 579 MSE B CB  1 
HETATM 922  C  CG  A MSE B 1 46 ? 21.358 6.996   35.805 0.50 47.00  ? 579 MSE B CG  1 
HETATM 923  C  CG  B MSE B 1 46 ? 21.852 9.076   36.570 0.50 54.51  ? 579 MSE B CG  1 
HETATM 924  SE SE  A MSE B 1 46 ? 20.950 7.292   33.951 0.37 54.78  ? 579 MSE B SE  1 
HETATM 925  SE SE  B MSE B 1 46 ? 22.438 9.596   34.776 0.38 66.32  ? 579 MSE B SE  1 
HETATM 926  C  CE  A MSE B 1 46 ? 22.382 8.520   33.667 0.50 52.73  ? 579 MSE B CE  1 
HETATM 927  C  CE  B MSE B 1 46 ? 22.873 7.861   34.044 0.50 63.25  ? 579 MSE B CE  1 
ATOM   928  N  N   . LEU B 1 47 ? 18.932 8.975   39.005 1.00 41.77  ? 580 LEU B N   1 
ATOM   929  C  CA  . LEU B 1 47 ? 18.332 10.043  39.804 1.00 41.95  ? 580 LEU B CA  1 
ATOM   930  C  C   . LEU B 1 47 ? 18.297 9.692   41.287 1.00 43.55  ? 580 LEU B C   1 
ATOM   931  O  O   . LEU B 1 47 ? 18.324 10.605  42.098 1.00 42.73  ? 580 LEU B O   1 
ATOM   932  C  CB  . LEU B 1 47 ? 16.918 10.424  39.295 1.00 42.88  ? 580 LEU B CB  1 
ATOM   933  C  CG  . LEU B 1 47 ? 16.816 10.988  37.861 1.00 48.93  ? 580 LEU B CG  1 
ATOM   934  C  CD1 . LEU B 1 47 ? 15.435 11.570  37.592 1.00 50.21  ? 580 LEU B CD1 1 
ATOM   935  C  CD2 . LEU B 1 47 ? 17.902 12.030  37.586 1.00 50.67  ? 580 LEU B CD2 1 
ATOM   936  N  N   . LEU B 1 48 ? 18.331 8.388   41.652 1.00 39.04  ? 581 LEU B N   1 
ATOM   937  C  CA  . LEU B 1 48 ? 18.348 7.979   43.069 1.00 37.03  ? 581 LEU B CA  1 
ATOM   938  C  C   . LEU B 1 48 ? 19.654 8.316   43.748 1.00 39.38  ? 581 LEU B C   1 
ATOM   939  O  O   . LEU B 1 48 ? 19.729 8.201   44.963 1.00 39.43  ? 581 LEU B O   1 
ATOM   940  C  CB  . LEU B 1 48 ? 18.038 6.503   43.264 1.00 36.42  ? 581 LEU B CB  1 
ATOM   941  C  CG  . LEU B 1 48 ? 16.583 6.124   43.143 1.00 40.65  ? 581 LEU B CG  1 
ATOM   942  C  CD1 . LEU B 1 48 ? 16.438 4.620   43.116 1.00 41.49  ? 581 LEU B CD1 1 
ATOM   943  C  CD2 . LEU B 1 48 ? 15.749 6.744   44.261 1.00 39.48  ? 581 LEU B CD2 1 
ATOM   944  N  N   . GLU B 1 49 ? 20.661 8.785   42.992 1.00 35.88  ? 582 GLU B N   1 
ATOM   945  C  CA  . GLU B 1 49 ? 21.939 9.211   43.563 1.00 35.72  ? 582 GLU B CA  1 
ATOM   946  C  C   . GLU B 1 49 ? 21.823 10.613  44.164 1.00 39.45  ? 582 GLU B C   1 
ATOM   947  O  O   . GLU B 1 49 ? 22.660 10.999  44.969 1.00 40.95  ? 582 GLU B O   1 
ATOM   948  C  CB  . GLU B 1 49 ? 23.045 9.177   42.511 1.00 38.31  ? 582 GLU B CB  1 
ATOM   949  C  CG  . GLU B 1 49 ? 23.317 7.800   41.913 1.00 46.62  ? 582 GLU B CG  1 
ATOM   950  C  CD  . GLU B 1 49 ? 24.047 6.802   42.778 1.00 55.09  ? 582 GLU B CD  1 
ATOM   951  O  OE1 . GLU B 1 49 ? 24.464 7.172   43.897 1.00 46.89  ? 582 GLU B OE1 1 
ATOM   952  O  OE2 . GLU B 1 49 ? 24.215 5.646   42.328 1.00 57.70  ? 582 GLU B OE2 1 
ATOM   953  N  N   . ILE B 1 50 ? 20.803 11.384  43.745 1.00 35.96  ? 583 ILE B N   1 
ATOM   954  C  CA  . ILE B 1 50 ? 20.520 12.741  44.227 1.00 36.20  ? 583 ILE B CA  1 
ATOM   955  C  C   . ILE B 1 50 ? 20.096 12.662  45.704 1.00 39.64  ? 583 ILE B C   1 
ATOM   956  O  O   . ILE B 1 50 ? 19.492 11.660  46.112 1.00 37.32  ? 583 ILE B O   1 
ATOM   957  C  CB  . ILE B 1 50 ? 19.400 13.378  43.330 1.00 39.14  ? 583 ILE B CB  1 
ATOM   958  C  CG1 . ILE B 1 50 ? 19.862 13.567  41.875 1.00 39.56  ? 583 ILE B CG1 1 
ATOM   959  C  CG2 . ILE B 1 50 ? 18.878 14.689  43.911 1.00 40.65  ? 583 ILE B CG2 1 
ATOM   960  C  CD1 . ILE B 1 50 ? 18.705 13.919  40.860 1.00 43.38  ? 583 ILE B CD1 1 
ATOM   961  N  N   . ASP B 1 51 ? 20.403 13.717  46.497 1.00 39.73  ? 584 ASP B N   1 
ATOM   962  C  CA  A ASP B 1 51 ? 20.022 13.784  47.908 0.50 39.75  ? 584 ASP B CA  1 
ATOM   963  C  CA  B ASP B 1 51 ? 20.011 13.791  47.914 0.50 40.02  ? 584 ASP B CA  1 
ATOM   964  C  C   . ASP B 1 51 ? 18.500 13.632  48.037 1.00 41.91  ? 584 ASP B C   1 
ATOM   965  O  O   . ASP B 1 51 ? 17.758 14.163  47.213 1.00 39.70  ? 584 ASP B O   1 
ATOM   966  C  CB  A ASP B 1 51 ? 20.512 15.098  48.546 0.50 44.47  ? 584 ASP B CB  1 
ATOM   967  C  CB  B ASP B 1 51 ? 20.471 15.113  48.566 0.50 45.09  ? 584 ASP B CB  1 
ATOM   968  C  CG  A ASP B 1 51 ? 22.028 15.240  48.613 0.50 60.12  ? 584 ASP B CG  1 
ATOM   969  C  CG  B ASP B 1 51 ? 20.227 15.201  50.072 0.50 63.44  ? 584 ASP B CG  1 
ATOM   970  O  OD1 A ASP B 1 51 ? 22.679 14.411  49.301 0.50 60.43  ? 584 ASP B OD1 1 
ATOM   971  O  OD1 B ASP B 1 51 ? 20.775 14.345  50.821 0.50 64.23  ? 584 ASP B OD1 1 
ATOM   972  O  OD2 A ASP B 1 51 ? 22.562 16.197  48.008 0.50 69.02  ? 584 ASP B OD2 1 
ATOM   973  O  OD2 B ASP B 1 51 ? 19.528 16.146  50.507 0.50 73.19  ? 584 ASP B OD2 1 
ATOM   974  N  N   . ASN B 1 52 ? 18.051 12.865  49.046 1.00 39.57  ? 585 ASN B N   1 
ATOM   975  C  CA  . ASN B 1 52 ? 16.643 12.557  49.335 1.00 38.79  ? 585 ASN B CA  1 
ATOM   976  C  C   . ASN B 1 52 ? 15.740 13.798  49.392 1.00 43.45  ? 585 ASN B C   1 
ATOM   977  O  O   . ASN B 1 52 ? 14.625 13.705  48.901 1.00 42.14  ? 585 ASN B O   1 
ATOM   978  C  CB  . ASN B 1 52 ? 16.528 11.770  50.647 1.00 35.93  ? 585 ASN B CB  1 
ATOM   979  C  CG  . ASN B 1 52 ? 17.035 10.357  50.556 1.00 48.69  ? 585 ASN B CG  1 
ATOM   980  O  OD1 . ASN B 1 52 ? 17.436 9.874   49.491 1.00 38.29  ? 585 ASN B OD1 1 
ATOM   981  N  ND2 . ASN B 1 52 ? 16.996 9.647   51.667 1.00 35.53  ? 585 ASN B ND2 1 
ATOM   982  N  N   . SER B 1 53 ? 16.204 14.937  49.978 1.00 44.40  ? 586 SER B N   1 
ATOM   983  C  CA  . SER B 1 53 ? 15.391 16.174  50.060 1.00 48.08  ? 586 SER B CA  1 
ATOM   984  C  C   . SER B 1 53 ? 15.089 16.717  48.664 1.00 55.07  ? 586 SER B C   1 
ATOM   985  O  O   . SER B 1 53 ? 13.944 17.102  48.384 1.00 58.30  ? 586 SER B O   1 
ATOM   986  C  CB  . SER B 1 53 ? 16.063 17.266  50.895 1.00 54.36  ? 586 SER B CB  1 
ATOM   987  O  OG  . SER B 1 53 ? 17.133 16.864  51.737 1.00 67.61  ? 586 SER B OG  1 
ATOM   988  N  N   . GLU B 1 54 ? 16.101 16.709  47.780 1.00 50.05  ? 587 GLU B N   1 
ATOM   989  C  CA  . GLU B 1 54 ? 15.955 17.181  46.412 1.00 51.16  ? 587 GLU B CA  1 
ATOM   990  C  C   . GLU B 1 54 ? 15.049 16.226  45.623 1.00 53.05  ? 587 GLU B C   1 
ATOM   991  O  O   . GLU B 1 54 ? 14.230 16.688  44.828 1.00 55.64  ? 587 GLU B O   1 
ATOM   992  C  CB  . GLU B 1 54 ? 17.337 17.377  45.771 1.00 53.31  ? 587 GLU B CB  1 
ATOM   993  C  CG  . GLU B 1 54 ? 17.352 18.070  44.414 1.00 70.74  ? 587 GLU B CG  1 
ATOM   994  C  CD  . GLU B 1 54 ? 16.598 19.377  44.215 1.00 96.84  ? 587 GLU B CD  1 
ATOM   995  O  OE1 . GLU B 1 54 ? 16.514 20.186  45.169 1.00 90.90  ? 587 GLU B OE1 1 
ATOM   996  O  OE2 . GLU B 1 54 ? 16.147 19.617  43.070 1.00 92.35  ? 587 GLU B OE2 1 
ATOM   997  N  N   . LEU B 1 55 ? 15.110 14.923  45.917 1.00 45.29  ? 588 LEU B N   1 
ATOM   998  C  CA  . LEU B 1 55 ? 14.231 13.945  45.279 1.00 43.89  ? 588 LEU B CA  1 
ATOM   999  C  C   . LEU B 1 55 ? 12.761 14.157  45.685 1.00 51.46  ? 588 LEU B C   1 
ATOM   1000 O  O   . LEU B 1 55 ? 11.868 13.983  44.860 1.00 53.40  ? 588 LEU B O   1 
ATOM   1001 C  CB  . LEU B 1 55 ? 14.672 12.505  45.612 1.00 41.11  ? 588 LEU B CB  1 
ATOM   1002 C  CG  . LEU B 1 55 ? 15.907 11.977  44.856 1.00 42.58  ? 588 LEU B CG  1 
ATOM   1003 C  CD1 . LEU B 1 55 ? 16.336 10.619  45.382 1.00 39.21  ? 588 LEU B CD1 1 
ATOM   1004 C  CD2 . LEU B 1 55 ? 15.641 11.927  43.350 1.00 42.03  ? 588 LEU B CD2 1 
ATOM   1005 N  N   . LEU B 1 56 ? 12.509 14.528  46.949 1.00 48.80  ? 589 LEU B N   1 
ATOM   1006 C  CA  . LEU B 1 56 ? 11.147 14.757  47.444 1.00 49.53  ? 589 LEU B CA  1 
ATOM   1007 C  C   . LEU B 1 56 ? 10.540 15.973  46.755 1.00 57.92  ? 589 LEU B C   1 
ATOM   1008 O  O   . LEU B 1 56 ? 9.353  15.944  46.416 1.00 58.17  ? 589 LEU B O   1 
ATOM   1009 C  CB  . LEU B 1 56 ? 11.126 14.923  48.973 1.00 48.57  ? 589 LEU B CB  1 
ATOM   1010 C  CG  . LEU B 1 56 ? 11.379 13.670  49.780 1.00 49.36  ? 589 LEU B CG  1 
ATOM   1011 C  CD1 . LEU B 1 56 ? 11.838 14.024  51.165 1.00 49.61  ? 589 LEU B CD1 1 
ATOM   1012 C  CD2 . LEU B 1 56 ? 10.165 12.766  49.806 1.00 47.82  ? 589 LEU B CD2 1 
ATOM   1013 N  N   . TYR B 1 57 ? 11.367 17.023  46.525 1.00 58.29  ? 590 TYR B N   1 
ATOM   1014 C  CA  . TYR B 1 57 ? 10.965 18.223  45.792 1.00 62.85  ? 590 TYR B CA  1 
ATOM   1015 C  C   . TYR B 1 57 ? 10.594 17.841  44.340 1.00 67.30  ? 590 TYR B C   1 
ATOM   1016 O  O   . TYR B 1 57 ? 9.549  18.265  43.841 1.00 71.37  ? 590 TYR B O   1 
ATOM   1017 C  CB  . TYR B 1 57 ? 12.077 19.285  45.826 1.00 66.97  ? 590 TYR B CB  1 
ATOM   1018 C  CG  . TYR B 1 57 ? 11.859 20.422  44.846 1.00 75.20  ? 590 TYR B CG  1 
ATOM   1019 C  CD1 . TYR B 1 57 ? 10.969 21.455  45.129 1.00 81.23  ? 590 TYR B CD1 1 
ATOM   1020 C  CD2 . TYR B 1 57 ? 12.545 20.466  43.636 1.00 77.25  ? 590 TYR B CD2 1 
ATOM   1021 C  CE1 . TYR B 1 57 ? 10.763 22.501  44.226 1.00 86.78  ? 590 TYR B CE1 1 
ATOM   1022 C  CE2 . TYR B 1 57 ? 12.355 21.511  42.732 1.00 82.49  ? 590 TYR B CE2 1 
ATOM   1023 C  CZ  . TYR B 1 57 ? 11.456 22.522  43.025 1.00 95.18  ? 590 TYR B CZ  1 
ATOM   1024 O  OH  . TYR B 1 57 ? 11.264 23.531  42.107 1.00 101.87 ? 590 TYR B OH  1 
HETATM 1025 N  N   . MSE B 1 58 ? 11.449 17.023  43.700 1.00 59.22  ? 591 MSE B N   1 
HETATM 1026 C  CA  A MSE B 1 58 ? 11.265 16.560  42.327 0.50 58.76  ? 591 MSE B CA  1 
HETATM 1027 C  CA  B MSE B 1 58 ? 11.306 16.493  42.342 0.50 59.04  ? 591 MSE B CA  1 
HETATM 1028 C  C   . MSE B 1 58 ? 10.006 15.715  42.170 1.00 65.96  ? 591 MSE B C   1 
HETATM 1029 O  O   . MSE B 1 58 ? 9.384  15.767  41.105 1.00 67.88  ? 591 MSE B O   1 
HETATM 1030 C  CB  A MSE B 1 58 ? 12.484 15.781  41.851 0.50 57.71  ? 591 MSE B CB  1 
HETATM 1031 C  CB  B MSE B 1 58 ? 12.477 15.558  42.052 0.50 57.98  ? 591 MSE B CB  1 
HETATM 1032 C  CG  A MSE B 1 58 ? 13.623 16.681  41.424 0.50 65.00  ? 591 MSE B CG  1 
HETATM 1033 C  CG  B MSE B 1 58 ? 13.216 15.883  40.801 0.50 65.67  ? 591 MSE B CG  1 
HETATM 1034 SE SE  A MSE B 1 58 ? 15.328 15.752  41.443 0.38 69.48  ? 591 MSE B SE  1 
HETATM 1035 SE SE  B MSE B 1 58 ? 14.900 14.928  40.838 0.37 70.32  ? 591 MSE B SE  1 
HETATM 1036 C  CE  A MSE B 1 58 ? 14.897 14.201  40.293 0.50 64.67  ? 591 MSE B CE  1 
HETATM 1037 C  CE  B MSE B 1 58 ? 15.922 16.269  41.730 0.50 68.19  ? 591 MSE B CE  1 
ATOM   1038 N  N   . LEU B 1 59 ? 9.604  14.963  43.213 1.00 64.08  ? 592 LEU B N   1 
ATOM   1039 C  CA  . LEU B 1 59 ? 8.368  14.180  43.165 1.00 65.93  ? 592 LEU B CA  1 
ATOM   1040 C  C   . LEU B 1 59 ? 7.106  15.095  43.198 1.00 74.12  ? 592 LEU B C   1 
ATOM   1041 O  O   . LEU B 1 59 ? 6.042  14.687  42.712 1.00 74.52  ? 592 LEU B O   1 
ATOM   1042 C  CB  . LEU B 1 59 ? 8.321  13.194  44.329 1.00 64.29  ? 592 LEU B CB  1 
ATOM   1043 C  CG  . LEU B 1 59 ? 9.151  11.937  44.188 1.00 66.52  ? 592 LEU B CG  1 
ATOM   1044 C  CD1 . LEU B 1 59 ? 9.201  11.181  45.511 1.00 65.32  ? 592 LEU B CD1 1 
ATOM   1045 C  CD2 . LEU B 1 59 ? 8.594  11.031  43.103 1.00 69.22  ? 592 LEU B CD2 1 
ATOM   1046 N  N   . GLU B 1 60 ? 7.239  16.323  43.768 1.00 73.11  ? 593 GLU B N   1 
ATOM   1047 C  CA  . GLU B 1 60 ? 6.135  17.285  43.868 1.00 78.14  ? 593 GLU B CA  1 
ATOM   1048 C  C   . GLU B 1 60 ? 6.163  18.321  42.706 1.00 86.53  ? 593 GLU B C   1 
ATOM   1049 O  O   . GLU B 1 60 ? 5.100  18.843  42.352 1.00 90.29  ? 593 GLU B O   1 
ATOM   1050 C  CB  . GLU B 1 60 ? 6.102  17.987  45.257 1.00 80.18  ? 593 GLU B CB  1 
ATOM   1051 C  CG  . GLU B 1 60 ? 7.074  19.150  45.477 1.00 93.18  ? 593 GLU B CG  1 
ATOM   1052 C  CD  . GLU B 1 60 ? 7.082  19.865  46.825 1.00 120.83 ? 593 GLU B CD  1 
ATOM   1053 O  OE1 . GLU B 1 60 ? 6.362  19.433  47.756 1.00 118.83 ? 593 GLU B OE1 1 
ATOM   1054 O  OE2 . GLU B 1 60 ? 7.831  20.862  46.950 1.00 115.51 ? 593 GLU B OE2 1 
ATOM   1055 N  N   . SER B 1 61 ? 7.369  18.612  42.130 1.00 80.79  ? 594 SER B N   1 
ATOM   1056 C  CA  . SER B 1 61 ? 7.581  19.576  41.039 1.00 82.45  ? 594 SER B CA  1 
ATOM   1057 C  C   . SER B 1 61 ? 7.778  18.828  39.685 1.00 85.62  ? 594 SER B C   1 
ATOM   1058 O  O   . SER B 1 61 ? 8.820  18.207  39.477 1.00 82.73  ? 594 SER B O   1 
ATOM   1059 C  CB  . SER B 1 61 ? 8.764  20.492  41.367 1.00 83.34  ? 594 SER B CB  1 
ATOM   1060 O  OG  . SER B 1 61 ? 9.204  21.292  40.281 1.00 88.87  ? 594 SER B OG  1 
ATOM   1061 N  N   . PRO B 1 62 ? 6.791  18.851  38.752 1.00 84.62  ? 595 PRO B N   1 
ATOM   1062 C  CA  . PRO B 1 62 ? 6.963  18.111  37.477 1.00 83.67  ? 595 PRO B CA  1 
ATOM   1063 C  C   . PRO B 1 62 ? 8.033  18.737  36.576 1.00 87.90  ? 595 PRO B C   1 
ATOM   1064 O  O   . PRO B 1 62 ? 8.662  18.041  35.767 1.00 84.79  ? 595 PRO B O   1 
ATOM   1065 C  CB  . PRO B 1 62 ? 5.576  18.181  36.838 1.00 89.00  ? 595 PRO B CB  1 
ATOM   1066 C  CG  . PRO B 1 62 ? 4.649  18.628  37.954 1.00 94.76  ? 595 PRO B CG  1 
ATOM   1067 C  CD  . PRO B 1 62 ? 5.473  19.512  38.808 1.00 89.42  ? 595 PRO B CD  1 
ATOM   1068 N  N   . GLU B 1 63 ? 8.256  20.054  36.786 1.00 87.95  ? 596 GLU B N   1 
ATOM   1069 C  CA  . GLU B 1 63 ? 9.220  20.949  36.143 1.00 90.03  ? 596 GLU B CA  1 
ATOM   1070 C  C   . GLU B 1 63 ? 10.631 20.423  36.350 1.00 88.24  ? 596 GLU B C   1 
ATOM   1071 O  O   . GLU B 1 63 ? 11.319 20.075  35.383 1.00 87.43  ? 596 GLU B O   1 
ATOM   1072 C  CB  . GLU B 1 63 ? 9.070  22.371  36.747 1.00 95.60  ? 596 GLU B CB  1 
ATOM   1073 C  CG  . GLU B 1 63 ? 10.016 23.441  36.207 1.00 112.56 ? 596 GLU B CG  1 
ATOM   1074 C  CD  . GLU B 1 63 ? 9.856  24.823  36.823 1.00 144.24 ? 596 GLU B CD  1 
ATOM   1075 O  OE1 . GLU B 1 63 ? 9.858  24.932  38.072 1.00 143.30 ? 596 GLU B OE1 1 
ATOM   1076 O  OE2 . GLU B 1 63 ? 9.769  25.805  36.051 1.00 143.78 ? 596 GLU B OE2 1 
ATOM   1077 N  N   . SER B 1 64 ? 11.044 20.359  37.623 1.00 80.69  ? 597 SER B N   1 
ATOM   1078 C  CA  . SER B 1 64 ? 12.350 19.883  38.027 1.00 75.69  ? 597 SER B CA  1 
ATOM   1079 C  C   . SER B 1 64 ? 12.544 18.400  37.653 1.00 72.37  ? 597 SER B C   1 
ATOM   1080 O  O   . SER B 1 64 ? 13.640 18.061  37.212 1.00 71.60  ? 597 SER B O   1 
ATOM   1081 C  CB  . SER B 1 64 ? 12.553 20.103  39.519 1.00 77.57  ? 597 SER B CB  1 
ATOM   1082 O  OG  . SER B 1 64 ? 13.930 20.215  39.842 1.00 86.34  ? 597 SER B OG  1 
ATOM   1083 N  N   . LEU B 1 65 ? 11.493 17.536  37.765 1.00 63.86  ? 598 LEU B N   1 
ATOM   1084 C  CA  . LEU B 1 65 ? 11.629 16.113  37.425 1.00 59.57  ? 598 LEU B CA  1 
ATOM   1085 C  C   . LEU B 1 65 ? 11.948 15.920  35.933 1.00 65.64  ? 598 LEU B C   1 
ATOM   1086 O  O   . LEU B 1 65 ? 12.898 15.197  35.618 1.00 63.45  ? 598 LEU B O   1 
ATOM   1087 C  CB  . LEU B 1 65 ? 10.404 15.274  37.837 1.00 58.16  ? 598 LEU B CB  1 
ATOM   1088 C  CG  . LEU B 1 65 ? 10.458 13.768  37.490 1.00 59.77  ? 598 LEU B CG  1 
ATOM   1089 C  CD1 . LEU B 1 65 ? 11.655 13.052  38.153 1.00 56.46  ? 598 LEU B CD1 1 
ATOM   1090 C  CD2 . LEU B 1 65 ? 9.190  13.086  37.882 1.00 60.80  ? 598 LEU B CD2 1 
ATOM   1091 N  N   . ARG B 1 66 ? 11.188 16.590  35.037 1.00 66.16  ? 599 ARG B N   1 
ATOM   1092 C  CA  . ARG B 1 66 ? 11.376 16.532  33.587 1.00 68.14  ? 599 ARG B CA  1 
ATOM   1093 C  C   . ARG B 1 66 ? 12.786 16.981  33.186 1.00 70.96  ? 599 ARG B C   1 
ATOM   1094 O  O   . ARG B 1 66 ? 13.425 16.299  32.380 1.00 69.87  ? 599 ARG B O   1 
ATOM   1095 C  CB  . ARG B 1 66 ? 10.328 17.399  32.866 1.00 76.26  ? 599 ARG B CB  1 
ATOM   1096 C  CG  . ARG B 1 66 ? 10.381 17.319  31.327 1.00 90.43  ? 599 ARG B CG  1 
ATOM   1097 C  CD  . ARG B 1 66 ? 9.202  18.023  30.662 1.00 108.01 ? 599 ARG B CD  1 
ATOM   1098 N  NE  . ARG B 1 66 ? 7.911  17.579  31.200 1.00 120.23 ? 599 ARG B NE  1 
ATOM   1099 C  CZ  . ARG B 1 66 ? 7.279  16.468  30.831 1.00 136.90 ? 599 ARG B CZ  1 
ATOM   1100 N  NH1 . ARG B 1 66 ? 7.801  15.674  29.903 1.00 125.21 ? 599 ARG B NH1 1 
ATOM   1101 N  NH2 . ARG B 1 66 ? 6.119  16.143  31.388 1.00 123.08 ? 599 ARG B NH2 1 
ATOM   1102 N  N   . SER B 1 67 ? 13.266 18.118  33.735 1.00 67.36  ? 600 SER B N   1 
ATOM   1103 C  CA  . SER B 1 67 ? 14.586 18.637  33.402 1.00 67.67  ? 600 SER B CA  1 
ATOM   1104 C  C   . SER B 1 67 ? 15.686 17.702  33.904 1.00 69.17  ? 600 SER B C   1 
ATOM   1105 O  O   . SER B 1 67 ? 16.682 17.539  33.203 1.00 69.16  ? 600 SER B O   1 
ATOM   1106 C  CB  . SER B 1 67 ? 14.778 20.053  33.934 1.00 73.77  ? 600 SER B CB  1 
ATOM   1107 O  OG  . SER B 1 67 ? 14.633 20.136  35.340 1.00 81.67  ? 600 SER B OG  1 
ATOM   1108 N  N   . LYS B 1 68 ? 15.488 17.040  35.072 1.00 63.20  ? 601 LYS B N   1 
ATOM   1109 C  CA  . LYS B 1 68 ? 16.459 16.078  35.613 1.00 59.45  ? 601 LYS B CA  1 
ATOM   1110 C  C   . LYS B 1 68 ? 16.464 14.804  34.774 1.00 62.32  ? 601 LYS B C   1 
ATOM   1111 O  O   . LYS B 1 68 ? 17.533 14.263  34.532 1.00 62.42  ? 601 LYS B O   1 
ATOM   1112 C  CB  . LYS B 1 68 ? 16.202 15.755  37.093 1.00 58.18  ? 601 LYS B CB  1 
ATOM   1113 C  CG  . LYS B 1 68 ? 16.555 16.884  38.050 1.00 54.36  ? 601 LYS B CG  1 
ATOM   1114 C  CD  . LYS B 1 68 ? 18.009 17.261  38.018 1.00 53.74  ? 601 LYS B CD  1 
ATOM   1115 C  CE  . LYS B 1 68 ? 18.301 18.394  38.957 1.00 59.46  ? 601 LYS B CE  1 
ATOM   1116 N  NZ  . LYS B 1 68 ? 19.534 19.119  38.559 1.00 68.13  ? 601 LYS B NZ  1 
ATOM   1117 N  N   . VAL B 1 69 ? 15.288 14.351  34.302 1.00 58.57  ? 602 VAL B N   1 
ATOM   1118 C  CA  . VAL B 1 69 ? 15.162 13.177  33.432 1.00 58.32  ? 602 VAL B CA  1 
ATOM   1119 C  C   . VAL B 1 69 ? 15.915 13.453  32.111 1.00 65.72  ? 602 VAL B C   1 
ATOM   1120 O  O   . VAL B 1 69 ? 16.693 12.609  31.673 1.00 65.51  ? 602 VAL B O   1 
ATOM   1121 C  CB  . VAL B 1 69 ? 13.674 12.783  33.201 1.00 62.85  ? 602 VAL B CB  1 
ATOM   1122 C  CG1 . VAL B 1 69 ? 13.511 11.828  32.014 1.00 63.15  ? 602 VAL B CG1 1 
ATOM   1123 C  CG2 . VAL B 1 69 ? 13.065 12.183  34.469 1.00 60.37  ? 602 VAL B CG2 1 
ATOM   1124 N  N   . ASP B 1 70 ? 15.729 14.654  31.528 1.00 65.21  ? 603 ASP B N   1 
ATOM   1125 C  CA  . ASP B 1 70 ? 16.406 15.084  30.300 1.00 67.85  ? 603 ASP B CA  1 
ATOM   1126 C  C   . ASP B 1 70 ? 17.930 15.122  30.501 1.00 70.14  ? 603 ASP B C   1 
ATOM   1127 O  O   . ASP B 1 70 ? 18.673 14.687  29.620 1.00 70.82  ? 603 ASP B O   1 
ATOM   1128 C  CB  . ASP B 1 70 ? 15.891 16.464  29.832 1.00 73.86  ? 603 ASP B CB  1 
ATOM   1129 C  CG  . ASP B 1 70 ? 14.462 16.498  29.315 1.00 88.80  ? 603 ASP B CG  1 
ATOM   1130 O  OD1 . ASP B 1 70 ? 13.908 15.409  29.013 1.00 88.14  ? 603 ASP B OD1 1 
ATOM   1131 O  OD2 . ASP B 1 70 ? 13.900 17.617  29.196 1.00 99.34  ? 603 ASP B OD2 1 
ATOM   1132 N  N   . GLU B 1 71 ? 18.383 15.619  31.663 1.00 64.26  ? 604 GLU B N   1 
ATOM   1133 C  CA  . GLU B 1 71 ? 19.797 15.675  32.002 1.00 63.87  ? 604 GLU B CA  1 
ATOM   1134 C  C   . GLU B 1 71 ? 20.380 14.260  32.129 1.00 64.42  ? 604 GLU B C   1 
ATOM   1135 O  O   . GLU B 1 71 ? 21.497 14.035  31.665 1.00 65.26  ? 604 GLU B O   1 
ATOM   1136 C  CB  . GLU B 1 71 ? 20.019 16.460  33.295 1.00 64.91  ? 604 GLU B CB  1 
ATOM   1137 C  CG  . GLU B 1 71 ? 19.985 17.967  33.134 1.00 76.80  ? 604 GLU B CG  1 
ATOM   1138 C  CD  . GLU B 1 71 ? 20.334 18.728  34.399 1.00 98.99  ? 604 GLU B CD  1 
ATOM   1139 O  OE1 . GLU B 1 71 ? 19.712 18.468  35.455 1.00 92.18  ? 604 GLU B OE1 1 
ATOM   1140 O  OE2 . GLU B 1 71 ? 21.237 19.593  34.332 1.00 97.25  ? 604 GLU B OE2 1 
ATOM   1141 N  N   . ALA B 1 72 ? 19.610 13.310  32.712 1.00 57.26  ? 605 ALA B N   1 
ATOM   1142 C  CA  . ALA B 1 72 ? 20.014 11.906  32.875 1.00 54.46  ? 605 ALA B CA  1 
ATOM   1143 C  C   . ALA B 1 72 ? 20.137 11.231  31.519 1.00 59.06  ? 605 ALA B C   1 
ATOM   1144 O  O   . ALA B 1 72 ? 21.091 10.484  31.291 1.00 58.52  ? 605 ALA B O   1 
ATOM   1145 C  CB  . ALA B 1 72 ? 19.016 11.158  33.750 1.00 52.69  ? 605 ALA B CB  1 
ATOM   1146 N  N   . VAL B 1 73 ? 19.193 11.543  30.603 1.00 57.44  ? 606 VAL B N   1 
ATOM   1147 C  CA  . VAL B 1 73 ? 19.145 11.036  29.227 1.00 58.73  ? 606 VAL B CA  1 
ATOM   1148 C  C   . VAL B 1 73 ? 20.417 11.473  28.494 1.00 65.12  ? 606 VAL B C   1 
ATOM   1149 O  O   . VAL B 1 73 ? 21.003 10.658  27.777 1.00 65.62  ? 606 VAL B O   1 
ATOM   1150 C  CB  . VAL B 1 73 ? 17.845 11.493  28.500 1.00 64.23  ? 606 VAL B CB  1 
ATOM   1151 C  CG1 . VAL B 1 73 ? 17.931 11.275  26.991 1.00 66.68  ? 606 VAL B CG1 1 
ATOM   1152 C  CG2 . VAL B 1 73 ? 16.628 10.772  29.064 1.00 62.40  ? 606 VAL B CG2 1 
ATOM   1153 N  N   . ALA B 1 74 ? 20.869 12.730  28.721 1.00 63.41  ? 607 ALA B N   1 
ATOM   1154 C  CA  . ALA B 1 74 ? 22.095 13.262  28.109 1.00 66.35  ? 607 ALA B CA  1 
ATOM   1155 C  C   . ALA B 1 74 ? 23.342 12.527  28.625 1.00 68.67  ? 607 ALA B C   1 
ATOM   1156 O  O   . ALA B 1 74 ? 24.273 12.286  27.852 1.00 71.19  ? 607 ALA B O   1 
ATOM   1157 C  CB  . ALA B 1 74 ? 22.221 14.755  28.375 1.00 69.44  ? 607 ALA B CB  1 
ATOM   1158 N  N   . VAL B 1 75 ? 23.345 12.146  29.913 1.00 60.68  ? 608 VAL B N   1 
ATOM   1159 C  CA  . VAL B 1 75 ? 24.444 11.416  30.534 1.00 58.65  ? 608 VAL B CA  1 
ATOM   1160 C  C   . VAL B 1 75 ? 24.559 10.027  29.887 1.00 60.51  ? 608 VAL B C   1 
ATOM   1161 O  O   . VAL B 1 75 ? 25.670 9.591   29.593 1.00 61.56  ? 608 VAL B O   1 
ATOM   1162 C  CB  . VAL B 1 75 ? 24.294 11.338  32.075 1.00 60.46  ? 608 VAL B CB  1 
ATOM   1163 C  CG1 . VAL B 1 75 ? 25.387 10.472  32.700 1.00 59.67  ? 608 VAL B CG1 1 
ATOM   1164 C  CG2 . VAL B 1 75 ? 24.307 12.726  32.706 1.00 61.13  ? 608 VAL B CG2 1 
ATOM   1165 N  N   . LEU B 1 76 ? 23.428 9.369   29.618 1.00 55.08  ? 609 LEU B N   1 
ATOM   1166 C  CA  . LEU B 1 76 ? 23.400 8.039   28.999 1.00 54.98  ? 609 LEU B CA  1 
ATOM   1167 C  C   . LEU B 1 76 ? 23.819 8.013   27.518 1.00 60.07  ? 609 LEU B C   1 
ATOM   1168 O  O   . LEU B 1 76 ? 24.284 6.973   27.041 1.00 59.04  ? 609 LEU B O   1 
ATOM   1169 C  CB  . LEU B 1 76 ? 21.995 7.439   29.103 1.00 53.93  ? 609 LEU B CB  1 
ATOM   1170 C  CG  . LEU B 1 76 ? 21.555 6.990   30.482 1.00 54.96  ? 609 LEU B CG  1 
ATOM   1171 C  CD1 . LEU B 1 76 ? 20.062 6.694   30.485 1.00 55.02  ? 609 LEU B CD1 1 
ATOM   1172 C  CD2 . LEU B 1 76 ? 22.371 5.782   30.974 1.00 52.32  ? 609 LEU B CD2 1 
ATOM   1173 N  N   . GLN B 1 77 ? 23.627 9.134   26.797 1.00 58.25  ? 610 GLN B N   1 
ATOM   1174 C  CA  . GLN B 1 77 ? 23.931 9.271   25.381 1.00 61.08  ? 610 GLN B CA  1 
ATOM   1175 C  C   . GLN B 1 77 ? 25.427 9.049   25.095 1.00 68.20  ? 610 GLN B C   1 
ATOM   1176 O  O   . GLN B 1 77 ? 26.278 9.759   25.641 1.00 68.61  ? 610 GLN B O   1 
ATOM   1177 C  CB  . GLN B 1 77 ? 23.477 10.650  24.877 1.00 64.65  ? 610 GLN B CB  1 
ATOM   1178 C  CG  . GLN B 1 77 ? 23.527 10.821  23.359 1.00 89.46  ? 610 GLN B CG  1 
ATOM   1179 C  CD  . GLN B 1 77 ? 22.552 9.927   22.634 1.00 115.36 ? 610 GLN B CD  1 
ATOM   1180 O  OE1 . GLN B 1 77 ? 21.350 10.206  22.565 1.00 112.17 ? 610 GLN B OE1 1 
ATOM   1181 N  NE2 . GLN B 1 77 ? 23.057 8.850   22.049 1.00 110.07 ? 610 GLN B NE2 1 
ATOM   1182 N  N   . ALA B 1 78 ? 25.737 8.059   24.226 1.00 65.54  ? 611 ALA B N   1 
ATOM   1183 C  CA  . ALA B 1 78 ? 27.110 7.729   23.846 1.00 66.65  ? 611 ALA B CA  1 
ATOM   1184 C  C   . ALA B 1 78 ? 27.677 8.812   22.956 1.00 73.54  ? 611 ALA B C   1 
ATOM   1185 O  O   . ALA B 1 78 ? 26.918 9.482   22.256 1.00 74.97  ? 611 ALA B O   1 
ATOM   1186 C  CB  . ALA B 1 78 ? 27.155 6.386   23.143 1.00 68.24  ? 611 ALA B CB  1 
ATOM   1187 N  N   . HIS B 1 79 ? 29.003 9.010   23.007 1.00 71.88  ? 612 HIS B N   1 
ATOM   1188 C  CA  . HIS B 1 79 ? 29.713 10.032  22.232 1.00 74.88  ? 612 HIS B CA  1 
ATOM   1189 C  C   . HIS B 1 79 ? 29.596 9.779   20.727 1.00 84.44  ? 612 HIS B C   1 
ATOM   1190 O  O   . HIS B 1 79 ? 29.450 8.631   20.298 1.00 83.26  ? 612 HIS B O   1 
ATOM   1191 C  CB  . HIS B 1 79 ? 31.194 10.101  22.671 1.00 75.84  ? 612 HIS B CB  1 
ATOM   1192 C  CG  . HIS B 1 79 ? 32.099 9.135   21.969 1.00 80.33  ? 612 HIS B CG  1 
ATOM   1193 N  ND1 . HIS B 1 79 ? 32.083 7.782   22.261 1.00 79.56  ? 612 HIS B ND1 1 
ATOM   1194 C  CD2 . HIS B 1 79 ? 33.012 9.361   20.996 1.00 85.07  ? 612 HIS B CD2 1 
ATOM   1195 C  CE1 . HIS B 1 79 ? 32.982 7.234   21.461 1.00 81.55  ? 612 HIS B CE1 1 
ATOM   1196 N  NE2 . HIS B 1 79 ? 33.562 8.146   20.679 1.00 85.47  ? 612 HIS B NE2 1 
ATOM   1197 N  N   . GLN B 1 80 ? 29.650 10.861  19.938 1.00 88.01  ? 613 GLN B N   1 
ATOM   1198 C  CA  . GLN B 1 80 ? 29.614 10.817  18.473 1.00 92.98  ? 613 GLN B CA  1 
ATOM   1199 C  C   . GLN B 1 80 ? 31.061 10.958  17.949 1.00 103.85 ? 613 GLN B C   1 
ATOM   1200 O  O   . GLN B 1 80 ? 31.743 11.935  18.286 1.00 106.12 ? 613 GLN B O   1 
ATOM   1201 C  CB  . GLN B 1 80 ? 28.682 11.910  17.912 1.00 96.33  ? 613 GLN B CB  1 
ATOM   1202 N  N   . ALA B 1 81 ? 31.548 9.950   17.185 1.00 102.48 ? 614 ALA B N   1 
ATOM   1203 C  CA  . ALA B 1 81 ? 32.910 9.912   16.648 1.00 131.81 ? 614 ALA B CA  1 
ATOM   1204 C  C   . ALA B 1 81 ? 33.064 10.799  15.406 1.00 165.61 ? 614 ALA B C   1 
ATOM   1205 O  O   . ALA B 1 81 ? 32.196 10.828  14.534 1.00 127.32 ? 614 ALA B O   1 
ATOM   1206 C  CB  . ALA B 1 81 ? 33.299 8.480   16.318 1.00 132.79 ? 614 ALA B CB  1 
ATOM   1207 N  N   . GLU C 1 5  ? -4.303 20.510  66.520 1.00 131.56 ? 538 GLU C N   1 
ATOM   1208 C  CA  . GLU C 1 5  ? -4.401 19.513  67.585 1.00 132.44 ? 538 GLU C CA  1 
ATOM   1209 C  C   . GLU C 1 5  ? -3.079 19.371  68.351 1.00 132.58 ? 538 GLU C C   1 
ATOM   1210 O  O   . GLU C 1 5  ? -2.007 19.528  67.760 1.00 128.42 ? 538 GLU C O   1 
ATOM   1211 C  CB  . GLU C 1 5  ? -4.825 18.151  67.014 1.00 135.64 ? 538 GLU C CB  1 
ATOM   1212 N  N   . THR C 1 6  ? -3.164 19.067  69.664 1.00 130.48 ? 539 THR C N   1 
ATOM   1213 C  CA  . THR C 1 6  ? -2.018 18.866  70.569 1.00 127.20 ? 539 THR C CA  1 
ATOM   1214 C  C   . THR C 1 6  ? -1.846 17.370  70.826 1.00 129.81 ? 539 THR C C   1 
ATOM   1215 O  O   . THR C 1 6  ? -2.811 16.711  71.224 1.00 133.60 ? 539 THR C O   1 
ATOM   1216 C  CB  . THR C 1 6  ? -2.206 19.652  71.885 1.00 137.93 ? 539 THR C CB  1 
ATOM   1217 O  OG1 . THR C 1 6  ? -3.463 19.300  72.477 1.00 141.25 ? 539 THR C OG1 1 
ATOM   1218 C  CG2 . THR C 1 6  ? -2.117 21.168  71.690 1.00 136.07 ? 539 THR C CG2 1 
ATOM   1219 N  N   . LEU C 1 7  ? -0.636 16.827  70.575 1.00 121.01 ? 540 LEU C N   1 
ATOM   1220 C  CA  . LEU C 1 7  ? -0.375 15.397  70.753 1.00 120.33 ? 540 LEU C CA  1 
ATOM   1221 C  C   . LEU C 1 7  ? -0.137 15.063  72.227 1.00 123.70 ? 540 LEU C C   1 
ATOM   1222 O  O   . LEU C 1 7  ? 0.896  15.426  72.802 1.00 120.95 ? 540 LEU C O   1 
ATOM   1223 C  CB  . LEU C 1 7  ? 0.800  14.911  69.874 1.00 116.27 ? 540 LEU C CB  1 
ATOM   1224 C  CG  . LEU C 1 7  ? 1.079  13.400  69.847 1.00 121.08 ? 540 LEU C CG  1 
ATOM   1225 C  CD1 . LEU C 1 7  ? -0.135 12.603  69.359 1.00 125.14 ? 540 LEU C CD1 1 
ATOM   1226 C  CD2 . LEU C 1 7  ? 2.275  13.102  68.984 1.00 119.54 ? 540 LEU C CD2 1 
ATOM   1227 N  N   . THR C 1 8  ? -1.119 14.375  72.831 1.00 122.97 ? 541 THR C N   1 
ATOM   1228 C  CA  . THR C 1 8  ? -1.057 13.936  74.224 1.00 124.17 ? 541 THR C CA  1 
ATOM   1229 C  C   . THR C 1 8  ? -0.455 12.538  74.263 1.00 124.60 ? 541 THR C C   1 
ATOM   1230 O  O   . THR C 1 8  ? -0.461 11.837  73.245 1.00 123.30 ? 541 THR C O   1 
ATOM   1231 C  CB  . THR C 1 8  ? -2.451 13.975  74.901 1.00 135.77 ? 541 THR C CB  1 
ATOM   1232 O  OG1 . THR C 1 8  ? -3.299 12.988  74.319 1.00 137.98 ? 541 THR C OG1 1 
ATOM   1233 C  CG2 . THR C 1 8  ? -3.111 15.352  74.845 1.00 134.15 ? 541 THR C CG2 1 
ATOM   1234 N  N   . ALA C 1 9  ? 0.046  12.127  75.438 1.00 119.78 ? 542 ALA C N   1 
ATOM   1235 C  CA  . ALA C 1 9  ? 0.596  10.793  75.634 1.00 119.07 ? 542 ALA C CA  1 
ATOM   1236 C  C   . ALA C 1 9  ? -0.499 9.725   75.447 1.00 125.31 ? 542 ALA C C   1 
ATOM   1237 O  O   . ALA C 1 9  ? -0.214 8.683   74.858 1.00 124.78 ? 542 ALA C O   1 
ATOM   1238 C  CB  . ALA C 1 9  ? 1.231  10.681  77.010 1.00 121.22 ? 542 ALA C CB  1 
ATOM   1239 N  N   . SER C 1 10 ? -1.756 10.010  75.888 1.00 124.21 ? 543 SER C N   1 
ATOM   1240 C  CA  . SER C 1 10 ? -2.890 9.087   75.748 1.00 128.15 ? 543 SER C CA  1 
ATOM   1241 C  C   . SER C 1 10 ? -3.303 8.919   74.275 1.00 128.23 ? 543 SER C C   1 
ATOM   1242 O  O   . SER C 1 10 ? -3.609 7.795   73.872 1.00 130.64 ? 543 SER C O   1 
ATOM   1243 C  CB  . SER C 1 10 ? -4.081 9.530   76.595 1.00 136.93 ? 543 SER C CB  1 
ATOM   1244 O  OG  . SER C 1 10 ? -4.494 10.862  76.336 1.00 143.05 ? 543 SER C OG  1 
ATOM   1245 N  N   . ARG C 1 11 ? -3.282 10.012  73.473 1.00 118.98 ? 544 ARG C N   1 
ATOM   1246 C  CA  . ARG C 1 11 ? -3.623 9.965   72.043 1.00 116.87 ? 544 ARG C CA  1 
ATOM   1247 C  C   . ARG C 1 11 ? -2.593 9.126   71.282 1.00 115.35 ? 544 ARG C C   1 
ATOM   1248 O  O   . ARG C 1 11 ? -2.974 8.285   70.465 1.00 117.33 ? 544 ARG C O   1 
ATOM   1249 C  CB  . ARG C 1 11 ? -3.725 11.380  71.440 1.00 113.57 ? 544 ARG C CB  1 
ATOM   1250 N  N   . LEU C 1 12 ? -1.297 9.325   71.589 1.00 105.19 ? 545 LEU C N   1 
ATOM   1251 C  CA  . LEU C 1 12 ? -0.203 8.584   70.964 1.00 101.09 ? 545 LEU C CA  1 
ATOM   1252 C  C   . LEU C 1 12 ? -0.293 7.086   71.307 1.00 107.98 ? 545 LEU C C   1 
ATOM   1253 O  O   . LEU C 1 12 ? -0.193 6.253   70.406 1.00 107.36 ? 545 LEU C O   1 
ATOM   1254 C  CB  . LEU C 1 12 ? 1.165  9.167   71.392 1.00 95.92  ? 545 LEU C CB  1 
ATOM   1255 C  CG  . LEU C 1 12 ? 2.380  8.589   70.702 1.00 95.97  ? 545 LEU C CG  1 
ATOM   1256 C  CD1 . LEU C 1 12 ? 2.596  9.238   69.389 1.00 92.69  ? 545 LEU C CD1 1 
ATOM   1257 C  CD2 . LEU C 1 12 ? 3.599  8.746   71.549 1.00 95.03  ? 545 LEU C CD2 1 
ATOM   1258 N  N   . ALA C 1 13 ? -0.524 6.768   72.601 1.00 107.88 ? 546 ALA C N   1 
ATOM   1259 C  CA  . ALA C 1 13 ? -0.619 5.408   73.140 1.00 112.00 ? 546 ALA C CA  1 
ATOM   1260 C  C   . ALA C 1 13 ? -1.750 4.589   72.514 1.00 120.54 ? 546 ALA C C   1 
ATOM   1261 O  O   . ALA C 1 13 ? -1.634 3.360   72.465 1.00 123.36 ? 546 ALA C O   1 
ATOM   1262 C  CB  . ALA C 1 13 ? -0.804 5.453   74.649 1.00 116.03 ? 546 ALA C CB  1 
ATOM   1263 N  N   . SER C 1 14 ? -2.829 5.253   72.033 1.00 117.44 ? 547 SER C N   1 
ATOM   1264 C  CA  . SER C 1 14 ? -3.986 4.589   71.424 1.00 122.00 ? 547 SER C CA  1 
ATOM   1265 C  C   . SER C 1 14 ? -3.682 4.021   70.011 1.00 122.60 ? 547 SER C C   1 
ATOM   1266 O  O   . SER C 1 14 ? -4.415 3.151   69.528 1.00 127.15 ? 547 SER C O   1 
ATOM   1267 C  CB  . SER C 1 14 ? -5.181 5.539   71.369 1.00 128.13 ? 547 SER C CB  1 
ATOM   1268 O  OG  . SER C 1 14 ? -4.999 6.585   70.429 1.00 132.00 ? 547 SER C OG  1 
ATOM   1269 N  N   . ALA C 1 15 ? -2.600 4.487   69.375 1.00 111.36 ? 548 ALA C N   1 
ATOM   1270 C  CA  . ALA C 1 15 ? -2.215 4.059   68.036 1.00 108.70 ? 548 ALA C CA  1 
ATOM   1271 C  C   . ALA C 1 15 ? -1.134 2.935   68.038 1.00 108.72 ? 548 ALA C C   1 
ATOM   1272 O  O   . ALA C 1 15 ? -0.397 2.805   69.022 1.00 106.39 ? 548 ALA C O   1 
ATOM   1273 C  CB  . ALA C 1 15 ? -1.710 5.265   67.264 1.00 104.20 ? 548 ALA C CB  1 
ATOM   1274 N  N   . PRO C 1 16 ? -1.009 2.142   66.928 1.00 104.53 ? 549 PRO C N   1 
ATOM   1275 C  CA  . PRO C 1 16 ? 0.040  1.102   66.857 1.00 102.72 ? 549 PRO C CA  1 
ATOM   1276 C  C   . PRO C 1 16 ? 1.468  1.666   66.991 1.00 99.27  ? 549 PRO C C   1 
ATOM   1277 O  O   . PRO C 1 16 ? 1.696  2.825   66.638 1.00 94.59  ? 549 PRO C O   1 
ATOM   1278 C  CB  . PRO C 1 16 ? -0.167 0.488   65.463 1.00 106.56 ? 549 PRO C CB  1 
ATOM   1279 C  CG  . PRO C 1 16 ? -1.570 0.791   65.116 1.00 115.59 ? 549 PRO C CG  1 
ATOM   1280 C  CD  . PRO C 1 16 ? -1.817 2.149   65.691 1.00 108.54 ? 549 PRO C CD  1 
ATOM   1281 N  N   . PRO C 1 17 ? 2.443  0.849   67.472 1.00 94.40  ? 550 PRO C N   1 
ATOM   1282 C  CA  . PRO C 1 17 ? 3.819  1.354   67.694 1.00 88.20  ? 550 PRO C CA  1 
ATOM   1283 C  C   . PRO C 1 17 ? 4.505  2.106   66.540 1.00 85.80  ? 550 PRO C C   1 
ATOM   1284 O  O   . PRO C 1 17 ? 5.158  3.112   66.833 1.00 80.87  ? 550 PRO C O   1 
ATOM   1285 C  CB  . PRO C 1 17 ? 4.612  0.087   68.014 1.00 91.42  ? 550 PRO C CB  1 
ATOM   1286 C  CG  . PRO C 1 17 ? 3.621  -0.823  68.624 1.00 101.94 ? 550 PRO C CG  1 
ATOM   1287 C  CD  . PRO C 1 17 ? 2.306  -0.541  67.959 1.00 100.31 ? 550 PRO C CD  1 
ATOM   1288 N  N   . GLN C 1 18 ? 4.427  1.625   65.268 1.00 82.14  ? 551 GLN C N   1 
ATOM   1289 C  CA  . GLN C 1 18 ? 5.084  2.312   64.139 1.00 77.56  ? 551 GLN C CA  1 
ATOM   1290 C  C   . GLN C 1 18 ? 4.308  3.587   63.760 1.00 77.87  ? 551 GLN C C   1 
ATOM   1291 O  O   . GLN C 1 18 ? 4.935  4.594   63.391 1.00 73.29  ? 551 GLN C O   1 
ATOM   1292 C  CB  . GLN C 1 18 ? 5.286  1.383   62.919 1.00 81.16  ? 551 GLN C CB  1 
ATOM   1293 C  CG  . GLN C 1 18 ? 6.135  1.959   61.748 1.00 97.80  ? 551 GLN C CG  1 
ATOM   1294 C  CD  . GLN C 1 18 ? 7.395  2.751   62.100 1.00 116.53 ? 551 GLN C CD  1 
ATOM   1295 O  OE1 . GLN C 1 18 ? 8.229  2.350   62.926 1.00 112.56 ? 551 GLN C OE1 1 
ATOM   1296 N  NE2 . GLN C 1 18 ? 7.597  3.872   61.414 1.00 104.41 ? 551 GLN C NE2 1 
ATOM   1297 N  N   . LYS C 1 19 ? 2.955  3.559   63.914 1.00 75.57  ? 552 LYS C N   1 
ATOM   1298 C  CA  . LYS C 1 19 ? 2.074  4.709   63.683 1.00 74.30  ? 552 LYS C CA  1 
ATOM   1299 C  C   . LYS C 1 19 ? 2.474  5.860   64.654 1.00 72.40  ? 552 LYS C C   1 
ATOM   1300 O  O   . LYS C 1 19 ? 2.469  7.030   64.259 1.00 69.08  ? 552 LYS C O   1 
ATOM   1301 C  CB  . LYS C 1 19 ? 0.594  4.291   63.846 1.00 82.02  ? 552 LYS C CB  1 
ATOM   1302 C  CG  . LYS C 1 19 ? -0.427 5.422   63.726 1.00 98.02  ? 552 LYS C CG  1 
ATOM   1303 C  CD  . LYS C 1 19 ? -1.040 5.552   62.337 1.00 112.91 ? 552 LYS C CD  1 
ATOM   1304 C  CE  . LYS C 1 19 ? -2.164 6.567   62.338 1.00 128.22 ? 552 LYS C CE  1 
ATOM   1305 N  NZ  . LYS C 1 19 ? -2.984 6.506   61.097 1.00 140.09 ? 552 LYS C NZ  1 
ATOM   1306 N  N   . GLN C 1 20 ? 2.900  5.498   65.888 1.00 67.03  ? 553 GLN C N   1 
ATOM   1307 C  CA  . GLN C 1 20 ? 3.351  6.425   66.926 1.00 62.97  ? 553 GLN C CA  1 
ATOM   1308 C  C   . GLN C 1 20 ? 4.593  7.189   66.503 1.00 59.40  ? 553 GLN C C   1 
ATOM   1309 O  O   . GLN C 1 20 ? 4.674  8.389   66.771 1.00 55.79  ? 553 GLN C O   1 
ATOM   1310 C  CB  . GLN C 1 20 ? 3.607  5.702   68.256 1.00 65.82  ? 553 GLN C CB  1 
ATOM   1311 C  CG  . GLN C 1 20 ? 2.339  5.220   68.954 1.00 77.29  ? 553 GLN C CG  1 
ATOM   1312 C  CD  . GLN C 1 20 ? 2.594  4.681   70.344 1.00 92.79  ? 553 GLN C CD  1 
ATOM   1313 O  OE1 . GLN C 1 20 ? 3.216  5.326   71.199 1.00 81.04  ? 553 GLN C OE1 1 
ATOM   1314 N  NE2 . GLN C 1 20 ? 2.067  3.501   70.618 1.00 93.61  ? 553 GLN C NE2 1 
ATOM   1315 N  N   . LYS C 1 21 ? 5.551  6.509   65.838 1.00 54.75  ? 554 LYS C N   1 
ATOM   1316 C  CA  . LYS C 1 21 ? 6.793  7.156   65.377 1.00 50.30  ? 554 LYS C CA  1 
ATOM   1317 C  C   . LYS C 1 21 ? 6.502  8.125   64.224 1.00 53.17  ? 554 LYS C C   1 
ATOM   1318 O  O   . LYS C 1 21 ? 7.067  9.212   64.200 1.00 51.06  ? 554 LYS C O   1 
ATOM   1319 C  CB  . LYS C 1 21 ? 7.883  6.134   64.982 1.00 50.79  ? 554 LYS C CB  1 
ATOM   1320 C  CG  . LYS C 1 21 ? 8.451  5.308   66.142 1.00 47.41  ? 554 LYS C CG  1 
ATOM   1321 C  CD  . LYS C 1 21 ? 9.202  6.136   67.197 1.00 42.90  ? 554 LYS C CD  1 
ATOM   1322 C  CE  . LYS C 1 21 ? 9.857  5.226   68.218 1.00 50.08  ? 554 LYS C CE  1 
ATOM   1323 N  NZ  . LYS C 1 21 ? 10.501 5.992   69.321 1.00 50.81  ? 554 LYS C NZ  1 
ATOM   1324 N  N   . GLN C 1 22 ? 5.596  7.757   63.310 1.00 51.83  ? 555 GLN C N   1 
ATOM   1325 C  CA  . GLN C 1 22 ? 5.200  8.617   62.199 1.00 51.69  ? 555 GLN C CA  1 
ATOM   1326 C  C   . GLN C 1 22 ? 4.510  9.895   62.710 1.00 54.97  ? 555 GLN C C   1 
ATOM   1327 O  O   . GLN C 1 22 ? 4.793  10.985  62.204 1.00 51.48  ? 555 GLN C O   1 
ATOM   1328 C  CB  . GLN C 1 22 ? 4.282  7.856   61.244 1.00 56.97  ? 555 GLN C CB  1 
ATOM   1329 C  CG  . GLN C 1 22 ? 5.070  7.055   60.229 1.00 73.46  ? 555 GLN C CG  1 
ATOM   1330 C  CD  . GLN C 1 22 ? 4.221  6.059   59.502 1.00 93.93  ? 555 GLN C CD  1 
ATOM   1331 O  OE1 . GLN C 1 22 ? 4.376  4.852   59.685 1.00 90.77  ? 555 GLN C OE1 1 
ATOM   1332 N  NE2 . GLN C 1 22 ? 3.311  6.540   58.659 1.00 88.97  ? 555 GLN C NE2 1 
HETATM 1333 N  N   . MSE C 1 23 ? 3.624  9.755   63.720 1.00 54.63  ? 556 MSE C N   1 
HETATM 1334 C  CA  . MSE C 1 23 ? 2.915  10.876  64.343 1.00 55.39  ? 556 MSE C CA  1 
HETATM 1335 C  C   . MSE C 1 23 ? 3.886  11.829  65.011 1.00 52.58  ? 556 MSE C C   1 
HETATM 1336 O  O   . MSE C 1 23 ? 3.749  13.035  64.863 1.00 51.57  ? 556 MSE C O   1 
HETATM 1337 C  CB  . MSE C 1 23 ? 1.890  10.383  65.358 1.00 62.27  ? 556 MSE C CB  1 
HETATM 1338 C  CG  . MSE C 1 23 ? 0.724  9.693   64.705 1.00 76.16  ? 556 MSE C CG  1 
HETATM 1339 SE SE  . MSE C 1 23 ? -0.606 9.044   65.956 0.75 92.59  ? 556 MSE C SE  1 
HETATM 1340 C  CE  . MSE C 1 23 ? 0.389  7.826   66.969 1.00 88.62  ? 556 MSE C CE  1 
ATOM   1341 N  N   . LEU C 1 24 ? 4.873  11.298  65.725 1.00 46.02  ? 557 LEU C N   1 
ATOM   1342 C  CA  . LEU C 1 24 ? 5.899  12.106  66.365 1.00 42.88  ? 557 LEU C CA  1 
ATOM   1343 C  C   . LEU C 1 24 ? 6.796  12.773  65.306 1.00 41.58  ? 557 LEU C C   1 
ATOM   1344 O  O   . LEU C 1 24 ? 7.120  13.952  65.445 1.00 39.66  ? 557 LEU C O   1 
ATOM   1345 C  CB  . LEU C 1 24 ? 6.728  11.255  67.337 1.00 42.84  ? 557 LEU C CB  1 
ATOM   1346 C  CG  . LEU C 1 24 ? 6.004  10.820  68.609 1.00 49.31  ? 557 LEU C CG  1 
ATOM   1347 C  CD1 . LEU C 1 24 ? 6.693  9.665   69.238 1.00 49.73  ? 557 LEU C CD1 1 
ATOM   1348 C  CD2 . LEU C 1 24 ? 5.906  11.950  69.596 1.00 50.97  ? 557 LEU C CD2 1 
ATOM   1349 N  N   . GLY C 1 25 ? 7.117  12.041  64.246 1.00 35.91  ? 558 GLY C N   1 
ATOM   1350 C  CA  . GLY C 1 25 ? 7.895  12.551  63.126 1.00 35.56  ? 558 GLY C CA  1 
ATOM   1351 C  C   . GLY C 1 25 ? 7.258  13.757  62.452 1.00 40.10  ? 558 GLY C C   1 
ATOM   1352 O  O   . GLY C 1 25 ? 7.947  14.739  62.179 1.00 36.84  ? 558 GLY C O   1 
ATOM   1353 N  N   . GLU C 1 26 ? 5.927  13.704  62.212 1.00 40.34  ? 559 GLU C N   1 
ATOM   1354 C  CA  . GLU C 1 26 ? 5.146  14.783  61.602 1.00 41.87  ? 559 GLU C CA  1 
ATOM   1355 C  C   . GLU C 1 26 ? 5.218  16.073  62.426 1.00 44.82  ? 559 GLU C C   1 
ATOM   1356 O  O   . GLU C 1 26 ? 5.134  17.158  61.850 1.00 44.75  ? 559 GLU C O   1 
ATOM   1357 C  CB  . GLU C 1 26 ? 3.674  14.382  61.441 1.00 47.14  ? 559 GLU C CB  1 
ATOM   1358 C  CG  . GLU C 1 26 ? 3.376  13.415  60.318 1.00 69.22  ? 559 GLU C CG  1 
ATOM   1359 C  CD  . GLU C 1 26 ? 1.902  13.046  60.257 1.00 109.17 ? 559 GLU C CD  1 
ATOM   1360 O  OE1 . GLU C 1 26 ? 1.464  12.189  61.058 1.00 101.87 ? 559 GLU C OE1 1 
ATOM   1361 O  OE2 . GLU C 1 26 ? 1.171  13.662  59.448 1.00 114.67 ? 559 GLU C OE2 1 
ATOM   1362 N  N   . ARG C 1 27 ? 5.328  15.962  63.765 1.00 40.82  ? 560 ARG C N   1 
ATOM   1363 C  CA  . ARG C 1 27 ? 5.414  17.129  64.656 1.00 39.49  ? 560 ARG C CA  1 
ATOM   1364 C  C   . ARG C 1 27 ? 6.862  17.609  64.780 1.00 39.48  ? 560 ARG C C   1 
ATOM   1365 O  O   . ARG C 1 27 ? 7.108  18.817  64.820 1.00 39.49  ? 560 ARG C O   1 
ATOM   1366 C  CB  . ARG C 1 27 ? 4.839  16.832  66.069 1.00 40.28  ? 560 ARG C CB  1 
ATOM   1367 C  CG  . ARG C 1 27 ? 3.486  16.133  66.164 1.00 48.22  ? 560 ARG C CG  1 
ATOM   1368 C  CD  . ARG C 1 27 ? 2.371  17.020  65.712 1.00 76.63  ? 560 ARG C CD  1 
ATOM   1369 N  NE  . ARG C 1 27 ? 1.076  16.427  66.031 1.00 102.28 ? 560 ARG C NE  1 
ATOM   1370 C  CZ  . ARG C 1 27 ? 0.198  16.951  66.876 1.00 122.48 ? 560 ARG C CZ  1 
ATOM   1371 N  NH1 . ARG C 1 27 ? 0.458  18.101  67.490 1.00 108.00 ? 560 ARG C NH1 1 
ATOM   1372 N  NH2 . ARG C 1 27 ? -0.957 16.342  67.101 1.00 116.62 ? 560 ARG C NH2 1 
ATOM   1373 N  N   . LEU C 1 28 ? 7.813  16.672  64.863 1.00 34.64  ? 561 LEU C N   1 
ATOM   1374 C  CA  . LEU C 1 28 ? 9.231  16.985  65.025 1.00 33.11  ? 561 LEU C CA  1 
ATOM   1375 C  C   . LEU C 1 28 ? 9.852  17.623  63.785 1.00 37.73  ? 561 LEU C C   1 
ATOM   1376 O  O   . LEU C 1 28 ? 10.567 18.624  63.914 1.00 37.12  ? 561 LEU C O   1 
ATOM   1377 C  CB  . LEU C 1 28 ? 10.016 15.723  65.360 1.00 32.64  ? 561 LEU C CB  1 
ATOM   1378 C  CG  . LEU C 1 28 ? 9.925  15.221  66.785 1.00 39.07  ? 561 LEU C CG  1 
ATOM   1379 C  CD1 . LEU C 1 28 ? 10.436 13.775  66.851 1.00 39.87  ? 561 LEU C CD1 1 
ATOM   1380 C  CD2 . LEU C 1 28 ? 10.696 16.128  67.761 1.00 38.27  ? 561 LEU C CD2 1 
ATOM   1381 N  N   . PHE C 1 29 ? 9.583  17.042  62.597 1.00 32.92  ? 562 PHE C N   1 
ATOM   1382 C  CA  . PHE C 1 29 ? 10.166 17.474  61.329 1.00 32.08  ? 562 PHE C CA  1 
ATOM   1383 C  C   . PHE C 1 29 ? 10.051 18.985  61.065 1.00 36.39  ? 562 PHE C C   1 
ATOM   1384 O  O   . PHE C 1 29 ? 11.083 19.549  60.730 1.00 36.47  ? 562 PHE C O   1 
ATOM   1385 C  CB  . PHE C 1 29 ? 9.613  16.690  60.116 1.00 34.44  ? 562 PHE C CB  1 
ATOM   1386 C  CG  . PHE C 1 29 ? 10.321 17.068  58.835 1.00 36.06  ? 562 PHE C CG  1 
ATOM   1387 C  CD1 . PHE C 1 29 ? 11.561 16.508  58.510 1.00 37.44  ? 562 PHE C CD1 1 
ATOM   1388 C  CD2 . PHE C 1 29 ? 9.782  18.030  57.982 1.00 38.39  ? 562 PHE C CD2 1 
ATOM   1389 C  CE1 . PHE C 1 29 ? 12.223 16.874  57.341 1.00 38.74  ? 562 PHE C CE1 1 
ATOM   1390 C  CE2 . PHE C 1 29 ? 10.472 18.433  56.843 1.00 41.80  ? 562 PHE C CE2 1 
ATOM   1391 C  CZ  . PHE C 1 29 ? 11.687 17.849  56.527 1.00 39.74  ? 562 PHE C CZ  1 
ATOM   1392 N  N   . PRO C 1 30 ? 8.875  19.661  61.114 1.00 34.09  ? 563 PRO C N   1 
ATOM   1393 C  CA  . PRO C 1 30 ? 8.853  21.102  60.802 1.00 34.24  ? 563 PRO C CA  1 
ATOM   1394 C  C   . PRO C 1 30 ? 9.716  21.942  61.738 1.00 35.56  ? 563 PRO C C   1 
ATOM   1395 O  O   . PRO C 1 30 ? 10.327 22.905  61.275 1.00 35.03  ? 563 PRO C O   1 
ATOM   1396 C  CB  . PRO C 1 30 ? 7.371  21.487  60.956 1.00 37.80  ? 563 PRO C CB  1 
ATOM   1397 C  CG  . PRO C 1 30 ? 6.628  20.228  60.907 1.00 42.76  ? 563 PRO C CG  1 
ATOM   1398 C  CD  . PRO C 1 30 ? 7.527  19.181  61.461 1.00 36.51  ? 563 PRO C CD  1 
ATOM   1399 N  N   . LEU C 1 31 ? 9.781  21.565  63.028 1.00 31.09  ? 564 LEU C N   1 
ATOM   1400 C  CA  . LEU C 1 31 ? 10.557 22.274  64.056 1.00 30.21  ? 564 LEU C CA  1 
ATOM   1401 C  C   . LEU C 1 31 ? 12.053 22.097  63.812 1.00 34.80  ? 564 LEU C C   1 
ATOM   1402 O  O   . LEU C 1 31 ? 12.791 23.074  63.866 1.00 35.44  ? 564 LEU C O   1 
ATOM   1403 C  CB  . LEU C 1 31 ? 10.177 21.815  65.482 1.00 29.06  ? 564 LEU C CB  1 
ATOM   1404 C  CG  . LEU C 1 31 ? 8.728  22.079  65.916 1.00 33.05  ? 564 LEU C CG  1 
ATOM   1405 C  CD1 . LEU C 1 31 ? 8.388  21.396  67.244 1.00 31.35  ? 564 LEU C CD1 1 
ATOM   1406 C  CD2 . LEU C 1 31 ? 8.440  23.561  65.985 1.00 34.98  ? 564 LEU C CD2 1 
ATOM   1407 N  N   . ILE C 1 32 ? 12.488 20.870  63.501 1.00 31.51  ? 565 ILE C N   1 
ATOM   1408 C  CA  . ILE C 1 32 ? 13.885 20.543  63.194 1.00 30.71  ? 565 ILE C CA  1 
ATOM   1409 C  C   . ILE C 1 32 ? 14.284 21.204  61.858 1.00 35.10  ? 565 ILE C C   1 
ATOM   1410 O  O   . ILE C 1 32 ? 15.371 21.756  61.762 1.00 36.19  ? 565 ILE C O   1 
ATOM   1411 C  CB  . ILE C 1 32 ? 14.082 19.007  63.187 1.00 33.08  ? 565 ILE C CB  1 
ATOM   1412 C  CG1 . ILE C 1 32 ? 13.852 18.407  64.611 1.00 31.88  ? 565 ILE C CG1 1 
ATOM   1413 C  CG2 . ILE C 1 32 ? 15.457 18.639  62.618 1.00 33.65  ? 565 ILE C CG2 1 
ATOM   1414 C  CD1 . ILE C 1 32 ? 13.834 16.824  64.638 1.00 38.07  ? 565 ILE C CD1 1 
ATOM   1415 N  N   . GLN C 1 33 ? 13.392 21.199  60.855 1.00 31.73  ? 566 GLN C N   1 
ATOM   1416 C  CA  . GLN C 1 33 ? 13.638 21.854  59.567 1.00 32.59  ? 566 GLN C CA  1 
ATOM   1417 C  C   . GLN C 1 33 ? 13.843 23.359  59.730 1.00 38.00  ? 566 GLN C C   1 
ATOM   1418 O  O   . GLN C 1 33 ? 14.669 23.924  59.030 1.00 39.75  ? 566 GLN C O   1 
ATOM   1419 C  CB  . GLN C 1 33 ? 12.488 21.579  58.597 1.00 35.09  ? 566 GLN C CB  1 
ATOM   1420 C  CG  . GLN C 1 33 ? 12.718 22.087  57.165 1.00 31.11  ? 566 GLN C CG  1 
ATOM   1421 C  CD  . GLN C 1 33 ? 11.562 21.757  56.257 1.00 47.14  ? 566 GLN C CD  1 
ATOM   1422 O  OE1 . GLN C 1 33 ? 11.754 21.272  55.136 1.00 45.89  ? 566 GLN C OE1 1 
ATOM   1423 N  NE2 . GLN C 1 33 ? 10.337 22.025  56.709 1.00 35.63  ? 566 GLN C NE2 1 
ATOM   1424 N  N   . ALA C 1 34 ? 13.130 23.998  60.674 1.00 35.39  ? 567 ALA C N   1 
ATOM   1425 C  CA  . ALA C 1 34 ? 13.270 25.437  60.962 1.00 36.36  ? 567 ALA C CA  1 
ATOM   1426 C  C   . ALA C 1 34 ? 14.681 25.737  61.478 1.00 42.49  ? 567 ALA C C   1 
ATOM   1427 O  O   . ALA C 1 34 ? 15.222 26.783  61.157 1.00 44.58  ? 567 ALA C O   1 
ATOM   1428 C  CB  . ALA C 1 34 ? 12.225 25.899  61.980 1.00 36.29  ? 567 ALA C CB  1 
HETATM 1429 N  N   . MSE C 1 35 ? 15.290 24.788  62.204 1.00 39.37  ? 568 MSE C N   1 
HETATM 1430 C  CA  . MSE C 1 35 ? 16.642 24.893  62.770 1.00 40.62  ? 568 MSE C CA  1 
HETATM 1431 C  C   . MSE C 1 35 ? 17.753 24.551  61.776 1.00 44.43  ? 568 MSE C C   1 
HETATM 1432 O  O   . MSE C 1 35 ? 18.726 25.289  61.697 1.00 46.03  ? 568 MSE C O   1 
HETATM 1433 C  CB  . MSE C 1 35 ? 16.788 23.957  63.965 1.00 41.71  ? 568 MSE C CB  1 
HETATM 1434 C  CG  . MSE C 1 35 ? 15.801 24.202  65.076 1.00 49.28  ? 568 MSE C CG  1 
HETATM 1435 SE SE  . MSE C 1 35 ? 16.217 22.983  66.557 0.75 57.32  ? 568 MSE C SE  1 
HETATM 1436 C  CE  . MSE C 1 35 ? 14.665 23.177  67.538 1.00 54.96  ? 568 MSE C CE  1 
ATOM   1437 N  N   . HIS C 1 36 ? 17.641 23.398  61.088 1.00 39.57  ? 569 HIS C N   1 
ATOM   1438 C  CA  . HIS C 1 36 ? 18.620 22.846  60.141 1.00 40.14  ? 569 HIS C CA  1 
ATOM   1439 C  C   . HIS C 1 36 ? 17.901 22.285  58.933 1.00 45.57  ? 569 HIS C C   1 
ATOM   1440 O  O   . HIS C 1 36 ? 17.662 21.088  58.872 1.00 43.72  ? 569 HIS C O   1 
ATOM   1441 C  CB  . HIS C 1 36 ? 19.440 21.735  60.816 1.00 39.87  ? 569 HIS C CB  1 
ATOM   1442 C  CG  . HIS C 1 36 ? 20.288 22.226  61.936 1.00 44.40  ? 569 HIS C CG  1 
ATOM   1443 N  ND1 . HIS C 1 36 ? 21.569 22.696  61.712 1.00 48.93  ? 569 HIS C ND1 1 
ATOM   1444 C  CD2 . HIS C 1 36 ? 19.998 22.340  63.252 1.00 45.84  ? 569 HIS C CD2 1 
ATOM   1445 C  CE1 . HIS C 1 36 ? 22.019 23.078  62.898 1.00 49.34  ? 569 HIS C CE1 1 
ATOM   1446 N  NE2 . HIS C 1 36 ? 21.106 22.883  63.856 1.00 47.97  ? 569 HIS C NE2 1 
ATOM   1447 N  N   . PRO C 1 37 ? 17.503 23.122  57.968 1.00 46.00  ? 570 PRO C N   1 
ATOM   1448 C  CA  . PRO C 1 37 ? 16.718 22.611  56.815 1.00 46.86  ? 570 PRO C CA  1 
ATOM   1449 C  C   . PRO C 1 37 ? 17.385 21.528  55.952 1.00 50.90  ? 570 PRO C C   1 
ATOM   1450 O  O   . PRO C 1 37 ? 16.677 20.667  55.427 1.00 50.40  ? 570 PRO C O   1 
ATOM   1451 C  CB  . PRO C 1 37 ? 16.448 23.868  55.974 1.00 50.83  ? 570 PRO C CB  1 
