data_4IVZ
# 
_entry.id   4IVZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IVZ         
NDB   NA2238       
RCSB  RCSB077278   
WWPDB D_1000077278 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4FN3 'S52A Mutant free protein'              unspecified 
PDB 4FBI 'R46A Mutant free protein'              unspecified 
PDB 4F8D 'R46A  Mutant free protein'             unspecified 
PDB 3G5G 'Native free protein'                   unspecified 
PDB 3FYA 'R35A  Mutant free protein'             unspecified 
PDB 3CLC 'Native DNA bound tetramer'             unspecified 
PDB 3S8Q 'Native DNA bound dimer (OL)'           unspecified 
PDB 3UFD 'Native DNA bound dimer (OM)'           unspecified 
PDB 4I6R 'Native free protein (High Resolution)' unspecified 
PDB 4I6T 'T36A Mutant free protein'              unspecified 
PDB 4I6U 'Y37F Mutant free protein'              unspecified 
PDB 4I8T 'Native DNA Bound Dimer (OR)'           unspecified 
PDB 4IA8 'Y37A  Mutant free protein'             unspecified 
# 
_pdbx_database_status.entry_id                        4IVZ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-23 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Martin, R.N.A.' 1 
'McGeehan, J.E.' 2 
'Kneale, G.G.'   3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural and Mutagenic Analysis of the RM Controller Protein C.Esp1396I.' 'Plos One'                 9  e98365 e98365 
2014 ?      US 1932-6203 ?    ? 24887147 10.1371/journal.pone.0098365 
1       'Transcription regulation of restriction-modification system Esp1396I.' 'Nucleic Acids Res.'       37 3354   3366   2009 
NARHAD UK 0305-1048 0389 ? 19336410 10.1093/nar/gkp210           
2       
'Recognition of dual symmetry by the controller protein C.Esp1396I based on the structure of the transcriptional activation complex.' 
'Nucleic Acids Res.'       40 4158   4167   2012 NARHAD UK 0305-1048 0389 ? 22210861 10.1093/nar/gkr1250          
3       'Structure of the restriction-modification controller protein C.Esp1396I.' 'Acta Crystallogr.,Sect.D' 65 900    905    
2009 ABCRE6 DK 0907-4449 0766 ? 19690367 10.1107/S0907444909020514    
4       'Structural analysis of the genetic switch that regulates the expression of restriction-modification genes.' 
'Nucleic Acids Res.'       36 4778   4787   2008 NARHAD UK 0305-1048 0389 ? 18644840 10.1093/nar/gkn448           
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Martin, R.N.'   1  
primary 'McGeehan, J.E.' 2  
primary 'Kneale, G.'     3  
1       'Bogdanova, E.'  4  
1       'Zakharova, M.'  5  
1       'Streeter, S.'   6  
1       'Taylor, J.'     7  
1       'Heyduk, T.'     8  
1       'Kneale, G.'     9  
1       'Severinov, K.'  10 
2       'McGeehan, J.E.' 11 
2       'Ball, N.J.'     12 
2       'Streeter, S.D.' 13 
2       'Thresh, S.J.'   14 
2       'Kneale, G.G.'   15 
3       'Ball, N.'       16 
3       'Streeter, S.D.' 17 
3       'Kneale, G.G.'   18 
3       'McGeehan, J.E.' 19 
4       'McGeehan, J.E.' 20 
4       'Streeter, S.D.' 21 
4       'Thresh, S.J.'   22 
4       'Ball, N.'       23 
4       'Ravelli, R.B.'  24 
4       'Kneale, G.G.'   25 
# 
_cell.entry_id           4IVZ 
_cell.length_a           47.540 
_cell.length_b           146.700 
_cell.length_c           47.790 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.21 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IVZ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Regulatory protein'                                                      9505.175 4 ? Y37F ? ? 
2 polymer syn 
;DNA (5'-D(*AP*TP*GP*TP*AP*GP*AP*CP*TP*AP*TP*AP*GP*TP*CP*GP*AP*CP*A)-3')
;
5852.823 2 ? ?    ? '19 base OM operator'            
3 polymer syn 
;DNA (5'-D(*TP*TP*GP*TP*CP*GP*AP*CP*TP*AP*TP*AP*GP*TP*CP*TP*AP*CP*A)-3')
;
5794.771 2 ? ?    ? '19 base OM operator complement' 
4 water   nat water                                                                     18.015   2 ? ?    ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
;
;GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
;
A,B,E,F ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DG)(DT)(DA)(DG)(DA)(DC)(DT)(DA)(DT)(DA)(DG)(DT)(DC)(DG)(DA)(DC)(DA)'        
ATGTAGACTATAGTCGACA                                                                   C,G     ? 
3 polydeoxyribonucleotide no no '(DT)(DT)(DG)(DT)(DC)(DG)(DA)(DC)(DT)(DA)(DT)(DA)(DG)(DT)(DC)(DT)(DA)(DC)(DA)'        
TTGTCGACTATAGTCTACA                                                                   D,H     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  GLU n 
1 6  SER n 
1 7  PHE n 
1 8  LEU n 
1 9  LEU n 
1 10 SER n 
1 11 LYS n 
1 12 VAL n 
1 13 SER n 
1 14 PHE n 
1 15 VAL n 
1 16 ILE n 
1 17 LYS n 
1 18 LYS n 
1 19 ILE n 
1 20 ARG n 
1 21 LEU n 
1 22 GLU n 
1 23 LYS n 
1 24 GLY n 
1 25 MET n 
1 26 THR n 
1 27 GLN n 
1 28 GLU n 
1 29 ASP n 
1 30 LEU n 
1 31 ALA n 
1 32 TYR n 
1 33 LYS n 
1 34 SER n 
1 35 ASN n 
1 36 LEU n 
1 37 ASP n 
1 38 ARG n 
1 39 THR n 
1 40 PHE n 
1 41 ILE n 
1 42 SER n 
1 43 GLY n 
1 44 ILE n 
1 45 GLU n 
1 46 ARG n 
1 47 ASN n 
1 48 SER n 
1 49 ARG n 
1 50 ASN n 
1 51 LEU n 
1 52 THR n 
1 53 ILE n 
1 54 LYS n 
1 55 SER n 
1 56 LEU n 
1 57 GLU n 
1 58 LEU n 
1 59 ILE n 
1 60 MET n 
1 61 LYS n 
1 62 GLY n 
1 63 LEU n 
1 64 GLU n 
1 65 VAL n 
1 66 SER n 
1 67 ASP n 
1 68 VAL n 
1 69 VAL n 
1 70 PHE n 
1 71 PHE n 
1 72 GLU n 
1 73 MET n 
1 74 LEU n 
1 75 ILE n 
1 76 LYS n 
1 77 GLU n 
1 78 ILE n 
1 79 LEU n 
1 80 LYS n 
1 81 HIS n 
1 82 ASP n 
2 1  DA  n 
2 2  DT  n 
2 3  DG  n 
2 4  DT  n 
2 5  DA  n 
2 6  DG  n 
2 7  DA  n 
2 8  DC  n 
2 9  DT  n 
2 10 DA  n 
2 11 DT  n 
2 12 DA  n 
2 13 DG  n 
2 14 DT  n 
2 15 DC  n 
2 16 DG  n 
2 17 DA  n 
2 18 DC  n 
2 19 DA  n 
3 1  DT  n 
3 2  DT  n 
3 3  DG  n 
3 4  DT  n 
3 5  DC  n 
3 6  DG  n 
3 7  DA  n 
3 8  DC  n 
3 9  DT  n 
3 10 DA  n 
3 11 DT  n 
3 12 DA  n 
3 13 DG  n 
3 14 DT  n 
3 15 DC  n 
3 16 DT  n 
3 17 DA  n 
3 18 DC  n 
3 19 DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 esp1396IC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    RFL1396 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacter sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     211595 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q8GGH0_9ENTR Q8GGH0 1 MESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD 1 ? 
2 PDB 4IVZ         4IVZ   2 ?                                                                               ? ? 
3 PDB 4IVZ         4IVZ   3 ?                                                                               ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IVZ A 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
2 1 4IVZ B 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
3 1 4IVZ E 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
4 1 4IVZ F 4 ? 82 ? Q8GGH0 1 ? 79 ? 1 79 
5 2 4IVZ C 1 ? 19 ? 4IVZ   1 ? 19 ? 1 19 
6 2 4IVZ G 1 ? 19 ? 4IVZ   1 ? 19 ? 1 19 
7 3 4IVZ D 1 ? 19 ? 4IVZ   1 ? 19 ? 1 19 
8 3 4IVZ H 1 ? 19 ? 4IVZ   1 ? 19 ? 1 19 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IVZ GLY A 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 1  
1 4IVZ SER A 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 2  
1 4IVZ HIS A 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  3  
1 4IVZ PHE A 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 4  
2 4IVZ GLY B 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 5  
2 4IVZ SER B 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 6  
2 4IVZ HIS B 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  7  
2 4IVZ PHE B 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 8  
3 4IVZ GLY E 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 9  
3 4IVZ SER E 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 10 
3 4IVZ HIS E 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  11 
3 4IVZ PHE E 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 12 
4 4IVZ GLY F 1  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -2 13 
4 4IVZ SER F 2  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      -1 14 
4 4IVZ HIS F 3  ? UNP Q8GGH0 ?   ?  'EXPRESSION TAG'      0  15 
4 4IVZ PHE F 40 ? UNP Q8GGH0 TYR 37 'ENGINEERED MUTATION' 37 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4IVZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.71 
_exptl_crystal.density_percent_sol   54.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M SPG buffer, 25 % w/v PEG 1500, 10 uM Spermidine , pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-10-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4IVZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             146.810 
_reflns.d_resolution_high            3.100 
_reflns.number_obs                   11810 
_reflns.number_all                   11888 
_reflns.percent_possible_obs         99.500 
_reflns.pdbx_Rmerge_I_obs            0.111 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.700 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.500 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.100 
_reflns_shell.d_res_low              3.310 
_reflns_shell.percent_possible_all   99.600 
_reflns_shell.Rmerge_I_obs           0.666 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.800 
_reflns_shell.pdbx_redundancy        3.600 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4IVZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     11333 
_refine.ls_number_reflns_all                     11888 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.63 
_refine.ls_d_res_high                            3.100 
_refine.ls_percent_reflns_obs                    98.61 
_refine.ls_R_factor_obs                          0.17194 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16987 
_refine.ls_R_factor_R_free                       0.21478 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  548 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            1.000 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               73.261 
_refine.aniso_B[1][1]                            -0.86 
_refine.aniso_B[2][2]                            1.50 
_refine.aniso_B[3][3]                            -0.64 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.27 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      'PDB ENTRY 3UFD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.086 
_refine.overall_SU_ML                            0.245 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             12.726 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2482 
_refine_hist.pdbx_number_atoms_nucleic_acid   1546 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               4030 
_refine_hist.d_res_high                       3.100 
_refine_hist.d_res_low                        34.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.016  ? 4235 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.708  1.637  ? 5997 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.331  5.000  ? 301  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.066 24.356 ? 101  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       22.384 15.000 ? 565  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.344 15.000 ? 16   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.102  0.200  ? 629  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 2500 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.087 
_refine_ls_shell.d_res_low                        3.167 
_refine_ls_shell.number_reflns_R_work             753 
_refine_ls_shell.R_factor_R_work                  0.151 
_refine_ls_shell.percent_reflns_obs               86.29 
_refine_ls_shell.R_factor_R_free                  0.182 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             40 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4IVZ 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4IVZ 
_struct.title                     'A Y37F mutant of C.Esp1396I bound to its highest affinity operator site OM' 
_struct.pdbx_descriptor           'Regulatory protein/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IVZ 
_struct_keywords.text            
'Restriction-modification, helix-turn-helix, transcriptional regulator, DNA, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 6  ? LYS A 23 ? SER A 3  LYS A 20 1 ? 18 
HELX_P HELX_P2  2  THR A 26 ? ASN A 35 ? THR A 23 ASN A 32 1 ? 10 
HELX_P HELX_P3  3  ASP A 37 ? SER A 48 ? ASP A 34 SER A 45 1 ? 12 
HELX_P HELX_P4  4  THR A 52 ? LEU A 63 ? THR A 49 LEU A 60 1 ? 12 
HELX_P HELX_P5  5  VAL A 68 ? LEU A 79 ? VAL A 65 LEU A 76 1 ? 12 
HELX_P HELX_P6  6  SER B 6  ? LYS B 23 ? SER B 3  LYS B 20 1 ? 18 
HELX_P HELX_P7  7  THR B 26 ? SER B 34 ? THR B 23 SER B 31 1 ? 9  
HELX_P HELX_P8  8  ASP B 37 ? SER B 48 ? ASP B 34 SER B 45 1 ? 12 
HELX_P HELX_P9  9  THR B 52 ? LEU B 63 ? THR B 49 LEU B 60 1 ? 12 
HELX_P HELX_P10 10 SER B 66 ? LEU B 79 ? SER B 63 LEU B 76 1 ? 14 
HELX_P HELX_P11 11 SER E 6  ? GLU E 22 ? SER E 3  GLU E 19 1 ? 17 
HELX_P HELX_P12 12 THR E 26 ? ASN E 35 ? THR E 23 ASN E 32 1 ? 10 
HELX_P HELX_P13 13 ASP E 37 ? SER E 48 ? ASP E 34 SER E 45 1 ? 12 
HELX_P HELX_P14 14 THR E 52 ? LEU E 63 ? THR E 49 LEU E 60 1 ? 12 
HELX_P HELX_P15 15 SER E 66 ? LEU E 79 ? SER E 63 LEU E 76 1 ? 14 
HELX_P HELX_P16 16 SER F 6  ? LYS F 23 ? SER F 3  LYS F 20 1 ? 18 
HELX_P HELX_P17 17 THR F 26 ? ASN F 35 ? THR F 23 ASN F 32 1 ? 10 
HELX_P HELX_P18 18 ASP F 37 ? SER F 48 ? ASP F 34 SER F 45 1 ? 12 
HELX_P HELX_P19 19 THR F 52 ? GLU F 64 ? THR F 49 GLU F 61 1 ? 13 
HELX_P HELX_P20 20 SER F 66 ? LEU F 79 ? SER F 63 LEU F 76 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DA 1  N1 ? ? ? 1_555 H DT 1  N3 ? ? C DA 1  H DT 1  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog2  hydrog ? ? C DT 2  N3 ? ? ? 1_555 D DA 19 N1 ? ? C DT 2  D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DT 2  O4 ? ? ? 1_555 D DA 19 N6 ? ? C DT 2  D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DG 3  N1 ? ? ? 1_555 D DC 18 N3 ? ? C DG 3  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DG 3  N2 ? ? ? 1_555 D DC 18 O2 ? ? C DG 3  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DG 3  O6 ? ? ? 1_555 D DC 18 N4 ? ? C DG 3  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 17 N1 ? ? C DT 4  D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 17 N6 ? ? C DT 4  D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 16 N3 ? ? C DA 5  D DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 16 O4 ? ? C DA 5  D DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 15 N3 ? ? C DG 6  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 15 O2 ? ? C DG 6  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 15 N4 ? ? C DG 6  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 14 N3 ? ? C DA 7  D DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 14 O4 ? ? C DA 7  D DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DC 8  N3 ? ? ? 1_555 D DG 13 N1 ? ? C DC 8  D DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DC 8  N4 ? ? ? 1_555 D DG 13 O6 ? ? C DC 8  D DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DC 8  O2 ? ? ? 1_555 D DG 13 N2 ? ? C DC 8  D DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DT 9  N3 ? ? ? 1_555 D DA 12 N1 ? ? C DT 9  D DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DT 9  O4 ? ? ? 1_555 D DA 12 N6 ? ? C DT 9  D DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 10 D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 10 D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 11 D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 11 D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 9  N3 ? ? C DA 12 D DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 9  O4 ? ? C DA 12 D DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC 8  N3 ? ? C DG 13 D DC 8  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog28 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 7  N1 ? ? C DT 14 D DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 7  N6 ? ? C DT 14 D DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DC 15 N3 ? ? ? 1_555 D DG 6  N1 ? ? C DC 15 D DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DC 15 N4 ? ? ? 1_555 D DG 6  O6 ? ? C DC 15 D DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DC 15 O2 ? ? ? 1_555 D DG 6  N2 ? ? C DC 15 D DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C DG 16 N1 ? ? ? 1_555 D DC 5  N3 ? ? C DG 16 D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DG 16 N2 ? ? ? 1_555 D DC 5  O2 ? ? C DG 16 D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DG 16 O6 ? ? ? 1_555 D DC 5  N4 ? ? C DG 16 D DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DA 17 N1 ? ? ? 1_555 D DT 4  N3 ? ? C DA 17 D DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DA 17 N6 ? ? ? 1_555 D DT 4  O4 ? ? C DA 17 D DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DC 18 O2 ? ? ? 1_555 D DG 3  N1 ? ? C DC 18 D DG 3  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog39 hydrog ? ? C DA 19 N1 ? ? ? 1_555 D DT 2  N3 ? ? C DA 19 D DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DA 19 N6 ? ? ? 1_555 D DT 2  O4 ? ? C DA 19 D DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? G DT 2  N3 ? ? ? 1_555 H DA 19 N1 ? ? G DT 2  H DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? G DT 2  O4 ? ? ? 1_555 H DA 19 N6 ? ? G DT 2  H DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? G DG 3  N1 ? ? ? 1_555 H DC 18 N3 ? ? G DG 3  H DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? G DG 3  N2 ? ? ? 1_555 H DC 18 O2 ? ? G DG 3  H DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? G DG 3  O6 ? ? ? 1_555 H DC 18 N4 ? ? G DG 3  H DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? G DT 4  N3 ? ? ? 1_555 H DA 17 N1 ? ? G DT 4  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? G DT 4  O4 ? ? ? 1_555 H DA 17 N6 ? ? G DT 4  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? G DA 5  N1 ? ? ? 1_555 H DT 16 N3 ? ? G DA 5  H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? G DA 5  N6 ? ? ? 1_555 H DT 16 O4 ? ? G DA 5  H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? G DG 6  N1 ? ? ? 1_555 H DC 15 N3 ? ? G DG 6  H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? G DG 6  N2 ? ? ? 1_555 H DC 15 O2 ? ? G DG 6  H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? G DG 6  O6 ? ? ? 1_555 H DC 15 N4 ? ? G DG 6  H DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 14 N3 ? ? G DA 7  H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 14 O4 ? ? G DA 7  H DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? G DC 8  N3 ? ? ? 1_555 H DG 13 N1 ? ? G DC 8  H DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? G DC 8  N4 ? ? ? 1_555 H DG 13 O6 ? ? G DC 8  H DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? G DC 8  O2 ? ? ? 1_555 H DG 13 N2 ? ? G DC 8  H DG 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? G DT 9  N3 ? ? ? 1_555 H DA 12 N1 ? ? G DT 9  H DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? G DT 9  O4 ? ? ? 1_555 H DA 12 N6 ? ? G DT 9  H DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? G DA 10 N1 ? ? ? 1_555 H DT 11 N3 ? ? G DA 10 H DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? G DA 10 N6 ? ? ? 1_555 H DT 11 O4 ? ? G DA 10 H DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? G DT 11 N3 ? ? ? 1_555 H DA 10 N1 ? ? G DT 11 H DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? G DT 11 O4 ? ? ? 1_555 H DA 10 N6 ? ? G DT 11 H DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? G DA 12 N1 ? ? ? 1_555 H DT 9  N3 ? ? G DA 12 H DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? G DA 12 N6 ? ? ? 1_555 H DT 9  O4 ? ? G DA 12 H DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? G DG 13 N1 ? ? ? 1_555 H DC 8  N3 ? ? G DG 13 H DC 8  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog67 hydrog ? ? G DT 14 N3 ? ? ? 1_555 H DA 7  N1 ? ? G DT 14 H DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68 hydrog ? ? G DT 14 O4 ? ? ? 1_555 H DA 7  N6 ? ? G DT 14 H DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? G DC 15 N3 ? ? ? 1_555 H DG 6  N1 ? ? G DC 15 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? G DC 15 N4 ? ? ? 1_555 H DG 6  O6 ? ? G DC 15 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? G DC 15 O2 ? ? ? 1_555 H DG 6  N2 ? ? G DC 15 H DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? G DG 16 N1 ? ? ? 1_555 H DC 5  N3 ? ? G DG 16 H DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? G DG 16 N2 ? ? ? 1_555 H DC 5  O2 ? ? G DG 16 H DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? G DG 16 O6 ? ? ? 1_555 H DC 5  N4 ? ? G DG 16 H DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? G DA 17 N1 ? ? ? 1_555 H DT 4  N3 ? ? G DA 17 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? G DA 17 N6 ? ? ? 1_555 H DT 4  O4 ? ? G DA 17 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77 hydrog ? ? G DC 18 N3 ? ? ? 1_555 H DG 3  N1 ? ? G DC 18 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78 hydrog ? ? G DC 18 N4 ? ? ? 1_555 H DG 3  O6 ? ? G DC 18 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79 hydrog ? ? G DC 18 O2 ? ? ? 1_555 H DG 3  N2 ? ? G DC 18 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80 hydrog ? ? G DA 19 N1 ? ? ? 1_555 H DT 2  N3 ? ? G DA 19 H DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81 hydrog ? ? G DA 19 N6 ? ? ? 1_555 H DT 2  O4 ? ? G DA 19 H DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           22 
_struct_mon_prot_cis.label_asym_id          F 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            19 
_struct_mon_prot_cis.auth_asym_id           F 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    23 
_struct_mon_prot_cis.pdbx_label_asym_id_2   F 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     20 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    F 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       11.81 
# 
_atom_sites.entry_id                    4IVZ 
_atom_sites.fract_transf_matrix[1][1]   0.021035 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001180 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006817 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020958 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLU A 1 5  ? 43.892 -18.762 19.324  1.00 125.39 ? 2   GLU A N     1 
ATOM   2    C CA    . GLU A 1 5  ? 43.842 -17.272 19.305  1.00 118.50 ? 2   GLU A CA    1 
ATOM   3    C C     . GLU A 1 5  ? 43.639 -16.785 17.873  1.00 109.18 ? 2   GLU A C     1 
ATOM   4    O O     . GLU A 1 5  ? 42.951 -17.432 17.080  1.00 95.81  ? 2   GLU A O     1 
ATOM   5    C CB    . GLU A 1 5  ? 45.109 -16.617 19.907  1.00 114.99 ? 2   GLU A CB    1 
ATOM   6    C CG    . GLU A 1 5  ? 45.976 -17.486 20.807  1.00 110.23 ? 2   GLU A CG    1 
ATOM   7    C CD    . GLU A 1 5  ? 46.622 -18.633 20.043  1.00 111.60 ? 2   GLU A CD    1 
ATOM   8    O OE1   . GLU A 1 5  ? 46.330 -19.794 20.407  1.00 110.86 ? 2   GLU A OE1   1 
ATOM   9    O OE2   . GLU A 1 5  ? 47.388 -18.390 19.071  1.00 94.22  ? 2   GLU A OE2   1 
ATOM   10   N N     . SER A 1 6  ? 44.291 -15.665 17.566  1.00 98.23  ? 3   SER A N     1 
ATOM   11   C CA    . SER A 1 6  ? 44.001 -14.821 16.417  1.00 92.12  ? 3   SER A CA    1 
ATOM   12   C C     . SER A 1 6  ? 44.583 -15.359 15.102  1.00 88.98  ? 3   SER A C     1 
ATOM   13   O O     . SER A 1 6  ? 45.765 -15.681 15.015  1.00 93.76  ? 3   SER A O     1 
ATOM   14   C CB    . SER A 1 6  ? 44.494 -13.389 16.728  1.00 96.32  ? 3   SER A CB    1 
ATOM   15   O OG    . SER A 1 6  ? 44.570 -12.543 15.589  1.00 95.88  ? 3   SER A OG    1 
ATOM   16   N N     . PHE A 1 7  ? 43.728 -15.463 14.089  1.00 89.69  ? 4   PHE A N     1 
ATOM   17   C CA    . PHE A 1 7  ? 44.125 -15.890 12.747  1.00 82.58  ? 4   PHE A CA    1 
ATOM   18   C C     . PHE A 1 7  ? 45.212 -14.968 12.250  1.00 77.80  ? 4   PHE A C     1 
ATOM   19   O O     . PHE A 1 7  ? 46.318 -15.409 11.992  1.00 91.40  ? 4   PHE A O     1 
ATOM   20   C CB    . PHE A 1 7  ? 42.903 -15.905 11.803  1.00 87.11  ? 4   PHE A CB    1 
ATOM   21   C CG    . PHE A 1 7  ? 43.237 -15.948 10.324  1.00 89.34  ? 4   PHE A CG    1 
ATOM   22   C CD1   . PHE A 1 7  ? 44.363 -16.613 9.844   1.00 83.30  ? 4   PHE A CD1   1 
ATOM   23   C CD2   . PHE A 1 7  ? 42.371 -15.357 9.394   1.00 97.72  ? 4   PHE A CD2   1 
ATOM   24   C CE1   . PHE A 1 7  ? 44.644 -16.649 8.485   1.00 80.12  ? 4   PHE A CE1   1 
ATOM   25   C CE2   . PHE A 1 7  ? 42.647 -15.394 8.030   1.00 90.93  ? 4   PHE A CE2   1 
ATOM   26   C CZ    . PHE A 1 7  ? 43.789 -16.039 7.579   1.00 85.42  ? 4   PHE A CZ    1 
ATOM   27   N N     . LEU A 1 8  ? 44.897 -13.690 12.137  1.00 69.29  ? 5   LEU A N     1 
ATOM   28   C CA    . LEU A 1 8  ? 45.853 -12.694 11.707  1.00 65.95  ? 5   LEU A CA    1 
ATOM   29   C C     . LEU A 1 8  ? 47.194 -12.722 12.450  1.00 64.46  ? 5   LEU A C     1 
ATOM   30   O O     . LEU A 1 8  ? 48.261 -12.840 11.828  1.00 59.40  ? 5   LEU A O     1 
ATOM   31   C CB    . LEU A 1 8  ? 45.231 -11.329 11.898  1.00 71.26  ? 5   LEU A CB    1 
ATOM   32   C CG    . LEU A 1 8  ? 46.022 -10.066 11.600  1.00 68.53  ? 5   LEU A CG    1 
ATOM   33   C CD1   . LEU A 1 8  ? 46.412 -9.982  10.128  1.00 61.64  ? 5   LEU A CD1   1 
ATOM   34   C CD2   . LEU A 1 8  ? 45.058 -8.949  11.941  1.00 81.76  ? 5   LEU A CD2   1 
ATOM   35   N N     . LEU A 1 9  ? 47.127 -12.603 13.779  1.00 66.05  ? 6   LEU A N     1 
ATOM   36   C CA    . LEU A 1 9  ? 48.319 -12.389 14.643  1.00 57.44  ? 6   LEU A CA    1 
ATOM   37   C C     . LEU A 1 9  ? 49.434 -13.315 14.283  1.00 54.99  ? 6   LEU A C     1 
ATOM   38   O O     . LEU A 1 9  ? 50.550 -12.878 13.961  1.00 49.73  ? 6   LEU A O     1 
ATOM   39   C CB    . LEU A 1 9  ? 47.968 -12.583 16.118  1.00 51.56  ? 6   LEU A CB    1 
ATOM   40   C CG    . LEU A 1 9  ? 48.949 -12.094 17.168  1.00 50.88  ? 6   LEU A CG    1 
ATOM   41   C CD1   . LEU A 1 9  ? 49.592 -10.782 16.751  1.00 55.24  ? 6   LEU A CD1   1 
ATOM   42   C CD2   . LEU A 1 9  ? 48.232 -11.934 18.499  1.00 51.59  ? 6   LEU A CD2   1 
ATOM   43   N N     . SER A 1 10 ? 49.107 -14.604 14.380  1.00 57.78  ? 7   SER A N     1 
ATOM   44   C CA    . SER A 1 10 ? 49.889 -15.692 13.819  1.00 59.22  ? 7   SER A CA    1 
ATOM   45   C C     . SER A 1 10 ? 50.529 -15.400 12.414  1.00 65.79  ? 7   SER A C     1 
ATOM   46   O O     . SER A 1 10 ? 51.758 -15.378 12.300  1.00 72.23  ? 7   SER A O     1 
ATOM   47   C CB    . SER A 1 10 ? 49.000 -16.908 13.747  1.00 55.66  ? 7   SER A CB    1 
ATOM   48   O OG    . SER A 1 10 ? 48.165 -16.788 12.603  1.00 60.78  ? 7   SER A OG    1 
ATOM   49   N N     . LYS A 1 11 ? 49.720 -15.183 11.364  1.00 66.31  ? 8   LYS A N     1 
ATOM   50   C CA    . LYS A 1 11 ? 50.261 -14.853 10.021  1.00 67.98  ? 8   LYS A CA    1 
ATOM   51   C C     . LYS A 1 11 ? 51.291 -13.743 10.110  1.00 64.32  ? 8   LYS A C     1 
ATOM   52   O O     . LYS A 1 11 ? 52.397 -13.886 9.557   1.00 62.37  ? 8   LYS A O     1 
ATOM   53   C CB    . LYS A 1 11 ? 49.161 -14.454 9.009   1.00 73.48  ? 8   LYS A CB    1 
ATOM   54   C CG    . LYS A 1 11 ? 48.324 -15.605 8.460   1.00 78.16  ? 8   LYS A CG    1 
ATOM   55   C CD    . LYS A 1 11 ? 49.118 -16.604 7.617   1.00 80.90  ? 8   LYS A CD    1 
ATOM   56   C CE    . LYS A 1 11 ? 48.739 -18.038 7.984   1.00 75.77  ? 8   LYS A CE    1 
ATOM   57   N NZ    . LYS A 1 11 ? 48.447 -18.866 6.781   1.00 78.70  ? 8   LYS A NZ    1 
ATOM   58   N N     . VAL A 1 12 ? 50.926 -12.657 10.819  1.00 60.50  ? 9   VAL A N     1 
ATOM   59   C CA    . VAL A 1 12 ? 51.859 -11.560 11.106  1.00 53.56  ? 9   VAL A CA    1 
ATOM   60   C C     . VAL A 1 12 ? 53.181 -12.127 11.600  1.00 53.33  ? 9   VAL A C     1 
ATOM   61   O O     . VAL A 1 12 ? 54.217 -11.980 10.929  1.00 47.24  ? 9   VAL A O     1 
ATOM   62   C CB    . VAL A 1 12 ? 51.358 -10.568 12.162  1.00 50.47  ? 9   VAL A CB    1 
ATOM   63   C CG1   . VAL A 1 12 ? 52.182 -9.284  12.118  1.00 43.49  ? 9   VAL A CG1   1 
ATOM   64   C CG2   . VAL A 1 12 ? 49.886 -10.267 11.973  1.00 55.29  ? 9   VAL A CG2   1 
ATOM   65   N N     . SER A 1 13 ? 53.145 -12.797 12.754  1.00 61.07  ? 10  SER A N     1 
ATOM   66   C CA    . SER A 1 13 ? 54.362 -13.443 13.300  1.00 65.53  ? 10  SER A CA    1 
ATOM   67   C C     . SER A 1 13 ? 55.112 -14.172 12.182  1.00 65.25  ? 10  SER A C     1 
ATOM   68   O O     . SER A 1 13 ? 56.266 -13.836 11.923  1.00 62.23  ? 10  SER A O     1 
ATOM   69   C CB    . SER A 1 13 ? 54.041 -14.393 14.467  1.00 65.05  ? 10  SER A CB    1 
ATOM   70   O OG    . SER A 1 13 ? 54.263 -15.750 14.120  1.00 62.48  ? 10  SER A OG    1 
ATOM   71   N N     . PHE A 1 14 ? 54.425 -15.104 11.493  1.00 69.26  ? 11  PHE A N     1 
ATOM   72   C CA    . PHE A 1 14 ? 54.994 -15.888 10.360  1.00 69.41  ? 11  PHE A CA    1 
ATOM   73   C C     . PHE A 1 14 ? 55.707 -15.062 9.305   1.00 64.71  ? 11  PHE A C     1 
ATOM   74   O O     . PHE A 1 14 ? 56.749 -15.502 8.789   1.00 63.92  ? 11  PHE A O     1 
ATOM   75   C CB    . PHE A 1 14 ? 53.962 -16.766 9.643   1.00 75.10  ? 11  PHE A CB    1 
ATOM   76   C CG    . PHE A 1 14 ? 54.513 -17.463 8.415   1.00 86.08  ? 11  PHE A CG    1 
ATOM   77   C CD1   . PHE A 1 14 ? 54.607 -16.798 7.183   1.00 88.83  ? 11  PHE A CD1   1 
ATOM   78   C CD2   . PHE A 1 14 ? 54.966 -18.779 8.486   1.00 90.32  ? 11  PHE A CD2   1 
ATOM   79   C CE1   . PHE A 1 14 ? 55.132 -17.435 6.061   1.00 81.50  ? 11  PHE A CE1   1 
ATOM   80   C CE2   . PHE A 1 14 ? 55.479 -19.419 7.358   1.00 86.10  ? 11  PHE A CE2   1 
ATOM   81   C CZ    . PHE A 1 14 ? 55.558 -18.751 6.148   1.00 79.84  ? 11  PHE A CZ    1 
ATOM   82   N N     . VAL A 1 15 ? 55.141 -13.899 8.962   1.00 60.33  ? 12  VAL A N     1 
ATOM   83   C CA    . VAL A 1 15 ? 55.845 -12.945 8.070   1.00 51.80  ? 12  VAL A CA    1 
ATOM   84   C C     . VAL A 1 15 ? 57.058 -12.323 8.747   1.00 48.88  ? 12  VAL A C     1 
ATOM   85   O O     . VAL A 1 15 ? 58.115 -12.227 8.143   1.00 45.95  ? 12  VAL A O     1 
ATOM   86   C CB    . VAL A 1 15 ? 54.917 -11.849 7.513   1.00 50.43  ? 12  VAL A CB    1 
ATOM   87   C CG1   . VAL A 1 15 ? 55.696 -10.657 6.996   1.00 44.70  ? 12  VAL A CG1   1 
ATOM   88   C CG2   . VAL A 1 15 ? 54.049 -12.438 6.418   1.00 53.45  ? 12  VAL A CG2   1 
ATOM   89   N N     . ILE A 1 16 ? 56.943 -11.916 9.998   1.00 48.72  ? 13  ILE A N     1 
ATOM   90   C CA    . ILE A 1 16 ? 58.113 -11.259 10.581  1.00 60.34  ? 13  ILE A CA    1 
ATOM   91   C C     . ILE A 1 16 ? 59.342 -12.166 10.549  1.00 60.27  ? 13  ILE A C     1 
ATOM   92   O O     . ILE A 1 16 ? 60.448 -11.724 10.217  1.00 48.55  ? 13  ILE A O     1 
ATOM   93   C CB    . ILE A 1 16 ? 57.861 -10.768 12.011  1.00 66.48  ? 13  ILE A CB    1 
ATOM   94   C CG1   . ILE A 1 16 ? 56.748 -9.704  11.994  1.00 69.48  ? 13  ILE A CG1   1 
ATOM   95   C CG2   . ILE A 1 16 ? 59.157 -10.233 12.620  1.00 57.86  ? 13  ILE A CG2   1 
ATOM   96   C CD1   . ILE A 1 16 ? 55.657 -9.875  13.034  1.00 69.10  ? 13  ILE A CD1   1 
ATOM   97   N N     . LYS A 1 17 ? 59.108 -13.437 10.880  1.00 67.78  ? 14  LYS A N     1 
ATOM   98   C CA    . LYS A 1 17 ? 60.162 -14.437 11.020  1.00 65.80  ? 14  LYS A CA    1 
ATOM   99   C C     . LYS A 1 17 ? 60.909 -14.529 9.719   1.00 66.49  ? 14  LYS A C     1 
ATOM   100  O O     . LYS A 1 17 ? 62.104 -14.194 9.657   1.00 64.16  ? 14  LYS A O     1 
ATOM   101  C CB    . LYS A 1 17 ? 59.560 -15.796 11.366  1.00 67.79  ? 14  LYS A CB    1 
ATOM   102  C CG    . LYS A 1 17 ? 60.588 -16.898 11.539  1.00 67.18  ? 14  LYS A CG    1 
ATOM   103  C CD    . LYS A 1 17 ? 60.316 -17.791 12.743  1.00 65.29  ? 14  LYS A CD    1 
ATOM   104  C CE    . LYS A 1 17 ? 61.622 -18.073 13.484  1.00 65.37  ? 14  LYS A CE    1 
ATOM   105  N NZ    . LYS A 1 17 ? 61.441 -19.064 14.581  1.00 79.82  ? 14  LYS A NZ    1 
ATOM   106  N N     . LYS A 1 18 ? 60.170 -14.968 8.698   1.00 66.20  ? 15  LYS A N     1 
ATOM   107  C CA    . LYS A 1 18 ? 60.627 -15.082 7.319   1.00 64.62  ? 15  LYS A CA    1 
ATOM   108  C C     . LYS A 1 18 ? 61.509 -13.901 6.918   1.00 62.91  ? 15  LYS A C     1 
ATOM   109  O O     . LYS A 1 18 ? 62.716 -14.086 6.696   1.00 59.78  ? 15  LYS A O     1 
ATOM   110  C CB    . LYS A 1 18 ? 59.411 -15.200 6.399   1.00 72.07  ? 15  LYS A CB    1 
ATOM   111  C CG    . LYS A 1 18 ? 59.704 -15.390 4.913   1.00 81.39  ? 15  LYS A CG    1 
ATOM   112  C CD    . LYS A 1 18 ? 58.468 -15.113 4.054   1.00 76.73  ? 15  LYS A CD    1 
ATOM   113  C CE    . LYS A 1 18 ? 58.612 -15.721 2.678   1.00 74.47  ? 15  LYS A CE    1 
ATOM   114  N NZ    . LYS A 1 18 ? 58.459 -17.201 2.779   1.00 78.06  ? 15  LYS A NZ    1 
ATOM   115  N N     . ILE A 1 19 ? 60.925 -12.700 6.839   1.00 58.48  ? 16  ILE A N     1 
ATOM   116  C CA    . ILE A 1 19 ? 61.721 -11.475 6.619   1.00 60.11  ? 16  ILE A CA    1 
ATOM   117  C C     . ILE A 1 19 ? 63.010 -11.481 7.439   1.00 60.23  ? 16  ILE A C     1 
ATOM   118  O O     . ILE A 1 19 ? 64.089 -11.312 6.869   1.00 56.96  ? 16  ILE A O     1 
ATOM   119  C CB    . ILE A 1 19 ? 61.005 -10.164 7.025   1.00 58.38  ? 16  ILE A CB    1 
ATOM   120  C CG1   . ILE A 1 19 ? 59.808 -9.847  6.154   1.00 57.93  ? 16  ILE A CG1   1 
ATOM   121  C CG2   . ILE A 1 19 ? 61.941 -8.981  6.869   1.00 58.69  ? 16  ILE A CG2   1 
ATOM   122  C CD1   . ILE A 1 19 ? 59.103 -8.612  6.655   1.00 49.07  ? 16  ILE A CD1   1 
ATOM   123  N N     . ARG A 1 20 ? 62.881 -11.655 8.769   1.00 63.10  ? 17  ARG A N     1 
ATOM   124  C CA    . ARG A 1 20 ? 64.011 -11.530 9.696   1.00 59.72  ? 17  ARG A CA    1 
ATOM   125  C C     . ARG A 1 20 ? 65.160 -12.428 9.334   1.00 64.26  ? 17  ARG A C     1 
ATOM   126  O O     . ARG A 1 20 ? 66.314 -11.958 9.210   1.00 61.21  ? 17  ARG A O     1 
ATOM   127  C CB    . ARG A 1 20 ? 63.626 -11.853 11.097  1.00 62.35  ? 17  ARG A CB    1 
ATOM   128  C CG    . ARG A 1 20 ? 64.812 -11.665 12.032  1.00 74.28  ? 17  ARG A CG    1 
ATOM   129  C CD    . ARG A 1 20 ? 64.534 -12.268 13.401  1.00 86.28  ? 17  ARG A CD    1 
ATOM   130  N NE    . ARG A 1 20 ? 64.245 -13.697 13.292  1.00 82.95  ? 17  ARG A NE    1 
ATOM   131  C CZ    . ARG A 1 20 ? 65.095 -14.648 13.638  1.00 75.42  ? 17  ARG A CZ    1 
ATOM   132  N NH1   . ARG A 1 20 ? 66.276 -14.304 14.147  1.00 75.30  ? 17  ARG A NH1   1 
ATOM   133  N NH2   . ARG A 1 20 ? 64.752 -15.925 13.491  1.00 68.38  ? 17  ARG A NH2   1 
ATOM   134  N N     . LEU A 1 21 ? 64.821 -13.712 9.177   1.00 63.93  ? 18  LEU A N     1 
ATOM   135  C CA    . LEU A 1 21 ? 65.684 -14.731 8.548   1.00 63.27  ? 18  LEU A CA    1 
ATOM   136  C C     . LEU A 1 21 ? 66.305 -14.358 7.176   1.00 62.59  ? 18  LEU A C     1 
ATOM   137  O O     . LEU A 1 21 ? 67.543 -14.324 7.037   1.00 53.15  ? 18  LEU A O     1 
ATOM   138  C CB    . LEU A 1 21 ? 64.905 -16.041 8.399   1.00 62.69  ? 18  LEU A CB    1 
ATOM   139  C CG    . LEU A 1 21 ? 64.418 -16.757 9.643   1.00 61.03  ? 18  LEU A CG    1 
ATOM   140  C CD1   . LEU A 1 21 ? 63.617 -17.979 9.228   1.00 55.43  ? 18  LEU A CD1   1 
ATOM   141  C CD2   . LEU A 1 21 ? 65.626 -17.146 10.485  1.00 71.90  ? 18  LEU A CD2   1 
ATOM   142  N N     . GLU A 1 22 ? 65.461 -14.138 6.161   1.00 65.26  ? 19  GLU A N     1 
ATOM   143  C CA    . GLU A 1 22 ? 65.959 -13.712 4.844   1.00 77.11  ? 19  GLU A CA    1 
ATOM   144  C C     . GLU A 1 22 ? 67.166 -12.800 5.079   1.00 76.19  ? 19  GLU A C     1 
ATOM   145  O O     . GLU A 1 22 ? 68.304 -13.164 4.768   1.00 80.08  ? 19  GLU A O     1 
ATOM   146  C CB    . GLU A 1 22 ? 64.876 -12.993 4.001   1.00 78.42  ? 19  GLU A CB    1 
ATOM   147  C CG    . GLU A 1 22 ? 63.828 -13.905 3.343   1.00 77.89  ? 19  GLU A CG    1 
ATOM   148  C CD    . GLU A 1 22 ? 62.769 -13.168 2.493   1.00 80.10  ? 19  GLU A CD    1 
ATOM   149  O OE1   . GLU A 1 22 ? 63.019 -12.054 1.952   1.00 76.56  ? 19  GLU A OE1   1 
ATOM   150  O OE2   . GLU A 1 22 ? 61.660 -13.725 2.352   1.00 77.98  ? 19  GLU A OE2   1 
ATOM   151  N N     . LYS A 1 23 ? 66.898 -11.658 5.709   1.00 74.29  ? 20  LYS A N     1 
ATOM   152  C CA    . LYS A 1 23 ? 67.910 -10.680 6.096   1.00 74.48  ? 20  LYS A CA    1 
ATOM   153  C C     . LYS A 1 23 ? 69.060 -11.224 6.971   1.00 71.94  ? 20  LYS A C     1 
ATOM   154  O O     . LYS A 1 23 ? 70.007 -10.488 7.266   1.00 62.75  ? 20  LYS A O     1 
ATOM   155  C CB    . LYS A 1 23 ? 67.228 -9.491  6.797   1.00 73.09  ? 20  LYS A CB    1 
ATOM   156  C CG    . LYS A 1 23 ? 66.121 -8.844  5.977   1.00 75.91  ? 20  LYS A CG    1 
ATOM   157  C CD    . LYS A 1 23 ? 66.568 -7.578  5.261   1.00 76.71  ? 20  LYS A CD    1 
ATOM   158  C CE    . LYS A 1 23 ? 65.839 -7.422  3.932   1.00 82.79  ? 20  LYS A CE    1 
ATOM   159  N NZ    . LYS A 1 23 ? 65.896 -6.023  3.415   1.00 89.22  ? 20  LYS A NZ    1 
ATOM   160  N N     . GLY A 1 24 ? 68.971 -12.493 7.390   1.00 76.63  ? 21  GLY A N     1 
ATOM   161  C CA    . GLY A 1 24 ? 69.990 -13.147 8.248   1.00 73.86  ? 21  GLY A CA    1 
ATOM   162  C C     . GLY A 1 24 ? 70.340 -12.414 9.539   1.00 71.34  ? 21  GLY A C     1 
ATOM   163  O O     . GLY A 1 24 ? 71.507 -12.115 9.801   1.00 70.58  ? 21  GLY A O     1 
ATOM   164  N N     . MET A 1 25 ? 69.326 -12.111 10.341  1.00 65.57  ? 22  MET A N     1 
ATOM   165  C CA    . MET A 1 25 ? 69.529 -11.429 11.602  1.00 65.93  ? 22  MET A CA    1 
ATOM   166  C C     . MET A 1 25 ? 69.184 -12.376 12.749  1.00 67.37  ? 22  MET A C     1 
ATOM   167  O O     . MET A 1 25 ? 68.324 -13.233 12.591  1.00 71.89  ? 22  MET A O     1 
ATOM   168  C CB    . MET A 1 25 ? 68.630 -10.208 11.656  1.00 67.06  ? 22  MET A CB    1 
ATOM   169  C CG    . MET A 1 25 ? 69.187 -8.973  10.965  1.00 73.94  ? 22  MET A CG    1 
ATOM   170  S SD    . MET A 1 25 ? 67.995 -7.612  11.088  1.00 83.11  ? 22  MET A SD    1 
ATOM   171  C CE    . MET A 1 25 ? 68.647 -6.598  12.423  1.00 72.89  ? 22  MET A CE    1 
ATOM   172  N N     . THR A 1 26 ? 69.863 -12.246 13.890  1.00 63.62  ? 23  THR A N     1 
ATOM   173  C CA    . THR A 1 26 ? 69.463 -12.980 15.088  1.00 55.46  ? 23  THR A CA    1 
ATOM   174  C C     . THR A 1 26 ? 68.486 -12.102 15.868  1.00 65.41  ? 23  THR A C     1 
ATOM   175  O O     . THR A 1 26 ? 68.421 -10.856 15.678  1.00 63.48  ? 23  THR A O     1 
ATOM   176  C CB    . THR A 1 26 ? 70.618 -13.205 16.038  1.00 48.22  ? 23  THR A CB    1 
ATOM   177  O OG1   . THR A 1 26 ? 70.447 -12.327 17.149  1.00 56.64  ? 23  THR A OG1   1 
ATOM   178  C CG2   . THR A 1 26 ? 71.891 -12.890 15.416  1.00 40.06  ? 23  THR A CG2   1 
ATOM   179  N N     . GLN A 1 27 ? 67.781 -12.734 16.804  1.00 69.81  ? 24  GLN A N     1 
ATOM   180  C CA    . GLN A 1 27 ? 66.625 -12.088 17.440  1.00 77.02  ? 24  GLN A CA    1 
ATOM   181  C C     . GLN A 1 27 ? 67.082 -10.858 18.204  1.00 77.41  ? 24  GLN A C     1 
ATOM   182  O O     . GLN A 1 27 ? 66.460 -9.795  18.125  1.00 77.46  ? 24  GLN A O     1 
ATOM   183  C CB    . GLN A 1 27 ? 65.877 -13.035 18.378  1.00 68.36  ? 24  GLN A CB    1 
ATOM   184  C CG    . GLN A 1 27 ? 64.884 -14.023 17.755  1.00 58.10  ? 24  GLN A CG    1 
ATOM   185  C CD    . GLN A 1 27 ? 64.483 -15.107 18.771  1.00 60.01  ? 24  GLN A CD    1 
ATOM   186  O OE1   . GLN A 1 27 ? 65.298 -15.473 19.655  1.00 64.24  ? 24  GLN A OE1   1 
ATOM   187  N NE2   . GLN A 1 27 ? 63.246 -15.607 18.677  1.00 48.88  ? 24  GLN A NE2   1 
ATOM   188  N N     . GLU A 1 28 ? 68.183 -11.008 18.925  1.00 69.52  ? 25  GLU A N     1 
ATOM   189  C CA    . GLU A 1 28 ? 68.717 -9.904  19.708  1.00 68.27  ? 25  GLU A CA    1 
ATOM   190  C C     . GLU A 1 28 ? 69.160 -8.769  18.818  1.00 66.89  ? 25  GLU A C     1 
ATOM   191  O O     . GLU A 1 28 ? 69.206 -7.624  19.248  1.00 64.13  ? 25  GLU A O     1 
ATOM   192  C CB    . GLU A 1 28 ? 69.895 -10.385 20.521  1.00 67.25  ? 25  GLU A CB    1 
ATOM   193  C CG    . GLU A 1 28 ? 70.173 -9.565  21.753  1.00 69.81  ? 25  GLU A CG    1 
ATOM   194  C CD    . GLU A 1 28 ? 71.429 -10.070 22.431  1.00 81.03  ? 25  GLU A CD    1 
ATOM   195  O OE1   . GLU A 1 28 ? 71.488 -10.020 23.696  1.00 79.76  ? 25  GLU A OE1   1 
ATOM   196  O OE2   . GLU A 1 28 ? 72.337 -10.549 21.681  1.00 72.09  ? 25  GLU A OE2   1 
ATOM   197  N N     . ASP A 1 29 ? 69.501 -9.090  17.574  1.00 70.13  ? 26  ASP A N     1 
ATOM   198  C CA    . ASP A 1 29 ? 69.930 -8.062  16.634  1.00 76.99  ? 26  ASP A CA    1 
ATOM   199  C C     . ASP A 1 29 ? 68.789 -7.079  16.508  1.00 68.47  ? 26  ASP A C     1 
ATOM   200  O O     . ASP A 1 29 ? 68.843 -5.942  16.964  1.00 74.57  ? 26  ASP A O     1 
ATOM   201  C CB    . ASP A 1 29 ? 70.293 -8.674  15.263  1.00 66.33  ? 26  ASP A CB    1 
ATOM   202  C CG    . ASP A 1 29 ? 71.735 -9.127  15.191  1.00 68.78  ? 26  ASP A CG    1 
ATOM   203  O OD1   . ASP A 1 29 ? 72.577 -8.756  16.070  1.00 69.39  ? 26  ASP A OD1   1 
ATOM   204  O OD2   . ASP A 1 29 ? 72.035 -9.872  14.245  1.00 72.90  ? 26  ASP A OD2   1 
ATOM   205  N N     . LEU A 1 30 ? 67.747 -7.582  15.895  1.00 59.22  ? 27  LEU A N     1 
ATOM   206  C CA    . LEU A 1 30 ? 66.483 -6.918  15.722  1.00 58.92  ? 27  LEU A CA    1 
ATOM   207  C C     . LEU A 1 30 ? 65.893 -6.246  16.957  1.00 58.54  ? 27  LEU A C     1 
ATOM   208  O O     . LEU A 1 30 ? 65.083 -5.338  16.868  1.00 55.22  ? 27  LEU A O     1 
ATOM   209  C CB    . LEU A 1 30 ? 65.539 -8.030  15.291  1.00 55.34  ? 27  LEU A CB    1 
ATOM   210  C CG    . LEU A 1 30 ? 64.094 -7.761  15.102  1.00 55.45  ? 27  LEU A CG    1 
ATOM   211  C CD1   . LEU A 1 30 ? 63.944 -6.621  14.124  1.00 61.49  ? 27  LEU A CD1   1 
ATOM   212  C CD2   . LEU A 1 30 ? 63.583 -9.058  14.523  1.00 66.03  ? 27  LEU A CD2   1 
ATOM   213  N N     . ALA A 1 31 ? 66.257 -6.758  18.117  1.00 63.51  ? 28  ALA A N     1 
ATOM   214  C CA    . ALA A 1 31 ? 65.626 -6.340  19.322  1.00 62.55  ? 28  ALA A CA    1 
ATOM   215  C C     . ALA A 1 31 ? 66.207 -4.955  19.487  1.00 63.35  ? 28  ALA A C     1 
ATOM   216  O O     . ALA A 1 31 ? 65.496 -3.967  19.766  1.00 63.37  ? 28  ALA A O     1 
ATOM   217  C CB    . ALA A 1 31 ? 66.056 -7.266  20.441  1.00 64.03  ? 28  ALA A CB    1 
ATOM   218  N N     . TYR A 1 32 ? 67.517 -4.910  19.247  1.00 58.73  ? 29  TYR A N     1 
ATOM   219  C CA    . TYR A 1 32 ? 68.285 -3.703  19.346  1.00 58.33  ? 29  TYR A CA    1 
ATOM   220  C C     . TYR A 1 32 ? 67.808 -2.626  18.377  1.00 62.61  ? 29  TYR A C     1 
ATOM   221  O O     . TYR A 1 32 ? 67.478 -1.511  18.816  1.00 70.00  ? 29  TYR A O     1 
ATOM   222  C CB    . TYR A 1 32 ? 69.734 -4.044  19.123  1.00 59.56  ? 29  TYR A CB    1 
ATOM   223  C CG    . TYR A 1 32 ? 70.586 -2.869  18.774  1.00 65.65  ? 29  TYR A CG    1 
ATOM   224  C CD1   . TYR A 1 32 ? 70.812 -1.829  19.683  1.00 63.88  ? 29  TYR A CD1   1 
ATOM   225  C CD2   . TYR A 1 32 ? 71.184 -2.790  17.520  1.00 70.35  ? 29  TYR A CD2   1 
ATOM   226  C CE1   . TYR A 1 32 ? 71.621 -0.763  19.329  1.00 59.01  ? 29  TYR A CE1   1 
ATOM   227  C CE2   . TYR A 1 32 ? 71.998 -1.731  17.173  1.00 60.39  ? 29  TYR A CE2   1 
ATOM   228  C CZ    . TYR A 1 32 ? 72.198 -0.737  18.073  1.00 53.93  ? 29  TYR A CZ    1 
ATOM   229  O OH    . TYR A 1 32 ? 72.965 0.288   17.667  1.00 57.43  ? 29  TYR A OH    1 
ATOM   230  N N     . LYS A 1 33 ? 67.741 -2.984  17.087  1.00 61.26  ? 30  LYS A N     1 
ATOM   231  C CA    . LYS A 1 33 ? 67.321 -2.112  15.979  1.00 63.46  ? 30  LYS A CA    1 
ATOM   232  C C     . LYS A 1 33 ? 65.920 -1.648  16.140  1.00 70.96  ? 30  LYS A C     1 
ATOM   233  O O     . LYS A 1 33 ? 65.585 -0.509  15.799  1.00 90.94  ? 30  LYS A O     1 
ATOM   234  C CB    . LYS A 1 33 ? 67.424 -2.847  14.639  1.00 67.96  ? 30  LYS A CB    1 
ATOM   235  C CG    . LYS A 1 33 ? 68.875 -3.164  14.237  1.00 87.14  ? 30  LYS A CG    1 
ATOM   236  C CD    . LYS A 1 33 ? 69.556 -2.074  13.400  1.00 88.61  ? 30  LYS A CD    1 
ATOM   237  C CE    . LYS A 1 33 ? 68.985 -2.057  11.983  1.00 93.50  ? 30  LYS A CE    1 
ATOM   238  N NZ    . LYS A 1 33 ? 69.116 -3.390  11.311  1.00 95.90  ? 30  LYS A NZ    1 
ATOM   239  N N     . SER A 1 34 ? 65.082 -2.548  16.645  1.00 68.90  ? 31  SER A N     1 
ATOM   240  C CA    . SER A 1 34 ? 63.684 -2.249  16.903  1.00 53.90  ? 31  SER A CA    1 
ATOM   241  C C     . SER A 1 34 ? 63.563 -1.592  18.244  1.00 46.83  ? 31  SER A C     1 
ATOM   242  O O     . SER A 1 34 ? 62.562 -1.014  18.531  1.00 50.45  ? 31  SER A O     1 
ATOM   243  C CB    . SER A 1 34 ? 62.856 -3.527  16.858  1.00 61.49  ? 31  SER A CB    1 
ATOM   244  O OG    . SER A 1 34 ? 62.883 -4.091  15.556  1.00 62.34  ? 31  SER A OG    1 
ATOM   245  N N     . ASN A 1 35 ? 64.584 -1.676  19.090  1.00 49.76  ? 32  ASN A N     1 
ATOM   246  C CA    . ASN A 1 35 ? 64.535 -0.918  20.327  1.00 54.69  ? 32  ASN A CA    1 
ATOM   247  C C     . ASN A 1 35 ? 63.496 -1.590  21.234  1.00 53.37  ? 32  ASN A C     1 
ATOM   248  O O     . ASN A 1 35 ? 62.985 -1.009  22.203  1.00 45.99  ? 32  ASN A O     1 
ATOM   249  C CB    . ASN A 1 35 ? 64.114 0.529   20.000  1.00 67.68  ? 32  ASN A CB    1 
ATOM   250  C CG    . ASN A 1 35 ? 64.499 1.528   21.075  1.00 73.47  ? 32  ASN A CG    1 
ATOM   251  O OD1   . ASN A 1 35 ? 64.905 1.171   22.179  1.00 74.43  ? 32  ASN A OD1   1 
ATOM   252  N ND2   . ASN A 1 35 ? 64.364 2.799   20.748  1.00 82.36  ? 32  ASN A ND2   1 
ATOM   253  N N     . LEU A 1 36 ? 63.192 -2.840  20.894  1.00 58.13  ? 33  LEU A N     1 
ATOM   254  C CA    . LEU A 1 36 ? 62.382 -3.703  21.736  1.00 54.71  ? 33  LEU A CA    1 
ATOM   255  C C     . LEU A 1 36 ? 63.283 -4.680  22.531  1.00 57.26  ? 33  LEU A C     1 
ATOM   256  O O     . LEU A 1 36 ? 64.463 -4.841  22.210  1.00 48.59  ? 33  LEU A O     1 