ATOM   1452 C  CG  . PRO C 1 37 ? 17.450 24.878  56.450 1.00 56.17  ? 570 PRO C CG  1 
ATOM   1453 C  CD  . PRO C 1 37 ? 17.709 24.579  57.887 1.00 49.30  ? 570 PRO C CD  1 
ATOM   1454 N  N   . THR C 1 38 ? 18.717 21.571  55.792 1.00 48.02  ? 571 THR C N   1 
ATOM   1455 C  CA  . THR C 1 38 ? 19.442 20.606  54.958 1.00 49.07  ? 571 THR C CA  1 
ATOM   1456 C  C   . THR C 1 38 ? 19.554 19.238  55.643 1.00 50.00  ? 571 THR C C   1 
ATOM   1457 O  O   . THR C 1 38 ? 19.473 18.218  54.962 1.00 51.57  ? 571 THR C O   1 
ATOM   1458 C  CB  . THR C 1 38 ? 20.835 21.160  54.611 1.00 62.96  ? 571 THR C CB  1 
ATOM   1459 O  OG1 . THR C 1 38 ? 20.667 22.408  53.946 1.00 70.21  ? 571 THR C OG1 1 
ATOM   1460 C  CG2 . THR C 1 38 ? 21.645 20.233  53.715 1.00 61.94  ? 571 THR C CG2 1 
ATOM   1461 N  N   . LEU C 1 39 ? 19.732 19.216  56.972 1.00 41.11  ? 572 LEU C N   1 
ATOM   1462 C  CA  . LEU C 1 39 ? 19.916 17.985  57.728 1.00 37.93  ? 572 LEU C CA  1 
ATOM   1463 C  C   . LEU C 1 39 ? 18.659 17.491  58.420 1.00 39.85  ? 572 LEU C C   1 
ATOM   1464 O  O   . LEU C 1 39 ? 18.708 16.447  59.079 1.00 39.93  ? 572 LEU C O   1 
ATOM   1465 C  CB  . LEU C 1 39 ? 21.020 18.214  58.775 1.00 37.06  ? 572 LEU C CB  1 
ATOM   1466 C  CG  . LEU C 1 39 ? 22.386 18.668  58.219 1.00 41.37  ? 572 LEU C CG  1 
ATOM   1467 C  CD1 . LEU C 1 39 ? 23.304 19.071  59.341 1.00 41.32  ? 572 LEU C CD1 1 
ATOM   1468 C  CD2 . LEU C 1 39 ? 23.018 17.601  57.321 1.00 39.57  ? 572 LEU C CD2 1 
ATOM   1469 N  N   . ALA C 1 40 ? 17.535 18.200  58.244 1.00 35.66  ? 573 ALA C N   1 
ATOM   1470 C  CA  . ALA C 1 40 ? 16.252 17.945  58.920 1.00 33.93  ? 573 ALA C CA  1 
ATOM   1471 C  C   . ALA C 1 40 ? 15.776 16.486  58.849 1.00 36.65  ? 573 ALA C C   1 
ATOM   1472 O  O   . ALA C 1 40 ? 15.413 15.925  59.877 1.00 36.32  ? 573 ALA C O   1 
ATOM   1473 C  CB  . ALA C 1 40 ? 15.190 18.857  58.362 1.00 35.10  ? 573 ALA C CB  1 
ATOM   1474 N  N   . GLY C 1 41 ? 15.804 15.898  57.658 1.00 33.85  ? 574 GLY C N   1 
ATOM   1475 C  CA  . GLY C 1 41 ? 15.388 14.518  57.417 1.00 34.24  ? 574 GLY C CA  1 
ATOM   1476 C  C   . GLY C 1 41 ? 16.222 13.522  58.196 1.00 37.86  ? 574 GLY C C   1 
ATOM   1477 O  O   . GLY C 1 41 ? 15.681 12.625  58.842 1.00 38.58  ? 574 GLY C O   1 
ATOM   1478 N  N   . LYS C 1 42 ? 17.546 13.720  58.195 1.00 32.80  ? 575 LYS C N   1 
ATOM   1479 C  CA  . LYS C 1 42 ? 18.516 12.872  58.891 1.00 31.38  ? 575 LYS C CA  1 
ATOM   1480 C  C   . LYS C 1 42 ? 18.391 13.011  60.400 1.00 34.15  ? 575 LYS C C   1 
ATOM   1481 O  O   . LYS C 1 42 ? 18.399 11.997  61.107 1.00 33.19  ? 575 LYS C O   1 
ATOM   1482 C  CB  . LYS C 1 42 ? 19.936 13.220  58.463 1.00 33.81  ? 575 LYS C CB  1 
ATOM   1483 C  CG  . LYS C 1 42 ? 20.250 12.928  57.011 1.00 40.37  ? 575 LYS C CG  1 
ATOM   1484 C  CD  . LYS C 1 42 ? 21.610 13.491  56.730 1.00 48.87  ? 575 LYS C CD  1 
ATOM   1485 C  CE  . LYS C 1 42 ? 22.047 13.314  55.317 1.00 55.90  ? 575 LYS C CE  1 
ATOM   1486 N  NZ  . LYS C 1 42 ? 23.421 13.836  55.153 1.00 71.49  ? 575 LYS C NZ  1 
ATOM   1487 N  N   . ILE C 1 43 ? 18.280 14.261  60.897 1.00 30.33  ? 576 ILE C N   1 
ATOM   1488 C  CA  . ILE C 1 43 ? 18.134 14.543  62.331 1.00 30.02  ? 576 ILE C CA  1 
ATOM   1489 C  C   . ILE C 1 43 ? 16.829 13.909  62.836 1.00 35.31  ? 576 ILE C C   1 
ATOM   1490 O  O   . ILE C 1 43 ? 16.856 13.217  63.855 1.00 35.82  ? 576 ILE C O   1 
ATOM   1491 C  CB  . ILE C 1 43 ? 18.197 16.081  62.639 1.00 32.39  ? 576 ILE C CB  1 
ATOM   1492 C  CG1 . ILE C 1 43 ? 19.533 16.699  62.181 1.00 32.22  ? 576 ILE C CG1 1 
ATOM   1493 C  CG2 . ILE C 1 43 ? 17.899 16.374  64.135 1.00 33.84  ? 576 ILE C CG2 1 
ATOM   1494 C  CD1 . ILE C 1 43 ? 19.553 18.206  62.124 1.00 36.57  ? 576 ILE C CD1 1 
ATOM   1495 N  N   . THR C 1 44 ? 15.705 14.128  62.108 1.00 32.02  ? 577 THR C N   1 
ATOM   1496 C  CA  . THR C 1 44 ? 14.397 13.594  62.485 1.00 32.61  ? 577 THR C CA  1 
ATOM   1497 C  C   . THR C 1 44 ? 14.460 12.063  62.591 1.00 36.88  ? 577 THR C C   1 
ATOM   1498 O  O   . THR C 1 44 ? 14.057 11.505  63.615 1.00 37.70  ? 577 THR C O   1 
ATOM   1499 C  CB  . THR C 1 44 ? 13.294 14.063  61.523 1.00 37.31  ? 577 THR C CB  1 
ATOM   1500 O  OG1 . THR C 1 44 ? 13.275 15.492  61.518 1.00 37.86  ? 577 THR C OG1 1 
ATOM   1501 C  CG2 . THR C 1 44 ? 11.906 13.546  61.921 1.00 29.50  ? 577 THR C CG2 1 
ATOM   1502 N  N   . GLY C 1 45 ? 15.003 11.414  61.573 1.00 32.61  ? 578 GLY C N   1 
ATOM   1503 C  CA  . GLY C 1 45 ? 15.136 9.961   61.576 1.00 33.82  ? 578 GLY C CA  1 
ATOM   1504 C  C   . GLY C 1 45 ? 15.910 9.420   62.763 1.00 36.61  ? 578 GLY C C   1 
ATOM   1505 O  O   . GLY C 1 45 ? 15.541 8.396   63.352 1.00 36.84  ? 578 GLY C O   1 
HETATM 1506 N  N   . MSE C 1 46 ? 16.996 10.115  63.116 1.00 32.02  ? 579 MSE C N   1 
HETATM 1507 C  CA  . MSE C 1 46 ? 17.844 9.732   64.231 1.00 32.11  ? 579 MSE C CA  1 
HETATM 1508 C  C   . MSE C 1 46 ? 17.139 9.965   65.577 1.00 37.42  ? 579 MSE C C   1 
HETATM 1509 O  O   . MSE C 1 46 ? 17.159 9.060   66.415 1.00 39.07  ? 579 MSE C O   1 
HETATM 1510 C  CB  . MSE C 1 46 ? 19.140 10.494  64.172 1.00 33.98  ? 579 MSE C CB  1 
HETATM 1511 C  CG  . MSE C 1 46 ? 20.159 9.954   65.120 1.00 43.09  ? 579 MSE C CG  1 
HETATM 1512 SE SE  . MSE C 1 46 ? 21.720 11.119  65.297 0.75 52.39  ? 579 MSE C SE  1 
HETATM 1513 C  CE  . MSE C 1 46 ? 22.167 11.407  63.389 1.00 48.34  ? 579 MSE C CE  1 
ATOM   1514 N  N   . LEU C 1 47 ? 16.493 11.149  65.767 1.00 32.21  ? 580 LEU C N   1 
ATOM   1515 C  CA  . LEU C 1 47 ? 15.792 11.483  67.010 1.00 32.85  ? 580 LEU C CA  1 
ATOM   1516 C  C   . LEU C 1 47 ? 14.585 10.583  67.234 1.00 36.79  ? 580 LEU C C   1 
ATOM   1517 O  O   . LEU C 1 47 ? 14.205 10.374  68.382 1.00 37.52  ? 580 LEU C O   1 
ATOM   1518 C  CB  . LEU C 1 47 ? 15.362 12.965  67.094 1.00 32.10  ? 580 LEU C CB  1 
ATOM   1519 C  CG  . LEU C 1 47 ? 16.465 14.056  67.097 1.00 36.54  ? 580 LEU C CG  1 
ATOM   1520 C  CD1 . LEU C 1 47 ? 15.880 15.418  67.531 1.00 36.93  ? 580 LEU C CD1 1 
ATOM   1521 C  CD2 . LEU C 1 47 ? 17.628 13.690  67.983 1.00 36.96  ? 580 LEU C CD2 1 
ATOM   1522 N  N   . LEU C 1 48 ? 14.027 9.990   66.161 1.00 32.60  ? 581 LEU C N   1 
ATOM   1523 C  CA  . LEU C 1 48 ? 12.884 9.086   66.293 1.00 33.04  ? 581 LEU C CA  1 
ATOM   1524 C  C   . LEU C 1 48 ? 13.261 7.776   66.964 1.00 39.38  ? 581 LEU C C   1 
ATOM   1525 O  O   . LEU C 1 48 ? 12.371 7.026   67.328 1.00 41.65  ? 581 LEU C O   1 
ATOM   1526 C  CB  . LEU C 1 48 ? 12.188 8.840   64.957 1.00 32.58  ? 581 LEU C CB  1 
ATOM   1527 C  CG  . LEU C 1 48 ? 11.281 10.007  64.492 1.00 34.04  ? 581 LEU C CG  1 
ATOM   1528 C  CD1 . LEU C 1 48 ? 10.832 9.797   63.083 1.00 34.58  ? 581 LEU C CD1 1 
ATOM   1529 C  CD2 . LEU C 1 48 ? 10.096 10.204  65.410 1.00 33.49  ? 581 LEU C CD2 1 
ATOM   1530 N  N   . GLU C 1 49 ? 14.558 7.531   67.212 1.00 36.29  ? 582 GLU C N   1 
ATOM   1531 C  CA  . GLU C 1 49 ? 15.009 6.332   67.927 1.00 38.36  ? 582 GLU C CA  1 
ATOM   1532 C  C   . GLU C 1 49 ? 14.878 6.503   69.455 1.00 43.03  ? 582 GLU C C   1 
ATOM   1533 O  O   . GLU C 1 49 ? 14.941 5.513   70.198 1.00 43.98  ? 582 GLU C O   1 
ATOM   1534 C  CB  . GLU C 1 49 ? 16.443 5.977   67.550 1.00 39.74  ? 582 GLU C CB  1 
ATOM   1535 C  CG  . GLU C 1 49 ? 16.585 5.599   66.085 1.00 54.09  ? 582 GLU C CG  1 
ATOM   1536 C  CD  . GLU C 1 49 ? 16.020 4.257   65.653 1.00 86.28  ? 582 GLU C CD  1 
ATOM   1537 O  OE1 . GLU C 1 49 ? 15.568 3.468   66.519 1.00 61.61  ? 582 GLU C OE1 1 
ATOM   1538 O  OE2 . GLU C 1 49 ? 16.037 3.996   64.429 1.00 96.11  ? 582 GLU C OE2 1 
ATOM   1539 N  N   . ILE C 1 50 ? 14.699 7.765   69.919 1.00 37.36  ? 583 ILE C N   1 
ATOM   1540 C  CA  . ILE C 1 50 ? 14.503 8.105   71.324 1.00 37.35  ? 583 ILE C CA  1 
ATOM   1541 C  C   . ILE C 1 50 ? 13.124 7.589   71.748 1.00 44.42  ? 583 ILE C C   1 
ATOM   1542 O  O   . ILE C 1 50 ? 12.219 7.520   70.907 1.00 42.75  ? 583 ILE C O   1 
ATOM   1543 C  CB  . ILE C 1 50 ? 14.656 9.640   71.508 1.00 38.31  ? 583 ILE C CB  1 
ATOM   1544 C  CG1 . ILE C 1 50 ? 16.093 10.099  71.175 1.00 36.55  ? 583 ILE C CG1 1 
ATOM   1545 C  CG2 . ILE C 1 50 ? 14.242 10.095  72.914 1.00 40.60  ? 583 ILE C CG2 1 
ATOM   1546 C  CD1 . ILE C 1 50 ? 16.298 11.666  70.999 1.00 35.36  ? 583 ILE C CD1 1 
ATOM   1547 N  N   . ASP C 1 51 ? 12.974 7.206   73.050 1.00 46.11  ? 584 ASP C N   1 
ATOM   1548 C  CA  A ASP C 1 51 ? 11.710 6.711   73.596 0.50 48.84  ? 584 ASP C CA  1 
ATOM   1549 C  CA  B ASP C 1 51 ? 11.702 6.720   73.612 0.50 48.70  ? 584 ASP C CA  1 
ATOM   1550 C  C   . ASP C 1 51 ? 10.623 7.775   73.414 1.00 50.62  ? 584 ASP C C   1 
ATOM   1551 O  O   . ASP C 1 51 ? 10.896 8.970   73.563 1.00 46.72  ? 584 ASP C O   1 
ATOM   1552 C  CB  A ASP C 1 51 ? 11.865 6.299   75.069 0.50 54.44  ? 584 ASP C CB  1 
ATOM   1553 C  CB  B ASP C 1 51 ? 11.833 6.351   75.106 0.50 54.10  ? 584 ASP C CB  1 
ATOM   1554 C  CG  A ASP C 1 51 ? 12.753 5.075   75.272 0.50 71.85  ? 584 ASP C CG  1 
ATOM   1555 C  CG  B ASP C 1 51 ? 10.586 5.721   75.725 0.50 71.87  ? 584 ASP C CG  1 
ATOM   1556 O  OD1 A ASP C 1 51 ? 12.378 3.974   74.789 0.50 73.27  ? 584 ASP C OD1 1 
ATOM   1557 O  OD1 B ASP C 1 51 ? 10.147 4.651   75.236 0.50 74.32  ? 584 ASP C OD1 1 
ATOM   1558 O  OD2 A ASP C 1 51 ? 13.814 5.211   75.925 0.50 81.48  ? 584 ASP C OD2 1 
ATOM   1559 O  OD2 B ASP C 1 51 ? 10.075 6.273   76.723 0.50 80.43  ? 584 ASP C OD2 1 
ATOM   1560 N  N   . ASN C 1 52 ? 9.413  7.329   73.047 1.00 48.87  ? 585 ASN C N   1 
ATOM   1561 C  CA  . ASN C 1 52 ? 8.238  8.158   72.770 1.00 49.05  ? 585 ASN C CA  1 
ATOM   1562 C  C   . ASN C 1 52 ? 7.907  9.173   73.879 1.00 53.55  ? 585 ASN C C   1 
ATOM   1563 O  O   . ASN C 1 52 ? 7.537  10.292  73.545 1.00 52.80  ? 585 ASN C O   1 
ATOM   1564 C  CB  . ASN C 1 52 ? 7.026  7.268   72.477 1.00 51.80  ? 585 ASN C CB  1 
ATOM   1565 C  CG  . ASN C 1 52 ? 7.105  6.564   71.134 1.00 60.70  ? 585 ASN C CG  1 
ATOM   1566 O  OD1 . ASN C 1 52 ? 8.025  6.773   70.332 1.00 46.56  ? 585 ASN C OD1 1 
ATOM   1567 N  ND2 . ASN C 1 52 ? 6.112  5.756   70.832 1.00 54.88  ? 585 ASN C ND2 1 
ATOM   1568 N  N   . SER C 1 53 ? 8.047  8.808   75.167 1.00 51.90  ? 586 SER C N   1 
ATOM   1569 C  CA  . SER C 1 53 ? 7.767  9.730   76.268 1.00 53.27  ? 586 SER C CA  1 
ATOM   1570 C  C   . SER C 1 53 ? 8.753  10.899  76.265 1.00 53.71  ? 586 SER C C   1 
ATOM   1571 O  O   . SER C 1 53 ? 8.338  12.035  76.468 1.00 53.15  ? 586 SER C O   1 
ATOM   1572 C  CB  . SER C 1 53 ? 7.804  9.006   77.610 1.00 61.79  ? 586 SER C CB  1 
ATOM   1573 O  OG  . SER C 1 53 ? 9.096  8.479   77.857 1.00 74.17  ? 586 SER C OG  1 
ATOM   1574 N  N   . GLU C 1 54 ? 10.041 10.627  75.996 1.00 48.49  ? 587 GLU C N   1 
ATOM   1575 C  CA  . GLU C 1 54 ? 11.072 11.663  75.933 1.00 46.19  ? 587 GLU C CA  1 
ATOM   1576 C  C   . GLU C 1 54 ? 10.847 12.564  74.678 1.00 43.66  ? 587 GLU C C   1 
ATOM   1577 O  O   . GLU C 1 54 ? 11.015 13.776  74.764 1.00 42.00  ? 587 GLU C O   1 
ATOM   1578 C  CB  . GLU C 1 54 ? 12.477 11.026  75.975 1.00 47.83  ? 587 GLU C CB  1 
ATOM   1579 C  CG  . GLU C 1 54 ? 13.642 12.017  76.059 1.00 63.98  ? 587 GLU C CG  1 
ATOM   1580 C  CD  . GLU C 1 54 ? 13.657 13.046  77.179 1.00 86.57  ? 587 GLU C CD  1 
ATOM   1581 O  OE1 . GLU C 1 54 ? 13.145 12.734  78.280 1.00 73.15  ? 587 GLU C OE1 1 
ATOM   1582 O  OE2 . GLU C 1 54 ? 14.224 14.146  76.966 1.00 78.66  ? 587 GLU C OE2 1 
ATOM   1583 N  N   . LEU C 1 55 ? 10.370 11.986  73.568 1.00 38.33  ? 588 LEU C N   1 
ATOM   1584 C  CA  . LEU C 1 55 ? 10.032 12.732  72.361 1.00 35.50  ? 588 LEU C CA  1 
ATOM   1585 C  C   . LEU C 1 55 ? 8.842  13.677  72.598 1.00 41.81  ? 588 LEU C C   1 
ATOM   1586 O  O   . LEU C 1 55 ? 8.877  14.818  72.132 1.00 39.52  ? 588 LEU C O   1 
ATOM   1587 C  CB  . LEU C 1 55 ? 9.740  11.776  71.198 1.00 34.44  ? 588 LEU C CB  1 
ATOM   1588 C  CG  . LEU C 1 55 ? 10.972 11.083  70.542 1.00 36.47  ? 588 LEU C CG  1 
ATOM   1589 C  CD1 . LEU C 1 55 ? 10.526 10.085  69.464 1.00 35.65  ? 588 LEU C CD1 1 
ATOM   1590 C  CD2 . LEU C 1 55 ? 11.948 12.103  69.939 1.00 34.00  ? 588 LEU C CD2 1 
ATOM   1591 N  N   . LEU C 1 56 ? 7.818  13.227  73.359 1.00 44.05  ? 589 LEU C N   1 
ATOM   1592 C  CA  . LEU C 1 56 ? 6.648  14.047  73.697 1.00 46.86  ? 589 LEU C CA  1 
ATOM   1593 C  C   . LEU C 1 56 ? 7.053  15.214  74.567 1.00 52.04  ? 589 LEU C C   1 
ATOM   1594 O  O   . LEU C 1 56 ? 6.500  16.297  74.401 1.00 53.69  ? 589 LEU C O   1 
ATOM   1595 C  CB  . LEU C 1 56 ? 5.551  13.238  74.400 1.00 51.48  ? 589 LEU C CB  1 
ATOM   1596 C  CG  . LEU C 1 56 ? 4.772  12.246  73.543 1.00 58.84  ? 589 LEU C CG  1 
ATOM   1597 C  CD1 . LEU C 1 56 ? 4.126  11.165  74.410 1.00 63.26  ? 589 LEU C CD1 1 
ATOM   1598 C  CD2 . LEU C 1 56 ? 3.719  12.948  72.686 1.00 62.54  ? 589 LEU C CD2 1 
ATOM   1599 N  N   . TYR C 1 57 ? 8.032  15.008  75.474 1.00 48.32  ? 590 TYR C N   1 
ATOM   1600 C  CA  . TYR C 1 57 ? 8.569  16.050  76.342 1.00 48.94  ? 590 TYR C CA  1 
ATOM   1601 C  C   . TYR C 1 57 ? 9.270  17.098  75.494 1.00 48.00  ? 590 TYR C C   1 
ATOM   1602 O  O   . TYR C 1 57 ? 9.020  18.284  75.683 1.00 48.66  ? 590 TYR C O   1 
ATOM   1603 C  CB  . TYR C 1 57 ? 9.516  15.458  77.396 1.00 53.03  ? 590 TYR C CB  1 
ATOM   1604 C  CG  . TYR C 1 57 ? 10.272 16.495  78.194 1.00 57.13  ? 590 TYR C CG  1 
ATOM   1605 C  CD1 . TYR C 1 57 ? 9.658  17.188  79.231 1.00 62.96  ? 590 TYR C CD1 1 
ATOM   1606 C  CD2 . TYR C 1 57 ? 11.607 16.775  77.921 1.00 56.78  ? 590 TYR C CD2 1 
ATOM   1607 C  CE1 . TYR C 1 57 ? 10.344 18.159  79.959 1.00 66.56  ? 590 TYR C CE1 1 
ATOM   1608 C  CE2 . TYR C 1 57 ? 12.306 17.742  78.643 1.00 59.63  ? 590 TYR C CE2 1 
ATOM   1609 C  CZ  . TYR C 1 57 ? 11.670 18.432  79.663 1.00 72.38  ? 590 TYR C CZ  1 
ATOM   1610 O  OH  . TYR C 1 57 ? 12.359 19.372  80.400 1.00 78.65  ? 590 TYR C OH  1 
HETATM 1611 N  N   . MSE C 1 58 ? 10.103 16.651  74.529 1.00 40.84  ? 591 MSE C N   1 
HETATM 1612 C  CA  A MSE C 1 58 ? 10.856 17.527  73.634 0.50 36.01  ? 591 MSE C CA  1 
HETATM 1613 C  CA  B MSE C 1 58 ? 10.844 17.514  73.607 0.50 38.85  ? 591 MSE C CA  1 
HETATM 1614 C  C   . MSE C 1 58 ? 9.928  18.389  72.769 1.00 41.10  ? 591 MSE C C   1 
HETATM 1615 O  O   . MSE C 1 58 ? 10.274 19.531  72.463 1.00 39.77  ? 591 MSE C O   1 
HETATM 1616 C  CB  A MSE C 1 58 ? 11.802 16.704  72.762 0.50 34.51  ? 591 MSE C CB  1 
HETATM 1617 C  CB  B MSE C 1 58 ? 11.688 16.666  72.673 0.50 39.54  ? 591 MSE C CB  1 
HETATM 1618 C  CG  A MSE C 1 58 ? 13.080 16.309  73.485 0.50 40.00  ? 591 MSE C CG  1 
HETATM 1619 C  CG  B MSE C 1 58 ? 13.051 16.382  73.198 0.50 48.08  ? 591 MSE C CG  1 
HETATM 1620 SE SE  A MSE C 1 58 ? 13.849 14.628  72.847 0.38 44.92  ? 591 MSE C SE  1 
HETATM 1621 SE SE  B MSE C 1 58 ? 13.861 15.211  71.911 0.37 55.82  ? 591 MSE C SE  1 
HETATM 1622 C  CE  A MSE C 1 58 ? 14.053 15.065  70.908 0.50 38.93  ? 591 MSE C CE  1 
HETATM 1623 C  CE  B MSE C 1 58 ? 13.805 13.656  72.884 0.50 54.58  ? 591 MSE C CE  1 
ATOM   1624 N  N   . LEU C 1 59 ? 8.755  17.857  72.387 1.00 40.18  ? 592 LEU C N   1 
ATOM   1625 C  CA  . LEU C 1 59 ? 7.778  18.601  71.581 1.00 39.82  ? 592 LEU C CA  1 
ATOM   1626 C  C   . LEU C 1 59 ? 7.118  19.716  72.387 1.00 46.95  ? 592 LEU C C   1 
ATOM   1627 O  O   . LEU C 1 59 ? 6.528  20.631  71.802 1.00 48.60  ? 592 LEU C O   1 
ATOM   1628 C  CB  . LEU C 1 59 ? 6.710  17.662  71.022 1.00 40.34  ? 592 LEU C CB  1 
ATOM   1629 C  CG  . LEU C 1 59 ? 7.144  16.813  69.828 1.00 43.20  ? 592 LEU C CG  1 
ATOM   1630 C  CD1 . LEU C 1 59 ? 6.110  15.744  69.544 1.00 45.56  ? 592 LEU C CD1 1 
ATOM   1631 C  CD2 . LEU C 1 59 ? 7.402  17.678  68.578 1.00 42.80  ? 592 LEU C CD2 1 
ATOM   1632 N  N   . GLU C 1 60 ? 7.228  19.651  73.721 1.00 44.74  ? 593 GLU C N   1 
ATOM   1633 C  CA  . GLU C 1 60 ? 6.685  20.647  74.638 1.00 47.67  ? 593 GLU C CA  1 
ATOM   1634 C  C   . GLU C 1 60 ? 7.800  21.454  75.314 1.00 50.71  ? 593 GLU C C   1 
ATOM   1635 O  O   . GLU C 1 60 ? 7.506  22.349  76.096 1.00 53.19  ? 593 GLU C O   1 
ATOM   1636 C  CB  . GLU C 1 60 ? 5.784  19.980  75.698 1.00 52.99  ? 593 GLU C CB  1 
ATOM   1637 C  CG  . GLU C 1 60 ? 4.442  19.496  75.163 1.00 69.95  ? 593 GLU C CG  1 
ATOM   1638 C  CD  . GLU C 1 60 ? 3.528  20.568  74.592 1.00 104.14 ? 593 GLU C CD  1 
ATOM   1639 O  OE1 . GLU C 1 60 ? 2.842  21.256  75.386 1.00 108.41 ? 593 GLU C OE1 1 
ATOM   1640 O  OE2 . GLU C 1 60 ? 3.492  20.712  73.346 1.00 96.82  ? 593 GLU C OE2 1 
ATOM   1641 N  N   . SER C 1 61 ? 9.065  21.158  75.005 1.00 44.29  ? 594 SER C N   1 
ATOM   1642 C  CA  . SER C 1 61 ? 10.191 21.862  75.600 1.00 44.44  ? 594 SER C CA  1 
ATOM   1643 C  C   . SER C 1 61 ? 11.161 22.282  74.484 1.00 44.20  ? 594 SER C C   1 
ATOM   1644 O  O   . SER C 1 61 ? 12.044 21.513  74.084 1.00 41.45  ? 594 SER C O   1 
ATOM   1645 C  CB  . SER C 1 61 ? 10.858 21.009  76.681 1.00 49.51  ? 594 SER C CB  1 
ATOM   1646 O  OG  . SER C 1 61 ? 12.035 21.625  77.177 1.00 60.20  ? 594 SER C OG  1 
ATOM   1647 N  N   . PRO C 1 62 ? 10.993 23.519  73.961 1.00 41.15  ? 595 PRO C N   1 
ATOM   1648 C  CA  . PRO C 1 62 ? 11.857 23.983  72.853 1.00 39.34  ? 595 PRO C CA  1 
ATOM   1649 C  C   . PRO C 1 62 ? 13.370 23.914  73.152 1.00 45.01  ? 595 PRO C C   1 
ATOM   1650 O  O   . PRO C 1 62 ? 14.148 23.577  72.249 1.00 42.84  ? 595 PRO C O   1 
ATOM   1651 C  CB  . PRO C 1 62 ? 11.384 25.430  72.641 1.00 40.75  ? 595 PRO C CB  1 
ATOM   1652 C  CG  . PRO C 1 62 ? 9.962  25.377  73.034 1.00 45.45  ? 595 PRO C CG  1 
ATOM   1653 C  CD  . PRO C 1 62 ? 9.960  24.528  74.265 1.00 42.99  ? 595 PRO C CD  1 
ATOM   1654 N  N   . GLU C 1 63 ? 13.775 24.186  74.407 1.00 44.85  ? 596 GLU C N   1 
ATOM   1655 C  CA  . GLU C 1 63 ? 15.176 24.153  74.842 1.00 46.61  ? 596 GLU C CA  1 
ATOM   1656 C  C   . GLU C 1 63 ? 15.734 22.737  74.765 1.00 48.60  ? 596 GLU C C   1 
ATOM   1657 O  O   . GLU C 1 63 ? 16.859 22.562  74.298 1.00 47.42  ? 596 GLU C O   1 
ATOM   1658 C  CB  . GLU C 1 63 ? 15.356 24.698  76.276 1.00 52.51  ? 596 GLU C CB  1 
ATOM   1659 C  CG  . GLU C 1 63 ? 14.375 25.775  76.733 1.00 75.19  ? 596 GLU C CG  1 
ATOM   1660 C  CD  . GLU C 1 63 ? 14.583 27.191  76.223 1.00 114.49 ? 596 GLU C CD  1 
ATOM   1661 O  OE1 . GLU C 1 63 ? 15.623 27.802  76.564 1.00 120.95 ? 596 GLU C OE1 1 
ATOM   1662 O  OE2 . GLU C 1 63 ? 13.659 27.723  75.562 1.00 110.85 ? 596 GLU C OE2 1 
ATOM   1663 N  N   . SER C 1 64 ? 14.949 21.727  75.207 1.00 45.44  ? 597 SER C N   1 
ATOM   1664 C  CA  . SER C 1 64 ? 15.405 20.339  75.212 1.00 45.34  ? 597 SER C CA  1 
ATOM   1665 C  C   . SER C 1 64 ? 15.408 19.767  73.792 1.00 45.08  ? 597 SER C C   1 
ATOM   1666 O  O   . SER C 1 64 ? 16.314 19.002  73.478 1.00 44.51  ? 597 SER C O   1 
ATOM   1667 C  CB  . SER C 1 64 ? 14.611 19.481  76.199 1.00 53.31  ? 597 SER C CB  1 
ATOM   1668 O  OG  . SER C 1 64 ? 13.334 19.081  75.734 1.00 67.72  ? 597 SER C OG  1 
ATOM   1669 N  N   . LEU C 1 65 ? 14.477 20.204  72.904 1.00 39.48  ? 598 LEU C N   1 
ATOM   1670 C  CA  . LEU C 1 65 ? 14.505 19.772  71.501 1.00 35.84  ? 598 LEU C CA  1 
ATOM   1671 C  C   . LEU C 1 65 ? 15.768 20.318  70.835 1.00 39.06  ? 598 LEU C C   1 
ATOM   1672 O  O   . LEU C 1 65 ? 16.461 19.574  70.146 1.00 37.72  ? 598 LEU C O   1 
ATOM   1673 C  CB  . LEU C 1 65 ? 13.247 20.216  70.730 1.00 35.00  ? 598 LEU C CB  1 
ATOM   1674 C  CG  . LEU C 1 65 ? 13.243 19.985  69.186 1.00 36.80  ? 598 LEU C CG  1 
ATOM   1675 C  CD1 . LEU C 1 65 ? 13.376 18.505  68.822 1.00 35.38  ? 598 LEU C CD1 1 
ATOM   1676 C  CD2 . LEU C 1 65 ? 12.015 20.564  68.551 1.00 36.57  ? 598 LEU C CD2 1 
ATOM   1677 N  N   . ARG C 1 66 ? 16.094 21.595  71.100 1.00 38.21  ? 599 ARG C N   1 
ATOM   1678 C  CA  . ARG C 1 66 ? 17.277 22.273  70.559 1.00 38.55  ? 599 ARG C CA  1 
ATOM   1679 C  C   . ARG C 1 66 ? 18.573 21.553  70.962 1.00 42.27  ? 599 ARG C C   1 
ATOM   1680 O  O   . ARG C 1 66 ? 19.415 21.341  70.097 1.00 42.66  ? 599 ARG C O   1 
ATOM   1681 C  CB  . ARG C 1 66 ? 17.294 23.746  70.996 1.00 38.87  ? 599 ARG C CB  1 
ATOM   1682 C  CG  . ARG C 1 66 ? 18.548 24.532  70.662 1.00 47.19  ? 599 ARG C CG  1 
ATOM   1683 C  CD  . ARG C 1 66 ? 18.240 26.019  70.493 1.00 54.18  ? 599 ARG C CD  1 
ATOM   1684 N  NE  . ARG C 1 66 ? 17.731 26.342  69.154 1.00 56.58  ? 599 ARG C NE  1 
ATOM   1685 C  CZ  . ARG C 1 66 ? 18.467 26.327  68.039 1.00 77.47  ? 599 ARG C CZ  1 
ATOM   1686 N  NH1 . ARG C 1 66 ? 19.753 25.999  68.085 1.00 70.19  ? 599 ARG C NH1 1 
ATOM   1687 N  NH2 . ARG C 1 66 ? 17.918 26.628  66.871 1.00 65.88  ? 599 ARG C NH2 1 
ATOM   1688 N  N   . SER C 1 67 ? 18.722 21.160  72.239 1.00 39.51  ? 600 SER C N   1 
ATOM   1689 C  CA  . SER C 1 67 ? 19.940 20.481  72.698 1.00 41.04  ? 600 SER C CA  1 
ATOM   1690 C  C   . SER C 1 67 ? 20.071 19.072  72.080 1.00 40.89  ? 600 SER C C   1 
ATOM   1691 O  O   . SER C 1 67 ? 21.183 18.673  71.744 1.00 41.32  ? 600 SER C O   1 
ATOM   1692 C  CB  . SER C 1 67 ? 20.012 20.444  74.223 1.00 48.95  ? 600 SER C CB  1 
ATOM   1693 O  OG  . SER C 1 67 ? 18.936 19.700  74.764 1.00 64.92  ? 600 SER C OG  1 
ATOM   1694 N  N   . LYS C 1 68 ? 18.944 18.373  71.846 1.00 35.74  ? 601 LYS C N   1 
ATOM   1695 C  CA  . LYS C 1 68 ? 18.941 17.072  71.173 1.00 34.63  ? 601 LYS C CA  1 
ATOM   1696 C  C   . LYS C 1 68 ? 19.283 17.214  69.710 1.00 39.05  ? 601 LYS C C   1 
ATOM   1697 O  O   . LYS C 1 68 ? 20.051 16.408  69.191 1.00 41.22  ? 601 LYS C O   1 
ATOM   1698 C  CB  . LYS C 1 68 ? 17.603 16.344  71.339 1.00 36.46  ? 601 LYS C CB  1 
ATOM   1699 C  CG  . LYS C 1 68 ? 17.408 15.801  72.755 1.00 48.21  ? 601 LYS C CG  1 
ATOM   1700 C  CD  . LYS C 1 68 ? 18.391 14.674  73.040 1.00 44.80  ? 601 LYS C CD  1 
ATOM   1701 C  CE  . LYS C 1 68 ? 18.310 14.122  74.413 1.00 43.37  ? 601 LYS C CE  1 
ATOM   1702 N  NZ  . LYS C 1 68 ? 19.403 13.152  74.613 1.00 56.73  ? 601 LYS C NZ  1 
ATOM   1703 N  N   . VAL C 1 69 ? 18.775 18.262  69.055 1.00 35.95  ? 602 VAL C N   1 
ATOM   1704 C  CA  . VAL C 1 69 ? 19.064 18.552  67.644 1.00 34.71  ? 602 VAL C CA  1 
ATOM   1705 C  C   . VAL C 1 69 ? 20.566 18.818  67.494 1.00 40.15  ? 602 VAL C C   1 
ATOM   1706 O  O   . VAL C 1 69 ? 21.181 18.232  66.611 1.00 40.35  ? 602 VAL C O   1 
ATOM   1707 C  CB  . VAL C 1 69 ? 18.190 19.699  67.092 1.00 37.53  ? 602 VAL C CB  1 
ATOM   1708 C  CG1 . VAL C 1 69 ? 18.729 20.224  65.766 1.00 36.69  ? 602 VAL C CG1 1 
ATOM   1709 C  CG2 . VAL C 1 69 ? 16.743 19.235  66.927 1.00 36.23  ? 602 VAL C CG2 1 
ATOM   1710 N  N   . ASP C 1 70 ? 21.158 19.620  68.406 1.00 38.07  ? 603 ASP C N   1 
ATOM   1711 C  CA  . ASP C 1 70 ? 22.593 19.932  68.427 1.00 40.20  ? 603 ASP C CA  1 
ATOM   1712 C  C   . ASP C 1 70 ? 23.444 18.659  68.602 1.00 43.22  ? 603 ASP C C   1 
ATOM   1713 O  O   . ASP C 1 70 ? 24.463 18.510  67.924 1.00 44.48  ? 603 ASP C O   1 
ATOM   1714 C  CB  . ASP C 1 70 ? 22.916 20.953  69.532 1.00 44.86  ? 603 ASP C CB  1 
ATOM   1715 C  CG  . ASP C 1 70 ? 22.412 22.371  69.282 1.00 56.73  ? 603 ASP C CG  1 
ATOM   1716 O  OD1 . ASP C 1 70 ? 22.003 22.676  68.123 1.00 56.90  ? 603 ASP C OD1 1 
ATOM   1717 O  OD2 . ASP C 1 70 ? 22.440 23.181  70.230 1.00 65.86  ? 603 ASP C OD2 1 
ATOM   1718 N  N   . GLU C 1 71 ? 23.011 17.740  69.480 1.00 37.67  ? 604 GLU C N   1 
ATOM   1719 C  CA  . GLU C 1 71 ? 23.689 16.463  69.684 1.00 38.03  ? 604 GLU C CA  1 
ATOM   1720 C  C   . GLU C 1 71 ? 23.631 15.598  68.408 1.00 40.80  ? 604 GLU C C   1 
ATOM   1721 O  O   . GLU C 1 71 ? 24.624 14.957  68.057 1.00 41.48  ? 604 GLU C O   1 
ATOM   1722 C  CB  . GLU C 1 71 ? 23.063 15.699  70.844 1.00 39.61  ? 604 GLU C CB  1 
ATOM   1723 C  CG  . GLU C 1 71 ? 23.454 16.184  72.221 1.00 49.36  ? 604 GLU C CG  1 
ATOM   1724 C  CD  . GLU C 1 71 ? 22.906 15.274  73.305 1.00 68.73  ? 604 GLU C CD  1 
ATOM   1725 O  OE1 . GLU C 1 71 ? 21.664 15.169  73.420 1.00 49.44  ? 604 GLU C OE1 1 
ATOM   1726 O  OE2 . GLU C 1 71 ? 23.717 14.641  74.020 1.00 72.71  ? 604 GLU C OE2 1 
ATOM   1727 N  N   . ALA C 1 72 ? 22.468 15.588  67.722 1.00 34.93  ? 605 ALA C N   1 
ATOM   1728 C  CA  . ALA C 1 72 ? 22.283 14.842  66.479 1.00 33.71  ? 605 ALA C CA  1 
ATOM   1729 C  C   . ALA C 1 72 ? 23.160 15.426  65.360 1.00 38.47  ? 605 ALA C C   1 
ATOM   1730 O  O   . ALA C 1 72 ? 23.776 14.665  64.611 1.00 39.35  ? 605 ALA C O   1 
ATOM   1731 C  CB  . ALA C 1 72 ? 20.826 14.862  66.077 1.00 32.61  ? 605 ALA C CB  1 
ATOM   1732 N  N   . VAL C 1 73 ? 23.268 16.772  65.302 1.00 34.89  ? 606 VAL C N   1 
ATOM   1733 C  CA  . VAL C 1 73 ? 24.098 17.512  64.346 1.00 35.90  ? 606 VAL C CA  1 
ATOM   1734 C  C   . VAL C 1 73 ? 25.553 17.113  64.535 1.00 41.79  ? 606 VAL C C   1 
ATOM   1735 O  O   . VAL C 1 73 ? 26.246 16.923  63.537 1.00 42.77  ? 606 VAL C O   1 
ATOM   1736 C  CB  . VAL C 1 73 ? 23.901 19.051  64.465 1.00 40.53  ? 606 VAL C CB  1 
ATOM   1737 C  CG1 . VAL C 1 73 ? 25.000 19.834  63.721 1.00 42.43  ? 606 VAL C CG1 1 
ATOM   1738 C  CG2 . VAL C 1 73 ? 22.524 19.461  63.954 1.00 38.08  ? 606 VAL C CG2 1 
ATOM   1739 N  N   . ALA C 1 74 ? 26.009 16.943  65.803 1.00 38.86  ? 607 ALA C N   1 
ATOM   1740 C  CA  . ALA C 1 74 ? 27.390 16.530  66.075 1.00 41.17  ? 607 ALA C CA  1 
ATOM   1741 C  C   . ALA C 1 74 ? 27.643 15.100  65.571 1.00 43.32  ? 607 ALA C C   1 
ATOM   1742 O  O   . ALA C 1 74 ? 28.735 14.821  65.079 1.00 45.82  ? 607 ALA C O   1 
ATOM   1743 C  CB  . ALA C 1 74 ? 27.701 16.628  67.562 1.00 43.80  ? 607 ALA C CB  1 
ATOM   1744 N  N   . VAL C 1 75 ? 26.631 14.205  65.680 1.00 36.63  ? 608 VAL C N   1 
ATOM   1745 C  CA  . VAL C 1 75 ? 26.718 12.825  65.216 1.00 36.02  ? 608 VAL C CA  1 
ATOM   1746 C  C   . VAL C 1 75 ? 26.917 12.835  63.679 1.00 40.47  ? 608 VAL C C   1 
ATOM   1747 O  O   . VAL C 1 75 ? 27.739 12.080  63.161 1.00 41.52  ? 608 VAL C O   1 
ATOM   1748 C  CB  . VAL C 1 75 ? 25.475 11.999  65.637 1.00 38.15  ? 608 VAL C CB  1 
ATOM   1749 C  CG1 . VAL C 1 75 ? 25.484 10.604  65.017 1.00 38.16  ? 608 VAL C CG1 1 
ATOM   1750 C  CG2 . VAL C 1 75 ? 25.351 11.909  67.151 1.00 38.85  ? 608 VAL C CG2 1 
ATOM   1751 N  N   . LEU C 1 76 ? 26.198 13.720  62.970 1.00 35.07  ? 609 LEU C N   1 
ATOM   1752 C  CA  . LEU C 1 76 ? 26.246 13.801  61.510 1.00 35.67  ? 609 LEU C CA  1 
ATOM   1753 C  C   . LEU C 1 76 ? 27.508 14.454  60.941 1.00 46.64  ? 609 LEU C C   1 
ATOM   1754 O  O   . LEU C 1 76 ? 27.856 14.157  59.784 1.00 49.38  ? 609 LEU C O   1 
ATOM   1755 C  CB  . LEU C 1 76 ? 25.041 14.568  60.986 1.00 33.11  ? 609 LEU C CB  1 
ATOM   1756 C  CG  . LEU C 1 76 ? 23.716 13.885  61.120 1.00 35.18  ? 609 LEU C CG  1 
ATOM   1757 C  CD1 . LEU C 1 76 ? 22.601 14.862  60.849 1.00 33.74  ? 609 LEU C CD1 1 
ATOM   1758 C  CD2 . LEU C 1 76 ? 23.622 12.666  60.208 1.00 37.74  ? 609 LEU C CD2 1 
ATOM   1759 N  N   . GLN C 1 77 ? 28.173 15.337  61.735 1.00 44.89  ? 610 GLN C N   1 
ATOM   1760 C  CA  A GLN C 1 77 ? 29.384 16.081  61.375 0.50 48.13  ? 610 GLN C CA  1 
ATOM   1761 C  CA  B GLN C 1 77 ? 29.349 16.067  61.266 0.50 48.25  ? 610 GLN C CA  1 
ATOM   1762 C  C   . GLN C 1 77 ? 30.506 15.131  60.946 1.00 55.15  ? 610 GLN C C   1 
ATOM   1763 O  O   . GLN C 1 77 ? 30.893 14.275  61.744 1.00 56.60  ? 610 GLN C O   1 
ATOM   1764 C  CB  A GLN C 1 77 ? 29.837 16.950  62.577 0.50 50.63  ? 610 GLN C CB  1 
ATOM   1765 C  CB  B GLN C 1 77 ? 29.791 17.180  62.235 0.50 51.09  ? 610 GLN C CB  1 
ATOM   1766 C  CG  A GLN C 1 77 ? 31.102 17.796  62.342 0.50 63.08  ? 610 GLN C CG  1 
ATOM   1767 C  CG  B GLN C 1 77 ? 30.709 18.241  61.583 0.50 64.22  ? 610 GLN C CG  1 
ATOM   1768 C  CD  A GLN C 1 77 ? 31.695 18.363  63.619 0.50 74.68  ? 610 GLN C CD  1 
ATOM   1769 C  CD  B GLN C 1 77 ? 30.077 18.988  60.420 0.50 76.32  ? 610 GLN C CD  1 
ATOM   1770 O  OE1 A GLN C 1 77 ? 31.696 17.729  64.685 0.50 67.65  ? 610 GLN C OE1 1 
ATOM   1771 O  OE1 B GLN C 1 77 ? 29.019 19.614  60.546 0.50 74.28  ? 610 GLN C OE1 1 
ATOM   1772 N  NE2 A GLN C 1 77 ? 32.267 19.555  63.526 0.50 65.10  ? 610 GLN C NE2 1 
ATOM   1773 N  NE2 B GLN C 1 77 ? 30.719 18.946  59.265 0.50 61.36  ? 610 GLN C NE2 1 
ATOM   1774 N  N   . ALA C 1 78 ? 31.030 15.305  59.715 1.00 53.34  ? 611 ALA C N   1 
ATOM   1775 C  CA  . ALA C 1 78 ? 32.141 14.537  59.148 1.00 56.60  ? 611 ALA C CA  1 
ATOM   1776 C  C   . ALA C 1 78 ? 33.444 14.938  59.818 1.00 64.70  ? 611 ALA C C   1 
ATOM   1777 O  O   . ALA C 1 78 ? 33.523 16.035  60.374 1.00 65.42  ? 611 ALA C O   1 
ATOM   1778 C  CB  . ALA C 1 78 ? 32.226 14.779  57.649 1.00 59.07  ? 611 ALA C CB  1 
ATOM   1779 N  N   . HIS C 1 79 ? 34.469 14.074  59.752 1.00 64.80  ? 612 HIS C N   1 
ATOM   1780 C  CA  . HIS C 1 79 ? 35.775 14.321  60.372 1.00 68.62  ? 612 HIS C CA  1 
ATOM   1781 C  C   . HIS C 1 79 ? 36.510 15.538  59.745 1.00 79.30  ? 612 HIS C C   1 
ATOM   1782 O  O   . HIS C 1 79 ? 37.287 16.210  60.442 1.00 83.25  ? 612 HIS C O   1 
ATOM   1783 C  CB  . HIS C 1 79 ? 36.651 13.058  60.320 1.00 71.34  ? 612 HIS C CB  1 
ATOM   1784 C  CG  . HIS C 1 79 ? 37.031 12.632  58.938 1.00 76.63  ? 612 HIS C CG  1 
ATOM   1785 N  ND1 . HIS C 1 79 ? 36.171 11.898  58.149 1.00 75.51  ? 612 HIS C ND1 1 
ATOM   1786 C  CD2 . HIS C 1 79 ? 38.169 12.863  58.246 1.00 83.01  ? 612 HIS C CD2 1 
ATOM   1787 C  CE1 . HIS C 1 79 ? 36.809 11.702  57.008 1.00 78.16  ? 612 HIS C CE1 1 
ATOM   1788 N  NE2 . HIS C 1 79 ? 38.013 12.267  57.020 1.00 83.19  ? 612 HIS C NE2 1 
ATOM   1789 N  N   . GLN C 1 80 ? 36.250 15.836  58.451 1.00 76.77  ? 613 GLN C N   1 
ATOM   1790 C  CA  . GLN C 1 80 ? 36.889 16.969  57.772 1.00 112.85 ? 613 GLN C CA  1 
ATOM   1791 C  C   . GLN C 1 80 ? 36.011 18.222  57.867 1.00 139.50 ? 613 GLN C C   1 
ATOM   1792 O  O   . GLN C 1 80 ? 35.450 18.520  58.925 1.00 93.99  ? 613 GLN C O   1 
ATOM   1793 C  CB  . GLN C 1 80 ? 37.193 16.627  56.304 1.00 116.47 ? 613 GLN C CB  1 
ATOM   1794 N  N   . GLU D 1 5  ? 35.571 -9.956  52.829 1.00 96.86  ? 538 GLU D N   1 
ATOM   1795 C  CA  . GLU D 1 5  ? 35.830 -8.812  51.953 1.00 95.87  ? 538 GLU D CA  1 
ATOM   1796 C  C   . GLU D 1 5  ? 35.674 -7.473  52.704 1.00 96.12  ? 538 GLU D C   1 
ATOM   1797 O  O   . GLU D 1 5  ? 34.897 -7.398  53.668 1.00 94.63  ? 538 GLU D O   1 
ATOM   1798 C  CB  . GLU D 1 5  ? 34.891 -8.842  50.730 1.00 96.77  ? 538 GLU D CB  1 
ATOM   1799 N  N   . THR D 1 6  ? 36.419 -6.419  52.258 1.00 89.74  ? 539 THR D N   1 
ATOM   1800 C  CA  . THR D 1 6  ? 36.370 -5.056  52.818 1.00 84.61  ? 539 THR D CA  1 
ATOM   1801 C  C   . THR D 1 6  ? 35.549 -4.182  51.862 1.00 80.23  ? 539 THR D C   1 
ATOM   1802 O  O   . THR D 1 6  ? 35.786 -4.204  50.653 1.00 81.97  ? 539 THR D O   1 
ATOM   1803 C  CB  . THR D 1 6  ? 37.792 -4.510  53.099 1.00 95.93  ? 539 THR D CB  1 
ATOM   1804 O  OG1 . THR D 1 6  ? 38.228 -5.061  54.341 1.00 101.71 ? 539 THR D OG1 1 
ATOM   1805 C  CG2 . THR D 1 6  ? 37.853 -2.974  53.196 1.00 89.29  ? 539 THR D CG2 1 
ATOM   1806 N  N   . LEU D 1 7  ? 34.571 -3.433  52.410 1.00 67.49  ? 540 LEU D N   1 
ATOM   1807 C  CA  . LEU D 1 7  ? 33.712 -2.578  51.612 1.00 62.07  ? 540 LEU D CA  1 
ATOM   1808 C  C   . LEU D 1 7  ? 34.452 -1.295  51.236 1.00 63.19  ? 540 LEU D C   1 
ATOM   1809 O  O   . LEU D 1 7  ? 34.710 -0.443  52.090 1.00 63.24  ? 540 LEU D O   1 
ATOM   1810 C  CB  . LEU D 1 7  ? 32.388 -2.281  52.328 1.00 57.91  ? 540 LEU D CB  1 
ATOM   1811 C  CG  . LEU D 1 7  ? 31.336 -1.460  51.557 1.00 59.16  ? 540 LEU D CG  1 
ATOM   1812 C  CD1 . LEU D 1 7  ? 30.897 -2.153  50.300 1.00 60.05  ? 540 LEU D CD1 1 
ATOM   1813 C  CD2 . LEU D 1 7  ? 30.124 -1.217  52.397 1.00 56.88  ? 540 LEU D CD2 1 
ATOM   1814 N  N   . THR D 1 8  ? 34.818 -1.191  49.944 1.00 56.45  ? 541 THR D N   1 
ATOM   1815 C  CA  . THR D 1 8  ? 35.499 -0.031  49.382 1.00 54.71  ? 541 THR D CA  1 
ATOM   1816 C  C   . THR D 1 8  ? 34.462 0.966   48.874 1.00 52.97  ? 541 THR D C   1 
ATOM   1817 O  O   . THR D 1 8  ? 33.299 0.614   48.684 1.00 49.67  ? 541 THR D O   1 
ATOM   1818 C  CB  . THR D 1 8  ? 36.456 -0.448  48.262 1.00 59.81  ? 541 THR D CB  1 
ATOM   1819 O  OG1 . THR D 1 8  ? 35.705 -0.939  47.152 1.00 57.93  ? 541 THR D OG1 1 
ATOM   1820 C  CG2 . THR D 1 8  ? 37.493 -1.475  48.716 1.00 58.32  ? 541 THR D CG2 1 
ATOM   1821 N  N   . ALA D 1 9  ? 34.896 2.207   48.635 1.00 48.89  ? 542 ALA D N   1 
ATOM   1822 C  CA  . ALA D 1 9  ? 34.051 3.244   48.076 1.00 46.85  ? 542 ALA D CA  1 
ATOM   1823 C  C   . ALA D 1 9  ? 33.598 2.867   46.659 1.00 49.92  ? 542 ALA D C   1 
ATOM   1824 O  O   . ALA D 1 9  ? 32.437 3.104   46.335 1.00 48.39  ? 542 ALA D O   1 
ATOM   1825 C  CB  . ALA D 1 9  ? 34.784 4.574   48.071 1.00 48.70  ? 542 ALA D CB  1 
ATOM   1826 N  N   . SER D 1 10 ? 34.481 2.217   45.852 1.00 48.65  ? 543 SER D N   1 
ATOM   1827 C  CA  . SER D 1 10 ? 34.134 1.774   44.494 1.00 49.18  ? 543 SER D CA  1 
ATOM   1828 C  C   . SER D 1 10 ? 33.117 0.636   44.525 1.00 53.04  ? 543 SER D C   1 
ATOM   1829 O  O   . SER D 1 10 ? 32.211 0.653   43.711 1.00 52.91  ? 543 SER D O   1 
ATOM   1830 C  CB  . SER D 1 10 ? 35.359 1.377   43.679 1.00 53.76  ? 543 SER D CB  1 
ATOM   1831 O  OG  . SER D 1 10 ? 36.211 0.485   44.366 1.00 66.51  ? 543 SER D OG  1 
ATOM   1832 N  N   . ARG D 1 11 ? 33.219 -0.309  45.472 1.00 50.03  ? 544 ARG D N   1 
ATOM   1833 C  CA  . ARG D 1 11 ? 32.265 -1.417  45.582 1.00 49.80  ? 544 ARG D CA  1 
ATOM   1834 C  C   . ARG D 1 11 ? 30.875 -0.880  46.019 1.00 49.99  ? 544 ARG D C   1 
ATOM   1835 O  O   . ARG D 1 11 ? 29.856 -1.315  45.483 1.00 51.01  ? 544 ARG D O   1 
ATOM   1836 C  CB  . ARG D 1 11 ? 32.800 -2.509  46.540 1.00 53.52  ? 544 ARG D CB  1 
ATOM   1837 C  CG  . ARG D 1 11 ? 31.790 -3.580  47.006 1.00 75.37  ? 544 ARG D CG  1 
ATOM   1838 C  CD  . ARG D 1 11 ? 31.402 -4.610  45.949 1.00 99.83  ? 544 ARG D CD  1 
ATOM   1839 N  NE  . ARG D 1 11 ? 30.109 -5.255  46.230 1.00 111.51 ? 544 ARG D NE  1 
ATOM   1840 C  CZ  . ARG D 1 11 ? 28.959 -4.963  45.617 1.00 125.32 ? 544 ARG D CZ  1 
ATOM   1841 N  NH1 . ARG D 1 11 ? 28.915 -4.024  44.674 1.00 105.55 ? 544 ARG D NH1 1 
ATOM   1842 N  NH2 . ARG D 1 11 ? 27.846 -5.612  45.939 1.00 113.25 ? 544 ARG D NH2 1 
ATOM   1843 N  N   . LEU D 1 12 ? 30.834 0.084   46.943 1.00 41.30  ? 545 LEU D N   1 
ATOM   1844 C  CA  . LEU D 1 12 ? 29.571 0.666   47.356 1.00 38.16  ? 545 LEU D CA  1 
ATOM   1845 C  C   . LEU D 1 12 ? 28.944 1.466   46.214 1.00 44.39  ? 545 LEU D C   1 
ATOM   1846 O  O   . LEU D 1 12 ? 27.740 1.332   45.987 1.00 45.85  ? 545 LEU D O   1 
ATOM   1847 C  CB  . LEU D 1 12 ? 29.731 1.546   48.601 1.00 35.56  ? 545 LEU D CB  1 
ATOM   1848 C  CG  . LEU D 1 12 ? 28.413 2.059   49.207 1.00 36.36  ? 545 LEU D CG  1 
ATOM   1849 C  CD1 . LEU D 1 12 ? 27.688 0.958   50.032 1.00 34.83  ? 545 LEU D CD1 1 
ATOM   1850 C  CD2 . LEU D 1 12 ? 28.647 3.338   49.975 1.00 35.50  ? 545 LEU D CD2 1 
ATOM   1851 N  N   . ALA D 1 13 ? 29.749 2.264   45.487 1.00 41.03  ? 546 ALA D N   1 
ATOM   1852 C  CA  . ALA D 1 13 ? 29.290 3.077   44.352 1.00 41.22  ? 546 ALA D CA  1 
ATOM   1853 C  C   . ALA D 1 13 ? 28.710 2.220   43.223 1.00 47.49  ? 546 ALA D C   1 
ATOM   1854 O  O   . ALA D 1 13 ? 27.819 2.679   42.519 1.00 48.39  ? 546 ALA D O   1 
ATOM   1855 C  CB  . ALA D 1 13 ? 30.441 3.920   43.816 1.00 43.17  ? 546 ALA D CB  1 
ATOM   1856 N  N   . SER D 1 14 ? 29.207 0.977   43.063 1.00 45.60  ? 547 SER D N   1 
ATOM   1857 C  CA  . SER D 1 14 ? 28.788 0.012   42.033 1.00 47.72  ? 547 SER D CA  1 
ATOM   1858 C  C   . SER D 1 14 ? 27.458 -0.653  42.349 1.00 51.80  ? 547 SER D C   1 
ATOM   1859 O  O   . SER D 1 14 ? 26.854 -1.249  41.456 1.00 54.64  ? 547 SER D O   1 
ATOM   1860 C  CB  . SER D 1 14 ? 29.842 -1.072  41.868 1.00 53.65  ? 547 SER D CB  1 
ATOM   1861 O  OG  . SER D 1 14 ? 31.106 -0.498  41.588 1.00 66.13  ? 547 SER D OG  1 
ATOM   1862 N  N   . ALA D 1 15 ? 27.020 -0.592  43.622 1.00 44.92  ? 548 ALA D N   1 
ATOM   1863 C  CA  . ALA D 1 15 ? 25.766 -1.189  44.078 1.00 43.56  ? 548 ALA D CA  1 
ATOM   1864 C  C   . ALA D 1 15 ? 24.589 -0.235  43.834 1.00 46.25  ? 548 ALA D C   1 
ATOM   1865 O  O   . ALA D 1 15 ? 24.801 0.987   43.875 1.00 42.75  ? 548 ALA D O   1 
ATOM   1866 C  CB  . ALA D 1 15 ? 25.861 -1.521  45.555 1.00 41.98  ? 548 ALA D CB  1 
ATOM   1867 N  N   . PRO D 1 16 ? 23.349 -0.754  43.587 1.00 44.92  ? 549 PRO D N   1 
ATOM   1868 C  CA  . PRO D 1 16 ? 22.203 0.163   43.388 1.00 43.60  ? 549 PRO D CA  1 
ATOM   1869 C  C   . PRO D 1 16 ? 21.974 1.065   44.614 1.00 42.45  ? 549 PRO D C   1 
ATOM   1870 O  O   . PRO D 1 16 ? 22.187 0.612   45.754 1.00 40.52  ? 549 PRO D O   1 
ATOM   1871 C  CB  . PRO D 1 16 ? 21.008 -0.778  43.167 1.00 47.06  ? 549 PRO D CB  1 
ATOM   1872 C  CG  . PRO D 1 16 ? 21.578 -2.105  42.906 1.00 53.13  ? 549 PRO D CG  1 
ATOM   1873 C  CD  . PRO D 1 16 ? 22.928 -2.173  43.522 1.00 48.05  ? 549 PRO D CD  1 
ATOM   1874 N  N   . PRO D 1 17 ? 21.554 2.343   44.403 1.00 35.50  ? 550 PRO D N   1 
ATOM   1875 C  CA  . PRO D 1 17 ? 21.317 3.241   45.549 1.00 32.49  ? 550 PRO D CA  1 
ATOM   1876 C  C   . PRO D 1 17 ? 20.355 2.657   46.570 1.00 38.01  ? 550 PRO D C   1 
ATOM   1877 O  O   . PRO D 1 17 ? 20.540 2.893   47.761 1.00 36.70  ? 550 PRO D O   1 
ATOM   1878 C  CB  . PRO D 1 17 ? 20.740 4.500   44.902 1.00 34.14  ? 550 PRO D CB  1 
ATOM   1879 C  CG  . PRO D 1 17 ? 21.263 4.465   43.511 1.00 39.45  ? 550 PRO D CG  1 
ATOM   1880 C  CD  . PRO D 1 17 ? 21.284 3.025   43.120 1.00 36.51  ? 550 PRO D CD  1 
ATOM   1881 N  N   . GLN D 1 18 ? 19.387 1.817   46.120 1.00 37.68  ? 551 GLN D N   1 
ATOM   1882 C  CA  . GLN D 1 18 ? 18.413 1.123   46.994 1.00 37.46  ? 551 GLN D CA  1 
ATOM   1883 C  C   . GLN D 1 18 ? 19.072 0.165   47.966 1.00 40.32  ? 551 GLN D C   1 
ATOM   1884 O  O   . GLN D 1 18 ? 18.457 -0.161  48.975 1.00 39.70  ? 551 GLN D O   1 
ATOM   1885 C  CB  . GLN D 1 18 ? 17.410 0.301   46.162 1.00 41.14  ? 551 GLN D CB  1 
ATOM   1886 C  CG  . GLN D 1 18 ? 16.527 1.128   45.254 1.00 47.49  ? 551 GLN D CG  1 
ATOM   1887 C  CD  . GLN D 1 18 ? 17.059 1.175   43.851 1.00 59.66  ? 551 GLN D CD  1 
ATOM   1888 O  OE1 . GLN D 1 18 ? 18.275 1.274   43.618 1.00 48.48  ? 551 GLN D OE1 1 
ATOM   1889 N  NE2 . GLN D 1 18 ? 16.140 1.173   42.886 1.00 54.82  ? 551 GLN D NE2 1 
ATOM   1890 N  N   . LYS D 1 19 ? 20.293 -0.324  47.658 1.00 37.15  ? 552 LYS D N   1 
ATOM   1891 C  CA  . LYS D 1 19 ? 20.964 -1.331  48.493 1.00 37.52  ? 552 LYS D CA  1 
ATOM   1892 C  C   . LYS D 1 19 ? 22.130 -0.795  49.346 1.00 40.15  ? 552 LYS D C   1 
ATOM   1893 O  O   . LYS D 1 19 ? 22.641 -1.525  50.195 1.00 40.96  ? 552 LYS D O   1 
ATOM   1894 C  CB  . LYS D 1 19 ? 21.486 -2.488  47.600 1.00 41.19  ? 552 LYS D CB  1 
ATOM   1895 C  CG  . LYS D 1 19 ? 20.433 -3.158  46.704 1.00 61.30  ? 552 LYS D CG  1 
ATOM   1896 C  CD  . LYS D 1 19 ? 19.312 -3.868  47.494 1.00 78.54  ? 552 LYS D CD  1 
ATOM   1897 C  CE  . LYS D 1 19 ? 18.070 -4.165  46.676 1.00 90.05  ? 552 LYS D CE  1 
ATOM   1898 N  NZ  . LYS D 1 19 ? 16.989 -4.750  47.521 1.00 97.73  ? 552 LYS D NZ  1 
ATOM   1899 N  N   . GLN D 1 20 ? 22.542 0.448   49.147 1.00 35.01  ? 553 GLN D N   1 
ATOM   1900 C  CA  . GLN D 1 20 ? 23.722 0.995   49.818 1.00 33.68  ? 553 GLN D CA  1 
ATOM   1901 C  C   . GLN D 1 20 ? 23.610 1.121   51.340 1.00 36.65  ? 553 GLN D C   1 
ATOM   1902 O  O   . GLN D 1 20 ? 24.568 0.719   52.014 1.00 37.16  ? 553 GLN D O   1 
ATOM   1903 C  CB  . GLN D 1 20 ? 24.141 2.331   49.201 1.00 34.00  ? 553 GLN D CB  1 
ATOM   1904 C  CG  . GLN D 1 20 ? 24.658 2.136   47.775 1.00 30.35  ? 553 GLN D CG  1 
ATOM   1905 C  CD  . GLN D 1 20 ? 24.880 3.419   47.034 1.00 43.11  ? 553 GLN D CD  1 
ATOM   1906 O  OE1 . GLN D 1 20 ? 24.503 4.498   47.468 1.00 42.54  ? 553 GLN D OE1 1 
ATOM   1907 N  NE2 . GLN D 1 20 ? 25.457 3.324   45.863 1.00 43.48  ? 553 GLN D NE2 1 
ATOM   1908 N  N   . LYS D 1 21 ? 22.506 1.680   51.892 1.00 31.22  ? 554 LYS D N   1 
ATOM   1909 C  CA  . LYS D 1 21 ? 22.400 1.796   53.361 1.00 30.07  ? 554 LYS D CA  1 
ATOM   1910 C  C   . LYS D 1 21 ? 22.342 0.400   54.028 1.00 35.99  ? 554 LYS D C   1 
ATOM   1911 O  O   . LYS D 1 21 ? 22.963 0.199   55.074 1.00 35.63  ? 554 LYS D O   1 
ATOM   1912 C  CB  . LYS D 1 21 ? 21.206 2.664   53.809 1.00 31.27  ? 554 LYS D CB  1 
ATOM   1913 C  CG  . LYS D 1 21 ? 21.313 4.147   53.448 1.00 28.15  ? 554 LYS D CG  1 
ATOM   1914 C  CD  . LYS D 1 21 ? 22.410 4.883   54.226 1.00 28.64  ? 554 LYS D CD  1 
ATOM   1915 C  CE  . LYS D 1 21 ? 22.351 6.362   53.966 1.00 28.51  ? 554 LYS D CE  1 
ATOM   1916 N  NZ  . LYS D 1 21 ? 23.528 7.046   54.554 1.00 28.60  ? 554 LYS D NZ  1 
ATOM   1917 N  N   . GLN D 1 22 ? 21.657 -0.564  53.380 1.00 34.43  ? 555 GLN D N   1 
ATOM   1918 C  CA  . GLN D 1 22 ? 21.569 -1.947  53.842 1.00 37.02  ? 555 GLN D CA  1 
ATOM   1919 C  C   . GLN D 1 22 ? 22.978 -2.542  53.975 1.00 43.60  ? 555 GLN D C   1 
ATOM   1920 O  O   . GLN D 1 22 ? 23.319 -3.075  55.030 1.00 44.35  ? 555 GLN D O   1 
ATOM   1921 C  CB  . GLN D 1 22 ? 20.692 -2.797  52.880 1.00 40.19  ? 555 GLN D CB  1 
ATOM   1922 C  CG  . GLN D 1 22 ? 20.414 -4.246  53.331 1.00 44.82  ? 555 GLN D CG  1 
ATOM   1923 C  CD  . GLN D 1 22 ? 19.770 -4.377  54.706 1.00 68.28  ? 555 GLN D CD  1 
ATOM   1924 O  OE1 . GLN D 1 22 ? 18.731 -3.770  55.021 1.00 65.96  ? 555 GLN D OE1 1 
ATOM   1925 N  NE2 . GLN D 1 22 ? 20.373 -5.199  55.554 1.00 61.74  ? 555 GLN D NE2 1 
HETATM 1926 N  N   . MSE D 1 23 ? 23.797 -2.410  52.912 1.00 40.32  ? 556 MSE D N   1 
HETATM 1927 C  CA  . MSE D 1 23 ? 25.168 -2.901  52.870 1.00 39.99  ? 556 MSE D CA  1 
HETATM 1928 C  C   . MSE D 1 23 ? 26.030 -2.293  53.959 1.00 38.59  ? 556 MSE D C   1 
HETATM 1929 O  O   . MSE D 1 23 ? 26.796 -3.018  54.575 1.00 38.53  ? 556 MSE D O   1 
HETATM 1930 C  CB  . MSE D 1 23 ? 25.798 -2.603  51.516 1.00 43.58  ? 556 MSE D CB  1 
HETATM 1931 C  CG  . MSE D 1 23 ? 25.314 -3.502  50.423 1.00 53.93  ? 556 MSE D CG  1 
HETATM 1932 SE SE  . MSE D 1 23 ? 26.145 -2.962  48.754 0.75 64.27  ? 556 MSE D SE  1 
HETATM 1933 C  CE  . MSE D 1 23 ? 27.869 -3.813  48.980 1.00 62.99  ? 556 MSE D CE  1 
ATOM   1934 N  N   . LEU D 1 24 ? 25.918 -0.979  54.189 1.00 32.51  ? 557 LEU D N   1 
ATOM   1935 C  CA  . LEU D 1 24 ? 26.696 -0.301  55.223 1.00 31.37  ? 557 LEU D CA  1 
ATOM   1936 C  C   . LEU D 1 24 ? 26.257 -0.757  56.614 1.00 38.17  ? 557 LEU D C   1 
ATOM   1937 O  O   . LEU D 1 24 ? 27.107 -0.999  57.461 1.00 39.44  ? 557 LEU D O   1 
ATOM   1938 C  CB  . LEU D 1 24 ? 26.584 1.214   55.085 1.00 29.43  ? 557 LEU D CB  1 
ATOM   1939 C  CG  . LEU D 1 24 ? 27.315 1.820   53.871 1.00 33.25  ? 557 LEU D CG  1 
ATOM   1940 C  CD1 . LEU D 1 24 ? 26.729 3.173   53.543 1.00 31.83  ? 557 LEU D CD1 1 
ATOM   1941 C  CD2 . LEU D 1 24 ? 28.820 1.932   54.129 1.00 31.24  ? 557 LEU D CD2 1 
ATOM   1942 N  N   . GLY D 1 25 ? 24.953 -0.956  56.803 1.00 35.05  ? 558 GLY D N   1 
ATOM   1943 C  CA  . GLY D 1 25 ? 24.387 -1.449  58.055 1.00 35.18  ? 558 GLY D CA  1 
ATOM   1944 C  C   . GLY D 1 25 ? 24.899 -2.818  58.464 1.00 40.84  ? 558 GLY D C   1 
ATOM   1945 O  O   . GLY D 1 25 ? 25.256 -3.034  59.629 1.00 41.11  ? 558 GLY D O   1 
ATOM   1946 N  N   . GLU D 1 26 ? 24.973 -3.736  57.489 1.00 38.79  ? 559 GLU D N   1 
ATOM   1947 C  CA  . GLU D 1 26 ? 25.480 -5.101  57.662 1.00 40.75  ? 559 GLU D CA  1 
ATOM   1948 C  C   . GLU D 1 26 ? 26.932 -5.119  58.174 1.00 45.51  ? 559 GLU D C   1 
ATOM   1949 O  O   . GLU D 1 26 ? 27.291 -6.016  58.945 1.00 47.30  ? 559 GLU D O   1 
ATOM   1950 C  CB  . GLU D 1 26 ? 25.374 -5.901  56.355 1.00 43.83  ? 559 GLU D CB  1 
ATOM   1951 C  CG  . GLU D 1 26 ? 23.945 -6.336  56.058 1.00 57.05  ? 559 GLU D CG  1 
ATOM   1952 C  CD  . GLU D 1 26 ? 23.594 -6.835  54.667 1.00 80.11  ? 559 GLU D CD  1 
ATOM   1953 O  OE1 . GLU D 1 26 ? 24.352 -6.570  53.703 1.00 84.78  ? 559 GLU D OE1 1 
ATOM   1954 O  OE2 . GLU D 1 26 ? 22.491 -7.412  54.530 1.00 71.72  ? 559 GLU D OE2 1 
ATOM   1955 N  N   . ARG D 1 27 ? 27.748 -4.137  57.753 1.00 40.62  ? 560 ARG D N   1 
ATOM   1956 C  CA  . ARG D 1 27 ? 29.153 -4.026  58.160 1.00 40.94  ? 560 ARG D CA  1 
ATOM   1957 C  C   . ARG D 1 27 ? 29.294 -3.258  59.461 1.00 43.17  ? 560 ARG D C   1 
ATOM   1958 O  O   . ARG D 1 27 ? 30.173 -3.581  60.249 1.00 44.71  ? 560 ARG D O   1 
ATOM   1959 C  CB  . ARG D 1 27 ? 30.028 -3.343  57.087 1.00 40.25  ? 560 ARG D CB  1 
ATOM   1960 C  CG  . ARG D 1 27 ? 29.873 -3.830  55.647 1.00 48.81  ? 560 ARG D CG  1 
ATOM   1961 C  CD  . ARG D 1 27 ? 30.214 -5.281  55.441 1.00 60.55  ? 560 ARG D CD  1 
ATOM   1962 N  NE  . ARG D 1 27 ? 30.555 -5.538  54.049 1.00 77.45  ? 560 ARG D NE  1 
ATOM   1963 C  CZ  . ARG D 1 27 ? 31.796 -5.724  53.619 1.00 98.46  ? 560 ARG D CZ  1 
ATOM   1964 N  NH1 . ARG D 1 27 ? 32.814 -5.689  54.471 1.00 79.87  ? 560 ARG D NH1 1 
ATOM   1965 N  NH2 . ARG D 1 27 ? 32.031 -5.948  52.333 1.00 98.59  ? 560 ARG D NH2 1 
ATOM   1966 N  N   . LEU D 1 28 ? 28.471 -2.220  59.670 1.00 37.46  ? 561 LEU D N   1 
ATOM   1967 C  CA  . LEU D 1 28 ? 28.490 -1.365  60.864 1.00 36.40  ? 561 LEU D CA  1 
ATOM   1968 C  C   . LEU D 1 28 ? 28.049 -2.115  62.125 1.00 38.46  ? 561 LEU D C   1 
ATOM   1969 O  O   . LEU D 1 28 ? 28.686 -1.980  63.175 1.00 40.01  ? 561 LEU D O   1 
ATOM   1970 C  CB  . LEU D 1 28 ? 27.524 -0.211  60.616 1.00 35.28  ? 561 LEU D CB  1 
ATOM   1971 C  CG  . LEU D 1 28 ? 27.838 1.210   60.950 1.00 40.59  ? 561 LEU D CG  1 
ATOM   1972 C  CD1 . LEU D 1 28 ? 29.095 1.706   60.236 1.00 41.94  ? 561 LEU D CD1 1 
ATOM   1973 C  CD2 . LEU D 1 28 ? 26.652 2.069   60.543 1.00 42.03  ? 561 LEU D CD2 1 
ATOM   1974 N  N   . PHE D 1 29 ? 26.954 -2.886  62.020 1.00 32.08  ? 562 PHE D N   1 
ATOM   1975 C  CA  . PHE D 1 29 ? 26.361 -3.591  63.141 1.00 32.10  ? 562 PHE D CA  1 
ATOM   1976 C  C   . PHE D 1 29 ? 27.378 -4.442  63.957 1.00 37.21  ? 562 PHE D C   1 
ATOM   1977 O  O   . PHE D 1 29 ? 27.414 -4.236  65.164 1.00 36.40  ? 562 PHE D O   1 
ATOM   1978 C  CB  . PHE D 1 29 ? 25.151 -4.449  62.711 1.00 33.84  ? 562 PHE D CB  1 
ATOM   1979 C  CG  . PHE D 1 29 ? 24.536 -5.165  63.891 1.00 35.35  ? 562 PHE D CG  1 
ATOM   1980 C  CD1 . PHE D 1 29 ? 23.732 -4.485  64.791 1.00 36.29  ? 562 PHE D CD1 1 
ATOM   1981 C  CD2 . PHE D 1 29 ? 24.825 -6.493  64.145 1.00 38.46  ? 562 PHE D CD2 1 
ATOM   1982 C  CE1 . PHE D 1 29 ? 23.228 -5.116  65.922 1.00 37.35  ? 562 PHE D CE1 1 