ATOM   257  C CB    . LEU A 1 36 ? 61.337 -4.411  20.875  1.00 53.71  ? 33  LEU A CB    1 
ATOM   258  C CG    . LEU A 1 36 ? 60.125 -3.477  20.562  1.00 56.67  ? 33  LEU A CG    1 
ATOM   259  C CD1   . LEU A 1 36 ? 59.307 -3.854  19.313  1.00 51.78  ? 33  LEU A CD1   1 
ATOM   260  C CD2   . LEU A 1 36 ? 59.191 -3.289  21.756  1.00 48.63  ? 33  LEU A CD2   1 
ATOM   261  N N     . ASP A 1 37 ? 62.740 -5.280  23.595  1.00 60.83  ? 34  ASP A N     1 
ATOM   262  C CA    . ASP A 1 37 ? 63.444 -6.340  24.335  1.00 56.03  ? 34  ASP A CA    1 
ATOM   263  C C     . ASP A 1 37 ? 63.304 -7.735  23.691  1.00 55.41  ? 34  ASP A C     1 
ATOM   264  O O     . ASP A 1 37 ? 62.193 -8.207  23.353  1.00 49.65  ? 34  ASP A O     1 
ATOM   265  C CB    . ASP A 1 37 ? 62.972 -6.387  25.771  1.00 55.32  ? 34  ASP A CB    1 
ATOM   266  C CG    . ASP A 1 37 ? 63.913 -7.151  26.670  1.00 54.47  ? 34  ASP A CG    1 
ATOM   267  O OD1   . ASP A 1 37 ? 63.969 -8.403  26.614  1.00 53.66  ? 34  ASP A OD1   1 
ATOM   268  O OD2   . ASP A 1 37 ? 64.577 -6.483  27.477  1.00 57.32  ? 34  ASP A OD2   1 
ATOM   269  N N     . ARG A 1 38 ? 64.459 -8.378  23.547  1.00 52.63  ? 35  ARG A N     1 
ATOM   270  C CA    . ARG A 1 38 ? 64.584 -9.625  22.836  1.00 57.05  ? 35  ARG A CA    1 
ATOM   271  C C     . ARG A 1 38 ? 63.489 -10.613 23.155  1.00 59.11  ? 35  ARG A C     1 
ATOM   272  O O     . ARG A 1 38 ? 62.933 -11.277 22.262  1.00 58.17  ? 35  ARG A O     1 
ATOM   273  C CB    . ARG A 1 38 ? 65.931 -10.263 23.133  1.00 54.48  ? 35  ARG A CB    1 
ATOM   274  C CG    . ARG A 1 38 ? 66.358 -11.188 22.013  1.00 68.56  ? 35  ARG A CG    1 
ATOM   275  C CD    . ARG A 1 38 ? 67.582 -11.976 22.426  1.00 78.45  ? 35  ARG A CD    1 
ATOM   276  N NE    . ARG A 1 38 ? 67.460 -12.465 23.791  1.00 70.33  ? 35  ARG A NE    1 
ATOM   277  C CZ    . ARG A 1 38 ? 67.117 -13.713 24.124  1.00 67.24  ? 35  ARG A CZ    1 
ATOM   278  N NH1   . ARG A 1 38 ? 67.042 -14.033 25.406  1.00 61.75  ? 35  ARG A NH1   1 
ATOM   279  N NH2   . ARG A 1 38 ? 66.848 -14.637 23.195  1.00 57.97  ? 35  ARG A NH2   1 
ATOM   280  N N     . THR A 1 39 ? 63.193 -10.713 24.437  1.00 53.58  ? 36  THR A N     1 
ATOM   281  C CA    . THR A 1 39 ? 62.280 -11.697 24.886  1.00 58.63  ? 36  THR A CA    1 
ATOM   282  C C     . THR A 1 39 ? 60.955 -11.500 24.148  1.00 63.37  ? 36  THR A C     1 
ATOM   283  O O     . THR A 1 39 ? 60.426 -12.438 23.507  1.00 66.13  ? 36  THR A O     1 
ATOM   284  C CB    . THR A 1 39 ? 62.159 -11.637 26.407  1.00 59.85  ? 36  THR A CB    1 
ATOM   285  O OG1   . THR A 1 39 ? 62.973 -10.557 26.894  1.00 66.74  ? 36  THR A OG1   1 
ATOM   286  C CG2   . THR A 1 39 ? 62.704 -12.898 26.997  1.00 53.86  ? 36  THR A CG2   1 
ATOM   287  N N     . PHE A 1 40 ? 60.474 -10.260 24.172  1.00 61.05  ? 37  PHE A N     1 
ATOM   288  C CA    . PHE A 1 40 ? 59.191 -9.900  23.553  1.00 54.67  ? 37  PHE A CA    1 
ATOM   289  C C     . PHE A 1 40 ? 59.138 -10.536 22.159  1.00 55.42  ? 37  PHE A C     1 
ATOM   290  O O     . PHE A 1 40 ? 58.198 -11.275 21.844  1.00 64.91  ? 37  PHE A O     1 
ATOM   291  C CB    . PHE A 1 40 ? 59.008 -8.361  23.552  1.00 46.53  ? 37  PHE A CB    1 
ATOM   292  C CG    . PHE A 1 40 ? 57.643 -7.921  23.154  1.00 46.59  ? 37  PHE A CG    1 
ATOM   293  C CD1   . PHE A 1 40 ? 56.535 -8.243  23.933  1.00 47.36  ? 37  PHE A CD1   1 
ATOM   294  C CD2   . PHE A 1 40 ? 57.437 -7.214  21.968  1.00 47.41  ? 37  PHE A CD2   1 
ATOM   295  C CE1   . PHE A 1 40 ? 55.259 -7.860  23.548  1.00 43.07  ? 37  PHE A CE1   1 
ATOM   296  C CE2   . PHE A 1 40 ? 56.153 -6.843  21.568  1.00 42.04  ? 37  PHE A CE2   1 
ATOM   297  C CZ    . PHE A 1 40 ? 55.077 -7.160  22.369  1.00 43.17  ? 37  PHE A CZ    1 
ATOM   298  N N     . ILE A 1 41 ? 60.221 -10.338 21.397  1.00 58.28  ? 38  ILE A N     1 
ATOM   299  C CA    . ILE A 1 41 ? 60.374 -10.789 20.003  1.00 53.74  ? 38  ILE A CA    1 
ATOM   300  C C     . ILE A 1 41 ? 60.293 -12.285 19.840  1.00 62.41  ? 38  ILE A C     1 
ATOM   301  O O     . ILE A 1 41 ? 59.732 -12.786 18.853  1.00 58.55  ? 38  ILE A O     1 
ATOM   302  C CB    . ILE A 1 41 ? 61.748 -10.433 19.445  1.00 44.61  ? 38  ILE A CB    1 
ATOM   303  C CG1   . ILE A 1 41 ? 61.989 -8.913  19.499  1.00 44.05  ? 38  ILE A CG1   1 
ATOM   304  C CG2   . ILE A 1 41 ? 61.917 -11.077 18.079  1.00 37.09  ? 38  ILE A CG2   1 
ATOM   305  C CD1   . ILE A 1 41 ? 61.073 -8.095  18.635  1.00 42.17  ? 38  ILE A CD1   1 
ATOM   306  N N     . SER A 1 42 ? 60.891 -12.987 20.800  1.00 65.05  ? 39  SER A N     1 
ATOM   307  C CA    . SER A 1 42 ? 60.730 -14.410 20.869  1.00 67.65  ? 39  SER A CA    1 
ATOM   308  C C     . SER A 1 42 ? 59.243 -14.752 21.003  1.00 68.13  ? 39  SER A C     1 
ATOM   309  O O     . SER A 1 42 ? 58.722 -15.593 20.251  1.00 80.47  ? 39  SER A O     1 
ATOM   310  C CB    . SER A 1 42 ? 61.528 -14.978 22.020  1.00 68.78  ? 39  SER A CB    1 
ATOM   311  O OG    . SER A 1 42 ? 61.893 -16.310 21.707  1.00 79.01  ? 39  SER A OG    1 
ATOM   312  N N     . GLY A 1 43 ? 58.549 -14.056 21.906  1.00 62.65  ? 40  GLY A N     1 
ATOM   313  C CA    . GLY A 1 43 ? 57.175 -14.377 22.225  1.00 54.53  ? 40  GLY A CA    1 
ATOM   314  C C     . GLY A 1 43 ? 56.439 -14.280 20.935  1.00 58.42  ? 40  GLY A C     1 
ATOM   315  O O     . GLY A 1 43 ? 55.612 -15.144 20.586  1.00 62.90  ? 40  GLY A O     1 
ATOM   316  N N     . ILE A 1 44 ? 56.781 -13.229 20.200  1.00 60.36  ? 41  ILE A N     1 
ATOM   317  C CA    . ILE A 1 44 ? 56.057 -12.874 18.978  1.00 58.92  ? 41  ILE A CA    1 
ATOM   318  C C     . ILE A 1 44 ? 56.210 -13.935 17.895  1.00 61.61  ? 41  ILE A C     1 
ATOM   319  O O     . ILE A 1 44 ? 55.214 -14.375 17.332  1.00 66.85  ? 41  ILE A O     1 
ATOM   320  C CB    . ILE A 1 44 ? 56.512 -11.536 18.414  1.00 52.89  ? 41  ILE A CB    1 
ATOM   321  C CG1   . ILE A 1 44 ? 56.235 -10.397 19.396  1.00 47.79  ? 41  ILE A CG1   1 
ATOM   322  C CG2   . ILE A 1 44 ? 55.791 -11.262 17.113  1.00 54.78  ? 41  ILE A CG2   1 
ATOM   323  C CD1   . ILE A 1 44 ? 56.286 -9.038  18.726  1.00 43.58  ? 41  ILE A CD1   1 
ATOM   324  N N     . GLU A 1 45 ? 57.452 -14.341 17.623  1.00 62.06  ? 42  GLU A N     1 
ATOM   325  C CA    . GLU A 1 45 ? 57.747 -15.401 16.650  1.00 57.19  ? 42  GLU A CA    1 
ATOM   326  C C     . GLU A 1 45 ? 57.154 -16.709 17.069  1.00 58.04  ? 42  GLU A C     1 
ATOM   327  O O     . GLU A 1 45 ? 56.426 -17.323 16.293  1.00 62.00  ? 42  GLU A O     1 
ATOM   328  C CB    . GLU A 1 45 ? 59.248 -15.609 16.449  1.00 52.80  ? 42  GLU A CB    1 
ATOM   329  C CG    . GLU A 1 45 ? 59.910 -14.669 15.454  1.00 52.96  ? 42  GLU A CG    1 
ATOM   330  C CD    . GLU A 1 45 ? 61.412 -14.931 15.300  1.00 57.37  ? 42  GLU A CD    1 
ATOM   331  O OE1   . GLU A 1 45 ? 61.986 -14.526 14.261  1.00 58.93  ? 42  GLU A OE1   1 
ATOM   332  O OE2   . GLU A 1 45 ? 62.033 -15.554 16.203  1.00 54.95  ? 42  GLU A OE2   1 
ATOM   333  N N     . ARG A 1 46 ? 57.454 -17.143 18.285  1.00 58.66  ? 43  ARG A N     1 
ATOM   334  C CA    . ARG A 1 46 ? 57.084 -18.499 18.648  1.00 67.08  ? 43  ARG A CA    1 
ATOM   335  C C     . ARG A 1 46 ? 55.586 -18.648 18.930  1.00 76.71  ? 43  ARG A C     1 
ATOM   336  O O     . ARG A 1 46 ? 54.934 -19.550 18.374  1.00 79.03  ? 43  ARG A O     1 
ATOM   337  C CB    . ARG A 1 46 ? 57.920 -19.006 19.814  1.00 73.85  ? 43  ARG A CB    1 
ATOM   338  C CG    . ARG A 1 46 ? 57.484 -20.367 20.320  1.00 88.64  ? 43  ARG A CG    1 
ATOM   339  C CD    . ARG A 1 46 ? 58.672 -21.289 20.537  1.00 101.28 ? 43  ARG A CD    1 
ATOM   340  N NE    . ARG A 1 46 ? 58.966 -22.140 19.383  1.00 119.95 ? 43  ARG A NE    1 
ATOM   341  C CZ    . ARG A 1 46 ? 58.998 -23.471 19.422  1.00 123.05 ? 43  ARG A CZ    1 
ATOM   342  N NH1   . ARG A 1 46 ? 58.748 -24.117 20.556  1.00 119.15 ? 43  ARG A NH1   1 
ATOM   343  N NH2   . ARG A 1 46 ? 59.291 -24.163 18.324  1.00 138.12 ? 43  ARG A NH2   1 
ATOM   344  N N     . ASN A 1 47 ? 55.035 -17.756 19.760  1.00 79.85  ? 44  ASN A N     1 
ATOM   345  C CA    . ASN A 1 47 ? 53.681 -17.949 20.316  1.00 75.39  ? 44  ASN A CA    1 
ATOM   346  C C     . ASN A 1 47 ? 52.653 -16.977 19.834  1.00 72.65  ? 44  ASN A C     1 
ATOM   347  O O     . ASN A 1 47 ? 51.506 -17.045 20.265  1.00 83.51  ? 44  ASN A O     1 
ATOM   348  C CB    . ASN A 1 47 ? 53.717 -17.875 21.837  1.00 74.87  ? 44  ASN A CB    1 
ATOM   349  C CG    . ASN A 1 47 ? 54.768 -18.786 22.426  1.00 80.66  ? 44  ASN A CG    1 
ATOM   350  O OD1   . ASN A 1 47 ? 55.837 -18.339 22.857  1.00 78.61  ? 44  ASN A OD1   1 
ATOM   351  N ND2   . ASN A 1 47 ? 54.489 -20.086 22.406  1.00 85.35  ? 44  ASN A ND2   1 
ATOM   352  N N     . SER A 1 48 ? 53.072 -16.055 18.974  1.00 65.64  ? 45  SER A N     1 
ATOM   353  C CA    . SER A 1 48 ? 52.186 -15.041 18.419  1.00 61.30  ? 45  SER A CA    1 
ATOM   354  C C     . SER A 1 48 ? 51.527 -14.175 19.485  1.00 56.24  ? 45  SER A C     1 
ATOM   355  O O     . SER A 1 48 ? 50.313 -14.091 19.523  1.00 56.45  ? 45  SER A O     1 
ATOM   356  C CB    . SER A 1 48 ? 51.091 -15.687 17.568  1.00 62.68  ? 45  SER A CB    1 
ATOM   357  O OG    . SER A 1 48 ? 51.651 -16.362 16.469  1.00 83.12  ? 45  SER A OG    1 
ATOM   358  N N     . ARG A 1 49 ? 52.306 -13.536 20.351  1.00 49.72  ? 46  ARG A N     1 
ATOM   359  C CA    . ARG A 1 49 ? 51.708 -12.580 21.269  1.00 45.57  ? 46  ARG A CA    1 
ATOM   360  C C     . ARG A 1 49 ? 50.986 -11.543 20.425  1.00 50.89  ? 46  ARG A C     1 
ATOM   361  O O     . ARG A 1 49 ? 51.296 -11.382 19.240  1.00 53.16  ? 46  ARG A O     1 
ATOM   362  C CB    . ARG A 1 49 ? 52.765 -11.896 22.149  1.00 46.03  ? 46  ARG A CB    1 
ATOM   363  C CG    . ARG A 1 49 ? 53.694 -12.831 22.961  1.00 48.99  ? 46  ARG A CG    1 
ATOM   364  C CD    . ARG A 1 49 ? 54.701 -12.074 23.863  1.00 47.73  ? 46  ARG A CD    1 
ATOM   365  N NE    . ARG A 1 49 ? 54.046 -11.143 24.781  1.00 40.75  ? 46  ARG A NE    1 
ATOM   366  C CZ    . ARG A 1 49 ? 54.508 -10.762 25.959  1.00 37.51  ? 46  ARG A CZ    1 
ATOM   367  N NH1   . ARG A 1 49 ? 55.652 -11.229 26.411  1.00 41.42  ? 46  ARG A NH1   1 
ATOM   368  N NH2   . ARG A 1 49 ? 53.806 -9.925  26.715  1.00 39.12  ? 46  ARG A NH2   1 
ATOM   369  N N     . ASN A 1 50 ? 49.998 -10.864 21.012  1.00 55.38  ? 47  ASN A N     1 
ATOM   370  C CA    . ASN A 1 50 ? 49.620 -9.551  20.519  1.00 50.23  ? 47  ASN A CA    1 
ATOM   371  C C     . ASN A 1 50 ? 50.818 -8.574  20.648  1.00 49.78  ? 47  ASN A C     1 
ATOM   372  O O     . ASN A 1 50 ? 51.635 -8.641  21.583  1.00 46.12  ? 47  ASN A O     1 
ATOM   373  C CB    . ASN A 1 50 ? 48.453 -9.022  21.298  1.00 52.95  ? 47  ASN A CB    1 
ATOM   374  C CG    . ASN A 1 50 ? 47.317 -8.535  20.394  1.00 66.95  ? 47  ASN A CG    1 
ATOM   375  O OD1   . ASN A 1 50 ? 47.464 -8.448  19.157  1.00 71.78  ? 47  ASN A OD1   1 
ATOM   376  N ND2   . ASN A 1 50 ? 46.161 -8.226  21.009  1.00 57.31  ? 47  ASN A ND2   1 
ATOM   377  N N     . LEU A 1 51 ? 50.943 -7.708  19.660  1.00 47.75  ? 48  LEU A N     1 
ATOM   378  C CA    . LEU A 1 51 ? 51.833 -6.568  19.730  1.00 45.90  ? 48  LEU A CA    1 
ATOM   379  C C     . LEU A 1 51 ? 51.006 -5.346  19.340  1.00 43.56  ? 48  LEU A C     1 
ATOM   380  O O     . LEU A 1 51 ? 49.924 -5.509  18.756  1.00 43.78  ? 48  LEU A O     1 
ATOM   381  C CB    . LEU A 1 51 ? 53.055 -6.759  18.825  1.00 43.05  ? 48  LEU A CB    1 
ATOM   382  C CG    . LEU A 1 51 ? 53.034 -6.689  17.300  1.00 42.46  ? 48  LEU A CG    1 
ATOM   383  C CD1   . LEU A 1 51 ? 54.458 -6.656  16.721  1.00 39.72  ? 48  LEU A CD1   1 
ATOM   384  C CD2   . LEU A 1 51 ? 52.265 -7.854  16.731  1.00 45.47  ? 48  LEU A CD2   1 
ATOM   385  N N     . THR A 1 52 ? 51.452 -4.144  19.690  1.00 38.42  ? 49  THR A N     1 
ATOM   386  C CA    . THR A 1 52 ? 50.733 -2.997  19.194  1.00 39.40  ? 49  THR A CA    1 
ATOM   387  C C     . THR A 1 52 ? 51.330 -2.541  17.910  1.00 46.81  ? 49  THR A C     1 
ATOM   388  O O     . THR A 1 52 ? 52.469 -2.903  17.589  1.00 52.81  ? 49  THR A O     1 
ATOM   389  C CB    . THR A 1 52 ? 50.810 -1.793  20.088  1.00 35.14  ? 49  THR A CB    1 
ATOM   390  O OG1   . THR A 1 52 ? 52.139 -1.294  20.066  1.00 29.63  ? 49  THR A OG1   1 
ATOM   391  C CG2   . THR A 1 52 ? 50.409 -2.144  21.453  1.00 35.84  ? 49  THR A CG2   1 
ATOM   392  N N     . ILE A 1 53 ? 50.562 -1.709  17.197  1.00 50.12  ? 50  ILE A N     1 
ATOM   393  C CA    . ILE A 1 53 ? 51.049 -1.046  16.008  1.00 54.72  ? 50  ILE A CA    1 
ATOM   394  C C     . ILE A 1 53 ? 52.331 -0.177  16.290  1.00 72.30  ? 50  ILE A C     1 
ATOM   395  O O     . ILE A 1 53 ? 53.269 -0.194  15.496  1.00 79.97  ? 50  ILE A O     1 
ATOM   396  C CB    . ILE A 1 53 ? 49.952 -0.257  15.326  1.00 49.37  ? 50  ILE A CB    1 
ATOM   397  C CG1   . ILE A 1 53 ? 48.637 -1.088  15.253  1.00 51.62  ? 50  ILE A CG1   1 
ATOM   398  C CG2   . ILE A 1 53 ? 50.453 0.283   13.988  1.00 49.04  ? 50  ILE A CG2   1 
ATOM   399  C CD1   . ILE A 1 53 ? 48.574 -2.260  14.266  1.00 45.82  ? 50  ILE A CD1   1 
ATOM   400  N N     . LYS A 1 54 ? 52.447 0.539   17.410  1.00 65.48  ? 51  LYS A N     1 
ATOM   401  C CA    . LYS A 1 54 ? 53.759 1.176   17.643  1.00 53.00  ? 51  LYS A CA    1 
ATOM   402  C C     . LYS A 1 54 ? 54.804 0.121   17.625  1.00 48.28  ? 51  LYS A C     1 
ATOM   403  O O     . LYS A 1 54 ? 55.901 0.363   17.125  1.00 53.23  ? 51  LYS A O     1 
ATOM   404  C CB    . LYS A 1 54 ? 53.867 1.991   18.945  1.00 54.23  ? 51  LYS A CB    1 
ATOM   405  C CG    . LYS A 1 54 ? 53.156 3.325   18.889  1.00 57.52  ? 51  LYS A CG    1 
ATOM   406  C CD    . LYS A 1 54 ? 53.747 4.348   19.835  1.00 71.43  ? 51  LYS A CD    1 
ATOM   407  C CE    . LYS A 1 54 ? 52.761 5.501   20.076  1.00 77.54  ? 51  LYS A CE    1 
ATOM   408  N NZ    . LYS A 1 54 ? 52.994 6.275   21.331  1.00 70.55  ? 51  LYS A NZ    1 
ATOM   409  N N     . SER A 1 55 ? 54.490 -1.052  18.166  1.00 45.51  ? 52  SER A N     1 
ATOM   410  C CA    . SER A 1 55 ? 55.468 -2.151  18.175  1.00 49.10  ? 52  SER A CA    1 
ATOM   411  C C     . SER A 1 55 ? 55.786 -2.598  16.766  1.00 48.30  ? 52  SER A C     1 
ATOM   412  O O     . SER A 1 55 ? 56.943 -2.638  16.358  1.00 50.45  ? 52  SER A O     1 
ATOM   413  C CB    . SER A 1 55 ? 54.994 -3.328  19.006  1.00 55.28  ? 52  SER A CB    1 
ATOM   414  O OG    . SER A 1 55 ? 55.060 -3.016  20.394  1.00 70.10  ? 52  SER A OG    1 
ATOM   415  N N     . LEU A 1 56 ? 54.760 -2.862  15.981  1.00 46.94  ? 53  LEU A N     1 
ATOM   416  C CA    . LEU A 1 56 ? 55.015 -3.195  14.590  1.00 54.63  ? 53  LEU A CA    1 
ATOM   417  C C     . LEU A 1 56 ? 55.842 -2.150  13.805  1.00 58.62  ? 53  LEU A C     1 
ATOM   418  O O     . LEU A 1 56 ? 56.797 -2.516  13.122  1.00 58.76  ? 53  LEU A O     1 
ATOM   419  C CB    . LEU A 1 56 ? 53.717 -3.481  13.874  1.00 54.53  ? 53  LEU A CB    1 
ATOM   420  C CG    . LEU A 1 56 ? 53.861 -4.175  12.529  1.00 51.46  ? 53  LEU A CG    1 
ATOM   421  C CD1   . LEU A 1 56 ? 54.740 -5.407  12.666  1.00 51.28  ? 53  LEU A CD1   1 
ATOM   422  C CD2   . LEU A 1 56 ? 52.459 -4.506  11.993  1.00 47.97  ? 53  LEU A CD2   1 
ATOM   423  N N     . GLU A 1 57 ? 55.480 -0.867  13.927  1.00 61.30  ? 54  GLU A N     1 
ATOM   424  C CA    . GLU A 1 57 ? 56.179 0.244   13.282  1.00 58.83  ? 54  GLU A CA    1 
ATOM   425  C C     . GLU A 1 57 ? 57.658 0.220   13.545  1.00 59.51  ? 54  GLU A C     1 
ATOM   426  O O     . GLU A 1 57 ? 58.416 0.525   12.627  1.00 66.17  ? 54  GLU A O     1 
ATOM   427  C CB    . GLU A 1 57 ? 55.624 1.593   13.687  1.00 59.64  ? 54  GLU A CB    1 
ATOM   428  C CG    . GLU A 1 57 ? 56.106 2.701   12.767  1.00 66.08  ? 54  GLU A CG    1 
ATOM   429  C CD    . GLU A 1 57 ? 55.850 4.093   13.307  1.00 73.26  ? 54  GLU A CD    1 
ATOM   430  O OE1   . GLU A 1 57 ? 56.105 4.327   14.516  1.00 79.98  ? 54  GLU A OE1   1 
ATOM   431  O OE2   . GLU A 1 57 ? 55.413 4.963   12.515  1.00 73.40  ? 54  GLU A OE2   1 
ATOM   432  N N     . LEU A 1 58 ? 58.076 -0.143  14.771  1.00 64.48  ? 55  LEU A N     1 
ATOM   433  C CA    . LEU A 1 58 ? 59.537 -0.362  15.085  1.00 59.57  ? 55  LEU A CA    1 
ATOM   434  C C     . LEU A 1 58 ? 60.113 -1.510  14.303  1.00 55.66  ? 55  LEU A C     1 
ATOM   435  O O     . LEU A 1 58 ? 61.028 -1.342  13.540  1.00 53.73  ? 55  LEU A O     1 
ATOM   436  C CB    . LEU A 1 58 ? 59.779 -0.626  16.557  1.00 52.90  ? 55  LEU A CB    1 
ATOM   437  C CG    . LEU A 1 58 ? 59.364 0.540   17.458  1.00 58.39  ? 55  LEU A CG    1 
ATOM   438  C CD1   . LEU A 1 58 ? 59.724 0.280   18.936  1.00 46.65  ? 55  LEU A CD1   1 
ATOM   439  C CD2   . LEU A 1 58 ? 60.006 1.824   16.930  1.00 58.12  ? 55  LEU A CD2   1 
ATOM   440  N N     . ILE A 1 59 ? 59.514 -2.675  14.458  1.00 60.40  ? 56  ILE A N     1 
ATOM   441  C CA    . ILE A 1 59 ? 59.998 -3.870  13.797  1.00 59.65  ? 56  ILE A CA    1 
ATOM   442  C C     . ILE A 1 59 ? 60.095 -3.736  12.283  1.00 57.98  ? 56  ILE A C     1 
ATOM   443  O O     . ILE A 1 59 ? 61.121 -4.130  11.718  1.00 60.70  ? 56  ILE A O     1 
ATOM   444  C CB    . ILE A 1 59 ? 59.186 -5.101  14.221  1.00 60.95  ? 56  ILE A CB    1 
ATOM   445  C CG1   . ILE A 1 59 ? 59.331 -5.284  15.740  1.00 51.47  ? 56  ILE A CG1   1 
ATOM   446  C CG2   . ILE A 1 59 ? 59.622 -6.341  13.434  1.00 64.02  ? 56  ILE A CG2   1 
ATOM   447  C CD1   . ILE A 1 59 ? 58.085 -5.811  16.370  1.00 51.94  ? 56  ILE A CD1   1 
ATOM   448  N N     . MET A 1 60 ? 59.071 -3.174  11.626  1.00 56.45  ? 57  MET A N     1 
ATOM   449  C CA    . MET A 1 60 ? 59.169 -2.842  10.180  1.00 55.89  ? 57  MET A CA    1 
ATOM   450  C C     . MET A 1 60 ? 60.541 -2.167  9.902   1.00 61.33  ? 57  MET A C     1 
ATOM   451  O O     . MET A 1 60 ? 61.253 -2.544  8.963   1.00 52.21  ? 57  MET A O     1 
ATOM   452  C CB    . MET A 1 60 ? 58.069 -1.853  9.752   1.00 55.55  ? 57  MET A CB    1 
ATOM   453  C CG    . MET A 1 60 ? 56.612 -2.251  9.951   1.00 55.50  ? 57  MET A CG    1 
ATOM   454  S SD    . MET A 1 60 ? 56.104 -3.366  8.643   1.00 65.08  ? 57  MET A SD    1 
ATOM   455  C CE    . MET A 1 60 ? 54.329 -3.119  8.643   1.00 57.51  ? 57  MET A CE    1 
ATOM   456  N N     . LYS A 1 61 ? 60.861 -1.176  10.753  1.00 67.06  ? 58  LYS A N     1 
ATOM   457  C CA    . LYS A 1 61 ? 62.055 -0.329  10.729  1.00 67.39  ? 58  LYS A CA    1 
ATOM   458  C C     . LYS A 1 61 ? 63.291 -1.070  11.228  1.00 66.02  ? 58  LYS A C     1 
ATOM   459  O O     . LYS A 1 61 ? 64.412 -0.681  10.952  1.00 64.89  ? 58  LYS A O     1 
ATOM   460  C CB    . LYS A 1 61 ? 61.807 0.925   11.597  1.00 74.91  ? 58  LYS A CB    1 
ATOM   461  C CG    . LYS A 1 61 ? 62.943 1.966   11.673  1.00 77.00  ? 58  LYS A CG    1 
ATOM   462  C CD    . LYS A 1 61 ? 62.368 3.356   11.895  1.00 74.28  ? 58  LYS A CD    1 
ATOM   463  C CE    . LYS A 1 61 ? 61.444 3.717   10.733  1.00 77.74  ? 58  LYS A CE    1 
ATOM   464  N NZ    . LYS A 1 61 ? 60.137 4.310   11.130  1.00 79.14  ? 58  LYS A NZ    1 
ATOM   465  N N     . GLY A 1 62 ? 63.075 -2.141  11.974  1.00 70.19  ? 59  GLY A N     1 
ATOM   466  C CA    . GLY A 1 62 ? 64.171 -2.994  12.421  1.00 67.48  ? 59  GLY A CA    1 
ATOM   467  C C     . GLY A 1 62 ? 64.608 -3.906  11.297  1.00 59.70  ? 59  GLY A C     1 
ATOM   468  O O     . GLY A 1 62 ? 65.790 -4.123  11.102  1.00 56.52  ? 59  GLY A O     1 
ATOM   469  N N     . LEU A 1 63 ? 63.646 -4.434  10.544  1.00 62.89  ? 60  LEU A N     1 
ATOM   470  C CA    . LEU A 1 63 ? 63.977 -5.328  9.417   1.00 75.52  ? 60  LEU A CA    1 
ATOM   471  C C     . LEU A 1 63 ? 64.455 -4.506  8.196   1.00 89.84  ? 60  LEU A C     1 
ATOM   472  O O     . LEU A 1 63 ? 64.960 -5.051  7.176   1.00 91.49  ? 60  LEU A O     1 
ATOM   473  C CB    . LEU A 1 63 ? 62.800 -6.266  9.084   1.00 63.59  ? 60  LEU A CB    1 
ATOM   474  C CG    . LEU A 1 63 ? 62.247 -7.087  10.280  1.00 63.09  ? 60  LEU A CG    1 
ATOM   475  C CD1   . LEU A 1 63 ? 60.747 -7.464  10.157  1.00 57.06  ? 60  LEU A CD1   1 
ATOM   476  C CD2   . LEU A 1 63 ? 63.145 -8.277  10.623  1.00 51.06  ? 60  LEU A CD2   1 
ATOM   477  N N     . GLU A 1 64 ? 64.338 -3.181  8.354   1.00 90.38  ? 61  GLU A N     1 
ATOM   478  C CA    . GLU A 1 64 ? 64.533 -2.206  7.284   1.00 75.18  ? 61  GLU A CA    1 
ATOM   479  C C     . GLU A 1 64 ? 63.732 -2.607  6.060   1.00 68.41  ? 61  GLU A C     1 
ATOM   480  O O     . GLU A 1 64 ? 64.310 -2.809  4.985   1.00 68.52  ? 61  GLU A O     1 
ATOM   481  C CB    . GLU A 1 64 ? 66.005 -2.061  6.947   1.00 75.72  ? 61  GLU A CB    1 
ATOM   482  C CG    . GLU A 1 64 ? 66.833 -1.440  8.068   1.00 76.31  ? 61  GLU A CG    1 
ATOM   483  C CD    . GLU A 1 64 ? 68.307 -1.360  7.718   1.00 69.10  ? 61  GLU A CD    1 
ATOM   484  O OE1   . GLU A 1 64 ? 68.670 -1.751  6.598   1.00 76.84  ? 61  GLU A OE1   1 
ATOM   485  O OE2   . GLU A 1 64 ? 69.113 -0.905  8.546   1.00 73.30  ? 61  GLU A OE2   1 
ATOM   486  N N     . VAL A 1 65 ? 62.413 -2.752  6.261   1.00 58.15  ? 62  VAL A N     1 
ATOM   487  C CA    . VAL A 1 65 ? 61.468 -3.067  5.183   1.00 58.43  ? 62  VAL A CA    1 
ATOM   488  C C     . VAL A 1 65 ? 60.355 -2.007  5.129   1.00 58.46  ? 62  VAL A C     1 
ATOM   489  O O     . VAL A 1 65 ? 59.956 -1.409  6.141   1.00 51.39  ? 62  VAL A O     1 
ATOM   490  C CB    . VAL A 1 65 ? 60.943 -4.578  5.144   1.00 55.75  ? 62  VAL A CB    1 
ATOM   491  C CG1   . VAL A 1 65 ? 60.025 -4.951  6.307   1.00 47.54  ? 62  VAL A CG1   1 
ATOM   492  C CG2   . VAL A 1 65 ? 60.227 -4.896  3.837   1.00 51.10  ? 62  VAL A CG2   1 
ATOM   493  N N     . SER A 1 66 ? 59.867 -1.776  3.916   1.00 61.34  ? 63  SER A N     1 
ATOM   494  C CA    . SER A 1 66 ? 58.858 -0.791  3.689   1.00 66.99  ? 63  SER A CA    1 
ATOM   495  C C     . SER A 1 66 ? 57.530 -1.277  4.253   1.00 79.65  ? 63  SER A C     1 
ATOM   496  O O     . SER A 1 66 ? 57.125 -2.442  4.087   1.00 68.32  ? 63  SER A O     1 
ATOM   497  C CB    . SER A 1 66 ? 58.734 -0.532  2.204   1.00 68.75  ? 63  SER A CB    1 
ATOM   498  O OG    . SER A 1 66 ? 58.466 -1.750  1.542   1.00 57.22  ? 63  SER A OG    1 
ATOM   499  N N     . ASP A 1 67 ? 56.850 -0.360  4.927   1.00 84.17  ? 64  ASP A N     1 
ATOM   500  C CA    . ASP A 1 67 ? 55.595 -0.676  5.537   1.00 78.86  ? 64  ASP A CA    1 
ATOM   501  C C     . ASP A 1 67 ? 54.619 -1.136  4.417   1.00 88.45  ? 64  ASP A C     1 
ATOM   502  O O     . ASP A 1 67 ? 53.398 -1.192  4.610   1.00 89.33  ? 64  ASP A O     1 
ATOM   503  C CB    . ASP A 1 67 ? 55.121 0.574   6.289   1.00 68.31  ? 64  ASP A CB    1 
ATOM   504  C CG    . ASP A 1 67 ? 55.182 1.838   5.436   1.00 72.11  ? 64  ASP A CG    1 
ATOM   505  O OD1   . ASP A 1 67 ? 55.492 1.739   4.200   1.00 62.09  ? 64  ASP A OD1   1 
ATOM   506  O OD2   . ASP A 1 67 ? 54.851 2.926   6.002   1.00 68.30  ? 64  ASP A OD2   1 
ATOM   507  N N     . VAL A 1 68 ? 55.153 -1.436  3.236   1.00 76.57  ? 65  VAL A N     1 
ATOM   508  C CA    . VAL A 1 68 ? 54.305 -1.723  2.099   1.00 79.20  ? 65  VAL A CA    1 
ATOM   509  C C     . VAL A 1 68 ? 54.616 -3.108  1.588   1.00 84.15  ? 65  VAL A C     1 
ATOM   510  O O     . VAL A 1 68 ? 53.760 -3.778  0.958   1.00 66.41  ? 65  VAL A O     1 
ATOM   511  C CB    . VAL A 1 68 ? 54.557 -0.714  0.967   1.00 78.68  ? 65  VAL A CB    1 
ATOM   512  C CG1   . VAL A 1 68 ? 53.489 -0.825  -0.124  1.00 73.55  ? 65  VAL A CG1   1 
ATOM   513  C CG2   . VAL A 1 68 ? 54.618 0.688   1.541   1.00 80.12  ? 65  VAL A CG2   1 
ATOM   514  N N     . VAL A 1 69 ? 55.858 -3.529  1.827   1.00 83.65  ? 66  VAL A N     1 
ATOM   515  C CA    . VAL A 1 69 ? 56.267 -4.844  1.354   1.00 81.85  ? 66  VAL A CA    1 
ATOM   516  C C     . VAL A 1 69 ? 55.744 -5.829  2.346   1.00 75.17  ? 66  VAL A C     1 
ATOM   517  O O     . VAL A 1 69 ? 55.145 -6.829  1.975   1.00 77.99  ? 66  VAL A O     1 
ATOM   518  C CB    . VAL A 1 69 ? 57.778 -5.040  1.255   1.00 81.36  ? 66  VAL A CB    1 
ATOM   519  C CG1   . VAL A 1 69 ? 58.052 -6.479  0.837   1.00 91.01  ? 66  VAL A CG1   1 
ATOM   520  C CG2   . VAL A 1 69 ? 58.388 -4.084  0.249   1.00 70.79  ? 66  VAL A CG2   1 
ATOM   521  N N     . PHE A 1 70 ? 55.970 -5.516  3.613   1.00 75.00  ? 67  PHE A N     1 
ATOM   522  C CA    . PHE A 1 70 ? 55.468 -6.326  4.682   1.00 76.24  ? 67  PHE A CA    1 
ATOM   523  C C     . PHE A 1 70 ? 54.023 -6.650  4.334   1.00 73.49  ? 67  PHE A C     1 
ATOM   524  O O     . PHE A 1 70 ? 53.683 -7.772  3.904   1.00 65.02  ? 67  PHE A O     1 
ATOM   525  C CB    . PHE A 1 70 ? 55.568 -5.561  6.004   1.00 83.97  ? 67  PHE A CB    1 
ATOM   526  C CG    . PHE A 1 70 ? 55.372 -6.426  7.226   1.00 97.69  ? 67  PHE A CG    1 
ATOM   527  C CD1   . PHE A 1 70 ? 56.441 -7.086  7.807   1.00 98.35  ? 67  PHE A CD1   1 
ATOM   528  C CD2   . PHE A 1 70 ? 54.113 -6.588  7.793   1.00 109.74 ? 67  PHE A CD2   1 
ATOM   529  C CE1   . PHE A 1 70 ? 56.263 -7.888  8.921   1.00 94.72  ? 67  PHE A CE1   1 
ATOM   530  C CE2   . PHE A 1 70 ? 53.932 -7.390  8.913   1.00 104.94 ? 67  PHE A CE2   1 
ATOM   531  C CZ    . PHE A 1 70 ? 55.008 -8.037  9.473   1.00 97.03  ? 67  PHE A CZ    1 
ATOM   532  N N     . PHE A 1 71 ? 53.182 -5.634  4.461   1.00 76.21  ? 68  PHE A N     1 
ATOM   533  C CA    . PHE A 1 71 ? 51.762 -5.795  4.176   1.00 78.23  ? 68  PHE A CA    1 
ATOM   534  C C     . PHE A 1 71 ? 51.474 -6.624  2.909   1.00 79.71  ? 68  PHE A C     1 
ATOM   535  O O     . PHE A 1 71 ? 50.590 -7.478  2.925   1.00 85.78  ? 68  PHE A O     1 
ATOM   536  C CB    . PHE A 1 71 ? 51.074 -4.433  4.123   1.00 69.86  ? 68  PHE A CB    1 
ATOM   537  C CG    . PHE A 1 71 ? 50.987 -3.746  5.451   1.00 62.84  ? 68  PHE A CG    1 
ATOM   538  C CD1   . PHE A 1 71 ? 50.426 -4.382  6.549   1.00 63.20  ? 68  PHE A CD1   1 
ATOM   539  C CD2   . PHE A 1 71 ? 51.448 -2.449  5.602   1.00 66.18  ? 68  PHE A CD2   1 
ATOM   540  C CE1   . PHE A 1 71 ? 50.330 -3.735  7.777   1.00 64.14  ? 68  PHE A CE1   1 
ATOM   541  C CE2   . PHE A 1 71 ? 51.373 -1.791  6.832   1.00 68.25  ? 68  PHE A CE2   1 
ATOM   542  C CZ    . PHE A 1 71 ? 50.816 -2.436  7.920   1.00 64.40  ? 68  PHE A CZ    1 
ATOM   543  N N     . GLU A 1 72 ? 52.230 -6.386  1.832   1.00 84.30  ? 69  GLU A N     1 
ATOM   544  C CA    . GLU A 1 72 ? 52.075 -7.148  0.584   1.00 80.46  ? 69  GLU A CA    1 
ATOM   545  C C     . GLU A 1 72 ? 52.287 -8.655  0.824   1.00 79.24  ? 69  GLU A C     1 
ATOM   546  O O     . GLU A 1 72 ? 51.393 -9.482  0.496   1.00 62.98  ? 69  GLU A O     1 
ATOM   547  C CB    . GLU A 1 72 ? 52.993 -6.596  -0.528  1.00 78.13  ? 69  GLU A CB    1 
ATOM   548  C CG    . GLU A 1 72 ? 52.250 -6.021  -1.739  1.00 79.75  ? 69  GLU A CG    1 
ATOM   549  C CD    . GLU A 1 72 ? 53.161 -5.363  -2.795  1.00 80.25  ? 69  GLU A CD    1 
ATOM   550  O OE1   . GLU A 1 72 ? 54.207 -5.914  -3.202  1.00 68.12  ? 69  GLU A OE1   1 
ATOM   551  O OE2   . GLU A 1 72 ? 52.803 -4.266  -3.260  1.00 89.49  ? 69  GLU A OE2   1 
ATOM   552  N N     . MET A 1 73 ? 53.448 -8.986  1.422   1.00 75.47  ? 70  MET A N     1 
ATOM   553  C CA    . MET A 1 73 ? 53.830 -10.366 1.759   1.00 74.99  ? 70  MET A CA    1 
ATOM   554  C C     . MET A 1 73 ? 52.685 -10.961 2.546   1.00 79.88  ? 70  MET A C     1 
ATOM   555  O O     . MET A 1 73 ? 52.103 -12.006 2.185   1.00 83.87  ? 70  MET A O     1 
ATOM   556  C CB    . MET A 1 73 ? 55.080 -10.392 2.630   1.00 66.16  ? 70  MET A CB    1 
ATOM   557  C CG    . MET A 1 73 ? 56.338 -9.859  1.961   1.00 71.41  ? 70  MET A CG    1 
ATOM   558  S SD    . MET A 1 73 ? 57.866 -10.201 2.873   1.00 78.22  ? 70  MET A SD    1 
ATOM   559  C CE    . MET A 1 73 ? 58.111 -11.964 2.565   1.00 72.80  ? 70  MET A CE    1 
ATOM   560  N N     . LEU A 1 74 ? 52.367 -10.225 3.605   1.00 70.27  ? 71  LEU A N     1 
ATOM   561  C CA    . LEU A 1 74 ? 51.263 -10.467 4.479   1.00 66.16  ? 71  LEU A CA    1 
ATOM   562  C C     . LEU A 1 74 ? 49.990 -10.819 3.711   1.00 72.54  ? 71  LEU A C     1 
ATOM   563  O O     . LEU A 1 74 ? 49.308 -11.760 4.084   1.00 77.24  ? 71  LEU A O     1 
ATOM   564  C CB    . LEU A 1 74 ? 51.093 -9.234  5.355   1.00 63.10  ? 71  LEU A CB    1 
ATOM   565  C CG    . LEU A 1 74 ? 50.182 -9.096  6.576   1.00 71.50  ? 71  LEU A CG    1 
ATOM   566  C CD1   . LEU A 1 74 ? 50.217 -10.268 7.570   1.00 72.14  ? 71  LEU A CD1   1 
ATOM   567  C CD2   . LEU A 1 74 ? 50.563 -7.784  7.253   1.00 66.49  ? 71  LEU A CD2   1 
ATOM   568  N N     . ILE A 1 75 ? 49.679 -10.111 2.628   1.00 74.99  ? 72  ILE A N     1 
ATOM   569  C CA    . ILE A 1 75 ? 48.478 -10.451 1.873   1.00 72.10  ? 72  ILE A CA    1 
ATOM   570  C C     . ILE A 1 75 ? 48.593 -11.805 1.189   1.00 73.81  ? 72  ILE A C     1 
ATOM   571  O O     . ILE A 1 75 ? 47.647 -12.606 1.230   1.00 81.40  ? 72  ILE A O     1 
ATOM   572  C CB    . ILE A 1 75 ? 48.105 -9.414  0.805   1.00 70.49  ? 72  ILE A CB    1 
ATOM   573  C CG1   . ILE A 1 75 ? 47.530 -8.146  1.423   1.00 69.14  ? 72  ILE A CG1   1 
ATOM   574  C CG2   . ILE A 1 75 ? 47.055 -10.000 -0.121  1.00 75.63  ? 72  ILE A CG2   1 
ATOM   575  C CD1   . ILE A 1 75 ? 48.446 -6.956  1.335   1.00 68.49  ? 72  ILE A CD1   1 
ATOM   576  N N     . LYS A 1 76 ? 49.731 -12.068 0.552   1.00 77.18  ? 73  LYS A N     1 
ATOM   577  C CA    . LYS A 1 76 ? 49.814 -13.279 -0.256  1.00 85.40  ? 73  LYS A CA    1 
ATOM   578  C C     . LYS A 1 76 ? 49.726 -14.420 0.718   1.00 82.77  ? 73  LYS A C     1 
ATOM   579  O O     . LYS A 1 76 ? 49.018 -15.413 0.506   1.00 79.66  ? 73  LYS A O     1 
ATOM   580  C CB    . LYS A 1 76 ? 51.075 -13.302 -1.135  1.00 96.66  ? 73  LYS A CB    1 
ATOM   581  C CG    . LYS A 1 76 ? 50.820 -12.724 -2.541  1.00 110.14 ? 73  LYS A CG    1 
ATOM   582  C CD    . LYS A 1 76 ? 51.877 -11.714 -3.005  1.00 104.20 ? 73  LYS A CD    1 
ATOM   583  C CE    . LYS A 1 76 ? 51.236 -10.463 -3.609  1.00 99.17  ? 73  LYS A CE    1 
ATOM   584  N NZ    . LYS A 1 76 ? 52.184 -9.314  -3.707  1.00 93.13  ? 73  LYS A NZ    1 
ATOM   585  N N     . GLU A 1 77 ? 50.406 -14.206 1.832   1.00 83.07  ? 74  GLU A N     1 
ATOM   586  C CA    . GLU A 1 77 ? 50.318 -15.074 2.970   1.00 83.06  ? 74  GLU A CA    1 
ATOM   587  C C     . GLU A 1 77 ? 48.866 -15.335 3.357   1.00 80.42  ? 74  GLU A C     1 
ATOM   588  O O     . GLU A 1 77 ? 48.373 -16.439 3.157   1.00 76.89  ? 74  GLU A O     1 
ATOM   589  C CB    . GLU A 1 77 ? 51.129 -14.483 4.118   1.00 88.11  ? 74  GLU A CB    1 
ATOM   590  C CG    . GLU A 1 77 ? 52.624 -14.678 3.937   1.00 93.47  ? 74  GLU A CG    1 
ATOM   591  C CD    . GLU A 1 77 ? 53.021 -16.146 3.971   1.00 99.97  ? 74  GLU A CD    1 
ATOM   592  O OE1   . GLU A 1 77 ? 52.353 -16.938 4.685   1.00 100.92 ? 74  GLU A OE1   1 
ATOM   593  O OE2   . GLU A 1 77 ? 54.002 -16.507 3.286   1.00 94.95  ? 74  GLU A OE2   1 
ATOM   594  N N     . ILE A 1 78 ? 48.180 -14.312 3.865   1.00 83.15  ? 75  ILE A N     1 
ATOM   595  C CA    . ILE A 1 78 ? 46.758 -14.401 4.257   1.00 79.70  ? 75  ILE A CA    1 
ATOM   596  C C     . ILE A 1 78 ? 45.962 -15.185 3.249   1.00 79.02  ? 75  ILE A C     1 
ATOM   597  O O     . ILE A 1 78 ? 44.976 -15.820 3.608   1.00 87.73  ? 75  ILE A O     1 
ATOM   598  C CB    . ILE A 1 78 ? 46.098 -13.010 4.433   1.00 79.90  ? 75  ILE A CB    1 
ATOM   599  C CG1   . ILE A 1 78 ? 46.639 -12.307 5.681   1.00 83.44  ? 75  ILE A CG1   1 
ATOM   600  C CG2   . ILE A 1 78 ? 44.591 -13.137 4.578   1.00 78.24  ? 75  ILE A CG2   1 
ATOM   601  C CD1   . ILE A 1 78 ? 46.398 -10.814 5.695   1.00 86.44  ? 75  ILE A CD1   1 
ATOM   602  N N     . LEU A 1 79 ? 46.431 -15.206 2.008   1.00 85.60  ? 76  LEU A N     1 
ATOM   603  C CA    . LEU A 1 79 ? 45.748 -15.936 0.940   1.00 83.37  ? 76  LEU A CA    1 
ATOM   604  C C     . LEU A 1 79 ? 45.839 -17.466 1.045   1.00 85.16  ? 76  LEU A C     1 
ATOM   605  O O     . LEU A 1 79 ? 45.621 -18.186 0.090   1.00 78.76  ? 76  LEU A O     1 
ATOM   606  C CB    . LEU A 1 79 ? 46.166 -15.397 -0.422  1.00 73.93  ? 76  LEU A CB    1 
ATOM   607  C CG    . LEU A 1 79 ? 45.846 -13.904 -0.520  1.00 67.20  ? 76  LEU A CG    1 
ATOM   608  C CD1   . LEU A 1 79 ? 46.068 -13.392 -1.922  1.00 63.43  ? 76  LEU A CD1   1 
ATOM   609  C CD2   . LEU A 1 79 ? 44.425 -13.608 -0.087  1.00 64.45  ? 76  LEU A CD2   1 
ATOM   610  N N     . LYS A 1 80 ? 46.181 -17.917 2.245   1.00 95.41  ? 77  LYS A N     1 
ATOM   611  C CA    . LYS A 1 80 ? 45.821 -19.214 2.819   1.00 85.56  ? 77  LYS A CA    1 
ATOM   612  C C     . LYS A 1 80 ? 46.418 -19.350 4.227   1.00 83.01  ? 77  LYS A C     1 
ATOM   613  O O     . LYS A 1 80 ? 45.822 -18.916 5.216   1.00 80.69  ? 77  LYS A O     1 
ATOM   614  C CB    . LYS A 1 80 ? 46.241 -20.393 1.946   1.00 81.43  ? 77  LYS A CB    1 
ATOM   615  C CG    . LYS A 1 80 ? 45.246 -21.549 1.988   1.00 75.87  ? 77  LYS A CG    1 
ATOM   616  C CD    . LYS A 1 80 ? 44.806 -21.952 3.400   1.00 76.51  ? 77  LYS A CD    1 
ATOM   617  C CE    . LYS A 1 80 ? 43.582 -21.189 3.929   1.00 79.69  ? 77  LYS A CE    1 
ATOM   618  N NZ    . LYS A 1 80 ? 42.294 -21.451 3.209   1.00 78.58  ? 77  LYS A NZ    1 
ATOM   619  N N     . GLU B 1 5  ? 54.645 10.695  17.034  1.00 69.44  ? 2   GLU B N     1 
ATOM   620  C CA    . GLU B 1 5  ? 53.254 10.346  16.536  1.00 77.11  ? 2   GLU B CA    1 
ATOM   621  C C     . GLU B 1 5  ? 53.304 9.330   15.387  1.00 73.16  ? 2   GLU B C     1 
ATOM   622  O O     . GLU B 1 5  ? 53.512 9.715   14.229  1.00 69.63  ? 2   GLU B O     1 
ATOM   623  C CB    . GLU B 1 5  ? 52.501 11.599  16.066  1.00 80.54  ? 2   GLU B CB    1 
ATOM   624  C CG    . GLU B 1 5  ? 52.415 12.721  17.095  1.00 104.49 ? 2   GLU B CG    1 
ATOM   625  C CD    . GLU B 1 5  ? 53.480 13.807  16.908  1.00 111.66 ? 2   GLU B CD    1 
ATOM   626  O OE1   . GLU B 1 5  ? 53.110 15.007  16.976  1.00 109.12 ? 2   GLU B OE1   1 
ATOM   627  O OE2   . GLU B 1 5  ? 54.680 13.475  16.706  1.00 116.27 ? 2   GLU B OE2   1 
ATOM   628  N N     . SER B 1 6  ? 53.104 8.046   15.694  1.00 66.33  ? 3   SER B N     1 
ATOM   629  C CA    . SER B 1 6  ? 53.356 7.002   14.712  1.00 70.44  ? 3   SER B CA    1 
ATOM   630  C C     . SER B 1 6  ? 52.697 7.233   13.355  1.00 77.02  ? 3   SER B C     1 
ATOM   631  O O     . SER B 1 6  ? 51.466 7.192   13.238  1.00 92.38  ? 3   SER B O     1 
ATOM   632  C CB    . SER B 1 6  ? 52.943 5.635   15.236  1.00 72.31  ? 3   SER B CB    1 
ATOM   633  O OG    . SER B 1 6  ? 53.016 4.680   14.174  1.00 72.69  ? 3   SER B OG    1 
ATOM   634  N N     . PHE B 1 7  ? 53.518 7.450   12.332  1.00 78.17  ? 4   PHE B N     1 
ATOM   635  C CA    . PHE B 1 7  ? 53.056 7.493   10.944  1.00 76.51  ? 4   PHE B CA    1 
ATOM   636  C C     . PHE B 1 7  ? 52.061 6.342   10.669  1.00 75.42  ? 4   PHE B C     1 
ATOM   637  O O     . PHE B 1 7  ? 50.892 6.580   10.330  1.00 65.34  ? 4   PHE B O     1 
ATOM   638  C CB    . PHE B 1 7  ? 54.273 7.457   10.011  1.00 72.22  ? 4   PHE B CB    1 
ATOM   639  C CG    . PHE B 1 7  ? 53.943 7.435   8.546   1.00 77.20  ? 4   PHE B CG    1 
ATOM   640  C CD1   . PHE B 1 7  ? 52.952 8.257   8.012   1.00 84.40  ? 4   PHE B CD1   1 
ATOM   641  C CD2   . PHE B 1 7  ? 54.666 6.609   7.684   1.00 83.00  ? 4   PHE B CD2   1 
ATOM   642  C CE1   . PHE B 1 7  ? 52.668 8.235   6.651   1.00 87.92  ? 4   PHE B CE1   1 
ATOM   643  C CE2   . PHE B 1 7  ? 54.395 6.583   6.323   1.00 84.14  ? 4   PHE B CE2   1 
ATOM   644  C CZ    . PHE B 1 7  ? 53.395 7.400   5.807   1.00 91.18  ? 4   PHE B CZ    1 
ATOM   645  N N     . LEU B 1 8  ? 52.523 5.107   10.886  1.00 77.32  ? 5   LEU B N     1 
ATOM   646  C CA    . LEU B 1 8  ? 51.711 3.894   10.727  1.00 70.91  ? 5   LEU B CA    1 
ATOM   647  C C     . LEU B 1 8  ? 50.365 4.004   11.428  1.00 72.62  ? 5   LEU B C     1 
ATOM   648  O O     . LEU B 1 8  ? 49.377 3.489   10.939  1.00 69.56  ? 5   LEU B O     1 
ATOM   649  C CB    . LEU B 1 8  ? 52.475 2.670   11.249  1.00 63.59  ? 5   LEU B CB    1 
ATOM   650  C CG    . LEU B 1 8  ? 52.169 1.211   10.819  1.00 64.45  ? 5   LEU B CG    1 
ATOM   651  C CD1   . LEU B 1 8  ? 51.802 0.977   9.348   1.00 50.22  ? 5   LEU B CD1   1 
ATOM   652  C CD2   . LEU B 1 8  ? 53.344 0.302   11.189  1.00 65.89  ? 5   LEU B CD2   1 
ATOM   653  N N     . LEU B 1 9  ? 50.335 4.701   12.561  1.00 79.73  ? 6   LEU B N     1 
ATOM   654  C CA    . LEU B 1 9  ? 49.155 4.742   13.422  1.00 73.82  ? 6   LEU B CA    1 
ATOM   655  C C     . LEU B 1 9  ? 48.037 5.545   12.804  1.00 81.25  ? 6   LEU B C     1 
ATOM   656  O O     . LEU B 1 9  ? 46.927 5.025   12.616  1.00 85.77  ? 6   LEU B O     1 
ATOM   657  C CB    . LEU B 1 9  ? 49.489 5.322   14.801  1.00 70.22  ? 6   LEU B CB    1 
ATOM   658  C CG    . LEU B 1 9  ? 48.739 4.674   15.968  1.00 67.03  ? 6   LEU B CG    1 
ATOM   659  C CD1   . LEU B 1 9  ? 49.200 3.235   16.079  1.00 69.04  ? 6   LEU B CD1   1 
ATOM   660  C CD2   . LEU B 1 9  ? 48.956 5.426   17.282  1.00 61.21  ? 6   LEU B CD2   1 
ATOM   661  N N     . SER B 1 10 ? 48.324 6.819   12.514  1.00 83.85  ? 7   SER B N     1 
ATOM   662  C CA    . SER B 1 10 ? 47.341 7.740   11.908  1.00 71.98  ? 7   SER B CA    1 
ATOM   663  C C     . SER B 1 10 ? 46.823 7.170   10.582  1.00 60.91  ? 7   SER B C     1 
ATOM   664  O O     . SER B 1 10 ? 45.620 7.229   10.271  1.00 56.29  ? 7   SER B O     1 
ATOM   665  C CB    . SER B 1 10 ? 47.962 9.122   11.720  1.00 70.35  ? 7   SER B CB    1 
ATOM   666  O OG    . SER B 1 10 ? 49.256 8.997   11.136  1.00 79.64  ? 7   SER B OG    1 
ATOM   667  N N     . LYS B 1 11 ? 47.731 6.574   9.831   1.00 57.35  ? 8   LYS B N     1 
ATOM   668  C CA    . LYS B 1 11 ? 47.379 5.843   8.622   1.00 67.23  ? 8   LYS B CA    1 
ATOM   669  C C     . LYS B 1 11 ? 46.506 4.583   8.869   1.00 71.45  ? 8   LYS B C     1 
ATOM   670  O O     . LYS B 1 11 ? 45.724 4.196   8.004   1.00 71.43  ? 8   LYS B O     1 
ATOM   671  C CB    . LYS B 1 11 ? 48.637 5.548   7.772   1.00 80.33  ? 8   LYS B CB    1 
ATOM   672  C CG    . LYS B 1 11 ? 49.409 6.794   7.302   1.00 86.61  ? 8   LYS B CG    1 
ATOM   673  C CD    . LYS B 1 11 ? 48.744 7.450   6.095   1.00 93.10  ? 8   LYS B CD    1 
ATOM   674  C CE    . LYS B 1 11 ? 48.923 8.959   6.062   1.00 89.77  ? 8   LYS B CE    1 
ATOM   675  N NZ    . LYS B 1 11 ? 48.127 9.519   4.935   1.00 85.19  ? 8   LYS B NZ    1 
ATOM   676  N N     . VAL B 1 12 ? 46.598 3.964   10.048  1.00 80.25  ? 9   VAL B N     1 
ATOM   677  C CA    . VAL B 1 12 ? 45.623 2.926   10.454  1.00 71.44  ? 9   VAL B CA    1 
ATOM   678  C C     . VAL B 1 12 ? 44.257 3.503   10.838  1.00 71.72  ? 9   VAL B C     1 
ATOM   679  O O     . VAL B 1 12 ? 43.213 2.974   10.422  1.00 74.78  ? 9   VAL B O     1 
ATOM   680  C CB    . VAL B 1 12 ? 46.102 2.054   11.618  1.00 68.02  ? 9   VAL B CB    1 
ATOM   681  C CG1   . VAL B 1 12 ? 45.149 0.892   11.818  1.00 59.69  ? 9   VAL B CG1   1 
ATOM   682  C CG2   . VAL B 1 12 ? 47.502 1.505   11.355  1.00 78.69  ? 9   VAL B CG2   1 
ATOM   683  N N     . SER B 1 13 ? 44.251 4.584   11.609  1.00 68.06  ? 10  SER B N     1 
ATOM   684  C CA    . SER B 1 13 ? 42.984 5.167   12.048  1.00 73.82  ? 10  SER B CA    1 
ATOM   685  C C     . SER B 1 13 ? 42.156 5.682   10.893  1.00 87.60  ? 10  SER B C     1 
ATOM   686  O O     . SER B 1 13 ? 40.923 5.493   10.861  1.00 95.30  ? 10  SER B O     1 
ATOM   687  C CB    . SER B 1 13 ? 43.238 6.312   12.999  1.00 78.06  ? 10  SER B CB    1 
ATOM   688  O OG    . SER B 1 13 ? 43.906 7.336   12.300  1.00 94.07  ? 10  SER B OG    1 
ATOM   689  N N     . PHE B 1 14 ? 42.829 6.343   9.946   1.00 98.05  ? 11  PHE B N     1 
ATOM   690  C CA    . PHE B 1 14 ? 42.129 6.996   8.840   1.00 91.92  ? 11  PHE B CA    1 
ATOM   691  C C     . PHE B 1 14 ? 41.281 6.010   8.061   1.00 72.41  ? 11  PHE B C     1 
ATOM   692  O O     . PHE B 1 14 ? 40.080 6.190   7.971   1.00 77.53  ? 11  PHE B O     1 
ATOM   693  C CB    . PHE B 1 14 ? 43.086 7.762   7.932   1.00 108.66 ? 11  PHE B CB    1 
ATOM   694  C CG    . PHE B 1 14 ? 42.399 8.790   7.085   1.00 119.24 ? 11  PHE B CG    1 
ATOM   695  C CD1   . PHE B 1 14 ? 41.301 9.496   7.588   1.00 117.56 ? 11  PHE B CD1   1 
ATOM   696  C CD2   . PHE B 1 14 ? 42.845 9.061   5.795   1.00 117.18 ? 11  PHE B CD2   1 
ATOM   697  C CE1   . PHE B 1 14 ? 40.653 10.439  6.811   1.00 131.44 ? 11  PHE B CE1   1 
ATOM   698  C CE2   . PHE B 1 14 ? 42.202 10.008  5.015   1.00 126.59 ? 11  PHE B CE2   1 
ATOM   699  C CZ    . PHE B 1 14 ? 41.105 10.697  5.520   1.00 131.54 ? 11  PHE B CZ    1 
ATOM   700  N N     . VAL B 1 15 ? 41.912 4.946   7.567   1.00 67.42  ? 12  VAL B N     1 
ATOM   701  C CA    . VAL B 1 15 ? 41.216 3.776   6.979   1.00 62.95  ? 12  VAL B CA    1 
ATOM   702  C C     . VAL B 1 15 ? 39.975 3.271   7.768   1.00 64.34  ? 12  VAL B C     1 
ATOM   703  O O     . VAL B 1 15 ? 38.953 2.881   7.167   1.00 61.73  ? 12  VAL B O     1 
ATOM   704  C CB    . VAL B 1 15 ? 42.201 2.617   6.737   1.00 54.89  ? 12  VAL B CB    1 
ATOM   705  C CG1   . VAL B 1 15 ? 41.588 1.560   5.836   1.00 56.68  ? 12  VAL B CG1   1 
ATOM   706  C CG2   . VAL B 1 15 ? 43.439 3.155   6.085   1.00 54.32  ? 12  VAL B CG2   1 
ATOM   707  N N     . ILE B 1 16 ? 40.079 3.285   9.100   1.00 67.82  ? 13  ILE B N     1 
ATOM   708  C CA    . ILE B 1 16 ? 39.029 2.781   10.006  1.00 66.28  ? 13  ILE B CA    1 
ATOM   709  C C     . ILE B 1 16 ? 37.775 3.645   9.842   1.00 67.98  ? 13  ILE B C     1 
ATOM   710  O O     . ILE B 1 16 ? 36.704 3.127   9.434   1.00 64.81  ? 13  ILE B O     1 
ATOM   711  C CB    . ILE B 1 16 ? 39.531 2.706   11.483  1.00 60.80  ? 13  ILE B CB    1 
ATOM   712  C CG1   . ILE B 1 16 ? 40.224 1.358   11.758  1.00 56.20  ? 13  ILE B CG1   1 
ATOM   713  C CG2   . ILE B 1 16 ? 38.425 2.950   12.487  1.00 54.11  ? 13  ILE B CG2   1 
ATOM   714  C CD1   . ILE B 1 16 ? 41.327 1.372   12.817  1.00 40.46  ? 13  ILE B CD1   1 
ATOM   715  N N     . LYS B 1 17 ? 37.950 4.945   10.130  1.00 58.90  ? 14  LYS B N     1 
ATOM   716  C CA    . LYS B 1 17 ? 36.949 5.981   9.906   1.00 50.85  ? 14  LYS B CA    1 
ATOM   717  C C     . LYS B 1 17 ? 36.401 6.064   8.431   1.00 44.71  ? 14  LYS B C     1 
ATOM   718  O O     . LYS B 1 17 ? 35.174 6.089   8.189   1.00 34.77  ? 14  LYS B O     1 
ATOM   719  C CB    . LYS B 1 17 ? 37.538 7.314   10.355  1.00 51.07  ? 14  LYS B CB    1 
ATOM   720  C CG    . LYS B 1 17 ? 36.968 8.464   9.530   1.00 60.14  ? 14  LYS B CG    1 
ATOM   721  C CD    . LYS B 1 17 ? 36.877 9.757   10.301  1.00 58.86  ? 14  LYS B CD    1 
ATOM   722  C CE    . LYS B 1 17 ? 36.702 9.501   11.779  1.00 57.19  ? 14  LYS B CE    1 
ATOM   723  N NZ    . LYS B 1 17 ? 37.347 10.643  12.456  1.00 52.67  ? 14  LYS B NZ    1 
ATOM   724  N N     . LYS B 1 18 ? 37.325 6.094   7.470   1.00 43.80  ? 15  LYS B N     1 
ATOM   725  C CA    . LYS B 1 18 ? 36.973 5.974   6.073   1.00 50.02  ? 15  LYS B CA    1 
ATOM   726  C C     . LYS B 1 18 ? 35.990 4.808   5.885   1.00 60.09  ? 15  LYS B C     1 
ATOM   727  O O     . LYS B 1 18 ? 34.840 5.025   5.485   1.00 67.97  ? 15  LYS B O     1 
ATOM   728  C CB    . LYS B 1 18 ? 38.215 5.791   5.201   1.00 49.62  ? 15  LYS B CB    1 
ATOM   729  C CG    . LYS B 1 18 ? 37.935 5.209   3.811   1.00 61.91  ? 15  LYS B CG    1 
ATOM   730  C CD    . LYS B 1 18 ? 39.067 5.453   2.812   1.00 63.96  ? 15  LYS B CD    1 
ATOM   731  C CE    . LYS B 1 18 ? 38.557 5.530   1.373   1.00 61.39  ? 15  LYS B CE    1 
ATOM   732  N NZ    . LYS B 1 18 ? 39.564 6.152   0.465   1.00 69.00  ? 15  LYS B NZ    1 
ATOM   733  N N     . ILE B 1 19 ? 36.425 3.584   6.190   1.00 60.77  ? 16  ILE B N     1 
ATOM   734  C CA    . ILE B 1 19 ? 35.535 2.442   6.053   1.00 65.07  ? 16  ILE B CA    1 
ATOM   735  C C     . ILE B 1 19 ? 34.200 2.669   6.812   1.00 65.01  ? 16  ILE B C     1 
ATOM   736  O O     . ILE B 1 19 ? 33.097 2.331   6.321   1.00 62.82  ? 16  ILE B O     1 
ATOM   737  C CB    . ILE B 1 19 ? 36.195 1.118   6.510   1.00 60.88  ? 16  ILE B CB    1 
ATOM   738  C CG1   . ILE B 1 19 ? 37.366 0.728   5.624   1.00 52.25  ? 16  ILE B CG1   1 
ATOM   739  C CG2   . ILE B 1 19 ? 35.216 -0.044  6.395   1.00 71.49  ? 16  ILE B CG2   1 
ATOM   740  C CD1   . ILE B 1 19 ? 37.655 -0.751  5.645   1.00 38.85  ? 16  ILE B CD1   1 
ATOM   741  N N     . ARG B 1 20 ? 34.307 3.253   7.997   1.00 61.17  ? 17  ARG B N     1 
ATOM   742  C CA    . ARG B 1 20 ? 33.162 3.358   8.872   1.00 64.68  ? 17  ARG B CA    1 
ATOM   743  C C     . ARG B 1 20 ? 32.107 4.303   8.303   1.00 79.38  ? 17  ARG B C     1 
ATOM   744  O O     . ARG B 1 20 ? 30.916 4.019   8.416   1.00 95.21  ? 17  ARG B O     1 
ATOM   745  C CB    . ARG B 1 20 ? 33.562 3.746   10.285  1.00 56.87  ? 17  ARG B CB    1 
ATOM   746  C CG    . ARG B 1 20 ? 32.378 3.826   11.206  1.00 58.00  ? 17  ARG B CG    1 
ATOM   747  C CD    . ARG B 1 20 ? 32.781 4.206   12.628  1.00 73.21  ? 17  ARG B CD    1 
ATOM   748  N NE    . ARG B 1 20 ? 33.343 5.556   12.747  1.00 71.21  ? 17  ARG B NE    1 
ATOM   749  C CZ    . ARG B 1 20 ? 32.622 6.670   12.824  1.00 67.37  ? 17  ARG B CZ    1 
ATOM   750  N NH1   . ARG B 1 20 ? 31.280 6.616   12.796  1.00 65.67  ? 17  ARG B NH1   1 
ATOM   751  N NH2   . ARG B 1 20 ? 33.256 7.837   12.935  1.00 64.31  ? 17  ARG B NH2   1 
ATOM   752  N N     . LEU B 1 21 ? 32.524 5.389   7.653   1.00 71.96  ? 18  LEU B N     1 
ATOM   753  C CA    . LEU B 1 21 ? 31.575 6.358   7.120   1.00 61.31  ? 18  LEU B CA    1 
ATOM   754  C C     . LEU B 1 21 ? 30.990 5.911   5.769   1.00 61.95  ? 18  LEU B C     1 
ATOM   755  O O     . LEU B 1 21 ? 29.797 6.136   5.501   1.00 57.00  ? 18  LEU B O     1 