ATOM   1983 C  CE2 . PHE D 1 29 ? 24.305 -7.126  65.272 1.00 42.94  ? 562 PHE D CE2 1 
ATOM   1984 C  CZ  . PHE D 1 29 ? 23.517 -6.428  66.160 1.00 39.40  ? 562 PHE D CZ  1 
ATOM   1985 N  N   . PRO D 1 30 ? 28.178 -5.377  63.382 1.00 37.00  ? 563 PRO D N   1 
ATOM   1986 C  CA  . PRO D 1 30 ? 29.106 -6.164  64.227 1.00 38.83  ? 563 PRO D CA  1 
ATOM   1987 C  C   . PRO D 1 30 ? 30.155 -5.322  64.964 1.00 42.70  ? 563 PRO D C   1 
ATOM   1988 O  O   . PRO D 1 30 ? 30.565 -5.672  66.065 1.00 43.79  ? 563 PRO D O   1 
ATOM   1989 C  CB  . PRO D 1 30 ? 29.782 -7.108  63.227 1.00 42.72  ? 563 PRO D CB  1 
ATOM   1990 C  CG  . PRO D 1 30 ? 28.941 -7.087  62.001 1.00 45.85  ? 563 PRO D CG  1 
ATOM   1991 C  CD  . PRO D 1 30 ? 28.314 -5.752  61.955 1.00 39.09  ? 563 PRO D CD  1 
ATOM   1992 N  N   . LEU D 1 31 ? 30.580 -4.211  64.357 1.00 38.98  ? 564 LEU D N   1 
ATOM   1993 C  CA  . LEU D 1 31 ? 31.574 -3.307  64.930 1.00 38.51  ? 564 LEU D CA  1 
ATOM   1994 C  C   . LEU D 1 31 ? 30.994 -2.530  66.094 1.00 39.91  ? 564 LEU D C   1 
ATOM   1995 O  O   . LEU D 1 31 ? 31.657 -2.384  67.112 1.00 40.47  ? 564 LEU D O   1 
ATOM   1996 C  CB  . LEU D 1 31 ? 32.126 -2.353  63.847 1.00 37.68  ? 564 LEU D CB  1 
ATOM   1997 C  CG  . LEU D 1 31 ? 32.948 -3.000  62.724 1.00 43.18  ? 564 LEU D CG  1 
ATOM   1998 C  CD1 . LEU D 1 31 ? 33.295 -1.977  61.660 1.00 43.11  ? 564 LEU D CD1 1 
ATOM   1999 C  CD2 . LEU D 1 31 ? 34.228 -3.644  63.258 1.00 45.95  ? 564 LEU D CD2 1 
ATOM   2000 N  N   . ILE D 1 32 ? 29.751 -2.050  65.953 1.00 35.28  ? 565 ILE D N   1 
ATOM   2001 C  CA  . ILE D 1 32 ? 29.063 -1.316  67.020 1.00 33.49  ? 565 ILE D CA  1 
ATOM   2002 C  C   . ILE D 1 32 ? 28.762 -2.312  68.169 1.00 38.81  ? 565 ILE D C   1 
ATOM   2003 O  O   . ILE D 1 32 ? 28.945 -1.985  69.346 1.00 39.43  ? 565 ILE D O   1 
ATOM   2004 C  CB  . ILE D 1 32 ? 27.797 -0.580  66.495 1.00 34.16  ? 565 ILE D CB  1 
ATOM   2005 C  CG1 . ILE D 1 32 ? 28.183 0.481   65.450 1.00 33.13  ? 565 ILE D CG1 1 
ATOM   2006 C  CG2 . ILE D 1 32 ? 27.018 0.089   67.666 1.00 33.14  ? 565 ILE D CG2 1 
ATOM   2007 C  CD1 . ILE D 1 32 ? 27.046 1.118   64.711 1.00 36.22  ? 565 ILE D CD1 1 
ATOM   2008 N  N   . GLN D 1 33 ? 28.405 -3.553  67.800 1.00 34.51  ? 566 GLN D N   1 
ATOM   2009 C  CA  . GLN D 1 33 ? 28.092 -4.642  68.713 1.00 35.02  ? 566 GLN D CA  1 
ATOM   2010 C  C   . GLN D 1 33 ? 29.306 -5.020  69.577 1.00 40.55  ? 566 GLN D C   1 
ATOM   2011 O  O   . GLN D 1 33 ? 29.140 -5.491  70.693 1.00 41.31  ? 566 GLN D O   1 
ATOM   2012 C  CB  . GLN D 1 33 ? 27.619 -5.835  67.890 1.00 37.26  ? 566 GLN D CB  1 
ATOM   2013 C  CG  . GLN D 1 33 ? 26.884 -6.906  68.663 1.00 41.63  ? 566 GLN D CG  1 
ATOM   2014 C  CD  . GLN D 1 33 ? 26.656 -8.148  67.838 1.00 56.11  ? 566 GLN D CD  1 
ATOM   2015 O  OE1 . GLN D 1 33 ? 25.703 -8.890  68.067 1.00 55.18  ? 566 GLN D OE1 1 
ATOM   2016 N  NE2 . GLN D 1 33 ? 27.530 -8.434  66.881 1.00 46.27  ? 566 GLN D NE2 1 
ATOM   2017 N  N   . ALA D 1 34 ? 30.513 -4.826  69.062 1.00 37.99  ? 567 ALA D N   1 
ATOM   2018 C  CA  . ALA D 1 34 ? 31.743 -5.129  69.794 1.00 40.36  ? 567 ALA D CA  1 
ATOM   2019 C  C   . ALA D 1 34 ? 32.019 -4.045  70.884 1.00 45.04  ? 567 ALA D C   1 
ATOM   2020 O  O   . ALA D 1 34 ? 32.862 -4.236  71.770 1.00 46.58  ? 567 ALA D O   1 
ATOM   2021 C  CB  . ALA D 1 34 ? 32.913 -5.233  68.818 1.00 42.13  ? 567 ALA D CB  1 
HETATM 2022 N  N   . MSE D 1 35 ? 31.331 -2.907  70.792 1.00 40.51  ? 568 MSE D N   1 
HETATM 2023 C  CA  . MSE D 1 35 ? 31.465 -1.802  71.741 1.00 40.24  ? 568 MSE D CA  1 
HETATM 2024 C  C   . MSE D 1 35 ? 30.292 -1.770  72.720 1.00 42.70  ? 568 MSE D C   1 
HETATM 2025 O  O   . MSE D 1 35 ? 30.506 -1.780  73.930 1.00 42.71  ? 568 MSE D O   1 
HETATM 2026 C  CB  . MSE D 1 35 ? 31.549 -0.458  71.001 1.00 41.56  ? 568 MSE D CB  1 
HETATM 2027 C  CG  . MSE D 1 35 ? 32.791 -0.341  70.151 1.00 50.43  ? 568 MSE D CG  1 
HETATM 2028 SE SE  . MSE D 1 35 ? 32.623 1.117   68.897 0.75 57.92  ? 568 MSE D SE  1 
HETATM 2029 C  CE  . MSE D 1 35 ? 34.261 0.756   67.820 1.00 57.51  ? 568 MSE D CE  1 
ATOM   2030 N  N   . HIS D 1 36 ? 29.053 -1.684  72.188 1.00 37.89  ? 569 HIS D N   1 
ATOM   2031 C  CA  . HIS D 1 36 ? 27.808 -1.604  72.953 1.00 36.64  ? 569 HIS D CA  1 
ATOM   2032 C  C   . HIS D 1 36 ? 26.774 -2.567  72.384 1.00 39.60  ? 569 HIS D C   1 
ATOM   2033 O  O   . HIS D 1 36 ? 25.891 -2.134  71.647 1.00 36.81  ? 569 HIS D O   1 
ATOM   2034 C  CB  . HIS D 1 36 ? 27.288 -0.165  72.965 1.00 35.96  ? 569 HIS D CB  1 
ATOM   2035 C  CG  . HIS D 1 36 ? 28.167 0.723   73.782 1.00 40.29  ? 569 HIS D CG  1 
ATOM   2036 N  ND1 . HIS D 1 36 ? 28.104 0.728   75.185 1.00 43.07  ? 569 HIS D ND1 1 
ATOM   2037 C  CD2 . HIS D 1 36 ? 29.180 1.524   73.390 1.00 42.03  ? 569 HIS D CD2 1 
ATOM   2038 C  CE1 . HIS D 1 36 ? 29.043 1.568   75.584 1.00 43.34  ? 569 HIS D CE1 1 
ATOM   2039 N  NE2 . HIS D 1 36 ? 29.715 2.078   74.544 1.00 43.49  ? 569 HIS D NE2 1 
ATOM   2040 N  N   . PRO D 1 37 ? 26.872 -3.879  72.725 1.00 38.73  ? 570 PRO D N   1 
ATOM   2041 C  CA  . PRO D 1 37 ? 25.935 -4.868  72.151 1.00 38.95  ? 570 PRO D CA  1 
ATOM   2042 C  C   . PRO D 1 37 ? 24.450 -4.636  72.434 1.00 43.10  ? 570 PRO D C   1 
ATOM   2043 O  O   . PRO D 1 37 ? 23.625 -5.017  71.598 1.00 42.79  ? 570 PRO D O   1 
ATOM   2044 C  CB  . PRO D 1 37 ? 26.375 -6.202  72.783 1.00 42.04  ? 570 PRO D CB  1 
ATOM   2045 C  CG  . PRO D 1 37 ? 27.255 -5.850  73.901 1.00 46.28  ? 570 PRO D CG  1 
ATOM   2046 C  CD  . PRO D 1 37 ? 27.873 -4.536  73.600 1.00 40.93  ? 570 PRO D CD  1 
ATOM   2047 N  N   . THR D 1 38 ? 24.106 -4.055  73.599 1.00 39.84  ? 571 THR D N   1 
ATOM   2048 C  CA  . THR D 1 38 ? 22.719 -3.834  74.025 1.00 39.98  ? 571 THR D CA  1 
ATOM   2049 C  C   . THR D 1 38 ? 22.003 -2.821  73.132 1.00 42.79  ? 571 THR D C   1 
ATOM   2050 O  O   . THR D 1 38 ? 20.854 -3.069  72.778 1.00 43.61  ? 571 THR D O   1 
ATOM   2051 C  CB  . THR D 1 38 ? 22.676 -3.424  75.498 1.00 44.31  ? 571 THR D CB  1 
ATOM   2052 O  OG1 . THR D 1 38 ? 23.295 -4.477  76.239 1.00 51.09  ? 571 THR D OG1 1 
ATOM   2053 C  CG2 . THR D 1 38 ? 21.250 -3.195  76.020 1.00 40.03  ? 571 THR D CG2 1 
ATOM   2054 N  N   . LEU D 1 39 ? 22.651 -1.706  72.781 1.00 37.34  ? 572 LEU D N   1 
ATOM   2055 C  CA  . LEU D 1 39 ? 22.003 -0.686  71.954 1.00 36.65  ? 572 LEU D CA  1 
ATOM   2056 C  C   . LEU D 1 39 ? 22.490 -0.707  70.497 1.00 38.74  ? 572 LEU D C   1 
ATOM   2057 O  O   . LEU D 1 39 ? 22.087 0.151   69.724 1.00 38.98  ? 572 LEU D O   1 
ATOM   2058 C  CB  . LEU D 1 39 ? 22.237 0.708   72.561 1.00 36.62  ? 572 LEU D CB  1 
ATOM   2059 C  CG  . LEU D 1 39 ? 21.681 0.967   73.966 1.00 42.91  ? 572 LEU D CG  1 
ATOM   2060 C  CD1 . LEU D 1 39 ? 22.351 2.169   74.591 1.00 44.15  ? 572 LEU D CD1 1 
ATOM   2061 C  CD2 . LEU D 1 39 ? 20.178 1.155   73.948 1.00 44.21  ? 572 LEU D CD2 1 
ATOM   2062 N  N   . ALA D 1 40 ? 23.308 -1.700  70.111 1.00 33.66  ? 573 ALA D N   1 
ATOM   2063 C  CA  . ALA D 1 40 ? 23.916 -1.802  68.784 1.00 32.45  ? 573 ALA D CA  1 
ATOM   2064 C  C   . ALA D 1 40 ? 22.908 -1.686  67.634 1.00 35.94  ? 573 ALA D C   1 
ATOM   2065 O  O   . ALA D 1 40 ? 23.192 -0.963  66.685 1.00 34.06  ? 573 ALA D O   1 
ATOM   2066 C  CB  . ALA D 1 40 ? 24.717 -3.088  68.642 1.00 34.24  ? 573 ALA D CB  1 
ATOM   2067 N  N   . GLY D 1 41 ? 21.764 -2.368  67.726 1.00 33.68  ? 574 GLY D N   1 
ATOM   2068 C  CA  . GLY D 1 41 ? 20.729 -2.314  66.695 1.00 33.49  ? 574 GLY D CA  1 
ATOM   2069 C  C   . GLY D 1 41 ? 20.195 -0.916  66.453 1.00 36.61  ? 574 GLY D C   1 
ATOM   2070 O  O   . GLY D 1 41 ? 20.095 -0.469  65.306 1.00 36.75  ? 574 GLY D O   1 
ATOM   2071 N  N   . LYS D 1 42 ? 19.882 -0.215  67.546 1.00 34.32  ? 575 LYS D N   1 
ATOM   2072 C  CA  . LYS D 1 42 ? 19.376 1.157   67.545 1.00 33.60  ? 575 LYS D CA  1 
ATOM   2073 C  C   . LYS D 1 42 ? 20.448 2.134   67.066 1.00 35.85  ? 575 LYS D C   1 
ATOM   2074 O  O   . LYS D 1 42 ? 20.154 2.994   66.238 1.00 37.17  ? 575 LYS D O   1 
ATOM   2075 C  CB  . LYS D 1 42 ? 18.922 1.532   68.964 1.00 35.85  ? 575 LYS D CB  1 
ATOM   2076 C  CG  . LYS D 1 42 ? 17.538 2.116   69.011 1.00 47.65  ? 575 LYS D CG  1 
ATOM   2077 C  CD  . LYS D 1 42 ? 17.085 2.429   70.429 1.00 48.84  ? 575 LYS D CD  1 
ATOM   2078 C  CE  . LYS D 1 42 ? 15.674 1.950   70.666 1.00 63.19  ? 575 LYS D CE  1 
ATOM   2079 N  NZ  . LYS D 1 42 ? 14.707 2.548   69.704 1.00 71.55  ? 575 LYS D NZ  1 
ATOM   2080 N  N   . ILE D 1 43 ? 21.683 1.998   67.579 1.00 30.56  ? 576 ILE D N   1 
ATOM   2081 C  CA  . ILE D 1 43 ? 22.808 2.880   67.241 1.00 29.20  ? 576 ILE D CA  1 
ATOM   2082 C  C   . ILE D 1 43 ? 23.121 2.733   65.757 1.00 31.93  ? 576 ILE D C   1 
ATOM   2083 O  O   . ILE D 1 43 ? 23.321 3.740   65.088 1.00 31.87  ? 576 ILE D O   1 
ATOM   2084 C  CB  . ILE D 1 43 ? 24.041 2.618   68.137 1.00 31.56  ? 576 ILE D CB  1 
ATOM   2085 C  CG1 . ILE D 1 43 ? 23.720 2.954   69.618 1.00 32.74  ? 576 ILE D CG1 1 
ATOM   2086 C  CG2 . ILE D 1 43 ? 25.251 3.434   67.651 1.00 31.07  ? 576 ILE D CG2 1 
ATOM   2087 C  CD1 . ILE D 1 43 ? 24.751 2.341   70.620 1.00 40.60  ? 576 ILE D CD1 1 
ATOM   2088 N  N   . THR D 1 44 ? 23.106 1.496   65.233 1.00 28.92  ? 577 THR D N   1 
ATOM   2089 C  CA  . THR D 1 44 ? 23.341 1.219   63.800 1.00 29.21  ? 577 THR D CA  1 
ATOM   2090 C  C   . THR D 1 44 ? 22.349 2.008   62.942 1.00 33.39  ? 577 THR D C   1 
ATOM   2091 O  O   . THR D 1 44 ? 22.782 2.735   62.062 1.00 34.35  ? 577 THR D O   1 
ATOM   2092 C  CB  . THR D 1 44 ? 23.279 -0.285  63.517 1.00 34.13  ? 577 THR D CB  1 
ATOM   2093 O  OG1 . THR D 1 44 ? 24.314 -0.903  64.286 1.00 35.82  ? 577 THR D OG1 1 
ATOM   2094 C  CG2 . THR D 1 44 ? 23.444 -0.620  62.032 1.00 31.83  ? 577 THR D CG2 1 
ATOM   2095 N  N   . GLY D 1 45 ? 21.063 1.912   63.260 1.00 30.04  ? 578 GLY D N   1 
ATOM   2096 C  CA  . GLY D 1 45 ? 20.016 2.640   62.555 1.00 30.21  ? 578 GLY D CA  1 
ATOM   2097 C  C   . GLY D 1 45 ? 20.238 4.143   62.550 1.00 34.23  ? 578 GLY D C   1 
ATOM   2098 O  O   . GLY D 1 45 ? 20.045 4.805   61.526 1.00 35.24  ? 578 GLY D O   1 
HETATM 2099 N  N   . MSE D 1 46 ? 20.679 4.684   63.688 1.00 30.02  ? 579 MSE D N   1 
HETATM 2100 C  CA  . MSE D 1 46 ? 20.962 6.115   63.854 1.00 28.54  ? 579 MSE D CA  1 
HETATM 2101 C  C   . MSE D 1 46 ? 22.162 6.542   63.044 1.00 32.55  ? 579 MSE D C   1 
HETATM 2102 O  O   . MSE D 1 46 ? 22.067 7.545   62.347 1.00 32.37  ? 579 MSE D O   1 
HETATM 2103 C  CB  . MSE D 1 46 ? 21.188 6.458   65.323 1.00 29.86  ? 579 MSE D CB  1 
HETATM 2104 C  CG  . MSE D 1 46 ? 19.991 6.148   66.175 1.00 36.48  ? 579 MSE D CG  1 
HETATM 2105 SE SE  . MSE D 1 46 ? 20.456 6.169   68.071 0.75 44.35  ? 579 MSE D SE  1 
HETATM 2106 C  CE  . MSE D 1 46 ? 20.236 8.117   68.390 1.00 42.10  ? 579 MSE D CE  1 
ATOM   2107 N  N   . LEU D 1 47 ? 23.289 5.789   63.121 1.00 29.07  ? 580 LEU D N   1 
ATOM   2108 C  CA  . LEU D 1 47 ? 24.518 6.109   62.405 1.00 28.93  ? 580 LEU D CA  1 
ATOM   2109 C  C   . LEU D 1 47 ? 24.355 5.964   60.897 1.00 32.19  ? 580 LEU D C   1 
ATOM   2110 O  O   . LEU D 1 47 ? 25.088 6.620   60.152 1.00 32.39  ? 580 LEU D O   1 
ATOM   2111 C  CB  . LEU D 1 47 ? 25.708 5.272   62.906 1.00 29.52  ? 580 LEU D CB  1 
ATOM   2112 C  CG  . LEU D 1 47 ? 26.125 5.479   64.389 1.00 34.99  ? 580 LEU D CG  1 
ATOM   2113 C  CD1 . LEU D 1 47 ? 27.498 4.892   64.641 1.00 35.42  ? 580 LEU D CD1 1 
ATOM   2114 C  CD2 . LEU D 1 47 ? 26.202 6.944   64.755 1.00 39.24  ? 580 LEU D CD2 1 
ATOM   2115 N  N   . LEU D 1 48 ? 23.350 5.177   60.432 1.00 27.30  ? 581 LEU D N   1 
ATOM   2116 C  CA  . LEU D 1 48 ? 23.076 5.038   59.006 1.00 25.50  ? 581 LEU D CA  1 
ATOM   2117 C  C   . LEU D 1 48 ? 22.533 6.324   58.411 1.00 31.65  ? 581 LEU D C   1 
ATOM   2118 O  O   . LEU D 1 48 ? 22.444 6.420   57.205 1.00 32.20  ? 581 LEU D O   1 
ATOM   2119 C  CB  . LEU D 1 48 ? 22.132 3.884   58.723 1.00 25.13  ? 581 LEU D CB  1 
ATOM   2120 C  CG  . LEU D 1 48 ? 22.768 2.509   58.752 1.00 28.99  ? 581 LEU D CG  1 
ATOM   2121 C  CD1 . LEU D 1 48 ? 21.718 1.455   58.645 1.00 28.98  ? 581 LEU D CD1 1 
ATOM   2122 C  CD2 . LEU D 1 48 ? 23.830 2.343   57.655 1.00 31.52  ? 581 LEU D CD2 1 
ATOM   2123 N  N   . GLU D 1 49 ? 22.231 7.338   59.234 1.00 31.48  ? 582 GLU D N   1 
ATOM   2124 C  CA  . GLU D 1 49 ? 21.769 8.660   58.756 1.00 31.82  ? 582 GLU D CA  1 
ATOM   2125 C  C   . GLU D 1 49 ? 22.936 9.461   58.205 1.00 34.50  ? 582 GLU D C   1 
ATOM   2126 O  O   . GLU D 1 49 ? 22.730 10.381  57.409 1.00 35.83  ? 582 GLU D O   1 
ATOM   2127 C  CB  . GLU D 1 49 ? 21.079 9.470   59.879 1.00 33.46  ? 582 GLU D CB  1 
ATOM   2128 C  CG  . GLU D 1 49 ? 19.819 8.836   60.445 1.00 39.03  ? 582 GLU D CG  1 
ATOM   2129 C  CD  . GLU D 1 49 ? 18.605 8.761   59.545 1.00 45.79  ? 582 GLU D CD  1 
ATOM   2130 O  OE1 . GLU D 1 49 ? 18.631 9.331   58.430 1.00 42.11  ? 582 GLU D OE1 1 
ATOM   2131 O  OE2 . GLU D 1 49 ? 17.609 8.138   59.974 1.00 42.66  ? 582 GLU D OE2 1 
ATOM   2132 N  N   . ILE D 1 50 ? 24.156 9.130   58.653 1.00 29.68  ? 583 ILE D N   1 
ATOM   2133 C  CA  . ILE D 1 50 ? 25.396 9.790   58.231 1.00 30.36  ? 583 ILE D CA  1 
ATOM   2134 C  C   . ILE D 1 50 ? 25.633 9.509   56.726 1.00 36.69  ? 583 ILE D C   1 
ATOM   2135 O  O   . ILE D 1 50 ? 25.236 8.452   56.229 1.00 35.57  ? 583 ILE D O   1 
ATOM   2136 C  CB  . ILE D 1 50 ? 26.559 9.306   59.123 1.00 32.84  ? 583 ILE D CB  1 
ATOM   2137 C  CG1 . ILE D 1 50 ? 26.336 9.719   60.611 1.00 32.57  ? 583 ILE D CG1 1 
ATOM   2138 C  CG2 . ILE D 1 50 ? 27.887 9.818   58.603 1.00 34.69  ? 583 ILE D CG2 1 
ATOM   2139 C  CD1 . ILE D 1 50 ? 27.240 9.056   61.665 1.00 30.84  ? 583 ILE D CD1 1 
ATOM   2140 N  N   . ASP D 1 51 ? 26.228 10.476  55.997 1.00 35.43  ? 584 ASP D N   1 
ATOM   2141 C  CA  . ASP D 1 51 ? 26.527 10.325  54.578 1.00 35.96  ? 584 ASP D CA  1 
ATOM   2142 C  C   . ASP D 1 51 ? 27.415 9.108   54.363 1.00 36.37  ? 584 ASP D C   1 
ATOM   2143 O  O   . ASP D 1 51 ? 28.275 8.815   55.187 1.00 36.77  ? 584 ASP D O   1 
ATOM   2144 C  CB  . ASP D 1 51 ? 27.184 11.603  54.019 1.00 41.24  ? 584 ASP D CB  1 
ATOM   2145 C  CG  . ASP D 1 51 ? 26.192 12.726  53.670 1.00 63.53  ? 584 ASP D CG  1 
ATOM   2146 O  OD1 . ASP D 1 51 ? 25.029 12.403  53.245 1.00 64.41  ? 584 ASP D OD1 1 
ATOM   2147 O  OD2 . ASP D 1 51 ? 26.580 13.930  53.786 1.00 72.89  ? 584 ASP D OD2 1 
ATOM   2148 N  N   . ASN D 1 52 ? 27.150 8.373   53.295 1.00 31.78  ? 585 ASN D N   1 
ATOM   2149 C  CA  . ASN D 1 52 ? 27.815 7.127   52.907 1.00 31.92  ? 585 ASN D CA  1 
ATOM   2150 C  C   . ASN D 1 52 ? 29.361 7.225   52.897 1.00 38.26  ? 585 ASN D C   1 
ATOM   2151 O  O   . ASN D 1 52 ? 30.005 6.289   53.370 1.00 38.51  ? 585 ASN D O   1 
ATOM   2152 C  CB  . ASN D 1 52 ? 27.290 6.651   51.537 1.00 26.92  ? 585 ASN D CB  1 
ATOM   2153 C  CG  . ASN D 1 52 ? 25.875 6.121   51.604 1.00 37.81  ? 585 ASN D CG  1 
ATOM   2154 O  OD1 . ASN D 1 52 ? 25.248 6.029   52.661 1.00 35.83  ? 585 ASN D OD1 1 
ATOM   2155 N  ND2 . ASN D 1 52 ? 25.342 5.688   50.495 1.00 28.99  ? 585 ASN D ND2 1 
ATOM   2156 N  N   . SER D 1 53 ? 29.948 8.344   52.402 1.00 35.60  ? 586 SER D N   1 
ATOM   2157 C  CA  . SER D 1 53 ? 31.409 8.505   52.383 1.00 37.53  ? 586 SER D CA  1 
ATOM   2158 C  C   . SER D 1 53 ? 31.979 8.556   53.797 1.00 41.59  ? 586 SER D C   1 
ATOM   2159 O  O   . SER D 1 53 ? 33.001 7.937   54.050 1.00 44.36  ? 586 SER D O   1 
ATOM   2160 C  CB  . SER D 1 53 ? 31.844 9.758   51.622 1.00 42.98  ? 586 SER D CB  1 
ATOM   2161 O  OG  . SER D 1 53 ? 30.918 10.193  50.645 1.00 56.10  ? 586 SER D OG  1 
ATOM   2162 N  N   . GLU D 1 54 ? 31.317 9.269   54.718 1.00 37.14  ? 587 GLU D N   1 
ATOM   2163 C  CA  . GLU D 1 54 ? 31.745 9.355   56.107 1.00 37.13  ? 587 GLU D CA  1 
ATOM   2164 C  C   . GLU D 1 54 ? 31.567 7.979   56.795 1.00 39.11  ? 587 GLU D C   1 
ATOM   2165 O  O   . GLU D 1 54 ? 32.428 7.581   57.584 1.00 40.33  ? 587 GLU D O   1 
ATOM   2166 C  CB  . GLU D 1 54 ? 30.994 10.481  56.833 1.00 38.28  ? 587 GLU D CB  1 
ATOM   2167 C  CG  . GLU D 1 54 ? 31.431 10.745  58.276 1.00 48.28  ? 587 GLU D CG  1 
ATOM   2168 C  CD  . GLU D 1 54 ? 32.883 11.075  58.575 1.00 62.47  ? 587 GLU D CD  1 
ATOM   2169 O  OE1 . GLU D 1 54 ? 33.573 11.618  57.683 1.00 48.59  ? 587 GLU D OE1 1 
ATOM   2170 O  OE2 . GLU D 1 54 ? 33.307 10.856  59.734 1.00 60.70  ? 587 GLU D OE2 1 
ATOM   2171 N  N   . LEU D 1 55 ? 30.529 7.211   56.411 1.00 33.29  ? 588 LEU D N   1 
ATOM   2172 C  CA  . LEU D 1 55 ? 30.326 5.861   56.950 1.00 31.98  ? 588 LEU D CA  1 
ATOM   2173 C  C   . LEU D 1 55 ? 31.444 4.902   56.510 1.00 36.58  ? 588 LEU D C   1 
ATOM   2174 O  O   . LEU D 1 55 ? 31.892 4.099   57.313 1.00 36.38  ? 588 LEU D O   1 
ATOM   2175 C  CB  . LEU D 1 55 ? 28.948 5.306   56.541 1.00 29.90  ? 588 LEU D CB  1 
ATOM   2176 C  CG  . LEU D 1 55 ? 27.737 5.843   57.341 1.00 31.09  ? 588 LEU D CG  1 
ATOM   2177 C  CD1 . LEU D 1 55 ? 26.428 5.329   56.754 1.00 27.93  ? 588 LEU D CD1 1 
ATOM   2178 C  CD2 . LEU D 1 55 ? 27.843 5.525   58.860 1.00 33.16  ? 588 LEU D CD2 1 
ATOM   2179 N  N   . LEU D 1 56 ? 31.919 5.020   55.266 1.00 35.37  ? 589 LEU D N   1 
ATOM   2180 C  CA  . LEU D 1 56 ? 33.002 4.192   54.727 1.00 38.37  ? 589 LEU D CA  1 
ATOM   2181 C  C   . LEU D 1 56 ? 34.294 4.478   55.464 1.00 46.20  ? 589 LEU D C   1 
ATOM   2182 O  O   . LEU D 1 56 ? 35.029 3.535   55.773 1.00 48.86  ? 589 LEU D O   1 
ATOM   2183 C  CB  . LEU D 1 56 ? 33.189 4.402   53.208 1.00 39.18  ? 589 LEU D CB  1 
ATOM   2184 C  CG  . LEU D 1 56 ? 32.065 3.825   52.345 1.00 42.64  ? 589 LEU D CG  1 
ATOM   2185 C  CD1 . LEU D 1 56 ? 32.022 4.497   50.975 1.00 43.29  ? 589 LEU D CD1 1 
ATOM   2186 C  CD2 . LEU D 1 56 ? 32.184 2.311   52.210 1.00 44.64  ? 589 LEU D CD2 1 
ATOM   2187 N  N   . TYR D 1 57 ? 34.548 5.773   55.778 1.00 43.09  ? 590 TYR D N   1 
ATOM   2188 C  CA  . TYR D 1 57 ? 35.703 6.201   56.570 1.00 46.05  ? 590 TYR D CA  1 
ATOM   2189 C  C   . TYR D 1 57 ? 35.630 5.555   57.985 1.00 49.03  ? 590 TYR D C   1 
ATOM   2190 O  O   . TYR D 1 57 ? 36.608 4.979   58.452 1.00 51.29  ? 590 TYR D O   1 
ATOM   2191 C  CB  . TYR D 1 57 ? 35.746 7.744   56.657 1.00 48.93  ? 590 TYR D CB  1 
ATOM   2192 C  CG  . TYR D 1 57 ? 36.748 8.272   57.663 1.00 55.61  ? 590 TYR D CG  1 
ATOM   2193 C  CD1 . TYR D 1 57 ? 38.090 8.422   57.326 1.00 61.40  ? 590 TYR D CD1 1 
ATOM   2194 C  CD2 . TYR D 1 57 ? 36.354 8.620   58.956 1.00 56.18  ? 590 TYR D CD2 1 
ATOM   2195 C  CE1 . TYR D 1 57 ? 39.024 8.880   58.259 1.00 66.12  ? 590 TYR D CE1 1 
ATOM   2196 C  CE2 . TYR D 1 57 ? 37.278 9.078   59.896 1.00 60.32  ? 590 TYR D CE2 1 
ATOM   2197 C  CZ  . TYR D 1 57 ? 38.613 9.205   59.545 1.00 74.45  ? 590 TYR D CZ  1 
ATOM   2198 O  OH  . TYR D 1 57 ? 39.521 9.655   60.481 1.00 80.79  ? 590 TYR D OH  1 
HETATM 2199 N  N   . MSE D 1 58 ? 34.443 5.657   58.625 1.00 41.74  ? 591 MSE D N   1 
HETATM 2200 C  CA  A MSE D 1 58 ? 34.175 5.138   59.966 0.50 37.97  ? 591 MSE D CA  1 
HETATM 2201 C  CA  B MSE D 1 58 ? 34.148 5.123   59.958 0.50 42.03  ? 591 MSE D CA  1 
HETATM 2202 C  C   . MSE D 1 58 ? 34.330 3.622   60.035 1.00 45.40  ? 591 MSE D C   1 
HETATM 2203 O  O   . MSE D 1 58 ? 34.751 3.126   61.066 1.00 45.78  ? 591 MSE D O   1 
HETATM 2204 C  CB  A MSE D 1 58 ? 32.779 5.546   60.422 0.50 35.27  ? 591 MSE D CB  1 
HETATM 2205 C  CB  B MSE D 1 58 ? 32.719 5.457   60.350 0.50 42.49  ? 591 MSE D CB  1 
HETATM 2206 C  CG  A MSE D 1 58 ? 32.683 7.017   60.811 0.50 39.15  ? 591 MSE D CG  1 
HETATM 2207 C  CG  B MSE D 1 58 ? 32.606 6.696   61.187 0.50 51.24  ? 591 MSE D CG  1 
HETATM 2208 SE SE  A MSE D 1 58 ? 30.842 7.650   60.778 0.38 40.56  ? 591 MSE D SE  1 
HETATM 2209 SE SE  B MSE D 1 58 ? 30.737 6.930   61.610 0.37 58.12  ? 591 MSE D SE  1 
HETATM 2210 C  CE  A MSE D 1 58 ? 29.977 6.301   62.045 0.50 35.82  ? 591 MSE D CE  1 
HETATM 2211 C  CE  B MSE D 1 58 ? 30.316 7.957   60.182 0.50 54.66  ? 591 MSE D CE  1 
ATOM   2212 N  N   . LEU D 1 59 ? 34.023 2.894   58.938 1.00 43.92  ? 592 LEU D N   1 
ATOM   2213 C  CA  . LEU D 1 59 ? 34.187 1.440   58.895 1.00 45.21  ? 592 LEU D CA  1 
ATOM   2214 C  C   . LEU D 1 59 ? 35.676 1.061   58.974 1.00 55.78  ? 592 LEU D C   1 
ATOM   2215 O  O   . LEU D 1 59 ? 36.002 -0.073  59.337 1.00 57.34  ? 592 LEU D O   1 
ATOM   2216 C  CB  . LEU D 1 59 ? 33.553 0.829   57.626 1.00 44.24  ? 592 LEU D CB  1 
ATOM   2217 C  CG  . LEU D 1 59 ? 32.040 0.652   57.612 1.00 46.78  ? 592 LEU D CG  1 
ATOM   2218 C  CD1 . LEU D 1 59 ? 31.560 0.200   56.240 1.00 46.88  ? 592 LEU D CD1 1 
ATOM   2219 C  CD2 . LEU D 1 59 ? 31.574 -0.322  58.663 1.00 47.39  ? 592 LEU D CD2 1 
ATOM   2220 N  N   . GLU D 1 60 ? 36.574 2.012   58.637 1.00 55.18  ? 593 GLU D N   1 
ATOM   2221 C  CA  . GLU D 1 60 ? 38.026 1.801   58.645 1.00 59.18  ? 593 GLU D CA  1 
ATOM   2222 C  C   . GLU D 1 60 ? 38.746 2.581   59.767 1.00 62.85  ? 593 GLU D C   1 
ATOM   2223 O  O   . GLU D 1 60 ? 39.964 2.469   59.899 1.00 66.54  ? 593 GLU D O   1 
ATOM   2224 C  CB  . GLU D 1 60 ? 38.623 2.194   57.270 1.00 62.90  ? 593 GLU D CB  1 
ATOM   2225 C  CG  . GLU D 1 60 ? 38.284 1.228   56.137 1.00 81.10  ? 593 GLU D CG  1 
ATOM   2226 C  CD  . GLU D 1 60 ? 38.729 -0.219  56.305 1.00 114.23 ? 593 GLU D CD  1 
ATOM   2227 O  OE1 . GLU D 1 60 ? 39.899 -0.520  55.971 1.00 130.36 ? 593 GLU D OE1 1 
ATOM   2228 O  OE2 . GLU D 1 60 ? 37.901 -1.056  56.741 1.00 94.85  ? 593 GLU D OE2 1 
ATOM   2229 N  N   . SER D 1 61 ? 38.015 3.372   60.553 1.00 55.80  ? 594 SER D N   1 
ATOM   2230 C  CA  . SER D 1 61 ? 38.582 4.179   61.627 1.00 56.49  ? 594 SER D CA  1 
ATOM   2231 C  C   . SER D 1 61 ? 37.883 3.838   62.943 1.00 57.25  ? 594 SER D C   1 
ATOM   2232 O  O   . SER D 1 61 ? 36.814 4.387   63.248 1.00 54.54  ? 594 SER D O   1 
ATOM   2233 C  CB  . SER D 1 61 ? 38.467 5.662   61.298 1.00 60.98  ? 594 SER D CB  1 
ATOM   2234 O  OG  . SER D 1 61 ? 38.999 6.433   62.363 1.00 78.73  ? 594 SER D OG  1 
ATOM   2235 N  N   . PRO D 1 62 ? 38.466 2.910   63.733 1.00 53.62  ? 595 PRO D N   1 
ATOM   2236 C  CA  . PRO D 1 62 ? 37.794 2.474   64.970 1.00 51.69  ? 595 PRO D CA  1 
ATOM   2237 C  C   . PRO D 1 62 ? 37.515 3.587   65.976 1.00 55.82  ? 595 PRO D C   1 
ATOM   2238 O  O   . PRO D 1 62 ? 36.476 3.540   66.628 1.00 53.59  ? 595 PRO D O   1 
ATOM   2239 C  CB  . PRO D 1 62 ? 38.764 1.440   65.552 1.00 55.79  ? 595 PRO D CB  1 
ATOM   2240 C  CG  . PRO D 1 62 ? 39.543 0.957   64.384 1.00 61.84  ? 595 PRO D CG  1 
ATOM   2241 C  CD  . PRO D 1 62 ? 39.717 2.157   63.513 1.00 57.42  ? 595 PRO D CD  1 
ATOM   2242 N  N   . GLU D 1 63 ? 38.407 4.579   66.102 1.00 55.46  ? 596 GLU D N   1 
ATOM   2243 C  CA  . GLU D 1 63 ? 38.224 5.656   67.080 1.00 55.13  ? 596 GLU D CA  1 
ATOM   2244 C  C   . GLU D 1 63 ? 37.157 6.658   66.631 1.00 52.71  ? 596 GLU D C   1 
ATOM   2245 O  O   . GLU D 1 63 ? 36.487 7.229   67.500 1.00 50.69  ? 596 GLU D O   1 
ATOM   2246 C  CB  . GLU D 1 63 ? 39.556 6.340   67.445 1.00 60.74  ? 596 GLU D CB  1 
ATOM   2247 C  CG  . GLU D 1 63 ? 40.448 5.482   68.350 1.00 74.85  ? 596 GLU D CG  1 
ATOM   2248 C  CD  . GLU D 1 63 ? 39.787 4.482   69.297 1.00 90.30  ? 596 GLU D CD  1 
ATOM   2249 O  OE1 . GLU D 1 63 ? 39.123 4.916   70.267 1.00 81.00  ? 596 GLU D OE1 1 
ATOM   2250 O  OE2 . GLU D 1 63 ? 39.961 3.259   69.085 1.00 81.77  ? 596 GLU D OE2 1 
ATOM   2251 N  N   . SER D 1 64 ? 36.988 6.846   65.298 1.00 47.24  ? 597 SER D N   1 
ATOM   2252 C  CA  A SER D 1 64 ? 35.958 7.732   64.755 0.50 45.03  ? 597 SER D CA  1 
ATOM   2253 C  CA  B SER D 1 64 ? 35.958 7.727   64.738 0.50 45.34  ? 597 SER D CA  1 
ATOM   2254 C  C   . SER D 1 64 ? 34.592 7.072   64.933 1.00 45.70  ? 597 SER D C   1 
ATOM   2255 O  O   . SER D 1 64 ? 33.631 7.730   65.342 1.00 43.87  ? 597 SER D O   1 
ATOM   2256 C  CB  A SER D 1 64 ? 36.231 8.065   63.290 0.50 48.74  ? 597 SER D CB  1 
ATOM   2257 C  CB  B SER D 1 64 ? 36.226 8.015   63.262 0.50 50.00  ? 597 SER D CB  1 
ATOM   2258 O  OG  A SER D 1 64 ? 37.288 9.003   63.174 0.50 58.40  ? 597 SER D OG  1 
ATOM   2259 O  OG  B SER D 1 64 ? 35.263 8.896   62.707 0.50 58.69  ? 597 SER D OG  1 
ATOM   2260 N  N   . LEU D 1 65 ? 34.520 5.753   64.700 1.00 41.18  ? 598 LEU D N   1 
ATOM   2261 C  CA  . LEU D 1 65 ? 33.292 5.008   64.902 1.00 37.92  ? 598 LEU D CA  1 
ATOM   2262 C  C   . LEU D 1 65 ? 32.929 5.026   66.401 1.00 42.68  ? 598 LEU D C   1 
ATOM   2263 O  O   . LEU D 1 65 ? 31.778 5.292   66.728 1.00 42.25  ? 598 LEU D O   1 
ATOM   2264 C  CB  . LEU D 1 65 ? 33.423 3.578   64.355 1.00 37.45  ? 598 LEU D CB  1 
ATOM   2265 C  CG  . LEU D 1 65 ? 32.255 2.614   64.614 1.00 39.99  ? 598 LEU D CG  1 
ATOM   2266 C  CD1 . LEU D 1 65 ? 30.945 3.133   64.029 1.00 36.85  ? 598 LEU D CD1 1 
ATOM   2267 C  CD2 . LEU D 1 65 ? 32.558 1.271   64.042 1.00 42.93  ? 598 LEU D CD2 1 
ATOM   2268 N  N   . ARG D 1 66 ? 33.915 4.822   67.294 1.00 41.20  ? 599 ARG D N   1 
ATOM   2269 C  CA  . ARG D 1 66 ? 33.743 4.838   68.751 1.00 41.04  ? 599 ARG D CA  1 
ATOM   2270 C  C   . ARG D 1 66 ? 33.131 6.141   69.226 1.00 43.89  ? 599 ARG D C   1 
ATOM   2271 O  O   . ARG D 1 66 ? 32.174 6.106   70.003 1.00 42.87  ? 599 ARG D O   1 
ATOM   2272 C  CB  . ARG D 1 66 ? 35.084 4.604   69.489 1.00 42.43  ? 599 ARG D CB  1 
ATOM   2273 C  CG  . ARG D 1 66 ? 34.904 4.380   71.015 1.00 54.59  ? 599 ARG D CG  1 
ATOM   2274 C  CD  . ARG D 1 66 ? 36.153 3.906   71.767 1.00 64.75  ? 599 ARG D CD  1 
ATOM   2275 N  NE  . ARG D 1 66 ? 36.921 2.889   71.034 1.00 76.04  ? 599 ARG D NE  1 
ATOM   2276 C  CZ  . ARG D 1 66 ? 36.598 1.600   70.947 1.00 92.20  ? 599 ARG D CZ  1 
ATOM   2277 N  NH1 . ARG D 1 66 ? 35.517 1.133   71.564 1.00 75.24  ? 599 ARG D NH1 1 
ATOM   2278 N  NH2 . ARG D 1 66 ? 37.346 0.770   70.233 1.00 84.43  ? 599 ARG D NH2 1 
ATOM   2279 N  N   . SER D 1 67 ? 33.688 7.282   68.786 1.00 41.42  ? 600 SER D N   1 
ATOM   2280 C  CA  . SER D 1 67 ? 33.191 8.586   69.210 1.00 42.67  ? 600 SER D CA  1 
ATOM   2281 C  C   . SER D 1 67 ? 31.777 8.848   68.681 1.00 44.29  ? 600 SER D C   1 
ATOM   2282 O  O   . SER D 1 67 ? 30.988 9.450   69.401 1.00 44.39  ? 600 SER D O   1 
ATOM   2283 C  CB  . SER D 1 67 ? 34.145 9.703   68.813 1.00 50.65  ? 600 SER D CB  1 
ATOM   2284 O  OG  . SER D 1 67 ? 34.296 9.765   67.409 1.00 65.07  ? 600 SER D OG  1 
ATOM   2285 N  N   . LYS D 1 68 ? 31.434 8.345   67.478 1.00 38.70  ? 601 LYS D N   1 
ATOM   2286 C  CA  . LYS D 1 68 ? 30.081 8.491   66.919 1.00 36.25  ? 601 LYS D CA  1 
ATOM   2287 C  C   . LYS D 1 68 ? 29.087 7.619   67.683 1.00 38.31  ? 601 LYS D C   1 
ATOM   2288 O  O   . LYS D 1 68 ? 27.977 8.073   67.941 1.00 36.28  ? 601 LYS D O   1 
ATOM   2289 C  CB  . LYS D 1 68 ? 30.024 8.178   65.413 1.00 36.48  ? 601 LYS D CB  1 
ATOM   2290 C  CG  . LYS D 1 68 ? 30.745 9.191   64.521 1.00 41.64  ? 601 LYS D CG  1 
ATOM   2291 C  CD  . LYS D 1 68 ? 30.211 10.572  64.654 1.00 45.15  ? 601 LYS D CD  1 
ATOM   2292 C  CE  . LYS D 1 68 ? 30.908 11.553  63.768 1.00 43.74  ? 601 LYS D CE  1 
ATOM   2293 N  NZ  . LYS D 1 68 ? 30.544 12.920  64.184 1.00 59.23  ? 601 LYS D NZ  1 
ATOM   2294 N  N   . VAL D 1 69 ? 29.502 6.389   68.086 1.00 34.75  ? 602 VAL D N   1 
ATOM   2295 C  CA  . VAL D 1 69 ? 28.689 5.469   68.883 1.00 32.83  ? 602 VAL D CA  1 
ATOM   2296 C  C   . VAL D 1 69 ? 28.376 6.134   70.248 1.00 38.24  ? 602 VAL D C   1 
ATOM   2297 O  O   . VAL D 1 69 ? 27.227 6.126   70.694 1.00 37.96  ? 602 VAL D O   1 
ATOM   2298 C  CB  . VAL D 1 69 ? 29.384 4.088   69.034 1.00 37.06  ? 602 VAL D CB  1 
ATOM   2299 C  CG1 . VAL D 1 69 ? 28.718 3.229   70.116 1.00 35.81  ? 602 VAL D CG1 1 
ATOM   2300 C  CG2 . VAL D 1 69 ? 29.402 3.343   67.700 1.00 36.54  ? 602 VAL D CG2 1 
ATOM   2301 N  N   . ASP D 1 70 ? 29.391 6.744   70.874 1.00 37.37  ? 603 ASP D N   1 
ATOM   2302 C  CA  . ASP D 1 70 ? 29.265 7.431   72.160 1.00 39.26  ? 603 ASP D CA  1 
ATOM   2303 C  C   . ASP D 1 70 ? 28.313 8.626   72.051 1.00 42.77  ? 603 ASP D C   1 
ATOM   2304 O  O   . ASP D 1 70 ? 27.489 8.836   72.951 1.00 41.77  ? 603 ASP D O   1 
ATOM   2305 C  CB  . ASP D 1 70 ? 30.641 7.890   72.665 1.00 43.67  ? 603 ASP D CB  1 
ATOM   2306 C  CG  . ASP D 1 70 ? 31.591 6.795   73.131 1.00 54.06  ? 603 ASP D CG  1 
ATOM   2307 O  OD1 . ASP D 1 70 ? 31.140 5.629   73.271 1.00 51.66  ? 603 ASP D OD1 1 
ATOM   2308 O  OD2 . ASP D 1 70 ? 32.787 7.105   73.357 1.00 61.99  ? 603 ASP D OD2 1 
ATOM   2309 N  N   . GLU D 1 71 ? 28.408 9.373   70.932 1.00 39.08  ? 604 GLU D N   1 
ATOM   2310 C  CA  . GLU D 1 71 ? 27.546 10.507  70.642 1.00 39.72  ? 604 GLU D CA  1 
ATOM   2311 C  C   . GLU D 1 71 ? 26.105 10.034  70.438 1.00 43.15  ? 604 GLU D C   1 
ATOM   2312 O  O   . GLU D 1 71 ? 25.204 10.687  70.951 1.00 45.27  ? 604 GLU D O   1 
ATOM   2313 C  CB  . GLU D 1 71 ? 28.036 11.280  69.412 1.00 41.63  ? 604 GLU D CB  1 
ATOM   2314 C  CG  . GLU D 1 71 ? 29.203 12.217  69.698 1.00 51.28  ? 604 GLU D CG  1 
ATOM   2315 C  CD  . GLU D 1 71 ? 29.866 12.915  68.519 1.00 67.54  ? 604 GLU D CD  1 
ATOM   2316 O  OE1 . GLU D 1 71 ? 29.672 12.479  67.360 1.00 51.24  ? 604 GLU D OE1 1 
ATOM   2317 O  OE2 . GLU D 1 71 ? 30.671 13.839  68.772 1.00 70.71  ? 604 GLU D OE2 1 
ATOM   2318 N  N   . ALA D 1 72 ? 25.890 8.881   69.754 1.00 35.61  ? 605 ALA D N   1 
ATOM   2319 C  CA  . ALA D 1 72 ? 24.560 8.299   69.530 1.00 33.99  ? 605 ALA D CA  1 
ATOM   2320 C  C   . ALA D 1 72 ? 23.932 7.869   70.867 1.00 38.65  ? 605 ALA D C   1 
ATOM   2321 O  O   . ALA D 1 72 ? 22.744 8.131   71.114 1.00 39.84  ? 605 ALA D O   1 
ATOM   2322 C  CB  . ALA D 1 72 ? 24.646 7.112   68.570 1.00 33.24  ? 605 ALA D CB  1 
ATOM   2323 N  N   . VAL D 1 73 ? 24.757 7.276   71.756 1.00 33.90  ? 606 VAL D N   1 
ATOM   2324 C  CA  . VAL D 1 73 ? 24.352 6.841   73.102 1.00 33.40  ? 606 VAL D CA  1 
ATOM   2325 C  C   . VAL D 1 73 ? 23.832 8.063   73.884 1.00 40.51  ? 606 VAL D C   1 
ATOM   2326 O  O   . VAL D 1 73 ? 22.781 7.979   74.528 1.00 40.40  ? 606 VAL D O   1 
ATOM   2327 C  CB  . VAL D 1 73 ? 25.517 6.109   73.862 1.00 35.55  ? 606 VAL D CB  1 
ATOM   2328 C  CG1 . VAL D 1 73 ? 25.168 5.912   75.329 1.00 36.15  ? 606 VAL D CG1 1 
ATOM   2329 C  CG2 . VAL D 1 73 ? 25.878 4.768   73.216 1.00 33.29  ? 606 VAL D CG2 1 
ATOM   2330 N  N   . ALA D 1 74 ? 24.548 9.207   73.780 1.00 39.85  ? 607 ALA D N   1 
ATOM   2331 C  CA  . ALA D 1 74 ? 24.163 10.446  74.469 1.00 42.43  ? 607 ALA D CA  1 
ATOM   2332 C  C   . ALA D 1 74 ? 22.838 10.990  73.933 1.00 45.94  ? 607 ALA D C   1 
ATOM   2333 O  O   . ALA D 1 74 ? 22.040 11.497  74.728 1.00 47.97  ? 607 ALA D O   1 
ATOM   2334 C  CB  . ALA D 1 74 ? 25.256 11.497  74.347 1.00 44.65  ? 607 ALA D CB  1 
ATOM   2335 N  N   . VAL D 1 75 ? 22.594 10.848  72.611 1.00 39.71  ? 608 VAL D N   1 
ATOM   2336 C  CA  . VAL D 1 75 ? 21.356 11.272  71.948 1.00 39.94  ? 608 VAL D CA  1 
ATOM   2337 C  C   . VAL D 1 75 ? 20.163 10.486  72.538 1.00 44.18  ? 608 VAL D C   1 
ATOM   2338 O  O   . VAL D 1 75 ? 19.119 11.085  72.799 1.00 45.29  ? 608 VAL D O   1 
ATOM   2339 C  CB  . VAL D 1 75 ? 21.424 11.137  70.406 1.00 41.61  ? 608 VAL D CB  1 
ATOM   2340 C  CG1 . VAL D 1 75 ? 20.080 11.459  69.765 1.00 42.33  ? 608 VAL D CG1 1 
ATOM   2341 C  CG2 . VAL D 1 75 ? 22.497 12.036  69.818 1.00 41.65  ? 608 VAL D CG2 1 
ATOM   2342 N  N   . LEU D 1 76 ? 20.336 9.168   72.765 1.00 39.25  ? 609 LEU D N   1 
ATOM   2343 C  CA  . LEU D 1 76 ? 19.290 8.291   73.300 1.00 39.03  ? 609 LEU D CA  1 
ATOM   2344 C  C   . LEU D 1 76 ? 18.962 8.539   74.777 1.00 47.65  ? 609 LEU D C   1 
ATOM   2345 O  O   . LEU D 1 76 ? 17.860 8.206   75.217 1.00 48.41  ? 609 LEU D O   1 
ATOM   2346 C  CB  . LEU D 1 76 ? 19.680 6.826   73.119 1.00 36.50  ? 609 LEU D CB  1 
ATOM   2347 C  CG  . LEU D 1 76 ? 19.713 6.323   71.694 1.00 37.68  ? 609 LEU D CG  1 
ATOM   2348 C  CD1 . LEU D 1 76 ? 20.441 4.975   71.613 1.00 36.19  ? 609 LEU D CD1 1 
ATOM   2349 C  CD2 . LEU D 1 76 ? 18.313 6.243   71.092 1.00 37.21  ? 609 LEU D CD2 1 
ATOM   2350 N  N   . GLN D 1 77 ? 19.906 9.092   75.543 1.00 47.80  ? 610 GLN D N   1 
ATOM   2351 C  CA  . GLN D 1 77 ? 19.740 9.351   76.966 1.00 51.40  ? 610 GLN D CA  1 
ATOM   2352 C  C   . GLN D 1 77 ? 18.674 10.426  77.235 1.00 60.82  ? 610 GLN D C   1 
ATOM   2353 O  O   . GLN D 1 77 ? 18.784 11.548  76.741 1.00 61.23  ? 610 GLN D O   1 
ATOM   2354 C  CB  . GLN D 1 77 ? 21.092 9.756   77.580 1.00 54.10  ? 610 GLN D CB  1 
ATOM   2355 C  CG  . GLN D 1 77 ? 21.125 9.746   79.112 1.00 83.08  ? 610 GLN D CG  1 
ATOM   2356 C  CD  . GLN D 1 77 ? 20.632 8.445   79.709 1.00 115.36 ? 610 GLN D CD  1 
ATOM   2357 O  OE1 . GLN D 1 77 ? 21.115 7.348   79.396 1.00 113.38 ? 610 GLN D OE1 1 
ATOM   2358 N  NE2 . GLN D 1 77 ? 19.603 8.539   80.535 1.00 111.61 ? 610 GLN D NE2 1 
ATOM   2359 N  N   . ALA D 1 78 ? 17.645 10.076  78.025 1.00 61.93  ? 611 ALA D N   1 
ATOM   2360 C  CA  . ALA D 1 78 ? 16.550 10.985  78.385 1.00 66.14  ? 611 ALA D CA  1 
ATOM   2361 C  C   . ALA D 1 78 ? 17.032 12.105  79.332 1.00 75.54  ? 611 ALA D C   1 
ATOM   2362 O  O   . ALA D 1 78 ? 18.089 11.963  79.963 1.00 76.12  ? 611 ALA D O   1 
ATOM   2363 C  CB  . ALA D 1 78 ? 15.420 10.200  79.038 1.00 68.33  ? 611 ALA D CB  1 
ATOM   2364 N  N   . HIS D 1 79 ? 16.258 13.210  79.434 1.00 75.31  ? 612 HIS D N   1 
ATOM   2365 C  CA  . HIS D 1 79 ? 16.579 14.346  80.319 1.00 79.02  ? 612 HIS D CA  1 
ATOM   2366 C  C   . HIS D 1 79 ? 16.570 13.913  81.816 1.00 86.44  ? 612 HIS D C   1 
ATOM   2367 O  O   . HIS D 1 79 ? 15.847 12.976  82.179 1.00 85.95  ? 612 HIS D O   1 
ATOM   2368 C  CB  . HIS D 1 79 ? 15.618 15.533  80.076 1.00 82.59  ? 612 HIS D CB  1 
ATOM   2369 C  CG  . HIS D 1 79 ? 14.254 15.364  80.677 1.00 88.19  ? 612 HIS D CG  1 
ATOM   2370 N  ND1 . HIS D 1 79 ? 13.306 14.549  80.095 1.00 88.54  ? 612 HIS D ND1 1 
ATOM   2371 C  CD2 . HIS D 1 79 ? 13.728 15.915  81.793 1.00 94.04  ? 612 HIS D CD2 1 
ATOM   2372 C  CE1 . HIS D 1 79 ? 12.237 14.627  80.865 1.00 91.40  ? 612 HIS D CE1 1 
ATOM   2373 N  NE2 . HIS D 1 79 ? 12.445 15.434  81.903 1.00 95.14  ? 612 HIS D NE2 1 
ATOM   2374 N  N   . GLN D 1 80 ? 17.394 14.583  82.661 1.00 85.96  ? 613 GLN D N   1 
ATOM   2375 C  CA  . GLN D 1 80 ? 17.543 14.293  84.098 1.00 111.58 ? 613 GLN D CA  1 
ATOM   2376 C  C   . GLN D 1 80 ? 16.258 14.593  84.899 1.00 136.60 ? 613 GLN D C   1 
ATOM   2377 O  O   . GLN D 1 80 ? 15.771 15.723  84.936 1.00 101.25 ? 613 GLN D O   1 
ATOM   2378 C  CB  . GLN D 1 80 ? 18.728 15.073  84.686 1.00 114.62 ? 613 GLN D CB  1 
HETATM 2379 CL CL  . CL  E 2 .  ? 33.830 17.641  45.035 1.00 83.03  ? 701 CL  A CL  1 
HETATM 2380 CL CL  . CL  F 2 .  ? 21.122 22.784  57.761 1.00 65.21  ? 701 CL  C CL  1 
HETATM 2381 O  O   . HOH G 3 .  ? 41.618 8.809   43.627 1.00 36.01  ? 801 HOH A O   1 
HETATM 2382 O  O   . HOH G 3 .  ? 40.753 10.539  33.233 1.00 36.22  ? 802 HOH A O   1 
HETATM 2383 O  O   . HOH G 3 .  ? 34.484 0.410   23.958 1.00 37.44  ? 803 HOH A O   1 
HETATM 2384 O  O   . HOH G 3 .  ? 38.923 0.773   28.325 1.00 38.13  ? 804 HOH A O   1 
HETATM 2385 O  O   . HOH G 3 .  ? 39.694 8.639   31.333 1.00 39.13  ? 805 HOH A O   1 
HETATM 2386 O  O   . HOH G 3 .  ? 29.487 10.560  46.990 1.00 41.76  ? 806 HOH A O   1 
HETATM 2387 O  O   . HOH G 3 .  ? 42.943 0.545   23.914 1.00 41.72  ? 807 HOH A O   1 
HETATM 2388 O  O   . HOH G 3 .  ? 39.672 12.969  32.723 1.00 43.00  ? 808 HOH A O   1 
HETATM 2389 O  O   . HOH G 3 .  ? 40.469 15.007  47.558 1.00 43.80  ? 809 HOH A O   1 
HETATM 2390 O  O   . HOH G 3 .  ? 40.809 14.798  44.737 1.00 45.75  ? 810 HOH A O   1 
HETATM 2391 O  O   . HOH G 3 .  ? 38.994 -9.334  24.853 1.00 47.68  ? 811 HOH A O   1 
HETATM 2392 O  O   . HOH G 3 .  ? 38.588 -3.865  37.269 1.00 45.88  ? 812 HOH A O   1 
HETATM 2393 O  O   . HOH G 3 .  ? 39.456 1.135   42.632 1.00 46.50  ? 813 HOH A O   1 
HETATM 2394 O  O   . HOH G 3 .  ? 38.784 9.426   20.433 1.00 55.33  ? 814 HOH A O   1 
HETATM 2395 O  O   . HOH G 3 .  ? 26.130 -2.310  29.132 1.00 54.11  ? 815 HOH A O   1 
HETATM 2396 O  O   . HOH G 3 .  ? 25.384 18.262  45.094 1.00 58.18  ? 816 HOH A O   1 
HETATM 2397 O  O   . HOH G 3 .  ? 36.479 17.576  28.676 1.00 56.77  ? 817 HOH A O   1 
HETATM 2398 O  O   . HOH G 3 .  ? 26.093 18.984  41.924 1.00 56.79  ? 818 HOH A O   1 
HETATM 2399 O  O   . HOH G 3 .  ? 32.281 10.257  47.537 1.00 59.68  ? 819 HOH A O   1 
HETATM 2400 O  O   . HOH G 3 .  ? 26.876 -0.891  33.339 1.00 56.70  ? 820 HOH A O   1 
HETATM 2401 O  O   . HOH G 3 .  ? 27.909 20.887  42.540 1.00 59.44  ? 821 HOH A O   1 
HETATM 2402 O  O   . HOH G 3 .  ? 24.986 1.760   39.785 1.00 59.56  ? 822 HOH A O   1 
HETATM 2403 O  O   . HOH G 3 .  ? 28.215 -2.967  25.500 1.00 63.80  ? 823 HOH A O   1 
HETATM 2404 O  O   . HOH G 3 .  ? 38.618 18.432  38.705 1.00 64.37  ? 824 HOH A O   1 
HETATM 2405 O  O   . HOH G 3 .  ? 41.184 12.646  25.768 1.00 66.49  ? 825 HOH A O   1 
HETATM 2406 O  O   . HOH G 3 .  ? 22.669 4.006   39.986 1.00 68.62  ? 826 HOH A O   1 
HETATM 2407 O  O   . HOH G 3 .  ? 23.385 21.032  44.679 1.00 71.05  ? 827 HOH A O   1 
HETATM 2408 O  O   . HOH G 3 .  ? 40.034 -0.852  30.103 1.00 47.47  ? 828 HOH A O   1 
HETATM 2409 O  O   B HOH G 3 .  ? 22.700 12.044  49.464 0.50 32.28  ? 829 HOH A O   1 
HETATM 2410 O  O   . HOH G 3 .  ? 39.198 18.057  29.181 1.00 65.35  ? 830 HOH A O   1 
HETATM 2411 O  O   . HOH G 3 .  ? 39.654 20.216  31.088 1.00 68.39  ? 831 HOH A O   1 
HETATM 2412 O  O   . HOH G 3 .  ? 36.799 20.968  30.721 1.00 64.70  ? 832 HOH A O   1 
HETATM 2413 O  O   . HOH H 3 .  ? 19.520 -0.008  51.568 1.00 30.44  ? 701 HOH B O   1 
HETATM 2414 O  O   . HOH H 3 .  ? 16.431 1.711   50.044 1.00 32.55  ? 702 HOH B O   1 
HETATM 2415 O  O   . HOH H 3 .  ? 18.865 6.930   52.248 1.00 34.87  ? 703 HOH B O   1 
HETATM 2416 O  O   . HOH H 3 .  ? 18.250 4.028   51.486 1.00 35.54  ? 704 HOH B O   1 
HETATM 2417 O  O   . HOH H 3 .  ? 20.192 11.666  50.876 1.00 41.72  ? 705 HOH B O   1 
HETATM 2418 O  O   . HOH H 3 .  ? 2.124  19.240  44.542 1.00 43.20  ? 706 HOH B O   1 
HETATM 2419 O  O   . HOH H 3 .  ? 26.551 5.466   44.331 1.00 43.88  ? 707 HOH B O   1 
HETATM 2420 O  O   . HOH H 3 .  ? 4.135  21.036  44.459 1.00 43.39  ? 708 HOH B O   1 
HETATM 2421 O  O   . HOH H 3 .  ? 7.107  13.529  47.579 1.00 47.49  ? 709 HOH B O   1 
HETATM 2422 O  O   . HOH H 3 .  ? 24.695 4.439   27.299 1.00 47.39  ? 710 HOH B O   1 
HETATM 2423 O  O   . HOH H 3 .  ? 17.010 13.923  53.932 1.00 49.42  ? 711 HOH B O   1 
HETATM 2424 O  O   . HOH H 3 .  ? 17.268 11.593  54.173 1.00 50.11  ? 712 HOH B O   1 
HETATM 2425 O  O   . HOH H 3 .  ? 6.800  16.701  55.975 1.00 49.69  ? 713 HOH B O   1 
HETATM 2426 O  O   . HOH H 3 .  ? 14.301 14.678  53.956 1.00 54.12  ? 714 HOH B O   1 
HETATM 2427 O  O   A HOH H 3 .  ? 18.524 14.715  51.468 0.50 26.18  ? 715 HOH B O   1 
HETATM 2428 O  O   . HOH H 3 .  ? 19.583 9.193   55.276 1.00 52.48  ? 716 HOH B O   1 
HETATM 2429 O  O   . HOH H 3 .  ? 14.148 12.212  55.055 1.00 55.04  ? 717 HOH B O   1 
HETATM 2430 O  O   . HOH H 3 .  ? 1.407  17.409  46.866 1.00 53.56  ? 718 HOH B O   1 
HETATM 2431 O  O   . HOH H 3 .  ? 36.216 8.778   18.977 1.00 52.85  ? 719 HOH B O   1 
HETATM 2432 O  O   . HOH H 3 .  ? 3.299  10.157  53.262 1.00 59.45  ? 720 HOH B O   1 
HETATM 2433 O  O   . HOH H 3 .  ? 22.483 15.695  45.367 1.00 60.51  ? 721 HOH B O   1 
HETATM 2434 O  O   . HOH H 3 .  ? 11.069 5.505   63.038 1.00 62.34  ? 722 HOH B O   1 
HETATM 2435 O  O   . HOH H 3 .  ? 3.334  13.296  56.751 1.00 62.35  ? 723 HOH B O   1 
HETATM 2436 O  O   . HOH H 3 .  ? 2.794  17.142  43.005 1.00 60.19  ? 724 HOH B O   1 
HETATM 2437 O  O   . HOH H 3 .  ? 23.324 16.386  31.904 1.00 62.48  ? 725 HOH B O   1 
HETATM 2438 O  O   . HOH H 3 .  ? 12.690 24.609  39.978 1.00 65.58  ? 726 HOH B O   1 
HETATM 2439 O  O   . HOH H 3 .  ? 3.541  15.227  45.331 1.00 66.14  ? 727 HOH B O   1 
HETATM 2440 O  O   . HOH H 3 .  ? 14.733 6.862   60.097 1.00 65.72  ? 728 HOH B O   1 
HETATM 2441 O  O   A HOH H 3 .  ? 20.610 8.520   51.769 0.50 20.98  ? 729 HOH B O   1 
HETATM 2442 O  O   B HOH H 3 .  ? 22.241 7.780   50.645 0.50 19.82  ? 729 HOH B O   1 
HETATM 2443 O  O   . HOH H 3 .  ? 3.704  18.239  48.224 1.00 59.06  ? 730 HOH B O   1 
HETATM 2444 O  O   . HOH I 3 .  ? 18.344 15.520  55.719 1.00 32.32  ? 801 HOH C O   1 
HETATM 2445 O  O   . HOH I 3 .  ? 9.737  23.951  58.824 1.00 33.24  ? 802 HOH C O   1 
HETATM 2446 O  O   . HOH I 3 .  ? 10.874 23.942  69.334 1.00 34.87  ? 803 HOH C O   1 
HETATM 2447 O  O   . HOH I 3 .  ? 13.512 24.189  69.918 1.00 35.60  ? 804 HOH C O   1 
HETATM 2448 O  O   . HOH I 3 .  ? 9.716  21.858  71.093 1.00 40.56  ? 805 HOH C O   1 
HETATM 2449 O  O   . HOH I 3 .  ? 5.103  23.686  59.703 1.00 40.01  ? 806 HOH C O   1 
HETATM 2450 O  O   . HOH I 3 .  ? 7.216  23.319  71.926 1.00 45.53  ? 807 HOH C O   1 
HETATM 2451 O  O   . HOH I 3 .  ? 6.751  24.249  69.645 1.00 45.84  ? 808 HOH C O   1 
HETATM 2452 O  O   . HOH I 3 .  ? 25.199 14.951  56.786 1.00 46.23  ? 809 HOH C O   1 
HETATM 2453 O  O   . HOH I 3 .  ? 18.879 24.852  74.188 1.00 48.14  ? 810 HOH C O   1 
HETATM 2454 O  O   . HOH I 3 .  ? 13.593 17.946  53.372 1.00 48.75  ? 811 HOH C O   1 
HETATM 2455 O  O   . HOH I 3 .  ? 7.142  23.952  58.189 1.00 48.26  ? 812 HOH C O   1 
HETATM 2456 O  O   . HOH I 3 .  ? 7.690  21.107  56.607 1.00 48.52  ? 813 HOH C O   1 
HETATM 2457 O  O   . HOH I 3 .  ? 26.771 17.009  58.234 1.00 46.43  ? 814 HOH C O   1 
HETATM 2458 O  O   . HOH I 3 .  ? 5.606  11.002  59.533 1.00 49.24  ? 815 HOH C O   1 
HETATM 2459 O  O   . HOH I 3 .  ? 26.116 20.408  67.358 1.00 52.12  ? 816 HOH C O   1 
HETATM 2460 O  O   . HOH I 3 .  ? 23.816 19.983  72.861 1.00 52.32  ? 817 HOH C O   1 
HETATM 2461 O  O   . HOH I 3 .  ? 26.112 13.916  70.457 1.00 53.87  ? 818 HOH C O   1 
HETATM 2462 O  O   . HOH I 3 .  ? 17.568 3.614   74.060 1.00 53.96  ? 819 HOH C O   1 
HETATM 2463 O  O   . HOH I 3 .  ? 9.654  19.970  53.105 1.00 53.45  ? 820 HOH C O   1 
HETATM 2464 O  O   . HOH I 3 .  ? 14.024 6.232   62.816 1.00 55.24  ? 821 HOH C O   1 
HETATM 2465 O  O   . HOH I 3 .  ? 26.643 18.046  60.815 1.00 54.83  ? 822 HOH C O   1 
HETATM 2466 O  O   . HOH I 3 .  ? 17.830 27.219  73.543 1.00 57.05  ? 823 HOH C O   1 
HETATM 2467 O  O   . HOH I 3 .  ? 33.451 14.423  63.085 1.00 56.93  ? 824 HOH C O   1 
HETATM 2468 O  O   . HOH I 3 .  ? 16.320 17.410  55.045 1.00 56.78  ? 825 HOH C O   1 
HETATM 2469 O  O   . HOH I 3 .  ? 8.441  24.397  78.029 1.00 59.57  ? 826 HOH C O   1 
HETATM 2470 O  O   . HOH I 3 .  ? 22.468 13.917  76.749 1.00 58.91  ? 827 HOH C O   1 
HETATM 2471 O  O   . HOH I 3 .  ? 16.382 1.069   74.074 1.00 59.45  ? 828 HOH C O   1 
HETATM 2472 O  O   . HOH I 3 .  ? 3.360  10.522  58.053 1.00 60.36  ? 829 HOH C O   1 
HETATM 2473 O  O   . HOH I 3 .  ? 11.453 24.737  77.208 1.00 62.57  ? 830 HOH C O   1 
HETATM 2474 O  O   . HOH I 3 .  ? 16.034 3.254   61.990 1.00 61.97  ? 831 HOH C O   1 
HETATM 2475 O  O   . HOH I 3 .  ? 20.154 23.763  66.529 1.00 68.08  ? 832 HOH C O   1 
HETATM 2476 O  O   . HOH I 3 .  ? 39.870 16.339  60.633 1.00 74.12  ? 833 HOH C O   1 
HETATM 2477 O  O   . HOH I 3 .  ? 6.591  3.404   69.322 1.00 56.61  ? 834 HOH C O   1 
HETATM 2478 O  O   . HOH I 3 .  ? 29.040 16.365  57.066 1.00 62.69  ? 835 HOH C O   1 
HETATM 2479 O  O   . HOH I 3 .  ? 15.120 4.643   73.100 1.00 59.28  ? 836 HOH C O   1 
HETATM 2480 O  O   . HOH I 3 .  ? 19.599 26.364  64.475 1.00 71.19  ? 837 HOH C O   1 
HETATM 2481 O  O   . HOH J 3 .  ? 20.462 3.097   50.307 1.00 31.62  ? 701 HOH D O   1 
HETATM 2482 O  O   . HOH J 3 .  ? 33.485 1.719   73.788 1.00 38.40  ? 702 HOH D O   1 
HETATM 2483 O  O   . HOH J 3 .  ? 22.296 5.342   49.754 1.00 37.88  ? 703 HOH D O   1 
HETATM 2484 O  O   . HOH J 3 .  ? 32.017 3.537   74.775 1.00 40.09  ? 704 HOH D O   1 
HETATM 2485 O  O   . HOH J 3 .  ? 15.906 9.659   58.134 1.00 40.84  ? 705 HOH D O   1 
HETATM 2486 O  O   . HOH J 3 .  ? 26.763 12.837  57.381 1.00 40.36  ? 706 HOH D O   1 
HETATM 2487 O  O   . HOH J 3 .  ? 23.863 -7.243  69.995 1.00 42.19  ? 707 HOH D O   1 
HETATM 2488 O  O   . HOH J 3 .  ? 24.706 9.292   51.241 1.00 44.40  ? 708 HOH D O   1 
HETATM 2489 O  O   . HOH J 3 .  ? 28.294 10.434  50.566 1.00 46.47  ? 709 HOH D O   1 
HETATM 2490 O  O   . HOH J 3 .  ? 15.623 7.067   74.588 1.00 45.32  ? 710 HOH D O   1 
HETATM 2491 O  O   . HOH J 3 .  ? 35.356 7.843   52.453 1.00 47.70  ? 711 HOH D O   1 
HETATM 2492 O  O   . HOH J 3 .  ? 36.032 0.760   62.513 1.00 47.84  ? 712 HOH D O   1 
HETATM 2493 O  O   . HOH J 3 .  ? 21.529 -3.091  57.490 1.00 49.04  ? 713 HOH D O   1 
HETATM 2494 O  O   . HOH J 3 .  ? 34.357 -2.576  66.985 1.00 49.79  ? 714 HOH D O   1 
HETATM 2495 O  O   . HOH J 3 .  ? 34.916 0.809   54.657 1.00 49.71  ? 715 HOH D O   1 
HETATM 2496 O  O   . HOH J 3 .  ? 17.625 6.183   62.010 1.00 51.05  ? 716 HOH D O   1 
HETATM 2497 O  O   . HOH J 3 .  ? 35.498 -0.550  64.890 1.00 51.89  ? 717 HOH D O   1 
HETATM 2498 O  O   . HOH J 3 .  ? 23.606 6.919   46.710 1.00 52.45  ? 718 HOH D O   1 
HETATM 2499 O  O   . HOH J 3 .  ? 23.190 -4.497  79.088 1.00 52.18  ? 719 HOH D O   1 
HETATM 2500 O  O   . HOH J 3 .  ? 31.943 -5.605  59.681 1.00 52.74  ? 720 HOH D O   1 
HETATM 2501 O  O   . HOH J 3 .  ? 30.455 -8.213  67.105 1.00 53.50  ? 721 HOH D O   1 
HETATM 2502 O  O   . HOH J 3 .  ? 18.987 4.443   76.093 1.00 55.16  ? 722 HOH D O   1 
HETATM 2503 O  O   . HOH J 3 .  ? 31.806 2.989   71.681 1.00 52.08  ? 723 HOH D O   1 
HETATM 2504 O  O   . HOH J 3 .  ? 37.643 2.149   46.346 1.00 51.76  ? 724 HOH D O   1 
HETATM 2505 O  O   . HOH J 3 .  ? 33.905 11.983  55.074 1.00 54.34  ? 725 HOH D O   1 
HETATM 2506 O  O   . HOH J 3 .  ? 22.548 9.918   54.588 1.00 55.86  ? 726 HOH D O   1 
HETATM 2507 O  O   . HOH J 3 .  ? 30.778 -7.715  58.184 1.00 59.70  ? 727 HOH D O   1 
HETATM 2508 O  O   . HOH J 3 .  ? 25.441 -7.602  59.866 1.00 58.85  ? 728 HOH D O   1 
HETATM 2509 O  O   . HOH J 3 .  ? 24.595 8.900   48.078 1.00 61.66  ? 729 HOH D O   1 
HETATM 2510 O  O   . HOH J 3 .  ? 21.442 6.076   76.332 1.00 58.88  ? 730 HOH D O   1 
HETATM 2511 O  O   . HOH J 3 .  ? 11.690 17.406  84.000 1.00 62.20  ? 731 HOH D O   1 
HETATM 2512 O  O   . HOH J 3 .  ? 41.012 6.033   64.491 1.00 68.53  ? 732 HOH D O   1 
HETATM 2513 O  O   . HOH J 3 .  ? 23.369 6.372   78.779 1.00 63.71  ? 733 HOH D O   1 
HETATM 2514 O  O   . HOH J 3 .  ? 24.799 8.525   78.184 1.00 73.72  ? 734 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLN A 4  ? 0.9430 1.3037 0.9382 0.2900  0.0609  -0.0948 537 GLN A N   
2    C  CA  . GLN A 4  ? 0.9423 1.2091 0.9133 0.2670  0.0688  -0.0806 537 GLN A CA  
3    C  C   . GLN A 4  ? 0.9422 1.1752 0.9132 0.2341  0.0816  -0.0931 537 GLN A C   
4    O  O   . GLN A 4  ? 0.9034 1.1858 0.8949 0.2039  0.0783  -0.1058 537 GLN A O   
5    C  CB  . GLN A 4  ? 0.9225 1.1955 0.8991 0.2348  0.0564  -0.0705 537 GLN A CB  
6    C  CG  . GLN A 4  ? 1.1876 1.3756 1.1391 0.2247  0.0641  -0.0537 537 GLN A CG  
7    C  CD  . GLN A 4  ? 1.4507 1.6475 1.4036 0.2094  0.0530  -0.0429 537 GLN A CD  
8    O  OE1 . GLN A 4  ? 1.3642 1.5938 1.3367 0.1760  0.0450  -0.0487 537 GLN A OE1 
9    N  NE2 . GLN A 4  ? 1.3936 1.5533 1.3208 0.2343  0.0554  -0.0261 537 GLN A NE2 
10   N  N   . GLU A 5  ? 0.8919 1.0397 0.8361 0.2385  0.0980  -0.0900 538 GLU A N   
11   C  CA  . GLU A 5  ? 0.8726 0.9847 0.8109 0.2101  0.1118  -0.1060 538 GLU A CA  
12   C  C   . GLU A 5  ? 0.8046 0.9269 0.7530 0.1594  0.1035  -0.1056 538 GLU A C   
13   O  O   . GLU A 5  ? 0.7757 0.8880 0.7250 0.1470  0.0951  -0.0899 538 GLU A O   
14   C  CB  . GLU A 5  ? 0.9641 0.9773 0.8692 0.2241  0.1348  -0.1053 538 GLU A CB  
15   C  CG  . GLU A 5  ? 1.2034 1.1880 1.0892 0.2814  0.1490  -0.1046 538 GLU A CG  
16   C  CD  . GLU A 5  ? 1.6995 1.5807 1.5507 0.2898  0.1805  -0.1147 538 GLU A CD  
17   O  OE1 . GLU A 5  ? 1.7255 1.5515 1.5661 0.2469  0.1925  -0.1221 538 GLU A OE1 
18   O  OE2 . GLU A 5  ? 1.7496 1.6062 1.5842 0.3398  0.1949  -0.1172 538 GLU A OE2 
19   N  N   . THR A 6  ? 0.6959 0.8383 0.6486 0.1340  0.1070  -0.1231 539 THR A N   
20   C  CA  . THR A 6  ? 0.6322 0.7872 0.5885 0.0927  0.1004  -0.1234 539 THR A CA  
21   C  C   . THR A 6  ? 0.6476 0.7417 0.5886 0.0776  0.1110  -0.1277 539 THR A C   
22   O  O   . THR A 6  ? 0.6878 0.7395 0.6132 0.0807  0.1291  -0.1463 539 THR A O   
23   C  CB  . THR A 6  ? 0.6727 0.8738 0.6314 0.0760  0.1020  -0.1404 539 THR A CB  
24   O  OG1 . THR A 6  ? 0.6786 0.9342 0.6520 0.0882  0.0982  -0.1397 539 THR A OG1 
25   C  CG2 . THR A 6  ? 0.5577 0.7805 0.5146 0.0410  0.0932  -0.1363 539 THR A CG2 
26   N  N   . LEU A 7  ? 0.5409 0.6297 0.4866 0.0607  0.1028  -0.1132 540 LEU A N   
27   C  CA  . LEU A 7  ? 0.5634 0.6104 0.5008 0.0392  0.1133  -0.1196 540 LEU A CA  
28   C  C   . LEU A 7  ? 0.6031 0.6846 0.5434 0.0070  0.1113  -0.1400 540 LEU A C   
29   O  O   . LEU A 7  ? 0.5650 0.7034 0.5141 0.0004  0.0959  -0.1345 540 LEU A O   
30   C  CB  . LEU A 7  ? 0.5473 0.5918 0.4922 0.0335  0.1051  -0.0990 540 LEU A CB  
31   C  CG  . LEU A 7  ? 0.6268 0.6302 0.5614 0.0601  0.1098  -0.0801 540 LEU A CG  
32   C  CD1 . LEU A 7  ? 0.5829 0.5924 0.5255 0.0484  0.1029  -0.0647 540 LEU A CD1 
33   C  CD2 . LEU A 7  ? 0.7487 0.6743 0.6566 0.0709  0.1357  -0.0862 540 LEU A CD2 
34   N  N   . THR A 8  ? 0.5947 0.6423 0.5239 -0.0133 0.1287  -0.1646 541 THR A N   
35   C  CA  . THR A 8  ? 0.5878 0.6809 0.5189 -0.0461 0.1253  -0.1887 541 THR A CA  
36   C  C   . THR A 8  ? 0.6489 0.7337 0.5845 -0.0789 0.1326  -0.2019 541 THR A C   
37   O  O   . THR A 8  ? 0.6649 0.6869 0.5948 -0.0800 0.1501  -0.1990 541 THR A O   
38   C  CB  . THR A 8  ? 0.6793 0.7657 0.5951 -0.0486 0.1390  -0.2190 541 THR A CB  
39   O  OG1 . THR A 8  ? 0.7547 0.7573 0.6533 -0.0464 0.1672  -0.2362 541 THR A OG1 
40   C  CG2 . THR A 8  ? 0.6130 0.7310 0.5293 -0.0220 0.1314  -0.2101 541 THR A CG2 
41   N  N   . ALA A 9  ? 0.5955 0.7496 0.5401 -0.1054 0.1201  -0.2165 542 ALA A N   
42   C  CA  . ALA A 9  ? 0.6134 0.7898 0.5691 -0.1409 0.1241  -0.2357 542 ALA A CA  
43   C  C   . ALA A 9  ? 0.7494 0.8532 0.6907 -0.1680 0.1577  -0.2702 542 ALA A C   
44   O  O   . ALA A 9  ? 0.7814 0.8539 0.7282 -0.1878 0.1727  -0.2730 542 ALA A O   
45   C  CB  . ALA A 9  ? 0.6016 0.8766 0.5640 -0.1586 0.1040  -0.2504 542 ALA A CB  
46   N  N   . SER A 10 ? 0.7448 0.8133 0.6651 -0.1674 0.1733  -0.2950 543 SER A N   
47   C  CA  . SER A 10 ? 0.8422 0.8259 0.7417 -0.1911 0.2105  -0.3297 543 SER A CA  
48   C  C   . SER A 10 ? 0.9535 0.8265 0.8359 -0.1660 0.2347  -0.3055 543 SER A C   
49   O  O   . SER A 10 ? 1.0285 0.8311 0.8982 -0.1941 0.2658  -0.3216 543 SER A O   
50   C  CB  . SER A 10 ? 0.9336 0.9065 0.8128 -0.1881 0.2210  -0.3603 543 SER A CB  
51   O  OG  . SER A 10 ? 1.0456 1.0014 0.9173 -0.1379 0.2146  -0.3341 543 SER A OG  
52   N  N   . ARG A 11 ? 0.8795 0.7403 0.7591 -0.1148 0.2219  -0.2678 544 ARG A N   
53   C  CA  . ARG A 11 ? 0.9222 0.6957 0.7828 -0.0802 0.2381  -0.2388 544 ARG A CA  
54   C  C   . ARG A 11 ? 0.9586 0.7299 0.8291 -0.0941 0.2367  -0.2173 544 ARG A C   
55   O  O   . ARG A 11 ? 1.0392 0.7236 0.8859 -0.0868 0.2625  -0.2049 544 ARG A O   
56   C  CB  . ARG A 11 ? 0.9118 0.7040 0.7735 -0.0255 0.2193  -0.2093 544 ARG A CB  
57   C  CG  . ARG A 11 ? 1.1490 0.9109 0.9926 0.0017  0.2332  -0.2260 544 ARG A CG  
58   C  CD  . ARG A 11 ? 1.3906 1.1017 1.2164 0.0605  0.2398  -0.1984 544 ARG A CD  
59   N  NE  . ARG A 11 ? 1.4998 1.2873 1.3486 0.0893  0.2081  -0.1703 544 ARG A NE  
60   C  CZ  . ARG A 11 ? 1.7092 1.4950 1.5592 0.1082  0.1978  -0.1388 544 ARG A CZ  
61   N  NH1 . ARG A 11 ? 1.6145 1.3267 1.4426 0.1041  0.2163  -0.1268 544 ARG A NH1 
62   N  NH2 . ARG A 11 ? 1.4859 1.3432 1.3568 0.1284  0.1713  -0.1211 544 ARG A NH2 
63   N  N   . LEU A 12 ? 0.8092 0.6732 0.7113 -0.1111 0.2088  -0.2117 545 LEU A N   
64   C  CA  . LEU A 12 ? 0.7755 0.6503 0.6909 -0.1236 0.2069  -0.1947 545 LEU A CA  
65   C  C   . LEU A 12 ? 0.9101 0.7726 0.8285 -0.1772 0.2319  -0.2267 545 LEU A C   
66   O  O   . LEU A 12 ? 0.9450 0.7540 0.8544 -0.1882 0.2543  -0.2179 545 LEU A O   
67   C  CB  . LEU A 12 ? 0.6763 0.6498 0.6225 -0.1164 0.1709  -0.1772 545 LEU A CB  
68   C  CG  . LEU A 12 ? 0.6644 0.6461 0.6101 -0.0720 0.1505  -0.1436 545 LEU A CG  
69   C  CD1 . LEU A 12 ? 0.5893 0.6556 0.5591 -0.0702 0.1212  -0.1319 545 LEU A CD1 
70   C  CD2 . LEU A 12 ? 0.6795 0.6040 0.6115 -0.0495 0.1605  -0.1176 545 LEU A CD2 
71   N  N   . ALA A 13 ? 0.8879 0.8002 0.8164 -0.2129 0.2309  -0.2664 546 ALA A N   
72   C  CA  . ALA A 13 ? 0.9405 0.8598 0.8762 -0.2725 0.2542  -0.3079 546 ALA A CA  
73   C  C   . ALA A 13 ? 1.1040 0.8898 1.0047 -0.2907 0.3037  -0.3196 546 ALA A C   
74   O  O   . ALA A 13 ? 1.1391 0.9131 1.0452 -0.3399 0.3293  -0.3419 546 ALA A O   
75   C  CB  . ALA A 13 ? 0.9502 0.9421 0.8941 -0.3007 0.2441  -0.3505 546 ALA A CB  
76   N  N   . SER A 14 ? 1.1158 0.8025 0.9798 -0.2495 0.3187  -0.3032 547 SER A N   
77   C  CA  . SER A 14 ? 1.2379 0.7794 1.0573 -0.2521 0.3679  -0.3059 547 SER A CA  
78   C  C   . SER A 14 ? 1.2997 0.7790 1.1033 -0.2390 0.3841  -0.2662 547 SER A C   
79   O  O   . SER A 14 ? 1.4039 0.7685 1.1712 -0.2581 0.4305  -0.2701 547 SER A O   
80   C  CB  . SER A 14 ? 1.3420 0.8129 1.1286 -0.1997 0.3744  -0.2972 547 SER A CB  
81   O  OG  . SER A 14 ? 1.4187 0.9069 1.2057 -0.1360 0.3470  -0.2494 547 SER A OG  
82   N  N   . ALA A 15 ? 1.1487 0.6984 0.9749 -0.2077 0.3489  -0.2292 548 ALA A N   
83   C  CA  . ALA A 15 ? 1.1433 0.6513 0.9549 -0.1916 0.3588  -0.1915 548 ALA A CA  
84   C  C   . ALA A 15 ? 1.1366 0.7129 0.9819 -0.2406 0.3588  -0.2020 548 ALA A C   
85   O  O   . ALA A 15 ? 1.0600 0.7465 0.9482 -0.2681 0.3340  -0.2275 548 ALA A O   
86   C  CB  . ALA A 15 ? 1.0773 0.6215 0.8915 -0.1287 0.3229  -0.1495 548 ALA A CB  
87   N  N   . PRO A 16 ? 1.1259 0.6459 0.9520 -0.2487 0.3859  -0.1815 549 PRO A N   
88   C  CA  . PRO A 16 ? 1.0851 0.6823 0.9480 -0.2926 0.3861  -0.1922 549 PRO A CA  
89   C  C   . PRO A 16 ? 1.0064 0.7344 0.9154 -0.2675 0.3352  -0.1782 549 PRO A C   
90   O  O   . PRO A 16 ? 0.9458 0.6788 0.8477 -0.2138 0.3072  -0.1476 549 PRO A O   
91   C  CB  . PRO A 16 ? 1.1789 0.6809 1.0020 -0.2888 0.4227  -0.1618 549 PRO A CB  
92   C  CG  . PRO A 16 ? 1.3392 0.6978 1.1009 -0.2635 0.4550  -0.1493 549 PRO A CG  
93   C  CD  . PRO A 16 ? 1.2288 0.6183 0.9967 -0.2152 0.4180  -0.1462 549 PRO A CD  
94   N  N   . PRO A 17 ? 0.9209 0.7568 0.8768 -0.3051 0.3243  -0.2018 550 PRO A N   
95   C  CA  . PRO A 17 ? 0.8133 0.7654 0.8086 -0.2771 0.2788  -0.1884 550 PRO A CA  
96   C  C   . PRO A 17 ? 0.8213 0.7581 0.8055 -0.2263 0.2632  -0.1438 550 PRO A C   
97   O  O   . PRO A 17 ? 0.7499 0.7263 0.7425 -0.1878 0.2290  -0.1275 550 PRO A O   
98   C  CB  . PRO A 17 ? 0.8229 0.8738 0.8621 -0.3234 0.2823  -0.2168 550 PRO A CB  
99   C  CG  . PRO A 17 ? 0.9560 0.9757 0.9893 -0.3827 0.3169  -0.2602 550 PRO A CG  
100  C  CD  . PRO A 17 ? 0.9855 0.8485 0.9613 -0.3746 0.3534  -0.2452 550 PRO A CD  
101  N  N   . GLN A 18 ? 0.8258 0.7059 0.7885 -0.2287 0.2901  -0.1259 551 GLN A N   
102  C  CA  . GLN A 18 ? 0.7913 0.6583 0.7389 -0.1840 0.2782  -0.0877 551 GLN A CA  
103  C  C   . GLN A 18 ? 0.8206 0.6241 0.7315 -0.1358 0.2672  -0.0636 551 GLN A C   
104  O  O   . GLN A 18 ? 0.7515 0.5814 0.6635 -0.0970 0.2412  -0.0414 551 GLN A O   
105  C  CB  . GLN A 18 ? 0.8655 0.6847 0.7911 -0.1993 0.3132  -0.0750 551 GLN A CB  
106  C  CG  . GLN A 18 ? 1.1545 1.0605 1.1153 -0.2019 0.3025  -0.0722 551 GLN A CG  
107  C  CD  . GLN A 18 ? 1.4046 1.3634 1.3789 -0.1539 0.2629  -0.0521 551 GLN A CD  
108  O  OE1 . GLN A 18 ? 1.2952 1.3459 1.3121 -0.1532 0.2406  -0.0620 551 GLN A OE1 
109  N  NE2 . GLN A 18 ? 1.3253 1.2283 1.2624 -0.1125 0.2551  -0.0247 551 GLN A NE2 
110  N  N   . LYS A 19 ? 0.8356 0.5599 0.7156 -0.1390 0.2881  -0.0713 552 LYS A N   
111  C  CA  . LYS A 19 ? 0.8489 0.5226 0.6975 -0.0911 0.2791  -0.0526 552 LYS A CA  
112  C  C   . LYS A 19 ? 0.7883 0.5405 0.6688 -0.0754 0.2401  -0.0618 552 LYS A C   
113  O  O   . LYS A 19 ? 0.7428 0.5038 0.6162 -0.0334 0.2189  -0.0421 552 LYS A O   
114  C  CB  . LYS A 19 ? 0.9967 0.5599 0.8022 -0.0955 0.3162  -0.0594 552 LYS A CB  
115  C  CG  . LYS A 19 ? 1.2855 0.7920 1.0527 -0.0356 0.3117  -0.0346 552 LYS A CG  
116  C  CD  . LYS A 19 ? 1.4878 0.9547 1.2166 0.0058  0.3162  0.0059  552 LYS A CD  
117  C  CE  . LYS A 19 ? 1.6039 1.0879 1.3203 0.0684  0.2893  0.0269  552 LYS A CE  
118  N  NZ  . LYS A 19 ? 1.5634 1.1600 1.3256 0.0743  0.2457  0.0234  552 LYS A NZ  
119  N  N   . GLN A 20 ? 0.7047 0.5202 0.6194 -0.1101 0.2312  -0.0916 553 GLN A N   
120  C  CA  . GLN A 20 ? 0.6232 0.5144 0.5637 -0.0989 0.1973  -0.0988 553 GLN A CA  
121  C  C   . GLN A 20 ? 0.6068 0.5527 0.5642 -0.0711 0.1689  -0.0746 553 GLN A C   
122  O  O   . GLN A 20 ? 0.5716 0.5277 0.5257 -0.0406 0.1495  -0.0623 553 GLN A O   
123  C  CB  . GLN A 20 ? 0.6163 0.5753 0.5862 -0.1404 0.1934  -0.1323 553 GLN A CB  
124  C  CG  . GLN A 20 ? 0.8080 0.7206 0.7623 -0.1718 0.2194  -0.1649 553 GLN A CG  
125  C  CD  . GLN A 20 ? 0.8879 0.8749 0.8708 -0.2213 0.2197  -0.2038 553 GLN A CD  
126  O  OE1 . GLN A 20 ? 0.7273 0.8149 0.7392 -0.2205 0.1900  -0.2082 553 GLN A OE1 
127  N  NE2 . GLN A 20 ? 0.7852 0.7242 0.7574 -0.2654 0.2548  -0.2342 553 GLN A NE2 
128  N  N   . LYS A 21 ? 0.5527 0.5303 0.5268 -0.0835 0.1705  -0.0702 554 LYS A N   
129  C  CA  . LYS A 21 ? 0.4976 0.5184 0.4859 -0.0609 0.1503  -0.0510 554 LYS A CA  
130  C  C   . LYS A 21 ? 0.5337 0.5081 0.4940 -0.0258 0.1485  -0.0271 554 LYS A C   
131  O  O   . LYS A 21 ? 0.4995 0.5032 0.4665 -0.0036 0.1271  -0.0170 554 LYS A O   
132  C  CB  . LYS A 21 ? 0.5241 0.5783 0.5317 -0.0804 0.1602  -0.0540 554 LYS A CB  
133  C  CG  . LYS A 21 ? 0.7688 0.9097 0.8147 -0.1021 0.1492  -0.0742 554 LYS A CG  
134  C  CD  . LYS A 21 ? 0.9739 1.1578 1.0422 -0.1123 0.1579  -0.0749 554 LYS A CD  
135  C  CE  . LYS A 21 ? 1.1008 1.3885 1.2096 -0.1178 0.1411  -0.0886 554 LYS A CE  
136  N  NZ  . LYS A 21 ? 1.1789 1.5100 1.3092 -0.1128 0.1464  -0.0842 554 LYS A NZ  
137  N  N   . GLN A 22 ? 0.5311 0.4336 0.4572 -0.0206 0.1720  -0.0187 555 GLN A N   
138  C  CA  A GLN A 22 ? 0.5433 0.4105 0.4384 0.0172  0.1695  0.0040  555 GLN A CA  
139  C  CA  B GLN A 22 ? 0.5458 0.4151 0.4418 0.0174  0.1686  0.0040  555 GLN A CA  
140  C  C   . GLN A 22 ? 0.5783 0.4576 0.4727 0.0433  0.1500  0.0034  555 GLN A C   
141  O  O   . GLN A 22 ? 0.5265 0.4323 0.4204 0.0685  0.1318  0.0135  555 GLN A O   
142  C  CB  A GLN A 22 ? 0.6392 0.4218 0.4907 0.0212  0.2018  0.0162  555 GLN A CB  
143  C  CB  B GLN A 22 ? 0.6442 0.4313 0.4963 0.0234  0.1997  0.0177  555 GLN A CB  
144  C  CG  A GLN A 22 ? 0.6635 0.4363 0.5072 0.0047  0.2211  0.0249  555 GLN A CG  
145  C  CG  B GLN A 22 ? 0.8121 0.5912 0.6368 0.0564  0.1959  0.0428  555 GLN A CG  
146  C  CD  A GLN A 22 ? 0.8558 0.5407 0.6603 -0.0113 0.2627  0.0307  555 GLN A CD  
147  C  CD  B GLN A 22 ? 1.0481 0.7507 0.8187 0.0883  0.2150  0.0642  555 GLN A CD  
148  O  OE1 A GLN A 22 ? 0.7458 0.4303 0.5587 -0.0491 0.2856  0.0221  555 GLN A OE1 
149  O  OE1 B GLN A 22 ? 1.0729 0.6999 0.8137 0.0753  0.2487  0.0684  555 GLN A OE1 
150  N  NE2 A GLN A 22 ? 0.8418 0.4491 0.6005 0.0181  0.2764  0.0462  555 GLN A NE2 
151  N  NE2 B GLN A 22 ? 0.8920 0.6139 0.6456 0.1313  0.1957  0.0792  555 GLN A NE2 
152  N  N   . MSE A 23 ? 0.5744 0.4397 0.4704 0.0337  0.1554  -0.0125 556 MSE A N   
153  C  CA  . MSE A 23 ? 0.5655 0.4453 0.4623 0.0554  0.1415  -0.0167 556 MSE A CA  
154  C  C   . MSE A 23 ? 0.5376 0.4909 0.4651 0.0518  0.1146  -0.0206 556 MSE A C   
155  O  O   . MSE A 23 ? 0.5227 0.5000 0.4513 0.0739  0.1001  -0.0153 556 MSE A O   
156  C  CB  . MSE A 23 ? 0.6426 0.4877 0.5319 0.0422  0.1579  -0.0361 556 MSE A CB  
157  C  CG  . MSE A 23 ? 0.8426 0.5957 0.6916 0.0550  0.1887  -0.0290 556 MSE A CG  
158  SE SE  . MSE A 23 ? 1.0525 0.7437 0.8859 0.0381  0.2164  -0.0589 556 MSE A SE  
159  C  CE  . MSE A 23 ? 1.0137 0.7186 0.8689 -0.0317 0.2320  -0.0872 556 MSE A CE  
160  N  N   . LEU A 24 ? 0.4551 0.4447 0.4057 0.0246  0.1096  -0.0294 557 LEU A N   
161  C  CA  . LEU A 24 ? 0.4023 0.4487 0.3743 0.0235  0.0886  -0.0283 557 LEU A CA  
162  C  C   . LEU A 24 ? 0.4496 0.5053 0.4229 0.0385  0.0799  -0.0129 557 LEU A C   
163  O  O   . LEU A 24 ? 0.4400 0.5180 0.4176 0.0476  0.0672  -0.0098 557 LEU A O   
164  C  CB  . LEU A 24 ? 0.3894 0.4753 0.3811 -0.0015 0.0857  -0.0392 557 LEU A CB  
165  C  CG  . LEU A 24 ? 0.4687 0.5651 0.4605 -0.0191 0.0888  -0.0601 557 LEU A CG  
166  C  CD1 . LEU A 24 ? 0.4651 0.6041 0.4742 -0.0462 0.0895  -0.0750 557 LEU A CD1 
167  C  CD2 . LEU A 24 ? 0.4466 0.5725 0.4383 -0.0094 0.0741  -0.0593 557 LEU A CD2 
168  N  N   . GLY A 25 ? 0.4259 0.4620 0.3926 0.0383  0.0900  -0.0059 558 GLY A N   
169  C  CA  . GLY A 25 ? 0.4022 0.4437 0.3657 0.0513  0.0854  0.0050  558 GLY A CA  
170  C  C   . GLY A 25 ? 0.4779 0.5145 0.4249 0.0745  0.0781  0.0098  558 GLY A C   
171  O  O   . GLY A 25 ? 0.4678 0.5278 0.4201 0.0794  0.0674  0.0098  558 GLY A O   
172  N  N   . GLU A 26 ? 0.4655 0.4742 0.3922 0.0895  0.0850  0.0120  559 GLU A N   
173  C  CA  . GLU A 26 ? 0.4995 0.5183 0.4117 0.1176  0.0767  0.0155  559 GLU A CA  
174  C  C   . GLU A 26 ? 0.4971 0.5634 0.4307 0.1144  0.0609  0.0037  559 GLU A C   
175  O  O   . GLU A 26 ? 0.4858 0.5843 0.4189 0.1268  0.0507  0.0009  559 GLU A O   
176  C  CB  . GLU A 26 ? 0.5829 0.5600 0.4678 0.1415  0.0892  0.0218  559 GLU A CB  
177  C  CG  . GLU A 26 ? 0.9102 0.8293 0.7602 0.1518  0.1092  0.0384  559 GLU A CG  
178  C  CD  . GLU A 26 ? 1.4735 1.3956 1.2965 0.1759  0.1071  0.0545  559 GLU A CD  
179  O  OE1 . GLU A 26 ? 1.5119 1.4890 1.3429 0.1887  0.0870  0.0501  559 GLU A OE1 
180  O  OE2 . GLU A 26 ? 1.5018 1.3713 1.2932 0.1793  0.1277  0.0700  559 GLU A OE2 
181  N  N   . ARG A 27 ? 0.4158 0.4898 0.3660 0.0963  0.0605  -0.0046 560 ARG A N   
182  C  CA  . ARG A 27 ? 0.3847 0.4977 0.3509 0.0891  0.0506  -0.0136 560 ARG A CA  
183  C  C   . ARG A 27 ? 0.4123 0.5407 0.3902 0.0722  0.0450  -0.0121 560 ARG A C   
184  O  O   . ARG A 27 ? 0.3993 0.5523 0.3830 0.0677  0.0400  -0.0179 560 ARG A O   
185  C  CB  . ARG A 27 ? 0.3939 0.5076 0.3656 0.0786  0.0543  -0.0218 560 ARG A CB  
186  C  CG  . ARG A 27 ? 0.5588 0.6423 0.5166 0.0923  0.0654  -0.0264 560 ARG A CG  
187  C  CD  . ARG A 27 ? 0.6952 0.7984 0.6498 0.1184  0.0627  -0.0305 560 ARG A CD  
188  N  NE  . ARG A 27 ? 0.8797 0.9452 0.8181 0.1355  0.0766  -0.0350 560 ARG A NE  
189  C  CZ  . ARG A 27 ? 0.9643 1.0387 0.9072 0.1335  0.0811  -0.0498 560 ARG A CZ  
190  N  NH1 . ARG A 27 ? 0.6653 0.7889 0.6272 0.1140  0.0725  -0.0590 560 ARG A NH1 
191  N  NH2 . ARG A 27 ? 0.8650 0.8940 0.7892 0.1518  0.0973  -0.0552 560 ARG A NH2 
192  N  N   . LEU A 28 ? 0.3675 0.4812 0.3483 0.0629  0.0485  -0.0057 561 LEU A N   
193  C  CA  . LEU A 28 ? 0.3628 0.4820 0.3510 0.0546  0.0461  -0.0015 561 LEU A CA  
194  C  C   . LEU A 28 ? 0.4120 0.5264 0.3950 0.0596  0.0462  -0.0019 561 LEU A C   
195  O  O   . LEU A 28 ? 0.3920 0.5085 0.3765 0.0525  0.0458  -0.0049 561 LEU A O   
196  C  CB  . LEU A 28 ? 0.3637 0.4815 0.3590 0.0497  0.0492  0.0038  561 LEU A CB  
197  C  CG  . LEU A 28 ? 0.4427 0.5790 0.4442 0.0403  0.0465  0.0016  561 LEU A CG  
198  C  CD1 . LEU A 28 ? 0.4540 0.6038 0.4658 0.0337  0.0496  0.0002  561 LEU A CD1 
199  C  CD2 . LEU A 28 ? 0.4640 0.6116 0.4641 0.0394  0.0415  0.0083  561 LEU A CD2 
200  N  N   . PHE A 29 ? 0.3695 0.4733 0.3425 0.0701  0.0496  0.0004  562 PHE A N   
201  C  CA  . PHE A 29 ? 0.3639 0.4665 0.3278 0.0754  0.0504  -0.0020 562 PHE A CA  
202  C  C   . PHE A 29 ? 0.4190 0.5438 0.3815 0.0722  0.0441  -0.0154 562 PHE A C   
203  O  O   . PHE A 29 ? 0.4267 0.5463 0.3894 0.0634  0.0471  -0.0224 562 PHE A O   
204  C  CB  . PHE A 29 ? 0.3903 0.4809 0.3357 0.0892  0.0559  0.0044  562 PHE A CB  
205  C  CG  . PHE A 29 ? 0.4101 0.5050 0.3438 0.0936  0.0570  0.0001  562 PHE A CG  
206  C  CD1 . PHE A 29 ? 0.4404 0.5250 0.3794 0.0886  0.0650  0.0010  562 PHE A CD1 
207  C  CD2 . PHE A 29 ? 0.4305 0.5482 0.3490 0.1037  0.0498  -0.0081 562 PHE A CD2 
208  C  CE1 . PHE A 29 ? 0.4612 0.5482 0.3878 0.0920  0.0680  -0.0069 562 PHE A CE1 
209  C  CE2 . PHE A 29 ? 0.4742 0.6013 0.3804 0.1042  0.0507  -0.0176 562 PHE A CE2 
210  C  CZ  . PHE A 29 ? 0.4594 0.5661 0.3683 0.0977  0.0609  -0.0173 562 PHE A CZ  
211  N  N   . PRO A 30 ? 0.3702 0.5222 0.3315 0.0789  0.0375  -0.0221 563 PRO A N   
212  C  CA  . PRO A 30 ? 0.3683 0.5568 0.3337 0.0700  0.0324  -0.0406 563 PRO A CA  
213  C  C   . PRO A 30 ? 0.4066 0.5879 0.3840 0.0431  0.0384  -0.0484 563 PRO A C   
214  O  O   . PRO A 30 ? 0.4275 0.6156 0.4043 0.0269  0.0420  -0.0646 563 PRO A O   
215  C  CB  . PRO A 30 ? 0.3834 0.6109 0.3512 0.0855  0.0247  -0.0449 563 PRO A CB  
216  C  CG  . PRO A 30 ? 0.4493 0.6464 0.4048 0.1072  0.0277  -0.0272 563 PRO A CG  
217  C  CD  . PRO A 30 ? 0.3842 0.5376 0.3419 0.0940  0.0363  -0.0163 563 PRO A CD  
218  N  N   . LEU A 31 ? 0.3577 0.5221 0.3415 0.0378  0.0417  -0.0373 564 LEU A N   
219  C  CA  . LEU A 31 ? 0.3592 0.5083 0.3455 0.0169  0.0500  -0.0375 564 LEU A CA  
220  C  C   . LEU A 31 ? 0.4123 0.5183 0.3901 0.0151  0.0588  -0.0304 564 LEU A C   
221  O  O   . LEU A 31 ? 0.4357 0.5208 0.4075 -0.0022 0.0699  -0.0382 564 LEU A O   
222  C  CB  . LEU A 31 ? 0.3406 0.4897 0.3301 0.0168  0.0498  -0.0257 564 LEU A CB  
223  C  CG  . LEU A 31 ? 0.3629 0.5494 0.3600 0.0200  0.0449  -0.0340 564 LEU A CG  
224  C  CD1 . LEU A 31 ? 0.3440 0.5266 0.3402 0.0205  0.0455  -0.0246 564 LEU A CD1 
225  C  CD2 . LEU A 31 ? 0.3692 0.5912 0.3742 0.0024  0.0484  -0.0520 564 LEU A CD2 
226  N  N   . ILE A 32 ? 0.3621 0.4540 0.3388 0.0323  0.0568  -0.0176 565 ILE A N   
227  C  CA  . ILE A 32 ? 0.3747 0.4333 0.3459 0.0383  0.0652  -0.0108 565 ILE A CA  
228  C  C   . ILE A 32 ? 0.4267 0.4765 0.3895 0.0332  0.0710  -0.0283 565 ILE A C   
229  O  O   . ILE A 32 ? 0.4442 0.4578 0.3982 0.0274  0.0837  -0.0323 565 ILE A O   
230  C  CB  . ILE A 32 ? 0.3877 0.4512 0.3657 0.0554  0.0621  0.0029  565 ILE A CB  
231  C  CG1 . ILE A 32 ? 0.3853 0.4619 0.3701 0.0561  0.0573  0.0150  565 ILE A CG1 
232  C  CG2 . ILE A 32 ? 0.3792 0.4202 0.3547 0.0673  0.0710  0.0069  565 ILE A CG2 
233  C  CD1 . ILE A 32 ? 0.3871 0.4844 0.3835 0.0643  0.0541  0.0208  565 ILE A CD1 
234  N  N   . GLN A 33 ? 0.3610 0.4419 0.3222 0.0364  0.0631  -0.0393 566 GLN A N   
235  C  CA  . GLN A 33 ? 0.3711 0.4583 0.3218 0.0313  0.0657  -0.0594 566 GLN A CA  
236  C  C   . GLN A 33 ? 0.4755 0.5643 0.4262 0.0033  0.0727  -0.0825 566 GLN A C   
237  O  O   . GLN A 33 ? 0.5309 0.5996 0.4717 -0.0093 0.0837  -0.1009 566 GLN A O   
238  C  CB  . GLN A 33 ? 0.3659 0.4936 0.3100 0.0457  0.0541  -0.0618 566 GLN A CB  
239  C  CG  . GLN A 33 ? 0.3943 0.5423 0.3233 0.0434  0.0539  -0.0833 566 GLN A CG  
240  C  CD  . GLN A 33 ? 0.5290 0.7176 0.4435 0.0653  0.0420  -0.0797 566 GLN A CD  
241  O  OE1 . GLN A 33 ? 0.5044 0.6931 0.3988 0.0778  0.0439  -0.0784 566 GLN A OE1 
242  N  NE2 . GLN A 33 ? 0.3805 0.6030 0.3012 0.0736  0.0313  -0.0766 566 GLN A NE2 
243  N  N   . ALA A 34 ? 0.4165 0.5274 0.3777 -0.0095 0.0697  -0.0840 567 ALA A N   
244  C  CA  . ALA A 34 ? 0.4509 0.5664 0.4142 -0.0427 0.0805  -0.1070 567 ALA A CA  
245  C  C   . ALA A 34 ? 0.5875 0.6275 0.5370 -0.0570 0.1032  -0.1018 567 ALA A C   
246  O  O   . ALA A 34 ? 0.6091 0.6302 0.5510 -0.0854 0.1192  -0.1263 567 ALA A O   
247  C  CB  . ALA A 34 ? 0.4351 0.5911 0.4130 -0.0512 0.0752  -0.1066 567 ALA A CB  
248  N  N   . MSE A 35 ? 0.6055 0.6032 0.5495 -0.0347 0.1055  -0.0712 568 MSE A N   
249  C  CA  . MSE A 35 ? 0.6719 0.5956 0.5978 -0.0328 0.1259  -0.0569 568 MSE A CA  
250  C  C   . MSE A 35 ? 0.7732 0.6577 0.6883 -0.0174 0.1351  -0.0608 568 MSE A C   
251  O  O   . MSE A 35 ? 0.8465 0.6698 0.7431 -0.0291 0.1580  -0.0698 568 MSE A O   
252  C  CB  . MSE A 35 ? 0.6856 0.6013 0.6111 -0.0087 0.1203  -0.0228 568 MSE A CB  
253  C  CG  . MSE A 35 ? 0.7424 0.6939 0.6756 -0.0192 0.1124  -0.0169 568 MSE A CG  
254  SE SE  . MSE A 35 ? 0.8365 0.7820 0.7634 0.0115  0.1057  0.0217  568 MSE A SE  
255  C  CE  . MSE A 35 ? 0.7513 0.7537 0.6907 -0.0039 0.0939  0.0163  568 MSE A CE  
256  N  N   . HIS A 36 ? 0.7086 0.6215 0.6330 0.0093  0.1212  -0.0525 569 HIS A N   
257  C  CA  . HIS A 36 ? 0.7363 0.6258 0.6539 0.0279  0.1288  -0.0556 569 HIS A CA  
258  C  C   . HIS A 36 ? 0.7288 0.6690 0.6526 0.0327  0.1154  -0.0674 569 HIS A C   
259  O  O   . HIS A 36 ? 0.6916 0.6558 0.6250 0.0534  0.1062  -0.0506 569 HIS A O   
260  C  CB  . HIS A 36 ? 0.7597 0.6337 0.6812 0.0612  0.1296  -0.0264 569 HIS A CB  
261  C  CG  . HIS A 36 ? 0.8643 0.6786 0.7692 0.0677  0.1459  -0.0103 569 HIS A CG  
262  N  ND1 . HIS A 36 ? 0.9561 0.7057 0.8419 0.0817  0.1681  -0.0119 569 HIS A ND1 
263  C  CD2 . HIS A 36 ? 0.9006 0.7066 0.8001 0.0636  0.1453  0.0082  569 HIS A CD2 
264  C  CE1 . HIS A 36 ? 1.0038 0.7015 0.8704 0.0878  0.1812  0.0089  569 HIS A CE1 
265  N  NE2 . HIS A 36 ? 0.9750 0.7076 0.8484 0.0764  0.1675  0.0221  569 HIS A NE2 
266  N  N   . PRO A 37 ? 0.7026 0.6627 0.6188 0.0131  0.1153  -0.0965 570 PRO A N   
267  C  CA  . PRO A 37 ? 0.6846 0.6953 0.5985 0.0228  0.1019  -0.1033 570 PRO A CA  
268  C  C   . PRO A 37 ? 0.7803 0.7808 0.6873 0.0456  0.1078  -0.0964 570 PRO A C   
269  O  O   . PRO A 37 ? 0.7514 0.7849 0.6572 0.0595  0.0983  -0.0858 570 PRO A O   
270  C  CB  . PRO A 37 ? 0.7274 0.7638 0.6314 -0.0025 0.1026  -0.1396 570 PRO A CB  
271  C  CG  . PRO A 37 ? 0.8256 0.8049 0.7243 -0.0279 0.1245  -0.1560 570 PRO A CG  
272  C  CD  . PRO A 37 ? 0.7606 0.7038 0.6681 -0.0206 0.1280  -0.1256 570 PRO A CD  
273  N  N   . THR A 38 ? 0.8002 0.7528 0.7006 0.0504  0.1262  -0.1020 571 THR A N   
274  C  CA  . THR A 38 ? 0.8162 0.7655 0.7119 0.0721  0.1347  -0.1000 571 THR A CA  
275  C  C   . THR A 38 ? 0.8024 0.7654 0.7175 0.0952  0.1305  -0.0699 571 THR A C   
276  O  O   . THR A 38 ? 0.7998 0.7902 0.7160 0.1063  0.1307  -0.0652 571 THR A O   
277  C  CB  . THR A 38 ? 1.0293 0.9222 0.9115 0.0739  0.1581  -0.1182 571 THR A CB  
278  O  OG1 . THR A 38 ? 1.0887 0.9721 0.9537 0.0439  0.1639  -0.1527 571 THR A OG1 
279  C  CG2 . THR A 38 ? 1.0408 0.9383 0.9185 0.0966  0.1686  -0.1213 571 THR A CG2 
280  N  N   . LEU A 39 ? 0.7027 0.6511 0.6313 0.1003  0.1284  -0.0513 572 LEU A N   
281  C  CA  . LEU A 39 ? 0.6521 0.6257 0.6011 0.1192  0.1238  -0.0286 572 LEU A CA  
282  C  C   . LEU A 39 ? 0.5837 0.5921 0.5445 0.1091  0.1074  -0.0163 572 LEU A C   
283  O  O   . LEU A 39 ? 0.5218 0.5557 0.5004 0.1178  0.1037  -0.0021 572 LEU A O   
284  C  CB  . LEU A 39 ? 0.6873 0.6294 0.6398 0.1384  0.1317  -0.0152 572 LEU A CB  
285  C  CG  . LEU A 39 ? 0.8033 0.6993 0.7426 0.1569  0.1526  -0.0246 572 LEU A CG  
286  C  CD1 . LEU A 39 ? 0.8479 0.6930 0.7778 0.1759  0.1624  -0.0080 572 LEU A CD1 
287  C  CD2 . LEU A 39 ? 0.7944 0.7257 0.7470 0.1793  0.1583  -0.0262 572 LEU A CD2 
288  N  N   . ALA A 40 ? 0.5173 0.5316 0.4687 0.0914  0.0988  -0.0248 573 ALA A N   
289  C  CA  . ALA A 40 ? 0.4841 0.5221 0.4422 0.0837  0.0858  -0.0165 573 ALA A CA  
290  C  C   . ALA A 40 ? 0.4882 0.5484 0.4555 0.0898  0.0843  -0.0046 573 ALA A C   
291  O  O   . ALA A 40 ? 0.4780 0.5492 0.4585 0.0874  0.0791  0.0049  573 ALA A O   
292  C  CB  . ALA A 40 ? 0.4948 0.5468 0.4401 0.0727  0.0787  -0.0303 573 ALA A CB  
293  N  N   . GLY A 41 ? 0.4438 0.5097 0.4013 0.0945  0.0911  -0.0069 574 GLY A N   
294  C  CA  . GLY A 41 ? 0.4279 0.5070 0.3892 0.0945  0.0966  0.0025  574 GLY A CA  
295  C  C   . GLY A 41 ? 0.4596 0.5578 0.4478 0.0957  0.1008  0.0078  574 GLY A C   
296  O  O   . GLY A 41 ? 0.4546 0.5677 0.4549 0.0862  0.0999  0.0125  574 GLY A O   
297  N  N   . LYS A 42 ? 0.4019 0.5020 0.3991 0.1088  0.1055  0.0052  575 LYS A N   
298  C  CA  . LYS A 42 ? 0.3824 0.5136 0.4061 0.1195  0.1077  0.0100  575 LYS A CA  
299  C  C   . LYS A 42 ? 0.4163 0.5566 0.4505 0.1196  0.0949  0.0182  575 LYS A C   
300  O  O   . LYS A 42 ? 0.3904 0.5726 0.4453 0.1156  0.0916  0.0202  575 LYS A O   
301  C  CB  . LYS A 42 ? 0.4220 0.5447 0.4462 0.1424  0.1173  0.0065  575 LYS A CB  
302  C  CG  . LYS A 42 ? 0.4973 0.6235 0.5137 0.1442  0.1321  -0.0034 575 LYS A CG  
303  C  CD  . LYS A 42 ? 0.7143 0.8247 0.7297 0.1696  0.1429  -0.0094 575 LYS A CD  
304  C  CE  . LYS A 42 ? 0.8739 0.9924 0.8816 0.1739  0.1596  -0.0219 575 LYS A CE  
305  N  NZ  . LYS A 42 ? 1.0307 1.1401 1.0433 0.2039  0.1728  -0.0282 575 LYS A NZ  
306  N  N   . ILE A 43 ? 0.4042 0.5095 0.4231 0.1205  0.0893  0.0206  576 ILE A N   
307  C  CA  . ILE A 43 ? 0.4038 0.5126 0.4248 0.1203  0.0793  0.0302  576 ILE A CA  
308  C  C   . ILE A 43 ? 0.4345 0.5672 0.4620 0.1008  0.0710  0.0279  576 ILE A C   
309  O  O   . ILE A 43 ? 0.4369 0.6035 0.4773 0.1006  0.0643  0.0319  576 ILE A O   
310  C  CB  . ILE A 43 ? 0.4618 0.5225 0.4613 0.1178  0.0811  0.0310  576 ILE A CB  
311  C  CG1 . ILE A 43 ? 0.4999 0.5220 0.4883 0.1364  0.0947  0.0314  576 ILE A CG1 
312  C  CG2 . ILE A 43 ? 0.4503 0.5146 0.4468 0.1147  0.0732  0.0424  576 ILE A CG2 
313  C  CD1 . ILE A 43 ? 0.5564 0.5230 0.5214 0.1229  0.1037  0.0233  576 ILE A CD1 
314  N  N   . THR A 44 ? 0.3791 0.4962 0.3956 0.0873  0.0724  0.0207  577 THR A N   
315  C  CA  . THR A 44 ? 0.3775 0.5020 0.3942 0.0727  0.0692  0.0182  577 THR A CA  
316  C  C   . THR A 44 ? 0.4388 0.5934 0.4726 0.0643  0.0748  0.0157  577 THR A C   
317  O  O   . THR A 44 ? 0.4541 0.6300 0.4974 0.0537  0.0702  0.0124  577 THR A O   
318  C  CB  . THR A 44 ? 0.4396 0.5402 0.4366 0.0702  0.0715  0.0146  577 THR A CB  
319  O  OG1 . THR A 44 ? 0.4314 0.5208 0.4187 0.0728  0.0656  0.0111  577 THR A OG1 
320  C  CG2 . THR A 44 ? 0.3691 0.4651 0.3617 0.0615  0.0719  0.0136  577 THR A CG2 
321  N  N   . GLY A 45 ? 0.3925 0.5536 0.4305 0.0662  0.0861  0.0141  578 GLY A N   
322  C  CA  . GLY A 45 ? 0.3774 0.5746 0.4353 0.0527  0.0958  0.0079  578 GLY A CA  
323  C  C   . GLY A 45 ? 0.3973 0.6513 0.4822 0.0553  0.0863  0.0050  578 GLY A C   
324  O  O   . GLY A 45 ? 0.3794 0.6680 0.4795 0.0345  0.0883  -0.0058 578 GLY A O   
325  N  N   . MSE A 46 ? 0.3519 0.6138 0.4390 0.0816  0.0773  0.0142  579 MSE A N   
326  C  CA  A MSE A 46 ? 0.3372 0.6547 0.4430 0.0959  0.0668  0.0174  579 MSE A CA  
327  C  CA  B MSE A 46 ? 0.3543 0.6707 0.4595 0.0968  0.0665  0.0179  579 MSE A CA  
328  C  C   . MSE A 46 ? 0.3767 0.7017 0.4761 0.0855  0.0540  0.0178  579 MSE A C   
329  O  O   . MSE A 46 ? 0.3469 0.7332 0.4643 0.0764  0.0479  0.0087  579 MSE A O   
330  C  CB  A MSE A 46 ? 0.3833 0.6872 0.4824 0.1323  0.0653  0.0317  579 MSE A CB  
331  C  CB  B MSE A 46 ? 0.4140 0.7104 0.5097 0.1327  0.0649  0.0328  579 MSE A CB  
332  C  CG  A MSE A 46 ? 0.4845 0.8583 0.6045 0.1579  0.0574  0.0371  579 MSE A CG  
333  C  CG  B MSE A 46 ? 0.5389 0.8478 0.6465 0.1515  0.0767  0.0306  579 MSE A CG  
334  SE SE  A MSE A 46 ? 0.6399 0.9762 0.7375 0.2122  0.0571  0.0631  579 MSE A SE  
335  SE SE  B MSE A 46 ? 0.7124 0.9818 0.8033 0.2016  0.0807  0.0479  579 MSE A SE  
336  C  CE  A MSE A 46 ? 0.6166 0.9065 0.7128 0.2232  0.0788  0.0548  579 MSE A CE  
337  C  CE  B MSE A 46 ? 0.6816 0.9959 0.7735 0.2236  0.0625  0.0662  579 MSE A CE  
338  N  N   . LEU A 47 ? 0.3362 0.6071 0.4108 0.0848  0.0509  0.0248  580 LEU A N   
339  C  CA  . LEU A 47 ? 0.3328 0.6074 0.3980 0.0757  0.0414  0.0249  580 LEU A CA  
340  C  C   . LEU A 47 ? 0.3606 0.6493 0.4325 0.0467  0.0441  0.0068  580 LEU A C   
341  O  O   . LEU A 47 ? 0.3676 0.6858 0.4398 0.0381  0.0365  0.0008  580 LEU A O   
342  C  CB  . LEU A 47 ? 0.3398 0.5591 0.3804 0.0781  0.0412  0.0332  580 LEU A CB  
343  C  CG  . LEU A 47 ? 0.4128 0.6011 0.4391 0.1004  0.0437  0.0492  580 LEU A CG  
344  C  CD1 . LEU A 47 ? 0.4231 0.5722 0.4283 0.0918  0.0450  0.0525  580 LEU A CD1 
345  C  CD2 . LEU A 47 ? 0.4301 0.6517 0.4576 0.1243  0.0380  0.0636  580 LEU A CD2 
346  N  N   . LEU A 48 ? 0.3063 0.5732 0.3803 0.0320  0.0575  -0.0020 581 LEU A N   
347  C  CA  . LEU A 48 ? 0.3156 0.5782 0.3902 0.0038  0.0672  -0.0189 581 LEU A CA  
348  C  C   . LEU A 48 ? 0.4058 0.7359 0.5059 -0.0159 0.0680  -0.0367 581 LEU A C   
349  O  O   . LEU A 48 ? 0.4456 0.7733 0.5458 -0.0449 0.0778  -0.0559 581 LEU A O   
350  C  CB  . LEU A 48 ? 0.3274 0.5390 0.3889 -0.0030 0.0851  -0.0185 581 LEU A CB  
351  C  CG  . LEU A 48 ? 0.3912 0.5461 0.4255 0.0105  0.0838  -0.0088 581 LEU A CG  
352  C  CD1 . LEU A 48 ? 0.4132 0.5274 0.4296 0.0134  0.0989  -0.0029 581 LEU A CD1 
353  C  CD2 . LEU A 48 ? 0.4290 0.5672 0.4532 0.0021  0.0827  -0.0169 581 LEU A CD2 
354  N  N   . GLU A 49 ? 0.3458 0.7388 0.4668 0.0002  0.0588  -0.0326 582 GLU A N   
355  C  CA  . GLU A 49 ? 0.3315 0.8129 0.4814 -0.0151 0.0557  -0.0518 582 GLU A CA  
356  C  C   . GLU A 49 ? 0.3700 0.8944 0.5155 -0.0138 0.0378  -0.0563 582 GLU A C   
357  O  O   . GLU A 49 ? 0.3745 0.9717 0.5390 -0.0362 0.0349  -0.0802 582 GLU A O   
358  C  CB  . GLU A 49 ? 0.3448 0.8864 0.5194 0.0096  0.0525  -0.0450 582 GLU A CB  
359  C  CG  . GLU A 49 ? 0.4603 0.9739 0.6409 0.0038  0.0728  -0.0455 582 GLU A CG  
360  C  CD  . GLU A 49 ? 0.8267 1.3572 1.0233 -0.0405 0.0949  -0.0702 582 GLU A CD  
361  O  OE1 . GLU A 49 ? 0.6192 1.1923 0.8287 -0.0726 0.0956  -0.0938 582 GLU A OE1 
362  O  OE2 . GLU A 49 ? 0.9380 1.4368 1.1314 -0.0453 0.1142  -0.0672 582 GLU A OE2 
363  N  N   . ILE A 50 ? 0.3136 0.7969 0.4329 0.0095  0.0272  -0.0355 583 ILE A N   
364  C  CA  . ILE A 50 ? 0.3207 0.8333 0.4263 0.0132  0.0126  -0.0348 583 ILE A CA  
365  C  C   . ILE A 50 ? 0.4051 0.9100 0.5065 -0.0250 0.0199  -0.0632 583 ILE A C   
366  O  O   . ILE A 50 ? 0.4015 0.8419 0.4972 -0.0429 0.0366  -0.0709 583 ILE A O   
367  C  CB  . ILE A 50 ? 0.3542 0.8082 0.4304 0.0402  0.0081  -0.0066 583 ILE A CB  
368  C  CG1 . ILE A 50 ? 0.3620 0.8167 0.4373 0.0781  0.0046  0.0191  583 ILE A CG1 
369  C  CG2 . ILE A 50 ? 0.3693 0.8411 0.4243 0.0398  -0.0020 -0.0049 583 ILE A CG2 
370  C  CD1 . ILE A 50 ? 0.3890 0.7665 0.4348 0.0962  0.0089  0.0431  583 ILE A CD1 
371  N  N   . ASP A 51 ? 0.3970 0.9669 0.4974 -0.0346 0.0084  -0.0785 584 ASP A N   
372  C  CA  A ASP A 51 ? 0.4160 0.9801 0.5096 -0.0706 0.0165  -0.1097 584 ASP A CA  
373  C  CA  B ASP A 51 ? 0.4129 0.9768 0.5063 -0.0706 0.0165  -0.1097 584 ASP A CA  
374  C  C   . ASP A 51 ? 0.4543 0.9267 0.5210 -0.0670 0.0256  -0.1006 584 ASP A C   
375  O  O   . ASP A 51 ? 0.4263 0.8739 0.4768 -0.0398 0.0176  -0.0739 584 ASP A O   
376  C  CB  A ASP A 51 ? 0.4579 1.1135 0.5493 -0.0756 -0.0004 -0.1256 584 ASP A CB  
377  C  CB  B ASP A 51 ? 0.4507 1.1039 0.5406 -0.0747 -0.0006 -0.1247 584 ASP A CB  
378  C  CG  A ASP A 51 ? 0.6438 1.3023 0.7054 -0.0446 -0.0160 -0.0994 584 ASP A CG  
379  C  CG  B ASP A 51 ? 0.6238 1.2790 0.7067 -0.1154 0.0093  -0.1646 584 ASP A CG  
380  O  OD1 A ASP A 51 ? 0.6702 1.2787 0.7088 -0.0520 -0.0098 -0.1022 584 ASP A OD1 
381  O  OD1 B ASP A 51 ? 0.6650 1.3148 0.7646 -0.1532 0.0272  -0.1962 584 ASP A OD1 
382  O  OD2 A ASP A 51 ? 0.7349 1.4532 0.7943 -0.0135 -0.0330 -0.0783 584 ASP A OD2 
383  O  OD2 B ASP A 51 ? 0.6697 1.3320 0.7284 -0.1109 0.0015  -0.1658 584 ASP A OD2 
384  N  N   . ASN A 52 ? 0.4314 0.8535 0.4933 -0.0938 0.0446  -0.1232 585 ASN A N   
385  C  CA  . ASN A 52 ? 0.4366 0.7792 0.4760 -0.0879 0.0552  -0.1189 585 ASN A CA  
386  C  C   . ASN A 52 ? 0.4707 0.8244 0.4921 -0.0742 0.0437  -0.1127 585 ASN A C   
387  O  O   . ASN A 52 ? 0.4701 0.7799 0.4799 -0.0550 0.0445  -0.0949 585 ASN A O   
388  C  CB  . ASN A 52 ? 0.4791 0.7735 0.5121 -0.1175 0.0795  -0.1481 585 ASN A CB  
389  C  CG  . ASN A 52 ? 0.6075 0.8591 0.6467 -0.1286 0.0989  -0.1470 585 ASN A CG  
390  O  OD1 . ASN A 52 ? 0.5168 0.7759 0.5669 -0.1132 0.0938  -0.1255 585 ASN A OD1 
391  N  ND2 . ASN A 52 ? 0.5373 0.7374 0.5657 -0.1560 0.1248  -0.1706 585 ASN A ND2 
392  N  N   . SER A 53 ? 0.4245 0.8427 0.4431 -0.0846 0.0336  -0.1279 586 SER A N   
393  C  CA  . SER A 53 ? 0.4284 0.8591 0.4249 -0.0734 0.0255  -0.1213 586 SER A CA  
394  C  C   . SER A 53 ? 0.4504 0.8832 0.4387 -0.0426 0.0134  -0.0827 586 SER A C   
395  O  O   . SER A 53 ? 0.4501 0.8535 0.4217 -0.0330 0.0161  -0.0707 586 SER A O   
396  C  CB  . SER A 53 ? 0.4785 0.9830 0.4686 -0.0914 0.0176  -0.1470 586 SER A CB  
397  O  OG  . SER A 53 ? 0.6231 1.0987 0.6106 -0.1206 0.0355  -0.1848 586 SER A OG  
398  N  N   . GLU A 54 ? 0.3916 0.8551 0.3913 -0.0279 0.0035  -0.0649 587 GLU A N   
399  C  CA  . GLU A 54 ? 0.3788 0.8284 0.3669 0.0018  -0.0027 -0.0288 587 GLU A CA  
400  C  C   . GLU A 54 ? 0.3974 0.7718 0.3881 0.0073  0.0085  -0.0172 587 GLU A C   
401  O  O   . GLU A 54 ? 0.3952 0.7385 0.3696 0.0184  0.0109  0.0016  587 GLU A O   
402  C  CB  . GLU A 54 ? 0.3938 0.8960 0.3923 0.0219  -0.0143 -0.0148 587 GLU A CB  
403  C  CG  . GLU A 54 ? 0.5221 1.0015 0.5003 0.0567  -0.0173 0.0238  587 GLU A CG  
404  C  CD  . GLU A 54 ? 0.7870 1.2565 0.7271 0.0673  -0.0178 0.0442  587 GLU A CD  
405  O  OE1 . GLU A 54 ? 0.5939 1.1086 0.5209 0.0562  -0.0237 0.0312  587 GLU A OE1 
406  O  OE2 . GLU A 54 ? 0.7663 1.1810 0.6872 0.0849  -0.0098 0.0722  587 GLU A OE2 
407  N  N   . LEU A 55 ? 0.3336 0.6812 0.3416 -0.0034 0.0171  -0.0307 588 LEU A N   
408  C  CA  . LEU A 55 ? 0.3343 0.6226 0.3424 0.0027  0.0260  -0.0230 588 LEU A CA  
409  C  C   . LEU A 55 ? 0.4078 0.6682 0.4027 0.0002  0.0313  -0.0285 588 LEU A C   
410  O  O   . LEU A 55 ? 0.4172 0.6520 0.4072 0.0095  0.0330  -0.0168 588 LEU A O   
411  C  CB  . LEU A 55 ? 0.3381 0.6065 0.3599 -0.0072 0.0359  -0.0351 588 LEU A CB  
412  C  CG  . LEU A 55 ? 0.3865 0.6750 0.4246 -0.0013 0.0346  -0.0274 588 LEU A CG  
413  C  CD1 . LEU A 55 ? 0.3848 0.6516 0.4318 -0.0169 0.0494  -0.0401 588 LEU A CD1 
414  C  CD2 . LEU A 55 ? 0.4192 0.6840 0.4524 0.0220  0.0317  -0.0044 588 LEU A CD2 
415  N  N   . LEU A 56 ? 0.3615 0.6325 0.3517 -0.0134 0.0351  -0.0495 589 LEU A N   
416  C  CA  . LEU A 56 ? 0.3650 0.6190 0.3448 -0.0126 0.0415  -0.0579 589 LEU A CA  
417  C  C   . LEU A 56 ? 0.4219 0.6960 0.3897 -0.0078 0.0367  -0.0438 589 LEU A C   
418  O  O   . LEU A 56 ? 0.4201 0.6803 0.3858 -0.0033 0.0416  -0.0416 589 LEU A O   
419  C  CB  . LEU A 56 ? 0.3801 0.6375 0.3548 -0.0275 0.0496  -0.0862 589 LEU A CB  
420  C  CG  . LEU A 56 ? 0.4355 0.6499 0.4144 -0.0344 0.0635  -0.1009 589 LEU A CG  
421  C  CD1 . LEU A 56 ? 0.4715 0.6902 0.4444 -0.0570 0.0737  -0.1322 589 LEU A CD1 
422  C  CD2 . LEU A 56 ? 0.4188 0.5827 0.3925 -0.0145 0.0725  -0.0942 589 LEU A CD2 
423  N  N   . TYR A 57 ? 0.3805 0.6897 0.3389 -0.0079 0.0284  -0.0334 590 TYR A N   
424  C  CA  . TYR A 57 ? 0.3820 0.6997 0.3201 -0.0025 0.0279  -0.0138 590 TYR A CA  
425  C  C   . TYR A 57 ? 0.4218 0.7001 0.3614 0.0060  0.0325  0.0067  590 TYR A C   
426  O  O   . TYR A 57 ? 0.4170 0.6816 0.3489 0.0009  0.0412  0.0100  590 TYR A O   
427  C  CB  . TYR A 57 ? 0.4038 0.7655 0.3261 0.0039  0.0175  -0.0020 590 TYR A CB  
428  C  CG  . TYR A 57 ? 0.4366 0.7909 0.3290 0.0145  0.0207  0.0271  590 TYR A CG  
429  C  CD1 . TYR A 57 ? 0.4624 0.8242 0.3324 0.0050  0.0288  0.0256  590 TYR A CD1 
430  C  CD2 . TYR A 57 ? 0.4523 0.7838 0.3362 0.0339  0.0202  0.0562  590 TYR A CD2 
431  C  CE1 . TYR A 57 ? 0.5085 0.8530 0.3459 0.0109  0.0377  0.0542  590 TYR A CE1 
432  C  CE2 . TYR A 57 ? 0.5026 0.8088 0.3519 0.0430  0.0295  0.0852  590 TYR A CE2 
433  C  CZ  . TYR A 57 ? 0.6322 0.9434 0.4572 0.0296  0.0390  0.0850  590 TYR A CZ  
434  O  OH  . TYR A 57 ? 0.7591 1.0378 0.5446 0.0350  0.0533  0.1153  590 TYR A OH  
435  N  N   . MSE A 58 ? 0.3948 0.6590 0.3454 0.0161  0.0286  0.0163  591 MSE A N   
436  C  CA  A MSE A 58 ? 0.3702 0.5950 0.3212 0.0229  0.0342  0.0305  591 MSE A CA  
437  C  CA  B MSE A 58 ? 0.4241 0.6489 0.3753 0.0228  0.0342  0.0303  591 MSE A CA  
438  C  C   . MSE A 58 ? 0.4446 0.6495 0.4061 0.0145  0.0407  0.0165  591 MSE A C   
439  O  O   . MSE A 58 ? 0.4707 0.6545 0.4275 0.0102  0.0482  0.0216  591 MSE A O   
440  C  CB  A MSE A 58 ? 0.3679 0.5883 0.3309 0.0361  0.0298  0.0372  591 MSE A CB  
441  C  CB  B MSE A 58 ? 0.4630 0.6832 0.4268 0.0354  0.0299  0.0361  591 MSE A CB  
442  C  CG  A MSE A 58 ? 0.4448 0.6898 0.3973 0.0535  0.0233  0.0557  591 MSE A CG  
443  C  CG  B MSE A 58 ? 0.6069 0.8436 0.5594 0.0535  0.0249  0.0564  591 MSE A CG  
444  SE SE  A MSE A 58 ? 0.4917 0.7774 0.4730 0.0638  0.0144  0.0484  591 MSE A SE  
445  SE SE  B MSE A 58 ? 0.7350 0.9758 0.7119 0.0691  0.0221  0.0569  591 MSE A SE  
446  C  CE  A MSE A 58 ? 0.4382 0.6633 0.4316 0.0671  0.0258  0.0484  591 MSE A CE  
447  C  CE  B MSE A 58 ? 0.6791 0.9937 0.6747 0.0595  0.0108  0.0377  591 MSE A CE  
448  N  N   . LEU A 59 ? 0.3675 0.5798 0.3411 0.0128  0.0394  -0.0019 592 LEU A N   
449  C  CA  . LEU A 59 ? 0.3527 0.5569 0.3340 0.0140  0.0433  -0.0133 592 LEU A CA  
450  C  C   . LEU A 59 ? 0.3940 0.6177 0.3716 0.0057  0.0489  -0.0198 592 LEU A C   
451  O  O   . LEU A 59 ? 0.4010 0.6320 0.3870 0.0063  0.0516  -0.0283 592 LEU A O   
452  C  CB  . LEU A 59 ? 0.3515 0.5487 0.3383 0.0205  0.0442  -0.0269 592 LEU A CB  
453  C  CG  . LEU A 59 ? 0.4178 0.5913 0.4087 0.0272  0.0441  -0.0224 592 LEU A CG  
454  C  CD1 . LEU A 59 ? 0.4400 0.5948 0.4284 0.0287  0.0512  -0.0337 592 LEU A CD1 
455  C  CD2 . LEU A 59 ? 0.4008 0.5638 0.3931 0.0365  0.0434  -0.0176 592 LEU A CD2 
456  N  N   . GLU A 60 ? 0.3558 0.5957 0.3203 -0.0021 0.0509  -0.0166 593 GLU A N   
457  C  CA  . GLU A 60 ? 0.3721 0.6338 0.3304 -0.0131 0.0597  -0.0221 593 GLU A CA  
458  C  C   . GLU A 60 ? 0.4516 0.7014 0.3892 -0.0241 0.0677  -0.0018 593 GLU A C   
459  O  O   . GLU A 60 ? 0.4461 0.7103 0.3735 -0.0381 0.0793  -0.0032 593 GLU A O   
460  C  CB  . GLU A 60 ? 0.3930 0.6806 0.3451 -0.0137 0.0603  -0.0361 593 GLU A CB  
461  C  CG  . GLU A 60 ? 0.4980 0.7854 0.4639 -0.0025 0.0604  -0.0574 593 GLU A CG  
462  C  CD  . GLU A 60 ? 0.6569 0.9600 0.6141 -0.0044 0.0648  -0.0760 593 GLU A CD  
463  O  OE1 . GLU A 60 ? 0.4774 0.8090 0.4224 -0.0141 0.0700  -0.0781 593 GLU A OE1 
464  O  OE2 . GLU A 60 ? 0.5457 0.8291 0.5053 0.0020  0.0660  -0.0898 593 GLU A OE2 
465  N  N   . SER A 61 ? 0.4200 0.6409 0.3480 -0.0163 0.0644  0.0180  594 SER A N   
466  C  CA  . SER A 61 ? 0.4638 0.6574 0.3639 -0.0195 0.0750  0.0423  594 SER A CA  
467  C  C   . SER A 61 ? 0.5436 0.6908 0.4459 -0.0167 0.0804  0.0510  594 SER A C   
468  O  O   . SER A 61 ? 0.5409 0.6727 0.4419 0.0023  0.0731  0.0635  594 SER A O   
469  C  CB  . SER A 61 ? 0.5080 0.7156 0.3849 -0.0044 0.0674  0.0608  594 SER A CB  
470  O  OG  . SER A 61 ? 0.6954 0.8681 0.5375 0.0011  0.0792  0.0904  594 SER A OG  
471  N  N   . PRO A 62 ? 0.5129 0.6444 0.4201 -0.0373 0.0943  0.0402  595 PRO A N   
472  C  CA  . PRO A 62 ? 0.5243 0.6130 0.4332 -0.0395 0.1013  0.0404  595 PRO A CA  
473  C  C   . PRO A 62 ? 0.6279 0.6583 0.5062 -0.0265 0.1119  0.0686  595 PRO A C   
474  O  O   . PRO A 62 ? 0.6398 0.6409 0.5215 -0.0129 0.1106  0.0713  595 PRO A O   
475  C  CB  . PRO A 62 ? 0.5523 0.6470 0.4682 -0.0715 0.1172  0.0201  595 PRO A CB  
476  C  CG  . PRO A 62 ? 0.5635 0.7231 0.4992 -0.0743 0.1084  0.0022  595 PRO A CG  
477  C  CD  . PRO A 62 ? 0.5167 0.6798 0.4328 -0.0609 0.1040  0.0210  595 PRO A CD  
478  N  N   . GLU A 63 ? 0.6177 0.6333 0.4639 -0.0257 0.1224  0.0909  596 GLU A N   
479  C  CA  . GLU A 63 ? 0.6875 0.6470 0.4954 -0.0044 0.1337  0.1245  596 GLU A CA  
480  C  C   . GLU A 63 ? 0.6775 0.6597 0.4928 0.0346  0.1120  0.1370  596 GLU A C   
481  O  O   . GLU A 63 ? 0.6990 0.6384 0.5038 0.0571  0.1173  0.1520  596 GLU A O   
482  C  CB  . GLU A 63 ? 0.7627 0.7166 0.5308 -0.0084 0.1466  0.1472  596 GLU A CB  
483  C  CG  . GLU A 63 ? 1.0709 0.9402 0.7970 -0.0240 0.1820  0.1661  596 GLU A CG  
484  C  CD  . GLU A 63 ? 1.5755 1.4274 1.2493 -0.0181 0.1969  0.1994  596 GLU A CD  
485  O  OE1 . GLU A 63 ? 1.5295 1.4377 1.2064 -0.0347 0.1928  0.1900  596 GLU A OE1 
486  O  OE2 . GLU A 63 ? 1.6465 1.4257 1.2723 0.0056  0.2145  0.2357  596 GLU A OE2 
487  N  N   . SER A 64 ? 0.5765 0.6278 0.4114 0.0405  0.0900  0.1271  597 SER A N   
488  C  CA  . SER A 64 ? 0.5528 0.6447 0.4005 0.0686  0.0699  0.1317  597 SER A CA  
489  C  C   . SER A 64 ? 0.5784 0.6690 0.4589 0.0712  0.0637  0.1150  597 SER A C   
490  O  O   . SER A 64 ? 0.6010 0.6986 0.4864 0.0968  0.0574  0.1248  597 SER A O   
491  C  CB  . SER A 64 ? 0.5587 0.7204 0.4157 0.0637  0.0534  0.1188  597 SER A CB  
492  O  OG  . SER A 64 ? 0.7220 0.8897 0.5432 0.0635  0.0593  0.1355  597 SER A OG  
493  N  N   . LEU A 65 ? 0.4909 0.5787 0.3928 0.0478  0.0658  0.0905  598 LEU A N   
494  C  CA  . LEU A 65 ? 0.4498 0.5345 0.3761 0.0504  0.0617  0.0762  598 LEU A CA  
495  C  C   . LEU A 65 ? 0.5336 0.5642 0.4477 0.0614  0.0747  0.0867  598 LEU A C   
496  O  O   . LEU A 65 ? 0.5322 0.5657 0.4572 0.0804  0.0704  0.0884  598 LEU A O   
497  C  CB  . LEU A 65 ? 0.4141 0.5104 0.3582 0.0297  0.0609  0.0513  598 LEU A CB  
498  C  CG  . LEU A 65 ? 0.4443 0.5352 0.4053 0.0333  0.0582  0.0386  598 LEU A CG  
499  C  CD1 . LEU A 65 ? 0.4216 0.5348 0.3959 0.0478  0.0488  0.0403  598 LEU A CD1 
500  C  CD2 . LEU A 65 ? 0.4206 0.5266 0.3919 0.0202  0.0569  0.0185  598 LEU A CD2 
501  N  N   . ARG A 66 ? 0.5348 0.5151 0.4255 0.0478  0.0936  0.0919  599 ARG A N   
502  C  CA  A ARG A 66 ? 0.5915 0.5046 0.4645 0.0536  0.1124  0.0983  599 ARG A CA  
503  C  CA  B ARG A 66 ? 0.5926 0.5051 0.4648 0.0540  0.1126  0.0990  599 ARG A CA  
504  C  C   . ARG A 66 ? 0.6916 0.5858 0.5469 0.0950  0.1128  0.1274  599 ARG A C   
505  O  O   . ARG A 66 ? 0.7002 0.5682 0.5587 0.1131  0.1179  0.1266  599 ARG A O   
506  C  CB  A ARG A 66 ? 0.6444 0.5043 0.4921 0.0239  0.1375  0.0967  599 ARG A CB  
507  C  CB  B ARG A 66 ? 0.6459 0.5044 0.4907 0.0267  0.1376  0.1004  599 ARG A CB  
508  C  CG  A ARG A 66 ? 0.8472 0.6168 0.6643 0.0287  0.1648  0.1068  599 ARG A CG  
509  C  CG  B ARG A 66 ? 0.8282 0.5978 0.6459 0.0288  0.1647  0.1062  599 ARG A CG  
510  C  CD  A ARG A 66 ? 0.9644 0.6972 0.7804 -0.0148 0.1868  0.0778  599 ARG A CD  
511  C  CD  B ARG A 66 ? 0.9458 0.6655 0.7423 -0.0133 0.1934  0.0963  599 ARG A CD  
512  N  NE  A ARG A 66 ? 0.9602 0.7172 0.8042 -0.0201 0.1770  0.0477  599 ARG A NE  
513  N  NE  B ARG A 66 ? 0.8521 0.6406 0.6771 -0.0476 0.1829  0.0694  599 ARG A NE  
514  C  CZ  A ARG A 66 ? 1.1361 0.8488 0.9735 -0.0039 0.1856  0.0444  599 ARG A CZ  
515  C  CZ  B ARG A 66 ? 0.8760 0.7015 0.7308 -0.0698 0.1763  0.0345  599 ARG A CZ  
516  N  NH1 A ARG A 66 ? 1.0521 0.6903 0.8574 0.0224  0.2045  0.0700  599 ARG A NH1 
517  N  NH1 B ARG A 66 ? 0.6862 0.4819 0.5435 -0.0693 0.1816  0.0190  599 ARG A NH1 
518  N  NH2 A ARG A 66 ? 0.9449 0.6880 0.8045 -0.0100 0.1761  0.0168  599 ARG A NH2 
519  N  NH2 B ARG A 66 ? 0.5509 0.4468 0.4310 -0.0896 0.1645  0.0144  599 ARG A NH2 
520  N  N   . SER A 67 ? 0.6565 0.5702 0.4923 0.1127  0.1074  0.1520  600 SER A N   
521  C  CA  . SER A 67 ? 0.6929 0.6037 0.5110 0.1587  0.1052  0.1811  600 SER A CA  
522  C  C   . SER A 67 ? 0.6591 0.6388 0.5151 0.1791  0.0839  0.1705  600 SER A C   
523  O  O   . SER A 67 ? 0.6927 0.6626 0.5464 0.2151  0.0866  0.1833  600 SER A O   
524  C  CB  . SER A 67 ? 0.7860 0.7128 0.5705 0.1740  0.1026  0.2094  600 SER A CB  
525  O  OG  . SER A 67 ? 0.9126 0.9240 0.7183 0.1599  0.0804  0.1953  600 SER A OG  
526  N  N   . LYS A 68 ? 0.5405 0.5841 0.4299 0.1559  0.0668  0.1462  601 LYS A N   
527  C  CA  . LYS A 68 ? 0.4936 0.5987 0.4189 0.1646  0.0520  0.1323  601 LYS A CA  
528  C  C   . LYS A 68 ? 0.5525 0.6243 0.4921 0.1630  0.0615  0.1190  601 LYS A C   
529  O  O   . LYS A 68 ? 0.5565 0.6540 0.5124 0.1858  0.0590  0.1195  601 LYS A O   
530  C  CB  . LYS A 68 ? 0.4616 0.6262 0.4105 0.1372  0.0377  0.1102  601 LYS A CB  
531  C  CG  . LYS A 68 ? 0.5148 0.7344 0.4543 0.1423  0.0253  0.1178  601 LYS A CG  
532  C  CD  . LYS A 68 ? 0.5832 0.8655 0.5328 0.1737  0.0135  0.1267  601 LYS A CD  
533  C  CE  . LYS A 68 ? 0.5389 0.8863 0.4756 0.1813  -0.0006 0.1331  601 LYS A CE  
534  N  NZ  . LYS A 68 ? 0.6195 1.0289 0.5596 0.2225  -0.0117 0.1481  601 LYS A NZ  
535  N  N   . VAL A 69 ? 0.4959 0.5187 0.4292 0.1367  0.0727  0.1055  602 VAL A N   
536  C  CA  . VAL A 69 ? 0.4886 0.4793 0.4285 0.1330  0.0825  0.0904  602 VAL A CA  
537  C  C   . VAL A 69 ? 0.6100 0.5499 0.5313 0.1643  0.0981  0.1055  602 VAL A C   
538  O  O   . VAL A 69 ? 0.6044 0.5538 0.5396 0.1819  0.0997  0.0998  602 VAL A O   
539  C  CB  . VAL A 69 ? 0.5184 0.4814 0.4536 0.0984  0.0894  0.0706  602 VAL A CB  
540  C  CG1 . VAL A 69 ? 0.5310 0.4548 0.4626 0.0950  0.1024  0.0550  602 VAL A CG1 
541  C  CG2 . VAL A 69 ? 0.4535 0.4674 0.4092 0.0802  0.0747  0.0553  602 VAL A CG2 