ATOM   756  C CB    . LEU B 1 21 ? 32.210 7.742   7.056   1.00 57.60  ? 18  LEU B CB    1 
ATOM   757  C CG    . LEU B 1 21 ? 32.633 8.247   8.433   1.00 56.66  ? 18  LEU B CG    1 
ATOM   758  C CD1   . LEU B 1 21 ? 33.667 9.385   8.356   1.00 54.10  ? 18  LEU B CD1   1 
ATOM   759  C CD2   . LEU B 1 21 ? 31.449 8.634   9.300   1.00 50.47  ? 18  LEU B CD2   1 
ATOM   760  N N     . GLU B 1 22 ? 31.841 5.300   4.933   1.00 65.25  ? 19  GLU B N     1 
ATOM   761  C CA    . GLU B 1 22 ? 31.424 4.567   3.734   1.00 72.03  ? 19  GLU B CA    1 
ATOM   762  C C     . GLU B 1 22 ? 30.329 3.597   4.124   1.00 83.66  ? 19  GLU B C     1 
ATOM   763  O O     . GLU B 1 22 ? 29.246 3.613   3.529   1.00 100.78 ? 19  GLU B O     1 
ATOM   764  C CB    . GLU B 1 22 ? 32.544 3.700   3.182   1.00 75.91  ? 19  GLU B CB    1 
ATOM   765  C CG    . GLU B 1 22 ? 33.612 4.344   2.316   1.00 81.28  ? 19  GLU B CG    1 
ATOM   766  C CD    . GLU B 1 22 ? 34.583 3.287   1.789   1.00 88.78  ? 19  GLU B CD    1 
ATOM   767  O OE1   . GLU B 1 22 ? 34.268 2.068   1.884   1.00 94.92  ? 19  GLU B OE1   1 
ATOM   768  O OE2   . GLU B 1 22 ? 35.665 3.658   1.283   1.00 86.10  ? 19  GLU B OE2   1 
ATOM   769  N N     . LYS B 1 23 ? 30.601 2.748   5.121   1.00 78.47  ? 20  LYS B N     1 
ATOM   770  C CA    . LYS B 1 23 ? 29.585 1.790   5.570   1.00 77.34  ? 20  LYS B CA    1 
ATOM   771  C C     . LYS B 1 23 ? 28.522 2.468   6.430   1.00 77.01  ? 20  LYS B C     1 
ATOM   772  O O     . LYS B 1 23 ? 27.542 1.845   6.843   1.00 82.69  ? 20  LYS B O     1 
ATOM   773  C CB    . LYS B 1 23 ? 30.220 0.577   6.263   1.00 76.48  ? 20  LYS B CB    1 
ATOM   774  C CG    . LYS B 1 23 ? 31.369 -0.027  5.461   1.00 74.62  ? 20  LYS B CG    1 
ATOM   775  C CD    . LYS B 1 23 ? 31.260 -1.531  5.290   1.00 69.56  ? 20  LYS B CD    1 
ATOM   776  C CE    . LYS B 1 23 ? 32.608 -2.052  4.805   1.00 75.91  ? 20  LYS B CE    1 
ATOM   777  N NZ    . LYS B 1 23 ? 32.525 -3.185  3.838   1.00 85.65  ? 20  LYS B NZ    1 
ATOM   778  N N     . GLY B 1 24 ? 28.731 3.759   6.685   1.00 77.33  ? 21  GLY B N     1 
ATOM   779  C CA    . GLY B 1 24 ? 27.764 4.607   7.368   1.00 67.07  ? 21  GLY B CA    1 
ATOM   780  C C     . GLY B 1 24 ? 27.458 4.050   8.726   1.00 69.10  ? 21  GLY B C     1 
ATOM   781  O O     . GLY B 1 24 ? 26.413 4.314   9.268   1.00 77.29  ? 21  GLY B O     1 
ATOM   782  N N     . MET B 1 25 ? 28.366 3.234   9.256   1.00 78.45  ? 22  MET B N     1 
ATOM   783  C CA    . MET B 1 25 ? 28.297 2.763   10.649  1.00 75.01  ? 22  MET B CA    1 
ATOM   784  C C     . MET B 1 25 ? 28.535 3.922   11.589  1.00 64.54  ? 22  MET B C     1 
ATOM   785  O O     . MET B 1 25 ? 29.199 4.912   11.229  1.00 59.96  ? 22  MET B O     1 
ATOM   786  C CB    . MET B 1 25 ? 29.313 1.659   10.928  1.00 72.20  ? 22  MET B CB    1 
ATOM   787  C CG    . MET B 1 25 ? 28.946 0.341   10.280  1.00 79.27  ? 22  MET B CG    1 
ATOM   788  S SD    . MET B 1 25 ? 30.132 -0.966  10.631  1.00 89.96  ? 22  MET B SD    1 
ATOM   789  C CE    . MET B 1 25 ? 29.692 -1.408  12.316  1.00 86.85  ? 22  MET B CE    1 
ATOM   790  N N     . THR B 1 26 ? 27.939 3.828   12.767  1.00 53.56  ? 23  THR B N     1 
ATOM   791  C CA    . THR B 1 26 ? 28.269 4.782   13.773  1.00 57.32  ? 23  THR B CA    1 
ATOM   792  C C     . THR B 1 26 ? 29.432 4.177   14.549  1.00 67.31  ? 23  THR B C     1 
ATOM   793  O O     . THR B 1 26 ? 29.826 3.021   14.285  1.00 75.07  ? 23  THR B O     1 
ATOM   794  C CB    . THR B 1 26 ? 27.063 5.208   14.637  1.00 54.89  ? 23  THR B CB    1 
ATOM   795  O OG1   . THR B 1 26 ? 27.469 5.250   16.008  1.00 69.34  ? 23  THR B OG1   1 
ATOM   796  C CG2   . THR B 1 26 ? 25.959 4.257   14.542  1.00 49.64  ? 23  THR B CG2   1 
ATOM   797  N N     . GLN B 1 27 ? 30.019 4.948   15.461  1.00 68.58  ? 24  GLN B N     1 
ATOM   798  C CA    . GLN B 1 27 ? 31.126 4.447   16.259  1.00 69.45  ? 24  GLN B CA    1 
ATOM   799  C C     . GLN B 1 27 ? 30.572 3.446   17.218  1.00 79.31  ? 24  GLN B C     1 
ATOM   800  O O     . GLN B 1 27 ? 31.171 2.409   17.460  1.00 88.11  ? 24  GLN B O     1 
ATOM   801  C CB    . GLN B 1 27 ? 31.711 5.540   17.108  1.00 64.94  ? 24  GLN B CB    1 
ATOM   802  C CG    . GLN B 1 27 ? 32.512 6.584   16.392  1.00 54.58  ? 24  GLN B CG    1 
ATOM   803  C CD    . GLN B 1 27 ? 33.180 7.478   17.389  1.00 51.89  ? 24  GLN B CD    1 
ATOM   804  O OE1   . GLN B 1 27 ? 32.702 7.642   18.513  1.00 58.23  ? 24  GLN B OE1   1 
ATOM   805  N NE2   . GLN B 1 27 ? 34.308 8.028   17.013  1.00 48.87  ? 24  GLN B NE2   1 
ATOM   806  N N     . GLU B 1 28 ? 29.431 3.783   17.805  1.00 87.20  ? 25  GLU B N     1 
ATOM   807  C CA    . GLU B 1 28 ? 28.760 2.846   18.672  1.00 95.19  ? 25  GLU B CA    1 
ATOM   808  C C     . GLU B 1 28 ? 28.498 1.610   17.823  1.00 90.14  ? 25  GLU B C     1 
ATOM   809  O O     . GLU B 1 28 ? 28.880 0.496   18.187  1.00 88.92  ? 25  GLU B O     1 
ATOM   810  C CB    . GLU B 1 28 ? 27.463 3.444   19.202  1.00 106.36 ? 25  GLU B CB    1 
ATOM   811  C CG    . GLU B 1 28 ? 26.973 2.808   20.491  1.00 110.60 ? 25  GLU B CG    1 
ATOM   812  C CD    . GLU B 1 28 ? 25.458 2.712   20.548  1.00 115.70 ? 25  GLU B CD    1 
ATOM   813  O OE1   . GLU B 1 28 ? 24.972 1.721   21.132  1.00 112.14 ? 25  GLU B OE1   1 
ATOM   814  O OE2   . GLU B 1 28 ? 24.755 3.608   20.006  1.00 110.10 ? 25  GLU B OE2   1 
ATOM   815  N N     . ASP B 1 29 ? 27.894 1.818   16.657  1.00 88.30  ? 26  ASP B N     1 
ATOM   816  C CA    . ASP B 1 29 ? 27.649 0.705   15.767  1.00 86.64  ? 26  ASP B CA    1 
ATOM   817  C C     . ASP B 1 29 ? 28.909 -0.136  15.667  1.00 77.56  ? 26  ASP B C     1 
ATOM   818  O O     . ASP B 1 29 ? 28.860 -1.344  15.800  1.00 93.05  ? 26  ASP B O     1 
ATOM   819  C CB    . ASP B 1 29 ? 27.110 1.151   14.402  1.00 84.80  ? 26  ASP B CB    1 
ATOM   820  C CG    . ASP B 1 29 ? 25.598 1.140   14.347  1.00 92.06  ? 26  ASP B CG    1 
ATOM   821  O OD1   . ASP B 1 29 ? 24.938 1.615   15.303  1.00 92.64  ? 26  ASP B OD1   1 
ATOM   822  O OD2   . ASP B 1 29 ? 25.057 0.655   13.335  1.00 109.56 ? 26  ASP B OD2   1 
ATOM   823  N N     . LEU B 1 30 ? 30.050 0.498   15.486  1.00 75.44  ? 27  LEU B N     1 
ATOM   824  C CA    . LEU B 1 30 ? 31.304 -0.274  15.452  1.00 79.91  ? 27  LEU B CA    1 
ATOM   825  C C     . LEU B 1 30 ? 31.610 -0.947  16.799  1.00 68.73  ? 27  LEU B C     1 
ATOM   826  O O     . LEU B 1 30 ? 31.832 -2.173  16.881  1.00 72.11  ? 27  LEU B O     1 
ATOM   827  C CB    . LEU B 1 30 ? 32.477 0.607   15.009  1.00 75.30  ? 27  LEU B CB    1 
ATOM   828  C CG    . LEU B 1 30 ? 33.838 -0.069  14.883  1.00 69.34  ? 27  LEU B CG    1 
ATOM   829  C CD1   . LEU B 1 30 ? 33.769 -1.168  13.830  1.00 78.05  ? 27  LEU B CD1   1 
ATOM   830  C CD2   . LEU B 1 30 ? 34.909 0.950   14.533  1.00 55.28  ? 27  LEU B CD2   1 
ATOM   831  N N     . ALA B 1 31 ? 31.586 -0.133  17.845  1.00 59.30  ? 28  ALA B N     1 
ATOM   832  C CA    . ALA B 1 31 ? 31.767 -0.617  19.185  1.00 56.39  ? 28  ALA B CA    1 
ATOM   833  C C     . ALA B 1 31 ? 31.031 -1.955  19.357  1.00 57.10  ? 28  ALA B C     1 
ATOM   834  O O     . ALA B 1 31 ? 31.620 -2.912  19.801  1.00 52.51  ? 28  ALA B O     1 
ATOM   835  C CB    . ALA B 1 31 ? 31.306 0.421   20.191  1.00 52.14  ? 28  ALA B CB    1 
ATOM   836  N N     . TYR B 1 32 ? 29.760 -2.047  18.961  1.00 60.81  ? 29  TYR B N     1 
ATOM   837  C CA    . TYR B 1 32 ? 29.070 -3.319  19.142  1.00 62.56  ? 29  TYR B CA    1 
ATOM   838  C C     . TYR B 1 32 ? 29.776 -4.404  18.346  1.00 58.30  ? 29  TYR B C     1 
ATOM   839  O O     . TYR B 1 32 ? 30.259 -5.382  18.909  1.00 58.67  ? 29  TYR B O     1 
ATOM   840  C CB    . TYR B 1 32 ? 27.569 -3.234  18.792  1.00 70.16  ? 29  TYR B CB    1 
ATOM   841  C CG    . TYR B 1 32 ? 26.810 -4.565  18.776  1.00 66.78  ? 29  TYR B CG    1 
ATOM   842  C CD1   . TYR B 1 32 ? 26.936 -5.495  19.806  1.00 69.66  ? 29  TYR B CD1   1 
ATOM   843  C CD2   . TYR B 1 32 ? 25.963 -4.877  17.730  1.00 75.40  ? 29  TYR B CD2   1 
ATOM   844  C CE1   . TYR B 1 32 ? 26.264 -6.710  19.775  1.00 72.82  ? 29  TYR B CE1   1 
ATOM   845  C CE2   . TYR B 1 32 ? 25.261 -6.075  17.698  1.00 84.74  ? 29  TYR B CE2   1 
ATOM   846  C CZ    . TYR B 1 32 ? 25.421 -6.994  18.719  1.00 80.43  ? 29  TYR B CZ    1 
ATOM   847  O OH    . TYR B 1 32 ? 24.719 -8.180  18.680  1.00 81.01  ? 29  TYR B OH    1 
ATOM   848  N N     . LYS B 1 33 ? 29.878 -4.185  17.044  1.00 57.88  ? 30  LYS B N     1 
ATOM   849  C CA    . LYS B 1 33 ? 30.307 -5.231  16.116  1.00 58.94  ? 30  LYS B CA    1 
ATOM   850  C C     . LYS B 1 33 ? 31.763 -5.629  16.339  1.00 62.57  ? 30  LYS B C     1 
ATOM   851  O O     . LYS B 1 33 ? 32.254 -6.597  15.762  1.00 67.47  ? 30  LYS B O     1 
ATOM   852  C CB    . LYS B 1 33 ? 30.081 -4.782  14.658  1.00 55.84  ? 30  LYS B CB    1 
ATOM   853  C CG    . LYS B 1 33 ? 28.608 -4.584  14.280  1.00 57.92  ? 30  LYS B CG    1 
ATOM   854  C CD    . LYS B 1 33 ? 27.798 -5.864  14.050  1.00 51.36  ? 30  LYS B CD    1 
ATOM   855  C CE    . LYS B 1 33 ? 28.027 -6.401  12.651  1.00 59.67  ? 30  LYS B CE    1 
ATOM   856  N NZ    . LYS B 1 33 ? 28.358 -5.317  11.674  1.00 63.51  ? 30  LYS B NZ    1 
ATOM   857  N N     . SER B 1 34 ? 32.469 -4.884  17.171  1.00 61.50  ? 31  SER B N     1 
ATOM   858  C CA    . SER B 1 34 ? 33.849 -5.222  17.398  1.00 69.26  ? 31  SER B CA    1 
ATOM   859  C C     . SER B 1 34 ? 34.036 -5.706  18.811  1.00 69.80  ? 31  SER B C     1 
ATOM   860  O O     . SER B 1 34 ? 35.154 -5.838  19.282  1.00 78.10  ? 31  SER B O     1 
ATOM   861  C CB    . SER B 1 34 ? 34.720 -4.007  17.135  1.00 76.80  ? 31  SER B CB    1 
ATOM   862  O OG    . SER B 1 34 ? 34.428 -3.509  15.851  1.00 88.78  ? 31  SER B OG    1 
ATOM   863  N N     . ASN B 1 35 ? 32.935 -5.982  19.488  1.00 70.71  ? 32  ASN B N     1 
ATOM   864  C CA    . ASN B 1 35 ? 32.969 -6.208  20.921  1.00 69.58  ? 32  ASN B CA    1 
ATOM   865  C C     . ASN B 1 35 ? 34.082 -5.382  21.492  1.00 62.21  ? 32  ASN B C     1 
ATOM   866  O O     . ASN B 1 35 ? 34.958 -5.942  22.131  1.00 84.77  ? 32  ASN B O     1 
ATOM   867  C CB    . ASN B 1 35 ? 33.211 -7.685  21.252  1.00 81.72  ? 32  ASN B CB    1 
ATOM   868  C CG    . ASN B 1 35 ? 32.413 -8.619  20.363  1.00 99.61  ? 32  ASN B CG    1 
ATOM   869  O OD1   . ASN B 1 35 ? 31.207 -8.799  20.574  1.00 127.13 ? 32  ASN B OD1   1 
ATOM   870  N ND2   . ASN B 1 35 ? 33.077 -9.219  19.357  1.00 86.43  ? 32  ASN B ND2   1 
ATOM   871  N N     . LEU B 1 36 ? 34.104 -4.075  21.224  1.00 54.42  ? 33  LEU B N     1 
ATOM   872  C CA    . LEU B 1 36 ? 35.092 -3.168  21.846  1.00 55.95  ? 33  LEU B CA    1 
ATOM   873  C C     . LEU B 1 36 ? 34.412 -1.900  22.313  1.00 53.41  ? 33  LEU B C     1 
ATOM   874  O O     . LEU B 1 36 ? 33.277 -1.692  21.927  1.00 58.74  ? 33  LEU B O     1 
ATOM   875  C CB    . LEU B 1 36 ? 36.205 -2.864  20.868  1.00 60.28  ? 33  LEU B CB    1 
ATOM   876  C CG    . LEU B 1 36 ? 37.290 -3.929  20.667  1.00 56.34  ? 33  LEU B CG    1 
ATOM   877  C CD1   . LEU B 1 36 ? 37.822 -3.845  19.251  1.00 57.66  ? 33  LEU B CD1   1 
ATOM   878  C CD2   . LEU B 1 36 ? 38.425 -3.794  21.663  1.00 55.86  ? 33  LEU B CD2   1 
ATOM   879  N N     . ASP B 1 37 ? 35.062 -1.065  23.131  1.00 53.07  ? 34  ASP B N     1 
ATOM   880  C CA    . ASP B 1 37 ? 34.369 0.116   23.772  1.00 61.97  ? 34  ASP B CA    1 
ATOM   881  C C     . ASP B 1 37 ? 34.371 1.479   23.067  1.00 63.12  ? 34  ASP B C     1 
ATOM   882  O O     . ASP B 1 37 ? 35.430 1.991   22.683  1.00 69.88  ? 34  ASP B O     1 
ATOM   883  C CB    . ASP B 1 37 ? 34.897 0.386   25.176  1.00 72.15  ? 34  ASP B CB    1 
ATOM   884  C CG    . ASP B 1 37 ? 33.809 0.853   26.117  1.00 66.80  ? 34  ASP B CG    1 
ATOM   885  O OD1   . ASP B 1 37 ? 32.856 0.061   26.288  1.00 61.92  ? 34  ASP B OD1   1 
ATOM   886  O OD2   . ASP B 1 37 ? 33.916 1.969   26.689  1.00 59.84  ? 34  ASP B OD2   1 
ATOM   887  N N     . ARG B 1 38 ? 33.188 2.092   22.980  1.00 63.45  ? 35  ARG B N     1 
ATOM   888  C CA    . ARG B 1 38 ? 32.998 3.373   22.260  1.00 67.47  ? 35  ARG B CA    1 
ATOM   889  C C     . ARG B 1 38 ? 34.187 4.310   22.417  1.00 71.35  ? 35  ARG B C     1 
ATOM   890  O O     . ARG B 1 38 ? 34.843 4.650   21.433  1.00 71.57  ? 35  ARG B O     1 
ATOM   891  C CB    . ARG B 1 38 ? 31.727 4.111   22.696  1.00 62.90  ? 35  ARG B CB    1 
ATOM   892  C CG    . ARG B 1 38 ? 30.884 4.529   21.494  1.00 73.04  ? 35  ARG B CG    1 
ATOM   893  C CD    . ARG B 1 38 ? 30.241 5.923   21.533  1.00 71.88  ? 35  ARG B CD    1 
ATOM   894  N NE    . ARG B 1 38 ? 30.163 6.578   22.840  1.00 56.26  ? 35  ARG B NE    1 
ATOM   895  C CZ    . ARG B 1 38 ? 30.933 7.601   23.194  1.00 54.97  ? 35  ARG B CZ    1 
ATOM   896  N NH1   . ARG B 1 38 ? 30.792 8.123   24.397  1.00 56.92  ? 35  ARG B NH1   1 
ATOM   897  N NH2   . ARG B 1 38 ? 31.859 8.091   22.363  1.00 50.81  ? 35  ARG B NH2   1 
ATOM   898  N N     . THR B 1 39 ? 34.469 4.685   23.666  1.00 61.40  ? 36  THR B N     1 
ATOM   899  C CA    . THR B 1 39 ? 35.573 5.572   24.034  1.00 59.93  ? 36  THR B CA    1 
ATOM   900  C C     . THR B 1 39 ? 36.947 5.186   23.452  1.00 62.27  ? 36  THR B C     1 
ATOM   901  O O     . THR B 1 39 ? 37.928 5.983   23.452  1.00 60.56  ? 36  THR B O     1 
ATOM   902  C CB    . THR B 1 39 ? 35.732 5.547   25.547  1.00 60.25  ? 36  THR B CB    1 
ATOM   903  O OG1   . THR B 1 39 ? 35.598 4.192   25.975  1.00 69.59  ? 36  THR B OG1   1 
ATOM   904  C CG2   . THR B 1 39 ? 34.661 6.358   26.209  1.00 65.84  ? 36  THR B CG2   1 
ATOM   905  N N     . PHE B 1 40 ? 37.042 3.949   22.990  1.00 56.40  ? 37  PHE B N     1 
ATOM   906  C CA    . PHE B 1 40 ? 38.321 3.480   22.544  1.00 54.90  ? 37  PHE B CA    1 
ATOM   907  C C     . PHE B 1 40 ? 38.402 3.696   21.047  1.00 58.37  ? 37  PHE B C     1 
ATOM   908  O O     . PHE B 1 40 ? 39.360 4.286   20.504  1.00 50.40  ? 37  PHE B O     1 
ATOM   909  C CB    . PHE B 1 40 ? 38.495 2.014   22.886  1.00 55.70  ? 37  PHE B CB    1 
ATOM   910  C CG    . PHE B 1 40 ? 39.880 1.524   22.649  1.00 55.41  ? 37  PHE B CG    1 
ATOM   911  C CD1   . PHE B 1 40 ? 40.946 2.172   23.230  1.00 53.50  ? 37  PHE B CD1   1 
ATOM   912  C CD2   . PHE B 1 40 ? 40.114 0.430   21.824  1.00 60.03  ? 37  PHE B CD2   1 
ATOM   913  C CE1   . PHE B 1 40 ? 42.235 1.746   23.007  1.00 59.63  ? 37  PHE B CE1   1 
ATOM   914  C CE2   . PHE B 1 40 ? 41.401 -0.008  21.578  1.00 59.70  ? 37  PHE B CE2   1 
ATOM   915  C CZ    . PHE B 1 40 ? 42.463 0.654   22.173  1.00 64.34  ? 37  PHE B CZ    1 
ATOM   916  N N     . ILE B 1 41 ? 37.367 3.208   20.379  1.00 57.82  ? 38  ILE B N     1 
ATOM   917  C CA    . ILE B 1 41 ? 37.196 3.482   18.977  1.00 54.25  ? 38  ILE B CA    1 
ATOM   918  C C     . ILE B 1 41 ? 37.310 5.015   18.810  1.00 59.09  ? 38  ILE B C     1 
ATOM   919  O O     . ILE B 1 41 ? 37.858 5.481   17.821  1.00 52.23  ? 38  ILE B O     1 
ATOM   920  C CB    . ILE B 1 41 ? 35.817 2.975   18.534  1.00 53.38  ? 38  ILE B CB    1 
ATOM   921  C CG1   . ILE B 1 41 ? 35.623 1.482   18.916  1.00 55.05  ? 38  ILE B CG1   1 
ATOM   922  C CG2   . ILE B 1 41 ? 35.565 3.290   17.079  1.00 54.09  ? 38  ILE B CG2   1 
ATOM   923  C CD1   . ILE B 1 41 ? 36.022 0.437   17.881  1.00 47.78  ? 38  ILE B CD1   1 
ATOM   924  N N     . SER B 1 42 ? 36.802 5.788   19.790  1.00 61.74  ? 39  SER B N     1 
ATOM   925  C CA    . SER B 1 42 ? 36.980 7.237   19.820  1.00 56.06  ? 39  SER B CA    1 
ATOM   926  C C     . SER B 1 42 ? 38.454 7.515   19.794  1.00 55.13  ? 39  SER B C     1 
ATOM   927  O O     . SER B 1 42 ? 38.939 8.112   18.853  1.00 56.20  ? 39  SER B O     1 
ATOM   928  C CB    . SER B 1 42 ? 36.430 7.857   21.094  1.00 63.93  ? 39  SER B CB    1 
ATOM   929  O OG    . SER B 1 42 ? 36.998 9.147   21.317  1.00 68.72  ? 39  SER B OG    1 
ATOM   930  N N     . GLY B 1 43 ? 39.157 7.065   20.828  1.00 56.46  ? 40  GLY B N     1 
ATOM   931  C CA    . GLY B 1 43 ? 40.589 7.376   20.998  1.00 63.55  ? 40  GLY B CA    1 
ATOM   932  C C     . GLY B 1 43 ? 41.456 7.070   19.780  1.00 64.53  ? 40  GLY B C     1 
ATOM   933  O O     . GLY B 1 43 ? 42.272 7.883   19.359  1.00 65.92  ? 40  GLY B O     1 
ATOM   934  N N     . ILE B 1 44 ? 41.231 5.901   19.195  1.00 64.62  ? 41  ILE B N     1 
ATOM   935  C CA    . ILE B 1 44 ? 41.951 5.440   18.038  1.00 63.67  ? 41  ILE B CA    1 
ATOM   936  C C     . ILE B 1 44 ? 41.762 6.451   16.942  1.00 71.80  ? 41  ILE B C     1 
ATOM   937  O O     . ILE B 1 44 ? 42.706 7.157   16.591  1.00 85.27  ? 41  ILE B O     1 
ATOM   938  C CB    . ILE B 1 44 ? 41.387 4.080   17.600  1.00 65.35  ? 41  ILE B CB    1 
ATOM   939  C CG1   . ILE B 1 44 ? 41.435 3.113   18.784  1.00 67.91  ? 41  ILE B CG1   1 
ATOM   940  C CG2   . ILE B 1 44 ? 42.089 3.542   16.356  1.00 61.07  ? 41  ILE B CG2   1 
ATOM   941  C CD1   . ILE B 1 44 ? 40.516 1.930   18.634  1.00 79.42  ? 41  ILE B CD1   1 
ATOM   942  N N     . GLU B 1 45 ? 40.525 6.531   16.444  1.00 78.53  ? 42  GLU B N     1 
ATOM   943  C CA    . GLU B 1 45 ? 40.113 7.431   15.368  1.00 85.51  ? 42  GLU B CA    1 
ATOM   944  C C     . GLU B 1 45 ? 40.500 8.887   15.588  1.00 96.41  ? 42  GLU B C     1 
ATOM   945  O O     . GLU B 1 45 ? 40.858 9.595   14.641  1.00 113.10 ? 42  GLU B O     1 
ATOM   946  C CB    . GLU B 1 45 ? 38.592 7.392   15.199  1.00 91.81  ? 42  GLU B CB    1 
ATOM   947  C CG    . GLU B 1 45 ? 38.032 6.279   14.327  1.00 87.85  ? 42  GLU B CG    1 
ATOM   948  C CD    . GLU B 1 45 ? 36.615 6.573   13.871  1.00 85.85  ? 42  GLU B CD    1 
ATOM   949  O OE1   . GLU B 1 45 ? 36.150 5.908   12.924  1.00 97.53  ? 42  GLU B OE1   1 
ATOM   950  O OE2   . GLU B 1 45 ? 35.967 7.471   14.451  1.00 77.77  ? 42  GLU B OE2   1 
ATOM   951  N N     . ARG B 1 46 ? 40.420 9.344   16.828  1.00 89.96  ? 43  ARG B N     1 
ATOM   952  C CA    . ARG B 1 46 ? 40.495 10.761  17.074  1.00 91.53  ? 43  ARG B CA    1 
ATOM   953  C C     . ARG B 1 46 ? 41.846 11.269  17.576  1.00 86.94  ? 43  ARG B C     1 
ATOM   954  O O     . ARG B 1 46 ? 42.198 12.401  17.267  1.00 107.43 ? 43  ARG B O     1 
ATOM   955  C CB    . ARG B 1 46 ? 39.333 11.219  17.963  1.00 92.64  ? 43  ARG B CB    1 
ATOM   956  C CG    . ARG B 1 46 ? 39.093 12.722  17.962  1.00 103.35 ? 43  ARG B CG    1 
ATOM   957  C CD    . ARG B 1 46 ? 38.173 13.196  16.837  1.00 111.59 ? 43  ARG B CD    1 
ATOM   958  N NE    . ARG B 1 46 ? 38.815 13.306  15.525  1.00 113.75 ? 43  ARG B NE    1 
ATOM   959  C CZ    . ARG B 1 46 ? 39.607 14.307  15.147  1.00 122.34 ? 43  ARG B CZ    1 
ATOM   960  N NH1   . ARG B 1 46 ? 39.888 15.307  15.975  1.00 135.46 ? 43  ARG B NH1   1 
ATOM   961  N NH2   . ARG B 1 46 ? 40.137 14.301  13.937  1.00 127.32 ? 43  ARG B NH2   1 
ATOM   962  N N     . ASN B 1 47 ? 42.599 10.473  18.338  1.00 79.51  ? 44  ASN B N     1 
ATOM   963  C CA    . ASN B 1 47 ? 43.857 10.994  18.938  1.00 79.36  ? 44  ASN B CA    1 
ATOM   964  C C     . ASN B 1 47 ? 45.016 10.025  18.934  1.00 77.48  ? 44  ASN B C     1 
ATOM   965  O O     . ASN B 1 47 ? 45.735 9.961   19.915  1.00 73.00  ? 44  ASN B O     1 
ATOM   966  C CB    . ASN B 1 47 ? 43.683 11.471  20.390  1.00 83.20  ? 44  ASN B CB    1 
ATOM   967  C CG    . ASN B 1 47 ? 42.237 11.506  20.836  1.00 91.99  ? 44  ASN B CG    1 
ATOM   968  O OD1   . ASN B 1 47 ? 41.834 10.749  21.727  1.00 91.13  ? 44  ASN B OD1   1 
ATOM   969  N ND2   . ASN B 1 47 ? 41.443 12.381  20.220  1.00 93.27  ? 44  ASN B ND2   1 
ATOM   970  N N     . SER B 1 48 ? 45.167 9.271   17.844  1.00 89.04  ? 45  SER B N     1 
ATOM   971  C CA    . SER B 1 48 ? 46.258 8.312   17.644  1.00 89.31  ? 45  SER B CA    1 
ATOM   972  C C     . SER B 1 48 ? 46.629 7.554   18.902  1.00 90.88  ? 45  SER B C     1 
ATOM   973  O O     . SER B 1 48 ? 47.802 7.540   19.299  1.00 103.26 ? 45  SER B O     1 
ATOM   974  C CB    . SER B 1 48 ? 47.504 8.998   17.054  1.00 98.17  ? 45  SER B CB    1 
ATOM   975  O OG    . SER B 1 48 ? 47.717 8.613   15.693  1.00 111.41 ? 45  SER B OG    1 
ATOM   976  N N     . ARG B 1 49 ? 45.631 6.959   19.546  1.00 82.05  ? 46  ARG B N     1 
ATOM   977  C CA    . ARG B 1 49 ? 45.880 6.002   20.618  1.00 76.68  ? 46  ARG B CA    1 
ATOM   978  C C     . ARG B 1 49 ? 46.133 4.655   19.939  1.00 72.34  ? 46  ARG B C     1 
ATOM   979  O O     . ARG B 1 49 ? 45.689 4.412   18.823  1.00 67.98  ? 46  ARG B O     1 
ATOM   980  C CB    . ARG B 1 49 ? 44.729 5.949   21.637  1.00 85.15  ? 46  ARG B CB    1 
ATOM   981  C CG    . ARG B 1 49 ? 44.400 7.309   22.258  1.00 98.06  ? 46  ARG B CG    1 
ATOM   982  C CD    . ARG B 1 49 ? 43.201 7.310   23.222  1.00 102.10 ? 46  ARG B CD    1 
ATOM   983  N NE    . ARG B 1 49 ? 43.446 6.518   24.428  1.00 94.78  ? 46  ARG B NE    1 
ATOM   984  C CZ    . ARG B 1 49 ? 42.923 5.315   24.645  1.00 91.06  ? 46  ARG B CZ    1 
ATOM   985  N NH1   . ARG B 1 49 ? 42.105 4.779   23.750  1.00 93.51  ? 46  ARG B NH1   1 
ATOM   986  N NH2   . ARG B 1 49 ? 43.215 4.649   25.756  1.00 85.70  ? 46  ARG B NH2   1 
ATOM   987  N N     . ASN B 1 50 ? 46.849 3.789   20.637  1.00 74.71  ? 47  ASN B N     1 
ATOM   988  C CA    . ASN B 1 50 ? 47.616 2.696   20.039  1.00 69.57  ? 47  ASN B CA    1 
ATOM   989  C C     . ASN B 1 50 ? 46.913 1.360   20.255  1.00 65.23  ? 47  ASN B C     1 
ATOM   990  O O     . ASN B 1 50 ? 46.927 0.803   21.345  1.00 69.80  ? 47  ASN B O     1 
ATOM   991  C CB    . ASN B 1 50 ? 49.017 2.729   20.696  1.00 73.53  ? 47  ASN B CB    1 
ATOM   992  C CG    . ASN B 1 50 ? 49.975 1.687   20.166  1.00 69.62  ? 47  ASN B CG    1 
ATOM   993  O OD1   . ASN B 1 50 ? 49.815 1.148   19.059  1.00 70.07  ? 47  ASN B OD1   1 
ATOM   994  N ND2   . ASN B 1 50 ? 51.000 1.401   20.970  1.00 60.47  ? 47  ASN B ND2   1 
ATOM   995  N N     . LEU B 1 51 ? 46.267 0.856   19.219  1.00 63.31  ? 48  LEU B N     1 
ATOM   996  C CA    . LEU B 1 51 ? 45.525 -0.382  19.348  1.00 54.98  ? 48  LEU B CA    1 
ATOM   997  C C     . LEU B 1 51 ? 46.526 -1.468  19.181  1.00 49.90  ? 48  LEU B C     1 
ATOM   998  O O     . LEU B 1 51 ? 47.657 -1.169  18.883  1.00 47.57  ? 48  LEU B O     1 
ATOM   999  C CB    . LEU B 1 51 ? 44.398 -0.474  18.310  1.00 56.09  ? 48  LEU B CB    1 
ATOM   1000 C CG    . LEU B 1 51 ? 44.596 -0.675  16.804  1.00 55.60  ? 48  LEU B CG    1 
ATOM   1001 C CD1   . LEU B 1 51 ? 43.252 -0.829  16.084  1.00 45.92  ? 48  LEU B CD1   1 
ATOM   1002 C CD2   . LEU B 1 51 ? 45.427 0.456   16.226  1.00 59.14  ? 48  LEU B CD2   1 
ATOM   1003 N N     . THR B 1 52 ? 46.129 -2.711  19.428  1.00 52.86  ? 49  THR B N     1 
ATOM   1004 C CA    . THR B 1 52 ? 46.931 -3.870  19.007  1.00 53.86  ? 49  THR B CA    1 
ATOM   1005 C C     . THR B 1 52 ? 46.347 -4.475  17.752  1.00 51.80  ? 49  THR B C     1 