542  N  N   . ASP A 70 ? 0.6389 0.5249 0.5266 0.1741  0.1116  0.1264  603 ASP A N   
543  C  CA  . ASP A 70 ? 0.7204 0.5421 0.5808 0.2099  0.1308  0.1460  603 ASP A CA  
544  C  C   . ASP A 70 ? 0.7524 0.6300 0.6269 0.2589  0.1181  0.1626  603 ASP A C   
545  O  O   . ASP A 70 ? 0.7859 0.6383 0.6593 0.2900  0.1294  0.1647  603 ASP A O   
546  C  CB  . ASP A 70 ? 0.8285 0.5787 0.6429 0.2106  0.1497  0.1706  603 ASP A CB  
547  C  CG  . ASP A 70 ? 1.0836 0.7710 0.8825 0.1615  0.1705  0.1516  603 ASP A CG  
548  O  OD1 . ASP A 70 ? 1.0728 0.7619 0.8922 0.1341  0.1721  0.1192  603 ASP A OD1 
549  O  OD2 . ASP A 70 ? 1.2122 0.8542 0.9774 0.1496  0.1861  0.1683  603 ASP A OD2 
550  N  N   . GLU A 71 ? 0.6511 0.6121 0.5415 0.2642  0.0953  0.1699  604 GLU A N   
551  C  CA  . GLU A 71 ? 0.6351 0.6763 0.5469 0.3037  0.0800  0.1788  604 GLU A CA  
552  C  C   . GLU A 71 ? 0.6326 0.7202 0.5864 0.2964  0.0761  0.1526  604 GLU A C   
553  O  O   . GLU A 71 ? 0.6508 0.7678 0.6179 0.3337  0.0775  0.1569  604 GLU A O   
554  C  CB  . GLU A 71 ? 0.6201 0.7458 0.5395 0.2994  0.0573  0.1836  604 GLU A CB  
555  C  CG  . GLU A 71 ? 0.7932 0.8956 0.6677 0.3254  0.0592  0.2175  604 GLU A CG  
556  C  CD  . GLU A 71 ? 1.0191 1.2193 0.8998 0.3260  0.0352  0.2196  604 GLU A CD  
557  O  OE1 . GLU A 71 ? 0.6851 0.9082 0.5766 0.2822  0.0277  0.1994  604 GLU A OE1 
558  O  OE2 . GLU A 71 ? 1.1507 1.4092 1.0249 0.3723  0.0239  0.2397  604 GLU A OE2 
559  N  N   . ALA A 72 ? 0.5430 0.6360 0.5147 0.2511  0.0734  0.1268  605 ALA A N   
560  C  CA  . ALA A 72 ? 0.4938 0.6201 0.4965 0.2390  0.0734  0.1041  605 ALA A CA  
561  C  C   . ALA A 72 ? 0.5944 0.6622 0.5870 0.2547  0.0926  0.0999  605 ALA A C   
562  O  O   . ALA A 72 ? 0.5786 0.6811 0.5920 0.2728  0.0959  0.0929  605 ALA A O   
563  C  CB  . ALA A 72 ? 0.4523 0.5819 0.4631 0.1939  0.0686  0.0843  605 ALA A CB  
564  N  N   . VAL A 73 ? 0.6104 0.5910 0.5705 0.2467  0.1077  0.1019  606 VAL A N   
565  C  CA  . VAL A 73 ? 0.6554 0.5658 0.5984 0.2562  0.1299  0.0933  606 VAL A CA  
566  C  C   . VAL A 73 ? 0.7750 0.6792 0.7133 0.3113  0.1392  0.1114  606 VAL A C   
567  O  O   . VAL A 73 ? 0.7983 0.6958 0.7439 0.3279  0.1511  0.0992  606 VAL A O   
568  C  CB  . VAL A 73 ? 0.7340 0.5564 0.6428 0.2295  0.1462  0.0890  606 VAL A CB  
569  C  CG1 . VAL A 73 ? 0.8108 0.5473 0.6938 0.2433  0.1743  0.0820  606 VAL A CG1 
570  C  CG2 . VAL A 73 ? 0.6687 0.5102 0.5876 0.1817  0.1379  0.0643  606 VAL A CG2 
571  N  N   . ALA A 74 ? 0.7657 0.6806 0.6917 0.3431  0.1333  0.1405  607 ALA A N   
572  C  CA  . ALA A 74 ? 0.8208 0.7406 0.7406 0.4058  0.1395  0.1625  607 ALA A CA  
573  C  C   . ALA A 74 ? 0.8180 0.8484 0.7857 0.4243  0.1257  0.1507  607 ALA A C   
574  O  O   . ALA A 74 ? 0.8675 0.8972 0.8401 0.4663  0.1379  0.1513  607 ALA A O   
575  C  CB  . ALA A 74 ? 0.8715 0.7935 0.7644 0.4360  0.1321  0.1981  607 ALA A CB  
576  N  N   . VAL A 75 ? 0.6837 0.8049 0.6857 0.3905  0.1040  0.1371  608 VAL A N   
577  C  CA  . VAL A 75 ? 0.6278 0.8580 0.6772 0.3937  0.0939  0.1213  608 VAL A CA  
578  C  C   . VAL A 75 ? 0.6502 0.8587 0.7110 0.3821  0.1113  0.0978  608 VAL A C   
579  O  O   . VAL A 75 ? 0.6324 0.8970 0.7192 0.4098  0.1164  0.0915  608 VAL A O   
580  C  CB  . VAL A 75 ? 0.6066 0.9167 0.6826 0.3503  0.0736  0.1085  608 VAL A CB  
581  C  CG1 . VAL A 75 ? 0.5721 0.9884 0.6960 0.3451  0.0697  0.0885  608 VAL A CG1 
582  C  CG2 . VAL A 75 ? 0.6061 0.9474 0.6693 0.3608  0.0562  0.1277  608 VAL A CG2 
583  N  N   . LEU A 76 ? 0.6133 0.7473 0.6536 0.3439  0.1207  0.0846  609 LEU A N   
584  C  CA  . LEU A 76 ? 0.6142 0.7259 0.6564 0.3293  0.1360  0.0617  609 LEU A CA  
585  C  C   . LEU A 76 ? 0.7733 0.8220 0.7957 0.3665  0.1589  0.0606  609 LEU A C   
586  O  O   . LEU A 76 ? 0.7927 0.8476 0.8227 0.3661  0.1718  0.0413  609 LEU A O   
587  C  CB  . LEU A 76 ? 0.5881 0.6505 0.6114 0.2806  0.1356  0.0479  609 LEU A CB  
588  C  CG  . LEU A 76 ? 0.5720 0.6874 0.6130 0.2432  0.1193  0.0428  609 LEU A CG  
589  C  CD1 . LEU A 76 ? 0.5622 0.6294 0.5811 0.2081  0.1175  0.0344  609 LEU A CD1 
590  C  CD2 . LEU A 76 ? 0.5491 0.7241 0.6156 0.2338  0.1231  0.0292  609 LEU A CD2 
591  N  N   . GLN A 77 ? 0.8028 0.7845 0.7954 0.3983  0.1671  0.0810  610 GLN A N   
592  C  CA  . GLN A 77 ? 0.8811 0.7807 0.8464 0.4364  0.1941  0.0816  610 GLN A CA  
593  C  C   . GLN A 77 ? 0.9286 0.8912 0.9204 0.4898  0.1991  0.0829  610 GLN A C   
594  O  O   . GLN A 77 ? 0.9069 0.9500 0.9214 0.5248  0.1838  0.1019  610 GLN A O   
595  C  CB  . GLN A 77 ? 0.9792 0.7882 0.9015 0.4592  0.2043  0.1090  610 GLN A CB  
596  C  CG  . GLN A 77 ? 1.2760 0.9648 1.1583 0.4840  0.2397  0.1049  610 GLN A CG  
597  C  CD  . GLN A 77 ? 1.7114 1.3136 1.5490 0.5207  0.2540  0.1401  610 GLN A CD  
598  O  OE1 . GLN A 77 ? 1.7432 1.2870 1.5523 0.4869  0.2567  0.1487  610 GLN A OE1 
599  N  NE2 . GLN A 77 ? 1.6691 1.2607 1.4970 0.5933  0.2655  0.1625  610 GLN A NE2 
600  N  N   . ALA A 78 ? 0.9167 0.8503 0.9059 0.4958  0.2206  0.0599  611 ALA A N   
601  C  CA  . ALA A 78 ? 0.9404 0.9298 0.9544 0.5463  0.2310  0.0554  611 ALA A CA  
602  C  C   . ALA A 78 ? 1.1062 1.0373 1.0950 0.6193  0.2476  0.0796  611 ALA A C   
603  O  O   . ALA A 78 ? 1.1752 0.9899 1.1167 0.6231  0.2610  0.0939  611 ALA A O   
604  C  CB  . ALA A 78 ? 0.9526 0.9213 0.9645 0.5262  0.2513  0.0212  611 ALA A CB  
605  N  N   . HIS A 79 ? 1.0796 1.0938 1.0994 0.6780  0.2489  0.0840  612 HIS A N   
606  C  CA  . HIS A 79 ? 1.2463 1.2270 1.2482 0.7631  0.2654  0.1068  612 HIS A CA  
607  C  C   . HIS A 79 ? 1.5609 1.5122 1.5632 0.7911  0.2964  0.0807  612 HIS A C   
608  O  O   . HIS A 79 ? 1.0906 1.1299 1.1329 0.7678  0.2948  0.0523  612 HIS A O   
609  C  CB  . HIS A 79 ? 1.2269 1.3507 1.2693 0.8146  0.2399  0.1297  612 HIS A CB  
610  N  N   . GLU B 5  ? 0.6489 1.8230 1.0653 0.0715  0.0082  -0.3289 538 GLU B N   
611  C  CA  . GLU B 5  ? 0.6502 1.7470 1.0450 0.0904  0.0145  -0.3101 538 GLU B CA  
612  C  C   . GLU B 5  ? 0.6918 1.6888 1.0557 0.1264  -0.0009 -0.2783 538 GLU B C   
613  O  O   . GLU B 5  ? 0.6938 1.6541 1.0432 0.1176  -0.0095 -0.2644 538 GLU B O   
614  C  CB  . GLU B 5  ? 0.6718 1.7187 1.0467 0.0354  0.0377  -0.3042 538 GLU B CB  
615  N  N   . THR B 6  ? 0.6253 1.5795 0.9779 0.1647  -0.0024 -0.2692 539 THR B N   
616  C  CA  . THR B 6  ? 0.6073 1.4638 0.9285 0.1931  -0.0126 -0.2409 539 THR B CA  
617  C  C   . THR B 6  ? 0.5770 1.3553 0.8732 0.1634  0.0004  -0.2274 539 THR B C   
618  O  O   . THR B 6  ? 0.5750 1.3675 0.8747 0.1529  0.0138  -0.2402 539 THR B O   
619  C  CB  . THR B 6  ? 0.7502 1.6075 1.0709 0.2561  -0.0230 -0.2416 539 THR B CB  
620  O  OG1 . THR B 6  ? 0.8027 1.7217 1.1371 0.2865  -0.0394 -0.2448 539 THR B OG1 
621  C  CG2 . THR B 6  ? 0.7311 1.4751 1.0142 0.2754  -0.0262 -0.2150 539 THR B CG2 
622  N  N   . LEU B 7  ? 0.4610 1.1661 0.7320 0.1507  -0.0038 -0.2027 540 LEU B N   
623  C  CA  . LEU B 7  ? 0.4263 1.0660 0.6732 0.1258  0.0050  -0.1883 540 LEU B CA  
624  C  C   . LEU B 7  ? 0.4584 1.0500 0.6904 0.1509  0.0044  -0.1845 540 LEU B C   
625  O  O   . LEU B 7  ? 0.4688 1.0159 0.6876 0.1761  -0.0052 -0.1711 540 LEU B O   
626  C  CB  . LEU B 7  ? 0.4066 0.9976 0.6350 0.1082  0.0003  -0.1660 540 LEU B CB  
627  C  CG  . LEU B 7  ? 0.4433 0.9787 0.6476 0.0848  0.0074  -0.1498 540 LEU B CG  
628  C  CD1 . LEU B 7  ? 0.4277 0.9820 0.6301 0.0545  0.0227  -0.1581 540 LEU B CD1 
629  C  CD2 . LEU B 7  ? 0.4725 0.9719 0.6622 0.0764  0.0020  -0.1307 540 LEU B CD2 
630  N  N   . THR B 8  ? 0.3863 0.9860 0.6174 0.1418  0.0163  -0.1979 541 THR B N   
631  C  CA  . THR B 8  ? 0.3914 0.9444 0.6056 0.1587  0.0186  -0.2009 541 THR B CA  
632  C  C   . THR B 8  ? 0.4120 0.9091 0.6010 0.1306  0.0205  -0.1838 541 THR B C   
633  O  O   . THR B 8  ? 0.3703 0.8743 0.5557 0.1014  0.0231  -0.1729 541 THR B O   
634  C  CB  . THR B 8  ? 0.4632 1.0614 0.6883 0.1644  0.0308  -0.2281 541 THR B CB  
635  O  OG1 . THR B 8  ? 0.3945 1.0158 0.6159 0.1240  0.0432  -0.2299 541 THR B OG1 
636  C  CG2 . THR B 8  ? 0.3971 1.0719 0.6529 0.1947  0.0291  -0.2484 541 THR B CG2 
637  N  N   . ALA B 9  ? 0.3979 0.8399 0.5674 0.1394  0.0199  -0.1827 542 ALA B N   
638  C  CA  . ALA B 9  ? 0.3861 0.7894 0.5340 0.1127  0.0211  -0.1713 542 ALA B CA  
639  C  C   . ALA B 9  ? 0.4163 0.8513 0.5596 0.0875  0.0311  -0.1804 542 ALA B C   
640  O  O   . ALA B 9  ? 0.3969 0.8280 0.5281 0.0643  0.0305  -0.1653 542 ALA B O   
641  C  CB  . ALA B 9  ? 0.4356 0.7793 0.5642 0.1222  0.0210  -0.1754 542 ALA B CB  
642  N  N   . SER B 10 ? 0.3940 0.8650 0.5456 0.0949  0.0406  -0.2039 543 SER B N   
643  C  CA  . SER B 10 ? 0.3936 0.8986 0.5368 0.0708  0.0521  -0.2119 543 SER B CA  
644  C  C   . SER B 10 ? 0.4221 0.9585 0.5697 0.0480  0.0561  -0.1973 543 SER B C   
645  O  O   . SER B 10 ? 0.4277 0.9626 0.5545 0.0244  0.0614  -0.1859 543 SER B O   
646  C  CB  . SER B 10 ? 0.4306 0.9714 0.5811 0.0845  0.0633  -0.2425 543 SER B CB  
647  O  OG  . SER B 10 ? 0.5682 1.1511 0.7469 0.1086  0.0639  -0.2549 543 SER B OG  
648  N  N   . ARG B 11 ? 0.3583 0.9194 0.5285 0.0549  0.0538  -0.1974 544 ARG B N   
649  C  CA  . ARG B 11 ? 0.3578 0.9392 0.5294 0.0287  0.0598  -0.1873 544 ARG B CA  
650  C  C   . ARG B 11 ? 0.3762 0.9065 0.5265 0.0176  0.0527  -0.1593 544 ARG B C   
651  O  O   . ARG B 11 ? 0.3816 0.9032 0.5118 -0.0057 0.0610  -0.1464 544 ARG B O   
652  C  CB  . ARG B 11 ? 0.3849 1.0137 0.5874 0.0365  0.0582  -0.2002 544 ARG B CB  
653  C  CG  . ARG B 11 ? 0.6469 1.2830 0.8495 0.0069  0.0630  -0.1919 544 ARG B CG  
654  C  CD  . ARG B 11 ? 0.9294 1.5873 1.1204 -0.0311 0.0834  -0.1950 544 ARG B CD  
655  N  NE  . ARG B 11 ? 1.1388 1.7636 1.3125 -0.0604 0.0888  -0.1794 544 ARG B NE  
656  C  CZ  . ARG B 11 ? 1.3306 1.8962 1.4668 -0.0746 0.0937  -0.1547 544 ARG B CZ  
657  N  NH1 . ARG B 11 ? 1.1384 1.6834 1.2528 -0.0658 0.0928  -0.1434 544 ARG B NH1 
658  N  NH2 . ARG B 11 ? 1.1777 1.7054 1.2958 -0.0964 0.0998  -0.1426 544 ARG B NH2 
659  N  N   . LEU B 12 ? 0.3093 0.8053 0.4606 0.0359  0.0388  -0.1494 545 LEU B N   
660  C  CA  . LEU B 12 ? 0.3034 0.7610 0.4379 0.0301  0.0319  -0.1258 545 LEU B CA  
661  C  C   . LEU B 12 ? 0.3810 0.8249 0.4901 0.0187  0.0344  -0.1166 545 LEU B C   
662  O  O   . LEU B 12 ? 0.3854 0.8160 0.4760 0.0086  0.0358  -0.0984 545 LEU B O   
663  C  CB  . LEU B 12 ? 0.2943 0.7265 0.4348 0.0498  0.0190  -0.1193 545 LEU B CB  
664  C  CG  . LEU B 12 ? 0.3377 0.7424 0.4655 0.0460  0.0125  -0.0972 545 LEU B CG  
665  C  CD1 . LEU B 12 ? 0.3281 0.7363 0.4602 0.0426  0.0126  -0.0920 545 LEU B CD1 
666  C  CD2 . LEU B 12 ? 0.3396 0.7203 0.4667 0.0585  0.0036  -0.0910 545 LEU B CD2 
667  N  N   . ALA B 13 ? 0.3448 0.7933 0.4505 0.0220  0.0354  -0.1305 546 ALA B N   
668  C  CA  . ALA B 13 ? 0.3596 0.8077 0.4418 0.0108  0.0362  -0.1272 546 ALA B CA  
669  C  C   . ALA B 13 ? 0.4135 0.8822 0.4760 -0.0052 0.0473  -0.1211 546 ALA B C   
670  O  O   . ALA B 13 ? 0.4340 0.9009 0.4713 -0.0114 0.0455  -0.1065 546 ALA B O   
671  C  CB  . ALA B 13 ? 0.3861 0.8335 0.4681 0.0150  0.0370  -0.1503 546 ALA B CB  
672  N  N   . SER B 14 ? 0.3652 0.8565 0.4372 -0.0118 0.0593  -0.1311 547 SER B N   
673  C  CA  . SER B 14 ? 0.3907 0.8981 0.4407 -0.0322 0.0744  -0.1250 547 SER B CA  
674  C  C   . SER B 14 ? 0.4723 0.9478 0.5038 -0.0425 0.0772  -0.0983 547 SER B C   
675  O  O   . SER B 14 ? 0.5131 0.9817 0.5129 -0.0586 0.0894  -0.0840 547 SER B O   
676  C  CB  . SER B 14 ? 0.4226 0.9739 0.4919 -0.0395 0.0885  -0.1491 547 SER B CB  
677  O  OG  . SER B 14 ? 0.5784 1.1357 0.6698 -0.0439 0.0905  -0.1505 547 SER B OG  
678  N  N   . ALA B 15 ? 0.4068 0.8578 0.4534 -0.0325 0.0673  -0.0915 548 ALA B N   
679  C  CA  . ALA B 15 ? 0.4127 0.8251 0.4417 -0.0379 0.0696  -0.0704 548 ALA B CA  
680  C  C   . ALA B 15 ? 0.4885 0.8726 0.4888 -0.0242 0.0606  -0.0455 548 ALA B C   
681  O  O   . ALA B 15 ? 0.4513 0.8499 0.4593 -0.0109 0.0480  -0.0482 548 ALA B O   
682  C  CB  . ALA B 15 ? 0.3864 0.7934 0.4429 -0.0305 0.0621  -0.0776 548 ALA B CB  
683  N  N   . PRO B 16 ? 0.4914 0.8357 0.4572 -0.0263 0.0672  -0.0219 549 PRO B N   
684  C  CA  . PRO B 16 ? 0.4890 0.8168 0.4293 -0.0047 0.0568  0.0015  549 PRO B CA  
685  C  C   . PRO B 16 ? 0.4417 0.7733 0.4079 0.0145  0.0406  -0.0008 549 PRO B C   
686  O  O   . PRO B 16 ? 0.4210 0.7419 0.4097 0.0127  0.0404  -0.0105 549 PRO B O   
687  C  CB  . PRO B 16 ? 0.5739 0.8444 0.4728 -0.0059 0.0691  0.0254  549 PRO B CB  
688  C  CG  . PRO B 16 ? 0.6595 0.9223 0.5551 -0.0383 0.0892  0.0149  549 PRO B CG  
689  C  CD  . PRO B 16 ? 0.5503 0.8600 0.4970 -0.0473 0.0850  -0.0164 549 PRO B CD  
690  N  N   . PRO B 17 ? 0.3607 0.7139 0.3235 0.0308  0.0277  0.0070  550 PRO B N   
691  C  CA  . PRO B 17 ? 0.3218 0.6834 0.3081 0.0446  0.0151  0.0050  550 PRO B CA  
692  C  C   . PRO B 17 ? 0.3936 0.7176 0.3753 0.0572  0.0167  0.0159  550 PRO B C   
693  O  O   . PRO B 17 ? 0.3560 0.6819 0.3618 0.0606  0.0115  0.0077  550 PRO B O   
694  C  CB  . PRO B 17 ? 0.3428 0.7404 0.3187 0.0561  0.0042  0.0135  550 PRO B CB  
695  C  CG  . PRO B 17 ? 0.4140 0.8318 0.3720 0.0440  0.0086  0.0093  550 PRO B CG  
696  C  CD  . PRO B 17 ? 0.3896 0.7698 0.3270 0.0351  0.0242  0.0162  550 PRO B CD  
697  N  N   . GLN B 18 ? 0.4035 0.6870 0.3499 0.0630  0.0258  0.0334  551 GLN B N   
698  C  CA  . GLN B 18 ? 0.4182 0.6537 0.3528 0.0742  0.0303  0.0409  551 GLN B CA  
699  C  C   . GLN B 18 ? 0.4771 0.7000 0.4347 0.0546  0.0362  0.0210  551 GLN B C   
700  O  O   . GLN B 18 ? 0.4941 0.6945 0.4538 0.0639  0.0354  0.0191  551 GLN B O   
701  C  CB  . GLN B 18 ? 0.4954 0.6729 0.3796 0.0801  0.0432  0.0625  551 GLN B CB  
702  C  CG  . GLN B 18 ? 0.4732 0.6611 0.3265 0.1100  0.0359  0.0869  551 GLN B CG  
703  C  CD  . GLN B 18 ? 0.6188 0.8335 0.4553 0.0980  0.0380  0.0925  551 GLN B CD  
704  O  OE1 . GLN B 18 ? 0.5751 0.8283 0.4371 0.0728  0.0382  0.0731  551 GLN B OE1 
705  N  NE2 . GLN B 18 ? 0.5591 0.7569 0.3494 0.1206  0.0388  0.1191  551 GLN B NE2 
706  N  N   . LYS B 19 ? 0.4300 0.6743 0.4051 0.0299  0.0417  0.0043  552 LYS B N   
707  C  CA  . LYS B 19 ? 0.4330 0.6795 0.4307 0.0117  0.0469  -0.0164 552 LYS B CA  
708  C  C   . LYS B 19 ? 0.4436 0.7346 0.4812 0.0166  0.0348  -0.0336 552 LYS B C   
709  O  O   . LYS B 19 ? 0.4305 0.7306 0.4863 0.0099  0.0350  -0.0489 552 LYS B O   
710  C  CB  . LYS B 19 ? 0.4937 0.7418 0.4844 -0.0183 0.0633  -0.0254 552 LYS B CB  
711  C  CG  . LYS B 19 ? 0.8437 1.0359 0.7865 -0.0297 0.0802  -0.0066 552 LYS B CG  
712  C  CD  . LYS B 19 ? 1.0787 1.2076 0.9993 -0.0333 0.0888  -0.0037 552 LYS B CD  
713  C  CE  . LYS B 19 ? 1.3316 1.3895 1.1962 -0.0202 0.0982  0.0255  552 LYS B CE  
714  N  NZ  . LYS B 19 ? 1.4675 1.4907 1.3213 0.0141  0.0892  0.0354  552 LYS B NZ  
715  N  N   . GLN B 20 ? 0.3751 0.6914 0.4225 0.0278  0.0250  -0.0314 553 GLN B N   
716  C  CA  . GLN B 20 ? 0.3362 0.6798 0.4121 0.0329  0.0163  -0.0447 553 GLN B CA  
717  C  C   . GLN B 20 ? 0.3512 0.6922 0.4398 0.0447  0.0083  -0.0453 553 GLN B C   
718  O  O   . GLN B 20 ? 0.3403 0.6976 0.4472 0.0458  0.0058  -0.0583 553 GLN B O   
719  C  CB  . GLN B 20 ? 0.3394 0.6980 0.4156 0.0370  0.0104  -0.0430 553 GLN B CB  
720  C  CG  . GLN B 20 ? 0.2898 0.6619 0.3577 0.0250  0.0181  -0.0501 553 GLN B CG  
721  C  CD  . GLN B 20 ? 0.3804 0.7675 0.4432 0.0252  0.0131  -0.0515 553 GLN B CD  
722  O  OE1 . GLN B 20 ? 0.3965 0.7863 0.4598 0.0310  0.0046  -0.0449 553 GLN B OE1 
723  N  NE2 . GLN B 20 ? 0.3056 0.7079 0.3610 0.0159  0.0194  -0.0613 553 GLN B NE2 
724  N  N   . LYS B 21 ? 0.2956 0.6231 0.3740 0.0562  0.0042  -0.0321 554 LYS B N   
725  C  CA  . LYS B 21 ? 0.2795 0.6086 0.3667 0.0662  -0.0017 -0.0334 554 LYS B CA  
726  C  C   . LYS B 21 ? 0.3729 0.6936 0.4607 0.0592  0.0030  -0.0455 554 LYS B C   
727  O  O   . LYS B 21 ? 0.3461 0.6842 0.4473 0.0629  -0.0024 -0.0548 554 LYS B O   
728  C  CB  . LYS B 21 ? 0.2846 0.6102 0.3619 0.0804  -0.0052 -0.0196 554 LYS B CB  
729  C  CG  . LYS B 21 ? 0.3087 0.6570 0.3904 0.0822  -0.0106 -0.0121 554 LYS B CG  
730  C  CD  . LYS B 21 ? 0.2537 0.6119 0.3497 0.0784  -0.0150 -0.0165 554 LYS B CD  
731  C  CE  . LYS B 21 ? 0.2505 0.6265 0.3474 0.0727  -0.0174 -0.0112 554 LYS B CE  
732  N  NZ  . LYS B 21 ? 0.3145 0.6816 0.4167 0.0660  -0.0180 -0.0144 554 LYS B NZ  
733  N  N   . GLN B 22 ? 0.3950 0.6890 0.4651 0.0472  0.0138  -0.0459 555 GLN B N   
734  C  CA  . GLN B 22 ? 0.4329 0.7153 0.5002 0.0308  0.0217  -0.0612 555 GLN B CA  
735  C  C   . GLN B 22 ? 0.4775 0.8052 0.5715 0.0181  0.0202  -0.0808 555 GLN B C   
736  O  O   . GLN B 22 ? 0.4809 0.8314 0.5877 0.0167  0.0159  -0.0958 555 GLN B O   
737  C  CB  . GLN B 22 ? 0.5081 0.7419 0.5443 0.0156  0.0373  -0.0551 555 GLN B CB  
738  C  CG  . GLN B 22 ? 0.8123 1.0224 0.8394 -0.0098 0.0495  -0.0731 555 GLN B CG  
739  C  CD  . GLN B 22 ? 1.1463 1.3401 1.1688 0.0011  0.0455  -0.0809 555 GLN B CD  
740  O  OE1 . GLN B 22 ? 1.1370 1.2874 1.1351 0.0211  0.0468  -0.0676 555 GLN B OE1 
741  N  NE2 . GLN B 22 ? 1.0312 1.2651 1.0760 -0.0091 0.0402  -0.1037 555 GLN B NE2 
742  N  N   . MSE B 23 ? 0.4152 0.7627 0.5174 0.0128  0.0228  -0.0817 556 MSE B N   
743  C  CA  . MSE B 23 ? 0.4017 0.7986 0.5301 0.0079  0.0218  -0.1008 556 MSE B CA  
744  C  C   . MSE B 23 ? 0.4115 0.8354 0.5586 0.0323  0.0070  -0.1038 556 MSE B C   
745  O  O   . MSE B 23 ? 0.4089 0.8745 0.5748 0.0340  0.0031  -0.1205 556 MSE B O   
746  C  CB  . MSE B 23 ? 0.4357 0.8452 0.5654 0.0035  0.0277  -0.1008 556 MSE B CB  
747  C  CG  . MSE B 23 ? 0.5654 0.9603 0.6764 -0.0239 0.0447  -0.1002 556 MSE B CG  
748  SE SE  . MSE B 23 ? 0.6733 1.0908 0.7823 -0.0256 0.0510  -0.1005 556 MSE B SE  
749  C  CE  . MSE B 23 ? 0.6041 1.0999 0.7548 -0.0273 0.0528  -0.1340 556 MSE B CE  
750  N  N   . LEU B 24 ? 0.3414 0.7448 0.4817 0.0505  -0.0008 -0.0874 557 LEU B N   
751  C  CA  . LEU B 24 ? 0.3241 0.7396 0.4731 0.0725  -0.0123 -0.0854 557 LEU B CA  
752  C  C   . LEU B 24 ? 0.3931 0.8171 0.5408 0.0773  -0.0181 -0.0876 557 LEU B C   
753  O  O   . LEU B 24 ? 0.3964 0.8496 0.5538 0.0919  -0.0265 -0.0938 557 LEU B O   
754  C  CB  . LEU B 24 ? 0.3057 0.6945 0.4445 0.0818  -0.0156 -0.0686 557 LEU B CB  
755  C  CG  . LEU B 24 ? 0.3418 0.7266 0.4819 0.0801  -0.0123 -0.0715 557 LEU B CG  
756  C  CD1 . LEU B 24 ? 0.3359 0.6978 0.4633 0.0768  -0.0127 -0.0582 557 LEU B CD1 
757  C  CD2 . LEU B 24 ? 0.3399 0.7346 0.4899 0.0981  -0.0162 -0.0805 557 LEU B CD2 
758  N  N   . GLY B 25 ? 0.3757 0.7756 0.5091 0.0675  -0.0133 -0.0838 558 GLY B N   
759  C  CA  . GLY B 25 ? 0.3936 0.7975 0.5215 0.0695  -0.0164 -0.0898 558 GLY B CA  
760  C  C   . GLY B 25 ? 0.4742 0.9161 0.6149 0.0569  -0.0165 -0.1142 558 GLY B C   
761  O  O   . GLY B 25 ? 0.4775 0.9510 0.6225 0.0672  -0.0258 -0.1219 558 GLY B O   
762  N  N   . GLU B 26 ? 0.4522 0.8985 0.5983 0.0331  -0.0059 -0.1269 559 GLU B N   
763  C  CA  . GLU B 26 ? 0.4618 0.9550 0.6236 0.0121  -0.0029 -0.1541 559 GLU B CA  
764  C  C   . GLU B 26 ? 0.4984 1.0606 0.6863 0.0333  -0.0163 -0.1636 559 GLU B C   
765  O  O   . GLU B 26 ? 0.4974 1.1147 0.6988 0.0277  -0.0214 -0.1853 559 GLU B O   
766  C  CB  . GLU B 26 ? 0.4978 0.9806 0.6577 -0.0199 0.0143  -0.1617 559 GLU B CB  
767  C  CG  . GLU B 26 ? 0.6827 1.0965 0.8109 -0.0426 0.0291  -0.1571 559 GLU B CG  
768  C  CD  . GLU B 26 ? 1.0175 1.3958 1.1284 -0.0698 0.0481  -0.1523 559 GLU B CD  
769  O  OE1 . GLU B 26 ? 1.1598 1.5624 1.2815 -0.0681 0.0498  -0.1473 559 GLU B OE1 
770  O  OE2 . GLU B 26 ? 0.8640 1.1824 0.9447 -0.0905 0.0623  -0.1516 559 GLU B OE2 
771  N  N   . ARG B 27 ? 0.4509 1.0093 0.6431 0.0589  -0.0219 -0.1482 560 ARG B N   
772  C  CA  . ARG B 27 ? 0.4503 1.0586 0.6597 0.0885  -0.0340 -0.1528 560 ARG B CA  
773  C  C   . ARG B 27 ? 0.5227 1.1252 0.7197 0.1175  -0.0479 -0.1382 560 ARG B C   
774  O  O   . ARG B 27 ? 0.5274 1.1818 0.7334 0.1395  -0.0597 -0.1460 560 ARG B O   
775  C  CB  . ARG B 27 ? 0.4470 1.0418 0.6604 0.1033  -0.0312 -0.1452 560 ARG B CB  
776  C  CG  . ARG B 27 ? 0.5701 1.1645 0.7892 0.0769  -0.0161 -0.1544 560 ARG B CG  
777  C  CD  . ARG B 27 ? 0.6313 1.2907 0.8720 0.0542  -0.0090 -0.1814 560 ARG B CD  
778  N  NE  . ARG B 27 ? 0.7171 1.3910 0.9655 0.0405  0.0042  -0.1898 560 ARG B NE  
779  C  CZ  . ARG B 27 ? 0.8822 1.6141 1.1535 0.0590  0.0029  -0.2056 560 ARG B CZ  
780  N  NH1 . ARG B 27 ? 0.6133 1.3890 0.9000 0.0960  -0.0122 -0.2116 560 ARG B NH1 
781  N  NH2 . ARG B 27 ? 0.8225 1.5705 1.0988 0.0442  0.0170  -0.2148 560 ARG B NH2 
782  N  N   . LEU B 28 ? 0.4848 1.0301 0.6600 0.1193  -0.0465 -0.1164 561 LEU B N   
783  C  CA  . LEU B 28 ? 0.4960 1.0311 0.6547 0.1423  -0.0561 -0.0995 561 LEU B CA  
784  C  C   . LEU B 28 ? 0.5675 1.1361 0.7219 0.1398  -0.0622 -0.1110 561 LEU B C   
785  O  O   . LEU B 28 ? 0.5703 1.1672 0.7181 0.1642  -0.0740 -0.1062 561 LEU B O   
786  C  CB  . LEU B 28 ? 0.4909 0.9686 0.6309 0.1384  -0.0504 -0.0771 561 LEU B CB  
787  C  CG  . LEU B 28 ? 0.5561 1.0006 0.6921 0.1467  -0.0481 -0.0625 561 LEU B CG  
788  C  CD1 . LEU B 28 ? 0.5614 0.9674 0.6861 0.1319  -0.0407 -0.0488 561 LEU B CD1 
789  C  CD2 . LEU B 28 ? 0.5881 1.0265 0.7118 0.1752  -0.0560 -0.0490 561 LEU B CD2 
790  N  N   . PHE B 29 ? 0.5438 1.1040 0.6967 0.1117  -0.0537 -0.1255 562 PHE B N   
791  C  CA  . PHE B 29 ? 0.5778 1.1604 0.7226 0.1043  -0.0568 -0.1412 562 PHE B CA  
792  C  C   . PHE B 29 ? 0.6410 1.3030 0.7995 0.1129  -0.0697 -0.1619 562 PHE B C   
793  O  O   . PHE B 29 ? 0.6403 1.3256 0.7853 0.1300  -0.0801 -0.1592 562 PHE B O   
794  C  CB  . PHE B 29 ? 0.6274 1.1783 0.7659 0.0707  -0.0425 -0.1582 562 PHE B CB  
795  C  CG  . PHE B 29 ? 0.6822 1.2468 0.8077 0.0633  -0.0443 -0.1773 562 PHE B CG  
796  C  CD1 . PHE B 29 ? 0.7375 1.2725 0.8407 0.0775  -0.0445 -0.1649 562 PHE B CD1 
797  C  CD2 . PHE B 29 ? 0.7381 1.3549 0.8742 0.0417  -0.0459 -0.2106 562 PHE B CD2 
798  C  CE1 . PHE B 29 ? 0.7782 1.3289 0.8672 0.0727  -0.0459 -0.1853 562 PHE B CE1 
799  C  CE2 . PHE B 29 ? 0.8065 1.4397 0.9286 0.0336  -0.0482 -0.2323 562 PHE B CE2 
800  C  CZ  . PHE B 29 ? 0.7914 1.3882 0.8885 0.0504  -0.0480 -0.2195 562 PHE B CZ  
801  N  N   . PRO B 30 ? 0.6031 1.3163 0.7871 0.1022  -0.0696 -0.1832 563 PRO B N   
802  C  CA  . PRO B 30 ? 0.6021 1.4072 0.8012 0.1136  -0.0839 -0.2046 563 PRO B CA  
803  C  C   . PRO B 30 ? 0.6270 1.4544 0.8180 0.1640  -0.1011 -0.1823 563 PRO B C   
804  O  O   . PRO B 30 ? 0.6496 1.5367 0.8359 0.1807  -0.1154 -0.1901 563 PRO B O   
805  C  CB  . PRO B 30 ? 0.6214 1.4763 0.8520 0.0944  -0.0777 -0.2280 563 PRO B CB  
806  C  CG  . PRO B 30 ? 0.6857 1.4689 0.9108 0.0610  -0.0576 -0.2238 563 PRO B CG  
807  C  CD  . PRO B 30 ? 0.6235 1.3243 0.8234 0.0802  -0.0566 -0.1896 563 PRO B CD  
808  N  N   . LEU B 31 ? 0.5503 1.3266 0.7349 0.1872  -0.0990 -0.1548 564 LEU B N   
809  C  CA  . LEU B 31 ? 0.5651 1.3376 0.7331 0.2344  -0.1111 -0.1295 564 LEU B CA  
810  C  C   . LEU B 31 ? 0.6470 1.3867 0.7808 0.2445  -0.1150 -0.1069 564 LEU B C   
811  O  O   . LEU B 31 ? 0.6820 1.4549 0.7991 0.2775  -0.1288 -0.0969 564 LEU B O   
812  C  CB  . LEU B 31 ? 0.5680 1.2801 0.7339 0.2479  -0.1037 -0.1103 564 LEU B CB  
813  C  CG  . LEU B 31 ? 0.6159 1.3646 0.8119 0.2493  -0.1004 -0.1299 564 LEU B CG  
814  C  CD1 . LEU B 31 ? 0.6222 1.3006 0.8101 0.2576  -0.0911 -0.1132 564 LEU B CD1 
815  C  CD2 . LEU B 31 ? 0.6456 1.4798 0.8553 0.2890  -0.1160 -0.1418 564 LEU B CD2 
816  N  N   . ILE B 32 ? 0.5956 1.2765 0.7175 0.2182  -0.1027 -0.0988 565 ILE B N   
817  C  CA  . ILE B 32 ? 0.6058 1.2603 0.6972 0.2229  -0.1028 -0.0798 565 ILE B CA  
818  C  C   . ILE B 32 ? 0.6625 1.3801 0.7496 0.2200  -0.1119 -0.1017 565 ILE B C   
819  O  O   . ILE B 32 ? 0.6587 1.3956 0.7206 0.2436  -0.1213 -0.0878 565 ILE B O   
820  C  CB  . ILE B 32 ? 0.6242 1.2146 0.7098 0.1981  -0.0874 -0.0701 565 ILE B CB  
821  C  CG1 . ILE B 32 ? 0.6271 1.1635 0.7119 0.2029  -0.0808 -0.0479 565 ILE B CG1 
822  C  CG2 . ILE B 32 ? 0.6384 1.2192 0.6973 0.1994  -0.0856 -0.0583 565 ILE B CG2 
823  C  CD1 . ILE B 32 ? 0.6794 1.1689 0.7659 0.1788  -0.0674 -0.0424 565 ILE B CD1 
824  N  N   . GLN B 33 ? 0.6328 1.3820 0.7411 0.1896  -0.1082 -0.1366 566 GLN B N   
825  C  CA  . GLN B 33 ? 0.6577 1.4671 0.7639 0.1776  -0.1148 -0.1665 566 GLN B CA  
826  C  C   . GLN B 33 ? 0.7639 1.6598 0.8711 0.2092  -0.1352 -0.1704 566 GLN B C   
827  O  O   . GLN B 33 ? 0.7711 1.7108 0.8600 0.2159  -0.1447 -0.1785 566 GLN B O   
828  C  CB  . GLN B 33 ? 0.6679 1.4854 0.7959 0.1342  -0.1039 -0.2035 566 GLN B CB  
829  C  CG  . GLN B 33 ? 0.7479 1.6136 0.8704 0.1115  -0.1065 -0.2402 566 GLN B CG  
830  C  CD  . GLN B 33 ? 0.8567 1.7123 0.9941 0.0630  -0.0915 -0.2750 566 GLN B CD  
831  O  OE1 . GLN B 33 ? 0.7829 1.5972 0.9028 0.0364  -0.0798 -0.2931 566 GLN B OE1 
832  N  NE2 . GLN B 33 ? 0.7130 1.6014 0.8796 0.0504  -0.0895 -0.2850 566 GLN B NE2 
833  N  N   . ALA B 34 ? 0.7579 1.6795 0.8833 0.2329  -0.1421 -0.1638 567 ALA B N   
834  C  CA  . ALA B 34 ? 0.7918 1.7974 0.9178 0.2736  -0.1626 -0.1642 567 ALA B CA  
835  C  C   . ALA B 34 ? 0.9151 1.8999 0.9970 0.3157  -0.1727 -0.1267 567 ALA B C   
836  O  O   . ALA B 34 ? 0.9410 2.0018 1.0105 0.3398  -0.1899 -0.1322 567 ALA B O   
837  C  CB  . ALA B 34 ? 0.7943 1.8171 0.9459 0.2958  -0.1647 -0.1624 567 ALA B CB  
838  N  N   . MSE B 35 ? 0.8958 1.7834 0.9521 0.3218  -0.1614 -0.0899 568 MSE B N   
839  C  CA  . MSE B 35 ? 0.9453 1.8031 0.9549 0.3552  -0.1663 -0.0514 568 MSE B CA  
840  C  C   . MSE B 35 ? 0.9893 1.8229 0.9732 0.3317  -0.1576 -0.0468 568 MSE B C   
841  O  O   . MSE B 35 ? 1.0327 1.8670 0.9764 0.3547  -0.1627 -0.0219 568 MSE B O   
842  C  CB  . MSE B 35 ? 1.0057 1.7756 0.9975 0.3776  -0.1585 -0.0134 568 MSE B CB  
843  C  CG  . MSE B 35 ? 1.0767 1.7642 1.0783 0.3408  -0.1379 -0.0083 568 MSE B CG  
844  SE SE  . MSE B 35 ? 1.2278 1.8167 1.2158 0.3613  -0.1282 0.0243  568 MSE B SE  
845  C  CE  . MSE B 35 ? 1.1494 1.7915 1.1916 0.3644  -0.1327 -0.0129 568 MSE B CE  
846  N  N   . HIS B 36 ? 0.8925 1.7050 0.8961 0.2893  -0.1440 -0.0699 569 HIS B N   
847  C  CA  . HIS B 36 ? 0.8812 1.6729 0.8650 0.2691  -0.1339 -0.0712 569 HIS B CA  
848  C  C   . HIS B 36 ? 0.9156 1.7221 0.9230 0.2317  -0.1269 -0.1136 569 HIS B C   
849  O  O   . HIS B 36 ? 0.8912 1.6404 0.9079 0.2092  -0.1115 -0.1145 569 HIS B O   
850  C  CB  . HIS B 36 ? 0.8798 1.5889 0.8514 0.2630  -0.1178 -0.0394 569 HIS B CB  
851  C  CG  . HIS B 36 ? 0.9559 1.6516 0.8854 0.2792  -0.1160 -0.0075 569 HIS B CG  
852  N  ND1 . HIS B 36 ? 0.9858 1.6993 0.8966 0.2690  -0.1106 -0.0146 569 HIS B ND1 
853  C  CD2 . HIS B 36 ? 1.0177 1.6791 0.9175 0.3031  -0.1165 0.0312  569 HIS B CD2 
854  C  CE1 . HIS B 36 ? 1.0200 1.7182 0.8918 0.2850  -0.1081 0.0206  569 HIS B CE1 
855  N  NE2 . HIS B 36 ? 1.0485 1.7097 0.9102 0.3045  -0.1110 0.0502  569 HIS B NE2 
856  N  N   . PRO B 37 ? 0.8848 1.7650 0.8989 0.2237  -0.1372 -0.1495 570 PRO B N   
857  C  CA  . PRO B 37 ? 0.8748 1.7539 0.9070 0.1827  -0.1272 -0.1914 570 PRO B CA  
858  C  C   . PRO B 37 ? 0.9322 1.7601 0.9438 0.1664  -0.1122 -0.1970 570 PRO B C   
859  O  O   . PRO B 37 ? 0.9301 1.7183 0.9513 0.1367  -0.0984 -0.2200 570 PRO B O   
860  C  CB  . PRO B 37 ? 0.9110 1.8884 0.9493 0.1779  -0.1424 -0.2283 570 PRO B CB  
861  C  CG  . PRO B 37 ? 0.9852 2.0120 0.9970 0.2204  -0.1602 -0.2035 570 PRO B CG  
862  C  CD  . PRO B 37 ? 0.9219 1.8905 0.9271 0.2504  -0.1582 -0.1551 570 PRO B CD  
863  N  N   . THR B 38 ? 0.8946 1.7213 0.8754 0.1879  -0.1136 -0.1743 571 THR B N   
864  C  CA  . THR B 38 ? 0.9026 1.6985 0.8608 0.1819  -0.1008 -0.1781 571 THR B CA  
865  C  C   . THR B 38 ? 0.9327 1.6488 0.9018 0.1710  -0.0826 -0.1657 571 THR B C   
866  O  O   . THR B 38 ? 0.9397 1.6236 0.9184 0.1489  -0.0724 -0.1921 571 THR B O   
867  C  CB  . THR B 38 ? 0.9865 1.8118 0.9093 0.2085  -0.1065 -0.1521 571 THR B CB  
868  O  OG1 . THR B 38 ? 0.9998 1.7968 0.9039 0.2051  -0.0914 -0.1515 571 THR B OG1 
869  C  CG2 . THR B 38 ? 0.9470 1.7581 0.8627 0.2335  -0.1119 -0.1049 571 THR B CG2 
870  N  N   . LEU B 39 ? 0.8523 1.5369 0.8172 0.1852  -0.0781 -0.1269 572 LEU B N   
871  C  CA  . LEU B 39 ? 0.8260 1.4525 0.8009 0.1771  -0.0633 -0.1166 572 LEU B CA  
872  C  C   . LEU B 39 ? 0.8447 1.4418 0.8448 0.1714  -0.0640 -0.1036 572 LEU B C   
873  O  O   . LEU B 39 ? 0.8372 1.4003 0.8414 0.1730  -0.0572 -0.0795 572 LEU B O   
874  C  CB  . LEU B 39 ? 0.8304 1.4505 0.7866 0.1892  -0.0556 -0.0887 572 LEU B CB  
875  C  CG  . LEU B 39 ? 0.9129 1.5654 0.8427 0.1959  -0.0523 -0.1017 572 LEU B CG  
876  C  CD1 . LEU B 39 ? 0.9265 1.6072 0.8300 0.2100  -0.0549 -0.0710 572 LEU B CD1 
877  C  CD2 . LEU B 39 ? 0.9507 1.5776 0.8803 0.1942  -0.0368 -0.1136 572 LEU B CD2 
878  N  N   . ALA B 40 ? 0.7749 1.3919 0.7924 0.1620  -0.0713 -0.1236 573 ALA B N   
879  C  CA  . ALA B 40 ? 0.7368 1.3382 0.7787 0.1561  -0.0719 -0.1182 573 ALA B CA  
880  C  C   . ALA B 40 ? 0.7413 1.2853 0.7915 0.1413  -0.0578 -0.1148 573 ALA B C   
881  O  O   . ALA B 40 ? 0.7037 1.2242 0.7641 0.1436  -0.0560 -0.0952 573 ALA B O   
882  C  CB  . ALA B 40 ? 0.7490 1.3956 0.8083 0.1435  -0.0791 -0.1487 573 ALA B CB  
883  N  N   . GLY B 41 ? 0.6928 1.2134 0.7350 0.1282  -0.0480 -0.1346 574 GLY B N   
884  C  CA  . GLY B 41 ? 0.6807 1.1457 0.7229 0.1201  -0.0349 -0.1311 574 GLY B CA  
885  C  C   . GLY B 41 ? 0.6973 1.1459 0.7356 0.1361  -0.0316 -0.1022 574 GLY B C   
886  O  O   . GLY B 41 ? 0.6985 1.1210 0.7457 0.1336  -0.0275 -0.0881 574 GLY B O   
887  N  N   . LYS B 42 ? 0.6205 1.0921 0.6451 0.1503  -0.0330 -0.0942 575 LYS B N   
888  C  CA  . LYS B 42 ? 0.5889 1.0595 0.6102 0.1606  -0.0284 -0.0694 575 LYS B CA  
889  C  C   . LYS B 42 ? 0.5738 1.0455 0.6044 0.1588  -0.0333 -0.0452 575 LYS B C   
890  O  O   . LYS B 42 ? 0.5616 1.0174 0.6000 0.1553  -0.0284 -0.0312 575 LYS B O   
891  C  CB  . LYS B 42 ? 0.6229 1.1240 0.6252 0.1722  -0.0265 -0.0687 575 LYS B CB  
892  C  CG  . LYS B 42 ? 0.6795 1.1703 0.6718 0.1798  -0.0167 -0.0871 575 LYS B CG  
893  C  CD  . LYS B 42 ? 0.7890 1.3172 0.7632 0.1919  -0.0130 -0.0867 575 LYS B CD  
894  C  CE  . LYS B 42 ? 1.0134 1.5293 0.9758 0.2044  -0.0027 -0.1102 575 LYS B CE  
895  N  NZ  . LYS B 42 ? 1.1458 1.7050 1.0937 0.2189  0.0042  -0.1081 575 LYS B NZ  
896  N  N   . ILE B 43 ? 0.4910 0.9806 0.5189 0.1628  -0.0428 -0.0419 576 ILE B N   
897  C  CA  . ILE B 43 ? 0.4701 0.9488 0.5002 0.1656  -0.0464 -0.0202 576 ILE B CA  
898  C  C   . ILE B 43 ? 0.4764 0.9299 0.5275 0.1553  -0.0446 -0.0236 576 ILE B C   
899  O  O   . ILE B 43 ? 0.4659 0.8979 0.5191 0.1506  -0.0405 -0.0077 576 ILE B O   
900  C  CB  . ILE B 43 ? 0.5200 1.0227 0.5393 0.1810  -0.0581 -0.0170 576 ILE B CB  
901  C  CG1 . ILE B 43 ? 0.5464 1.0738 0.5379 0.1913  -0.0589 -0.0082 576 ILE B CG1 
902  C  CG2 . ILE B 43 ? 0.5227 0.9989 0.5403 0.1887  -0.0603 0.0042  576 ILE B CG2 
903  C  CD1 . ILE B 43 ? 0.6372 1.2036 0.6143 0.2100  -0.0728 -0.0116 576 ILE B CD1 
904  N  N   . THR B 44 ? 0.4216 0.8789 0.4856 0.1481  -0.0460 -0.0457 577 THR B N   
905  C  CA  . THR B 44 ? 0.4115 0.8496 0.4919 0.1367  -0.0427 -0.0504 577 THR B CA  
906  C  C   . THR B 44 ? 0.4482 0.8590 0.5275 0.1307  -0.0340 -0.0397 577 THR B C   
907  O  O   . THR B 44 ? 0.4229 0.8210 0.5085 0.1267  -0.0327 -0.0292 577 THR B O   
908  C  CB  . THR B 44 ? 0.5187 0.9670 0.6080 0.1239  -0.0418 -0.0765 577 THR B CB  
909  O  OG1 . THR B 44 ? 0.5358 1.0270 0.6299 0.1309  -0.0521 -0.0877 577 THR B OG1 
910  C  CG2 . THR B 44 ? 0.4518 0.8819 0.5541 0.1095  -0.0358 -0.0803 577 THR B CG2 
911  N  N   . GLY B 45 ? 0.4075 0.8135 0.4772 0.1328  -0.0286 -0.0439 578 GLY B N   
912  C  CA  . GLY B 45 ? 0.4011 0.7927 0.4686 0.1347  -0.0218 -0.0347 578 GLY B CA  
913  C  C   . GLY B 45 ? 0.4235 0.8288 0.4938 0.1349  -0.0220 -0.0155 578 GLY B C   
914  O  O   . GLY B 45 ? 0.4156 0.8166 0.4918 0.1300  -0.0197 -0.0084 578 GLY B O   
915  N  N   . MSE B 46 ? 0.3637 0.7860 0.4264 0.1380  -0.0239 -0.0075 579 MSE B N   
916  C  CA  A MSE B 46 ? 0.3348 0.7645 0.3946 0.1313  -0.0208 0.0107  579 MSE B CA  
917  C  CA  B MSE B 46 ? 0.3661 0.7960 0.4258 0.1314  -0.0207 0.0107  579 MSE B CA  
918  C  C   . MSE B 46 ? 0.4071 0.8135 0.4724 0.1208  -0.0225 0.0168  579 MSE B C   
919  O  O   . MSE B 46 ? 0.3990 0.8042 0.4689 0.1081  -0.0183 0.0230  579 MSE B O   
920  C  CB  A MSE B 46 ? 0.3598 0.8038 0.4021 0.1363  -0.0205 0.0198  579 MSE B CB  
921  C  CB  B MSE B 46 ? 0.4153 0.8600 0.4575 0.1364  -0.0204 0.0197  579 MSE B CB  
922  C  CG  A MSE B 46 ? 0.4264 0.8978 0.4614 0.1464  -0.0171 0.0115  579 MSE B CG  
923  C  CG  B MSE B 46 ? 0.5293 0.9784 0.5634 0.1232  -0.0127 0.0388  579 MSE B CG  
924  SE SE  A MSE B 46 ? 0.5264 1.0202 0.5348 0.1568  -0.0198 0.0152  579 MSE B SE  
925  SE SE  B MSE B 46 ? 0.6810 1.1533 0.6854 0.1247  -0.0060 0.0554  579 MSE B SE  
926  C  CE  A MSE B 46 ? 0.5007 1.0057 0.4971 0.1419  -0.0076 0.0430  579 MSE B CE  
927  C  CE  B MSE B 46 ? 0.6260 1.1429 0.6344 0.1428  -0.0049 0.0340  579 MSE B CE  
928  N  N   . LEU B 47 ? 0.3765 0.7695 0.4412 0.1273  -0.0288 0.0125  580 LEU B N   
929  C  CA  . LEU B 47 ? 0.3861 0.7542 0.4536 0.1240  -0.0301 0.0152  580 LEU B CA  
930  C  C   . LEU B 47 ? 0.4031 0.7656 0.4858 0.1135  -0.0280 0.0053  580 LEU B C   
931  O  O   . LEU B 47 ? 0.3988 0.7425 0.4822 0.1057  -0.0260 0.0073  580 LEU B O   
932  C  CB  . LEU B 47 ? 0.3986 0.7670 0.4636 0.1412  -0.0381 0.0110  580 LEU B CB  
933  C  CG  . LEU B 47 ? 0.4813 0.8538 0.5241 0.1566  -0.0419 0.0247  580 LEU B CG  
934  C  CD1 . LEU B 47 ? 0.4972 0.8732 0.5373 0.1795  -0.0515 0.0223  580 LEU B CD1 
935  C  CD2 . LEU B 47 ? 0.5202 0.8635 0.5415 0.1473  -0.0334 0.0473  580 LEU B CD2 
936  N  N   . LEU B 48 ? 0.3399 0.7137 0.4296 0.1129  -0.0271 -0.0045 581 LEU B N   
937  C  CA  . LEU B 48 ? 0.3141 0.6815 0.4112 0.1042  -0.0243 -0.0098 581 LEU B CA  
938  C  C   . LEU B 48 ? 0.3419 0.7160 0.4382 0.0958  -0.0213 -0.0010 581 LEU B C   
939  O  O   . LEU B 48 ? 0.3421 0.7151 0.4411 0.0892  -0.0202 -0.0038 581 LEU B O   
940  C  CB  . LEU B 48 ? 0.3078 0.6725 0.4035 0.1060  -0.0219 -0.0191 581 LEU B CB  
941  C  CG  . LEU B 48 ? 0.3597 0.7240 0.4607 0.1031  -0.0228 -0.0342 581 LEU B CG  
942  C  CD1 . LEU B 48 ? 0.3776 0.7285 0.4702 0.0992  -0.0171 -0.0436 581 LEU B CD1 
943  C  CD2 . LEU B 48 ? 0.3418 0.7056 0.4526 0.0954  -0.0220 -0.0395 581 LEU B CD2 
944  N  N   . GLU B 49 ? 0.2947 0.6822 0.3866 0.0938  -0.0197 0.0086  582 GLU B N   
945  C  CA  . GLU B 49 ? 0.2849 0.6930 0.3793 0.0808  -0.0165 0.0138  582 GLU B CA  
946  C  C   . GLU B 49 ? 0.3395 0.7272 0.4321 0.0618  -0.0144 0.0133  582 GLU B C   
947  O  O   . GLU B 49 ? 0.3517 0.7564 0.4477 0.0452  -0.0123 0.0112  582 GLU B O   
948  C  CB  . GLU B 49 ? 0.3087 0.7466 0.4002 0.0813  -0.0127 0.0217  582 GLU B CB  
949  C  CG  . GLU B 49 ? 0.4081 0.8646 0.4986 0.1028  -0.0131 0.0191  582 GLU B CG  
950  C  CD  . GLU B 49 ? 0.5069 0.9846 0.6017 0.1147  -0.0137 0.0170  582 GLU B CD  
951  O  OE1 . GLU B 49 ? 0.3964 0.8882 0.4971 0.1046  -0.0152 0.0178  582 GLU B OE1 
952  O  OE2 . GLU B 49 ? 0.5414 1.0206 0.6302 0.1360  -0.0126 0.0140  582 GLU B OE2 
953  N  N   . ILE B 50 ? 0.3095 0.6619 0.3948 0.0659  -0.0150 0.0137  583 ILE B N   
954  C  CA  . ILE B 50 ? 0.3273 0.6435 0.4047 0.0542  -0.0116 0.0121  583 ILE B CA  
955  C  C   . ILE B 50 ? 0.3680 0.6841 0.4542 0.0494  -0.0127 -0.0024 583 ILE B C   
956  O  O   . ILE B 50 ? 0.3304 0.6620 0.4258 0.0604  -0.0164 -0.0084 583 ILE B O   
957  C  CB  . ILE B 50 ? 0.3802 0.6617 0.4452 0.0731  -0.0137 0.0174  583 ILE B CB  
958  C  CG1 . ILE B 50 ? 0.3913 0.6718 0.4399 0.0768  -0.0118 0.0343  583 ILE B CG1 
959  C  CG2 . ILE B 50 ? 0.4193 0.6524 0.4728 0.0710  -0.0100 0.0136  583 ILE B CG2 
960  C  CD1 . ILE B 50 ? 0.4508 0.7123 0.4853 0.1041  -0.0175 0.0414  583 ILE B CD1 
961  N  N   . ASP B 51 ? 0.3777 0.6740 0.4579 0.0304  -0.0079 -0.0090 584 ASP B N   
962  C  CA  A ASP B 51 ? 0.3759 0.6739 0.4606 0.0247  -0.0080 -0.0247 584 ASP B CA  
963  C  CA  B ASP B 51 ? 0.3795 0.6771 0.4642 0.0247  -0.0079 -0.0248 584 ASP B CA  
964  C  C   . ASP B 51 ? 0.4068 0.6899 0.4957 0.0464  -0.0103 -0.0320 584 ASP B C   
965  O  O   . ASP B 51 ? 0.3894 0.6461 0.4729 0.0625  -0.0110 -0.0283 584 ASP B O   
966  C  CB  A ASP B 51 ? 0.4485 0.7194 0.5217 -0.0004 -0.0010 -0.0345 584 ASP B CB  
967  C  CB  B ASP B 51 ? 0.4569 0.7264 0.5299 0.0000  -0.0010 -0.0349 584 ASP B CB  
968  C  CG  A ASP B 51 ? 0.6358 0.9390 0.7093 -0.0294 0.0020  -0.0331 584 ASP B CG  
969  C  CG  B ASP B 51 ? 0.6855 0.9643 0.7605 -0.0086 -0.0006 -0.0542 584 ASP B CG  
970  O  OD1 A ASP B 51 ? 0.6173 0.9763 0.7023 -0.0323 -0.0031 -0.0359 584 ASP B OD1 
971  O  OD1 B ASP B 51 ? 0.6765 1.0041 0.7597 -0.0125 -0.0050 -0.0557 584 ASP B OD1 
972  O  OD2 A ASP B 51 ? 0.7626 1.0369 0.8229 -0.0494 0.0100  -0.0293 584 ASP B OD2 
973  O  OD2 B ASP B 51 ? 0.8266 1.0631 0.8913 -0.0097 0.0045  -0.0674 584 ASP B OD2 
974  N  N   . ASN B 52 ? 0.3666 0.6730 0.4637 0.0473  -0.0114 -0.0414 585 ASN B N   
975  C  CA  . ASN B 52 ? 0.3534 0.6622 0.4581 0.0615  -0.0115 -0.0515 585 ASN B CA  
976  C  C   . ASN B 52 ? 0.4231 0.7028 0.5248 0.0729  -0.0091 -0.0623 585 ASN B C   
977  O  O   . ASN B 52 ? 0.4017 0.6882 0.5112 0.0928  -0.0116 -0.0657 585 ASN B O   
978  C  CB  . ASN B 52 ? 0.3086 0.6417 0.4150 0.0524  -0.0089 -0.0590 585 ASN B CB  
979  C  CG  . ASN B 52 ? 0.4643 0.8165 0.5693 0.0519  -0.0104 -0.0474 585 ASN B CG  
980  O  OD1 . ASN B 52 ? 0.3324 0.6842 0.4384 0.0588  -0.0134 -0.0370 585 ASN B OD1 
981  N  ND2 . ASN B 52 ? 0.2955 0.6607 0.3939 0.0458  -0.0073 -0.0486 585 ASN B ND2 
982  N  N   . SER B 53 ? 0.4497 0.6986 0.5388 0.0615  -0.0041 -0.0697 586 SER B N   
983  C  CA  . SER B 53 ? 0.5132 0.7205 0.5930 0.0770  0.0000  -0.0809 586 SER B CA  
984  C  C   . SER B 53 ? 0.6163 0.7901 0.6859 0.0996  -0.0027 -0.0655 586 SER B C   
985  O  O   . SER B 53 ? 0.6597 0.8255 0.7300 0.1300  -0.0046 -0.0701 586 SER B O   
986  C  CB  . SER B 53 ? 0.6110 0.7809 0.6736 0.0560  0.0079  -0.0939 586 SER B CB  
987  O  OG  . SER B 53 ? 0.7690 0.9675 0.8322 0.0244  0.0083  -0.0965 586 SER B OG  
988  N  N   . GLU B 54 ? 0.5599 0.7225 0.6195 0.0869  -0.0031 -0.0470 587 GLU B N   
989  C  CA  . GLU B 54 ? 0.5893 0.7217 0.6328 0.1057  -0.0049 -0.0284 587 GLU B CA  
990  C  C   . GLU B 54 ? 0.5922 0.7713 0.6521 0.1315  -0.0151 -0.0247 587 GLU B C   
991  O  O   . GLU B 54 ? 0.6321 0.7989 0.6831 0.1616  -0.0195 -0.0184 587 GLU B O   
992  C  CB  . GLU B 54 ? 0.6266 0.7438 0.6550 0.0793  0.0003  -0.0117 587 GLU B CB  
993  C  CG  . GLU B 54 ? 0.8706 0.9453 0.8717 0.0930  0.0021  0.0108  587 GLU B CG  
994  C  CD  . GLU B 54 ? 1.2362 1.2362 1.2071 0.1176  0.0065  0.0155  587 GLU B CD  
995  O  OE1 . GLU B 54 ? 1.1789 1.1342 1.1406 0.1102  0.0143  0.0002  587 GLU B OE1 
996  O  OE2 . GLU B 54 ? 1.1912 1.1745 1.1433 0.1456  0.0026  0.0349  587 GLU B OE2 
997  N  N   . LEU B 55 ? 0.4694 0.7006 0.5508 0.1208  -0.0185 -0.0306 588 LEU B N   
998  C  CA  . LEU B 55 ? 0.4322 0.7066 0.5287 0.1366  -0.0259 -0.0332 588 LEU B CA  
999  C  C   . LEU B 55 ? 0.5173 0.8111 0.6268 0.1580  -0.0281 -0.0501 588 LEU B C   
1000 O  O   . LEU B 55 ? 0.5304 0.8524 0.6461 0.1800  -0.0355 -0.0514 588 LEU B O   
1001 C  CB  . LEU B 55 ? 0.3811 0.6902 0.4906 0.1175  -0.0254 -0.0365 588 LEU B CB  
1002 C  CG  . LEU B 55 ? 0.4017 0.7127 0.5034 0.1076  -0.0255 -0.0219 588 LEU B CG  
1003 C  CD1 . LEU B 55 ? 0.3488 0.6828 0.4582 0.0959  -0.0239 -0.0254 588 LEU B CD1 
1004 C  CD2 . LEU B 55 ? 0.3949 0.7125 0.4897 0.1241  -0.0311 -0.0131 588 LEU B CD2 
1005 N  N   . LEU B 56 ? 0.4842 0.7717 0.5983 0.1521  -0.0219 -0.0649 589 LEU B N   
1006 C  CA  . LEU B 56 ? 0.4797 0.7942 0.6081 0.1724  -0.0218 -0.0838 589 LEU B CA  
1007 C  C   . LEU B 56 ? 0.5997 0.8861 0.7149 0.2106  -0.0258 -0.0798 589 LEU B C   
1008 O  O   . LEU B 56 ? 0.5839 0.9130 0.7132 0.2388  -0.0317 -0.0891 589 LEU B O   
1009 C  CB  . LEU B 56 ? 0.4670 0.7801 0.5985 0.1572  -0.0126 -0.1009 589 LEU B CB  
1010 C  CG  . LEU B 56 ? 0.4622 0.8097 0.6037 0.1276  -0.0086 -0.1049 589 LEU B CG  
1011 C  CD1 . LEU B 56 ? 0.4725 0.8071 0.6054 0.1105  -0.0006 -0.1147 589 LEU B CD1 
1012 C  CD2 . LEU B 56 ? 0.4167 0.8207 0.5796 0.1293  -0.0079 -0.1175 589 LEU B CD2 
1013 N  N   . TYR B 57 ? 0.6378 0.8531 0.7237 0.2111  -0.0218 -0.0656 590 TYR B N   
1014 C  CA  . TYR B 57 ? 0.7206 0.8864 0.7810 0.2483  -0.0235 -0.0547 590 TYR B CA  
1015 C  C   . TYR B 57 ? 0.7668 0.9645 0.8257 0.2716  -0.0355 -0.0378 590 TYR B C   
1016 O  O   . TYR B 57 ? 0.8134 1.0276 0.8708 0.3144  -0.0431 -0.0384 590 TYR B O   
1017 C  CB  . TYR B 57 ? 0.8150 0.8906 0.8390 0.2315  -0.0132 -0.0415 590 TYR B CB  
1018 C  CG  . TYR B 57 ? 0.9544 0.9624 0.9405 0.2666  -0.0131 -0.0210 590 TYR B CG  
1019 C  CD1 . TYR B 57 ? 1.0505 1.0157 1.0203 0.3079  -0.0107 -0.0289 590 TYR B CD1 
1020 C  CD2 . TYR B 57 ? 0.9961 0.9806 0.9583 0.2612  -0.0143 0.0073  590 TYR B CD2 
1021 C  CE1 . TYR B 57 ? 1.1593 1.0518 1.0862 0.3458  -0.0101 -0.0061 590 TYR B CE1 
1022 C  CE2 . TYR B 57 ? 1.0999 1.0154 1.0189 0.2938  -0.0128 0.0308  590 TYR B CE2 
1023 C  CZ  . TYR B 57 ? 1.2836 1.1496 1.1834 0.3376  -0.0111 0.0255  590 TYR B CZ  
1024 O  OH  . TYR B 57 ? 1.4102 1.2002 1.2602 0.3754  -0.0095 0.0528  590 TYR B OH  
1025 N  N   . MSE B 58 ? 0.6593 0.8720 0.7187 0.2455  -0.0374 -0.0249 591 MSE B N   
1026 C  CA  A MSE B 58 ? 0.6440 0.8894 0.6994 0.2607  -0.0477 -0.0112 591 MSE B CA  
1027 C  CA  B MSE B 58 ? 0.6465 0.8937 0.7030 0.2585  -0.0475 -0.0115 591 MSE B CA  
1028 C  C   . MSE B 58 ? 0.6970 1.0260 0.7830 0.2769  -0.0580 -0.0303 591 MSE B C   
1029 O  O   . MSE B 58 ? 0.7132 1.0727 0.7935 0.3064  -0.0690 -0.0241 591 MSE B O   
1030 C  CB  A MSE B 58 ? 0.6307 0.8791 0.6828 0.2275  -0.0451 0.0003  591 MSE B CB  
1031 C  CB  B MSE B 58 ? 0.6291 0.8862 0.6878 0.2223  -0.0447 -0.0040 591 MSE B CB  
1032 C  CG  A MSE B 58 ? 0.7567 0.9386 0.7745 0.2165  -0.0367 0.0237  591 MSE B CG  
1033 C  CG  B MSE B 58 ? 0.7448 0.9761 0.7743 0.2251  -0.0451 0.0213  591 MSE B CG  
1034 SE SE  A MSE B 58 ? 0.8057 1.0038 0.8304 0.1687  -0.0293 0.0284  591 MSE B SE  
1035 SE SE  B MSE B 58 ? 0.7987 1.0398 0.8335 0.1792  -0.0370 0.0259  591 MSE B SE  
1036 C  CE  A MSE B 58 ? 0.7144 0.9875 0.7551 0.1798  -0.0411 0.0249  591 MSE B CE  
1037 C  CE  B MSE B 58 ? 0.8031 0.9705 0.8174 0.1546  -0.0224 0.0329  591 MSE B CE  
1038 N  N   . LEU B 59 ? 0.6499 1.0191 0.7660 0.2564  -0.0541 -0.0536 592 LEU B N   
1039 C  CA  . LEU B 59 ? 0.6359 1.0872 0.7821 0.2631  -0.0604 -0.0754 592 LEU B CA  
1040 C  C   . LEU B 59 ? 0.7284 1.2073 0.8807 0.3086  -0.0663 -0.0854 592 LEU B C   
1041 O  O   . LEU B 59 ? 0.7002 1.2579 0.8735 0.3248  -0.0756 -0.0998 592 LEU B O   
1042 C  CB  . LEU B 59 ? 0.5991 1.0754 0.7684 0.2265  -0.0508 -0.0945 592 LEU B CB  
1043 C  CG  . LEU B 59 ? 0.6281 1.1026 0.7969 0.1904  -0.0473 -0.0906 592 LEU B CG  
1044 C  CD1 . LEU B 59 ? 0.6078 1.0865 0.7876 0.1594  -0.0358 -0.1028 592 LEU B CD1 
1045 C  CD2 . LEU B 59 ? 0.6414 1.1689 0.8197 0.1897  -0.0551 -0.0986 592 LEU B CD2 
1046 N  N   . GLU B 60 ? 0.7428 1.1589 0.8760 0.3294  -0.0604 -0.0800 593 GLU B N   
1047 C  CA  . GLU B 60 ? 0.8019 1.2316 0.9356 0.3801  -0.0644 -0.0888 593 GLU B CA  
1048 C  C   . GLU B 60 ? 0.9377 1.3174 1.0325 0.4270  -0.0728 -0.0616 593 GLU B C   
1049 O  O   . GLU B 60 ? 0.9732 1.3883 1.0691 0.4793  -0.0821 -0.0655 593 GLU B O   
1050 C  CB  . GLU B 60 ? 0.8410 1.2311 0.9744 0.3792  -0.0512 -0.1046 593 GLU B CB  
1051 C  CG  . GLU B 60 ? 1.0582 1.3322 1.1500 0.3790  -0.0417 -0.0882 593 GLU B CG  
1052 C  CD  . GLU B 60 ? 1.4242 1.6557 1.5109 0.3795  -0.0286 -0.1079 593 GLU B CD  
1053 O  OE1 . GLU B 60 ? 1.3674 1.6629 1.4847 0.3760  -0.0251 -0.1348 593 GLU B OE1 
1054 O  OE2 . GLU B 60 ? 1.4024 1.5350 1.4516 0.3801  -0.0202 -0.0977 593 GLU B OE2 
1055 N  N   . SER B 61 ? 0.9032 1.2044 0.9622 0.4093  -0.0688 -0.0336 594 SER B N   
1056 C  CA  . SER B 61 ? 0.9608 1.1989 0.9729 0.4447  -0.0727 -0.0021 594 SER B CA  
1057 C  C   . SER B 61 ? 0.9862 1.2727 0.9943 0.4407  -0.0844 0.0137  594 SER B C   
1058 O  O   . SER B 61 ? 0.9537 1.2294 0.9602 0.3974  -0.0791 0.0209  594 SER B O   
1059 C  CB  . SER B 61 ? 1.0253 1.1437 0.9975 0.4223  -0.0564 0.0158  594 SER B CB  
1060 O  OG  . SER B 61 ? 1.1362 1.1833 1.0570 0.4422  -0.0556 0.0504  594 SER B OG  
1061 N  N   . PRO B 62 ? 0.9535 1.3017 0.9600 0.4870  -0.1008 0.0167  595 PRO B N   
1062 C  CA  . PRO B 62 ? 0.9259 1.3261 0.9269 0.4812  -0.1120 0.0273  595 PRO B CA  
1063 C  C   . PRO B 62 ? 1.0259 1.3413 0.9725 0.4797  -0.1064 0.0662  595 PRO B C   
1064 O  O   . PRO B 62 ? 0.9807 1.3189 0.9219 0.4547  -0.1081 0.0740  595 PRO B O   
1065 C  CB  . PRO B 62 ? 0.9603 1.4504 0.9708 0.5358  -0.1314 0.0190  595 PRO B CB  
1066 C  CG  . PRO B 62 ? 1.0193 1.5254 1.0557 0.5609  -0.1291 -0.0039 595 PRO B CG  
1067 C  CD  . PRO B 62 ? 1.0012 1.3848 1.0114 0.5487  -0.1107 0.0083  595 PRO B CD  
1068 N  N   . GLU B 63 ? 1.0747 1.2875 0.9796 0.5031  -0.0970 0.0883  596 GLU B N   
1069 C  CA  . GLU B 63 ? 1.1559 1.2640 1.0008 0.5005  -0.0858 0.1266  596 GLU B CA  
1070 C  C   . GLU B 63 ? 1.1398 1.2228 0.9903 0.4337  -0.0710 0.1275  596 GLU B C   
1071 O  O   . GLU B 63 ? 1.1324 1.2250 0.9645 0.4169  -0.0706 0.1457  596 GLU B O   
1072 C  CB  . GLU B 63 ? 1.2759 1.2729 1.0835 0.5300  -0.0744 0.1376  596 GLU B CB  
1073 C  CG  . GLU B 63 ? 1.5565 1.4256 1.2946 0.5238  -0.0583 0.1770  596 GLU B CG  
1074 C  CD  . GLU B 63 ? 2.0129 1.7584 1.7093 0.5504  -0.0445 0.1843  596 GLU B CD  
1075 O  OE1 . GLU B 63 ? 1.9972 1.7266 1.7211 0.5316  -0.0361 0.1547  596 GLU B OE1 
1076 O  OE2 . GLU B 63 ? 2.0578 1.7163 1.6887 0.5893  -0.0408 0.2202  596 GLU B OE2 
1077 N  N   . SER B 64 ? 1.0435 1.1027 0.9196 0.3982  -0.0594 0.1065  597 SER B N   
1078 C  CA  . SER B 64 ? 0.9813 1.0271 0.8676 0.3388  -0.0465 0.1035  597 SER B CA  
1079 C  C   . SER B 64 ? 0.8963 1.0352 0.8184 0.3160  -0.0548 0.0906  597 SER B C   
1080 O  O   . SER B 64 ? 0.8910 1.0254 0.8043 0.2843  -0.0477 0.1016  597 SER B O   
1081 C  CB  . SER B 64 ? 1.0084 1.0240 0.9148 0.3135  -0.0359 0.0808  597 SER B CB  
1082 O  OG  . SER B 64 ? 1.1361 1.1108 1.0335 0.2633  -0.0211 0.0859  597 SER B OG  
1083 N  N   . LEU B 65 ? 0.7485 0.9704 0.7077 0.3318  -0.0683 0.0667  598 LEU B N   
1084 C  CA  . LEU B 65 ? 0.6598 0.9564 0.6474 0.3086  -0.0739 0.0518  598 LEU B CA  