ATOM   1006 O O     . THR B 1 52 ? 45.349 -3.988  17.231  1.00 53.67  ? 49  THR B O     1 
ATOM   1007 C CB    . THR B 1 52 ? 46.881 -5.043  20.000  1.00 51.73  ? 49  THR B CB    1 
ATOM   1008 O OG1   . THR B 1 52 ? 45.606 -5.688  19.878  1.00 50.86  ? 49  THR B OG1   1 
ATOM   1009 C CG2   . THR B 1 52 ? 47.158 -4.627  21.429  1.00 46.07  ? 49  THR B CG2   1 
ATOM   1010 N N     . ILE B 1 53 ? 46.950 -5.585  17.332  1.00 53.50  ? 50  ILE B N     1 
ATOM   1011 C CA    . ILE B 1 53 ? 46.431 -6.464  16.270  1.00 54.97  ? 50  ILE B CA    1 
ATOM   1012 C C     . ILE B 1 53 ? 45.083 -7.145  16.590  1.00 60.35  ? 50  ILE B C     1 
ATOM   1013 O O     . ILE B 1 53 ? 44.145 -7.092  15.749  1.00 57.68  ? 50  ILE B O     1 
ATOM   1014 C CB    . ILE B 1 53 ? 47.503 -7.490  15.902  1.00 54.67  ? 50  ILE B CB    1 
ATOM   1015 C CG1   . ILE B 1 53 ? 48.790 -6.743  15.477  1.00 55.00  ? 50  ILE B CG1   1 
ATOM   1016 C CG2   . ILE B 1 53 ? 47.011 -8.516  14.879  1.00 51.60  ? 50  ILE B CG2   1 
ATOM   1017 C CD1   . ILE B 1 53 ? 48.737 -6.004  14.153  1.00 49.82  ? 50  ILE B CD1   1 
ATOM   1018 N N     . LYS B 1 54 ? 44.945 -7.767  17.770  1.00 57.45  ? 51  LYS B N     1 
ATOM   1019 C CA    . LYS B 1 54 ? 43.658 -8.469  18.081  1.00 64.97  ? 51  LYS B CA    1 
ATOM   1020 C C     . LYS B 1 54 ? 42.502 -7.502  17.965  1.00 57.97  ? 51  LYS B C     1 
ATOM   1021 O O     . LYS B 1 54 ? 41.412 -7.861  17.426  1.00 55.25  ? 51  LYS B O     1 
ATOM   1022 C CB    . LYS B 1 54 ? 43.642 -9.123  19.479  1.00 73.13  ? 51  LYS B CB    1 
ATOM   1023 C CG    . LYS B 1 54 ? 43.138 -10.568 19.480  1.00 81.96  ? 51  LYS B CG    1 
ATOM   1024 C CD    . LYS B 1 54 ? 43.527 -11.319 20.757  1.00 91.12  ? 51  LYS B CD    1 
ATOM   1025 C CE    . LYS B 1 54 ? 43.671 -12.840 20.534  1.00 98.02  ? 51  LYS B CE    1 
ATOM   1026 N NZ    . LYS B 1 54 ? 44.460 -13.608 21.577  1.00 71.15  ? 51  LYS B NZ    1 
ATOM   1027 N N     . SER B 1 55 ? 42.779 -6.284  18.479  1.00 54.52  ? 52  SER B N     1 
ATOM   1028 C CA    . SER B 1 55 ? 41.918 -5.079  18.412  1.00 48.32  ? 52  SER B CA    1 
ATOM   1029 C C     . SER B 1 55 ? 41.689 -4.759  16.949  1.00 46.64  ? 52  SER B C     1 
ATOM   1030 O O     . SER B 1 55 ? 40.546 -4.834  16.427  1.00 49.30  ? 52  SER B O     1 
ATOM   1031 C CB    . SER B 1 55 ? 42.567 -3.874  19.135  1.00 49.34  ? 52  SER B CB    1 
ATOM   1032 O OG    . SER B 1 55 ? 42.177 -3.690  20.519  1.00 41.22  ? 52  SER B OG    1 
ATOM   1033 N N     . LEU B 1 56 ? 42.770 -4.480  16.245  1.00 43.45  ? 53  LEU B N     1 
ATOM   1034 C CA    . LEU B 1 56 ? 42.663 -4.338  14.801  1.00 50.78  ? 53  LEU B CA    1 
ATOM   1035 C C     . LEU B 1 56 ? 41.769 -5.438  14.197  1.00 55.72  ? 53  LEU B C     1 
ATOM   1036 O O     . LEU B 1 56 ? 40.648 -5.157  13.757  1.00 54.91  ? 53  LEU B O     1 
ATOM   1037 C CB    . LEU B 1 56 ? 44.046 -4.339  14.152  1.00 52.77  ? 53  LEU B CB    1 
ATOM   1038 C CG    . LEU B 1 56 ? 44.032 -4.120  12.642  1.00 56.67  ? 53  LEU B CG    1 
ATOM   1039 C CD1   . LEU B 1 56 ? 43.001 -3.069  12.279  1.00 58.02  ? 53  LEU B CD1   1 
ATOM   1040 C CD2   . LEU B 1 56 ? 45.404 -3.713  12.134  1.00 62.88  ? 53  LEU B CD2   1 
ATOM   1041 N N     . GLU B 1 57 ? 42.259 -6.684  14.202  1.00 57.51  ? 54  GLU B N     1 
ATOM   1042 C CA    . GLU B 1 57 ? 41.511 -7.803  13.638  1.00 57.67  ? 54  GLU B CA    1 
ATOM   1043 C C     . GLU B 1 57 ? 40.014 -7.752  13.961  1.00 55.83  ? 54  GLU B C     1 
ATOM   1044 O O     . GLU B 1 57 ? 39.189 -7.914  13.047  1.00 53.05  ? 54  GLU B O     1 
ATOM   1045 C CB    . GLU B 1 57 ? 42.083 -9.141  14.086  1.00 58.38  ? 54  GLU B CB    1 
ATOM   1046 C CG    . GLU B 1 57 ? 41.251 -10.324 13.565  1.00 61.06  ? 54  GLU B CG    1 
ATOM   1047 C CD    . GLU B 1 57 ? 41.836 -11.670 13.938  1.00 57.80  ? 54  GLU B CD    1 
ATOM   1048 O OE1   . GLU B 1 57 ? 41.772 -11.985 15.140  1.00 67.82  ? 54  GLU B OE1   1 
ATOM   1049 O OE2   . GLU B 1 57 ? 42.338 -12.406 13.048  1.00 49.36  ? 54  GLU B OE2   1 
ATOM   1050 N N     . LEU B 1 58 ? 39.673 -7.538  15.243  1.00 56.00  ? 55  LEU B N     1 
ATOM   1051 C CA    . LEU B 1 58 ? 38.249 -7.439  15.617  1.00 62.74  ? 55  LEU B CA    1 
ATOM   1052 C C     . LEU B 1 58 ? 37.593 -6.360  14.796  1.00 72.52  ? 55  LEU B C     1 
ATOM   1053 O O     . LEU B 1 58 ? 36.517 -6.584  14.207  1.00 76.81  ? 55  LEU B O     1 
ATOM   1054 C CB    . LEU B 1 58 ? 38.038 -7.145  17.107  1.00 61.32  ? 55  LEU B CB    1 
ATOM   1055 C CG    . LEU B 1 58 ? 38.282 -8.275  18.125  1.00 64.24  ? 55  LEU B CG    1 
ATOM   1056 C CD1   . LEU B 1 58 ? 38.296 -7.689  19.538  1.00 57.94  ? 55  LEU B CD1   1 
ATOM   1057 C CD2   . LEU B 1 58 ? 37.253 -9.429  17.985  1.00 59.54  ? 55  LEU B CD2   1 
ATOM   1058 N N     . ILE B 1 59 ? 38.269 -5.203  14.730  1.00 67.45  ? 56  ILE B N     1 
ATOM   1059 C CA    . ILE B 1 59 ? 37.756 -4.059  13.981  1.00 63.17  ? 56  ILE B CA    1 
ATOM   1060 C C     . ILE B 1 59 ? 37.421 -4.409  12.513  1.00 58.61  ? 56  ILE B C     1 
ATOM   1061 O O     . ILE B 1 59 ? 36.281 -4.205  12.043  1.00 60.79  ? 56  ILE B O     1 
ATOM   1062 C CB    . ILE B 1 59 ? 38.659 -2.823  14.187  1.00 61.52  ? 56  ILE B CB    1 
ATOM   1063 C CG1   . ILE B 1 59 ? 38.457 -2.316  15.623  1.00 58.62  ? 56  ILE B CG1   1 
ATOM   1064 C CG2   . ILE B 1 59 ? 38.356 -1.718  13.176  1.00 60.99  ? 56  ILE B CG2   1 
ATOM   1065 C CD1   . ILE B 1 59 ? 39.505 -1.344  16.138  1.00 58.57  ? 56  ILE B CD1   1 
ATOM   1066 N N     . MET B 1 60 ? 38.368 -5.003  11.817  1.00 50.92  ? 57  MET B N     1 
ATOM   1067 C CA    . MET B 1 60 ? 38.087 -5.470  10.471  1.00 59.16  ? 57  MET B CA    1 
ATOM   1068 C C     . MET B 1 60 ? 36.767 -6.244  10.446  1.00 61.11  ? 57  MET B C     1 
ATOM   1069 O O     . MET B 1 60 ? 35.945 -6.049  9.543   1.00 66.62  ? 57  MET B O     1 
ATOM   1070 C CB    . MET B 1 60 ? 39.251 -6.305  9.910   1.00 60.68  ? 57  MET B CB    1 
ATOM   1071 C CG    . MET B 1 60 ? 40.588 -6.004  10.588  1.00 61.70  ? 57  MET B CG    1 
ATOM   1072 S SD    . MET B 1 60 ? 41.931 -5.647  9.448   1.00 59.30  ? 57  MET B SD    1 
ATOM   1073 C CE    . MET B 1 60 ? 42.618 -7.280  9.175   1.00 65.04  ? 57  MET B CE    1 
ATOM   1074 N N     . LYS B 1 61 ? 36.546 -7.093  11.452  1.00 61.07  ? 58  LYS B N     1 
ATOM   1075 C CA    . LYS B 1 61 ? 35.334 -7.903  11.499  1.00 63.30  ? 58  LYS B CA    1 
ATOM   1076 C C     . LYS B 1 61 ? 34.110 -7.023  11.727  1.00 63.27  ? 58  LYS B C     1 
ATOM   1077 O O     . LYS B 1 61 ? 33.077 -7.217  11.077  1.00 63.26  ? 58  LYS B O     1 
ATOM   1078 C CB    . LYS B 1 61 ? 35.455 -8.973  12.581  1.00 74.82  ? 58  LYS B CB    1 
ATOM   1079 C CG    . LYS B 1 61 ? 34.334 -10.015 12.624  1.00 75.82  ? 58  LYS B CG    1 
ATOM   1080 C CD    . LYS B 1 61 ? 34.779 -11.255 13.401  1.00 80.29  ? 58  LYS B CD    1 
ATOM   1081 C CE    . LYS B 1 61 ? 35.929 -11.971 12.676  1.00 84.63  ? 58  LYS B CE    1 
ATOM   1082 N NZ    . LYS B 1 61 ? 36.434 -13.165 13.419  1.00 98.27  ? 58  LYS B NZ    1 
ATOM   1083 N N     . GLY B 1 62 ? 34.245 -6.042  12.626  1.00 70.08  ? 59  GLY B N     1 
ATOM   1084 C CA    . GLY B 1 62 ? 33.174 -5.071  12.911  1.00 78.33  ? 59  GLY B CA    1 
ATOM   1085 C C     . GLY B 1 62 ? 32.763 -4.283  11.675  1.00 78.56  ? 59  GLY B C     1 
ATOM   1086 O O     . GLY B 1 62 ? 31.578 -4.026  11.445  1.00 89.65  ? 59  GLY B O     1 
ATOM   1087 N N     . LEU B 1 63 ? 33.758 -3.931  10.868  1.00 73.68  ? 60  LEU B N     1 
ATOM   1088 C CA    . LEU B 1 63 ? 33.548 -3.280  9.576   1.00 72.90  ? 60  LEU B CA    1 
ATOM   1089 C C     . LEU B 1 63 ? 33.023 -4.243  8.507   1.00 73.50  ? 60  LEU B C     1 
ATOM   1090 O O     . LEU B 1 63 ? 32.634 -3.800  7.422   1.00 76.24  ? 60  LEU B O     1 
ATOM   1091 C CB    . LEU B 1 63 ? 34.863 -2.622  9.114   1.00 66.98  ? 60  LEU B CB    1 
ATOM   1092 C CG    . LEU B 1 63 ? 35.327 -1.523  10.078  1.00 63.25  ? 60  LEU B CG    1 
ATOM   1093 C CD1   . LEU B 1 63 ? 36.806 -1.205  9.974   1.00 52.29  ? 60  LEU B CD1   1 
ATOM   1094 C CD2   . LEU B 1 63 ? 34.448 -0.284  9.898   1.00 62.50  ? 60  LEU B CD2   1 
ATOM   1095 N N     . GLU B 1 64 ? 33.025 -5.549  8.829   1.00 74.07  ? 61  GLU B N     1 
ATOM   1096 C CA    . GLU B 1 64 ? 32.773 -6.646  7.884   1.00 64.63  ? 61  GLU B CA    1 
ATOM   1097 C C     . GLU B 1 64 ? 33.689 -6.498  6.662   1.00 67.64  ? 61  GLU B C     1 
ATOM   1098 O O     . GLU B 1 64 ? 33.263 -6.735  5.510   1.00 69.55  ? 61  GLU B O     1 
ATOM   1099 C CB    . GLU B 1 64 ? 31.299 -6.694  7.475   1.00 64.58  ? 61  GLU B CB    1 
ATOM   1100 C CG    . GLU B 1 64 ? 30.343 -6.846  8.661   1.00 70.03  ? 61  GLU B CG    1 
ATOM   1101 C CD    . GLU B 1 64 ? 28.867 -6.993  8.255   1.00 66.83  ? 61  GLU B CD    1 
ATOM   1102 O OE1   . GLU B 1 64 ? 28.545 -6.768  7.073   1.00 55.27  ? 61  GLU B OE1   1 
ATOM   1103 O OE2   . GLU B 1 64 ? 28.025 -7.358  9.125   1.00 70.06  ? 61  GLU B OE2   1 
ATOM   1104 N N     . VAL B 1 65 ? 34.930 -6.070  6.932   1.00 60.60  ? 62  VAL B N     1 
ATOM   1105 C CA    . VAL B 1 65 ? 35.984 -5.873  5.914   1.00 61.91  ? 62  VAL B CA    1 
ATOM   1106 C C     . VAL B 1 65 ? 36.982 -7.046  5.960   1.00 62.85  ? 62  VAL B C     1 
ATOM   1107 O O     . VAL B 1 65 ? 37.556 -7.348  7.034   1.00 58.79  ? 62  VAL B O     1 
ATOM   1108 C CB    . VAL B 1 65 ? 36.722 -4.495  6.078   1.00 54.29  ? 62  VAL B CB    1 
ATOM   1109 C CG1   . VAL B 1 65 ? 38.187 -4.558  5.658   1.00 46.15  ? 62  VAL B CG1   1 
ATOM   1110 C CG2   . VAL B 1 65 ? 36.025 -3.425  5.282   1.00 48.08  ? 62  VAL B CG2   1 
ATOM   1111 N N     . SER B 1 66 ? 37.169 -7.712  4.816   1.00 60.25  ? 63  SER B N     1 
ATOM   1112 C CA    . SER B 1 66 ? 38.163 -8.773  4.738   1.00 68.40  ? 63  SER B CA    1 
ATOM   1113 C C     . SER B 1 66 ? 39.552 -8.169  4.977   1.00 78.09  ? 63  SER B C     1 
ATOM   1114 O O     . SER B 1 66 ? 39.872 -7.087  4.457   1.00 83.25  ? 63  SER B O     1 
ATOM   1115 C CB    . SER B 1 66 ? 38.101 -9.550  3.412   1.00 68.78  ? 63  SER B CB    1 
ATOM   1116 O OG    . SER B 1 66 ? 37.849 -8.710  2.302   1.00 70.06  ? 63  SER B OG    1 
ATOM   1117 N N     . ASP B 1 67 ? 40.358 -8.861  5.782   1.00 73.05  ? 64  ASP B N     1 
ATOM   1118 C CA    . ASP B 1 67 ? 41.683 -8.400  6.139   1.00 68.02  ? 64  ASP B CA    1 
ATOM   1119 C C     . ASP B 1 67 ? 42.417 -7.909  4.900   1.00 67.94  ? 64  ASP B C     1 
ATOM   1120 O O     . ASP B 1 67 ? 42.919 -6.780  4.884   1.00 59.14  ? 64  ASP B O     1 
ATOM   1121 C CB    . ASP B 1 67 ? 42.447 -9.530  6.836   1.00 75.44  ? 64  ASP B CB    1 
ATOM   1122 C CG    . ASP B 1 67 ? 41.978 -10.918 6.389   1.00 81.38  ? 64  ASP B CG    1 
ATOM   1123 O OD1   . ASP B 1 67 ? 41.764 -11.121 5.161   1.00 86.48  ? 64  ASP B OD1   1 
ATOM   1124 O OD2   . ASP B 1 67 ? 41.839 -11.809 7.259   1.00 72.39  ? 64  ASP B OD2   1 
ATOM   1125 N N     . VAL B 1 68 ? 42.452 -8.753  3.863   1.00 68.93  ? 65  VAL B N     1 
ATOM   1126 C CA    . VAL B 1 68 ? 43.118 -8.439  2.592   1.00 75.52  ? 65  VAL B CA    1 
ATOM   1127 C C     . VAL B 1 68 ? 42.773 -7.009  2.142   1.00 82.79  ? 65  VAL B C     1 
ATOM   1128 O O     . VAL B 1 68 ? 43.660 -6.141  2.025   1.00 83.05  ? 65  VAL B O     1 
ATOM   1129 C CB    . VAL B 1 68 ? 42.745 -9.458  1.486   1.00 68.91  ? 65  VAL B CB    1 
ATOM   1130 C CG1   . VAL B 1 68 ? 43.755 -9.408  0.356   1.00 60.62  ? 65  VAL B CG1   1 
ATOM   1131 C CG2   . VAL B 1 68 ? 42.654 -10.870 2.048   1.00 62.88  ? 65  VAL B CG2   1 
ATOM   1132 N N     . VAL B 1 69 ? 41.479 -6.775  1.928   1.00 81.17  ? 66  VAL B N     1 
ATOM   1133 C CA    . VAL B 1 69 ? 40.954 -5.457  1.566   1.00 87.63  ? 66  VAL B CA    1 
ATOM   1134 C C     . VAL B 1 69 ? 41.504 -4.335  2.459   1.00 92.66  ? 66  VAL B C     1 
ATOM   1135 O O     . VAL B 1 69 ? 41.943 -3.317  1.944   1.00 88.93  ? 66  VAL B O     1 
ATOM   1136 C CB    . VAL B 1 69 ? 39.395 -5.416  1.576   1.00 84.80  ? 66  VAL B CB    1 
ATOM   1137 C CG1   . VAL B 1 69 ? 38.880 -3.987  1.466   1.00 86.96  ? 66  VAL B CG1   1 
ATOM   1138 C CG2   . VAL B 1 69 ? 38.815 -6.256  0.453   1.00 85.99  ? 66  VAL B CG2   1 
ATOM   1139 N N     . PHE B 1 70 ? 41.480 -4.526  3.783   1.00 91.26  ? 67  PHE B N     1 
ATOM   1140 C CA    . PHE B 1 70 ? 41.862 -3.463  4.716   1.00 82.29  ? 67  PHE B CA    1 
ATOM   1141 C C     . PHE B 1 70 ? 43.288 -3.030  4.474   1.00 75.56  ? 67  PHE B C     1 
ATOM   1142 O O     . PHE B 1 70 ? 43.622 -1.846  4.542   1.00 69.06  ? 67  PHE B O     1 
ATOM   1143 C CB    . PHE B 1 70 ? 41.736 -3.927  6.169   1.00 90.29  ? 67  PHE B CB    1 
ATOM   1144 C CG    . PHE B 1 70 ? 42.160 -2.880  7.180   1.00 92.46  ? 67  PHE B CG    1 
ATOM   1145 C CD1   . PHE B 1 70 ? 41.302 -1.844  7.537   1.00 93.64  ? 67  PHE B CD1   1 
ATOM   1146 C CD2   . PHE B 1 70 ? 43.413 -2.922  7.761   1.00 96.33  ? 67  PHE B CD2   1 
ATOM   1147 C CE1   . PHE B 1 70 ? 41.681 -0.877  8.451   1.00 84.72  ? 67  PHE B CE1   1 
ATOM   1148 C CE2   . PHE B 1 70 ? 43.801 -1.951  8.676   1.00 103.90 ? 67  PHE B CE2   1 
ATOM   1149 C CZ    . PHE B 1 70 ? 42.931 -0.926  9.017   1.00 90.71  ? 67  PHE B CZ    1 
ATOM   1150 N N     . PHE B 1 71 ? 44.121 -4.022  4.208   1.00 74.44  ? 68  PHE B N     1 
ATOM   1151 C CA    . PHE B 1 71 ? 45.530 -3.796  4.080   1.00 75.97  ? 68  PHE B CA    1 
ATOM   1152 C C     . PHE B 1 71 ? 45.751 -3.222  2.728   1.00 80.34  ? 68  PHE B C     1 
ATOM   1153 O O     . PHE B 1 71 ? 46.637 -2.388  2.553   1.00 76.70  ? 68  PHE B O     1 
ATOM   1154 C CB    . PHE B 1 71 ? 46.282 -5.103  4.188   1.00 73.54  ? 68  PHE B CB    1 
ATOM   1155 C CG    . PHE B 1 71 ? 46.486 -5.560  5.589   1.00 70.16  ? 68  PHE B CG    1 
ATOM   1156 C CD1   . PHE B 1 71 ? 47.016 -4.699  6.545   1.00 69.23  ? 68  PHE B CD1   1 
ATOM   1157 C CD2   . PHE B 1 71 ? 46.145 -6.857  5.963   1.00 73.41  ? 68  PHE B CD2   1 
ATOM   1158 C CE1   . PHE B 1 71 ? 47.202 -5.127  7.855   1.00 75.35  ? 68  PHE B CE1   1 
ATOM   1159 C CE2   . PHE B 1 71 ? 46.345 -7.299  7.270   1.00 74.85  ? 68  PHE B CE2   1 
ATOM   1160 C CZ    . PHE B 1 71 ? 46.864 -6.431  8.221   1.00 71.83  ? 68  PHE B CZ    1 
ATOM   1161 N N     . GLU B 1 72 ? 44.933 -3.669  1.775   1.00 80.04  ? 69  GLU B N     1 
ATOM   1162 C CA    . GLU B 1 72 ? 45.056 -3.179  0.415   1.00 77.66  ? 69  GLU B CA    1 
ATOM   1163 C C     . GLU B 1 72 ? 44.783 -1.682  0.414   1.00 71.62  ? 69  GLU B C     1 
ATOM   1164 O O     . GLU B 1 72 ? 45.666 -0.891  0.049   1.00 64.44  ? 69  GLU B O     1 
ATOM   1165 C CB    . GLU B 1 72 ? 44.175 -3.969  -0.544  1.00 81.84  ? 69  GLU B CB    1 
ATOM   1166 C CG    . GLU B 1 72 ? 44.845 -5.257  -1.013  1.00 87.04  ? 69  GLU B CG    1 
ATOM   1167 C CD    . GLU B 1 72 ? 44.291 -5.781  -2.326  1.00 98.93  ? 69  GLU B CD    1 
ATOM   1168 O OE1   . GLU B 1 72 ? 43.810 -4.976  -3.153  1.00 111.76 ? 69  GLU B OE1   1 
ATOM   1169 O OE2   . GLU B 1 72 ? 44.332 -7.010  -2.541  1.00 102.71 ? 69  GLU B OE2   1 
ATOM   1170 N N     . MET B 1 73 ? 43.596 -1.316  0.904   1.00 71.45  ? 70  MET B N     1 
ATOM   1171 C CA    . MET B 1 73 ? 43.161 0.071   1.116   1.00 72.53  ? 70  MET B CA    1 
ATOM   1172 C C     . MET B 1 73 ? 44.198 0.831   1.871   1.00 63.24  ? 70  MET B C     1 
ATOM   1173 O O     . MET B 1 73 ? 44.599 1.916   1.474   1.00 60.49  ? 70  MET B O     1 
ATOM   1174 C CB    . MET B 1 73 ? 41.854 0.138   1.919   1.00 82.00  ? 70  MET B CB    1 
ATOM   1175 C CG    . MET B 1 73 ? 40.598 0.417   1.096   1.00 90.96  ? 70  MET B CG    1 
ATOM   1176 S SD    . MET B 1 73 ? 39.143 0.893   2.080   1.00 92.41  ? 70  MET B SD    1 
ATOM   1177 C CE    . MET B 1 73 ? 39.742 2.405   2.811   1.00 75.58  ? 70  MET B CE    1 
ATOM   1178 N N     . LEU B 1 74 ? 44.633 0.234   2.966   1.00 64.47  ? 71  LEU B N     1 
ATOM   1179 C CA    . LEU B 1 74 ? 45.633 0.820   3.820   1.00 66.34  ? 71  LEU B CA    1 
ATOM   1180 C C     . LEU B 1 74 ? 46.858 1.239   3.010   1.00 73.44  ? 71  LEU B C     1 
ATOM   1181 O O     . LEU B 1 74 ? 47.261 2.409   3.046   1.00 76.62  ? 71  LEU B O     1 
ATOM   1182 C CB    . LEU B 1 74 ? 45.988 -0.179  4.906   1.00 65.84  ? 71  LEU B CB    1 
ATOM   1183 C CG    . LEU B 1 74 ? 47.326 -0.049  5.625   1.00 80.76  ? 71  LEU B CG    1 
ATOM   1184 C CD1   . LEU B 1 74 ? 47.546 1.338   6.232   1.00 84.72  ? 71  LEU B CD1   1 
ATOM   1185 C CD2   . LEU B 1 74 ? 47.437 -1.145  6.677   1.00 90.47  ? 71  LEU B CD2   1 
ATOM   1186 N N     . ILE B 1 75 ? 47.436 0.281   2.279   1.00 80.69  ? 72  ILE B N     1 
ATOM   1187 C CA    . ILE B 1 75 ? 48.682 0.468   1.510   1.00 76.26  ? 72  ILE B CA    1 
ATOM   1188 C C     . ILE B 1 75 ? 48.586 1.754   0.702   1.00 81.55  ? 72  ILE B C     1 
ATOM   1189 O O     . ILE B 1 75 ? 49.436 2.668   0.815   1.00 65.42  ? 72  ILE B O     1 
ATOM   1190 C CB    . ILE B 1 75 ? 48.913 -0.731  0.550   1.00 66.72  ? 72  ILE B CB    1 
ATOM   1191 C CG1   . ILE B 1 75 ? 49.392 -1.946  1.337   1.00 66.10  ? 72  ILE B CG1   1 
ATOM   1192 C CG2   . ILE B 1 75 ? 49.923 -0.386  -0.535  1.00 56.80  ? 72  ILE B CG2   1 
ATOM   1193 C CD1   . ILE B 1 75 ? 49.203 -3.281  0.638   1.00 66.33  ? 72  ILE B CD1   1 
ATOM   1194 N N     . LYS B 1 76 ? 47.500 1.815   -0.077  1.00 79.15  ? 73  LYS B N     1 
ATOM   1195 C CA    . LYS B 1 76 ? 47.272 2.904   -0.982  1.00 86.97  ? 73  LYS B CA    1 
ATOM   1196 C C     . LYS B 1 76 ? 47.274 4.243   -0.237  1.00 93.53  ? 73  LYS B C     1 
ATOM   1197 O O     . LYS B 1 76 ? 47.804 5.254   -0.738  1.00 99.56  ? 73  LYS B O     1 
ATOM   1198 C CB    . LYS B 1 76 ? 45.999 2.644   -1.784  1.00 93.08  ? 73  LYS B CB    1 
ATOM   1199 C CG    . LYS B 1 76 ? 46.244 1.711   -2.967  1.00 102.35 ? 73  LYS B CG    1 
ATOM   1200 C CD    . LYS B 1 76 ? 44.972 1.145   -3.594  1.00 104.25 ? 73  LYS B CD    1 
ATOM   1201 C CE    . LYS B 1 76 ? 45.348 0.255   -4.772  1.00 110.36 ? 73  LYS B CE    1 
ATOM   1202 N NZ    . LYS B 1 76 ? 44.189 -0.518  -5.290  1.00 125.66 ? 73  LYS B NZ    1 
ATOM   1203 N N     . GLU B 1 77 ? 46.748 4.233   0.983   1.00 87.75  ? 74  GLU B N     1 
ATOM   1204 C CA    . GLU B 1 77 ? 46.705 5.446   1.776   1.00 90.11  ? 74  GLU B CA    1 
ATOM   1205 C C     . GLU B 1 77 ? 48.045 5.893   2.352   1.00 89.44  ? 74  GLU B C     1 
ATOM   1206 O O     . GLU B 1 77 ? 48.150 7.024   2.835   1.00 90.75  ? 74  GLU B O     1 
ATOM   1207 C CB    . GLU B 1 77 ? 45.653 5.331   2.864   1.00 96.12  ? 74  GLU B CB    1 
ATOM   1208 C CG    . GLU B 1 77 ? 44.401 6.115   2.532   1.00 99.89  ? 74  GLU B CG    1 
ATOM   1209 C CD    . GLU B 1 77 ? 44.512 7.578   2.910   1.00 103.44 ? 74  GLU B CD    1 
ATOM   1210 O OE1   . GLU B 1 77 ? 45.502 7.984   3.564   1.00 114.31 ? 74  GLU B OE1   1 
ATOM   1211 O OE2   . GLU B 1 77 ? 43.587 8.324   2.561   1.00 102.93 ? 74  GLU B OE2   1 
ATOM   1212 N N     . ILE B 1 78 ? 49.052 5.016   2.298   1.00 90.12  ? 75  ILE B N     1 
ATOM   1213 C CA    . ILE B 1 78 ? 50.410 5.388   2.704   1.00 95.52  ? 75  ILE B CA    1 
ATOM   1214 C C     . ILE B 1 78 ? 51.014 6.210   1.575   1.00 94.32  ? 75  ILE B C     1 
ATOM   1215 O O     . ILE B 1 78 ? 51.572 7.301   1.783   1.00 87.20  ? 75  ILE B O     1 
ATOM   1216 C CB    . ILE B 1 78 ? 51.313 4.151   2.909   1.00 109.06 ? 75  ILE B CB    1 
ATOM   1217 C CG1   . ILE B 1 78 ? 50.515 2.953   3.446   1.00 117.33 ? 75  ILE B CG1   1 
ATOM   1218 C CG2   . ILE B 1 78 ? 52.506 4.489   3.801   1.00 103.91 ? 75  ILE B CG2   1 
ATOM   1219 C CD1   . ILE B 1 78 ? 51.220 1.621   3.250   1.00 120.32 ? 75  ILE B CD1   1 
ATOM   1220 N N     . LEU B 1 79 ? 50.848 5.656   0.374   1.00 94.16  ? 76  LEU B N     1 
ATOM   1221 C CA    . LEU B 1 79 ? 51.484 6.111   -0.852  1.00 93.72  ? 76  LEU B CA    1 
ATOM   1222 C C     . LEU B 1 79 ? 51.082 7.518   -1.343  1.00 110.14 ? 76  LEU B C     1 
ATOM   1223 O O     . LEU B 1 79 ? 51.679 8.020   -2.301  1.00 119.44 ? 76  LEU B O     1 
ATOM   1224 C CB    . LEU B 1 79 ? 51.238 5.079   -1.962  1.00 85.34  ? 76  LEU B CB    1 
ATOM   1225 C CG    . LEU B 1 79 ? 51.757 3.642   -1.816  1.00 82.25  ? 76  LEU B CG    1 
ATOM   1226 C CD1   . LEU B 1 79 ? 51.227 2.796   -2.982  1.00 73.42  ? 76  LEU B CD1   1 
ATOM   1227 C CD2   . LEU B 1 79 ? 53.291 3.553   -1.671  1.00 66.58  ? 76  LEU B CD2   1 
ATOM   1228 N N     . LYS B 1 80 ? 50.075 8.145   -0.726  1.00 109.18 ? 77  LYS B N     1 
ATOM   1229 C CA    . LYS B 1 80 ? 49.841 9.564   -0.969  1.00 101.50 ? 77  LYS B CA    1 
ATOM   1230 C C     . LYS B 1 80 ? 51.020 10.317  -0.351  1.00 103.06 ? 77  LYS B C     1 
ATOM   1231 O O     . LYS B 1 80 ? 51.419 10.038  0.787   1.00 101.83 ? 77  LYS B O     1 
ATOM   1232 C CB    . LYS B 1 80 ? 48.501 10.033  -0.375  1.00 108.25 ? 77  LYS B CB    1 
ATOM   1233 C CG    . LYS B 1 80 ? 48.139 11.497  -0.661  1.00 113.07 ? 77  LYS B CG    1 
ATOM   1234 C CD    . LYS B 1 80 ? 48.901 12.483  0.235   1.00 111.72 ? 77  LYS B CD    1 
ATOM   1235 C CE    . LYS B 1 80 ? 49.472 13.650  -0.572  1.00 108.16 ? 77  LYS B CE    1 
ATOM   1236 N NZ    . LYS B 1 80 ? 50.882 13.959  -0.189  1.00 102.42 ? 77  LYS B NZ    1 
ATOM   1237 O "O5'" . DA  C 2 1  ? 72.421 -15.460 18.926  1.00 63.61  ? 1   DA  C "O5'" 1 
ATOM   1238 C "C5'" . DA  C 2 1  ? 72.882 -16.351 17.877  1.00 58.15  ? 1   DA  C "C5'" 1 
ATOM   1239 C "C4'" . DA  C 2 1  ? 71.714 -17.089 17.257  1.00 60.81  ? 1   DA  C "C4'" 1 
ATOM   1240 O "O4'" . DA  C 2 1  ? 71.615 -18.405 17.840  1.00 64.89  ? 1   DA  C "O4'" 1 
ATOM   1241 C "C3'" . DA  C 2 1  ? 70.351 -16.463 17.517  1.00 55.99  ? 1   DA  C "C3'" 1 
ATOM   1242 O "O3'" . DA  C 2 1  ? 69.358 -16.925 16.602  1.00 55.83  ? 1   DA  C "O3'" 1 
ATOM   1243 C "C2'" . DA  C 2 1  ? 70.009 -17.005 18.890  1.00 57.77  ? 1   DA  C "C2'" 1 
ATOM   1244 C "C1'" . DA  C 2 1  ? 70.666 -18.381 18.906  1.00 61.98  ? 1   DA  C "C1'" 1 
ATOM   1245 N N9    . DA  C 2 1  ? 71.397 -18.641 20.139  1.00 65.38  ? 1   DA  C N9    1 
ATOM   1246 C C8    . DA  C 2 1  ? 72.521 -17.993 20.587  1.00 76.94  ? 1   DA  C C8    1 
ATOM   1247 N N7    . DA  C 2 1  ? 72.972 -18.443 21.732  1.00 73.41  ? 1   DA  C N7    1 
ATOM   1248 C C5    . DA  C 2 1  ? 72.107 -19.481 22.042  1.00 66.89  ? 1   DA  C C5    1 
ATOM   1249 C C6    . DA  C 2 1  ? 72.052 -20.365 23.127  1.00 63.36  ? 1   DA  C C6    1 
ATOM   1250 N N6    . DA  C 2 1  ? 72.927 -20.350 24.129  1.00 59.22  ? 1   DA  C N6    1 
ATOM   1251 N N1    . DA  C 2 1  ? 71.047 -21.268 23.154  1.00 73.64  ? 1   DA  C N1    1 
ATOM   1252 C C2    . DA  C 2 1  ? 70.170 -21.280 22.137  1.00 83.56  ? 1   DA  C C2    1 
ATOM   1253 N N3    . DA  C 2 1  ? 70.119 -20.500 21.058  1.00 73.93  ? 1   DA  C N3    1 
ATOM   1254 C C4    . DA  C 2 1  ? 71.130 -19.613 21.070  1.00 69.37  ? 1   DA  C C4    1 
ATOM   1255 P P     . DT  C 2 2  ? 67.844 -16.415 16.790  1.00 63.58  ? 2   DT  C P     1 
ATOM   1256 O OP1   . DT  C 2 2  ? 67.109 -16.612 15.519  1.00 56.89  ? 2   DT  C OP1   1 
ATOM   1257 O OP2   . DT  C 2 2  ? 67.940 -15.068 17.418  1.00 81.68  ? 2   DT  C OP2   1 
ATOM   1258 O "O5'" . DT  C 2 2  ? 67.172 -17.416 17.845  1.00 64.86  ? 2   DT  C "O5'" 1 
ATOM   1259 C "C5'" . DT  C 2 2  ? 67.110 -18.864 17.640  1.00 65.20  ? 2   DT  C "C5'" 1 
ATOM   1260 C "C4'" . DT  C 2 2  ? 66.373 -19.525 18.782  1.00 57.06  ? 2   DT  C "C4'" 1 
ATOM   1261 O "O4'" . DT  C 2 2  ? 67.227 -19.649 19.947  1.00 65.07  ? 2   DT  C "O4'" 1 
ATOM   1262 C "C3'" . DT  C 2 2  ? 65.151 -18.734 19.241  1.00 60.37  ? 2   DT  C "C3'" 1 
ATOM   1263 O "O3'" . DT  C 2 2  ? 64.005 -19.556 19.080  1.00 62.31  ? 2   DT  C "O3'" 1 
ATOM   1264 C "C2'" . DT  C 2 2  ? 65.450 -18.347 20.683  1.00 55.18  ? 2   DT  C "C2'" 1 
ATOM   1265 C "C1'" . DT  C 2 2  ? 66.474 -19.364 21.123  1.00 59.68  ? 2   DT  C "C1'" 1 
ATOM   1266 N N1    . DT  C 2 2  ? 67.417 -18.904 22.184  1.00 59.69  ? 2   DT  C N1    1 
ATOM   1267 C C2    . DT  C 2 2  ? 67.637 -19.692 23.297  1.00 58.73  ? 2   DT  C C2    1 
ATOM   1268 O O2    . DT  C 2 2  ? 67.082 -20.761 23.486  1.00 70.68  ? 2   DT  C O2    1 
ATOM   1269 N N3    . DT  C 2 2  ? 68.538 -19.176 24.191  1.00 56.92  ? 2   DT  C N3    1 
ATOM   1270 C C4    . DT  C 2 2  ? 69.229 -17.985 24.090  1.00 56.32  ? 2   DT  C C4    1 
ATOM   1271 O O4    . DT  C 2 2  ? 70.023 -17.664 24.966  1.00 52.00  ? 2   DT  C O4    1 
ATOM   1272 C C5    . DT  C 2 2  ? 68.950 -17.210 22.907  1.00 57.89  ? 2   DT  C C5    1 
ATOM   1273 C C7    . DT  C 2 2  ? 69.654 -15.905 22.714  1.00 59.57  ? 2   DT  C C7    1 
ATOM   1274 C C6    . DT  C 2 2  ? 68.062 -17.696 22.029  1.00 62.54  ? 2   DT  C C6    1 
ATOM   1275 P P     . DG  C 2 3  ? 62.675 -19.241 19.864  1.00 58.94  ? 3   DG  C P     1 
ATOM   1276 O OP1   . DG  C 2 3  ? 61.602 -20.038 19.218  1.00 76.10  ? 3   DG  C OP1   1 
ATOM   1277 O OP2   . DG  C 2 3  ? 62.547 -17.773 20.022  1.00 53.31  ? 3   DG  C OP2   1 
ATOM   1278 O "O5'" . DG  C 2 3  ? 62.892 -19.970 21.263  1.00 67.83  ? 3   DG  C "O5'" 1 
ATOM   1279 C "C5'" . DG  C 2 3  ? 62.686 -21.404 21.377  1.00 74.42  ? 3   DG  C "C5'" 1 
ATOM   1280 C "C4'" . DG  C 2 3  ? 62.336 -21.800 22.794  1.00 65.54  ? 3   DG  C "C4'" 1 
ATOM   1281 O "O4'" . DG  C 2 3  ? 63.366 -21.357 23.708  1.00 57.72  ? 3   DG  C "O4'" 1 
ATOM   1282 C "C3'" . DG  C 2 3  ? 61.026 -21.201 23.301  1.00 69.47  ? 3   DG  C "C3'" 1 
ATOM   1283 O "O3'" . DG  C 2 3  ? 60.285 -22.207 24.002  1.00 80.77  ? 3   DG  C "O3'" 1 
ATOM   1284 C "C2'" . DG  C 2 3  ? 61.475 -20.020 24.146  1.00 67.08  ? 3   DG  C "C2'" 1 
ATOM   1285 C "C1'" . DG  C 2 3  ? 62.805 -20.493 24.692  1.00 68.10  ? 3   DG  C "C1'" 1 
ATOM   1286 N N9    . DG  C 2 3  ? 63.784 -19.452 24.984  1.00 68.56  ? 3   DG  C N9    1 
ATOM   1287 C C8    . DG  C 2 3  ? 64.210 -18.442 24.155  1.00 72.21  ? 3   DG  C C8    1 
ATOM   1288 N N7    . DG  C 2 3  ? 65.138 -17.694 24.689  1.00 66.09  ? 3   DG  C N7    1 
ATOM   1289 C C5    . DG  C 2 3  ? 65.328 -18.237 25.950  1.00 72.71  ? 3   DG  C C5    1 
ATOM   1290 C C6    . DG  C 2 3  ? 66.193 -17.839 26.995  1.00 77.87  ? 3   DG  C C6    1 
ATOM   1291 O O6    . DG  C 2 3  ? 66.994 -16.899 27.012  1.00 79.74  ? 3   DG  C O6    1 
ATOM   1292 N N1    . DG  C 2 3  ? 66.063 -18.663 28.109  1.00 78.49  ? 3   DG  C N1    1 
ATOM   1293 C C2    . DG  C 2 3  ? 65.206 -19.734 28.204  1.00 77.20  ? 3   DG  C C2    1 
ATOM   1294 N N2    . DG  C 2 3  ? 65.225 -20.404 29.363  1.00 93.78  ? 3   DG  C N2    1 
ATOM   1295 N N3    . DG  C 2 3  ? 64.389 -20.113 27.238  1.00 69.60  ? 3   DG  C N3    1 
ATOM   1296 C C4    . DG  C 2 3  ? 64.501 -19.324 26.147  1.00 71.59  ? 3   DG  C C4    1 
ATOM   1297 P P     . DT  C 2 4  ? 58.808 -21.896 24.548  1.00 84.10  ? 4   DT  C P     1 
ATOM   1298 O OP1   . DT  C 2 4  ? 57.884 -22.872 23.936  1.00 80.78  ? 4   DT  C OP1   1 
ATOM   1299 O OP2   . DT  C 2 4  ? 58.540 -20.432 24.412  1.00 85.36  ? 4   DT  C OP2   1 
ATOM   1300 O "O5'" . DT  C 2 4  ? 58.927 -22.237 26.101  1.00 86.96  ? 4   DT  C "O5'" 1 
ATOM   1301 C "C5'" . DT  C 2 4  ? 60.207 -22.434 26.732  1.00 76.31  ? 4   DT  C "C5'" 1 
ATOM   1302 C "C4'" . DT  C 2 4  ? 60.244 -21.782 28.095  1.00 76.92  ? 4   DT  C "C4'" 1 
ATOM   1303 O "O4'" . DT  C 2 4  ? 61.280 -20.782 28.114  1.00 71.60  ? 4   DT  C "O4'" 1 
ATOM   1304 C "C3'" . DT  C 2 4  ? 58.971 -21.073 28.582  1.00 73.85  ? 4   DT  C "C3'" 1 
ATOM   1305 O "O3'" . DT  C 2 4  ? 58.843 -21.294 29.984  1.00 81.84  ? 4   DT  C "O3'" 1 
ATOM   1306 C "C2'" . DT  C 2 4  ? 59.348 -19.605 28.558  1.00 69.10  ? 4   DT  C "C2'" 1 
ATOM   1307 C "C1'" . DT  C 2 4  ? 60.810 -19.703 28.895  1.00 66.91  ? 4   DT  C "C1'" 1 
ATOM   1308 N N1    . DT  C 2 4  ? 61.616 -18.546 28.554  1.00 68.69  ? 4   DT  C N1    1 
ATOM   1309 C C2    . DT  C 2 4  ? 62.661 -18.222 29.390  1.00 70.01  ? 4   DT  C C2    1 
ATOM   1310 O O2    . DT  C 2 4  ? 62.897 -18.820 30.431  1.00 68.02  ? 4   DT  C O2    1 
ATOM   1311 N N3    . DT  C 2 4  ? 63.414 -17.156 28.970  1.00 70.47  ? 4   DT  C N3    1 
ATOM   1312 C C4    . DT  C 2 4  ? 63.230 -16.400 27.828  1.00 69.14  ? 4   DT  C C4    1 
ATOM   1313 O O4    . DT  C 2 4  ? 63.989 -15.468 27.585  1.00 69.57  ? 4   DT  C O4    1 
ATOM   1314 C C5    . DT  C 2 4  ? 62.122 -16.806 26.991  1.00 70.05  ? 4   DT  C C5    1 
ATOM   1315 C C7    . DT  C 2 4  ? 61.847 -16.050 25.729  1.00 66.32  ? 4   DT  C C7    1 
ATOM   1316 C C6    . DT  C 2 4  ? 61.395 -17.858 27.381  1.00 71.93  ? 4   DT  C C6    1 
ATOM   1317 P P     . DA  C 2 5  ? 57.405 -21.472 30.658  1.00 85.70  ? 5   DA  C P     1 
ATOM   1318 O OP1   . DA  C 2 5  ? 56.887 -22.804 30.241  1.00 86.14  ? 5   DA  C OP1   1 
ATOM   1319 O OP2   . DA  C 2 5  ? 56.598 -20.252 30.391  1.00 81.77  ? 5   DA  C OP2   1 
ATOM   1320 O "O5'" . DA  C 2 5  ? 57.754 -21.456 32.219  1.00 84.81  ? 5   DA  C "O5'" 1 
ATOM   1321 C "C5'" . DA  C 2 5  ? 59.104 -21.667 32.727  1.00 73.36  ? 5   DA  C "C5'" 1 
ATOM   1322 C "C4'" . DA  C 2 5  ? 59.423 -20.692 33.839  1.00 71.87  ? 5   DA  C "C4'" 1 
ATOM   1323 O "O4'" . DA  C 2 5  ? 60.288 -19.668 33.297  1.00 72.86  ? 5   DA  C "O4'" 1 
ATOM   1324 C "C3'" . DA  C 2 5  ? 58.227 -19.956 34.471  1.00 76.47  ? 5   DA  C "C3'" 1 
ATOM   1325 O "O3'" . DA  C 2 5  ? 58.236 -19.885 35.916  1.00 79.30  ? 5   DA  C "O3'" 1 
ATOM   1326 C "C2'" . DA  C 2 5  ? 58.317 -18.557 33.882  1.00 73.99  ? 5   DA  C "C2'" 1 
ATOM   1327 C "C1'" . DA  C 2 5  ? 59.809 -18.390 33.695  1.00 75.11  ? 5   DA  C "C1'" 1 
ATOM   1328 N N9    . DA  C 2 5  ? 60.161 -17.431 32.653  1.00 73.06  ? 5   DA  C N9    1 
ATOM   1329 C C8    . DA  C 2 5  ? 59.582 -17.276 31.416  1.00 75.38  ? 5   DA  C C8    1 
ATOM   1330 N N7    . DA  C 2 5  ? 60.132 -16.333 30.690  1.00 69.78  ? 5   DA  C N7    1 
ATOM   1331 C C5    . DA  C 2 5  ? 61.125 -15.818 31.510  1.00 64.02  ? 5   DA  C C5    1 
ATOM   1332 C C6    . DA  C 2 5  ? 62.049 -14.777 31.333  1.00 68.04  ? 5   DA  C C6    1 
ATOM   1333 N N6    . DA  C 2 5  ? 62.126 -14.038 30.223  1.00 64.78  ? 5   DA  C N6    1 
ATOM   1334 N N1    . DA  C 2 5  ? 62.913 -14.524 32.343  1.00 78.81  ? 5   DA  C N1    1 
ATOM   1335 C C2    . DA  C 2 5  ? 62.831 -15.267 33.457  1.00 74.53  ? 5   DA  C C2    1 
ATOM   1336 N N3    . DA  C 2 5  ? 61.985 -16.254 33.752  1.00 61.61  ? 5   DA  C N3    1 
ATOM   1337 C C4    . DA  C 2 5  ? 61.155 -16.486 32.722  1.00 64.47  ? 5   DA  C C4    1 
ATOM   1338 P P     . DG  C 2 6  ? 56.861 -19.521 36.758  1.00 90.09  ? 6   DG  C P     1 
ATOM   1339 O OP1   . DG  C 2 6  ? 56.404 -20.749 37.451  1.00 83.62  ? 6   DG  C OP1   1 
ATOM   1340 O OP2   . DG  C 2 6  ? 55.906 -18.816 35.850  1.00 95.19  ? 6   DG  C OP2   1 
ATOM   1341 O "O5'" . DG  C 2 6  ? 57.340 -18.472 37.858  1.00 66.32  ? 6   DG  C "O5'" 1 
ATOM   1342 C "C5'" . DG  C 2 6  ? 58.707 -18.071 37.954  1.00 75.82  ? 6   DG  C "C5'" 1 
ATOM   1343 C "C4'" . DG  C 2 6  ? 58.811 -16.606 38.308  1.00 86.93  ? 6   DG  C "C4'" 1 
ATOM   1344 O "O4'" . DG  C 2 6  ? 59.274 -15.850 37.160  1.00 96.15  ? 6   DG  C "O4'" 1 
ATOM   1345 C "C3'" . DG  C 2 6  ? 57.512 -15.928 38.741  1.00 88.84  ? 6   DG  C "C3'" 1 
ATOM   1346 O "O3'" . DG  C 2 6  ? 57.881 -14.838 39.585  1.00 91.32  ? 6   DG  C "O3'" 1 
ATOM   1347 C "C2'" . DG  C 2 6  ? 57.043 -15.277 37.458  1.00 89.45  ? 6   DG  C "C2'" 1 
ATOM   1348 C "C1'" . DG  C 2 6  ? 58.374 -14.778 36.933  1.00 85.63  ? 6   DG  C "C1'" 1 
ATOM   1349 N N9    . DG  C 2 6  ? 58.379 -14.463 35.508  1.00 81.91  ? 6   DG  C N9    1 
ATOM   1350 C C8    . DG  C 2 6  ? 57.435 -14.848 34.587  1.00 76.97  ? 6   DG  C C8    1 
ATOM   1351 N N7    . DG  C 2 6  ? 57.674 -14.395 33.387  1.00 74.45  ? 6   DG  C N7    1 
ATOM   1352 C C5    . DG  C 2 6  ? 58.834 -13.646 33.527  1.00 71.66  ? 6   DG  C C5    1 
ATOM   1353 C C6    . DG  C 2 6  ? 59.570 -12.912 32.565  1.00 70.69  ? 6   DG  C C6    1 
ATOM   1354 O O6    . DG  C 2 6  ? 59.328 -12.760 31.359  1.00 67.03  ? 6   DG  C O6    1 
ATOM   1355 N N1    . DG  C 2 6  ? 60.700 -12.323 33.128  1.00 71.43  ? 6   DG  C N1    1 
ATOM   1356 C C2    . DG  C 2 6  ? 61.062 -12.412 34.448  1.00 64.60  ? 6   DG  C C2    1 
ATOM   1357 N N2    . DG  C 2 6  ? 62.182 -11.766 34.796  1.00 64.18  ? 6   DG  C N2    1 
ATOM   1358 N N3    . DG  C 2 6  ? 60.373 -13.080 35.360  1.00 65.73  ? 6   DG  C N3    1 
ATOM   1359 C C4    . DG  C 2 6  ? 59.279 -13.671 34.832  1.00 75.17  ? 6   DG  C C4    1 
ATOM   1360 P P     . DA  C 2 7  ? 56.846 -14.223 40.645  1.00 99.00  ? 7   DA  C P     1 
ATOM   1361 O OP1   . DA  C 2 7  ? 56.405 -15.326 41.542  1.00 92.80  ? 7   DA  C OP1   1 
ATOM   1362 O OP2   . DA  C 2 7  ? 55.811 -13.443 39.903  1.00 94.77  ? 7   DA  C OP2   1 
ATOM   1363 O "O5'" . DA  C 2 7  ? 57.782 -13.200 41.426  1.00 85.24  ? 7   DA  C "O5'" 1 
ATOM   1364 C "C5'" . DA  C 2 7  ? 59.106 -12.927 40.912  1.00 84.96  ? 7   DA  C "C5'" 1 
ATOM   1365 C "C4'" . DA  C 2 7  ? 59.322 -11.438 40.763  1.00 84.52  ? 7   DA  C "C4'" 1 
ATOM   1366 O "O4'" . DA  C 2 7  ? 59.453 -11.064 39.368  1.00 78.93  ? 7   DA  C "O4'" 1 
ATOM   1367 C "C3'" . DA  C 2 7  ? 58.197 -10.568 41.322  1.00 86.09  ? 7   DA  C "C3'" 1 
ATOM   1368 O "O3'" . DA  C 2 7  ? 58.848 -9.440  41.922  1.00 84.12  ? 7   DA  C "O3'" 1 
ATOM   1369 C "C2'" . DA  C 2 7  ? 57.354 -10.251 40.094  1.00 79.18  ? 7   DA  C "C2'" 1 
ATOM   1370 C "C1'" . DA  C 2 7  ? 58.416 -10.144 39.007  1.00 79.86  ? 7   DA  C "C1'" 1 
ATOM   1371 N N9    . DA  C 2 7  ? 57.989 -10.468 37.646  1.00 69.67  ? 7   DA  C N9    1 
ATOM   1372 C C8    . DA  C 2 7  ? 57.099 -11.424 37.228  1.00 66.51  ? 7   DA  C C8    1 
ATOM   1373 N N7    . DA  C 2 7  ? 56.986 -11.507 35.926  1.00 62.22  ? 7   DA  C N7    1 
ATOM   1374 C C5    . DA  C 2 7  ? 57.884 -10.562 35.454  1.00 64.44  ? 7   DA  C C5    1 
ATOM   1375 C C6    . DA  C 2 7  ? 58.233 -10.157 34.158  1.00 62.46  ? 7   DA  C C6    1 
ATOM   1376 N N6    . DA  C 2 7  ? 57.692 -10.669 33.054  1.00 68.90  ? 7   DA  C N6    1 
ATOM   1377 N N1    . DA  C 2 7  ? 59.150 -9.174  34.032  1.00 65.85  ? 7   DA  C N1    1 
ATOM   1378 C C2    . DA  C 2 7  ? 59.673 -8.641  35.140  1.00 67.05  ? 7   DA  C C2    1 
ATOM   1379 N N3    . DA  C 2 7  ? 59.430 -8.940  36.413  1.00 77.36  ? 7   DA  C N3    1 
ATOM   1380 C C4    . DA  C 2 7  ? 58.506 -9.912  36.502  1.00 70.40  ? 7   DA  C C4    1 
ATOM   1381 P P     . DC  C 2 8  ? 58.009 -8.164  42.345  1.00 90.30  ? 8   DC  C P     1 
ATOM   1382 O OP1   . DC  C 2 8  ? 58.823 -7.410  43.333  1.00 84.31  ? 8   DC  C OP1   1 
ATOM   1383 O OP2   . DC  C 2 8  ? 56.600 -8.590  42.643  1.00 69.97  ? 8   DC  C OP2   1 
ATOM   1384 O "O5'" . DC  C 2 8  ? 57.961 -7.299  41.011  1.00 85.93  ? 8   DC  C "O5'" 1 
ATOM   1385 C "C5'" . DC  C 2 8  ? 59.155 -6.706  40.496  1.00 83.09  ? 8   DC  C "C5'" 1 
ATOM   1386 C "C4'" . DC  C 2 8  ? 58.810 -5.863  39.294  1.00 79.98  ? 8   DC  C "C4'" 1 
ATOM   1387 O "O4'" . DC  C 2 8  ? 58.407 -6.705  38.203  1.00 82.75  ? 8   DC  C "O4'" 1 
ATOM   1388 C "C3'" . DC  C 2 8  ? 57.638 -4.914  39.515  1.00 82.80  ? 8   DC  C "C3'" 1 
ATOM   1389 O "O3'" . DC  C 2 8  ? 58.193 -3.643  39.869  1.00 84.32  ? 8   DC  C "O3'" 1 
ATOM   1390 C "C2'" . DC  C 2 8  ? 56.901 -4.916  38.179  1.00 84.75  ? 8   DC  C "C2'" 1 
ATOM   1391 C "C1'" . DC  C 2 8  ? 57.676 -5.892  37.311  1.00 81.92  ? 8   DC  C "C1'" 1 
ATOM   1392 N N1    . DC  C 2 8  ? 56.835 -6.768  36.495  1.00 69.59  ? 8   DC  C N1    1 
ATOM   1393 C C2    . DC  C 2 8  ? 56.919 -6.678  35.107  1.00 74.35  ? 8   DC  C C2    1 
ATOM   1394 O O2    . DC  C 2 8  ? 57.705 -5.863  34.607  1.00 81.78  ? 8   DC  C O2    1 
ATOM   1395 N N3    . DC  C 2 8  ? 56.162 -7.496  34.344  1.00 81.70  ? 8   DC  C N3    1 
ATOM   1396 C C4    . DC  C 2 8  ? 55.330 -8.363  34.921  1.00 75.13  ? 8   DC  C C4    1 
ATOM   1397 N N4    . DC  C 2 8  ? 54.601 -9.150  34.128  1.00 71.03  ? 8   DC  C N4    1 
ATOM   1398 C C5    . DC  C 2 8  ? 55.227 -8.478  36.336  1.00 75.24  ? 8   DC  C C5    1 
ATOM   1399 C C6    . DC  C 2 8  ? 56.004 -7.681  37.077  1.00 68.03  ? 8   DC  C C6    1 
ATOM   1400 P P     . DT  C 2 9  ? 57.338 -2.308  39.688  1.00 87.69  ? 9   DT  C P     1 
ATOM   1401 O OP1   . DT  C 2 9  ? 58.106 -1.192  40.296  1.00 81.10  ? 9   DT  C OP1   1 
ATOM   1402 O OP2   . DT  C 2 9  ? 55.926 -2.582  40.105  1.00 74.74  ? 9   DT  C OP2   1 
ATOM   1403 O "O5'" . DT  C 2 9  ? 57.319 -2.120  38.108  1.00 93.65  ? 9   DT  C "O5'" 1 
ATOM   1404 C "C5'" . DT  C 2 9  ? 58.469 -1.646  37.400  1.00 88.86  ? 9   DT  C "C5'" 1 
ATOM   1405 C "C4'" . DT  C 2 9  ? 58.030 -1.085  36.068  1.00 86.37  ? 9   DT  C "C4'" 1 
ATOM   1406 O "O4'" . DT  C 2 9  ? 57.245 -2.073  35.365  1.00 80.86  ? 9   DT  C "O4'" 1 
ATOM   1407 C "C3'" . DT  C 2 9  ? 57.155 0.163   36.160  1.00 92.62  ? 9   DT  C "C3'" 1 
ATOM   1408 O "O3'" . DT  C 2 9  ? 57.652 1.107   35.196  1.00 94.59  ? 9   DT  C "O3'" 1 
ATOM   1409 C "C2'" . DT  C 2 9  ? 55.745 -0.372  35.934  1.00 86.88  ? 9   DT  C "C2'" 1 
ATOM   1410 C "C1'" . DT  C 2 9  ? 55.996 -1.530  34.986  1.00 86.84  ? 9   DT  C "C1'" 1 
ATOM   1411 N N1    . DT  C 2 9  ? 55.017 -2.624  35.028  1.00 91.85  ? 9   DT  C N1    1 
ATOM   1412 C C2    . DT  C 2 9  ? 54.909 -3.420  33.910  1.00 97.64  ? 9   DT  C C2    1 
ATOM   1413 O O2    . DT  C 2 9  ? 55.554 -3.229  32.891  1.00 100.15 ? 9   DT  C O2    1 
ATOM   1414 N N3    . DT  C 2 9  ? 53.996 -4.439  34.020  1.00 96.11  ? 9   DT  C N3    1 
ATOM   1415 C C4    . DT  C 2 9  ? 53.218 -4.748  35.118  1.00 91.85  ? 9   DT  C C4    1 
ATOM   1416 O O4    . DT  C 2 9  ? 52.443 -5.698  35.071  1.00 100.14 ? 9   DT  C O4    1 
ATOM   1417 C C5    . DT  C 2 9  ? 53.387 -3.875  36.258  1.00 83.27  ? 9   DT  C C5    1 
ATOM   1418 C C7    . DT  C 2 9  ? 52.576 -4.123  37.490  1.00 78.77  ? 9   DT  C C7    1 
ATOM   1419 C C6    . DT  C 2 9  ? 54.273 -2.875  36.160  1.00 88.26  ? 9   DT  C C6    1 
ATOM   1420 P P     . DA  C 2 10 ? 56.809 2.431   34.837  1.00 98.30  ? 10  DA  C P     1 
ATOM   1421 O OP1   . DA  C 2 10 ? 57.760 3.475   34.362  1.00 100.30 ? 10  DA  C OP1   1 
ATOM   1422 O OP2   . DA  C 2 10 ? 55.918 2.742   35.994  1.00 96.53  ? 10  DA  C OP2   1 
ATOM   1423 O "O5'" . DA  C 2 10 ? 55.996 1.956   33.556  1.00 79.58  ? 10  DA  C "O5'" 1 
ATOM   1424 C "C5'" . DA  C 2 10 ? 56.742 1.534   32.406  1.00 79.14  ? 10  DA  C "C5'" 1 
ATOM   1425 C "C4'" . DA  C 2 10 ? 55.861 1.549   31.181  1.00 87.95  ? 10  DA  C "C4'" 1 
ATOM   1426 O "O4'" . DA  C 2 10 ? 54.874 0.505   31.311  1.00 91.93  ? 10  DA  C "O4'" 1 
ATOM   1427 C "C3'" . DA  C 2 10 ? 55.094 2.853   30.934  1.00 88.83  ? 10  DA  C "C3'" 1 
ATOM   1428 O "O3'" . DA  C 2 10 ? 55.346 3.284   29.581  1.00 87.88  ? 10  DA  C "O3'" 1 
ATOM   1429 C "C2'" . DA  C 2 10 ? 53.674 2.534   31.372  1.00 81.74  ? 10  DA  C "C2'" 1 
ATOM   1430 C "C1'" . DA  C 2 10 ? 53.566 1.026   31.219  1.00 82.88  ? 10  DA  C "C1'" 1 
ATOM   1431 N N9    . DA  C 2 10 ? 52.767 0.384   32.254  1.00 82.10  ? 10  DA  C N9    1 
ATOM   1432 C C8    . DA  C 2 10 ? 52.465 0.851   33.509  1.00 87.25  ? 10  DA  C C8    1 
ATOM   1433 N N7    . DA  C 2 10 ? 51.705 0.041   34.205  1.00 89.59  ? 10  DA  C N7    1 
ATOM   1434 C C5    . DA  C 2 10 ? 51.499 -1.037  33.354  1.00 92.62  ? 10  DA  C C5    1 
ATOM   1435 C C6    . DA  C 2 10 ? 50.769 -2.233  33.496  1.00 93.39  ? 10  DA  C C6    1 
ATOM   1436 N N6    . DA  C 2 10 ? 50.094 -2.563  34.598  1.00 95.00  ? 10  DA  C N6    1 
ATOM   1437 N N1    . DA  C 2 10 ? 50.765 -3.095  32.455  1.00 96.90  ? 10  DA  C N1    1 
ATOM   1438 C C2    . DA  C 2 10 ? 51.436 -2.760  31.345  1.00 109.73 ? 10  DA  C C2    1 
ATOM   1439 N N3    . DA  C 2 10 ? 52.160 -1.668  31.092  1.00 106.23 ? 10  DA  C N3    1 
ATOM   1440 C C4    . DA  C 2 10 ? 52.152 -0.839  32.150  1.00 90.88  ? 10  DA  C C4    1 
ATOM   1441 P P     . DT  C 2 11 ? 54.211 3.951   28.652  1.00 83.60  ? 11  DT  C P     1 
ATOM   1442 O OP1   . DT  C 2 11 ? 54.834 4.242   27.334  1.00 78.64  ? 11  DT  C OP1   1 
ATOM   1443 O OP2   . DT  C 2 11 ? 53.565 5.065   29.399  1.00 79.76  ? 11  DT  C OP2   1 
ATOM   1444 O "O5'" . DT  C 2 11 ? 53.204 2.741   28.409  1.00 81.11  ? 11  DT  C "O5'" 1 
ATOM   1445 C "C5'" . DT  C 2 11 ? 52.934 2.273   27.072  1.00 83.86  ? 11  DT  C "C5'" 1 
ATOM   1446 C "C4'" . DT  C 2 11 ? 51.551 1.671   27.018  1.00 76.13  ? 11  DT  C "C4'" 1 
ATOM   1447 O "O4'" . DT  C 2 11 ? 51.252 1.128   28.333  1.00 69.98  ? 11  DT  C "O4'" 1 
ATOM   1448 C "C3'" . DT  C 2 11 ? 50.407 2.648   26.694  1.00 68.43  ? 11  DT  C "C3'" 1 
ATOM   1449 O "O3'" . DT  C 2 11 ? 49.318 1.957   26.082  1.00 65.15  ? 11  DT  C "O3'" 1 
ATOM   1450 C "C2'" . DT  C 2 11 ? 49.760 2.857   28.048  1.00 70.54  ? 11  DT  C "C2'" 1 
ATOM   1451 C "C1'" . DT  C 2 11 ? 49.905 1.444   28.573  1.00 65.89  ? 11  DT  C "C1'" 1 
ATOM   1452 N N1    . DT  C 2 11 ? 49.587 1.153   29.984  1.00 65.34  ? 11  DT  C N1    1 
ATOM   1453 C C2    . DT  C 2 11 ? 49.086 -0.104  30.254  1.00 66.51  ? 11  DT  C C2    1 
ATOM   1454 O O2    . DT  C 2 11 ? 48.965 -0.973  29.403  1.00 64.35  ? 11  DT  C O2    1 
ATOM   1455 N N3    . DT  C 2 11 ? 48.748 -0.313  31.569  1.00 68.58  ? 11  DT  C N3    1 
ATOM   1456 C C4    . DT  C 2 11 ? 48.843 0.594   32.612  1.00 65.11  ? 11  DT  C C4    1 
ATOM   1457 O O4    . DT  C 2 11 ? 48.510 0.259   33.746  1.00 64.31  ? 11  DT  C O4    1 
ATOM   1458 C C5    . DT  C 2 11 ? 49.351 1.900   32.251  1.00 57.31  ? 11  DT  C C5    1 
ATOM   1459 C C7    . DT  C 2 11 ? 49.491 2.945   33.314  1.00 52.25  ? 11  DT  C C7    1 
ATOM   1460 C C6    . DT  C 2 11 ? 49.683 2.114   30.970  1.00 61.94  ? 11  DT  C C6    1 
ATOM   1461 P P     . DA  C 2 12 ? 48.922 2.154   24.539  1.00 68.47  ? 12  DA  C P     1 
ATOM   1462 O OP1   . DA  C 2 12 ? 50.125 1.910   23.704  1.00 60.30  ? 12  DA  C OP1   1 
ATOM   1463 O OP2   . DA  C 2 12 ? 48.173 3.435   24.416  1.00 76.83  ? 12  DA  C OP2   1 
ATOM   1464 O "O5'" . DA  C 2 12 ? 47.930 0.926   24.291  1.00 67.00  ? 12  DA  C "O5'" 1 
ATOM   1465 C "C5'" . DA  C 2 12 ? 48.482 -0.421  24.280  1.00 67.33  ? 12  DA  C "C5'" 1 
ATOM   1466 C "C4'" . DA  C 2 12 ? 47.469 -1.500  24.599  1.00 56.23  ? 12  DA  C "C4'" 1 
ATOM   1467 O "O4'" . DA  C 2 12 ? 47.187 -1.572  26.012  1.00 61.27  ? 12  DA  C "O4'" 1 
ATOM   1468 C "C3'" . DA  C 2 12 ? 46.117 -1.402  23.915  1.00 50.32  ? 12  DA  C "C3'" 1 
ATOM   1469 O "O3'" . DA  C 2 12 ? 45.726 -2.753  23.735  1.00 53.75  ? 12  DA  C "O3'" 1 
ATOM   1470 C "C2'" . DA  C 2 12 ? 45.262 -0.697  24.944  1.00 52.49  ? 12  DA  C "C2'" 1 
ATOM   1471 C "C1'" . DA  C 2 12 ? 45.837 -1.207  26.268  1.00 61.41  ? 12  DA  C "C1'" 1 
ATOM   1472 N N9    . DA  C 2 12 ? 45.839 -0.260  27.390  1.00 60.28  ? 12  DA  C N9    1 
ATOM   1473 C C8    . DA  C 2 12 ? 46.472 0.959   27.463  1.00 57.12  ? 12  DA  C C8    1 
ATOM   1474 N N7    . DA  C 2 12 ? 46.308 1.572   28.611  1.00 59.56  ? 12  DA  C N7    1 
ATOM   1475 C C5    . DA  C 2 12 ? 45.537 0.687   29.354  1.00 65.83  ? 12  DA  C C5    1 
ATOM   1476 C C6    . DA  C 2 12 ? 45.023 0.746   30.664  1.00 68.84  ? 12  DA  C C6    1 
ATOM   1477 N N6    . DA  C 2 12 ? 45.223 1.778   31.487  1.00 69.76  ? 12  DA  C N6    1 
ATOM   1478 N N1    . DA  C 2 12 ? 44.269 -0.293  31.095  1.00 63.41  ? 12  DA  C N1    1 
ATOM   1479 C C2    . DA  C 2 12 ? 44.061 -1.321  30.262  1.00 71.26  ? 12  DA  C C2    1 
ATOM   1480 N N3    . DA  C 2 12 ? 44.509 -1.503  29.016  1.00 70.20  ? 12  DA  C N3    1 
ATOM   1481 C C4    . DA  C 2 12 ? 45.243 -0.448  28.615  1.00 64.80  ? 12  DA  C C4    1 
ATOM   1482 P P     . DG  C 2 13 ? 44.562 -3.126  22.687  1.00 73.88  ? 13  DG  C P     1 
ATOM   1483 O OP1   . DG  C 2 13 ? 44.956 -4.333  21.931  1.00 65.35  ? 13  DG  C OP1   1 
ATOM   1484 O OP2   . DG  C 2 13 ? 44.150 -1.920  21.940  1.00 69.11  ? 13  DG  C OP2   1 
ATOM   1485 O "O5'" . DG  C 2 13 ? 43.360 -3.467  23.663  1.00 75.33  ? 13  DG  C "O5'" 1 
ATOM   1486 C "C5'" . DG  C 2 13 ? 42.501 -2.406  24.039  1.00 66.98  ? 13  DG  C "C5'" 1 
ATOM   1487 C "C4'" . DG  C 2 13 ? 41.600 -2.831  25.166  1.00 60.10  ? 13  DG  C "C4'" 1 
ATOM   1488 O "O4'" . DG  C 2 13 ? 42.113 -2.214  26.372  1.00 52.37  ? 13  DG  C "O4'" 1 
ATOM   1489 C "C3'" . DG  C 2 13 ? 40.161 -2.332  24.972  1.00 59.31  ? 13  DG  C "C3'" 1 
ATOM   1490 O "O3'" . DG  C 2 13 ? 39.200 -3.327  25.324  1.00 70.30  ? 13  DG  C "O3'" 1 
ATOM   1491 C "C2'" . DG  C 2 13 ? 40.047 -1.161  25.925  1.00 59.12  ? 13  DG  C "C2'" 1 
ATOM   1492 C "C1'" . DG  C 2 13 ? 41.066 -1.501  27.012  1.00 62.40  ? 13  DG  C "C1'" 1 
ATOM   1493 N N9    . DG  C 2 13 ? 41.627 -0.302  27.621  1.00 58.56  ? 13  DG  C N9    1 
ATOM   1494 C C8    . DG  C 2 13 ? 42.460 0.622   27.033  1.00 61.63  ? 13  DG  C C8    1 
ATOM   1495 N N7    . DG  C 2 13 ? 42.742 1.629   27.814  1.00 63.46  ? 13  DG  C N7    1 
ATOM   1496 C C5    . DG  C 2 13 ? 42.013 1.380   28.969  1.00 68.93  ? 13  DG  C C5    1 
ATOM   1497 C C6    . DG  C 2 13 ? 41.916 2.125   30.174  1.00 67.74  ? 13  DG  C C6    1 
ATOM   1498 O O6    . DG  C 2 13 ? 42.455 3.199   30.460  1.00 59.75  ? 13  DG  C O6    1 
ATOM   1499 N N1    . DG  C 2 13 ? 41.067 1.507   31.090  1.00 70.33  ? 13  DG  C N1    1 
ATOM   1500 C C2    . DG  C 2 13 ? 40.404 0.320   30.881  1.00 67.62  ? 13  DG  C C2    1 
ATOM   1501 N N2    . DG  C 2 13 ? 39.637 -0.113  31.889  1.00 69.10  ? 13  DG  C N2    1 
ATOM   1502 N N3    . DG  C 2 13 ? 40.496 -0.391  29.768  1.00 67.36  ? 13  DG  C N3    1 
ATOM   1503 C C4    . DG  C 2 13 ? 41.305 0.198   28.858  1.00 67.58  ? 13  DG  C C4    1 
ATOM   1504 P P     . DT  C 2 14 ? 37.642 -2.972  25.332  1.00 77.73  ? 14  DT  C P     1 
ATOM   1505 O OP1   . DT  C 2 14 ? 36.900 -4.153  24.752  1.00 67.90  ? 14  DT  C OP1   1 