1085 C  C   . LEU B 65 ? 0.7394 1.0545 0.7001 0.3171  -0.0796 0.0710  598 LEU B C   
1086 O  O   . LEU B 65 ? 0.7080 1.0328 0.6701 0.2870  -0.0739 0.0720  598 LEU B O   
1087 C  CB  . LEU B 65 ? 0.6017 0.9780 0.6302 0.3168  -0.0840 0.0207  598 LEU B CB  
1088 C  CG  . LEU B 65 ? 0.5923 1.0338 0.6448 0.2903  -0.0875 0.0022  598 LEU B CG  
1089 C  CD1 . LEU B 65 ? 0.5569 0.9709 0.6174 0.2477  -0.0748 -0.0001 598 LEU B CD1 
1090 C  CD2 . LEU B 65 ? 0.5693 1.0837 0.6573 0.2935  -0.0947 -0.0282 598 LEU B CD2 
1091 N  N   . ARG B 66 ? 0.7532 1.0740 0.6865 0.3610  -0.0903 0.0866  599 ARG B N   
1092 C  CA  . ARG B 66 ? 0.7826 1.1234 0.6829 0.3750  -0.0968 0.1071  599 ARG B CA  
1093 C  C   . ARG B 66 ? 0.8533 1.1267 0.7164 0.3486  -0.0804 0.1357  599 ARG B C   
1094 O  O   . ARG B 66 ? 0.8301 1.1368 0.6877 0.3309  -0.0792 0.1382  599 ARG B O   
1095 C  CB  . ARG B 66 ? 0.8936 1.2406 0.7634 0.4334  -0.1106 0.1241  599 ARG B CB  
1096 C  CG  . ARG B 66 ? 1.0744 1.4551 0.9065 0.4528  -0.1200 0.1451  599 ARG B CG  
1097 C  CD  . ARG B 66 ? 1.2971 1.7042 1.1028 0.5173  -0.1379 0.1590  599 ARG B CD  
1098 N  NE  . ARG B 66 ? 1.4070 1.8998 1.2613 0.5382  -0.1533 0.1238  599 ARG B NE  
1099 C  CZ  . ARG B 66 ? 1.5684 2.1744 1.4588 0.5303  -0.1674 0.0918  599 ARG B CZ  
1100 N  NH1 . ARG B 66 ? 1.4107 2.0544 1.2922 0.5064  -0.1693 0.0895  599 ARG B NH1 
1101 N  NH2 . ARG B 66 ? 1.3527 2.0365 1.2875 0.5440  -0.1782 0.0593  599 ARG B NH2 
1102 N  N   . SER B 67 ? 0.8468 1.0285 0.6840 0.3437  -0.0665 0.1544  600 SER B N   
1103 C  CA  . SER B 67 ? 0.8832 1.0029 0.6850 0.3122  -0.0484 0.1800  600 SER B CA  
1104 C  C   . SER B 67 ? 0.8800 1.0313 0.7166 0.2619  -0.0391 0.1617  600 SER B C   
1105 O  O   . SER B 67 ? 0.8839 1.0405 0.7035 0.2392  -0.0299 0.1753  600 SER B O   
1106 C  CB  . SER B 67 ? 1.0089 1.0197 0.7742 0.3134  -0.0341 0.1990  600 SER B CB  
1107 O  OG  . SER B 67 ? 1.1040 1.0968 0.9023 0.2999  -0.0305 0.1736  600 SER B OG  
1108 N  N   . LYS B 68 ? 0.7796 0.9585 0.6631 0.2479  -0.0417 0.1315  601 LYS B N   
1109 C  CA  . LYS B 68 ? 0.7109 0.9223 0.6258 0.2090  -0.0351 0.1149  601 LYS B CA  
1110 C  C   . LYS B 68 ? 0.7188 1.0018 0.6471 0.2111  -0.0430 0.1045  601 LYS B C   
1111 O  O   . LYS B 68 ? 0.7133 1.0140 0.6442 0.1877  -0.0349 0.1049  601 LYS B O   
1112 C  CB  . LYS B 68 ? 0.6810 0.8963 0.6334 0.1969  -0.0353 0.0895  601 LYS B CB  
1113 C  CG  . LYS B 68 ? 0.6591 0.8062 0.6000 0.1825  -0.0239 0.0935  601 LYS B CG  
1114 C  CD  . LYS B 68 ? 0.6654 0.7858 0.5908 0.1445  -0.0086 0.1059  601 LYS B CD  
1115 C  CE  . LYS B 68 ? 0.7649 0.8172 0.6772 0.1255  0.0032  0.1046  601 LYS B CE  
1116 N  NZ  . LYS B 68 ? 0.8975 0.9108 0.7802 0.0901  0.0201  0.1223  601 LYS B NZ  
1117 N  N   . VAL B 69 ? 0.6542 0.9812 0.5899 0.2391  -0.0580 0.0931  602 VAL B N   
1118 C  CA  . VAL B 69 ? 0.6269 1.0185 0.5705 0.2405  -0.0654 0.0788  602 VAL B CA  
1119 C  C   . VAL B 69 ? 0.7337 1.1252 0.6382 0.2426  -0.0609 0.1027  602 VAL B C   
1120 O  O   . VAL B 69 ? 0.7198 1.1412 0.6280 0.2260  -0.0556 0.0951  602 VAL B O   
1121 C  CB  . VAL B 69 ? 0.6615 1.1064 0.6201 0.2662  -0.0823 0.0589  602 VAL B CB  
1122 C  CG1 . VAL B 69 ? 0.6462 1.1534 0.5998 0.2692  -0.0903 0.0463  602 VAL B CG1 
1123 C  CG2 . VAL B 69 ? 0.6119 1.0699 0.6119 0.2537  -0.0829 0.0310  602 VAL B CG2 
1124 N  N   . ASP B 70 ? 0.7538 1.1066 0.6174 0.2635  -0.0608 0.1326  603 ASP B N   
1125 C  CA  . ASP B 70 ? 0.8053 1.1497 0.6229 0.2648  -0.0539 0.1611  603 ASP B CA  
1126 C  C   . ASP B 70 ? 0.8428 1.1640 0.6582 0.2242  -0.0334 0.1693  603 ASP B C   
1127 O  O   . ASP B 70 ? 0.8446 1.1997 0.6465 0.2139  -0.0271 0.1737  603 ASP B O   
1128 C  CB  . ASP B 70 ? 0.9171 1.2045 0.6848 0.2959  -0.0553 0.1957  603 ASP B CB  
1129 C  CG  . ASP B 70 ? 1.0948 1.4227 0.8565 0.3444  -0.0770 0.1926  603 ASP B CG  
1130 O  OD1 . ASP B 70 ? 1.0492 1.4600 0.8397 0.3488  -0.0908 0.1639  603 ASP B OD1 
1131 O  OD2 . ASP B 70 ? 1.2570 1.5343 0.9829 0.3787  -0.0799 0.2179  603 ASP B OD2 
1132 N  N   . GLU B 71 ? 0.7793 1.0527 0.6096 0.2015  -0.0233 0.1682  604 GLU B N   
1133 C  CA  . GLU B 71 ? 0.7757 1.0406 0.6106 0.1612  -0.0052 0.1713  604 GLU B CA  
1134 C  C   . GLU B 71 ? 0.7467 1.0811 0.6197 0.1491  -0.0065 0.1451  604 GLU B C   
1135 O  O   . GLU B 71 ? 0.7502 1.1113 0.6182 0.1295  0.0054  0.1496  604 GLU B O   
1136 C  CB  . GLU B 71 ? 0.8047 1.0122 0.6493 0.1402  0.0032  0.1694  604 GLU B CB  
1137 C  CG  . GLU B 71 ? 1.0004 1.1206 0.7972 0.1391  0.0141  0.1980  604 GLU B CG  
1138 C  CD  . GLU B 71 ? 1.2980 1.3607 1.1022 0.1117  0.0248  0.1907  604 GLU B CD  
1139 O  OE1 . GLU B 71 ? 1.1990 1.2674 1.0361 0.1211  0.0154  0.1675  604 GLU B OE1 
1140 O  OE2 . GLU B 71 ? 1.3021 1.3158 1.0774 0.0775  0.0440  0.2066  604 GLU B OE2 
1141 N  N   . ALA B 72 ? 0.6353 0.9975 0.5428 0.1620  -0.0196 0.1181  605 ALA B N   
1142 C  CA  . ALA B 72 ? 0.5734 0.9851 0.5107 0.1560  -0.0206 0.0932  605 ALA B CA  
1143 C  C   . ALA B 72 ? 0.6224 1.0787 0.5429 0.1671  -0.0220 0.0906  605 ALA B C   
1144 O  O   . ALA B 72 ? 0.6027 1.0908 0.5302 0.1580  -0.0140 0.0820  605 ALA B O   
1145 C  CB  . ALA B 72 ? 0.5389 0.9563 0.5066 0.1646  -0.0317 0.0684  605 ALA B CB  
1146 N  N   . VAL B 73 ? 0.6080 1.0704 0.5040 0.1894  -0.0322 0.0979  606 VAL B N   
1147 C  CA  . VAL B 73 ? 0.6169 1.1247 0.4900 0.2019  -0.0354 0.0953  606 VAL B CA  
1148 C  C   . VAL B 73 ? 0.7061 1.2171 0.5512 0.1876  -0.0188 0.1177  606 VAL B C   
1149 O  O   . VAL B 73 ? 0.6982 1.2544 0.5407 0.1861  -0.0140 0.1055  606 VAL B O   
1150 C  CB  . VAL B 73 ? 0.6910 1.2086 0.5409 0.2311  -0.0515 0.1021  606 VAL B CB  
1151 C  CG1 . VAL B 73 ? 0.7187 1.2815 0.5332 0.2432  -0.0536 0.1071  606 VAL B CG1 
1152 C  CG2 . VAL B 73 ? 0.6487 1.1904 0.5319 0.2405  -0.0666 0.0711  606 VAL B CG2 
1153 N  N   . ALA B 74 ? 0.7077 1.1696 0.5319 0.1744  -0.0080 0.1477  607 ALA B N   
1154 C  CA  . ALA B 74 ? 0.7537 1.2167 0.5505 0.1519  0.0115  0.1703  607 ALA B CA  
1155 C  C   . ALA B 74 ? 0.7587 1.2607 0.5896 0.1277  0.0234  0.1520  607 ALA B C   
1156 O  O   . ALA B 74 ? 0.7800 1.3253 0.5995 0.1181  0.0360  0.1546  607 ALA B O   
1157 C  CB  . ALA B 74 ? 0.8276 1.2172 0.5936 0.1375  0.0222  0.2029  607 ALA B CB  
1158 N  N   . VAL B 75 ? 0.6472 1.1401 0.5184 0.1214  0.0193  0.1332  608 VAL B N   
1159 C  CA  . VAL B 75 ? 0.5974 1.1294 0.5015 0.1066  0.0272  0.1161  608 VAL B CA  
1160 C  C   . VAL B 75 ? 0.6003 1.1859 0.5130 0.1269  0.0239  0.0926  608 VAL B C   
1161 O  O   . VAL B 75 ? 0.5959 1.2287 0.5142 0.1213  0.0354  0.0873  608 VAL B O   
1162 C  CB  . VAL B 75 ? 0.6171 1.1246 0.5554 0.0999  0.0216  0.1036  608 VAL B CB  
1163 C  CG1 . VAL B 75 ? 0.5811 1.1358 0.5504 0.0936  0.0269  0.0867  608 VAL B CG1 
1164 C  CG2 . VAL B 75 ? 0.6473 1.1007 0.5746 0.0773  0.0276  0.1220  608 VAL B CG2 
1165 N  N   . LEU B 76 ? 0.5334 1.1141 0.4451 0.1494  0.0095  0.0771  609 LEU B N   
1166 C  CA  . LEU B 76 ? 0.5186 1.1370 0.4333 0.1663  0.0070  0.0504  609 LEU B CA  
1167 C  C   . LEU B 76 ? 0.5796 1.2406 0.4621 0.1718  0.0141  0.0548  609 LEU B C   
1168 O  O   . LEU B 76 ? 0.5536 1.2513 0.4384 0.1820  0.0186  0.0323  609 LEU B O   
1169 C  CB  . LEU B 76 ? 0.5086 1.1115 0.4290 0.1804  -0.0090 0.0301  609 LEU B CB  
1170 C  CG  . LEU B 76 ? 0.5216 1.0930 0.4735 0.1769  -0.0142 0.0165  609 LEU B CG  
1171 C  CD1 . LEU B 76 ? 0.5243 1.0873 0.4790 0.1843  -0.0283 0.0004  609 LEU B CD1 
1172 C  CD2 . LEU B 76 ? 0.4801 1.0588 0.4490 0.1797  -0.0069 -0.0032 609 LEU B CD2 
1173 N  N   . GLN B 77 ? 0.5710 1.2230 0.4193 0.1675  0.0159  0.0836  610 GLN B N   
1174 C  CA  . GLN B 77 ? 0.6071 1.2969 0.4166 0.1718  0.0229  0.0938  610 GLN B CA  
1175 C  C   . GLN B 77 ? 0.6807 1.4171 0.4934 0.1575  0.0435  0.0929  610 GLN B C   
1176 O  O   . GLN B 77 ? 0.6857 1.4146 0.5066 0.1332  0.0565  0.1103  610 GLN B O   
1177 C  CB  . GLN B 77 ? 0.6779 1.3329 0.4454 0.1697  0.0226  0.1324  610 GLN B CB  
1178 C  CG  . GLN B 77 ? 0.9968 1.6875 0.7147 0.1786  0.0269  0.1468  610 GLN B CG  
1179 C  CD  . GLN B 77 ? 1.3145 2.0429 1.0257 0.2058  0.0089  0.1207  610 GLN B CD  
1180 O  OE1 . GLN B 77 ? 1.2828 1.9960 0.9832 0.2244  -0.0090 0.1251  610 GLN B OE1 
1181 N  NE2 . GLN B 77 ? 1.2278 2.0103 0.9441 0.2090  0.0138  0.0909  610 GLN B NE2 
1182 N  N   . ALA B 78 ? 0.6316 1.4211 0.4375 0.1721  0.0470  0.0696  611 ALA B N   
1183 C  CA  . ALA B 78 ? 0.6250 1.4728 0.4345 0.1657  0.0665  0.0638  611 ALA B CA  
1184 C  C   . ALA B 78 ? 0.7186 1.5863 0.4893 0.1450  0.0828  0.0973  611 ALA B C   
1185 O  O   . ALA B 78 ? 0.7583 1.6018 0.4885 0.1477  0.0771  0.1192  611 ALA B O   
1186 C  CB  . ALA B 78 ? 0.6315 1.5216 0.4396 0.1909  0.0659  0.0271  611 ALA B CB  
1187 N  N   . HIS B 79 ? 0.6789 1.5920 0.4602 0.1239  0.1036  0.1025  612 HIS B N   
1188 C  CA  . HIS B 79 ? 0.7220 1.6565 0.4668 0.0946  0.1250  0.1343  612 HIS B CA  
1189 C  C   . HIS B 79 ? 0.8439 1.8212 0.5431 0.1093  0.1299  0.1348  612 HIS B C   
1190 O  O   . HIS B 79 ? 0.8135 1.8300 0.5201 0.1383  0.1230  0.1010  612 HIS B O   
1191 C  CB  . HIS B 79 ? 0.7036 1.6986 0.4792 0.0675  0.1465  0.1301  612 HIS B CB  
1192 C  CG  . HIS B 79 ? 0.7256 1.8162 0.5103 0.0834  0.1589  0.1037  612 HIS B CG  
1193 N  ND1 . HIS B 79 ? 0.6971 1.8119 0.5138 0.1216  0.1481  0.0650  612 HIS B ND1 
1194 C  CD2 . HIS B 79 ? 0.7692 1.9316 0.5314 0.0669  0.1826  0.1111  612 HIS B CD2 
1195 C  CE1 . HIS B 79 ? 0.6951 1.8947 0.5088 0.1313  0.1645  0.0484  612 HIS B CE1 
1196 N  NE2 . HIS B 79 ? 0.7423 1.9795 0.5256 0.0985  0.1855  0.0745  612 HIS B NE2 
1197 N  N   . GLN B 80 ? 0.9108 1.8752 0.5580 0.0887  0.1428  0.1733  613 GLN B N   
1198 C  CA  . GLN B 80 ? 0.9769 1.9846 0.5712 0.0983  0.1501  0.1812  613 GLN B CA  
1199 C  C   . GLN B 80 ? 1.0910 2.1750 0.6797 0.0694  0.1819  0.1857  613 GLN B C   
1200 O  O   . GLN B 80 ? 1.1268 2.1944 0.7109 0.0284  0.2011  0.2137  613 GLN B O   
1201 C  CB  . GLN B 80 ? 1.0616 2.0044 0.5941 0.0997  0.1435  0.2246  613 GLN B CB  
1202 N  N   . ALA B 81 ? 1.0439 2.2137 0.6361 0.0890  0.1884  0.1537  614 ALA B N   
1203 C  CA  . ALA B 81 ? 1.3846 2.6463 0.9771 0.0678  0.2185  0.1503  614 ALA B CA  
1204 C  C   . ALA B 81 ? 1.8322 3.1063 1.3538 0.0434  0.2391  0.1898  614 ALA B C   
1205 O  O   . ALA B 81 ? 1.3737 2.6204 0.8435 0.0629  0.2274  0.2038  614 ALA B O   
1206 C  CB  . ALA B 81 ? 1.3622 2.7035 0.9799 0.1045  0.2178  0.1001  614 ALA B CB  
1207 N  N   . GLU C 5  ? 1.3004 1.7448 1.9535 0.2149  0.1608  -0.1155 538 GLU C N   
1208 C  CA  . GLU C 5  ? 1.2989 1.7435 1.9896 0.1870  0.2076  -0.1021 538 GLU C CA  
1209 C  C   . GLU C 5  ? 1.3682 1.7310 1.9384 0.1712  0.2248  -0.0864 538 GLU C C   
1210 O  O   . GLU C 5  ? 1.3542 1.6778 1.8472 0.1663  0.1893  -0.0916 538 GLU C O   
1211 C  CB  . GLU C 5  ? 1.2822 1.7833 2.0882 0.1558  0.1881  -0.1157 538 GLU C CB  
1212 N  N   . THR C 6  ? 1.3543 1.6935 1.9100 0.1653  0.2798  -0.0665 539 THR C N   
1213 C  CA  . THR C 6  ? 1.3741 1.6394 1.8195 0.1536  0.2975  -0.0507 539 THR C CA  
1214 C  C   . THR C 6  ? 1.3900 1.6613 1.8808 0.1202  0.3112  -0.0406 539 THR C C   
1215 O  O   . THR C 6  ? 1.3939 1.7044 1.9779 0.1124  0.3485  -0.0315 539 THR C O   
1216 C  CB  . THR C 6  ? 1.5478 1.7708 1.9223 0.1781  0.3476  -0.0356 539 THR C CB  
1217 O  OG1 . THR C 6  ? 1.5442 1.8132 2.0094 0.1842  0.3993  -0.0245 539 THR C OG1 
1218 C  CG2 . THR C 6  ? 1.5561 1.7505 1.8634 0.2099  0.3318  -0.0464 539 THR C CG2 
1219 N  N   . LEU C 7  ? 1.3106 1.5437 1.7434 0.1010  0.2828  -0.0411 540 LEU C N   
1220 C  CA  . LEU C 7  ? 1.2908 1.5208 1.7606 0.0717  0.2923  -0.0317 540 LEU C CA  
1221 C  C   . LEU C 7  ? 1.3695 1.5510 1.7793 0.0721  0.3443  -0.0021 540 LEU C C   
1222 O  O   . LEU C 7  ? 1.3920 1.5155 1.6880 0.0796  0.3397  0.0061  540 LEU C O   
1223 C  CB  . LEU C 7  ? 1.2573 1.4676 1.6928 0.0556  0.2437  -0.0437 540 LEU C CB  
1224 C  CG  . LEU C 7  ? 1.3048 1.5106 1.7850 0.0271  0.2468  -0.0385 540 LEU C CG  
1225 C  CD1 . LEU C 7  ? 1.2902 1.5547 1.9097 0.0108  0.2523  -0.0500 540 LEU C CD1 
1226 C  CD2 . LEU C 7  ? 1.3067 1.4917 1.7437 0.0191  0.2013  -0.0515 540 LEU C CD2 
1227 N  N   . THR C 8  ? 1.3254 1.5319 1.8149 0.0651  0.3937  0.0143  541 THR C N   
1228 C  CA  . THR C 8  ? 1.3730 1.5346 1.8105 0.0682  0.4512  0.0471  541 THR C CA  
1229 C  C   . THR C 8  ? 1.3818 1.5198 1.8326 0.0405  0.4501  0.0606  541 THR C C   
1230 O  O   . THR C 8  ? 1.3275 1.4969 1.8604 0.0171  0.4161  0.0428  541 THR C O   
1231 C  CB  . THR C 8  ? 1.4819 1.6794 1.9972 0.0783  0.5158  0.0633  541 THR C CB  
1232 O  OG1 . THR C 8  ? 1.4388 1.6959 2.1082 0.0505  0.5220  0.0603  541 THR C OG1 
1233 C  CG2 . THR C 8  ? 1.4548 1.6774 1.9648 0.1100  0.5186  0.0494  541 THR C CG2 
1234 N  N   . ALA C 9  ? 1.3685 1.4478 1.7347 0.0462  0.4865  0.0912  542 ALA C N   
1235 C  CA  . ALA C 9  ? 1.3681 1.4162 1.7398 0.0252  0.4930  0.1104  542 ALA C CA  
1236 C  C   . ALA C 9  ? 1.3849 1.4731 1.9034 -0.0004 0.5292  0.1194  542 ALA C C   
1237 O  O   . ALA C 9  ? 1.3592 1.4469 1.9348 -0.0264 0.5086  0.1141  542 ALA C O   
1238 C  CB  . ALA C 9  ? 1.4613 1.4384 1.7060 0.0441  0.5270  0.1441  542 ALA C CB  
1239 N  N   . SER C 10 ? 1.3354 1.4606 1.9234 0.0064  0.5815  0.1300  543 SER C N   
1240 C  CA  . SER C 10 ? 1.3169 1.4886 2.0636 -0.0200 0.6193  0.1381  543 SER C CA  
1241 C  C   . SER C 10 ? 1.2519 1.4919 2.1282 -0.0438 0.5612  0.0956  543 SER C C   
1242 O  O   . SER C 10 ? 1.2410 1.4961 2.2265 -0.0762 0.5612  0.0925  543 SER C O   
1243 C  CB  . SER C 10 ? 1.4046 1.6039 2.1940 -0.0031 0.6912  0.1604  543 SER C CB  
1244 O  OG  . SER C 10 ? 1.4733 1.7111 2.2508 0.0238  0.6745  0.1375  543 SER C OG  
1245 N  N   . ARG C 11 ? 1.1293 1.4039 1.9874 -0.0265 0.5103  0.0626  544 ARG C N   
1246 C  CA  . ARG C 11 ? 1.0494 1.3845 2.0064 -0.0407 0.4490  0.0209  544 ARG C CA  
1247 C  C   . ARG C 11 ? 1.0498 1.3522 1.9808 -0.0612 0.3992  0.0047  544 ARG C C   
1248 O  O   . ARG C 11 ? 1.0281 1.3622 2.0676 -0.0872 0.3737  -0.0179 544 ARG C O   
1249 C  CB  . ARG C 11 ? 1.0106 1.3759 1.9287 -0.0107 0.4102  -0.0034 544 ARG C CB  
1250 N  N   . LEU C 12 ? 0.9890 1.2274 1.7802 -0.0490 0.3866  0.0155  545 LEU C N   
1251 C  CA  . LEU C 12 ? 0.9607 1.1644 1.7160 -0.0626 0.3453  0.0040  545 LEU C CA  
1252 C  C   . LEU C 12 ? 1.0345 1.2133 1.8547 -0.0908 0.3749  0.0212  545 LEU C C   
1253 O  O   . LEU C 12 ? 1.0035 1.1893 1.8862 -0.1118 0.3411  -0.0030 545 LEU C O   
1254 C  CB  . LEU C 12 ? 0.9653 1.1116 1.5678 -0.0422 0.3323  0.0164  545 LEU C CB  
1255 C  CG  . LEU C 12 ? 0.9892 1.1061 1.5510 -0.0500 0.2892  0.0043  545 LEU C CG  
1256 C  CD1 . LEU C 12 ? 0.9371 1.0856 1.4990 -0.0438 0.2338  -0.0315 545 LEU C CD1 
1257 C  CD2 . LEU C 12 ? 1.0378 1.0962 1.4766 -0.0360 0.2946  0.0285  545 LEU C CD2 
1258 N  N   . ALA C 13 ? 1.0498 1.1960 1.8530 -0.0890 0.4397  0.0630  546 ALA C N   
1259 C  CA  . ALA C 13 ? 1.0976 1.2078 1.9501 -0.1119 0.4810  0.0905  546 ALA C CA  
1260 C  C   . ALA C 13 ? 1.1308 1.2905 2.1589 -0.1461 0.4861  0.0726  546 ALA C C   
1261 O  O   . ALA C 13 ? 1.1593 1.2876 2.2404 -0.1716 0.4951  0.0792  546 ALA C O   
1262 C  CB  . ALA C 13 ? 1.1821 1.2523 1.9742 -0.0961 0.5543  0.1407  546 ALA C CB  
1263 N  N   . SER C 14 ? 1.0349 1.2704 2.1569 -0.1463 0.4777  0.0489  547 SER C N   
1264 C  CA  . SER C 14 ? 1.0125 1.3076 2.3153 -0.1785 0.4758  0.0270  547 SER C CA  
1265 C  C   . SER C 14 ? 1.0000 1.3073 2.3508 -0.1980 0.4000  -0.0233 547 SER C C   
1266 O  O   . SER C 14 ? 1.0003 1.3366 2.4943 -0.2307 0.3930  -0.0435 547 SER C O   
1267 C  CB  . SER C 14 ? 1.0359 1.4122 2.4201 -0.1666 0.4860  0.0172  547 SER C CB  
1268 O  OG  . SER C 14 ? 1.0878 1.4996 2.4280 -0.1436 0.4207  -0.0202 547 SER C OG  
1269 N  N   . ALA C 15 ? 0.9055 1.1878 2.1378 -0.1779 0.3459  -0.0433 548 ALA C N   
1270 C  CA  . ALA C 15 ? 0.8642 1.1516 2.1142 -0.1875 0.2764  -0.0901 548 ALA C CA  
1271 C  C   . ALA C 15 ? 0.9067 1.1188 2.1055 -0.1993 0.2730  -0.0836 548 ALA C C   
1272 O  O   . ALA C 15 ? 0.9258 1.0808 2.0356 -0.1897 0.3123  -0.0423 548 ALA C O   
1273 C  CB  . ALA C 15 ? 0.8319 1.1395 1.9879 -0.1557 0.2242  -0.1141 548 ALA C CB  
1274 N  N   . PRO C 16 ? 0.8380 1.0476 2.0861 -0.2160 0.2234  -0.1258 549 PRO C N   
1275 C  CA  . PRO C 16 ? 0.8558 0.9928 2.0544 -0.2225 0.2187  -0.1225 549 PRO C CA  
1276 C  C   . PRO C 16 ? 0.8791 0.9749 1.9178 -0.1904 0.2081  -0.1060 549 PRO C C   
1277 O  O   . PRO C 16 ? 0.8319 0.9581 1.8039 -0.1662 0.1824  -0.1157 549 PRO C O   
1278 C  CB  . PRO C 16 ? 0.8761 1.0290 2.1436 -0.2373 0.1575  -0.1816 549 PRO C CB  
1279 C  CG  . PRO C 16 ? 0.9219 1.1516 2.3184 -0.2522 0.1449  -0.2071 549 PRO C CG  
1280 C  CD  . PRO C 16 ? 0.8355 1.1058 2.1826 -0.2263 0.1673  -0.1804 549 PRO C CD  
1281 N  N   . PRO C 17 ? 0.8589 0.8862 1.8416 -0.1897 0.2262  -0.0813 550 PRO C N   
1282 C  CA  . PRO C 17 ? 0.8376 0.8314 1.6820 -0.1604 0.2167  -0.0636 550 PRO C CA  
1283 C  C   . PRO C 17 ? 0.8201 0.8372 1.6027 -0.1402 0.1610  -0.0990 550 PRO C C   
1284 O  O   . PRO C 17 ? 0.7873 0.8072 1.4781 -0.1175 0.1587  -0.0836 550 PRO C O   
1285 C  CB  . PRO C 17 ? 0.9064 0.8308 1.7364 -0.1659 0.2315  -0.0456 550 PRO C CB  
1286 C  CG  . PRO C 17 ? 1.0102 0.9199 1.9430 -0.1943 0.2761  -0.0276 550 PRO C CG  
1287 C  CD  . PRO C 17 ? 0.9292 0.9055 1.9765 -0.2148 0.2609  -0.0631 550 PRO C CD  
1288 N  N   . GLN C 18 ? 0.7563 0.7838 1.5810 -0.1468 0.1179  -0.1449 551 GLN C N   
1289 C  CA  . GLN C 18 ? 0.7147 0.7594 1.4726 -0.1240 0.0705  -0.1752 551 GLN C CA  
1290 C  C   . GLN C 18 ? 0.6968 0.8023 1.4598 -0.1134 0.0522  -0.1891 551 GLN C C   
1291 O  O   . GLN C 18 ? 0.6633 0.7779 1.3435 -0.0893 0.0342  -0.1893 551 GLN C O   
1292 C  CB  . GLN C 18 ? 0.7574 0.7856 1.5408 -0.1282 0.0321  -0.2199 551 GLN C CB  
1293 C  CG  . GLN C 18 ? 0.9943 1.0285 1.6931 -0.0998 -0.0090 -0.2463 551 GLN C CG  
1294 C  CD  . GLN C 18 ? 1.2713 1.2924 1.8639 -0.0756 0.0025  -0.2148 551 GLN C CD  
1295 O  OE1 . GLN C 18 ? 1.2439 1.2278 1.8050 -0.0746 0.0289  -0.1825 551 GLN C OE1 
1296 N  NE2 . GLN C 18 ? 1.1265 1.1770 1.6635 -0.0546 -0.0202 -0.2249 551 GLN C NE2 
1297 N  N   . LYS C 19 ? 0.6201 0.7664 1.4849 -0.1308 0.0604  -0.1970 552 LYS C N   
1298 C  CA  . LYS C 19 ? 0.5771 0.7837 1.4624 -0.1193 0.0477  -0.2066 552 LYS C CA  
1299 C  C   . LYS C 19 ? 0.5838 0.7839 1.3830 -0.0994 0.0799  -0.1668 552 LYS C C   
1300 O  O   . LYS C 19 ? 0.5491 0.7747 1.3010 -0.0772 0.0603  -0.1732 552 LYS C O   
1301 C  CB  . LYS C 19 ? 0.6122 0.8641 1.6400 -0.1441 0.0585  -0.2176 552 LYS C CB  
1302 C  CG  . LYS C 19 ? 0.7796 1.0990 1.8455 -0.1306 0.0505  -0.2241 552 LYS C CG  
1303 C  CD  . LYS C 19 ? 0.9367 1.3051 2.0481 -0.1234 -0.0141 -0.2754 552 LYS C CD  
1304 C  CE  . LYS C 19 ? 1.0890 1.5270 2.2558 -0.1095 -0.0183 -0.2780 552 LYS C CE  
1305 N  NZ  . LYS C 19 ? 1.1980 1.6905 2.4343 -0.1050 -0.0829 -0.3287 552 LYS C NZ  
1306 N  N   . GLN C 20 ? 0.5394 0.6978 1.3098 -0.1054 0.1264  -0.1269 553 GLN C N   
1307 C  CA  . GLN C 20 ? 0.5231 0.6640 1.2056 -0.0876 0.1557  -0.0914 553 GLN C CA  
1308 C  C   . GLN C 20 ? 0.5199 0.6429 1.0942 -0.0659 0.1266  -0.0943 553 GLN C C   
1309 O  O   . GLN C 20 ? 0.4900 0.6214 1.0084 -0.0486 0.1282  -0.0858 553 GLN C O   
1310 C  CB  . GLN C 20 ? 0.5804 0.6737 1.2469 -0.0957 0.2054  -0.0507 553 GLN C CB  
1311 C  CG  . GLN C 20 ? 0.6878 0.7974 1.4516 -0.1138 0.2514  -0.0351 553 GLN C CG  
1312 C  CD  . GLN C 20 ? 0.9145 0.9714 1.6394 -0.1142 0.3063  0.0120  553 GLN C CD  
1313 O  OE1 . GLN C 20 ? 0.8101 0.8387 1.4302 -0.0926 0.3215  0.0378  553 GLN C OE1 
1314 N  NE2 . GLN C 20 ? 0.9023 0.9429 1.7115 -0.1381 0.3376  0.0242  553 GLN C NE2 
1315 N  N   . LYS C 21 ? 0.4777 0.5752 1.0272 -0.0668 0.1022  -0.1066 554 LYS C N   
1316 C  CA  . LYS C 21 ? 0.4560 0.5398 0.9153 -0.0478 0.0784  -0.1079 554 LYS C CA  
1317 C  C   . LYS C 21 ? 0.4832 0.6038 0.9333 -0.0333 0.0444  -0.1353 554 LYS C C   
1318 O  O   . LYS C 21 ? 0.4795 0.5985 0.8623 -0.0171 0.0390  -0.1268 554 LYS C O   
1319 C  CB  . LYS C 21 ? 0.4797 0.5290 0.9209 -0.0492 0.0673  -0.1120 554 LYS C CB  
1320 C  CG  . LYS C 21 ? 0.4564 0.4616 0.8831 -0.0550 0.0976  -0.0789 554 LYS C CG  
1321 C  CD  . LYS C 21 ? 0.4313 0.4208 0.7777 -0.0416 0.1113  -0.0468 554 LYS C CD  
1322 C  CE  . LYS C 21 ? 0.5447 0.4889 0.8692 -0.0417 0.1333  -0.0158 554 LYS C CE  
1323 N  NZ  . LYS C 21 ? 0.5857 0.5138 0.8312 -0.0278 0.1419  0.0122  554 LYS C NZ  
1324 N  N   . GLN C 22 ? 0.4332 0.5848 0.9512 -0.0385 0.0211  -0.1674 555 GLN C N   
1325 C  CA  . GLN C 22 ? 0.4233 0.6094 0.9314 -0.0204 -0.0138 -0.1929 555 GLN C CA  
1326 C  C   . GLN C 22 ? 0.4580 0.6704 0.9604 -0.0089 -0.0011 -0.1784 555 GLN C C   
1327 O  O   . GLN C 22 ? 0.4323 0.6485 0.8753 0.0127  -0.0165 -0.1790 555 GLN C O   
1328 C  CB  . GLN C 22 ? 0.4538 0.6685 1.0424 -0.0287 -0.0454 -0.2325 555 GLN C CB  
1329 C  CG  . GLN C 22 ? 0.6814 0.8696 1.2401 -0.0247 -0.0732 -0.2582 555 GLN C CG  
1330 C  CD  . GLN C 22 ? 0.9075 1.1114 1.5501 -0.0385 -0.1028 -0.2995 555 GLN C CD  
1331 O  OE1 . GLN C 22 ? 0.8634 1.0382 1.5474 -0.0589 -0.0945 -0.3058 555 GLN C OE1 
1332 N  NE2 . GLN C 22 ? 0.8206 1.0686 1.4912 -0.0269 -0.1405 -0.3295 555 GLN C NE2 
1333 N  N   . MSE C 23 ? 0.4290 0.6551 0.9917 -0.0216 0.0312  -0.1636 556 MSE C N   
1334 C  CA  . MSE C 23 ? 0.4318 0.6795 0.9931 -0.0089 0.0507  -0.1493 556 MSE C CA  
1335 C  C   . MSE C 23 ? 0.4437 0.6528 0.9012 0.0050  0.0661  -0.1239 556 MSE C C   
1336 O  O   . MSE C 23 ? 0.4406 0.6574 0.8613 0.0246  0.0597  -0.1234 556 MSE C O   
1337 C  CB  . MSE C 23 ? 0.4856 0.7502 1.1299 -0.0250 0.0913  -0.1350 556 MSE C CB  
1338 C  CG  . MSE C 23 ? 0.6039 0.9187 1.3714 -0.0396 0.0741  -0.1627 556 MSE C CG  
1339 SE SE  . MSE C 23 ? 0.7611 1.1026 1.6544 -0.0633 0.1344  -0.1407 556 MSE C SE  
1340 C  CE  . MSE C 23 ? 0.7503 1.0171 1.5999 -0.0842 0.1757  -0.1075 556 MSE C CE  
1341 N  N   . LEU C 24 ? 0.3900 0.5563 0.8022 -0.0042 0.0832  -0.1042 557 LEU C N   
1342 C  CA  . LEU C 24 ? 0.3933 0.5233 0.7126 0.0063  0.0906  -0.0841 557 LEU C CA  
1343 C  C   . LEU C 24 ? 0.3956 0.5217 0.6627 0.0184  0.0575  -0.0959 557 LEU C C   
1344 O  O   . LEU C 24 ? 0.3932 0.5079 0.6059 0.0312  0.0562  -0.0889 557 LEU C O   
1345 C  CB  . LEU C 24 ? 0.4157 0.5057 0.7063 -0.0044 0.1108  -0.0615 557 LEU C CB  
1346 C  CG  . LEU C 24 ? 0.4934 0.5733 0.8067 -0.0107 0.1532  -0.0394 557 LEU C CG  
1347 C  CD1 . LEU C 24 ? 0.5154 0.5581 0.8161 -0.0206 0.1672  -0.0201 557 LEU C CD1 
1348 C  CD2 . LEU C 24 ? 0.5400 0.6052 0.7915 0.0049  0.1734  -0.0242 557 LEU C CD2 
1349 N  N   . GLY C 25 ? 0.3153 0.4485 0.6007 0.0154  0.0336  -0.1141 558 GLY C N   
1350 C  CA  . GLY C 25 ? 0.3272 0.4578 0.5661 0.0292  0.0078  -0.1243 558 GLY C CA  
1351 C  C   . GLY C 25 ? 0.3821 0.5333 0.6081 0.0487  -0.0066 -0.1328 558 GLY C C   
1352 O  O   . GLY C 25 ? 0.3659 0.5007 0.5331 0.0611  -0.0102 -0.1239 558 GLY C O   
1353 N  N   . GLU C 26 ? 0.3529 0.5403 0.6396 0.0519  -0.0141 -0.1486 559 GLU C N   
1354 C  CA  . GLU C 26 ? 0.3651 0.5766 0.6491 0.0746  -0.0299 -0.1567 559 GLU C CA  
1355 C  C   . GLU C 26 ? 0.4238 0.6157 0.6634 0.0847  -0.0080 -0.1346 559 GLU C C   
1356 O  O   . GLU C 26 ? 0.4355 0.6254 0.6393 0.1067  -0.0197 -0.1343 559 GLU C O   
1357 C  CB  . GLU C 26 ? 0.3847 0.6456 0.7609 0.0735  -0.0399 -0.1764 559 GLU C CB  
1358 C  CG  . GLU C 26 ? 0.6421 0.9266 1.0614 0.0709  -0.0761 -0.2085 559 GLU C CG  
1359 C  CD  . GLU C 26 ? 1.0940 1.4328 1.6211 0.0658  -0.0879 -0.2290 559 GLU C CD  
1360 O  OE1 . GLU C 26 ? 0.9737 1.3211 1.5756 0.0396  -0.0644 -0.2260 559 GLU C OE1 
1361 O  OE2 . GLU C 26 ? 1.1478 1.5214 1.6876 0.0892  -0.1188 -0.2453 559 GLU C OE2 
1362 N  N   . ARG C 27 ? 0.3801 0.5531 0.6178 0.0714  0.0236  -0.1170 560 ARG C N   
1363 C  CA  . ARG C 27 ? 0.3882 0.5348 0.5773 0.0811  0.0438  -0.1004 560 ARG C CA  
1364 C  C   . ARG C 27 ? 0.4283 0.5305 0.5412 0.0779  0.0406  -0.0885 560 ARG C C   
1365 O  O   . ARG C 27 ? 0.4516 0.5306 0.5181 0.0899  0.0405  -0.0829 560 ARG C O   
1366 C  CB  . ARG C 27 ? 0.3923 0.5352 0.6028 0.0730  0.0799  -0.0879 560 ARG C CB  
1367 C  CG  . ARG C 27 ? 0.4465 0.6350 0.7506 0.0687  0.0931  -0.0949 560 ARG C CG  
1368 C  CD  . ARG C 27 ? 0.7821 1.0073 1.1222 0.0908  0.0863  -0.1053 560 ARG C CD  
1369 N  NE  . ARG C 27 ? 1.0578 1.3304 1.4980 0.0854  0.1055  -0.1089 560 ARG C NE  
1370 C  CZ  . ARG C 27 ? 1.3019 1.5864 1.7654 0.0974  0.1403  -0.0986 560 ARG C CZ  
1371 N  NH1 . ARG C 27 ? 1.1570 1.4039 1.5426 0.1171  0.1563  -0.0874 560 ARG C NH1 
1372 N  NH2 . ARG C 27 ? 1.1761 1.5100 1.7450 0.0902  0.1603  -0.1007 560 ARG C NH2 
1373 N  N   . LEU C 28 ? 0.3730 0.4634 0.4798 0.0616  0.0384  -0.0847 561 LEU C N   
1374 C  CA  . LEU C 28 ? 0.3827 0.4403 0.4351 0.0562  0.0344  -0.0737 561 LEU C CA  
1375 C  C   . LEU C 28 ? 0.4502 0.5061 0.4774 0.0661  0.0166  -0.0771 561 LEU C C   
1376 O  O   . LEU C 28 ? 0.4650 0.4947 0.4508 0.0678  0.0175  -0.0675 561 LEU C O   
1377 C  CB  . LEU C 28 ? 0.3751 0.4272 0.4380 0.0406  0.0360  -0.0686 561 LEU C CB  
1378 C  CG  . LEU C 28 ? 0.4638 0.4985 0.5223 0.0321  0.0565  -0.0551 561 LEU C CG  
1379 C  CD1 . LEU C 28 ? 0.4665 0.4992 0.5492 0.0206  0.0572  -0.0510 561 LEU C CD1 
1380 C  CD2 . LEU C 28 ? 0.4857 0.4863 0.4820 0.0338  0.0583  -0.0435 561 LEU C CD2 
1381 N  N   . PHE C 29 ? 0.3733 0.4536 0.4237 0.0730  0.0014  -0.0910 562 PHE C N   
1382 C  CA  . PHE C 29 ? 0.3744 0.4512 0.3932 0.0866  -0.0115 -0.0926 562 PHE C CA  
1383 C  C   . PHE C 29 ? 0.4477 0.5071 0.4277 0.1031  -0.0102 -0.0831 562 PHE C C   
1384 O  O   . PHE C 29 ? 0.4682 0.5046 0.4130 0.1030  -0.0061 -0.0704 562 PHE C O   
1385 C  CB  . PHE C 29 ? 0.3882 0.4916 0.4286 0.0981  -0.0315 -0.1140 562 PHE C CB  
1386 C  CG  . PHE C 29 ? 0.4281 0.5213 0.4205 0.1163  -0.0398 -0.1128 562 PHE C CG  
1387 C  CD1 . PHE C 29 ? 0.4555 0.5366 0.4307 0.1108  -0.0333 -0.1076 562 PHE C CD1 
1388 C  CD2 . PHE C 29 ? 0.4678 0.5615 0.4295 0.1420  -0.0504 -0.1131 562 PHE C CD2 
1389 C  CE1 . PHE C 29 ? 0.4907 0.5614 0.4196 0.1298  -0.0329 -0.1030 562 PHE C CE1 
1390 C  CE2 . PHE C 29 ? 0.5344 0.6119 0.4419 0.1615  -0.0512 -0.1061 562 PHE C CE2 
1391 C  CZ  . PHE C 29 ? 0.5173 0.5838 0.4089 0.1546  -0.0402 -0.1008 562 PHE C CZ  
1392 N  N   . PRO C 30 ? 0.4123 0.4813 0.4016 0.1186  -0.0125 -0.0877 563 PRO C N   
1393 C  CA  . PRO C 30 ? 0.4364 0.4800 0.3845 0.1370  -0.0104 -0.0767 563 PRO C CA  
1394 C  C   . PRO C 30 ? 0.4778 0.4788 0.3944 0.1234  0.0059  -0.0613 563 PRO C C   
1395 O  O   . PRO C 30 ? 0.4932 0.4638 0.3740 0.1294  0.0087  -0.0491 563 PRO C O   
1396 C  CB  . PRO C 30 ? 0.4643 0.5305 0.4413 0.1555  -0.0139 -0.0856 563 PRO C CB  
1397 C  CG  . PRO C 30 ? 0.4920 0.6033 0.5293 0.1485  -0.0237 -0.1035 563 PRO C CG  
1398 C  CD  . PRO C 30 ? 0.4134 0.5166 0.4572 0.1208  -0.0145 -0.1013 563 PRO C CD  
1399 N  N   . LEU C 31 ? 0.4190 0.4150 0.3474 0.1056  0.0160  -0.0621 564 LEU C N   
1400 C  CA  . LEU C 31 ? 0.4318 0.3873 0.3286 0.0927  0.0246  -0.0537 564 LEU C CA  
1401 C  C   . LEU C 31 ? 0.4969 0.4412 0.3844 0.0754  0.0198  -0.0451 564 LEU C C   
1402 O  O   . LEU C 31 ? 0.5234 0.4353 0.3879 0.0701  0.0209  -0.0373 564 LEU C O   
1403 C  CB  . LEU C 31 ? 0.4166 0.3696 0.3180 0.0840  0.0354  -0.0569 564 LEU C CB  
1404 C  CG  . LEU C 31 ? 0.4587 0.4225 0.3746 0.1011  0.0486  -0.0628 564 LEU C CG  
1405 C  CD1 . LEU C 31 ? 0.4357 0.3993 0.3561 0.0935  0.0666  -0.0618 564 LEU C CD1 
1406 C  CD2 . LEU C 31 ? 0.5060 0.4354 0.3876 0.1182  0.0528  -0.0623 564 LEU C CD2 
1407 N  N   . ILE C 32 ? 0.4382 0.4092 0.3498 0.0671  0.0153  -0.0469 565 ILE C N   
1408 C  CA  . ILE C 32 ? 0.4276 0.3977 0.3416 0.0543  0.0129  -0.0387 565 ILE C CA  
1409 C  C   . ILE C 32 ? 0.4897 0.4549 0.3891 0.0659  0.0160  -0.0305 565 ILE C C   
1410 O  O   . ILE C 32 ? 0.5102 0.4592 0.4056 0.0558  0.0213  -0.0182 565 ILE C O   
1411 C  CB  . ILE C 32 ? 0.4390 0.4359 0.3819 0.0483  0.0098  -0.0438 565 ILE C CB  
1412 C  CG1 . ILE C 32 ? 0.4232 0.4155 0.3726 0.0373  0.0118  -0.0443 565 ILE C CG1 
1413 C  CG2 . ILE C 32 ? 0.4418 0.4442 0.3924 0.0421  0.0096  -0.0357 565 ILE C CG2 
1414 C  CD1 . ILE C 32 ? 0.4846 0.4965 0.4655 0.0329  0.0119  -0.0477 565 ILE C CD1 
1415 N  N   . GLN C 33 ? 0.4454 0.4232 0.3370 0.0879  0.0129  -0.0364 566 GLN C N   
1416 C  CA  . GLN C 33 ? 0.4695 0.4367 0.3321 0.1061  0.0174  -0.0261 566 GLN C CA  
1417 C  C   . GLN C 33 ? 0.5596 0.4864 0.3977 0.1067  0.0278  -0.0103 566 GLN C C   
1418 O  O   . GLN C 33 ? 0.5934 0.5013 0.4156 0.1080  0.0405  0.0070  566 GLN C O   
1419 C  CB  . GLN C 33 ? 0.4975 0.4852 0.3508 0.1336  0.0044  -0.0388 566 GLN C CB  
1420 C  CG  . GLN C 33 ? 0.4661 0.4413 0.2746 0.1597  0.0076  -0.0279 566 GLN C CG  
1421 C  CD  . GLN C 33 ? 0.6657 0.6633 0.4621 0.1893  -0.0145 -0.0451 566 GLN C CD  
1422 O  OE1 . GLN C 33 ? 0.6572 0.6611 0.4251 0.2077  -0.0207 -0.0502 566 GLN C OE1 
1423 N  NE2 . GLN C 33 ? 0.5083 0.5193 0.3263 0.1967  -0.0278 -0.0560 566 GLN C NE2 
1424 N  N   . ALA C 34 ? 0.5328 0.4427 0.3693 0.1055  0.0257  -0.0156 567 ALA C N   
1425 C  CA  . ALA C 34 ? 0.5685 0.4310 0.3819 0.1054  0.0342  -0.0048 567 ALA C CA  
1426 C  C   . ALA C 34 ? 0.6500 0.4902 0.4741 0.0761  0.0395  0.0038  567 ALA C C   
1427 O  O   . ALA C 34 ? 0.6923 0.4956 0.5059 0.0727  0.0499  0.0181  567 ALA C O   
1428 C  CB  . ALA C 34 ? 0.5734 0.4231 0.3824 0.1119  0.0319  -0.0168 567 ALA C CB  
1429 N  N   . MSE C 35 ? 0.5941 0.4579 0.4439 0.0556  0.0317  -0.0038 568 MSE C N   
1430 C  CA  . MSE C 35 ? 0.6056 0.4607 0.4770 0.0281  0.0291  0.0009  568 MSE C CA  
1431 C  C   . MSE C 35 ? 0.6389 0.5140 0.5352 0.0228  0.0401  0.0164  568 MSE C C   
1432 O  O   . MSE C 35 ? 0.6592 0.5163 0.5736 0.0067  0.0477  0.0286  568 MSE C O   
1433 C  CB  . MSE C 35 ? 0.6092 0.4825 0.4932 0.0151  0.0144  -0.0119 568 MSE C CB  
1434 C  CG  . MSE C 35 ? 0.7209 0.5742 0.5775 0.0208  0.0094  -0.0253 568 MSE C CG  
1435 SE SE  . MSE C 35 ? 0.8162 0.6848 0.6767 0.0071  -0.0054 -0.0337 568 MSE C SE  
1436 C  CE  . MSE C 35 ? 0.8060 0.6543 0.6278 0.0244  0.0037  -0.0450 568 MSE C CE  
1437 N  N   . HIS C 36 ? 0.5633 0.4750 0.4651 0.0352  0.0418  0.0145  569 HIS C N   
1438 C  CA  . HIS C 36 ? 0.5569 0.4911 0.4773 0.0365  0.0551  0.0264  569 HIS C CA  
1439 C  C   . HIS C 36 ? 0.6310 0.5787 0.5219 0.0656  0.0599  0.0231  569 HIS C C   
1440 O  O   . HIS C 36 ? 0.5956 0.5703 0.4951 0.0709  0.0509  0.0091  569 HIS C O   
1441 C  CB  . HIS C 36 ? 0.5300 0.4947 0.4904 0.0206  0.0454  0.0205  569 HIS C CB  
1442 C  CG  . HIS C 36 ? 0.5807 0.5364 0.5698 -0.0057 0.0341  0.0218  569 HIS C CG  
1443 N  ND1 . HIS C 36 ? 0.6233 0.5831 0.6527 -0.0219 0.0433  0.0362  569 HIS C ND1 
1444 C  CD2 . HIS C 36 ? 0.6061 0.5481 0.5876 -0.0166 0.0137  0.0093  569 HIS C CD2 
1445 C  CE1 . HIS C 36 ? 0.6252 0.5755 0.6740 -0.0438 0.0218  0.0286  569 HIS C CE1 
1446 N  NE2 . HIS C 36 ? 0.6245 0.5608 0.6374 -0.0393 0.0036  0.0122  569 HIS C NE2 
1447 N  N   . PRO C 37 ? 0.6564 0.5821 0.5092 0.0865  0.0715  0.0345  570 PRO C N   
1448 C  CA  . PRO C 37 ? 0.6758 0.6133 0.4912 0.1188  0.0679  0.0271  570 PRO C CA  
1449 C  C   . PRO C 37 ? 0.7194 0.6805 0.5339 0.1284  0.0762  0.0251  570 PRO C C   
1450 O  O   . PRO C 37 ? 0.7130 0.6909 0.5110 0.1469  0.0609  0.0052  570 PRO C O   
1451 C  CB  . PRO C 37 ? 0.7534 0.6554 0.5223 0.1408  0.0816  0.0470  570 PRO C CB  
1452 C  CG  . PRO C 37 ? 0.8236 0.6960 0.6144 0.1161  0.1019  0.0690  570 PRO C CG  
1453 C  CD  . PRO C 37 ? 0.7167 0.6011 0.5555 0.0837  0.0862  0.0541  570 PRO C CD  
1454 N  N   . THR C 38 ? 0.6755 0.6378 0.5113 0.1167  0.0999  0.0435  571 THR C N   
1455 C  CA  . THR C 38 ? 0.6829 0.6649 0.5167 0.1297  0.1141  0.0434  571 THR C CA  
1456 C  C   . THR C 38 ? 0.6713 0.6828 0.5457 0.1174  0.0964  0.0217  571 THR C C   
1457 O  O   . THR C 38 ? 0.6926 0.7154 0.5515 0.1358  0.0946  0.0070  571 THR C O   
1458 C  CB  . THR C 38 ? 0.8528 0.8309 0.7085 0.1214  0.1505  0.0734  571 THR C CB  
1459 O  OG1 . THR C 38 ? 0.9704 0.9131 0.7844 0.1343  0.1703  0.0965  571 THR C OG1 
1460 C  CG2 . THR C 38 ? 0.8343 0.8320 0.6870 0.1392  0.1729  0.0759  571 THR C CG2 
1461 N  N   . LEU C 39 ? 0.5414 0.5595 0.4612 0.0892  0.0832  0.0193  572 LEU C N   
1462 C  CA  . LEU C 39 ? 0.4819 0.5215 0.4378 0.0785  0.0690  0.0050  572 LEU C CA  
1463 C  C   . LEU C 39 ? 0.5077 0.5464 0.4598 0.0761  0.0452  -0.0156 572 LEU C C   
1464 O  O   . LEU C 39 ? 0.4962 0.5460 0.4749 0.0680  0.0358  -0.0249 572 LEU C O   
1465 C  CB  . LEU C 39 ? 0.4517 0.4996 0.4569 0.0523  0.0687  0.0178  572 LEU C CB  
1466 C  CG  . LEU C 39 ? 0.4932 0.5511 0.5275 0.0487  0.0942  0.0398  572 LEU C CG  
1467 C  CD1 . LEU C 39 ? 0.4714 0.5384 0.5601 0.0202  0.0840  0.0477  572 LEU C CD1 
1468 C  CD2 . LEU C 39 ? 0.4607 0.5404 0.5025 0.0680  0.1118  0.0396  572 LEU C CD2 
1469 N  N   . ALA C 40 ? 0.4688 0.4947 0.3915 0.0853  0.0381  -0.0210 573 ALA C N   
1470 C  CA  . ALA C 40 ? 0.4442 0.4727 0.3722 0.0831  0.0206  -0.0377 573 ALA C CA  
1471 C  C   . ALA C 40 ? 0.4658 0.5121 0.4148 0.0855  0.0097  -0.0582 573 ALA C C   
1472 O  O   . ALA C 40 ? 0.4515 0.5011 0.4274 0.0712  0.0044  -0.0630 573 ALA C O   
1473 C  CB  . ALA C 40 ? 0.4725 0.4917 0.3693 0.1012  0.0160  -0.0403 573 ALA C CB  
1474 N  N   . GLY C 41 ? 0.4336 0.4857 0.3668 0.1041  0.0081  -0.0696 574 GLY C N   
1475 C  CA  . GLY C 41 ? 0.4288 0.4907 0.3814 0.1070  -0.0039 -0.0933 574 GLY C CA  
1476 C  C   . GLY C 41 ? 0.4629 0.5254 0.4504 0.0912  0.0028  -0.0888 574 GLY C C   
1477 O  O   . GLY C 41 ? 0.4611 0.5248 0.4800 0.0804  -0.0047 -0.0994 574 GLY C O   
1478 N  N   . LYS C 42 ? 0.3991 0.4612 0.3861 0.0899  0.0182  -0.0702 575 LYS C N   
1479 C  CA  . LYS C 42 ? 0.3686 0.4346 0.3892 0.0799  0.0230  -0.0624 575 LYS C CA  
1480 C  C   . LYS C 42 ? 0.3980 0.4606 0.4390 0.0591  0.0161  -0.0521 575 LYS C C   
1481 O  O   . LYS C 42 ? 0.3796 0.4388 0.4427 0.0534  0.0124  -0.0537 575 LYS C O   
1482 C  CB  . LYS C 42 ? 0.3951 0.4698 0.4197 0.0849  0.0408  -0.0444 575 LYS C CB  
1483 C  CG  . LYS C 42 ? 0.4872 0.5620 0.4849 0.1102  0.0551  -0.0515 575 LYS C CG  
1484 C  CD  . LYS C 42 ? 0.5858 0.6729 0.5980 0.1118  0.0796  -0.0275 575 LYS C CD  
1485 C  CE  . LYS C 42 ? 0.6867 0.7718 0.6653 0.1401  0.1030  -0.0286 575 LYS C CE  
1486 N  NZ  . LYS C 42 ? 0.8682 0.9706 0.8774 0.1386  0.1330  -0.0011 575 LYS C NZ  
1487 N  N   . ILE C 43 ? 0.3557 0.4134 0.3833 0.0503  0.0154  -0.0412 576 ILE C N   
1488 C  CA  . ILE C 43 ? 0.3536 0.4020 0.3850 0.0346  0.0084  -0.0338 576 ILE C CA  
1489 C  C   . ILE C 43 ? 0.4213 0.4643 0.4558 0.0335  0.0054  -0.0450 576 ILE C C   
1490 O  O   . ILE C 43 ? 0.4269 0.4627 0.4715 0.0262  0.0048  -0.0397 576 ILE C O   
1491 C  CB  . ILE C 43 ? 0.3942 0.4308 0.4056 0.0277  0.0081  -0.0252 576 ILE C CB  
1492 C  CG1 . ILE C 43 ? 0.3860 0.4288 0.4096 0.0238  0.0143  -0.0118 576 ILE C CG1 
1493 C  CG2 . ILE C 43 ? 0.4214 0.4418 0.4227 0.0161  -0.0003 -0.0229 576 ILE C CG2 
1494 C  CD1 . ILE C 43 ? 0.4523 0.4775 0.4597 0.0180  0.0178  -0.0044 576 ILE C CD1 
1495 N  N   . THR C 44 ? 0.3800 0.4276 0.4089 0.0419  0.0041  -0.0591 577 THR C N   
1496 C  CA  . THR C 44 ? 0.3802 0.4306 0.4283 0.0393  0.0028  -0.0706 577 THR C CA  
1497 C  C   . THR C 44 ? 0.4240 0.4734 0.5037 0.0348  0.0036  -0.0767 577 THR C C   
1498 O  O   . THR C 44 ? 0.4317 0.4724 0.5282 0.0249  0.0108  -0.0702 577 THR C O   
1499 C  CB  . THR C 44 ? 0.4360 0.4995 0.4822 0.0518  -0.0050 -0.0869 577 THR C CB  
1500 O  OG1 . THR C 44 ? 0.4557 0.5120 0.4707 0.0577  -0.0030 -0.0773 577 THR C OG1 
1501 C  CG2 . THR C 44 ? 0.3203 0.3958 0.4049 0.0470  -0.0062 -0.0994 577 THR C CG2 
1502 N  N   . GLY C 45 ? 0.3679 0.4205 0.4508 0.0437  -0.0006 -0.0873 578 GLY C N   
1503 C  CA  . GLY C 45 ? 0.3764 0.4206 0.4878 0.0416  0.0001  -0.0953 578 GLY C CA  
1504 C  C   . GLY C 45 ? 0.4140 0.4439 0.5331 0.0337  0.0084  -0.0737 578 GLY C C   
1505 O  O   . GLY C 45 ? 0.4136 0.4287 0.5574 0.0269  0.0137  -0.0724 578 GLY C O   
1506 N  N   . MSE C 46 ? 0.3611 0.3945 0.4609 0.0350  0.0086  -0.0560 579 MSE C N   
1507 C  CA  . MSE C 46 ? 0.3648 0.3885 0.4667 0.0316  0.0089  -0.0360 579 MSE C CA  
1508 C  C   . MSE C 46 ? 0.4421 0.4504 0.5293 0.0224  0.0119  -0.0245 579 MSE C C   
1509 O  O   . MSE C 46 ? 0.4675 0.4577 0.5593 0.0219  0.0169  -0.0129 579 MSE C O   
1510 C  CB  . MSE C 46 ? 0.3859 0.4239 0.4815 0.0340  0.0036  -0.0246 579 MSE C CB  
1511 C  CG  . MSE C 46 ? 0.4988 0.5341 0.6043 0.0353  -0.0031 -0.0076 579 MSE C CG  
1512 SE SE  . MSE C 46 ? 0.6046 0.6657 0.7201 0.0315  -0.0160 0.0053  579 MSE C SE  
1513 C  CE  . MSE C 46 ? 0.5394 0.6239 0.6733 0.0411  0.0027  -0.0036 579 MSE C CE  
1514 N  N   . LEU C 47 ? 0.3824 0.3935 0.4479 0.0183  0.0119  -0.0268 580 LEU C N   
1515 C  CA  . LEU C 47 ? 0.4033 0.3980 0.4468 0.0138  0.0191  -0.0174 580 LEU C CA  
1516 C  C   . LEU C 47 ? 0.4466 0.4350 0.5161 0.0104  0.0356  -0.0197 580 LEU C C   
1517 O  O   . LEU C 47 ? 0.4672 0.4366 0.5216 0.0091  0.0491  -0.0051 580 LEU C O   
1518 C  CB  . LEU C 47 ? 0.4028 0.3983 0.4187 0.0134  0.0174  -0.0215 580 LEU C CB  
1519 C  CG  . LEU C 47 ? 0.4668 0.4613 0.4601 0.0119  0.0031  -0.0179 580 LEU C CG  
1520 C  CD1 . LEU C 47 ? 0.4875 0.4676 0.4481 0.0116  0.0043  -0.0212 580 LEU C CD1 
1521 C  CD2 . LEU C 47 ? 0.4776 0.4643 0.4623 0.0101  -0.0090 -0.0054 580 LEU C CD2 
1522 N  N   . LEU C 48 ? 0.3758 0.3781 0.4848 0.0093  0.0349  -0.0378 581 LEU C N   
1523 C  CA  . LEU C 48 ? 0.3680 0.3676 0.5197 0.0016  0.0485  -0.0431 581 LEU C CA  
1524 C  C   . LEU C 48 ? 0.4533 0.4255 0.6176 -0.0016 0.0600  -0.0277 581 LEU C C   
1525 O  O   . LEU C 48 ? 0.4733 0.4356 0.6737 -0.0106 0.0776  -0.0250 581 LEU C O   
1526 C  CB  . LEU C 48 ? 0.3418 0.3630 0.5331 0.0012  0.0367  -0.0720 581 LEU C CB  
1527 C  CG  . LEU C 48 ? 0.3522 0.3994 0.5417 0.0058  0.0300  -0.0844 581 LEU C CG  
1528 C  CD1 . LEU C 48 ? 0.3443 0.4117 0.5580 0.0116  0.0097  -0.1137 581 LEU C CD1 
1529 C  CD2 . LEU C 48 ? 0.3355 0.3878 0.5493 -0.0011 0.0493  -0.0768 581 LEU C CD2 
1530 N  N   . GLU C 49 ? 0.4271 0.3865 0.5653 0.0064  0.0520  -0.0145 582 GLU C N   
1531 C  CA  . GLU C 49 ? 0.4621 0.3911 0.6044 0.0089  0.0615  0.0046  582 GLU C CA  
1532 C  C   . GLU C 49 ? 0.5429 0.4479 0.6442 0.0115  0.0760  0.0331  582 GLU C C   
1533 O  O   . GLU C 49 ? 0.5661 0.4392 0.6658 0.0147  0.0907  0.0541  582 GLU C O   
1534 C  CB  . GLU C 49 ? 0.4813 0.4111 0.6174 0.0211  0.0456  0.0070  582 GLU C CB  
1535 C  CG  . GLU C 49 ? 0.6480 0.5919 0.8154 0.0237  0.0379  -0.0195 582 GLU C CG  
1536 C  CD  . GLU C 49 ? 1.0493 0.9703 1.2584 0.0198  0.0462  -0.0326 582 GLU C CD  
1537 O  OE1 . GLU C 49 ? 0.7422 0.6336 0.9651 0.0135  0.0624  -0.0162 582 GLU C OE1 
1538 O  OE2 . GLU C 49 ? 1.1657 1.0947 1.3912 0.0241  0.0371  -0.0597 582 GLU C OE2 
1539 N  N   . ILE C 50 ? 0.4810 0.3956 0.5428 0.0126  0.0726  0.0340  583 ILE C N   
1540 C  CA  . ILE C 50 ? 0.5069 0.3967 0.5155 0.0188  0.0854  0.0556  583 ILE C CA  
1541 C  C   . ILE C 50 ? 0.5921 0.4697 0.6259 0.0121  0.1216  0.0640  583 ILE C C   
1542 O  O   . ILE C 50 ? 0.5437 0.4449 0.6358 0.0004  0.1282  0.0454  583 ILE C O   
1543 C  CB  . ILE C 50 ? 0.5298 0.4309 0.4948 0.0214  0.0705  0.0465  583 ILE C CB  
1544 C  CG1 . ILE C 50 ? 0.5076 0.4209 0.4603 0.0246  0.0375  0.0416  583 ILE C CG1 
1545 C  CG2 . ILE C 50 ? 0.5896 0.4614 0.4916 0.0304  0.0857  0.0623  583 ILE C CG2 
1546 C  CD1 . ILE C 50 ? 0.4966 0.4219 0.4251 0.0217  0.0212  0.0275  583 ILE C CD1 
1547 N  N   . ASP C 51 ? 0.6397 0.4810 0.6312 0.0207  0.1453  0.0928  584 ASP C N   
1548 C  CA  A ASP C 51 ? 0.6708 0.4980 0.6868 0.0151  0.1886  0.1077  584 ASP C CA  
1549 C  CA  B ASP C 51 ? 0.6694 0.4964 0.6846 0.0152  0.1889  0.1080  584 ASP C CA  
1550 C  C   . ASP C 51 ? 0.6781 0.5352 0.7099 0.0103  0.1997  0.0913  584 ASP C C   
1551 O  O   . ASP C 51 ? 0.6435 0.5073 0.6244 0.0193  0.1831  0.0821  584 ASP C O   
1552 C  CB  A ASP C 51 ? 0.7814 0.5598 0.7275 0.0317  0.2135  0.1450  584 ASP C CB  
1553 C  CB  B ASP C 51 ? 0.7780 0.5563 0.7215 0.0321  0.2143  0.1452  584 ASP C CB  
1554 C  CG  A ASP C 51 ? 1.0147 0.7601 0.9551 0.0391  0.2081  0.1660  584 ASP C CG  
1555 C  CG  B ASP C 51 ? 1.0004 0.7593 0.9712 0.0271  0.2692  0.1684  584 ASP C CG  
1556 O  OD1 A ASP C 51 ? 1.0120 0.7503 1.0218 0.0260  0.2246  0.1679  584 ASP C OD1 
1557 O  OD1 B ASP C 51 ? 1.0038 0.7636 1.0563 0.0099  0.2860  0.1690  584 ASP C OD1 
1558 O  OD2 A ASP C 51 ? 1.1672 0.8924 1.0361 0.0588  0.1856  0.1794  584 ASP C OD2 
1559 O  OD2 B ASP C 51 ? 1.1354 0.8749 1.0456 0.0410  0.2969  0.1864  584 ASP C OD2 
1560 N  N   . ASN C 52 ? 0.6239 0.4995 0.7336 -0.0040 0.2256  0.0862  585 ASN C N   
1561 C  CA  . ASN C 52 ? 0.6014 0.5133 0.7490 -0.0077 0.2373  0.0706  585 ASN C CA  
1562 C  C   . ASN C 52 ? 0.6866 0.5841 0.7638 0.0097  0.2602  0.0845  585 ASN C C   
1563 O  O   . ASN C 52 ? 0.6701 0.5925 0.7435 0.0149  0.2500  0.0660  585 ASN C O   
1564 C  CB  . ASN C 52 ? 0.5954 0.5261 0.8466 -0.0264 0.2656  0.0692  585 ASN C CB  
1565 C  CG  . ASN C 52 ? 0.6759 0.6288 1.0016 -0.0428 0.2348  0.0407  585 ASN C CG  
1566 O  OD1 . ASN C 52 ? 0.5043 0.4614 0.8033 -0.0380 0.1960  0.0225  585 ASN C OD1 
1567 N  ND2 . ASN C 52 ? 0.5647 0.5330 0.9874 -0.0620 0.2519  0.0341  585 ASN C ND2 
1568 N  N   . SER C 53 ? 0.7012 0.5546 0.7162 0.0218  0.2905  0.1162  586 SER C N   
1569 C  CA  . SER C 53 ? 0.7530 0.5845 0.6865 0.0427  0.3130  0.1274  586 SER C CA  
1570 C  C   . SER C 53 ? 0.7879 0.6112 0.6415 0.0549  0.2689  0.1092  586 SER C C   
1571 O  O   . SER C 53 ? 0.7907 0.6168 0.6122 0.0656  0.2724  0.0974  586 SER C O   
1572 C  CB  . SER C 53 ? 0.8991 0.6788 0.7699 0.0572  0.3528  0.1663  586 SER C CB  
1573 O  OG  . SER C 53 ? 1.0854 0.8321 0.9007 0.0638  0.3228  0.1773  586 SER C OG  
1574 N  N   . GLU C 54 ? 0.7323 0.5467 0.5633 0.0527  0.2283  0.1060  587 GLU C N   
1575 C  CA  . GLU C 54 ? 0.7236 0.5341 0.4974 0.0591  0.1848  0.0887  587 GLU C CA  
1576 C  C   . GLU C 54 ? 0.6604 0.5118 0.4866 0.0479  0.1643  0.0592  587 GLU C C   
1577 O  O   . GLU C 54 ? 0.6550 0.5010 0.4400 0.0543  0.1490  0.0451  587 GLU C O   
1578 C  CB  . GLU C 54 ? 0.7557 0.5534 0.5083 0.0601  0.1510  0.0962  587 GLU C CB  
1579 C  CG  . GLU C 54 ? 0.9781 0.7727 0.6803 0.0646  0.1057  0.0808  587 GLU C CG  
1580 C  CD  . GLU C 54 ? 1.3068 1.0670 0.9155 0.0810  0.1013  0.0776  587 GLU C CD  
1581 O  OE1 . GLU C 54 ? 1.1684 0.8933 0.7176 0.0981  0.1307  0.0970  587 GLU C OE1 
1582 O  OE2 . GLU C 54 ? 1.2109 0.9749 0.8029 0.0775  0.0690  0.0558  587 GLU C OE2 
1583 N  N   . LEU C 55 ? 0.5523 0.4392 0.4648 0.0335  0.1661  0.0501  588 LEU C N   
1584 C  CA  . LEU C 55 ? 0.4896 0.4130 0.4464 0.0279  0.1488  0.0252  588 LEU C CA  
1585 C  C   . LEU C 55 ? 0.5660 0.4987 0.5240 0.0369  0.1710  0.0193  588 LEU C C   
1586 O  O   . LEU C 55 ? 0.5396 0.4793 0.4826 0.0425  0.1539  0.0037  588 LEU C O   
1587 C  CB  . LEU C 55 ? 0.4379 0.3925 0.4781 0.0143  0.1435  0.0148  588 LEU C CB  
1588 C  CG  . LEU C 55 ? 0.4628 0.4151 0.5077 0.0089  0.1162  0.0120  588 LEU C CG  
1589 C  CD1 . LEU C 55 ? 0.4195 0.3946 0.5405 -0.0020 0.1136  -0.0024 588 LEU C CD1 
1590 C  CD2 . LEU C 55 ? 0.4401 0.3991 0.4526 0.0130  0.0853  0.0002  588 LEU C CD2 
1591 N  N   . LEU C 56 ? 0.5894 0.5194 0.5648 0.0402  0.2123  0.0340  589 LEU C N   
1592 C  CA  . LEU C 56 ? 0.6193 0.5602 0.6010 0.0525  0.2406  0.0312  589 LEU C CA  
1593 C  C   . LEU C 56 ? 0.7312 0.6326 0.6135 0.0715  0.2384  0.0304  589 LEU C C   
1594 O  O   . LEU C 56 ? 0.7507 0.6598 0.6293 0.0829  0.2402  0.0170  589 LEU C O   
1595 C  CB  . LEU C 56 ? 0.6615 0.6075 0.6869 0.0517  0.2923  0.0516  589 LEU C CB  
1596 C  CG  . LEU C 56 ? 0.6999 0.6905 0.8454 0.0312  0.2985  0.0467  589 LEU C CG  
1597 C  CD1 . LEU C 56 ? 0.7484 0.7269 0.9283 0.0249  0.3504  0.0751  589 LEU C CD1 
1598 C  CD2 . LEU C 56 ? 0.7041 0.7485 0.9235 0.0333  0.2917  0.0238  589 LEU C CD2 
1599 N  N   . TYR C 57 ? 0.7259 0.5831 0.5271 0.0766  0.2307  0.0427  590 TYR C N   
1600 C  CA  . TYR C 57 ? 0.7819 0.5953 0.4821 0.0934  0.2194  0.0370  590 TYR C CA  
1601 C  C   . TYR C 57 ? 0.7680 0.5880 0.4677 0.0869  0.1762  0.0129  590 TYR C C   
1602 O  O   . TYR C 57 ? 0.7946 0.5969 0.4572 0.0987  0.1756  -0.0008 590 TYR C O   
1603 C  CB  . TYR C 57 ? 0.8743 0.6449 0.4958 0.1002  0.2114  0.0539  590 TYR C CB  
1604 C  CG  . TYR C 57 ? 0.9751 0.7013 0.4945 0.1147  0.1845  0.0410  590 TYR C CG  
1605 C  CD1 . TYR C 57 ? 1.0878 0.7756 0.5287 0.1387  0.2112  0.0398  590 TYR C CD1 
1606 C  CD2 . TYR C 57 ? 0.9770 0.6992 0.4812 0.1047  0.1326  0.0283  590 TYR C CD2 
1607 C  CE1 . TYR C 57 ? 1.1812 0.8226 0.5252 0.1520  0.1817  0.0219  590 TYR C CE1 
1608 C  CE2 . TYR C 57 ? 1.0543 0.7366 0.4749 0.1145  0.1025  0.0120  590 TYR C CE2 
1609 C  CZ  . TYR C 57 ? 1.2579 0.8970 0.5952 0.1379  0.1248  0.0070  590 TYR C CZ  
1610 O  OH  . TYR C 57 ? 1.3816 0.9749 0.6317 0.1479  0.0910  -0.0142 590 TYR C OH  
1611 N  N   . MSE C 58 ? 0.6549 0.4984 0.3985 0.0695  0.1447  0.0089  591 MSE C N   
1612 C  CA  A MSE C 58 ? 0.5891 0.4399 0.3394 0.0618  0.1092  -0.0084 591 MSE C CA  
1613 C  CA  B MSE C 58 ? 0.6240 0.4759 0.3761 0.0616  0.1093  -0.0084 591 MSE C CA  
1614 C  C   . MSE C 58 ? 0.6337 0.5065 0.4215 0.0665  0.1162  -0.0216 591 MSE C C   
1615 O  O   . MSE C 58 ? 0.6293 0.4874 0.3943 0.0687  0.0987  -0.0335 591 MSE C O   
1616 C  CB  A MSE C 58 ? 0.5472 0.4222 0.3417 0.0462  0.0851  -0.0062 591 MSE C CB  
1617 C  CB  B MSE C 58 ? 0.6075 0.4861 0.4087 0.0460  0.0872  -0.0064 591 MSE C CB  
1618 C  CG  A MSE C 58 ? 0.6382 0.4908 0.3908 0.0442  0.0632  0.0022  591 MSE C CG  
1619 C  CG  B MSE C 58 ? 0.7341 0.5936 0.4990 0.0422  0.0616  -0.0005 591 MSE C CG  
1620 SE SE  A MSE C 58 ? 0.6725 0.5510 0.4832 0.0338  0.0548  0.0151  591 MSE C SE  
1621 SE SE  B MSE C 58 ? 0.7951 0.6927 0.6332 0.0282  0.0456  0.0023  591 MSE C SE  
1622 C  CE  A MSE C 58 ? 0.5600 0.4808 0.4385 0.0224  0.0387  -0.0036 591 MSE C CE  
1623 C  CE  B MSE C 58 ? 0.7875 0.6687 0.6177 0.0330  0.0637  0.0252  591 MSE C CE  
1624 N  N   . LEU C 59 ? 0.5904 0.4972 0.4390 0.0684  0.1404  -0.0191 592 LEU C N   
1625 C  CA  . LEU C 59 ? 0.5633 0.4970 0.4528 0.0774  0.1442  -0.0310 592 LEU C CA  
1626 C  C   . LEU C 59 ? 0.6776 0.5844 0.5217 0.0979  0.1649  -0.0341 592 LEU C C   
1627 O  O   . LEU C 59 ? 0.6900 0.6067 0.5499 0.1100  0.1628  -0.0443 592 LEU C O   
1628 C  CB  . LEU C 59 ? 0.5247 0.5069 0.5013 0.0730  0.1596  -0.0303 592 LEU C CB  
1629 C  CG  . LEU C 59 ? 0.5343 0.5454 0.5619 0.0577  0.1338  -0.0370 592 LEU C CG  
1630 C  CD1 . LEU C 59 ? 0.5227 0.5730 0.6354 0.0499  0.1486  -0.0385 592 LEU C CD1 
1631 C  CD2 . LEU C 59 ? 0.5254 0.5481 0.5527 0.0638  0.1043  -0.0514 592 LEU C CD2 
1632 N  N   . GLU C 60 ? 0.6834 0.5522 0.4644 0.1054  0.1845  -0.0255 593 GLU C N   
1633 C  CA  . GLU C 60 ? 0.7522 0.5852 0.4737 0.1284  0.2069  -0.0301 593 GLU C CA  
1634 C  C   . GLU C 60 ? 0.8421 0.6158 0.4689 0.1304  0.1808  -0.0401 593 GLU C C   
1635 O  O   . GLU C 60 ? 0.9083 0.6408 0.4718 0.1501  0.1934  -0.0490 593 GLU C O   
1636 C  CB  . GLU C 60 ? 0.8220 0.6538 0.5377 0.1410  0.2560  -0.0132 593 GLU C CB  
1637 C  CG  . GLU C 60 ? 0.9829 0.8731 0.8016 0.1418  0.2867  -0.0075 593 GLU C CG  
1638 C  CD  . GLU C 60 ? 1.3966 1.3093 1.2508 0.1594  0.2904  -0.0220 593 GLU C CD  
1639 O  OE1 . GLU C 60 ? 1.4690 1.3615 1.2886 0.1846  0.3240  -0.0218 593 GLU C OE1 
1640 O  OE2 . GLU C 60 ? 1.2723 1.2211 1.1855 0.1516  0.2605  -0.0328 593 GLU C OE2 
1641 N  N   . SER C 61 ? 0.7636 0.5339 0.3854 0.1109  0.1437  -0.0410 594 SER C N   
1642 C  CA  . SER C 61 ? 0.8057 0.5278 0.3552 0.1085  0.1124  -0.0528 594 SER C CA  
1643 C  C   . SER C 61 ? 0.7850 0.5205 0.3739 0.0880  0.0757  -0.0607 594 SER C C   
1644 O  O   . SER C 61 ? 0.7325 0.4909 0.3516 0.0712  0.0557  -0.0534 594 SER C O   
1645 C  CB  . SER C 61 ? 0.8952 0.5958 0.3901 0.1093  0.1067  -0.0423 594 SER C CB  
1646 O  OG  . SER C 61 ? 1.0626 0.7251 0.4997 0.1047  0.0664  -0.0570 594 SER C OG  
1647 N  N   . PRO C 62 ? 0.7519 0.4708 0.3410 0.0916  0.0704  -0.0738 595 PRO C N   
1648 C  CA  . PRO C 62 ? 0.7134 0.4415 0.3398 0.0738  0.0440  -0.0766 595 PRO C CA  
1649 C  C   . PRO C 62 ? 0.7942 0.5085 0.4073 0.0533  0.0096  -0.0797 595 PRO C C   
1650 O  O   . PRO C 62 ? 0.7401 0.4846 0.4028 0.0368  -0.0044 -0.0725 595 PRO C O   
1651 C  CB  . PRO C 62 ? 0.7496 0.4419 0.3567 0.0859  0.0486  -0.0886 595 PRO C CB  
1652 C  CG  . PRO C 62 ? 0.8091 0.5079 0.4100 0.1112  0.0824  -0.0876 595 PRO C CG  
1653 C  CD  . PRO C 62 ? 0.7938 0.4853 0.3545 0.1144  0.0932  -0.0835 595 PRO C CD  
1654 N  N   . GLU C 63 ? 0.8283 0.4999 0.3757 0.0567  -0.0042 -0.0908 596 GLU C N   
1655 C  CA  . GLU C 63 ? 0.8579 0.5187 0.3944 0.0395  -0.0433 -0.0973 596 GLU C CA  
1656 C  C   . GLU C 63 ? 0.8580 0.5618 0.4269 0.0329  -0.0494 -0.0796 596 GLU C C   
1657 O  O   . GLU C 63 ? 0.8213 0.5473 0.4331 0.0148  -0.0749 -0.0775 596 GLU C O   
1658 C  CB  . GLU C 63 ? 0.9815 0.5846 0.4292 0.0503  -0.0607 -0.1167 596 GLU C CB  
1659 C  CG  . GLU C 63 ? 1.3044 0.8569 0.6956 0.0705  -0.0402 -0.1329 596 GLU C CG  
1660 C  CD  . GLU C 63 ? 1.8098 1.3275 1.2128 0.0606  -0.0522 -0.1509 596 GLU C CD  
1661 O  OE1 . GLU C 63 ? 1.9063 1.3926 1.2967 0.0435  -0.0905 -0.1697 596 GLU C OE1 
1662 O  OE2 . GLU C 63 ? 1.7571 1.2748 1.1799 0.0719  -0.0237 -0.1470 596 GLU C OE2 
1663 N  N   . SER C 64 ? 0.8194 0.5340 0.3731 0.0480  -0.0231 -0.0655 597 SER C N   
1664 C  CA  . SER C 64 ? 0.7992 0.5446 0.3788 0.0446  -0.0259 -0.0476 597 SER C CA  
1665 C  C   . SER C 64 ? 0.7514 0.5460 0.4155 0.0323  -0.0178 -0.0386 597 SER C C   
1666 O  O   . SER C 64 ? 0.7247 0.5436 0.4228 0.0233  -0.0336 -0.0306 597 SER C O   
1667 C  CB  . SER C 64 ? 0.9201 0.6513 0.4540 0.0637  0.0022  -0.0333 597 SER C CB  
1668 O  OG  . SER C 64 ? 1.0833 0.8356 0.6541 0.0693  0.0433  -0.0241 597 SER C OG  
1669 N  N   . LEU C 65 ? 0.6656 0.4738 0.3608 0.0345  0.0032  -0.0418 598 LEU C N   
1670 C  CA  . LEU C 65 ? 0.5832 0.4328 0.3457 0.0265  0.0060  -0.0374 598 LEU C CA  
1671 C  C   . LEU C 65 ? 0.6153 0.4696 0.3991 0.0119  -0.0186 -0.0403 598 LEU C C   
1672 O  O   . LEU C 65 ? 0.5747 0.4587 0.3999 0.0046  -0.0246 -0.0331 598 LEU C O   
1673 C  CB  . LEU C 65 ? 0.5612 0.4231 0.3454 0.0362  0.0269  -0.0418 598 LEU C CB  
1674 C  CG  . LEU C 65 ? 0.5540 0.4521 0.3922 0.0329  0.0246  -0.0413 598 LEU C CG  
1675 C  CD1 . LEU C 65 ? 0.5124 0.4417 0.3901 0.0277  0.0261  -0.0352 598 LEU C CD1 
1676 C  CD2 . LEU C 65 ? 0.5436 0.4511 0.3949 0.0469  0.0377  -0.0470 598 LEU C CD2 
1677 N  N   . ARG C 66 ? 0.6241 0.4462 0.3815 0.0077  -0.0308 -0.0507 599 ARG C N   
1678 C  CA  . ARG C 66 ? 0.6193 0.4414 0.4041 -0.0094 -0.0505 -0.0525 599 ARG C CA  
1679 C  C   . ARG C 66 ? 0.6533 0.4942 0.4587 -0.0210 -0.0753 -0.0484 599 ARG C C   
1680 O  O   . ARG C 66 ? 0.6305 0.5017 0.4888 -0.0315 -0.0784 -0.0406 599 ARG C O   
1681 C  CB  . ARG C 66 ? 0.6507 0.4247 0.4016 -0.0128 -0.0594 -0.0669 599 ARG C CB  
1682 C  CG  . ARG C 66 ? 0.7473 0.5142 0.5317 -0.0351 -0.0798 -0.0697 599 ARG C CG  
1683 C  CD  . ARG C 66 ? 0.8574 0.5767 0.6244 -0.0367 -0.0748 -0.0791 599 ARG C CD  
1684 N  NE  . ARG C 66 ? 0.8761 0.6056 0.6680 -0.0295 -0.0487 -0.0649 599 ARG C NE  
1685 C  CZ  . ARG C 66 ? 1.1160 0.8699 0.9577 -0.0405 -0.0424 -0.0495 599 ARG C CZ  
1686 N  NH1 . ARG C 66 ? 1.0016 0.7782 0.8869 -0.0615 -0.0584 -0.0462 599 ARG C NH1 
1687 N  NH2 . ARG C 66 ? 0.9663 0.7233 0.8134 -0.0276 -0.0195 -0.0366 599 ARG C NH2 
1688 N  N   . SER C 67 ? 0.6381 0.4622 0.4007 -0.0155 -0.0912 -0.0521 600 SER C N   
1689 C  CA  . SER C 67 ? 0.6455 0.4881 0.4257 -0.0217 -0.1198 -0.0479 600 SER C CA  
1690 C  C   . SER C 67 ? 0.6155 0.4992 0.4390 -0.0169 -0.1067 -0.0303 600 SER C C   
1691 O  O   . SER C 67 ? 0.5948 0.5085 0.4665 -0.0244 -0.1225 -0.0246 600 SER C O   
1692 C  CB  . SER C 67 ? 0.7807 0.5891 0.4902 -0.0112 -0.1424 -0.0559 600 SER C CB  
1693 O  OG  . SER C 67 ? 1.0034 0.7981 0.6653 0.0089  -0.1155 -0.0461 600 SER C OG  
1694 N  N   . LYS C 68 ? 0.5524 0.4383 0.3675 -0.0051 -0.0770 -0.0232 601 LYS C N   
1695 C  CA  . LYS C 68 ? 0.5141 0.4308 0.3708 -0.0014 -0.0635 -0.0110 601 LYS C CA  
1696 C  C   . LYS C 68 ? 0.5420 0.4886 0.4532 -0.0086 -0.0568 -0.0118 601 LYS C C   
1697 O  O   . LYS C 68 ? 0.5475 0.5203 0.4983 -0.0088 -0.0595 -0.0048 601 LYS C O   
1698 C  CB  . LYS C 68 ? 0.5447 0.4540 0.3867 0.0093  -0.0351 -0.0062 601 LYS C CB  
1699 C  CG  . LYS C 68 ? 0.7203 0.6014 0.5099 0.0203  -0.0338 0.0033  601 LYS C CG  
1700 C  CD  . LYS C 68 ? 0.6701 0.5599 0.4723 0.0239  -0.0490 0.0169  601 LYS C CD  
1701 C  CE  . LYS C 68 ? 0.6827 0.5405 0.4247 0.0390  -0.0490 0.0306  601 LYS C CE  
1702 N  NZ  . LYS C 68 ? 0.8436 0.7110 0.6010 0.0452  -0.0695 0.0440  601 LYS C NZ  
1703 N  N   . VAL C 69 ? 0.5060 0.4454 0.4146 -0.0113 -0.0473 -0.0189 602 VAL C N   
1704 C  CA  . VAL C 69 ? 0.4711 0.4312 0.4166 -0.0139 -0.0381 -0.0171 602 VAL C CA  
1705 C  C   . VAL C 69 ? 0.5229 0.4979 0.5047 -0.0267 -0.0526 -0.0117 602 VAL C C   
1706 O  O   . VAL C 69 ? 0.5029 0.5065 0.5235 -0.0249 -0.0447 -0.0045 602 VAL C O   
1707 C  CB  . VAL C 69 ? 0.5191 0.4614 0.4456 -0.0100 -0.0259 -0.0225 602 VAL C CB  
1708 C  CG1 . VAL C 69 ? 0.4962 0.4497 0.4481 -0.0118 -0.0175 -0.0162 602 VAL C CG1 
1709 C  CG2 . VAL C 69 ? 0.5052 0.4509 0.4205 0.0041  -0.0108 -0.0272 602 VAL C CG2 
1710 N  N   . ASP C 70 ? 0.5060 0.4626 0.4779 -0.0386 -0.0745 -0.0169 603 ASP C N   
1711 C  CA  . ASP C 70 ? 0.5109 0.4858 0.5307 -0.0543 -0.0934 -0.0142 603 ASP C CA  
1712 C  C   . ASP C 70 ? 0.5255 0.5363 0.5803 -0.0489 -0.1043 -0.0058 603 ASP C C   
1713 O  O   . ASP C 70 ? 0.5099 0.5549 0.6251 -0.0545 -0.1018 0.0025  603 ASP C O   
1714 C  CB  . ASP C 70 ? 0.5877 0.5315 0.5855 -0.0674 -0.1226 -0.0280 603 ASP C CB  
1715 C  CG  . ASP C 70 ? 0.7575 0.6628 0.7353 -0.0753 -0.1132 -0.0361 603 ASP C CG  
1716 O  OD1 . ASP C 70 ? 0.7546 0.6625 0.7447 -0.0719 -0.0846 -0.0267 603 ASP C OD1 
1717 O  OD2 . ASP C 70 ? 0.8959 0.7646 0.8417 -0.0824 -0.1356 -0.0521 603 ASP C OD2 
1718 N  N   . GLU C 71 ? 0.4706 0.4721 0.4887 -0.0359 -0.1122 -0.0054 604 GLU C N   
1719 C  CA  . GLU C 71 ? 0.4579 0.4850 0.5019 -0.0260 -0.1207 0.0047  604 GLU C CA  
1720 C  C   . GLU C 71 ? 0.4722 0.5246 0.5536 -0.0175 -0.0925 0.0123  604 GLU C C   
1721 O  O   . GLU C 71 ? 0.4539 0.5378 0.5844 -0.0134 -0.0953 0.0201  604 GLU C O   
1722 C  CB  . GLU C 71 ? 0.5059 0.5064 0.4929 -0.0116 -0.1272 0.0076  604 GLU C CB  
1723 C  CG  . GLU C 71 ? 0.6512 0.6293 0.5950 -0.0116 -0.1620 0.0014  604 GLU C CG  
1724 C  CD  . GLU C 71 ? 0.9263 0.8767 0.8083 0.0082  -0.1615 0.0109  604 GLU C CD  
1725 O  OE1 . GLU C 71 ? 0.7047 0.6285 0.5453 0.0141  -0.1329 0.0123  604 GLU C OE1 
1726 O  OE2 . GLU C 71 ? 0.9758 0.9323 0.8548 0.0192  -0.1875 0.0194  604 GLU C OE2 
1727 N  N   . ALA C 72 ? 0.4099 0.4489 0.4682 -0.0128 -0.0675 0.0080  605 ALA C N   
1728 C  CA  . ALA C 72 ? 0.3812 0.4370 0.4626 -0.0031 -0.0449 0.0089  605 ALA C CA  
1729 C  C   . ALA C 72 ? 0.4207 0.5004 0.5406 -0.0067 -0.0344 0.0130  605 ALA C C   
1730 O  O   . ALA C 72 ? 0.4134 0.5161 0.5656 0.0030  -0.0231 0.0174  605 ALA C O   
1731 C  CB  . ALA C 72 ? 0.3837 0.4217 0.4335 0.0019  -0.0289 -0.0001 605 ALA C CB  
1732 N  N   . VAL C 73 ? 0.3793 0.4501 0.4963 -0.0198 -0.0356 0.0128  606 VAL C N   
1733 C  CA  . VAL C 73 ? 0.3743 0.4614 0.5285 -0.0262 -0.0207 0.0215  606 VAL C CA  
1734 C  C   . VAL C 73 ? 0.4151 0.5389 0.6338 -0.0314 -0.0296 0.0303  606 VAL C C   
1735 O  O   . VAL C 73 ? 0.4059 0.5558 0.6634 -0.0253 -0.0067 0.0402  606 VAL C O   
1736 C  CB  . VAL C 73 ? 0.4466 0.5068 0.5865 -0.0417 -0.0221 0.0203  606 VAL C CB  
1737 C  CG1 . VAL C 73 ? 0.4478 0.5237 0.6408 -0.0541 -0.0069 0.0339  606 VAL C CG1 
1738 C  CG2 . VAL C 73 ? 0.4433 0.4746 0.5288 -0.0302 -0.0075 0.0149  606 VAL C CG2 
1739 N  N   . ALA C 74 ? 0.3735 0.5008 0.6021 -0.0387 -0.0625 0.0270  607 ALA C N   
1740 C  CA  . ALA C 74 ? 0.3663 0.5347 0.6632 -0.0411 -0.0783 0.0344  607 ALA C CA  
1741 C  C   . ALA C 74 ? 0.3798 0.5714 0.6950 -0.0181 -0.0637 0.0414  607 ALA C C   
1742 O  O   . ALA C 74 ? 0.3760 0.6078 0.7572 -0.0143 -0.0550 0.0510  607 ALA C O   
1743 C  CB  . ALA C 74 ? 0.4046 0.5667 0.6929 -0.0483 -0.1228 0.0270  607 ALA C CB  
1744 N  N   . VAL C 75 ? 0.3215 0.4867 0.5836 -0.0030 -0.0587 0.0364  608 VAL C N   
1745 C  CA  . VAL C 75 ? 0.3074 0.4813 0.5799 0.0185  -0.0450 0.0393  608 VAL C CA  
1746 C  C   . VAL C 75 ? 0.3523 0.5416 0.6439 0.0274  -0.0100 0.0401  608 VAL C C   
1747 O  O   . VAL C 75 ? 0.3434 0.5584 0.6759 0.0426  0.0025  0.0459  608 VAL C O   
1748 C  CB  . VAL C 75 ? 0.3655 0.5019 0.5823 0.0271  -0.0449 0.0325  608 VAL C CB  
1749 C  CG1 . VAL C 75 ? 0.3615 0.4980 0.5903 0.0471  -0.0289 0.0318  608 VAL C CG1 
1750 C  CG2 . VAL C 75 ? 0.3898 0.5076 0.5787 0.0242  -0.0728 0.0362  608 VAL C CG2 
1751 N  N   . LEU C 76 ? 0.3007 0.4727 0.5592 0.0214  0.0063  0.0355  609 LEU C N   
1752 C  CA  . LEU C 76 ? 0.3074 0.4850 0.5627 0.0343  0.0394  0.0369  609 LEU C CA  
1753 C  C   . LEU C 76 ? 0.4166 0.6269 0.7287 0.0298  0.0594  0.0535  609 LEU C C   
1754 O  O   . LEU C 76 ? 0.4464 0.6674 0.7624 0.0482  0.0914  0.0584  609 LEU C O   
1755 C  CB  . LEU C 76 ? 0.3046 0.4516 0.5018 0.0333  0.0469  0.0290  609 LEU C CB  
1756 C  CG  . LEU C 76 ? 0.3543 0.4763 0.5059 0.0412  0.0374  0.0119  609 LEU C CG  
1757 C  CD1 . LEU C 76 ? 0.3585 0.4578 0.4656 0.0381  0.0381  0.0060  609 LEU C CD1 
1758 C  CD2 . LEU C 76 ? 0.3884 0.5115 0.5340 0.0636  0.0502  0.0013  609 LEU C CD2 
1759 N  N   . GLN C 77 ? 0.3750 0.5995 0.7309 0.0060  0.0416  0.0612  610 GLN C N   
1760 C  CA  A GLN C 77 ? 0.3805 0.6389 0.8095 -0.0066 0.0576  0.0775  610 GLN C CA  
1761 C  CA  B GLN C 77 ? 0.3835 0.6408 0.8092 -0.0049 0.0610  0.0778  610 GLN C CA  
1762 C  C   . GLN C 77 ? 0.4324 0.7369 0.9260 0.0111  0.0746  0.0872  610 GLN C C   
1763 O  O   . GLN C 77 ? 0.4356 0.7587 0.9562 0.0170  0.0481  0.0834  610 GLN C O   
1764 C  CB  A GLN C 77 ? 0.3970 0.6610 0.8656 -0.0365 0.0208  0.0754  610 GLN C CB  
1765 C  CB  B GLN C 77 ? 0.4051 0.6654 0.8707 -0.0368 0.0328  0.0785  610 GLN C CB  
1766 C  CG  A GLN C 77 ? 0.5112 0.8119 1.0738 -0.0573 0.0319  0.0902  610 GLN C CG  
1767 C  CG  B GLN C 77 ? 0.5416 0.8228 1.0759 -0.0547 0.0601  0.0962  610 GLN C CG  
1768 C  CD  A GLN C 77 ? 0.6371 0.9505 1.2498 -0.0845 -0.0158 0.0814  610 GLN C CD  
1769 C  CD  B GLN C 77 ? 0.7228 0.9700 1.2072 -0.0489 0.1019  0.1066  610 GLN C CD  
1770 O  OE1 A GLN C 77 ? 0.5504 0.8680 1.1520 -0.0796 -0.0572 0.0698  610 GLN C OE1 
1771 O  OE1 B GLN C 77 ? 0.7347 0.9357 1.1520 -0.0529 0.0942  0.0987  610 GLN C OE1 
1772 N  NE2 A GLN C 77 ? 0.4950 0.8131 1.1652 -0.1129 -0.0112 0.0871  610 GLN C NE2 
1773 N  NE2 B GLN C 77 ? 0.5166 0.7850 1.0300 -0.0358 0.1484  0.1262  610 GLN C NE2 
1774 N  N   . ALA C 78 ? 0.3969 0.7176 0.9123 0.0222  0.1204  0.1015  611 ALA C N   
1775 C  CA  . ALA C 78 ? 0.4016 0.7675 0.9814 0.0422  0.1476  0.1129  611 ALA C CA  
1776 C  C   . ALA C 78 ? 0.4475 0.8684 1.1423 0.0211  0.1336  0.1254  611 ALA C C   
1777 O  O   . ALA C 78 ? 0.4487 0.8673 1.1695 -0.0107 0.1147  0.1270  611 ALA C O   
1778 C  CB  . ALA C 78 ? 0.4427 0.8027 0.9990 0.0612  0.2049  0.1258  611 ALA C CB  
1779 N  N   . HIS C 79 ? 0.4079 0.8784 1.1759 0.0392  0.1417  0.1327  612 HIS C N   
1780 C  CA  . HIS C 79 ? 0.3931 0.9280 1.2862 0.0227  0.1242  0.1432  612 HIS C CA  
1781 C  C   . HIS C 79 ? 0.4927 1.0560 1.4643 -0.0018 0.1612  0.1635  612 HIS C C   
1782 O  O   . HIS C 79 ? 0.4975 1.0998 1.5658 -0.0319 0.1340  0.1663  612 HIS C O   
1783 C  CB  . HIS C 79 ? 0.3918 0.9738 1.3451 0.0546  0.1297  0.1479  612 HIS C CB  
1784 C  CG  . HIS C 79 ? 0.4517 1.0470 1.4130 0.0847  0.1957  0.1609  612 HIS C CG  
1785 N  ND1 . HIS C 79 ? 0.4891 1.0340 1.3458 0.1152  0.2209  0.1502  612 HIS C ND1 
1786 C  CD2 . HIS C 79 ? 0.4804 1.1325 1.5411 0.0891  0.2408  0.1824  612 HIS C CD2 
1787 C  CE1 . HIS C 79 ? 0.5064 1.0740 1.3895 0.1401  0.2791  0.1641  612 HIS C CE1 
1788 N  NE2 . HIS C 79 ? 0.5075 1.1403 1.5132 0.1262  0.2969  0.1859  612 HIS C NE2 
1789 N  N   . GLN C 80 ? 0.4825 1.0230 1.4113 0.0110  0.2213  0.1773  613 GLN C N   
1790 C  CA  . GLN C 80 ? 0.9110 1.4698 1.9069 -0.0094 0.2667  0.2025  613 GLN C CA  
1791 C  C   . GLN C 80 ? 1.2860 1.7883 2.2262 -0.0397 0.2568  0.2006  613 GLN C C   
1792 O  O   . GLN C 80 ? 0.7327 1.2055 1.6330 -0.0573 0.2021  0.1792  613 GLN C O   
1793 C  CB  . GLN C 80 ? 0.9637 1.5243 1.9373 0.0255  0.3423  0.2231  613 GLN C CB  
1794 N  N   . GLU D 5  ? 1.4396 1.2187 1.0220 0.5369  0.2409  0.1259  538 GLU D N   
1795 C  CA  . GLU D 5  ? 1.3779 1.2472 1.0176 0.5257  0.2429  0.1322  538 GLU D CA  
1796 C  C   . GLU D 5  ? 1.3123 1.2845 1.0554 0.4689  0.2235  0.1389  538 GLU D C   
1797 O  O   . GLU D 5  ? 1.2958 1.2448 1.0550 0.4270  0.2048  0.1270  538 GLU D O   
1798 C  CB  . GLU D 5  ? 1.4342 1.2229 1.0199 0.5078  0.2389  0.1047  538 GLU D CB  
1799 N  N   . THR D 6  ? 1.1736 1.2554 0.9808 0.4680  0.2285  0.1589  539 THR D N   
1800 C  CA  . THR D 6  ? 1.0498 1.2209 0.9440 0.4153  0.2106  0.1662  539 THR D CA  
1801 C  C   . THR D 6  ? 0.9978 1.1539 0.8969 0.3790  0.2025  0.1489  539 THR D C   
1802 O  O   . THR D 6  ? 1.0300 1.1821 0.9023 0.4036  0.2172  0.1508  539 THR D O   
1803 C  CB  . THR D 6  ? 1.1287 1.4293 1.0868 0.4329  0.2191  0.2032  539 THR D CB  
1804 O  OG1 . THR D 6  ? 1.1933 1.5112 1.1600 0.4479  0.2159  0.2151  539 THR D OG1 
1805 C  CG2 . THR D 6  ? 0.9919 1.3755 1.0251 0.3785  0.2033  0.2117  539 THR D CG2 
1806 N  N   . LEU D 7  ? 0.8297 0.9765 0.7582 0.3249  0.1799  0.1326  540 LEU D N   
1807 C  CA  . LEU D 7  ? 0.7646 0.8973 0.6966 0.2927  0.1704  0.1167  540 LEU D CA  
1808 C  C   . LEU D 7  ? 0.7310 0.9526 0.7175 0.2806  0.1724  0.1382  540 LEU D C   
1809 O  O   . LEU D 7  ? 0.6955 0.9726 0.7347 0.2508  0.1602  0.1493  540 LEU D O   
1810 C  CB  . LEU D 7  ? 0.7225 0.8163 0.6617 0.2468  0.1478  0.0938  540 LEU D CB  
1811 C  CG  . LEU D 7  ? 0.7441 0.8213 0.6825 0.2173  0.1364  0.0763  540 LEU D CG  
1812 C  CD1 . LEU D 7  ? 0.7960 0.8120 0.6737 0.2360  0.1436  0.0615  540 LEU D CD1 
1813 C  CD2 . LEU D 7  ? 0.7194 0.7734 0.6684 0.1796  0.1169  0.0584  540 LEU D CD2 
1814 N  N   . THR D 8  ? 0.6492 0.8794 0.6162 0.3036  0.1881  0.1448  541 THR D N   
1815 C  CA  . THR D 8  ? 0.5875 0.8946 0.5965 0.2918  0.1930  0.1669  541 THR D CA  
1816 C  C   . THR D 8  ? 0.5759 0.8525 0.5843 0.2538  0.1780  0.1497  541 THR D C   
1817 O  O   . THR D 8  ? 0.5706 0.7747 0.5419 0.2467  0.1681  0.1220  541 THR D O   
1818 C  CB  . THR D 8  ? 0.6496 0.9868 0.6360 0.3402  0.2205  0.1861  541 THR D CB  
1819 O  OG1 . THR D 8  ? 0.6745 0.9311 0.5954 0.3580  0.2259  0.1635  541 THR D OG1 
1820 C  CG2 . THR D 8  ? 0.6223 0.9907 0.6028 0.3887  0.2378  0.2049  541 THR D CG2 
1821 N  N   . ALA D 9  ? 0.4926 0.8258 0.5393 0.2294  0.1761  0.1678  542 ALA D N   
1822 C  CA  . ALA D 9  ? 0.4773 0.7839 0.5190 0.2000  0.1645  0.1564  542 ALA D CA  
1823 C  C   . ALA D 9  ? 0.5482 0.8103 0.5382 0.2259  0.1756  0.1445  542 ALA D C   
1824 O  O   . ALA D 9  ? 0.5542 0.7641 0.5201 0.2117  0.1622  0.1215  542 ALA D O   
1825 C  CB  . ALA D 9  ? 0.4659 0.8352 0.5492 0.1707  0.1628  0.1826  542 ALA D CB  
1826 N  N   . SER D 10 ? 0.5322 0.8151 0.5011 0.2670  0.1996  0.1595  543 SER D N   
1827 C  CA  . SER D 10 ? 0.5745 0.8100 0.4841 0.2962  0.2111  0.1479  543 SER D CA  
1828 C  C   . SER D 10 ? 0.6720 0.8178 0.5254 0.3069  0.2020  0.1149  543 SER D C   
1829 O  O   . SER D 10 ? 0.7012 0.7952 0.5139 0.3029  0.1942  0.0947  543 SER D O   
1830 C  CB  . SER D 10 ? 0.6218 0.9026 0.5183 0.3416  0.2411  0.1736  543 SER D CB  
1831 O  OG  . SER D 10 ? 0.7716 1.0801 0.6755 0.3723  0.2533  0.1863  543 SER D OG  
1832 N  N   . ARG D 11 ? 0.6415 0.7681 0.4912 0.3161  0.2007  0.1101  544 ARG D N   
1833 C  CA  . ARG D 11 ? 0.6876 0.7238 0.4809 0.3188  0.1910  0.0808  544 ARG D CA  
1834 C  C   . ARG D 11 ? 0.6929 0.7045 0.5020 0.2703  0.1637  0.0584  544 ARG D C   
1835 O  O   . ARG D 11 ? 0.7417 0.6916 0.5046 0.2625  0.1529  0.0345  544 ARG D O   
1836 C  CB  . ARG D 11 ? 0.7428 0.7644 0.5264 0.3415  0.1982  0.0856  544 ARG D CB  
1837 C  CG  . ARG D 11 ? 1.0677 0.9955 0.8003 0.3311  0.1849  0.0584  544 ARG D CG  
1838 C  CD  . ARG D 11 ? 1.4399 1.2733 1.0799 0.3556  0.1900  0.0387  544 ARG D CD  
1839 N  NE  . ARG D 11 ? 1.6285 1.3797 1.2286 0.3220  0.1689  0.0106  544 ARG D NE  
1840 C  CZ  . ARG D 11 ? 1.8173 1.5419 1.4024 0.2887  0.1502  -0.0104 544 ARG D CZ  
1841 N  NH1 . ARG D 11 ? 1.5482 1.3127 1.1495 0.2878  0.1501  -0.0079 544 ARG D NH1 
1842 N  NH2 . ARG D 11 ? 1.6962 1.3576 1.2491 0.2554  0.1312  -0.0321 544 ARG D NH2 
1843 N  N   . LEU D 12 ? 0.5455 0.6075 0.4162 0.2390  0.1524  0.0670  545 LEU D N   
1844 C  CA  . LEU D 12 ? 0.5060 0.5530 0.3910 0.2012  0.1299  0.0490  545 LEU D CA  
1845 C  C   . LEU D 12 ? 0.5914 0.6333 0.4619 0.1949  0.1245  0.0422  545 LEU D C   
1846 O  O   . LEU D 12 ? 0.6290 0.6358 0.4775 0.1803  0.1093  0.0209  545 LEU D O   
1847 C  CB  . LEU D 12 ? 0.4381 0.5316 0.3812 0.1748  0.1204  0.0597  545 LEU D CB  
1848 C  CG  . LEU D 12 ? 0.4497 0.5280 0.4040 0.1431  0.0995  0.0418  545 LEU D CG  
1849 C  CD1 . LEU D 12 ? 0.4480 0.4886 0.3867 0.1358  0.0923  0.0255  545 LEU D CD1 
1850 C  CD2 . LEU D 12 ? 0.4108 0.5291 0.4088 0.1217  0.0919  0.0539  545 LEU D CD2 
1851 N  N   . ALA D 13 ? 0.5326 0.6122 0.4141 0.2055  0.1368  0.0620  546 ALA D N   
1852 C  CA  . ALA D 13 ? 0.5426 0.6173 0.4065 0.2035  0.1341  0.0597  546 ALA D CA  
1853 C  C   . ALA D 13 ? 0.6610 0.6823 0.4612 0.2233  0.1347  0.0405  546 ALA D C   
1854 O  O   . ALA D 13 ? 0.6840 0.6892 0.4651 0.2149  0.1227  0.0285  546 ALA D O   
1855 C  CB  . ALA D 13 ? 0.5443 0.6684 0.4275 0.2117  0.1510  0.0887  546 ALA D CB  
1856 N  N   . SER D 14 ? 0.6601 0.6504 0.4220 0.2507  0.1476  0.0375  547 SER D N   
1857 C  CA  . SER D 14 ? 0.7338 0.6585 0.4208 0.2710  0.1485  0.0183  547 SER D CA  
1858 C  C   . SER D 14 ? 0.8124 0.6826 0.4732 0.2440  0.1245  -0.0103 547 SER D C   
1859 O  O   . SER D 14 ? 0.8875 0.7026 0.4859 0.2479  0.1172  -0.0291 547 SER D O   
1860 C  CB  . SER D 14 ? 0.8295 0.7319 0.4772 0.3133  0.1718  0.0266  547 SER D CB  
1861 O  OG  . SER D 14 ? 0.9557 0.9241 0.6329 0.3381  0.1953  0.0569  547 SER D OG  
1862 N  N   . ALA D 15 ? 0.7053 0.5912 0.4102 0.2155  0.1122  -0.0128 548 ALA D N   
1863 C  CA  . ALA D 15 ? 0.7053 0.5542 0.3956 0.1848  0.0906  -0.0354 548 ALA D CA  
1864 C  C   . ALA D 15 ? 0.7216 0.6006 0.4350 0.1581  0.0702  -0.0439 548 ALA D C   
1865 O  O   . ALA D 15 ? 0.6467 0.5754 0.4023 0.1588  0.0725  -0.0302 548 ALA D O   
1866 C  CB  . ALA D 15 ? 0.6702 0.5284 0.3965 0.1703  0.0895  -0.0311 548 ALA D CB  
1867 N  N   . PRO D 16 ? 0.7241 0.5747 0.4082 0.1341  0.0497  -0.0649 549 PRO D N   
1868 C  CA  . PRO D 16 ? 0.6849 0.5772 0.3944 0.1139  0.0304  -0.0705 549 PRO D CA  
1869 C  C   . PRO D 16 ? 0.6297 0.5767 0.4065 0.1000  0.0275  -0.0604 549 PRO D C   
1870 O  O   . PRO D 16 ? 0.5987 0.5439 0.3968 0.0902  0.0311  -0.0578 549 PRO D O   
1871 C  CB  . PRO D 16 ? 0.7519 0.6126 0.4237 0.0854  0.0087  -0.0920 549 PRO D CB  
1872 C  CG  . PRO D 16 ? 0.8754 0.6590 0.4844 0.0938  0.0168  -0.0998 549 PRO D CG  
1873 C  CD  . PRO D 16 ? 0.8063 0.5875 0.4319 0.1225  0.0420  -0.0828 549 PRO D CD  
1874 N  N   . PRO D 17 ? 0.5188 0.5080 0.3221 0.1018  0.0215  -0.0547 550 PRO D N   
1875 C  CA  . PRO D 17 ? 0.4503 0.4795 0.3046 0.0926  0.0188  -0.0466 550 PRO D CA  
1876 C  C   . PRO D 17 ? 0.5103 0.5515 0.3823 0.0676  0.0068  -0.0565 550 PRO D C   
1877 O  O   . PRO D 17 ? 0.4774 0.5342 0.3826 0.0619  0.0106  -0.0499 550 PRO D O   
1878 C  CB  . PRO D 17 ? 0.4615 0.5169 0.3187 0.1017  0.0113  -0.0434 550 PRO D CB  
1879 C  CG  . PRO D 17 ? 0.5496 0.5821 0.3672 0.1201  0.0181  -0.0415 550 PRO D CG  
1880 C  CD  . PRO D 17 ? 0.5378 0.5323 0.3173 0.1156  0.0173  -0.0550 550 PRO D CD  
1881 N  N   . GLN D 18 ? 0.5179 0.5497 0.3642 0.0498  -0.0076 -0.0715 551 GLN D N   
1882 C  CA  . GLN D 18 ? 0.5060 0.5516 0.3656 0.0193  -0.0193 -0.0792 551 GLN D CA  
1883 C  C   . GLN D 18 ? 0.5551 0.5642 0.4125 0.0112  -0.0087 -0.0770 551 GLN D C   
1884 O  O   . GLN D 18 ? 0.5343 0.5610 0.4131 -0.0110 -0.0136 -0.0775 551 GLN D O   
1885 C  CB  . GLN D 18 ? 0.5682 0.6034 0.3914 -0.0043 -0.0380 -0.0943 551 GLN D CB  
1886 C  CG  . GLN D 18 ? 0.6322 0.7142 0.4580 0.0006  -0.0530 -0.0968 551 GLN D CG  
1887 C  CD  . GLN D 18 ? 0.8143 0.8590 0.5935 0.0217  -0.0512 -0.1006 551 GLN D CD  
1888 O  OE1 . GLN D 18 ? 0.6901 0.6973 0.4548 0.0466  -0.0323 -0.0937 551 GLN D OE1 
1889 N  NE2 . GLN D 18 ? 0.7544 0.8177 0.5109 0.0134  -0.0708 -0.1097 551 GLN D NE2 
1890 N  N   . LYS D 19 ? 0.5405 0.5014 0.3696 0.0313  0.0064  -0.0732 552 LYS D N   
1891 C  CA  . LYS D 19 ? 0.5623 0.4831 0.3800 0.0303  0.0169  -0.0702 552 LYS D CA  
1892 C  C   . LYS D 19 ? 0.5766 0.5183 0.4306 0.0504  0.0327  -0.0530 552 LYS D C   
1893 O  O   . LYS D 19 ? 0.5950 0.5149 0.4464 0.0512  0.0403  -0.0484 552 LYS D O   
1894 C  CB  . LYS D 19 ? 0.6565 0.5028 0.4058 0.0427  0.0227  -0.0779 552 LYS D CB  
1895 C  CG  . LYS D 19 ? 0.9399 0.7505 0.6388 0.0186  0.0044  -0.0966 552 LYS D CG  
1896 C  CD  . LYS D 19 ? 1.1590 0.9656 0.8594 -0.0262 -0.0115 -0.1043 552 LYS D CD  
1897 C  CE  . LYS D 19 ? 1.3137 1.1213 0.9867 -0.0596 -0.0356 -0.1193 552 LYS D CE  
1898 N  NZ  . LYS D 19 ? 1.4008 1.2250 1.0875 -0.1076 -0.0503 -0.1218 552 LYS D NZ  
1899 N  N   . GLN D 20 ? 0.4885 0.4697 0.3722 0.0644  0.0365  -0.0428 553 GLN D N   
1900 C  CA  . GLN D 20 ? 0.4546 0.4567 0.3685 0.0783  0.0489  -0.0254 553 GLN D CA  
1901 C  C   . GLN D 20 ? 0.4740 0.4961 0.4224 0.0641  0.0459  -0.0213 553 GLN D C   
1902 O  O   . GLN D 20 ? 0.4794 0.4979 0.4344 0.0725  0.0553  -0.0109 553 GLN D O   
1903 C  CB  . GLN D 20 ? 0.4434 0.4751 0.3735 0.0891  0.0517  -0.0148 553 GLN D CB  
1904 C  CG  . GLN D 20 ? 0.4149 0.4282 0.3100 0.1097  0.0608  -0.0132 553 GLN D CG  
1905 C  CD  . GLN D 20 ? 0.5660 0.6027 0.4693 0.1169  0.0625  -0.0029 553 GLN D CD  
1906 O  OE1 . GLN D 20 ? 0.5434 0.6015 0.4713 0.1066  0.0547  0.0005  553 GLN D OE1 
1907 N  NE2 . GLN D 20 ? 0.5834 0.6099 0.4585 0.1364  0.0733  0.0022  553 GLN D NE2 
1908 N  N   . LYS D 21 ? 0.3904 0.4369 0.3589 0.0468  0.0340  -0.0275 554 LYS D N   
1909 C  CA  . LYS D 21 ? 0.3613 0.4244 0.3566 0.0364  0.0326  -0.0235 554 LYS D CA  
1910 C  C   . LYS D 21 ? 0.4511 0.4853 0.4311 0.0262  0.0354  -0.0264 554 LYS D C   
1911 O  O   . LYS D 21 ? 0.4427 0.4769 0.4343 0.0284  0.0406  -0.0179 554 LYS D O   
1912 C  CB  . LYS D 21 ? 0.3591 0.4556 0.3734 0.0267  0.0221  -0.0285 554 LYS D CB  
1913 C  CG  . LYS D 21 ? 0.3114 0.4244 0.3339 0.0393  0.0199  -0.0236 554 LYS D CG  
1914 C  CD  . LYS D 21 ? 0.3135 0.4250 0.3495 0.0432  0.0243  -0.0113 554 LYS D CD  
1915 C  CE  . LYS D 21 ? 0.3121 0.4259 0.3454 0.0504  0.0202  -0.0073 554 LYS D CE  
1916 N  NZ  . LYS D 21 ? 0.3132 0.4202 0.3533 0.0465  0.0221  0.0056  554 LYS D NZ  
1917 N  N   . GLN D 22 ? 0.4521 0.4562 0.3998 0.0146  0.0310  -0.0377 555 GLN D N   
1918 C  CA  . GLN D 22 ? 0.5099 0.4686 0.4281 0.0022  0.0330  -0.0409 555 GLN D CA  
1919 C  C   . GLN D 22 ? 0.6113 0.5348 0.5105 0.0285  0.0477  -0.0309 555 GLN D C   
1920 O  O   . GLN D 22 ? 0.6242 0.5361 0.5248 0.0285  0.0526  -0.0238 555 GLN D O   
1921 C  CB  . GLN D 22 ? 0.5767 0.4985 0.4519 -0.0173 0.0234  -0.0553 555 GLN D CB  
1922 C  CG  . GLN D 22 ? 0.6692 0.5309 0.5029 -0.0391 0.0226  -0.0594 555 GLN D CG  
1923 C  CD  . GLN D 22 ? 0.9482 0.8361 0.8100 -0.0639 0.0205  -0.0537 555 GLN D CD  
1924 O  OE1 . GLN D 22 ? 0.8868 0.8343 0.7849 -0.0840 0.0115  -0.0546 555 GLN D OE1 
1925 N  NE2 . GLN D 22 ? 0.8864 0.7309 0.7286 -0.0594 0.0301  -0.0465 555 GLN D NE2 
1926 N  N   . MSE D 23 ? 0.5788 0.4923 0.4610 0.0539  0.0554  -0.0282 556 MSE D N   
1927 C  CA  . MSE D 23 ? 0.5862 0.4810 0.4521 0.0860  0.0712  -0.0159 556 MSE D CA  
1928 C  C   . MSE D 23 ? 0.5370 0.4801 0.4491 0.0937  0.0759  0.0013  556 MSE D C   
1929 O  O   . MSE D 23 ? 0.5443 0.4731 0.4465 0.1101  0.0847  0.0111  556 MSE D O   
1930 C  CB  . MSE D 23 ? 0.6374 0.5325 0.4859 0.1111  0.0794  -0.0136 556 MSE D CB  
1931 C  CG  . MSE D 23 ? 0.8111 0.6420 0.5958 0.1129  0.0775  -0.0294 556 MSE D CG  
1932 SE SE  . MSE D 23 ? 0.9456 0.7862 0.7101 0.1489  0.0902  -0.0239 556 MSE D SE  
1933 C  CE  . MSE D 23 ? 0.9420 0.7676 0.6837 0.1992  0.1167  -0.0039 556 MSE D CE  
1934 N  N   . LEU D 24 ? 0.4279 0.4232 0.3841 0.0828  0.0691  0.0053  557 LEU D N   
1935 C  CA  . LEU D 24 ? 0.3865 0.4239 0.3814 0.0837  0.0694  0.0202  557 LEU D CA  
1936 C  C   . LEU D 24 ? 0.4734 0.5034 0.4736 0.0699  0.0646  0.0183  557 LEU D C   
1937 O  O   . LEU D 24 ? 0.4827 0.5238 0.4921 0.0794  0.0686  0.0308  557 LEU D O   
1938 C  CB  . LEU D 24 ? 0.3392 0.4147 0.3642 0.0729  0.0618  0.0226  557 LEU D CB  
1939 C  CG  . LEU D 24 ? 0.3825 0.4735 0.4072 0.0862  0.0686  0.0316  557 LEU D CG  
1940 C  CD1 . LEU D 24 ? 0.3563 0.4608 0.3924 0.0730  0.0592  0.0284  557 LEU D CD1 
1941 C  CD2 . LEU D 24 ? 0.3386 0.4652 0.3834 0.0988  0.0777  0.0538  557 LEU D CD2 
1942 N  N   . GLY D 25 ? 0.4415 0.4563 0.4338 0.0486  0.0567  0.0045  558 GLY D N   
1943 C  CA  . GLY D 25 ? 0.4451 0.4530 0.4387 0.0333  0.0538  0.0034  558 GLY D CA  
1944 C  C   . GLY D 25 ? 0.5424 0.5055 0.5039 0.0429  0.0623  0.0088  558 GLY D C   
1945 O  O   . GLY D 25 ? 0.5417 0.5096 0.5106 0.0449  0.0639  0.0177  558 GLY D O   
1946 N  N   . GLU D 26 ? 0.5473 0.4606 0.4660 0.0520  0.0676  0.0034  559 GLU D N   
1947 C  CA  . GLU D 26 ? 0.6087 0.4603 0.4794 0.0678  0.0771  0.0076  559 GLU D CA  
1948 C  C   . GLU D 26 ? 0.6579 0.5313 0.5401 0.1027  0.0876  0.0264  559 GLU D C   
1949 O  O   . GLU D 26 ? 0.6998 0.5405 0.5571 0.1145  0.0933  0.0342  559 GLU D O   
1950 C  CB  . GLU D 26 ? 0.6877 0.4762 0.5013 0.0759  0.0805  -0.0030 559 GLU D CB  
1951 C  CG  . GLU D 26 ? 0.8754 0.6286 0.6635 0.0362  0.0683  -0.0198 559 GLU D CG  
1952 C  CD  . GLU D 26 ? 1.2028 0.9030 0.9382 0.0336  0.0646  -0.0343 559 GLU D CD  
1953 O  OE1 . GLU D 26 ? 1.2649 0.9662 0.9901 0.0647  0.0721  -0.0333 559 GLU D OE1 
1954 O  OE2 . GLU D 26 ? 1.1179 0.7827 0.8245 -0.0032 0.0530  -0.0462 559 GLU D OE2 
1955 N  N   . ARG D 27 ? 0.5645 0.4955 0.4833 0.1175  0.0893  0.0354  560 ARG D N   
1956 C  CA  . ARG D 27 ? 0.5480 0.5205 0.4869 0.1464  0.0972  0.0562  560 ARG D CA  
1957 C  C   . ARG D 27 ? 0.5445 0.5680 0.5279 0.1299  0.0872  0.0644  560 ARG D C   
1958 O  O   . ARG D 27 ? 0.5556 0.5985 0.5447 0.1474  0.0903  0.0799  560 ARG D O   
1959 C  CB  . ARG D 27 ? 0.5186 0.5351 0.4757 0.1651  0.1039  0.0657  560 ARG D CB  
1960 C  CG  . ARG D 27 ? 0.6561 0.6287 0.5697 0.1817  0.1130  0.0564  560 ARG D CG  
1961 C  CD  . ARG D 27 ? 0.8485 0.7530 0.6990 0.2147  0.1262  0.0566  560 ARG D CD  
1962 N  NE  . ARG D 27 ? 1.0832 0.9638 0.8956 0.2427  0.1382  0.0545  560 ARG D NE  
1963 C  CZ  . ARG D 27 ? 1.3418 1.2504 1.1487 0.2877  0.1557  0.0731  560 ARG D CZ  
1964 N  NH1 . ARG D 27 ? 1.0757 1.0424 0.9166 0.3073  0.1614  0.0958  560 ARG D NH1 
1965 N  NH2 . ARG D 27 ? 1.3650 1.2490 1.1319 0.3146  0.1678  0.0704  560 ARG D NH2 
1966 N  N   . LEU D 28 ? 0.4560 0.5011 0.4664 0.0999  0.0750  0.0546  561 LEU D N   
1967 C  CA  . LEU D 28 ? 0.4193 0.5022 0.4617 0.0834  0.0641  0.0590  561 LEU D CA  
1968 C  C   . LEU D 28 ? 0.4583 0.5171 0.4861 0.0777  0.0629  0.0583  561 LEU D C   
1969 O  O   . LEU D 28 ? 0.4651 0.5491 0.5061 0.0813  0.0590  0.0696  561 LEU D O   
1970 C  CB  . LEU D 28 ? 0.3966 0.4898 0.4540 0.0599  0.0543  0.0460  561 LEU D CB  
1971 C  CG  . LEU D 28 ? 0.4426 0.5726 0.5270 0.0482  0.0439  0.0501  561 LEU D CG  
1972 C  CD1 . LEU D 28 ? 0.4430 0.6066 0.5440 0.0568  0.0462  0.0653  561 LEU D CD1 
1973 C  CD2 . LEU D 28 ? 0.4639 0.5861 0.5468 0.0344  0.0377  0.0352  561 LEU D CD2 
1974 N  N   . PHE D 29 ? 0.4024 0.4147 0.4020 0.0658  0.0654  0.0461  562 PHE D N   
1975 C  CA  . PHE D 29 ? 0.4165 0.4035 0.3995 0.0548  0.0655  0.0461  562 PHE D CA  
1976 C  C   . PHE D 29 ? 0.4916 0.4649 0.4572 0.0786  0.0718  0.0622  562 PHE D C   
1977 O  O   . PHE D 29 ? 0.4714 0.4636 0.4479 0.0737  0.0671  0.0682  562 PHE D O   
1978 C  CB  . PHE D 29 ? 0.4660 0.4034 0.4165 0.0348  0.0676  0.0339  562 PHE D CB  
1979 C  CG  . PHE D 29 ? 0.4986 0.4126 0.4320 0.0191  0.0691  0.0372  562 PHE D CG  
1980 C  CD1 . PHE D 29 ? 0.4891 0.4413 0.4483 -0.0003 0.0637  0.0355  562 PHE D CD1 
1981 C  CD2 . PHE D 29 ? 0.5743 0.4260 0.4610 0.0276  0.0772  0.0440  562 PHE D CD2 
1982 C  CE1 . PHE D 29 ? 0.5129 0.4495 0.4569 -0.0131 0.0671  0.0414  562 PHE D CE1 
1983 C  CE2 . PHE D 29 ? 0.6446 0.4735 0.5133 0.0122  0.0794  0.0498  562 PHE D CE2 
1984 C  CZ  . PHE D 29 ? 0.5737 0.4494 0.4739 -0.0090 0.0747  0.0490  562 PHE D CZ  
1985 N  N   . PRO D 30 ? 0.5102 0.4507 0.4448 0.1077  0.0823  0.0697  563 PRO D N   
1986 C  CA  . PRO D 30 ? 0.5427 0.4739 0.4586 0.1360  0.0883  0.0869  563 PRO D CA  
1987 C  C   . PRO D 30 ? 0.5513 0.5596 0.5116 0.1463  0.0810  0.1024  563 PRO D C   
1988 O  O   . PRO D 30 ? 0.5648 0.5790 0.5199 0.1563  0.0794  0.1142  563 PRO D O   
1989 C  CB  . PRO D 30 ? 0.6205 0.5083 0.4942 0.1719  0.1020  0.0913  563 PRO D CB  
1990 C  CG  . PRO D 30 ? 0.6781 0.5295 0.5345 0.1540  0.1022  0.0728  563 PRO D CG  
1991 C  CD  . PRO D 30 ? 0.5554 0.4651 0.4648 0.1218  0.0899  0.0638  563 PRO D CD  
1992 N  N   . LEU D 31 ? 0.4719 0.5370 0.4724 0.1411  0.0752  0.1030  564 LEU D N   
1993 C  CA  . LEU D 31 ? 0.4276 0.5664 0.4692 0.1411  0.0648  0.1175  564 LEU D CA  
1994 C  C   . LEU D 31 ? 0.4369 0.5870 0.4924 0.1118  0.0500  0.1110  564 LEU D C   
1995 O  O   . LEU D 31 ? 0.4294 0.6129 0.4953 0.1146  0.0413  0.1231  564 LEU D O   
1996 C  CB  . LEU D 31 ? 0.3909 0.5768 0.4640 0.1377  0.0635  0.1207  564 LEU D CB  
1997 C  CG  . LEU D 31 ? 0.4619 0.6542 0.5246 0.1730  0.0795  0.1320  564 LEU D CG  
1998 C  CD1 . LEU D 31 ? 0.4368 0.6722 0.5289 0.1634  0.0789  0.1343  564 LEU D CD1 
1999 C  CD2 . LEU D 31 ? 0.4814 0.7164 0.5481 0.2081  0.0845  0.1568  564 LEU D CD2 
2000 N  N   . ILE D 32 ? 0.3878 0.5123 0.4404 0.0865  0.0469  0.0925  565 ILE D N   
2001 C  CA  . ILE D 32 ? 0.3618 0.4914 0.4194 0.0643  0.0358  0.0850  565 ILE D CA  
2002 C  C   . ILE D 32 ? 0.4473 0.5486 0.4788 0.0696  0.0400  0.0892  565 ILE D C   
2003 O  O   . ILE D 32 ? 0.4491 0.5672 0.4818 0.0660  0.0312  0.0939  565 ILE D O   
2004 C  CB  . ILE D 32 ? 0.3737 0.4904 0.4338 0.0439  0.0340  0.0667  565 ILE D CB  
2005 C  CG1 . ILE D 32 ? 0.3458 0.4866 0.4265 0.0399  0.0291  0.0651  565 ILE D CG1 
2006 C  CG2 . ILE D 32 ? 0.3613 0.4800 0.4180 0.0292  0.0261  0.0597  565 ILE D CG2 
2007 C  CD1 . ILE D 32 ? 0.3894 0.5178 0.4691 0.0281  0.0286  0.0494  565 ILE D CD1 
2008 N  N   . GLN D 33 ? 0.4186 0.4722 0.4203 0.0787  0.0531  0.0889  566 GLN D N   
2009 C  CA  . GLN D 33 ? 0.4499 0.4628 0.4178 0.0824  0.0597  0.0946  566 GLN D CA  
2010 C  C   . GLN D 33 ? 0.5157 0.5465 0.4784 0.1090  0.0579  0.1137  566 GLN D C   
2011 O  O   . GLN D 33 ? 0.5379 0.5519 0.4799 0.1100  0.0584  0.1200  566 GLN D O   
2012 C  CB  . GLN D 33 ? 0.5127 0.4610 0.4420 0.0850  0.0723  0.0905  566 GLN D CB  
2013 C  CG  . GLN D 33 ? 0.6004 0.4926 0.4887 0.0743  0.0793  0.0930  566 GLN D CG  
2014 C  CD  . GLN D 33 ? 0.8266 0.6413 0.6642 0.0774  0.0896  0.0906  566 GLN D CD  
2015 O  OE1 . GLN D 33 ? 0.8429 0.6065 0.6472 0.0529  0.0935  0.0878  566 GLN D OE1 
2016 N  NE2 . GLN D 33 ? 0.7107 0.5116 0.5355 0.1068  0.0944  0.0928  566 GLN D NE2 
2017 N  N   . ALA D 34 ? 0.4637 0.5341 0.4454 0.1310  0.0561  0.1246  567 ALA D N   
2018 C  CA  . ALA D 34 ? 0.4815 0.5871 0.4650 0.1585  0.0528  0.1456  567 ALA D CA  
2019 C  C   . ALA D 34 ? 0.5128 0.6739 0.5245 0.1396  0.0332  0.1482  567 ALA D C   
2020 O  O   . ALA D 34 ? 0.5218 0.7148 0.5333 0.1553  0.0260  0.1644  567 ALA D O   
2021 C  CB  . ALA D 34 ? 0.4863 0.6298 0.4849 0.1880  0.0584  0.1588  567 ALA D CB  
2022 N  N   . MSE D 35 ? 0.4465 0.6160 0.4766 0.1079  0.0238  0.1323  568 MSE D N   
2023 C  CA  . MSE D 35 ? 0.4277 0.6307 0.4707 0.0878  0.0046  0.1307  568 MSE D CA  
2024 C  C   . MSE D 35 ? 0.4799 0.6452 0.4973 0.0743  0.0050  0.1187  568 MSE D C   
2025 O  O   . MSE D 35 ? 0.4824 0.6545 0.4858 0.0760  -0.0035 0.1248  568 MSE D O   
2026 C  CB  . MSE D 35 ? 0.4263 0.6562 0.4966 0.0653  -0.0061 0.1223  568 MSE D CB  
2027 C  CG  . MSE D 35 ? 0.5116 0.7932 0.6112 0.0745  -0.0075 0.1380  568 MSE D CG  
2028 SE SE  . MSE D 35 ? 0.5950 0.8872 0.7184 0.0465  -0.0133 0.1271  568 MSE D SE  
2029 C  CE  . MSE D 35 ? 0.5535 0.9195 0.7122 0.0683  -0.0062 0.1546  568 MSE D CE  
2030 N  N   . HIS D 36 ? 0.4316 0.5644 0.4436 0.0610  0.0144  0.1029  569 HIS D N   
2031 C  CA  . HIS D 36 ? 0.4302 0.5389 0.4231 0.0484  0.0181  0.0928  569 HIS D CA  
2032 C  C   . HIS D 36 ? 0.4843 0.5560 0.4644 0.0441  0.0353  0.0883  569 HIS D C   
2033 O  O   . HIS D 36 ? 0.4456 0.5168 0.4360 0.0306  0.0380  0.0757  569 HIS D O   
2034 C  CB  . HIS D 36 ? 0.4144 0.5362 0.4158 0.0326  0.0076  0.0785  569 HIS D CB  
2035 C  CG  . HIS D 36 ? 0.4627 0.6062 0.4619 0.0298  -0.0117 0.0821  569 HIS D CG  
2036 N  ND1 . HIS D 36 ? 0.5084 0.6466 0.4815 0.0318  -0.0177 0.0844  569 HIS D ND1 
2037 C  CD2 . HIS D 36 ? 0.4699 0.6403 0.4867 0.0227  -0.0269 0.0856  569 HIS D CD2 
2038 C  CE1 . HIS D 36 ? 0.5049 0.6636 0.4784 0.0245  -0.0385 0.0870  569 HIS D CE1 
2039 N  NE2 . HIS D 36 ? 0.4904 0.6705 0.4913 0.0163  -0.0450 0.0886  569 HIS D NE2 
2040 N  N   . PRO D 37 ? 0.4935 0.5314 0.4466 0.0542  0.0458  0.0994  570 PRO D N   
2041 C  CA  . PRO D 37 ? 0.5181 0.5109 0.4509 0.0433  0.0598  0.0958  570 PRO D CA  
2042 C  C   . PRO D 37 ? 0.5696 0.5649 0.5030 0.0170  0.0642  0.0867  570 PRO D C   
2043 O  O   . PRO D 37 ? 0.5719 0.5505 0.5035 0.0000  0.0702  0.0799  570 PRO D O   
2044 C  CB  . PRO D 37 ? 0.5855 0.5335 0.4783 0.0590  0.0684  0.1116  570 PRO D CB  
2045 C  CG  . PRO D 37 ? 0.6279 0.6069 0.5235 0.0762  0.0593  0.1227  570 PRO D CG  
2046 C  CD  . PRO D 37 ? 0.5283 0.5636 0.4632 0.0762  0.0443  0.1166  570 PRO D CD  
2047 N  N   . THR D 38 ? 0.5206 0.5391 0.4539 0.0144  0.0614  0.0878  571 THR D N   
2048 C  CA  . THR D 38 ? 0.5177 0.5502 0.4511 -0.0042 0.0684  0.0831  571 THR D CA  
2049 C  C   . THR D 38 ? 0.5333 0.5978 0.4948 -0.0123 0.0647  0.0683  571 THR D C   
2050 O  O   . THR D 38 ? 0.5387 0.6130 0.5053 -0.0302 0.0723  0.0655  571 THR D O   
2051 C  CB  . THR D 38 ? 0.5725 0.6194 0.4915 0.0032  0.0673  0.0885  571 THR D CB  
2052 O  OG1 . THR D 38 ? 0.6787 0.6934 0.5689 0.0116  0.0714  0.1039  571 THR D OG1 
2053 C  CG2 . THR D 38 ? 0.5109 0.5812 0.4288 -0.0102 0.0778  0.0868  571 THR D CG2 
2054 N  N   . LEU D 39 ? 0.4530 0.5350 0.4305 -0.0009 0.0527  0.0606  572 LEU D N   
2055 C  CA  . LEU D 39 ? 0.4302 0.5354 0.4270 -0.0043 0.0492  0.0476  572 LEU D CA  
2056 C  C   . LEU D 39 ? 0.4537 0.5521 0.4661 -0.0048 0.0458  0.0430  572 LEU D C   
2057 O  O   . LEU D 39 ? 0.4469 0.5612 0.4730 -0.0055 0.0420  0.0335  572 LEU D O   
2058 C  CB  . LEU D 39 ? 0.4269 0.5451 0.4195 0.0068  0.0385  0.0415  572 LEU D CB  
2059 C  CG  . LEU D 39 ? 0.5120 0.6362 0.4820 0.0126  0.0419  0.0432  572 LEU D CG  
2060 C  CD1 . LEU D 39 ? 0.5367 0.6525 0.4882 0.0231  0.0269  0.0378  572 LEU D CD1 
2061 C  CD2 . LEU D 39 ? 0.5184 0.6692 0.4920 0.0111  0.0537  0.0392  572 LEU D CD2 
2062 N  N   . ALA D 40 ? 0.4003 0.4731 0.4057 -0.0011 0.0485  0.0505  573 ALA D N   
2063 C  CA  . ALA D 40 ? 0.3849 0.4493 0.3987 0.0040  0.0473  0.0482  573 ALA D CA  
2064 C  C   . ALA D 40 ? 0.4258 0.4927 0.4471 -0.0089 0.0493  0.0367  573 ALA D C   
2065 O  O   . ALA D 40 ? 0.3935 0.4719 0.4287 -0.0039 0.0444  0.0311  573 ALA D O   
2066 C  CB  . ALA D 40 ? 0.4263 0.4554 0.4191 0.0154  0.0540  0.0586  573 ALA D CB  
2067 N  N   . GLY D 41 ? 0.4025 0.4627 0.4144 -0.0272 0.0554  0.0349  574 GLY D N   
2068 C  CA  . GLY D 41 ? 0.3936 0.4654 0.4133 -0.0429 0.0547  0.0254  574 GLY D CA  
2069 C  C   . GLY D 41 ? 0.4104 0.5266 0.4538 -0.0368 0.0489  0.0174  574 GLY D C   
2070 O  O   . GLY D 41 ? 0.4072 0.5302 0.4591 -0.0348 0.0445  0.0099  574 GLY D O   
2071 N  N   . LYS D 42 ? 0.3722 0.5126 0.4191 -0.0304 0.0492  0.0192  575 LYS D N   
2072 C  CA  . LYS D 42 ? 0.3497 0.5209 0.4059 -0.0181 0.0449  0.0125  575 LYS D CA  
2073 C  C   . LYS D 42 ? 0.3834 0.5389 0.4397 -0.0042 0.0356  0.0090  575 LYS D C   
2074 O  O   . LYS D 42 ? 0.3955 0.5601 0.4568 0.0020  0.0315  0.0023  575 LYS D O   
2075 C  CB  . LYS D 42 ? 0.3761 0.5634 0.4228 -0.0107 0.0489  0.0160  575 LYS D CB  
2076 C  CG  . LYS D 42 ? 0.5081 0.7406 0.5618 -0.0055 0.0537  0.0132  575 LYS D CG  
2077 C  CD  . LYS D 42 ? 0.5231 0.7712 0.5616 0.0066  0.0607  0.0176  575 LYS D CD  
2078 C  CE  . LYS D 42 ? 0.6819 0.9852 0.7337 -0.0027 0.0728  0.0248  575 LYS D CE  
2079 N  NZ  . LYS D 42 ? 0.7661 1.1158 0.8367 0.0041  0.0718  0.0202  575 LYS D NZ  
2080 N  N   . ILE D 43 ? 0.3252 0.4606 0.3754 -0.0007 0.0320  0.0155  576 ILE D N   
2081 C  CA  . ILE D 43 ? 0.3098 0.4377 0.3620 0.0056  0.0222  0.0163  576 ILE D CA  
2082 C  C   . ILE D 43 ? 0.3412 0.4669 0.4049 0.0051  0.0233  0.0151  576 ILE D C   
2083 O  O   . ILE D 43 ? 0.3394 0.4662 0.4055 0.0079  0.0176  0.0120  576 ILE D O   
2084 C  CB  . ILE D 43 ? 0.3430 0.4650 0.3909 0.0070  0.0172  0.0266  576 ILE D CB  
2085 C  CG1 . ILE D 43 ? 0.3647 0.4853 0.3940 0.0088  0.0142  0.0261  576 ILE D CG1 
2086 C  CG2 . ILE D 43 ? 0.3330 0.4589 0.3888 0.0063  0.0065  0.0309  576 ILE D CG2 
2087 C  CD1 . ILE D 43 ? 0.4672 0.5857 0.4899 0.0103  0.0104  0.0378  576 ILE D CD1 
2088 N  N   . THR D 44 ? 0.3067 0.4223 0.3699 0.0020  0.0310  0.0173  577 THR D N   
2089 C  CA  . THR D 44 ? 0.3124 0.4198 0.3775 0.0041  0.0333  0.0151  577 THR D CA  
2090 C  C   . THR D 44 ? 0.3593 0.4803 0.4292 0.0015  0.0301  0.0048  577 THR D C   
2091 O  O   . THR D 44 ? 0.3698 0.4921 0.4433 0.0077  0.0270  0.0042  577 THR D O   
2092 C  CB  . THR D 44 ? 0.3897 0.4690 0.4382 0.0009  0.0413  0.0167  577 THR D CB  
2093 O  OG1 . THR D 44 ? 0.4176 0.4848 0.4587 0.0112  0.0446  0.0284  577 THR D OG1 
2094 C  CG2 . THR D 44 ? 0.3690 0.4317 0.4088 0.0050  0.0438  0.0124  577 THR D CG2 
2095 N  N   . GLY D 45 ? 0.3116 0.4481 0.3818 -0.0065 0.0310  -0.0007 578 GLY D N   
2096 C  CA  . GLY D 45 ? 0.3040 0.4644 0.3795 -0.0048 0.0277  -0.0085 578 GLY D CA  
2097 C  C   . GLY D 45 ? 0.3549 0.5174 0.4282 0.0108  0.0222  -0.0100 578 GLY D C   
2098 O  O   . GLY D 45 ? 0.3673 0.5322 0.4393 0.0178  0.0190  -0.0138 578 GLY D O   
2099 N  N   . MSE D 46 ? 0.3070 0.4610 0.3728 0.0155  0.0202  -0.0069 579 MSE D N   
2100 C  CA  . MSE D 46 ? 0.2984 0.4374 0.3488 0.0265  0.0130  -0.0085 579 MSE D CA  
2101 C  C   . MSE D 46 ? 0.3551 0.4753 0.4063 0.0226  0.0080  -0.0038 579 MSE D C   
2102 O  O   . MSE D 46 ? 0.3606 0.4690 0.4004 0.0290  0.0041  -0.0060 579 MSE D O   
2103 C  CB  . MSE D 46 ? 0.3242 0.4518 0.3586 0.0286  0.0102  -0.0071 579 MSE D CB  
2104 C  CG  . MSE D 46 ? 0.4012 0.5521 0.4327 0.0352  0.0176  -0.0095 579 MSE D CG  
2105 SE SE  . MSE D 46 ? 0.5142 0.6484 0.5226 0.0363  0.0157  -0.0059 579 MSE D SE  
2106 C  CE  . MSE D 46 ? 0.5140 0.6106 0.4751 0.0585  0.0066  -0.0153 579 MSE D CE  
2107 N  N   . LEU D 47 ? 0.3072 0.4271 0.3700 0.0141  0.0090  0.0049  580 LEU D N   
2108 C  CA  . LEU D 47 ? 0.3045 0.4214 0.3734 0.0102  0.0063  0.0138  580 LEU D CA  
2109 C  C   . LEU D 47 ? 0.3436 0.4627 0.4168 0.0152  0.0118  0.0122  580 LEU D C   
2110 O  O   . LEU D 47 ? 0.3468 0.4635 0.4202 0.0136  0.0100  0.0190  580 LEU D O   
2111 C  CB  . LEU D 47 ? 0.3039 0.4325 0.3855 0.0066  0.0076  0.0258  580 LEU D CB  
2112 C  CG  . LEU D 47 ? 0.3750 0.5037 0.4506 0.0005  -0.0008 0.0297  580 LEU D CG  
2113 C  CD1 . LEU D 47 ? 0.3680 0.5188 0.4588 -0.0009 -0.0018 0.0453  580 LEU D CD1 
2114 C  CD2 . LEU D 47 ? 0.4412 0.5519 0.4980 -0.0083 -0.0138 0.0269  580 LEU D CD2 
2115 N  N   . LEU D 48 ? 0.2802 0.4038 0.3534 0.0185  0.0172  0.0039  581 LEU D N   
2116 C  CA  . LEU D 48 ? 0.2584 0.3816 0.3289 0.0229  0.0201  0.0003  581 LEU D CA  
2117 C  C   . LEU D 48 ? 0.3399 0.4615 0.4011 0.0298  0.0148  -0.0035 581 LEU D C   
2118 O  O   . LEU D 48 ? 0.3490 0.4694 0.4051 0.0349  0.0159  -0.0047 581 LEU D O   
2119 C  CB  . LEU D 48 ? 0.2537 0.3796 0.3215 0.0184  0.0233  -0.0078 581 LEU D CB  
2120 C  CG  . LEU D 48 ? 0.3105 0.4186 0.3725 0.0159  0.0302  -0.0040 581 LEU D CG  
2121 C  CD1 . LEU D 48 ? 0.3165 0.4170 0.3675 0.0033  0.0305  -0.0123 581 LEU D CD1 
2122 C  CD2 . LEU D 48 ? 0.3486 0.4452 0.4038 0.0275  0.0357  0.0017  581 LEU D CD2 
2123 N  N   . GLU D 49 ? 0.3433 0.4582 0.3947 0.0328  0.0092  -0.0049 582 GLU D N   
2124 C  CA  . GLU D 49 ? 0.3594 0.4595 0.3902 0.0444  0.0045  -0.0073 582 GLU D CA  
2125 C  C   . GLU D 49 ? 0.4048 0.4802 0.4259 0.0378  0.0018  0.0025  582 GLU D C   
2126 O  O   . GLU D 49 ? 0.4344 0.4914 0.4357 0.0460  -0.0001 0.0031  582 GLU D O   
2127 C  CB  . GLU D 49 ? 0.3903 0.4796 0.4013 0.0545  0.0005  -0.0121 582 GLU D CB  
2128 C  CG  . GLU D 49 ? 0.4456 0.5702 0.4670 0.0620  0.0047  -0.0186 582 GLU D CG  
2129 C  CD  . GLU D 49 ? 0.5182 0.6763 0.5453 0.0741  0.0061  -0.0231 582 GLU D CD  
2130 O  OE1 . GLU D 49 ? 0.4784 0.6263 0.4952 0.0827  0.0034  -0.0229 582 GLU D OE1 
2131 O  OE2 . GLU D 49 ? 0.4603 0.6588 0.5019 0.0738  0.0092  -0.0254 582 GLU D OE2 
2132 N  N   . ILE D 50 ? 0.3383 0.4167 0.3726 0.0228  0.0016  0.0122  583 ILE D N   
2133 C  CA  . ILE D 50 ? 0.3503 0.4202 0.3829 0.0097  -0.0009 0.0260  583 ILE D CA  
2134 C  C   . ILE D 50 ? 0.4245 0.5061 0.4636 0.0162  0.0080  0.0313  583 ILE D C   
2135 O  O   . ILE D 50 ? 0.4015 0.4993 0.4507 0.0265  0.0153  0.0255  583 ILE D O   
2136 C  CB  . ILE D 50 ? 0.3686 0.4584 0.4209 -0.0055 -0.0031 0.0368  583 ILE D CB  
2137 C  CG1 . ILE D 50 ? 0.3763 0.4480 0.4133 -0.0122 -0.0137 0.0311  583 ILE D CG1 
2138 C  CG2 . ILE D 50 ? 0.3855 0.4868 0.4457 -0.0220 -0.0046 0.0551  583 ILE D CG2 
2139 C  CD1 . ILE D 50 ? 0.3402 0.4361 0.3954 -0.0229 -0.0172 0.0393  583 ILE D CD1 
2140 N  N   . ASP D 51 ? 0.4174 0.4848 0.4440 0.0091  0.0068  0.0421  584 ASP D N   
2141 C  CA  . ASP D 51 ? 0.4202 0.4979 0.4483 0.0162  0.0162  0.0492  584 ASP D CA  
2142 C  C   . ASP D 51 ? 0.4041 0.5190 0.4589 0.0187  0.0269  0.0578  584 ASP D C   
2143 O  O   . ASP D 51 ? 0.3956 0.5318 0.4696 0.0084  0.0258  0.0672  584 ASP D O   
2144 C  CB  . ASP D 51 ? 0.5003 0.5568 0.5098 0.0027  0.0137  0.0639  584 ASP D CB  
2145 C  CG  . ASP D 51 ? 0.8119 0.8208 0.7811 0.0128  0.0076  0.0558  584 ASP D CG  
2146 O  OD1 . ASP D 51 ? 0.8246 0.8355 0.7872 0.0362  0.0093  0.0419  584 ASP D OD1 
2147 O  OD2 . ASP D 51 ? 0.9533 0.9222 0.8938 -0.0027 0.0005  0.0645  584 ASP D OD2 
2148 N  N   . ASN D 52 ? 0.3456 0.4655 0.3963 0.0355  0.0364  0.0536  585 ASN D N   
2149 C  CA  . ASN D 52 ? 0.3371 0.4780 0.3976 0.0476  0.0487  0.0586  585 ASN D CA  
2150 C  C   . ASN D 52 ? 0.3985 0.5757 0.4794 0.0429  0.0564  0.0828  585 ASN D C   
2151 O  O   . ASN D 52 ? 0.3894 0.5892 0.4847 0.0510  0.0624  0.0888  585 ASN D O   
2152 C  CB  . ASN D 52 ? 0.2855 0.4135 0.3238 0.0652  0.0558  0.0504  585 ASN D CB  
2153 C  CG  . ASN D 52 ? 0.4346 0.5430 0.4592 0.0677  0.0482  0.0287  585 ASN D CG  
2154 O  OD1 . ASN D 52 ? 0.4069 0.5144 0.4403 0.0588  0.0404  0.0205  585 ASN D OD1 
2155 N  ND2 . ASN D 52 ? 0.3343 0.4308 0.3365 0.0784  0.0501  0.0199  585 ASN D ND2 
2156 N  N   . SER D 53 ? 0.3621 0.5474 0.4433 0.0294  0.0561  0.0985  586 SER D N   
2157 C  CA  . SER D 53 ? 0.3620 0.5961 0.4677 0.0194  0.0626  0.1252  586 SER D CA  
2158 C  C   . SER D 53 ? 0.3982 0.6549 0.5270 -0.0005 0.0512  0.1319  586 SER D C   
2159 O  O   . SER D 53 ? 0.4075 0.7157 0.5621 0.0044  0.0578  0.1486  586 SER D O   
2160 C  CB  . SER D 53 ? 0.4334 0.6681 0.5315 0.0009  0.0631  0.1423  586 SER D CB  
2161 O  OG  . SER D 53 ? 0.6260 0.8147 0.6909 0.0094  0.0627  0.1300  586 SER D OG  
2162 N  N   . GLU D 54 ? 0.3585 0.5781 0.4746 -0.0188 0.0344  0.1192  587 GLU D N   
2163 C  CA  . GLU D 54 ? 0.3498 0.5820 0.4790 -0.0377 0.0212  0.1224  587 GLU D CA  
2164 C  C   . GLU D 54 ? 0.3661 0.6122 0.5075 -0.0158 0.0262  0.1138  587 GLU D C   
2165 O  O   . GLU D 54 ? 0.3615 0.6466 0.5244 -0.0200 0.0234  0.1262  587 GLU D O   
2166 C  CB  . GLU D 54 ? 0.3928 0.5697 0.4921 -0.0570 0.0038  0.1092  587 GLU D CB  
2167 C  CG  . GLU D 54 ? 0.5177 0.6974 0.6195 -0.0795 -0.0127 0.1112  587 GLU D CG  
2168 C  CD  . GLU D 54 ? 0.6735 0.9019 0.7983 -0.1103 -0.0209 0.1363  587 GLU D CD  
2169 O  OE1 . GLU D 54 ? 0.4888 0.7372 0.6200 -0.1258 -0.0169 0.1547  587 GLU D OE1 
2170 O  OE2 . GLU D 54 ? 0.6412 0.8892 0.7759 -0.1214 -0.0325 0.1385  587 GLU D OE2 
2171 N  N   . LEU D 55 ? 0.3072 0.5243 0.4333 0.0069  0.0337  0.0953  588 LEU D N   
2172 C  CA  . LEU D 55 ? 0.2895 0.5076 0.4180 0.0249  0.0394  0.0882  588 LEU D CA  
2173 C  C   . LEU D 55 ? 0.3308 0.5868 0.4721 0.0458  0.0541  0.1053  588 LEU D C   
2174 O  O   . LEU D 55 ? 0.3202 0.5924 0.4697 0.0550  0.0555  0.1109  588 LEU D O   
2175 C  CB  . LEU D 55 ? 0.2840 0.4622 0.3898 0.0365  0.0423  0.0662  588 LEU D CB  
2176 C  CG  . LEU D 55 ? 0.3110 0.4634 0.4069 0.0252  0.0304  0.0499  588 LEU D CG  
2177 C  CD1 . LEU D 55 ? 0.2833 0.4146 0.3632 0.0338  0.0329  0.0326  588 LEU D CD1 
2178 C  CD2 . LEU D 55 ? 0.3332 0.4903 0.4364 0.0183  0.0241  0.0502  588 LEU D CD2 
2179 N  N   . LEU D 56 ? 0.3109 0.5822 0.4509 0.0564  0.0659  0.1153  589 LEU D N   
2180 C  CA  . LEU D 56 ? 0.3330 0.6440 0.4806 0.0833  0.0830  0.1335  589 LEU D CA  
2181 C  C   . LEU D 56 ? 0.3974 0.7767 0.5812 0.0730  0.0795  0.1593  589 LEU D C   
2182 O  O   . LEU D 56 ? 0.4174 0.8295 0.6094 0.0983  0.0887  0.1715  589 LEU D O   
2183 C  CB  . LEU D 56 ? 0.3461 0.6611 0.4815 0.0965  0.0970  0.1397  589 LEU D CB  
2184 C  CG  . LEU D 56 ? 0.4234 0.6778 0.5187 0.1131  0.1014  0.1160  589 LEU D CG  
2185 C  CD1 . LEU D 56 ? 0.4367 0.6897 0.5186 0.1156  0.1084  0.1198  589 LEU D CD1 
2186 C  CD2 . LEU D 56 ? 0.4647 0.6974 0.5338 0.1471  0.1144  0.1111  589 LEU D CD2 
2187 N  N   . TYR D 57 ? 0.3462 0.7439 0.5469 0.0356  0.0649  0.1679  590 TYR D N   
2188 C  CA  . TYR D 57 ? 0.3507 0.8139 0.5850 0.0134  0.0551  0.1918  590 TYR D CA  
2189 C  C   . TYR D 57 ? 0.3879 0.8493 0.6256 0.0171  0.0446  0.1852  590 TYR D C   
2190 O  O   . TYR D 57 ? 0.3884 0.9106 0.6497 0.0294  0.0471  0.2045  590 TYR D O   
2191 C  CB  . TYR D 57 ? 0.3903 0.8445 0.6245 -0.0336 0.0377  0.1962  590 TYR D CB  
2192 C  CG  . TYR D 57 ? 0.4483 0.9560 0.7087 -0.0680 0.0199  0.2159  590 TYR D CG  
2193 C  CD1 . TYR D 57 ? 0.4795 1.0770 0.7764 -0.0796 0.0242  0.2493  590 TYR D CD1 
2194 C  CD2 . TYR D 57 ? 0.4713 0.9445 0.7187 -0.0899 -0.0018 0.2022  590 TYR D CD2 
2195 C  CE1 . TYR D 57 ? 0.5112 1.1669 0.8341 -0.1159 0.0047  0.2687  590 TYR D CE1 
2196 C  CE2 . TYR D 57 ? 0.5018 1.0221 0.7680 -0.1237 -0.0212 0.2191  590 TYR D CE2 
2197 C  CZ  . TYR D 57 ? 0.6368 1.2499 0.9420 -0.1389 -0.0194 0.2524  590 TYR D CZ  
2198 O  OH  . TYR D 57 ? 0.6925 1.3595 1.0176 -0.1774 -0.0419 0.2702  590 TYR D OH  
2199 N  N   . MSE D 58 ? 0.3261 0.7210 0.5387 0.0092  0.0341  0.1592  591 MSE D N   
2200 C  CA  A MSE D 58 ? 0.2839 0.6663 0.4925 0.0106  0.0246  0.1508  591 MSE D CA  
2201 C  CA  B MSE D 58 ? 0.3360 0.7170 0.5440 0.0111  0.0249  0.1503  591 MSE D CA  
2202 C  C   . MSE D 58 ? 0.3777 0.7649 0.5822 0.0493  0.0399  0.1529  591 MSE D C   
2203 O  O   . MSE D 58 ? 0.3734 0.7813 0.5848 0.0548  0.0348  0.1600  591 MSE D O   
2204 C  CB  A MSE D 58 ? 0.2817 0.5960 0.4623 -0.0009 0.0154  0.1243  591 MSE D CB  
2205 C  CB  B MSE D 58 ? 0.3743 0.6864 0.5538 0.0017  0.0169  0.1234  591 MSE D CB  
2206 C  CG  A MSE D 58 ? 0.3391 0.6368 0.5115 -0.0359 -0.0032 0.1221  591 MSE D CG  
2207 C  CG  B MSE D 58 ? 0.4926 0.7897 0.6647 -0.0313 -0.0035 0.1199  591 MSE D CG  
2208 SE SE  A MSE D 58 ? 0.3972 0.6143 0.5297 -0.0355 -0.0067 0.0915  591 MSE D SE  
2209 SE SE  B MSE D 58 ? 0.6173 0.8387 0.7524 -0.0278 -0.0070 0.0883  591 MSE D SE  
2210 C  CE  A MSE D 58 ? 0.3438 0.5470 0.4703 -0.0160 -0.0034 0.0766  591 MSE D CE  
2211 C  CE  B MSE D 58 ? 0.5863 0.7826 0.7079 -0.0326 -0.0038 0.0847  591 MSE D CE  
2212 N  N   . LEU D 59 ? 0.3731 0.7359 0.5598 0.0768  0.0579  0.1472  592 LEU D N   
2213 C  CA  . LEU D 59 ? 0.3998 0.7499 0.5680 0.1155  0.0733  0.1488  592 LEU D CA  
2214 C  C   . LEU D 59 ? 0.5003 0.9261 0.6929 0.1393  0.0815  0.1784  592 LEU D C   
2215 O  O   . LEU D 59 ? 0.5265 0.9482 0.7039 0.1732  0.0909  0.1843  592 LEU D O   
2216 C  CB  . LEU D 59 ? 0.4159 0.7153 0.5498 0.1367  0.0885  0.1351  592 LEU D CB  
2217 C  CG  . LEU D 59 ? 0.4818 0.7095 0.5862 0.1234  0.0829  0.1072  592 LEU D CG  
2218 C  CD1 . LEU D 59 ? 0.5073 0.6951 0.5790 0.1393  0.0942  0.0961  592 LEU D CD1 
2219 C  CD2 . LEU D 59 ? 0.5078 0.6993 0.5934 0.1274  0.0808  0.0994  592 LEU D CD2 
2220 N  N   . GLU D 60 ? 0.4575 0.9535 0.6856 0.1217  0.0781  0.1990  593 GLU D N   
2221 C  CA  . GLU D 60 ? 0.4657 1.0563 0.7265 0.1402  0.0853  0.2319  593 GLU D CA  
2222 C  C   . GLU D 60 ? 0.4771 1.1345 0.7763 0.1039  0.0627  0.2485  593 GLU D C   
2223 O  O   . GLU D 60 ? 0.4814 1.2324 0.8144 0.1137  0.0648  0.2783  593 GLU D O   
2224 C  CB  . GLU D 60 ? 0.4941 1.1287 0.7673 0.1475  0.1013  0.2486  593 GLU D CB  
2225 C  CG  . GLU D 60 ? 0.7545 1.3402 0.9868 0.1944  0.1259  0.2390  593 GLU D CG  
2226 C  CD  . GLU D 60 ? 1.1834 1.7658 1.3911 0.2511  0.1429  0.2458  593 GLU D CD  
2227 O  OE1 . GLU D 60 ? 1.3554 2.0167 1.5808 0.2853  0.1588  0.2747  593 GLU D OE1 
2228 O  OE2 . GLU D 60 ? 0.9790 1.4788 1.1460 0.2628  0.1413  0.2237  593 GLU D OE2 
2229 N  N   . SER D 61 ? 0.4053 1.0181 0.6968 0.0633  0.0409  0.2304  594 SER D N   
2230 C  CA  . SER D 61 ? 0.3916 1.0488 0.7061 0.0241  0.0160  0.2415  594 SER D CA  
2231 C  C   . SER D 61 ? 0.4260 1.0319 0.7173 0.0229  0.0029  0.2226  594 SER D C   
2232 O  O   . SER D 61 ? 0.4245 0.9585 0.6893 0.0017  -0.0066 0.1981  594 SER D O   
2233 C  CB  . SER D 61 ? 0.4514 1.0976 0.7682 -0.0267 0.0012  0.2397  594 SER D CB  
2234 O  OG  . SER D 61 ? 0.6623 1.3386 0.9905 -0.0684 -0.0256 0.2483  594 SER D OG  
2235 N  N   . PRO D 62 ? 0.3651 1.0087 0.6633 0.0497  0.0038  0.2352  595 PRO D N   
2236 C  CA  . PRO D 62 ? 0.3665 0.9593 0.6384 0.0524  -0.0056 0.2191  595 PRO D CA  
2237 C  C   . PRO D 62 ? 0.4264 1.0022 0.6922 0.0059  -0.0330 0.2089  595 PRO D C   
2238 O  O   . PRO D 62 ? 0.4317 0.9385 0.6660 0.0030  -0.0366 0.1865  595 PRO D O   
2239 C  CB  . PRO D 62 ? 0.3943 1.0474 0.6780 0.0887  -0.0012 0.2420  595 PRO D CB  
2240 C  CG  . PRO D 62 ? 0.4475 1.1531 0.7492 0.1226  0.0205  0.2622  595 PRO D CG  
2241 C  CD  . PRO D 62 ? 0.3744 1.1071 0.7000 0.0851  0.0159  0.2658  595 PRO D CD  
2242 N  N   . GLU D 63 ? 0.3938 1.0289 0.6845 -0.0310 -0.0520 0.2255  596 GLU D N   
2243 C  CA  . GLU D 63 ? 0.4042 1.0132 0.6772 -0.0763 -0.0804 0.2157  596 GLU D CA  
2244 C  C   . GLU D 63 ? 0.4125 0.9369 0.6533 -0.0999 -0.0825 0.1915  596 GLU D C   
2245 O  O   . GLU D 63 ? 0.4182 0.8841 0.6239 -0.1178 -0.0980 0.1730  596 GLU D O   
2246 C  CB  . GLU D 63 ? 0.4357 1.1327 0.7393 -0.1136 -0.1039 0.2422  596 GLU D CB  
2247 C  CG  . GLU D 63 ? 0.5811 1.3560 0.9067 -0.0928 -0.1105 0.2626  596 GLU D CG  
2248 C  CD  . GLU D 63 ? 0.8029 1.5293 1.0989 -0.0563 -0.1050 0.2480  596 GLU D CD  
2249 O  OE1 . GLU D 63 ? 0.7173 1.3828 0.9776 -0.0763 -0.1215 0.2283  596 GLU D OE1 
2250 O  OE2 . GLU D 63 ? 0.6855 1.4323 0.9891 -0.0068 -0.0836 0.2575  596 GLU D OE2 
2251 N  N   . SER D 64 ? 0.3430 0.8605 0.5914 -0.0952 -0.0662 0.1921  597 SER D N   
2252 C  CA  A SER D 64 ? 0.3513 0.7915 0.5682 -0.1097 -0.0660 0.1710  597 SER D CA  
2253 C  CA  B SER D 64 ? 0.3551 0.7954 0.5722 -0.1094 -0.0657 0.1711  597 SER D CA  
2254 C  C   . SER D 64 ? 0.3908 0.7650 0.5804 -0.0798 -0.0536 0.1453  597 SER D C   
2255 O  O   . SER D 64 ? 0.4000 0.7112 0.5557 -0.0899 -0.0614 0.1253  597 SER D O   
2256 C  CB  A SER D 64 ? 0.3873 0.8451 0.6195 -0.1112 -0.0523 0.1816  597 SER D CB  
2257 C  CB  B SER D 64 ? 0.4028 0.8614 0.6356 -0.1095 -0.0513 0.1817  597 SER D CB  
2258 O  OG  A SER D 64 ? 0.4883 0.9931 0.7373 -0.1523 -0.0671 0.2037  597 SER D OG  
2259 O  OG  B SER D 64 ? 0.5481 0.9337 0.7482 -0.1207 -0.0516 0.1635  597 SER D OG  
2260 N  N   . LEU D 65 ? 0.3250 0.7140 0.5256 -0.0430 -0.0347 0.1473  598 LEU D N   
2261 C  CA  . LEU D 65 ? 0.3102 0.6438 0.4866 -0.0208 -0.0238 0.1266  598 LEU D CA  
2262 C  C   . LEU D 65 ? 0.3840 0.6966 0.5411 -0.0279 -0.0373 0.1182  598 LEU D C   
2263 O  O   . LEU D 65 ? 0.4043 0.6657 0.5354 -0.0298 -0.0376 0.0989  598 LEU D O   
2264 C  CB  . LEU D 65 ? 0.2988 0.6429 0.4811 0.0157  -0.0028 0.1324  598 LEU D CB  
2265 C  CG  . LEU D 65 ? 0.3582 0.6473 0.5139 0.0333  0.0076  0.1149  598 LEU D CG  
2266 C  CD1 . LEU D 65 ? 0.3398 0.5815 0.4789 0.0230  0.0092  0.0935  598 LEU D CD1 
2267 C  CD2 . LEU D 65 ? 0.3978 0.6855 0.5480 0.0661  0.0262  0.1219  598 LEU D CD2 
2268 N  N   . ARG D 66 ? 0.3464 0.7036 0.5154 -0.0314 -0.0487 0.1341  599 ARG D N   
2269 C  CA  . ARG D 66 ? 0.3562 0.6989 0.5044 -0.0376 -0.0630 0.1288  599 ARG D CA  
2270 C  C   . ARG D 66 ? 0.4187 0.7134 0.5355 -0.0659 -0.0798 0.1124  599 ARG D C   
2271 O  O   . ARG D 66 ? 0.4310 0.6805 0.5174 -0.0594 -0.0794 0.0963  599 ARG D O   
2272 C  CB  . ARG D 66 ? 0.3442 0.7550 0.5129 -0.0409 -0.0769 0.1518  599 ARG D CB  
2273 C  CG  . ARG D 66 ? 0.5120 0.9073 0.6549 -0.0401 -0.0897 0.1472  599 ARG D CG  
2274 C  CD  . ARG D 66 ? 0.6104 1.0773 0.7726 -0.0348 -0.1021 0.1709  599 ARG D CD  
2275 N  NE  . ARG D 66 ? 0.7239 1.2468 0.9184 -0.0018 -0.0843 0.1920  599 ARG D NE  
2276 C  CZ  . ARG D 66 ? 0.9395 1.4402 1.1233 0.0391  -0.0624 0.1926  599 ARG D CZ  
2277 N  NH1 . ARG D 66 ? 0.7594 1.1917 0.9076 0.0475  -0.0557 0.1754  599 ARG D NH1 
2278 N  NH2 . ARG D 66 ? 0.8201 1.3642 1.0238 0.0722  -0.0464 0.2115  599 ARG D NH2 
2279 N  N   . SER D 67 ? 0.3844 0.6859 0.5033 -0.0962 -0.0939 0.1175  600 SER D N   
2280 C  CA  . SER D 67 ? 0.4345 0.6762 0.5105 -0.1219 -0.1109 0.1023  600 SER D CA  
2281 C  C   . SER D 67 ? 0.4843 0.6637 0.5347 -0.1050 -0.0964 0.0811  600 SER D C   
2282 O  O   . SER D 67 ? 0.5180 0.6431 0.5253 -0.1053 -0.1032 0.0648  600 SER D O   
2283 C  CB  . SER D 67 ? 0.5303 0.7860 0.6083 -0.1624 -0.1296 0.1148  600 SER D CB  
2284 O  OG  . SER D 67 ? 0.6981 0.9723 0.8020 -0.1604 -0.1150 0.1233  600 SER D OG  
2285 N  N   . LYS D 68 ? 0.4022 0.5922 0.4760 -0.0870 -0.0764 0.0817  601 LYS D N   
2286 C  CA  . LYS D 68 ? 0.3924 0.5375 0.4475 -0.0702 -0.0635 0.0638  601 LYS D CA  
2287 C  C   . LYS D 68 ? 0.4251 0.5591 0.4715 -0.0480 -0.0535 0.0526  601 LYS D C   
2288 O  O   . LYS D 68 ? 0.4209 0.5181 0.4395 -0.0402 -0.0515 0.0375  601 LYS D O   
2289 C  CB  . LYS D 68 ? 0.3821 0.5428 0.4611 -0.0598 -0.0477 0.0677  601 LYS D CB  
2290 C  CG  . LYS D 68 ? 0.4458 0.6093 0.5269 -0.0813 -0.0543 0.0780  601 LYS D CG  
2291 C  CD  . LYS D 68 ? 0.5252 0.6280 0.5622 -0.0957 -0.0666 0.0668  601 LYS D CD  
2292 C  CE  . LYS D 68 ? 0.5104 0.6077 0.5436 -0.1205 -0.0727 0.0788  601 LYS D CE  
2293 N  NZ  . LYS D 68 ? 0.7501 0.7737 0.7265 -0.1373 -0.0884 0.0688  601 LYS D NZ  
2294 N  N   . VAL D 69 ? 0.3623 0.5287 0.4293 -0.0371 -0.0468 0.0619  602 VAL D N   
2295 C  CA  . VAL D 69 ? 0.3449 0.5007 0.4019 -0.0210 -0.0373 0.0555  602 VAL D CA  
2296 C  C   . VAL D 69 ? 0.4329 0.5643 0.4558 -0.0271 -0.0501 0.0478  602 VAL D C   
2297 O  O   . VAL D 69 ? 0.4441 0.5521 0.4463 -0.0168 -0.0427 0.0361  602 VAL D O   
2298 C  CB  . VAL D 69 ? 0.3823 0.5674 0.4584 -0.0076 -0.0288 0.0698  602 VAL D CB  
2299 C  CG1 . VAL D 69 ? 0.3778 0.5469 0.4358 0.0030  -0.0224 0.0668  602 VAL D CG1 
2300 C  CG2 . VAL D 69 ? 0.3676 0.5591 0.4615 0.0048  -0.0129 0.0729  602 VAL D CG2 
2301 N  N   . ASP D 70 ? 0.4220 0.5611 0.4370 -0.0445 -0.0697 0.0551  603 ASP D N   
2302 C  CA  . ASP D 70 ? 0.4697 0.5789 0.4431 -0.0521 -0.0853 0.0474  603 ASP D CA  
2303 C  C   . ASP D 70 ? 0.5465 0.6000 0.4787 -0.0519 -0.0874 0.0299  603 ASP D C   
2304 O  O   . ASP D 70 ? 0.5566 0.5790 0.4513 -0.0391 -0.0859 0.0187  603 ASP D O   
2305 C  CB  . ASP D 70 ? 0.5182 0.6496 0.4914 -0.0777 -0.1099 0.0596  603 ASP D CB  
2306 C  CG  . ASP D 70 ? 0.6204 0.8095 0.6241 -0.0716 -0.1109 0.0781  603 ASP D CG  
2307 O  OD1 . ASP D 70 ? 0.5843 0.7807 0.5979 -0.0460 -0.0926 0.0799  603 ASP D OD1 
2308 O  OD2 . ASP D 70 ? 0.7042 0.9315 0.7196 -0.0928 -0.1306 0.0922  603 ASP D OD2 
2309 N  N   . GLU D 71 ? 0.5023 0.5438 0.4389 -0.0616 -0.0888 0.0291  604 GLU D N   
2310 C  CA  . GLU D 71 ? 0.5429 0.5286 0.4378 -0.0562 -0.0893 0.0147  604 GLU D CA  
2311 C  C   . GLU D 71 ? 0.5848 0.5721 0.4827 -0.0252 -0.0678 0.0047  604 GLU D C   
2312 O  O   . GLU D 71 ? 0.6385 0.5882 0.4934 -0.0089 -0.0665 -0.0073 604 GLU D O   
2313 C  CB  . GLU D 71 ? 0.5683 0.5441 0.4692 -0.0734 -0.0941 0.0197  604 GLU D CB  
2314 C  CG  . GLU D 71 ? 0.7046 0.6609 0.5830 -0.1106 -0.1190 0.0273  604 GLU D CG  
2315 C  CD  . GLU D 71 ? 0.9081 0.8623 0.7959 -0.1345 -0.1235 0.0377  604 GLU D CD  
2316 O  OE1 . GLU D 71 ? 0.6794 0.6634 0.6039 -0.1213 -0.1063 0.0425  604 GLU D OE1 
2317 O  OE2 . GLU D 71 ? 0.9674 0.8935 0.8256 -0.1702 -0.1453 0.0430  604 GLU D OE2 
2318 N  N   . ALA D 72 ? 0.4591 0.4906 0.4034 -0.0170 -0.0515 0.0105  605 ALA D N   
2319 C  CA  . ALA D 72 ? 0.4316 0.4754 0.3844 0.0038  -0.0333 0.0038  605 ALA D CA  
2320 C  C   . ALA D 72 ? 0.4962 0.5414 0.4308 0.0149  -0.0282 0.0010  605 ALA D C   
2321 O  O   . ALA D 72 ? 0.5186 0.5600 0.4352 0.0328  -0.0190 -0.0069 605 ALA D O   
2322 C  CB  . ALA D 72 ? 0.3957 0.4751 0.3920 0.0029  -0.0211 0.0109  605 ALA D CB  
2323 N  N   . VAL D 73 ? 0.4325 0.4864 0.3692 0.0063  -0.0344 0.0091  606 VAL D N   
2324 C  CA  . VAL D 73 ? 0.4334 0.4867 0.3491 0.0153  -0.0307 0.0090  606 VAL D CA  
2325 C  C   . VAL D 73 ? 0.5550 0.5678 0.4163 0.0260  -0.0377 -0.0030 606 VAL D C   
2326 O  O   . VAL D 73 ? 0.5593 0.5739 0.4017 0.0451  -0.0253 -0.0073 606 VAL D O   
2327 C  CB  . VAL D 73 ? 0.4534 0.5209 0.3763 0.0055  -0.0397 0.0214  606 VAL D CB  
2328 C  CG1 . VAL D 73 ? 0.4753 0.5332 0.3649 0.0148  -0.0390 0.0207  606 VAL D CG1 
2329 C  CG2 . VAL D 73 ? 0.4009 0.4992 0.3647 0.0053  -0.0283 0.0335  606 VAL D CG2 
2330 N  N   . ALA D 74 ? 0.5690 0.5435 0.4015 0.0138  -0.0569 -0.0076 607 ALA D N   
2331 C  CA  . ALA D 74 ? 0.6436 0.5597 0.4088 0.0241  -0.0660 -0.0205 607 ALA D CA  
2332 C  C   . ALA D 74 ? 0.6974 0.6013 0.4467 0.0527  -0.0505 -0.0297 607 ALA D C   
2333 O  O   . ALA D 74 ? 0.7485 0.6255 0.4487 0.0783  -0.0453 -0.0382 607 ALA D O   
2334 C  CB  . ALA D 74 ? 0.6970 0.5678 0.4318 -0.0028 -0.0915 -0.0218 607 ALA D CB  
2335 N  N   . VAL D 75 ? 0.5970 0.5257 0.3863 0.0519  -0.0424 -0.0270 608 VAL D N   
2336 C  CA  . VAL D 75 ? 0.6004 0.5328 0.3841 0.0792  -0.0285 -0.0330 608 VAL D CA  
2337 C  C   . VAL D 75 ? 0.6331 0.6144 0.4312 0.1011  -0.0086 -0.0313 608 VAL D C   
2338 O  O   . VAL D 75 ? 0.6594 0.6360 0.4254 0.1325  0.0008  -0.0369 608 VAL D O   
2339 C  CB  . VAL D 75 ? 0.5999 0.5550 0.4260 0.0705  -0.0256 -0.0291 608 VAL D CB  
2340 C  CG1 . VAL D 75 ? 0.6038 0.5763 0.4284 0.1002  -0.0120 -0.0336 608 VAL D CG1 
2341 C  CG2 . VAL D 75 ? 0.6220 0.5308 0.4296 0.0497  -0.0428 -0.0284 608 VAL D CG2 
2342 N  N   . LEU D 76 ? 0.5410 0.5676 0.3829 0.0854  -0.0017 -0.0219 609 LEU D N   
2343 C  CA  . LEU D 76 ? 0.5165 0.5912 0.3753 0.0962  0.0168  -0.0167 609 LEU D CA  
2344 C  C   . LEU D 76 ? 0.6456 0.7061 0.4588 0.1145  0.0206  -0.0182 609 LEU D C   
2345 O  O   . LEU D 76 ? 0.6410 0.7412 0.4570 0.1315  0.0382  -0.0141 609 LEU D O   
2346 C  CB  . LEU D 76 ? 0.4578 0.5657 0.3632 0.0718  0.0216  -0.0058 609 LEU D CB  
2347 C  CG  . LEU D 76 ? 0.4520 0.5804 0.3993 0.0582  0.0232  -0.0039 609 LEU D CG  
2348 C  CD1 . LEU D 76 ? 0.4217 0.5574 0.3960 0.0373  0.0246  0.0058  609 LEU D CD1 
2349 C  CD2 . LEU D 76 ? 0.4261 0.5970 0.3906 0.0678  0.0360  -0.0048 609 LEU D CD2 
2350 N  N   . GLN D 77 ? 0.6788 0.6874 0.4498 0.1095  0.0040  -0.0228 610 GLN D N   
2351 C  CA  . GLN D 77 ? 0.7499 0.7349 0.4681 0.1262  0.0046  -0.0257 610 GLN D CA  
2352 C  C   . GLN D 77 ? 0.8949 0.8567 0.5591 0.1658  0.0136  -0.0355 610 GLN D C   
2353 O  O   . GLN D 77 ? 0.9298 0.8398 0.5571 0.1747  0.0032  -0.0457 610 GLN D O   
2354 C  CB  . GLN D 77 ? 0.8129 0.7461 0.4966 0.1062  -0.0206 -0.0291 610 GLN D CB  
2355 C  CG  . GLN D 77 ? 1.2046 1.1160 0.8361 0.1175  -0.0228 -0.0306 610 GLN D CG  
2356 C  CD  . GLN D 77 ? 1.5843 1.5513 1.2473 0.1214  -0.0031 -0.0174 610 GLN D CD  
2357 O  OE1 . GLN D 77 ? 1.5303 1.5329 1.2449 0.1003  -0.0012 -0.0054 610 GLN D OE1 
2358 N  NE2 . GLN D 77 ? 1.5461 1.5198 1.1749 0.1506  0.0141  -0.0180 610 GLN D NE2 
2359 N  N   . ALA D 78 ? 0.8990 0.8988 0.5553 0.1913  0.0342  -0.0306 611 ALA D N   
2360 C  CA  . ALA D 78 ? 0.9724 0.9635 0.5771 0.2381  0.0477  -0.0366 611 ALA D CA  
2361 C  C   . ALA D 78 ? 1.1546 1.0516 0.6638 0.2565  0.0330  -0.0510 611 ALA D C   
2362 O  O   . ALA D 78 ? 1.1815 1.0392 0.6716 0.2301  0.0144  -0.0533 611 ALA D O   
2363 C  CB  . ALA D 78 ? 0.9671 1.0356 0.5935 0.2562  0.0745  -0.0235 611 ALA D CB  
2364 N  N   . HIS D 79 ? 1.1860 1.0451 0.6303 0.3028  0.0406  -0.0602 612 HIS D N   
2365 C  CA  . HIS D 79 ? 1.3041 1.0583 0.6402 0.3250  0.0274  -0.0758 612 HIS D CA  
2366 C  C   . HIS D 79 ? 1.4095 1.1653 0.7097 0.3341  0.0331  -0.0739 612 HIS D C   
2367 O  O   . HIS D 79 ? 1.3588 1.2009 0.7061 0.3428  0.0566  -0.0594 612 HIS D O   
2368 C  CB  . HIS D 79 ? 1.3854 1.0985 0.6543 0.3823  0.0390  -0.0844 612 HIS D CB  
2369 C  CG  . HIS D 79 ? 1.4367 1.2160 0.6983 0.4370  0.0711  -0.0762 612 HIS D CG  
2370 N  ND1 . HIS D 79 ? 1.3707 1.2726 0.7208 0.4419  0.0942  -0.0590 612 HIS D ND1 
2371 C  CD2 . HIS D 79 ? 1.5524 1.2936 0.7271 0.4870  0.0831  -0.0818 612 HIS D CD2 
2372 C  CE1 . HIS D 79 ? 1.4021 1.3468 0.7238 0.4926  0.1200  -0.0524 612 HIS D CE1 
2373 N  NE2 . HIS D 79 ? 1.5162 1.3669 0.7318 0.5247  0.1159  -0.0658 612 HIS D NE2 
2374 N  N   . GLN D 80 ? 1.4639 1.1232 0.6789 0.3281  0.0102  -0.0876 613 GLN D N   
2375 C  CA  . GLN D 80 ? 1.8092 1.4542 0.9762 0.3354  0.0101  -0.0881 613 GLN D CA  
2376 C  C   . GLN D 80 ? 2.1420 1.7966 1.2514 0.3999  0.0399  -0.0881 613 GLN D C   
2377 O  O   . GLN D 80 ? 1.7462 1.3302 0.7705 0.4438  0.0425  -0.1013 613 GLN D O   
2378 C  CB  . GLN D 80 ? 1.9123 1.4470 0.9959 0.3103  -0.0262 -0.1043 613 GLN D CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  0   ?   ?   ?   A . n 
A 1 2  GLN 2  535 ?   ?   ?   A . n 
A 1 3  GLY 3  536 ?   ?   ?   A . n 
A 1 4  GLN 4  537 537 GLN GLN A . n 
A 1 5  GLU 5  538 538 GLU GLU A . n 
A 1 6  THR 6  539 539 THR THR A . n 
A 1 7  LEU 7  540 540 LEU LEU A . n 
A 1 8  THR 8  541 541 THR THR A . n 
A 1 9  ALA 9  542 542 ALA ALA A . n 
A 1 10 SER 10 543 543 SER SER A . n 
A 1 11 ARG 11 544 544 ARG ARG A . n 
A 1 12 LEU 12 545 545 LEU LEU A . n 
A 1 13 ALA 13 546 546 ALA ALA A . n 
A 1 14 SER 14 547 547 SER SER A . n 
A 1 15 ALA 15 548 548 ALA ALA A . n 
A 1 16 PRO 16 549 549 PRO PRO A . n 
A 1 17 PRO 17 550 550 PRO PRO A . n 
A 1 18 GLN 18 551 551 GLN GLN A . n 
A 1 19 LYS 19 552 552 LYS LYS A . n 
A 1 20 GLN 20 553 553 GLN GLN A . n 
A 1 21 LYS 21 554 554 LYS LYS A . n 
A 1 22 GLN 22 555 555 GLN GLN A . n 
A 1 23 MSE 23 556 556 MSE MSE A . n 
A 1 24 LEU 24 557 557 LEU LEU A . n 
A 1 25 GLY 25 558 558 GLY GLY A . n 
A 1 26 GLU 26 559 559 GLU GLU A . n 
A 1 27 ARG 27 560 560 ARG ARG A . n 
A 1 28 LEU 28 561 561 LEU LEU A . n 
A 1 29 PHE 29 562 562 PHE PHE A . n 
A 1 30 PRO 30 563 563 PRO PRO A . n 
A 1 31 LEU 31 564 564 LEU LEU A . n 
A 1 32 ILE 32 565 565 ILE ILE A . n 
A 1 33 GLN 33 566 566 GLN GLN A . n 
A 1 34 ALA 34 567 567 ALA ALA A . n 
A 1 35 MSE 35 568 568 MSE MSE A . n 
A 1 36 HIS 36 569 569 HIS HIS A . n 
A 1 37 PRO 37 570 570 PRO PRO A . n 
A 1 38 THR 38 571 571 THR THR A . n 
A 1 39 LEU 39 572 572 LEU LEU A . n 
A 1 40 ALA 40 573 573 ALA ALA A . n 
A 1 41 GLY 41 574 574 GLY GLY A . n 
A 1 42 LYS 42 575 575 LYS LYS A . n 
A 1 43 ILE 43 576 576 ILE ILE A . n 
A 1 44 THR 44 577 577 THR THR A . n 
A 1 45 GLY 45 578 578 GLY GLY A . n 
A 1 46 MSE 46 579 579 MSE MSE A . n 
A 1 47 LEU 47 580 580 LEU LEU A . n 
A 1 48 LEU 48 581 581 LEU LEU A . n 
A 1 49 GLU 49 582 582 GLU GLU A . n 
A 1 50 ILE 50 583 583 ILE ILE A . n 
A 1 51 ASP 51 584 584 ASP ASP A . n 
A 1 52 ASN 52 585 585 ASN ASN A . n 
A 1 53 SER 53 586 586 SER SER A . n 
A 1 54 GLU 54 587 587 GLU GLU A . n 
A 1 55 LEU 55 588 588 LEU LEU A . n 
A 1 56 LEU 56 589 589 LEU LEU A . n 
A 1 57 TYR 57 590 590 TYR TYR A . n 
A 1 58 MSE 58 591 591 MSE MSE A . n 
A 1 59 LEU 59 592 592 LEU LEU A . n 
A 1 60 GLU 60 593 593 GLU GLU A . n 
A 1 61 SER 61 594 594 SER SER A . n 
A 1 62 PRO 62 595 595 PRO PRO A . n 
A 1 63 GLU 63 596 596 GLU GLU A . n 
A 1 64 SER 64 597 597 SER SER A . n 
A 1 65 LEU 65 598 598 LEU LEU A . n 
A 1 66 ARG 66 599 599 ARG ARG A . n 
A 1 67 SER 67 600 600 SER SER A . n 
A 1 68 LYS 68 601 601 LYS LYS A . n 
A 1 69 VAL 69 602 602 VAL VAL A . n 
A 1 70 ASP 70 603 603 ASP ASP A . n 
A 1 71 GLU 71 604 604 GLU GLU A . n 
A 1 72 ALA 72 605 605 ALA ALA A . n 
A 1 73 VAL 73 606 606 VAL VAL A . n 
A 1 74 ALA 74 607 607 ALA ALA A . n 
A 1 75 VAL 75 608 608 VAL VAL A . n 
A 1 76 LEU 76 609 609 LEU LEU A . n 
A 1 77 GLN 77 610 610 GLN GLN A . n 
A 1 78 ALA 78 611 611 ALA ALA A . n 
A 1 79 HIS 79 612 612 HIS HIS A . n 
A 1 80 GLN 80 613 ?   ?   ?   A . n 
A 1 81 ALA 81 614 ?   ?   ?   A . n 
A 1 82 LYS 82 615 ?   ?   ?   A . n 
A 1 83 GLU 83 616 ?   ?   ?   A . n 
A 1 84 ALA 84 617 ?   ?   ?   A . n 
A 1 85 THR 85 618 ?   ?   ?   A . n 
A 1 86 GLN 86 619 ?   ?   ?   A . n 
A 1 87 LYS 87 620 ?   ?   ?   A . n 
A 1 88 ALA 88 621 ?   ?   ?   A . n 
A 1 89 VAL 89 622 ?   ?   ?   A . n 
A 1 90 ASN 90 623 ?   ?   ?   A . n 
A 1 91 SER 91 624 ?   ?   ?   A . n 
A 1 92 ALA 92 625 ?   ?   ?   A . n 
A 1 93 THR 93 626 ?   ?   ?   A . n 
A 1 94 GLY 94 627 ?   ?   ?   A . n 
A 1 95 VAL 95 628 ?   ?   ?   A . n 
A 1 96 PRO 96 629 ?   ?   ?   A . n 
A 1 97 THR 97 630 ?   ?   ?   A . n 
A 1 98 VAL 98 631 ?   ?   ?   A . n 
B 1 1  GLY 1  0   ?   ?   ?   B . n 
B 1 2  GLN 2  535 ?   ?   ?   B . n 
B 1 3  GLY 3  536 ?   ?   ?   B . n 
B 1 4  GLN 4  537 ?   ?   ?   B . n 
B 1 5  GLU 5  538 538 GLU GLU B . n 
B 1 6  THR 6  539 539 THR THR B . n 
B 1 7  LEU 7  540 540 LEU LEU B . n 
B 1 8  THR 8  541 541 THR THR B . n 
B 1 9  ALA 9  542 542 ALA ALA B . n 
B 1 10 SER 10 543 543 SER SER B . n 
B 1 11 ARG 11 544 544 ARG ARG B . n 
B 1 12 LEU 12 545 545 LEU LEU B . n 
B 1 13 ALA 13 546 546 ALA ALA B . n 
B 1 14 SER 14 547 547 SER SER B . n 
B 1 15 ALA 15 548 548 ALA ALA B . n 
B 1 16 PRO 16 549 549 PRO PRO B . n 
B 1 17 PRO 17 550 550 PRO PRO B . n 
B 1 18 GLN 18 551 551 GLN GLN B . n 
B 1 19 LYS 19 552 552 LYS LYS B . n 
B 1 20 GLN 20 553 553 GLN GLN B . n 
B 1 21 LYS 21 554 554 LYS LYS B . n 
B 1 22 GLN 22 555 555 GLN GLN B . n 
B 1 23 MSE 23 556 556 MSE MSE B . n 
B 1 24 LEU 24 557 557 LEU LEU B . n 
B 1 25 GLY 25 558 558 GLY GLY B . n 
B 1 26 GLU 26 559 559 GLU GLU B . n 
B 1 27 ARG 27 560 560 ARG ARG B . n 
B 1 28 LEU 28 561 561 LEU LEU B . n 
B 1 29 PHE 29 562 562 PHE PHE B . n 
B 1 30 PRO 30 563 563 PRO PRO B . n 
B 1 31 LEU 31 564 564 LEU LEU B . n 
B 1 32 ILE 32 565 565 ILE ILE B . n 
B 1 33 GLN 33 566 566 GLN GLN B . n 
B 1 34 ALA 34 567 567 ALA ALA B . n 
B 1 35 MSE 35 568 568 MSE MSE B . n 
B 1 36 HIS 36 569 569 HIS HIS B . n 
B 1 37 PRO 37 570 570 PRO PRO B . n 
B 1 38 THR 38 571 571 THR THR B . n 
B 1 39 LEU 39 572 572 LEU LEU B . n 
B 1 40 ALA 40 573 573 ALA ALA B . n 
B 1 41 GLY 41 574 574 GLY GLY B . n 
B 1 42 LYS 42 575 575 LYS LYS B . n 
B 1 43 ILE 43 576 576 ILE ILE B . n 
B 1 44 THR 44 577 577 THR THR B . n 
B 1 45 GLY 45 578 578 GLY GLY B . n 
B 1 46 MSE 46 579 579 MSE MSE B . n 
B 1 47 LEU 47 580 580 LEU LEU B . n 
B 1 48 LEU 48 581 581 LEU LEU B . n 
B 1 49 GLU 49 582 582 GLU GLU B . n 
B 1 50 ILE 50 583 583 ILE ILE B . n 
B 1 51 ASP 51 584 584 ASP ASP B . n 
B 1 52 ASN 52 585 585 ASN ASN B . n 
B 1 53 SER 53 586 586 SER SER B . n 
B 1 54 GLU 54 587 587 GLU GLU B . n 
B 1 55 LEU 55 588 588 LEU LEU B . n 
B 1 56 LEU 56 589 589 LEU LEU B . n 
B 1 57 TYR 57 590 590 TYR TYR B . n 
B 1 58 MSE 58 591 591 MSE MSE B . n 
B 1 59 LEU 59 592 592 LEU LEU B . n 
B 1 60 GLU 60 593 593 GLU GLU B . n 
B 1 61 SER 61 594 594 SER SER B . n 
B 1 62 PRO 62 595 595 PRO PRO B . n 
B 1 63 GLU 63 596 596 GLU GLU B . n 
B 1 64 SER 64 597 597 SER SER B . n 
B 1 65 LEU 65 598 598 LEU LEU B . n 
B 1 66 ARG 66 599 599 ARG ARG B . n 
B 1 67 SER 67 600 600 SER SER B . n 
B 1 68 LYS 68 601 601 LYS LYS B . n 
B 1 69 VAL 69 602 602 VAL VAL B . n 
B 1 70 ASP 70 603 603 ASP ASP B . n 
B 1 71 GLU 71 604 604 GLU GLU B . n 
B 1 72 ALA 72 605 605 ALA ALA B . n 
B 1 73 VAL 73 606 606 VAL VAL B . n 
B 1 74 ALA 74 607 607 ALA ALA B . n 
B 1 75 VAL 75 608 608 VAL VAL B . n 
B 1 76 LEU 76 609 609 LEU LEU B . n 
B 1 77 GLN 77 610 610 GLN GLN B . n 
B 1 78 ALA 78 611 611 ALA ALA B . n 
B 1 79 HIS 79 612 612 HIS HIS B . n 
B 1 80 GLN 80 613 613 GLN GLN B . n 
B 1 81 ALA 81 614 614 ALA ALA B . n 
B 1 82 LYS 82 615 ?   ?   ?   B . n 
B 1 83 GLU 83 616 ?   ?   ?   B . n 
B 1 84 ALA 84 617 ?   ?   ?   B . n 
B 1 85 THR 85 618 ?   ?   ?   B . n 
B 1 86 GLN 86 619 ?   ?   ?   B . n 
B 1 87 LYS 87 620 ?   ?   ?   B . n 
B 1 88 ALA 88 621 ?   ?   ?   B . n 
B 1 89 VAL 89 622 ?   ?   ?   B . n 
B 1 90 ASN 90 623 ?   ?   ?   B . n 
B 1 91 SER 91 624 ?   ?   ?   B . n 
B 1 92 ALA 92 625 ?   ?   ?   B . n 
B 1 93 THR 93 626 ?   ?   ?   B . n 
B 1 94 GLY 94 627 ?   ?   ?   B . n 
B 1 95 VAL 95 628 ?   ?   ?   B . n 
B 1 96 PRO 96 629 ?   ?   ?   B . n 
B 1 97 THR 97 630 ?   ?   ?   B . n 
B 1 98 VAL 98 631 ?   ?   ?   B . n 
C 1 1  GLY 1  0   ?   ?   ?   C . n 
C 1 2  GLN 2  535 ?   ?   ?   C . n 
C 1 3  GLY 3  536 ?   ?   ?   C . n 
C 1 4  GLN 4  537 ?   ?   ?   C . n 
C 1 5  GLU 5  538 538 GLU GLU C . n 
C 1 6  THR 6  539 539 THR THR C . n 
C 1 7  LEU 7  540 540 LEU LEU C . n 
C 1 8  THR 8  541 541 THR THR C . n 
C 1 9  ALA 9  542 542 ALA ALA C . n 
C 1 10 SER 10 543 543 SER SER C . n 
C 1 11 ARG 11 544 544 ARG ARG C . n 
C 1 12 LEU 12 545 545 LEU LEU C . n 
C 1 13 ALA 13 546 546 ALA ALA C . n 
C 1 14 SER 14 547 547 SER SER C . n 
C 1 15 ALA 15 548 548 ALA ALA C . n 
C 1 16 PRO 16 549 549 PRO PRO C . n 
C 1 17 PRO 17 550 550 PRO PRO C . n 
C 1 18 GLN 18 551 551 GLN GLN C . n 
C 1 19 LYS 19 552 552 LYS LYS C . n 
C 1 20 GLN 20 553 553 GLN GLN C . n 
C 1 21 LYS 21 554 554 LYS LYS C . n 
C 1 22 GLN 22 555 555 GLN GLN C . n 
C 1 23 MSE 23 556 556 MSE MSE C . n 
C 1 24 LEU 24 557 557 LEU LEU C . n 
C 1 25 GLY 25 558 558 GLY GLY C . n 
C 1 26 GLU 26 559 559 GLU GLU C . n 
C 1 27 ARG 27 560 560 ARG ARG C . n 
C 1 28 LEU 28 561 561 LEU LEU C . n 
C 1 29 PHE 29 562 562 PHE PHE C . n 
C 1 30 PRO 30 563 563 PRO PRO C . n 
C 1 31 LEU 31 564 564 LEU LEU C . n 
C 1 32 ILE 32 565 565 ILE ILE C . n 
C 1 33 GLN 33 566 566 GLN GLN C . n 
C 1 34 ALA 34 567 567 ALA ALA C . n 
C 1 35 MSE 35 568 568 MSE MSE C . n 
C 1 36 HIS 36 569 569 HIS HIS C . n 
C 1 37 PRO 37 570 570 PRO PRO C . n 
C 1 38 THR 38 571 571 THR THR C . n 
C 1 39 LEU 39 572 572 LEU LEU C . n 
C 1 40 ALA 40 573 573 ALA ALA C . n 
C 1 41 GLY 41 574 574 GLY GLY C . n 
C 1 42 LYS 42 575 575 LYS LYS C . n 
C 1 43 ILE 43 576 576 ILE ILE C . n 
C 1 44 THR 44 577 577 THR THR C . n 
C 1 45 GLY 45 578 578 GLY GLY C . n 
C 1 46 MSE 46 579 579 MSE MSE C . n 
C 1 47 LEU 47 580 580 LEU LEU C . n 
C 1 48 LEU 48 581 581 LEU LEU C . n 
C 1 49 GLU 49 582 582 GLU GLU C . n 
C 1 50 ILE 50 583 583 ILE ILE C . n 
C 1 51 ASP 51 584 584 ASP ASP C . n 
C 1 52 ASN 52 585 585 ASN ASN C . n 
C 1 53 SER 53 586 586 SER SER C . n 
C 1 54 GLU 54 587 587 GLU GLU C . n 
C 1 55 LEU 55 588 588 LEU LEU C . n 
C 1 56 LEU 56 589 589 LEU LEU C . n 
C 1 57 TYR 57 590 590 TYR TYR C . n 
C 1 58 MSE 58 591 591 MSE MSE C . n 
C 1 59 LEU 59 592 592 LEU LEU C . n 
C 1 60 GLU 60 593 593 GLU GLU C . n 
C 1 61 SER 61 594 594 SER SER C . n 
C 1 62 PRO 62 595 595 PRO PRO C . n 
C 1 63 GLU 63 596 596 GLU GLU C . n 
C 1 64 SER 64 597 597 SER SER C . n 
C 1 65 LEU 65 598 598 LEU LEU C . n 
C 1 66 ARG 66 599 599 ARG ARG C . n 
C 1 67 SER 67 600 600 SER SER C . n 
C 1 68 LYS 68 601 601 LYS LYS C . n 
C 1 69 VAL 69 602 602 VAL VAL C . n 
C 1 70 ASP 70 603 603 ASP ASP C . n 
C 1 71 GLU 71 604 604 GLU GLU C . n 
C 1 72 ALA 72 605 605 ALA ALA C . n 
C 1 73 VAL 73 606 606 VAL VAL C . n 
C 1 74 ALA 74 607 607 ALA ALA C . n 
C 1 75 VAL 75 608 608 VAL VAL C . n 
C 1 76 LEU 76 609 609 LEU LEU C . n 
C 1 77 GLN 77 610 610 GLN GLN C . n 
C 1 78 ALA 78 611 611 ALA ALA C . n 
C 1 79 HIS 79 612 612 HIS HIS C . n 
C 1 80 GLN 80 613 613 GLN GLN C . n 
C 1 81 ALA 81 614 ?   ?   ?   C . n 
C 1 82 LYS 82 615 ?   ?   ?   C . n 
C 1 83 GLU 83 616 ?   ?   ?   C . n 
C 1 84 ALA 84 617 ?   ?   ?   C . n 
C 1 85 THR 85 618 ?   ?   ?   C . n 
C 1 86 GLN 86 619 ?   ?   ?   C . n 
C 1 87 LYS 87 620 ?   ?   ?   C . n 
C 1 88 ALA 88 621 ?   ?   ?   C . n 
C 1 89 VAL 89 622 ?   ?   ?   C . n 
C 1 90 ASN 90 623 ?   ?   ?   C . n 
C 1 91 SER 91 624 ?   ?   ?   C . n 
C 1 92 ALA 92 625 ?   ?   ?   C . n 
C 1 93 THR 93 626 ?   ?   ?   C . n 
C 1 94 GLY 94 627 ?   ?   ?   C . n 
C 1 95 VAL 95 628 ?   ?   ?   C . n 
C 1 96 PRO 96 629 ?   ?   ?   C . n 
C 1 97 THR 97 630 ?   ?   ?   C . n 
C 1 98 VAL 98 631 ?   ?   ?   C . n 
D 1 1  GLY 1  0   ?   ?   ?   D . n 
D 1 2  GLN 2  535 ?   ?   ?   D . n 
D 1 3  GLY 3  536 ?   ?   ?   D . n 
D 1 4  GLN 4  537 ?   ?   ?   D . n 
D 1 5  GLU 5  538 538 GLU GLU D . n 
D 1 6  THR 6  539 539 THR THR D . n 
D 1 7  LEU 7  540 540 LEU LEU D . n 
D 1 8  THR 8  541 541 THR THR D . n 
D 1 9  ALA 9  542 542 ALA ALA D . n 
D 1 10 SER 10 543 543 SER SER D . n 
D 1 11 ARG 11 544 544 ARG ARG D . n 
D 1 12 LEU 12 545 545 LEU LEU D . n 
D 1 13 ALA 13 546 546 ALA ALA D . n 
D 1 14 SER 14 547 547 SER SER D . n 
D 1 15 ALA 15 548 548 ALA ALA D . n 
D 1 16 PRO 16 549 549 PRO PRO D . n 
D 1 17 PRO 17 550 550 PRO PRO D . n 
D 1 18 GLN 18 551 551 GLN GLN D . n 
D 1 19 LYS 19 552 552 LYS LYS D . n 
D 1 20 GLN 20 553 553 GLN GLN D . n 
D 1 21 LYS 21 554 554 LYS LYS D . n 
D 1 22 GLN 22 555 555 GLN GLN D . n 
D 1 23 MSE 23 556 556 MSE MSE D . n 
D 1 24 LEU 24 557 557 LEU LEU D . n 
D 1 25 GLY 25 558 558 GLY GLY D . n 
D 1 26 GLU 26 559 559 GLU GLU D . n 
D 1 27 ARG 27 560 560 ARG ARG D . n 
D 1 28 LEU 28 561 561 LEU LEU D . n 
D 1 29 PHE 29 562 562 PHE PHE D . n 
D 1 30 PRO 30 563 563 PRO PRO D . n 
D 1 31 LEU 31 564 564 LEU LEU D . n 
D 1 32 ILE 32 565 565 ILE ILE D . n 
D 1 33 GLN 33 566 566 GLN GLN D . n 
D 1 34 ALA 34 567 567 ALA ALA D . n 
D 1 35 MSE 35 568 568 MSE MSE D . n 
D 1 36 HIS 36 569 569 HIS HIS D . n 
D 1 37 PRO 37 570 570 PRO PRO D . n 
D 1 38 THR 38 571 571 THR THR D . n 
D 1 39 LEU 39 572 572 LEU LEU D . n 
D 1 40 ALA 40 573 573 ALA ALA D . n 
D 1 41 GLY 41 574 574 GLY GLY D . n 
D 1 42 LYS 42 575 575 LYS LYS D . n 
D 1 43 ILE 43 576 576 ILE ILE D . n 
D 1 44 THR 44 577 577 THR THR D . n 
D 1 45 GLY 45 578 578 GLY GLY D . n 
D 1 46 MSE 46 579 579 MSE MSE D . n 
D 1 47 LEU 47 580 580 LEU LEU D . n 
D 1 48 LEU 48 581 581 LEU LEU D . n 
D 1 49 GLU 49 582 582 GLU GLU D . n 
D 1 50 ILE 50 583 583 ILE ILE D . n 
D 1 51 ASP 51 584 584 ASP ASP D . n 
D 1 52 ASN 52 585 585 ASN ASN D . n 
D 1 53 SER 53 586 586 SER SER D . n 
D 1 54 GLU 54 587 587 GLU GLU D . n 
D 1 55 LEU 55 588 588 LEU LEU D . n 
D 1 56 LEU 56 589 589 LEU LEU D . n 
D 1 57 TYR 57 590 590 TYR TYR D . n 
D 1 58 MSE 58 591 591 MSE MSE D . n 
D 1 59 LEU 59 592 592 LEU LEU D . n 
D 1 60 GLU 60 593 593 GLU GLU D . n 
D 1 61 SER 61 594 594 SER SER D . n 
D 1 62 PRO 62 595 595 PRO PRO D . n 
D 1 63 GLU 63 596 596 GLU GLU D . n 
D 1 64 SER 64 597 597 SER SER D . n 
D 1 65 LEU 65 598 598 LEU LEU D . n 
D 1 66 ARG 66 599 599 ARG ARG D . n 
D 1 67 SER 67 600 600 SER SER D . n 
D 1 68 LYS 68 601 601 LYS LYS D . n 
D 1 69 VAL 69 602 602 VAL VAL D . n 
D 1 70 ASP 70 603 603 ASP ASP D . n 
D 1 71 GLU 71 604 604 GLU GLU D . n 
D 1 72 ALA 72 605 605 ALA ALA D . n 
D 1 73 VAL 73 606 606 VAL VAL D . n 
D 1 74 ALA 74 607 607 ALA ALA D . n 
D 1 75 VAL 75 608 608 VAL VAL D . n 
D 1 76 LEU 76 609 609 LEU LEU D . n 
D 1 77 GLN 77 610 610 GLN GLN D . n 
D 1 78 ALA 78 611 611 ALA ALA D . n 
D 1 79 HIS 79 612 612 HIS HIS D . n 
D 1 80 GLN 80 613 613 GLN GLN D . n 
D 1 81 ALA 81 614 ?   ?   ?   D . n 
D 1 82 LYS 82 615 ?   ?   ?   D . n 
D 1 83 GLU 83 616 ?   ?   ?   D . n 
D 1 84 ALA 84 617 ?   ?   ?   D . n 
D 1 85 THR 85 618 ?   ?   ?   D . n 
D 1 86 GLN 86 619 ?   ?   ?   D . n 
D 1 87 LYS 87 620 ?   ?   ?   D . n 
D 1 88 ALA 88 621 ?   ?   ?   D . n 
D 1 89 VAL 89 622 ?   ?   ?   D . n 
D 1 90 ASN 90 623 ?   ?   ?   D . n 
D 1 91 SER 91 624 ?   ?   ?   D . n 
D 1 92 ALA 92 625 ?   ?   ?   D . n 
D 1 93 THR 93 626 ?   ?   ?   D . n 
D 1 94 GLY 94 627 ?   ?   ?   D . n 
D 1 95 VAL 95 628 ?   ?   ?   D . n 
D 1 96 PRO 96 629 ?   ?   ?   D . n 
D 1 97 THR 97 630 ?   ?   ?   D . n 
D 1 98 VAL 98 631 ?   ?   ?   D . n 
# 
loop_
_pdbx_SG_project.project_name 
_pdbx_SG_project.full_name_of_center 
_pdbx_SG_project.id 
_pdbx_SG_project.initial_of_center 
PSI:Biology 'Joint Center for Structural Genomics' 1 JCSG  
PSI:Biology 'Partnership for T-Cell Biology'       2 TCELL 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 CL  1  701 636 CL  CL  A . 
F 2 CL  1  701 635 CL  CL  C . 
G 3 HOH 1  801 645 HOH HOH A . 
G 3 HOH 2  802 647 HOH HOH A . 
G 3 HOH 3  803 648 HOH HOH A . 
G 3 HOH 4  804 651 HOH HOH A . 
G 3 HOH 5  805 654 HOH HOH A . 
G 3 HOH 6  806 659 HOH HOH A . 
G 3 HOH 7  807 660 HOH HOH A . 
G 3 HOH 8  808 661 HOH HOH A . 
G 3 HOH 9  809 666 HOH HOH A . 
G 3 HOH 10 810 668 HOH HOH A . 
G 3 HOH 11 811 674 HOH HOH A . 
G 3 HOH 12 812 675 HOH HOH A . 
G 3 HOH 13 813 677 HOH HOH A . 
G 3 HOH 14 814 705 HOH HOH A . 
G 3 HOH 15 815 706 HOH HOH A . 
G 3 HOH 16 816 718 HOH HOH A . 
G 3 HOH 17 817 725 HOH HOH A . 
G 3 HOH 18 818 726 HOH HOH A . 
G 3 HOH 19 819 727 HOH HOH A . 
G 3 HOH 20 820 728 HOH HOH A . 
G 3 HOH 21 821 730 HOH HOH A . 
G 3 HOH 22 822 732 HOH HOH A . 
G 3 HOH 23 823 746 HOH HOH A . 
G 3 HOH 24 824 750 HOH HOH A . 
G 3 HOH 25 825 751 HOH HOH A . 
G 3 HOH 26 826 753 HOH HOH A . 
G 3 HOH 27 827 755 HOH HOH A . 
G 3 HOH 28 828 759 HOH HOH A . 
G 3 HOH 29 829 760 HOH HOH A . 
G 3 HOH 30 830 764 HOH HOH A . 
G 3 HOH 31 831 765 HOH HOH A . 
G 3 HOH 32 832 766 HOH HOH A . 
H 3 HOH 1  701 637 HOH HOH B . 
H 3 HOH 2  702 639 HOH HOH B . 
H 3 HOH 3  703 642 HOH HOH B . 
H 3 HOH 4  704 643 HOH HOH B . 
H 3 HOH 5  705 658 HOH HOH B . 
H 3 HOH 6  706 664 HOH HOH B . 
H 3 HOH 7  707 665 HOH HOH B . 
H 3 HOH 8  708 667 HOH HOH B . 
H 3 HOH 9  709 670 HOH HOH B . 
H 3 HOH 10 710 673 HOH HOH B . 
H 3 HOH 11 711 682 HOH HOH B . 
H 3 HOH 12 712 691 HOH HOH B . 
H 3 HOH 13 713 693 HOH HOH B . 
H 3 HOH 14 714 694 HOH HOH B . 
H 3 HOH 15 715 698 HOH HOH B . 
H 3 HOH 16 716 700 HOH HOH B . 
H 3 HOH 17 717 702 HOH HOH B . 
H 3 HOH 18 718 711 HOH HOH B . 
H 3 HOH 19 719 716 HOH HOH B . 
H 3 HOH 20 720 734 HOH HOH B . 
H 3 HOH 21 721 735 HOH HOH B . 
H 3 HOH 22 722 739 HOH HOH B . 
H 3 HOH 23 723 741 HOH HOH B . 
H 3 HOH 24 724 744 HOH HOH B . 
H 3 HOH 25 725 745 HOH HOH B . 
H 3 HOH 26 726 747 HOH HOH B . 
H 3 HOH 27 727 748 HOH HOH B . 
H 3 HOH 28 728 749 HOH HOH B . 
H 3 HOH 29 729 757 HOH HOH B . 
H 3 HOH 30 730 763 HOH HOH B . 
I 3 HOH 1  801 640 HOH HOH C . 
I 3 HOH 2  802 641 HOH HOH C . 
I 3 HOH 3  803 644 HOH HOH C . 
I 3 HOH 4  804 646 HOH HOH C . 
I 3 HOH 5  805 655 HOH HOH C . 
I 3 HOH 6  806 656 HOH HOH C . 
I 3 HOH 7  807 671 HOH HOH C . 
I 3 HOH 8  808 672 HOH HOH C . 
I 3 HOH 9  809 678 HOH HOH C . 
I 3 HOH 10 810 680 HOH HOH C . 
I 3 HOH 11 811 681 HOH HOH C . 
I 3 HOH 12 812 685 HOH HOH C . 
I 3 HOH 13 813 687 HOH HOH C . 
I 3 HOH 14 814 689 HOH HOH C . 
I 3 HOH 15 815 690 HOH HOH C . 
I 3 HOH 16 816 695 HOH HOH C . 
I 3 HOH 17 817 699 HOH HOH C . 
I 3 HOH 18 818 703 HOH HOH C . 
I 3 HOH 19 819 709 HOH HOH C . 
I 3 HOH 20 820 713 HOH HOH C . 
I 3 HOH 21 821 714 HOH HOH C . 
I 3 HOH 22 822 717 HOH HOH C . 
I 3 HOH 23 823 719 HOH HOH C . 
I 3 HOH 24 824 720 HOH HOH C . 
I 3 HOH 25 825 722 HOH HOH C . 
I 3 HOH 26 826 724 HOH HOH C . 
I 3 HOH 27 827 733 HOH HOH C . 
I 3 HOH 28 828 736 HOH HOH C . 
I 3 HOH 29 829 740 HOH HOH C . 
I 3 HOH 30 830 742 HOH HOH C . 
I 3 HOH 31 831 743 HOH HOH C . 
I 3 HOH 32 832 752 HOH HOH C . 
I 3 HOH 33 833 756 HOH HOH C . 
I 3 HOH 34 834 758 HOH HOH C . 
I 3 HOH 35 835 761 HOH HOH C . 
I 3 HOH 36 836 762 HOH HOH C . 
I 3 HOH 37 837 769 HOH HOH C . 
J 3 HOH 1  701 638 HOH HOH D . 
J 3 HOH 2  702 649 HOH HOH D . 
J 3 HOH 3  703 650 HOH HOH D . 
J 3 HOH 4  704 652 HOH HOH D . 
J 3 HOH 5  705 653 HOH HOH D . 
J 3 HOH 6  706 657 HOH HOH D . 
J 3 HOH 7  707 662 HOH HOH D . 
J 3 HOH 8  708 663 HOH HOH D . 
J 3 HOH 9  709 669 HOH HOH D . 
J 3 HOH 10 710 676 HOH HOH D . 
J 3 HOH 11 711 679 HOH HOH D . 
J 3 HOH 12 712 683 HOH HOH D . 
J 3 HOH 13 713 684 HOH HOH D . 
J 3 HOH 14 714 686 HOH HOH D . 
J 3 HOH 15 715 688 HOH HOH D . 
J 3 HOH 16 716 692 HOH HOH D . 
J 3 HOH 17 717 696 HOH HOH D . 
J 3 HOH 18 718 697 HOH HOH D . 
J 3 HOH 19 719 701 HOH HOH D . 
J 3 HOH 20 720 704 HOH HOH D . 
J 3 HOH 21 721 707 HOH HOH D . 
J 3 HOH 22 722 708 HOH HOH D . 
J 3 HOH 23 723 710 HOH HOH D . 
J 3 HOH 24 724 712 HOH HOH D . 
J 3 HOH 25 725 715 HOH HOH D . 
J 3 HOH 26 726 721 HOH HOH D . 
J 3 HOH 27 727 723 HOH HOH D . 
J 3 HOH 28 728 729 HOH HOH D . 
J 3 HOH 29 729 731 HOH HOH D . 
J 3 HOH 30 730 737 HOH HOH D . 
J 3 HOH 31 731 738 HOH HOH D . 
J 3 HOH 32 732 754 HOH HOH D . 
J 3 HOH 33 733 767 HOH HOH D . 
J 3 HOH 34 734 768 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 23 A MSE 556 ? MET SELENOMETHIONINE 
2  A MSE 35 A MSE 568 ? MET SELENOMETHIONINE 
3  A MSE 46 A MSE 579 ? MET SELENOMETHIONINE 
4  A MSE 58 A MSE 591 ? MET SELENOMETHIONINE 
5  B MSE 23 B MSE 556 ? MET SELENOMETHIONINE 
6  B MSE 35 B MSE 568 ? MET SELENOMETHIONINE 
7  B MSE 46 B MSE 579 ? MET SELENOMETHIONINE 
8  B MSE 58 B MSE 591 ? MET SELENOMETHIONINE 
9  C MSE 23 C MSE 556 ? MET SELENOMETHIONINE 
10 C MSE 35 C MSE 568 ? MET SELENOMETHIONINE 
11 C MSE 46 C MSE 579 ? MET SELENOMETHIONINE 
12 C MSE 58 C MSE 591 ? MET SELENOMETHIONINE 
13 D MSE 23 D MSE 556 ? MET SELENOMETHIONINE 
14 D MSE 35 D MSE 568 ? MET SELENOMETHIONINE 
15 D MSE 46 D MSE 579 ? MET SELENOMETHIONINE 
16 D MSE 58 D MSE 591 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 software_defined_assembly            PISA dimeric    2 
3 software_defined_assembly            PISA dimeric    2 
4 author_defined_assembly              ?    monomeric  1 
5 author_defined_assembly              ?    monomeric  1 
6 author_defined_assembly              ?    monomeric  1 
7 author_defined_assembly              ?    monomeric  1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J 
2 1 A,B,E,G,H           
3 1 C,D,F,I,J           
4 1 A,E,G               
5 1 B,H                 
6 1 C,F,I               
7 1 D,J                 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5510  ? 
1 MORE         -40   ? 
1 'SSA (A^2)'  14880 ? 
2 'ABSA (A^2)' 1710  ? 
2 MORE         -15   ? 
2 'SSA (A^2)'  8490  ? 
3 'ABSA (A^2)' 1710  ? 
3 MORE         -15   ? 
3 'SSA (A^2)'  8470  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-02-06 
2 'Structure model' 1 1 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 32.5961 5.2067  34.9959 -0.1722 -0.0079 -0.1571 0.0411 0.0436  0.0104  5.2051 2.7463 8.3043 
-0.5073 -2.9104 1.7077  -0.1195 0.0914  0.0281 0.4790  -0.0245 0.2472  0.0176  -0.0230 -0.4441 
'X-RAY DIFFRACTION' 2 ? refined 14.0336 10.1033 40.7462 -0.2594 0.1354  -0.1581 0.1520 -0.0471 -0.0262 4.5334 2.0930 8.3155 
-0.1746 -1.3191 1.3940  0.1601  -0.3809 0.2208 0.5442  0.2683  0.2485  -0.2480 -0.4700 -0.5442 
'X-RAY DIFFRACTION' 3 ? refined 12.4094 14.5409 67.0452 -0.1353 -0.1298 -0.1187 0.0207 0.0392  -0.0395 4.8886 7.5299 4.2650 
-2.6500 -0.6239 -0.0312 -0.0234 -0.1305 0.1540 -0.0686 -0.5442 0.4828  0.5297  -0.1313 -0.2367 
'X-RAY DIFFRACTION' 4 ? refined 27.6101 2.7740  61.1619 -0.1614 -0.0136 -0.0624 0.0313 0.0315  0.0475  1.7851 2.7042 8.3155 
-0.8429 0.1631  -1.7318 -0.0432 -0.3216 0.3648 -0.0238 -0.0661 -0.2696 -0.0481 0.2565  0.5148  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 537 A 612 '{A|537 - 612}' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 538 B 614 '{B|538 - 614}' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 538 C 613 '{C|538 - 613}' ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 538 D 613 '{D|538 - 613}' ? ? ? ? ? 
# 
_phasing.method   MAD 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MolProbity  3beta29          ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 
'model building'  http://kinemage.biochem.duke.edu/molprobity/                                ?          ? 
2 PDB_EXTRACT 3.10             'June 10, 2010' package PDB                          deposit@deposit.rcsb.org             
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 
3 SHELX       .                ?               package 'George M. Sheldrick'        gsheldr@shelx.uni-ac.gwdg.de         phasing 
http://shelx.uni-ac.gwdg.de/SHELX/                                          Fortran_77 ? 
4 SHARP       .                ?               package 'Eric de La Fortelle'        sharp-develop@globalphasing.com      phasing 
http://www.globalphasing.com/sharp/                                         ?          ? 
5 XSCALE      'March 15, 2012' ?               package 'Wolfgang Kabsch'            ?                                    
'data scaling'    http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 
6 BUSTER-TNT  2.10.0           ?               program 'Gerard Bricogne'            buster-develop@GlobalPhasing.com     
refinement        http://www.globalphasing.com/buster/                                        ?          ? 
7 XDS         .                ?               ?       ?                            ?                                    
'data reduction'  ?                                                                           ?          ? 
8 SHELXD      .                ?               ?       ?                            ?                                    phasing ? 
?          ? 
9 BUSTER      2.10.0           ?               ?       ?                            ?                                    
refinement        ?                                                                           ?          ? 
# 
_pdbx_entry_details.entry_id             4IVE 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE CONSTRUCT (535-631) WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR B 571 ? ? -60.18 -84.96 
2 1 LEU B 572 ? ? -98.79 42.72  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 612 ? CG  ? A HIS 79 CG  
2  1 Y 1 A HIS 612 ? ND1 ? A HIS 79 ND1 
3  1 Y 1 A HIS 612 ? CD2 ? A HIS 79 CD2 
4  1 Y 1 A HIS 612 ? CE1 ? A HIS 79 CE1 
5  1 Y 1 A HIS 612 ? NE2 ? A HIS 79 NE2 
6  1 Y 1 B GLU 538 ? CG  ? B GLU 5  CG  
7  1 Y 1 B GLU 538 ? CD  ? B GLU 5  CD  
8  1 Y 1 B GLU 538 ? OE1 ? B GLU 5  OE1 
9  1 Y 1 B GLU 538 ? OE2 ? B GLU 5  OE2 
10 1 Y 1 B GLN 613 ? CG  ? B GLN 80 CG  
11 1 Y 1 B GLN 613 ? CD  ? B GLN 80 CD  
12 1 Y 1 B GLN 613 ? OE1 ? B GLN 80 OE1 
13 1 Y 1 B GLN 613 ? NE2 ? B GLN 80 NE2 
14 1 Y 1 C GLU 538 ? CG  ? C GLU 5  CG  
15 1 Y 1 C GLU 538 ? CD  ? C GLU 5  CD  
16 1 Y 1 C GLU 538 ? OE1 ? C GLU 5  OE1 
17 1 Y 1 C GLU 538 ? OE2 ? C GLU 5  OE2 
18 1 Y 1 C ARG 544 ? CG  ? C ARG 11 CG  
19 1 Y 1 C ARG 544 ? CD  ? C ARG 11 CD  
20 1 Y 1 C ARG 544 ? NE  ? C ARG 11 NE  
21 1 Y 1 C ARG 544 ? CZ  ? C ARG 11 CZ  
22 1 Y 1 C ARG 544 ? NH1 ? C ARG 11 NH1 
23 1 Y 1 C ARG 544 ? NH2 ? C ARG 11 NH2 
24 1 Y 1 C GLN 613 ? CG  ? C GLN 80 CG  
25 1 Y 1 C GLN 613 ? CD  ? C GLN 80 CD  
26 1 Y 1 C GLN 613 ? OE1 ? C GLN 80 OE1 
27 1 Y 1 C GLN 613 ? NE2 ? C GLN 80 NE2 
28 1 Y 1 D GLU 538 ? CG  ? D GLU 5  CG  
29 1 Y 1 D GLU 538 ? CD  ? D GLU 5  CD  
30 1 Y 1 D GLU 538 ? OE1 ? D GLU 5  OE1 
31 1 Y 1 D GLU 538 ? OE2 ? D GLU 5  OE2 
32 1 Y 1 D GLN 613 ? CG  ? D GLN 80 CG  
33 1 Y 1 D GLN 613 ? CD  ? D GLN 80 CD  
34 1 Y 1 D GLN 613 ? OE1 ? D GLN 80 OE1 
35 1 Y 1 D GLN 613 ? NE2 ? D GLN 80 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0   ? A GLY 1  
2  1 Y 1 A GLN 535 ? A GLN 2  
3  1 Y 1 A GLY 536 ? A GLY 3  
4  1 Y 1 A GLN 613 ? A GLN 80 
5  1 Y 1 A ALA 614 ? A ALA 81 
6  1 Y 1 A LYS 615 ? A LYS 82 
7  1 Y 1 A GLU 616 ? A GLU 83 
8  1 Y 1 A ALA 617 ? A ALA 84 
9  1 Y 1 A THR 618 ? A THR 85 
10 1 Y 1 A GLN 619 ? A GLN 86 
11 1 Y 1 A LYS 620 ? A LYS 87 
12 1 Y 1 A ALA 621 ? A ALA 88 
13 1 Y 1 A VAL 622 ? A VAL 89 
14 1 Y 1 A ASN 623 ? A ASN 90 
15 1 Y 1 A SER 624 ? A SER 91 
16 1 Y 1 A ALA 625 ? A ALA 92 
17 1 Y 1 A THR 626 ? A THR 93 
18 1 Y 1 A GLY 627 ? A GLY 94 
19 1 Y 1 A VAL 628 ? A VAL 95 
20 1 Y 1 A PRO 629 ? A PRO 96 
21 1 Y 1 A THR 630 ? A THR 97 
22 1 Y 1 A VAL 631 ? A VAL 98 
23 1 Y 1 B GLY 0   ? B GLY 1  
24 1 Y 1 B GLN 535 ? B GLN 2  
25 1 Y 1 B GLY 536 ? B GLY 3  
26 1 Y 1 B GLN 537 ? B GLN 4  
27 1 Y 1 B LYS 615 ? B LYS 82 
28 1 Y 1 B GLU 616 ? B GLU 83 
29 1 Y 1 B ALA 617 ? B ALA 84 
30 1 Y 1 B THR 618 ? B THR 85 
31 1 Y 1 B GLN 619 ? B GLN 86 
32 1 Y 1 B LYS 620 ? B LYS 87 
33 1 Y 1 B ALA 621 ? B ALA 88 
34 1 Y 1 B VAL 622 ? B VAL 89 
35 1 Y 1 B ASN 623 ? B ASN 90 
36 1 Y 1 B SER 624 ? B SER 91 
37 1 Y 1 B ALA 625 ? B ALA 92 
38 1 Y 1 B THR 626 ? B THR 93 
39 1 Y 1 B GLY 627 ? B GLY 94 
40 1 Y 1 B VAL 628 ? B VAL 95 
41 1 Y 1 B PRO 629 ? B PRO 96 
42 1 Y 1 B THR 630 ? B THR 97 
43 1 Y 1 B VAL 631 ? B VAL 98 
44 1 Y 1 C GLY 0   ? C GLY 1  
45 1 Y 1 C GLN 535 ? C GLN 2  
46 1 Y 1 C GLY 536 ? C GLY 3  
47 1 Y 1 C GLN 537 ? C GLN 4  
48 1 Y 1 C ALA 614 ? C ALA 81 
49 1 Y 1 C LYS 615 ? C LYS 82 
50 1 Y 1 C GLU 616 ? C GLU 83 
51 1 Y 1 C ALA 617 ? C ALA 84 
52 1 Y 1 C THR 618 ? C THR 85 
53 1 Y 1 C GLN 619 ? C GLN 86 
54 1 Y 1 C LYS 620 ? C LYS 87 
55 1 Y 1 C ALA 621 ? C ALA 88 
56 1 Y 1 C VAL 622 ? C VAL 89 
57 1 Y 1 C ASN 623 ? C ASN 90 
58 1 Y 1 C SER 624 ? C SER 91 
59 1 Y 1 C ALA 625 ? C ALA 92 
60 1 Y 1 C THR 626 ? C THR 93 
61 1 Y 1 C GLY 627 ? C GLY 94 
62 1 Y 1 C VAL 628 ? C VAL 95 
63 1 Y 1 C PRO 629 ? C PRO 96 
64 1 Y 1 C THR 630 ? C THR 97 
65 1 Y 1 C VAL 631 ? C VAL 98 
66 1 Y 1 D GLY 0   ? D GLY 1  
67 1 Y 1 D GLN 535 ? D GLN 2  
68 1 Y 1 D GLY 536 ? D GLY 3  
69 1 Y 1 D GLN 537 ? D GLN 4  
70 1 Y 1 D ALA 614 ? D ALA 81 
71 1 Y 1 D LYS 615 ? D LYS 82 
72 1 Y 1 D GLU 616 ? D GLU 83 
73 1 Y 1 D ALA 617 ? D ALA 84 
74 1 Y 1 D THR 618 ? D THR 85 
75 1 Y 1 D GLN 619 ? D GLN 86 
76 1 Y 1 D LYS 620 ? D LYS 87 
77 1 Y 1 D ALA 621 ? D ALA 88 
78 1 Y 1 D VAL 622 ? D VAL 89 
79 1 Y 1 D ASN 623 ? D ASN 90 
80 1 Y 1 D SER 624 ? D SER 91 
81 1 Y 1 D ALA 625 ? D ALA 92 
82 1 Y 1 D THR 626 ? D THR 93 
83 1 Y 1 D GLY 627 ? D GLY 94 
84 1 Y 1 D VAL 628 ? D VAL 95 
85 1 Y 1 D PRO 629 ? D PRO 96 
86 1 Y 1 D THR 630 ? D THR 97 
87 1 Y 1 D VAL 631 ? D VAL 98 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#