ATOM   1506 O OP2   . DT  C 2 14 ? 37.484 -1.644  24.683  1.00 69.21  ? 14  DT  C OP2   1 
ATOM   1507 O "O5'" . DT  C 2 14 ? 37.345 -2.672  26.880  1.00 71.00  ? 14  DT  C "O5'" 1 
ATOM   1508 C "C5'" . DT  C 2 14 ? 37.444 -3.661  27.946  1.00 58.97  ? 14  DT  C "C5'" 1 
ATOM   1509 C "C4'" . DT  C 2 14 ? 36.696 -3.242  29.205  1.00 58.77  ? 14  DT  C "C4'" 1 
ATOM   1510 O "O4'" . DT  C 2 14 ? 37.332 -2.126  29.887  1.00 49.88  ? 14  DT  C "O4'" 1 
ATOM   1511 C "C3'" . DT  C 2 14 ? 35.208 -2.890  29.056  1.00 50.94  ? 14  DT  C "C3'" 1 
ATOM   1512 O "O3'" . DT  C 2 14 ? 34.393 -3.681  29.932  1.00 49.17  ? 14  DT  C "O3'" 1 
ATOM   1513 C "C2'" . DT  C 2 14 ? 35.119 -1.424  29.446  1.00 52.80  ? 14  DT  C "C2'" 1 
ATOM   1514 C "C1'" . DT  C 2 14 ? 36.381 -1.131  30.235  1.00 52.82  ? 14  DT  C "C1'" 1 
ATOM   1515 N N1    . DT  C 2 14 ? 36.968 0.182   29.915  1.00 54.96  ? 14  DT  C N1    1 
ATOM   1516 C C2    . DT  C 2 14 ? 37.206 1.080   30.934  1.00 64.24  ? 14  DT  C C2    1 
ATOM   1517 O O2    . DT  C 2 14 ? 36.958 0.845   32.105  1.00 76.37  ? 14  DT  C O2    1 
ATOM   1518 N N3    . DT  C 2 14 ? 37.774 2.262   30.534  1.00 63.43  ? 14  DT  C N3    1 
ATOM   1519 C C4    . DT  C 2 14 ? 38.107 2.633   29.248  1.00 68.67  ? 14  DT  C C4    1 
ATOM   1520 O O4    . DT  C 2 14 ? 38.619 3.729   29.046  1.00 67.23  ? 14  DT  C O4    1 
ATOM   1521 C C5    . DT  C 2 14 ? 37.804 1.652   28.224  1.00 69.13  ? 14  DT  C C5    1 
ATOM   1522 C C7    . DT  C 2 14 ? 38.122 1.965   26.797  1.00 72.58  ? 14  DT  C C7    1 
ATOM   1523 C C6    . DT  C 2 14 ? 37.250 0.496   28.605  1.00 57.86  ? 14  DT  C C6    1 
ATOM   1524 P P     . DC  C 2 15 ? 32.748 -3.688  29.810  1.00 51.33  ? 15  DC  C P     1 
ATOM   1525 O OP1   . DC  C 2 15 ? 32.261 -4.875  30.543  1.00 59.33  ? 15  DC  C OP1   1 
ATOM   1526 O OP2   . DC  C 2 15 ? 32.336 -3.557  28.384  1.00 48.82  ? 15  DC  C OP2   1 
ATOM   1527 O "O5'" . DC  C 2 15 ? 32.345 -2.379  30.620  1.00 47.88  ? 15  DC  C "O5'" 1 
ATOM   1528 C "C5'" . DC  C 2 15 ? 32.916 -2.178  31.922  1.00 58.07  ? 15  DC  C "C5'" 1 
ATOM   1529 C "C4'" . DC  C 2 15 ? 32.648 -0.778  32.423  1.00 66.27  ? 15  DC  C "C4'" 1 
ATOM   1530 O "O4'" . DC  C 2 15 ? 33.579 0.155   31.854  1.00 65.17  ? 15  DC  C "O4'" 1 
ATOM   1531 C "C3'" . DC  C 2 15 ? 31.263 -0.172  32.154  1.00 66.78  ? 15  DC  C "C3'" 1 
ATOM   1532 O "O3'" . DC  C 2 15 ? 30.498 -0.210  33.366  1.00 76.24  ? 15  DC  C "O3'" 1 
ATOM   1533 C "C2'" . DC  C 2 15 ? 31.570 1.272   31.784  1.00 63.35  ? 15  DC  C "C2'" 1 
ATOM   1534 C "C1'" . DC  C 2 15 ? 33.025 1.407   32.164  1.00 66.21  ? 15  DC  C "C1'" 1 
ATOM   1535 N N1    . DC  C 2 15 ? 33.783 2.435   31.449  1.00 70.46  ? 15  DC  C N1    1 
ATOM   1536 C C2    . DC  C 2 15 ? 33.975 3.682   32.061  1.00 67.61  ? 15  DC  C C2    1 
ATOM   1537 O O2    . DC  C 2 15 ? 33.470 3.891   33.178  1.00 57.70  ? 15  DC  C O2    1 
ATOM   1538 N N3    . DC  C 2 15 ? 34.687 4.632   31.411  1.00 74.34  ? 15  DC  C N3    1 
ATOM   1539 C C4    . DC  C 2 15 ? 35.198 4.376   30.204  1.00 79.51  ? 15  DC  C C4    1 
ATOM   1540 N N4    . DC  C 2 15 ? 35.878 5.350   29.593  1.00 75.99  ? 15  DC  C N4    1 
ATOM   1541 C C5    . DC  C 2 15 ? 35.022 3.113   29.563  1.00 79.73  ? 15  DC  C C5    1 
ATOM   1542 C C6    . DC  C 2 15 ? 34.319 2.180   30.218  1.00 78.22  ? 15  DC  C C6    1 
ATOM   1543 P P     . DG  C 2 16 ? 28.972 0.335   33.448  1.00 83.84  ? 16  DG  C P     1 
ATOM   1544 O OP1   . DG  C 2 16 ? 28.354 -0.247  34.678  1.00 89.04  ? 16  DG  C OP1   1 
ATOM   1545 O OP2   . DG  C 2 16 ? 28.313 0.154   32.130  1.00 72.46  ? 16  DG  C OP2   1 
ATOM   1546 O "O5'" . DG  C 2 16 ? 29.155 1.878   33.780  1.00 78.29  ? 16  DG  C "O5'" 1 
ATOM   1547 C "C5'" . DG  C 2 16 ? 29.336 2.292   35.146  1.00 80.96  ? 16  DG  C "C5'" 1 
ATOM   1548 C "C4'" . DG  C 2 16 ? 29.028 3.764   35.244  1.00 91.38  ? 16  DG  C "C4'" 1 
ATOM   1549 O "O4'" . DG  C 2 16 ? 30.028 4.498   34.497  1.00 94.53  ? 16  DG  C "O4'" 1 
ATOM   1550 C "C3'" . DG  C 2 16 ? 27.676 4.148   34.635  1.00 103.05 ? 16  DG  C "C3'" 1 
ATOM   1551 O "O3'" . DG  C 2 16 ? 27.046 5.078   35.535  1.00 111.32 ? 16  DG  C "O3'" 1 
ATOM   1552 C "C2'" . DG  C 2 16 ? 28.044 4.651   33.247  1.00 88.39  ? 16  DG  C "C2'" 1 
ATOM   1553 C "C1'" . DG  C 2 16 ? 29.392 5.300   33.511  1.00 89.20  ? 16  DG  C "C1'" 1 
ATOM   1554 N N9    . DG  C 2 16 ? 30.282 5.394   32.359  1.00 78.50  ? 16  DG  C N9    1 
ATOM   1555 C C8    . DG  C 2 16 ? 30.321 4.565   31.262  1.00 78.72  ? 16  DG  C C8    1 
ATOM   1556 N N7    . DG  C 2 16 ? 31.211 4.928   30.378  1.00 71.18  ? 16  DG  C N7    1 
ATOM   1557 C C5    . DG  C 2 16 ? 31.782 6.074   30.916  1.00 66.57  ? 16  DG  C C5    1 
ATOM   1558 C C6    . DG  C 2 16 ? 32.810 6.916   30.411  1.00 63.68  ? 16  DG  C C6    1 
ATOM   1559 O O6    . DG  C 2 16 ? 33.457 6.802   29.368  1.00 76.39  ? 16  DG  C O6    1 
ATOM   1560 N N1    . DG  C 2 16 ? 33.090 7.960   31.283  1.00 60.99  ? 16  DG  C N1    1 
ATOM   1561 C C2    . DG  C 2 16 ? 32.457 8.178   32.480  1.00 66.08  ? 16  DG  C C2    1 
ATOM   1562 N N2    . DG  C 2 16 ? 32.864 9.247   33.174  1.00 78.94  ? 16  DG  C N2    1 
ATOM   1563 N N3    . DG  C 2 16 ? 31.497 7.405   32.962  1.00 63.54  ? 16  DG  C N3    1 
ATOM   1564 C C4    . DG  C 2 16 ? 31.221 6.373   32.139  1.00 68.78  ? 16  DG  C C4    1 
ATOM   1565 P P     . DA  C 2 17 ? 26.123 6.272   35.002  1.00 105.38 ? 17  DA  C P     1 
ATOM   1566 O OP1   . DA  C 2 17 ? 25.351 6.790   36.148  1.00 100.96 ? 17  DA  C OP1   1 
ATOM   1567 O OP2   . DA  C 2 17 ? 25.405 5.805   33.781  1.00 106.89 ? 17  DA  C OP2   1 
ATOM   1568 O "O5'" . DA  C 2 17 ? 27.173 7.429   34.687  1.00 107.30 ? 17  DA  C "O5'" 1 
ATOM   1569 C "C5'" . DA  C 2 17 ? 27.752 8.214   35.749  1.00 94.26  ? 17  DA  C "C5'" 1 
ATOM   1570 C "C4'" . DA  C 2 17 ? 28.048 9.611   35.254  1.00 89.20  ? 17  DA  C "C4'" 1 
ATOM   1571 O "O4'" . DA  C 2 17 ? 28.961 9.545   34.134  1.00 90.32  ? 17  DA  C "O4'" 1 
ATOM   1572 C "C3'" . DA  C 2 17 ? 26.827 10.402  34.775  1.00 90.43  ? 17  DA  C "C3'" 1 
ATOM   1573 O "O3'" . DA  C 2 17 ? 26.854 11.701  35.385  1.00 107.44 ? 17  DA  C "O3'" 1 
ATOM   1574 C "C2'" . DA  C 2 17 ? 26.978 10.438  33.263  1.00 80.12  ? 17  DA  C "C2'" 1 
ATOM   1575 C "C1'" . DA  C 2 17 ? 28.483 10.347  33.065  1.00 85.39  ? 17  DA  C "C1'" 1 
ATOM   1576 N N9    . DA  C 2 17 ? 28.896 9.719   31.802  1.00 73.25  ? 17  DA  C N9    1 
ATOM   1577 C C8    . DA  C 2 17 ? 28.289 8.656   31.178  1.00 68.16  ? 17  DA  C C8    1 
ATOM   1578 N N7    . DA  C 2 17 ? 28.848 8.319   30.042  1.00 64.30  ? 17  DA  C N7    1 
ATOM   1579 C C5    . DA  C 2 17 ? 29.904 9.211   29.912  1.00 63.18  ? 17  DA  C C5    1 
ATOM   1580 C C6    . DA  C 2 17 ? 30.897 9.365   28.924  1.00 65.26  ? 17  DA  C C6    1 
ATOM   1581 N N6    . DA  C 2 17 ? 30.988 8.590   27.838  1.00 64.42  ? 17  DA  C N6    1 
ATOM   1582 N N1    . DA  C 2 17 ? 31.804 10.355  29.091  1.00 59.77  ? 17  DA  C N1    1 
ATOM   1583 C C2    . DA  C 2 17 ? 31.714 11.124  30.186  1.00 65.88  ? 17  DA  C C2    1 
ATOM   1584 N N3    . DA  C 2 17 ? 30.824 11.080  31.181  1.00 60.94  ? 17  DA  C N3    1 
ATOM   1585 C C4    . DA  C 2 17 ? 29.940 10.086  30.984  1.00 62.58  ? 17  DA  C C4    1 
ATOM   1586 P P     . DC  C 2 18 ? 25.741 12.818  35.029  1.00 108.38 ? 18  DC  C P     1 
ATOM   1587 O OP1   . DC  C 2 18 ? 25.658 13.777  36.167  1.00 94.05  ? 18  DC  C OP1   1 
ATOM   1588 O OP2   . DC  C 2 18 ? 24.510 12.130  34.544  1.00 92.95  ? 18  DC  C OP2   1 
ATOM   1589 O "O5'" . DC  C 2 18 ? 26.465 13.651  33.887  1.00 104.63 ? 18  DC  C "O5'" 1 
ATOM   1590 C "C5'" . DC  C 2 18 ? 27.621 14.439  34.224  1.00 101.98 ? 18  DC  C "C5'" 1 
ATOM   1591 C "C4'" . DC  C 2 18 ? 28.120 15.128  32.980  1.00 101.07 ? 18  DC  C "C4'" 1 
ATOM   1592 O "O4'" . DC  C 2 18 ? 28.464 14.119  31.998  1.00 101.96 ? 18  DC  C "O4'" 1 
ATOM   1593 C "C3'" . DC  C 2 18 ? 27.082 16.037  32.309  1.00 97.36  ? 18  DC  C "C3'" 1 
ATOM   1594 O "O3'" . DC  C 2 18 ? 27.733 17.219  31.828  1.00 108.19 ? 18  DC  C "O3'" 1 
ATOM   1595 C "C2'" . DC  C 2 18 ? 26.623 15.224  31.114  1.00 84.02  ? 18  DC  C "C2'" 1 
ATOM   1596 C "C1'" . DC  C 2 18 ? 27.919 14.522  30.759  1.00 91.53  ? 18  DC  C "C1'" 1 
ATOM   1597 N N1    . DC  C 2 18 ? 27.770 13.339  29.897  1.00 89.01  ? 18  DC  C N1    1 
ATOM   1598 C C2    . DC  C 2 18 ? 28.710 13.116  28.879  1.00 89.22  ? 18  DC  C C2    1 
ATOM   1599 O O2    . DC  C 2 18 ? 29.690 13.875  28.785  1.00 96.98  ? 18  DC  C O2    1 
ATOM   1600 N N3    . DC  C 2 18 ? 28.537 12.069  28.039  1.00 76.69  ? 18  DC  C N3    1 
ATOM   1601 C C4    . DC  C 2 18 ? 27.474 11.272  28.177  1.00 83.83  ? 18  DC  C C4    1 
ATOM   1602 N N4    . DC  C 2 18 ? 27.346 10.251  27.330  1.00 85.16  ? 18  DC  C N4    1 
ATOM   1603 C C5    . DC  C 2 18 ? 26.495 11.487  29.193  1.00 89.98  ? 18  DC  C C5    1 
ATOM   1604 C C6    . DC  C 2 18 ? 26.675 12.528  30.016  1.00 90.39  ? 18  DC  C C6    1 
ATOM   1605 P P     . DA  C 2 19 ? 26.953 18.617  31.766  1.00 101.01 ? 19  DA  C P     1 
ATOM   1606 O OP1   . DA  C 2 19 ? 27.653 19.560  32.671  1.00 107.56 ? 19  DA  C OP1   1 
ATOM   1607 O OP2   . DA  C 2 19 ? 25.503 18.348  31.966  1.00 93.68  ? 19  DA  C OP2   1 
ATOM   1608 O "O5'" . DA  C 2 19 ? 27.213 19.108  30.270  1.00 91.50  ? 19  DA  C "O5'" 1 
ATOM   1609 C "C5'" . DA  C 2 19 ? 27.870 20.361  30.018  1.00 92.15  ? 19  DA  C "C5'" 1 
ATOM   1610 C "C4'" . DA  C 2 19 ? 29.084 20.139  29.146  1.00 95.70  ? 19  DA  C "C4'" 1 
ATOM   1611 O "O4'" . DA  C 2 19 ? 29.148 18.745  28.753  1.00 98.12  ? 19  DA  C "O4'" 1 
ATOM   1612 C "C3'" . DA  C 2 19 ? 29.072 20.936  27.844  1.00 103.45 ? 19  DA  C "C3'" 1 
ATOM   1613 O "O3'" . DA  C 2 19 ? 30.409 21.340  27.524  1.00 95.38  ? 19  DA  C "O3'" 1 
ATOM   1614 C "C2'" . DA  C 2 19 ? 28.528 19.937  26.836  1.00 105.16 ? 19  DA  C "C2'" 1 
ATOM   1615 C "C1'" . DA  C 2 19 ? 29.133 18.635  27.335  1.00 90.46  ? 19  DA  C "C1'" 1 
ATOM   1616 N N9    . DA  C 2 19 ? 28.395 17.419  26.990  1.00 72.46  ? 19  DA  C N9    1 
ATOM   1617 C C8    . DA  C 2 19 ? 27.252 16.950  27.585  1.00 64.60  ? 19  DA  C C8    1 
ATOM   1618 N N7    . DA  C 2 19 ? 26.821 15.817  27.085  1.00 64.19  ? 19  DA  C N7    1 
ATOM   1619 C C5    . DA  C 2 19 ? 27.745 15.518  26.093  1.00 66.22  ? 19  DA  C C5    1 
ATOM   1620 C C6    . DA  C 2 19 ? 27.853 14.439  25.194  1.00 65.03  ? 19  DA  C C6    1 
ATOM   1621 N N6    . DA  C 2 19 ? 26.993 13.419  25.157  1.00 64.26  ? 19  DA  C N6    1 
ATOM   1622 N N1    . DA  C 2 19 ? 28.880 14.453  24.316  1.00 67.03  ? 19  DA  C N1    1 
ATOM   1623 C C2    . DA  C 2 19 ? 29.756 15.467  24.372  1.00 76.34  ? 19  DA  C C2    1 
ATOM   1624 N N3    . DA  C 2 19 ? 29.772 16.527  25.183  1.00 76.92  ? 19  DA  C N3    1 
ATOM   1625 C C4    . DA  C 2 19 ? 28.723 16.495  26.026  1.00 69.52  ? 19  DA  C C4    1 
ATOM   1626 O "O5'" . DT  D 3 1  ? 23.473 9.791   14.793  1.00 116.43 ? 1   DT  D "O5'" 1 
ATOM   1627 C "C5'" . DT  D 3 1  ? 24.224 9.726   16.027  1.00 105.17 ? 1   DT  D "C5'" 1 
ATOM   1628 C "C4'" . DT  D 3 1  ? 25.591 10.345  15.849  1.00 86.15  ? 1   DT  D "C4'" 1 
ATOM   1629 O "O4'" . DT  D 3 1  ? 25.700 11.516  16.692  1.00 84.18  ? 1   DT  D "O4'" 1 
ATOM   1630 C "C3'" . DT  D 3 1  ? 26.770 9.448   16.226  1.00 83.74  ? 1   DT  D "C3'" 1 
ATOM   1631 O "O3'" . DT  D 3 1  ? 27.872 9.687   15.340  1.00 90.70  ? 1   DT  D "O3'" 1 
ATOM   1632 C "C2'" . DT  D 3 1  ? 27.102 9.890   17.641  1.00 82.46  ? 1   DT  D "C2'" 1 
ATOM   1633 C "C1'" . DT  D 3 1  ? 26.747 11.365  17.638  1.00 66.20  ? 1   DT  D "C1'" 1 
ATOM   1634 N N1    . DT  D 3 1  ? 26.248 11.850  18.932  1.00 56.28  ? 1   DT  D N1    1 
ATOM   1635 C C2    . DT  D 3 1  ? 26.752 13.031  19.417  1.00 51.01  ? 1   DT  D C2    1 
ATOM   1636 O O2    . DT  D 3 1  ? 27.609 13.672  18.838  1.00 52.19  ? 1   DT  D O2    1 
ATOM   1637 N N3    . DT  D 3 1  ? 26.236 13.421  20.627  1.00 49.43  ? 1   DT  D N3    1 
ATOM   1638 C C4    . DT  D 3 1  ? 25.275 12.769  21.374  1.00 58.54  ? 1   DT  D C4    1 
ATOM   1639 O O4    . DT  D 3 1  ? 24.901 13.247  22.443  1.00 55.97  ? 1   DT  D O4    1 
ATOM   1640 C C5    . DT  D 3 1  ? 24.755 11.557  20.784  1.00 66.30  ? 1   DT  D C5    1 
ATOM   1641 C C7    . DT  D 3 1  ? 23.697 10.790  21.515  1.00 68.09  ? 1   DT  D C7    1 
ATOM   1642 C C6    . DT  D 3 1  ? 25.263 11.162  19.607  1.00 63.88  ? 1   DT  D C6    1 
ATOM   1643 P P     . DT  D 3 2  ? 29.111 8.639   15.223  1.00 98.97  ? 2   DT  D P     1 
ATOM   1644 O OP1   . DT  D 3 2  ? 29.523 8.557   13.796  1.00 97.62  ? 2   DT  D OP1   1 
ATOM   1645 O OP2   . DT  D 3 2  ? 28.764 7.394   15.956  1.00 110.58 ? 2   DT  D OP2   1 
ATOM   1646 O "O5'" . DT  D 3 2  ? 30.267 9.337   16.068  1.00 78.54  ? 2   DT  D "O5'" 1 
ATOM   1647 C "C5'" . DT  D 3 2  ? 30.709 10.656  15.767  1.00 62.59  ? 2   DT  D "C5'" 1 
ATOM   1648 C "C4'" . DT  D 3 2  ? 31.070 11.379  17.045  1.00 70.63  ? 2   DT  D "C4'" 1 
ATOM   1649 O "O4'" . DT  D 3 2  ? 30.070 11.225  18.078  1.00 69.32  ? 2   DT  D "O4'" 1 
ATOM   1650 C "C3'" . DT  D 3 2  ? 32.395 10.985  17.719  1.00 67.19  ? 2   DT  D "C3'" 1 
ATOM   1651 O "O3'" . DT  D 3 2  ? 33.467 11.875  17.395  1.00 64.33  ? 2   DT  D "O3'" 1 
ATOM   1652 C "C2'" . DT  D 3 2  ? 32.096 11.100  19.212  1.00 64.89  ? 2   DT  D "C2'" 1 
ATOM   1653 C "C1'" . DT  D 3 2  ? 30.727 11.748  19.219  1.00 65.46  ? 2   DT  D "C1'" 1 
ATOM   1654 N N1    . DT  D 3 2  ? 29.891 11.527  20.407  1.00 62.95  ? 2   DT  D N1    1 
ATOM   1655 C C2    . DT  D 3 2  ? 30.057 12.422  21.439  1.00 63.75  ? 2   DT  D C2    1 
ATOM   1656 O O2    . DT  D 3 2  ? 30.870 13.330  21.404  1.00 60.39  ? 2   DT  D O2    1 
ATOM   1657 N N3    . DT  D 3 2  ? 29.250 12.200  22.528  1.00 67.32  ? 2   DT  D N3    1 
ATOM   1658 C C4    . DT  D 3 2  ? 28.314 11.194  22.684  1.00 74.68  ? 2   DT  D C4    1 
ATOM   1659 O O4    . DT  D 3 2  ? 27.666 11.114  23.728  1.00 67.41  ? 2   DT  D O4    1 
ATOM   1660 C C5    . DT  D 3 2  ? 28.177 10.299  21.550  1.00 80.20  ? 2   DT  D C5    1 
ATOM   1661 C C7    . DT  D 3 2  ? 27.179 9.184   21.621  1.00 77.28  ? 2   DT  D C7    1 
ATOM   1662 C C6    . DT  D 3 2  ? 28.971 10.502  20.487  1.00 68.91  ? 2   DT  D C6    1 
ATOM   1663 P P     . DG  D 3 3  ? 34.990 11.469  17.747  1.00 76.62  ? 3   DG  D P     1 
ATOM   1664 O OP1   . DG  D 3 3  ? 35.880 11.949  16.657  1.00 78.35  ? 3   DG  D OP1   1 
ATOM   1665 O OP2   . DG  D 3 3  ? 35.003 10.038  18.174  1.00 77.82  ? 3   DG  D OP2   1 
ATOM   1666 O "O5'" . DG  D 3 3  ? 35.355 12.296  19.059  1.00 72.28  ? 3   DG  D "O5'" 1 
ATOM   1667 C "C5'" . DG  D 3 3  ? 35.721 13.673  19.029  1.00 63.39  ? 3   DG  D "C5'" 1 
ATOM   1668 C "C4'" . DG  D 3 3  ? 35.753 14.166  20.455  1.00 79.08  ? 3   DG  D "C4'" 1 
ATOM   1669 O "O4'" . DG  D 3 3  ? 34.570 13.729  21.166  1.00 72.83  ? 3   DG  D "O4'" 1 
ATOM   1670 C "C3'" . DG  D 3 3  ? 36.947 13.674  21.278  1.00 88.53  ? 3   DG  D "C3'" 1 
ATOM   1671 O "O3'" . DG  D 3 3  ? 37.691 14.830  21.698  1.00 99.43  ? 3   DG  D "O3'" 1 
ATOM   1672 C "C2'" . DG  D 3 3  ? 36.323 12.866  22.413  1.00 82.12  ? 3   DG  D "C2'" 1 
ATOM   1673 C "C1'" . DG  D 3 3  ? 34.922 13.427  22.505  1.00 70.32  ? 3   DG  D "C1'" 1 
ATOM   1674 N N9    . DG  D 3 3  ? 33.899 12.528  23.037  1.00 71.24  ? 3   DG  D N9    1 
ATOM   1675 C C8    . DG  D 3 3  ? 33.523 11.311  22.520  1.00 67.88  ? 3   DG  D C8    1 
ATOM   1676 N N7    . DG  D 3 3  ? 32.540 10.756  23.177  1.00 58.14  ? 3   DG  D N7    1 
ATOM   1677 C C5    . DG  D 3 3  ? 32.231 11.671  24.172  1.00 54.06  ? 3   DG  D C5    1 
ATOM   1678 C C6    . DG  D 3 3  ? 31.259 11.613  25.192  1.00 59.99  ? 3   DG  D C6    1 
ATOM   1679 O O6    . DG  D 3 3  ? 30.430 10.725  25.411  1.00 74.72  ? 3   DG  D O6    1 
ATOM   1680 N N1    . DG  D 3 3  ? 31.292 12.749  25.999  1.00 61.34  ? 3   DG  D N1    1 
ATOM   1681 C C2    . DG  D 3 3  ? 32.137 13.815  25.828  1.00 55.27  ? 3   DG  D C2    1 
ATOM   1682 N N2    . DG  D 3 3  ? 32.007 14.818  26.706  1.00 51.22  ? 3   DG  D N2    1 
ATOM   1683 N N3    . DG  D 3 3  ? 33.068 13.873  24.889  1.00 57.29  ? 3   DG  D N3    1 
ATOM   1684 C C4    . DG  D 3 3  ? 33.052 12.777  24.095  1.00 63.14  ? 3   DG  D C4    1 
ATOM   1685 P P     . DT  D 3 4  ? 39.024 14.670  22.557  1.00 91.37  ? 4   DT  D P     1 
ATOM   1686 O OP1   . DT  D 3 4  ? 39.897 15.844  22.284  1.00 85.77  ? 4   DT  D OP1   1 
ATOM   1687 O OP2   . DT  D 3 4  ? 39.549 13.308  22.316  1.00 105.38 ? 4   DT  D OP2   1 
ATOM   1688 O "O5'" . DT  D 3 4  ? 38.475 14.706  24.050  1.00 86.75  ? 4   DT  D "O5'" 1 
ATOM   1689 C "C5'" . DT  D 3 4  ? 37.619 15.767  24.494  1.00 89.04  ? 4   DT  D "C5'" 1 
ATOM   1690 C "C4'" . DT  D 3 4  ? 37.350 15.600  25.971  1.00 101.59 ? 4   DT  D "C4'" 1 
ATOM   1691 O "O4'" . DT  D 3 4  ? 36.249 14.674  26.155  1.00 105.61 ? 4   DT  D "O4'" 1 
ATOM   1692 C "C3'" . DT  D 3 4  ? 38.522 15.031  26.780  1.00 97.44  ? 4   DT  D "C3'" 1 
ATOM   1693 O "O3'" . DT  D 3 4  ? 38.645 15.737  28.027  1.00 107.48 ? 4   DT  D "O3'" 1 
ATOM   1694 C "C2'" . DT  D 3 4  ? 38.118 13.584  27.001  1.00 94.31  ? 4   DT  D "C2'" 1 
ATOM   1695 C "C1'" . DT  D 3 4  ? 36.618 13.728  27.142  1.00 91.35  ? 4   DT  D "C1'" 1 
ATOM   1696 N N1    . DT  D 3 4  ? 35.828 12.500  26.921  1.00 80.97  ? 4   DT  D N1    1 
ATOM   1697 C C2    . DT  D 3 4  ? 34.684 12.327  27.670  1.00 79.09  ? 4   DT  D C2    1 
ATOM   1698 O O2    . DT  D 3 4  ? 34.291 13.146  28.486  1.00 73.52  ? 4   DT  D O2    1 
ATOM   1699 N N3    . DT  D 3 4  ? 34.013 11.151  27.428  1.00 79.61  ? 4   DT  D N3    1 
ATOM   1700 C C4    . DT  D 3 4  ? 34.371 10.152  26.540  1.00 77.95  ? 4   DT  D C4    1 
ATOM   1701 O O4    . DT  D 3 4  ? 33.663 9.152   26.426  1.00 73.10  ? 4   DT  D O4    1 
ATOM   1702 C C5    . DT  D 3 4  ? 35.588 10.398  25.792  1.00 77.14  ? 4   DT  D C5    1 
ATOM   1703 C C7    . DT  D 3 4  ? 36.047 9.382   24.794  1.00 77.91  ? 4   DT  D C7    1 
ATOM   1704 C C6    . DT  D 3 4  ? 36.246 11.542  26.021  1.00 75.77  ? 4   DT  D C6    1 
ATOM   1705 P P     . DC  D 3 5  ? 39.945 15.534  28.971  1.00 113.98 ? 5   DC  D P     1 
ATOM   1706 O OP1   . DC  D 3 5  ? 41.063 16.324  28.389  1.00 100.20 ? 5   DC  D OP1   1 
ATOM   1707 O OP2   . DC  D 3 5  ? 40.116 14.074  29.218  1.00 114.38 ? 5   DC  D OP2   1 
ATOM   1708 O "O5'" . DC  D 3 5  ? 39.508 16.171  30.368  1.00 95.44  ? 5   DC  D "O5'" 1 
ATOM   1709 C "C5'" . DC  D 3 5  ? 38.127 16.172  30.786  1.00 110.77 ? 5   DC  D "C5'" 1 
ATOM   1710 C "C4'" . DC  D 3 5  ? 37.861 15.180  31.900  1.00 116.77 ? 5   DC  D "C4'" 1 
ATOM   1711 O "O4'" . DC  D 3 5  ? 37.074 14.060  31.426  1.00 115.07 ? 5   DC  D "O4'" 1 
ATOM   1712 C "C3'" . DC  D 3 5  ? 39.081 14.585  32.612  1.00 113.36 ? 5   DC  D "C3'" 1 
ATOM   1713 O "O3'" . DC  D 3 5  ? 38.926 14.896  34.005  1.00 110.87 ? 5   DC  D "O3'" 1 
ATOM   1714 C "C2'" . DC  D 3 5  ? 39.012 13.096  32.292  1.00 108.78 ? 5   DC  D "C2'" 1 
ATOM   1715 C "C1'" . DC  D 3 5  ? 37.528 12.874  32.050  1.00 97.17  ? 5   DC  D "C1'" 1 
ATOM   1716 N N1    . DC  D 3 5  ? 37.163 11.736  31.182  1.00 72.59  ? 5   DC  D N1    1 
ATOM   1717 C C2    . DC  D 3 5  ? 35.998 11.015  31.478  1.00 67.12  ? 5   DC  D C2    1 
ATOM   1718 O O2    . DC  D 3 5  ? 35.323 11.345  32.461  1.00 71.17  ? 5   DC  D O2    1 
ATOM   1719 N N3    . DC  D 3 5  ? 35.640 9.977   30.689  1.00 68.64  ? 5   DC  D N3    1 
ATOM   1720 C C4    . DC  D 3 5  ? 36.392 9.652   29.634  1.00 75.96  ? 5   DC  D C4    1 
ATOM   1721 N N4    . DC  D 3 5  ? 35.997 8.614   28.883  1.00 64.65  ? 5   DC  D N4    1 
ATOM   1722 C C5    . DC  D 3 5  ? 37.587 10.368  29.309  1.00 75.23  ? 5   DC  D C5    1 
ATOM   1723 C C6    . DC  D 3 5  ? 37.928 11.397  30.100  1.00 67.87  ? 5   DC  D C6    1 
ATOM   1724 P P     . DG  D 3 6  ? 39.967 14.352  35.091  1.00 103.35 ? 6   DG  D P     1 
ATOM   1725 O OP1   . DG  D 3 6  ? 39.954 15.275  36.256  1.00 88.72  ? 6   DG  D OP1   1 
ATOM   1726 O OP2   . DG  D 3 6  ? 41.251 14.031  34.398  1.00 88.26  ? 6   DG  D OP2   1 
ATOM   1727 O "O5'" . DG  D 3 6  ? 39.286 12.991  35.542  1.00 104.84 ? 6   DG  D "O5'" 1 
ATOM   1728 C "C5'" . DG  D 3 6  ? 38.073 12.959  36.313  1.00 98.22  ? 6   DG  D "C5'" 1 
ATOM   1729 C "C4'" . DG  D 3 6  ? 37.944 11.575  36.900  1.00 95.41  ? 6   DG  D "C4'" 1 
ATOM   1730 O "O4'" . DG  D 3 6  ? 37.573 10.657  35.845  1.00 87.69  ? 6   DG  D "O4'" 1 
ATOM   1731 C "C3'" . DG  D 3 6  ? 39.265 11.035  37.455  1.00 107.05 ? 6   DG  D "C3'" 1 
ATOM   1732 O "O3'" . DG  D 3 6  ? 38.974 10.161  38.552  1.00 110.45 ? 6   DG  D "O3'" 1 
ATOM   1733 C "C2'" . DG  D 3 6  ? 39.838 10.259  36.280  1.00 92.04  ? 6   DG  D "C2'" 1 
ATOM   1734 C "C1'" . DG  D 3 6  ? 38.568 9.638   35.746  1.00 89.72  ? 6   DG  D "C1'" 1 
ATOM   1735 N N9    . DG  D 3 6  ? 38.590 9.137   34.372  1.00 83.66  ? 6   DG  D N9    1 
ATOM   1736 C C8    . DG  D 3 6  ? 39.535 9.353   33.395  1.00 78.15  ? 6   DG  D C8    1 
ATOM   1737 N N7    . DG  D 3 6  ? 39.258 8.744   32.273  1.00 67.54  ? 6   DG  D N7    1 
ATOM   1738 C C5    . DG  D 3 6  ? 38.064 8.081   32.528  1.00 63.82  ? 6   DG  D C5    1 
ATOM   1739 C C6    . DG  D 3 6  ? 37.280 7.242   31.693  1.00 68.00  ? 6   DG  D C6    1 
ATOM   1740 O O6    . DG  D 3 6  ? 37.488 6.906   30.523  1.00 77.57  ? 6   DG  D O6    1 
ATOM   1741 N N1    . DG  D 3 6  ? 36.143 6.784   32.351  1.00 73.23  ? 6   DG  D N1    1 
ATOM   1742 C C2    . DG  D 3 6  ? 35.810 7.075   33.651  1.00 70.94  ? 6   DG  D C2    1 
ATOM   1743 N N2    . DG  D 3 6  ? 34.663 6.537   34.107  1.00 67.71  ? 6   DG  D N2    1 
ATOM   1744 N N3    . DG  D 3 6  ? 36.545 7.833   34.446  1.00 66.05  ? 6   DG  D N3    1 
ATOM   1745 C C4    . DG  D 3 6  ? 37.649 8.298   33.824  1.00 67.70  ? 6   DG  D C4    1 
ATOM   1746 P P     . DA  D 3 7  ? 40.063 9.866   39.710  1.00 102.13 ? 7   DA  D P     1 
ATOM   1747 O OP1   . DA  D 3 7  ? 39.787 10.811  40.826  1.00 92.90  ? 7   DA  D OP1   1 
ATOM   1748 O OP2   . DA  D 3 7  ? 41.431 9.817   39.104  1.00 83.56  ? 7   DA  D OP2   1 
ATOM   1749 O "O5'" . DA  D 3 7  ? 39.640 8.400   40.173  1.00 97.68  ? 7   DA  D "O5'" 1 
ATOM   1750 C "C5'" . DA  D 3 7  ? 38.239 8.022   40.158  1.00 96.55  ? 7   DA  D "C5'" 1 
ATOM   1751 C "C4'" . DA  D 3 7  ? 38.060 6.616   39.631  1.00 95.97  ? 7   DA  D "C4'" 1 
ATOM   1752 O "O4'" . DA  D 3 7  ? 38.080 6.599   38.177  1.00 97.98  ? 7   DA  D "O4'" 1 
ATOM   1753 C "C3'" . DA  D 3 7  ? 39.133 5.617   40.088  1.00 92.19  ? 7   DA  D "C3'" 1 
ATOM   1754 O "O3'" . DA  D 3 7  ? 38.526 4.480   40.721  1.00 94.05  ? 7   DA  D "O3'" 1 
ATOM   1755 C "C2'" . DA  D 3 7  ? 39.837 5.231   38.798  1.00 84.16  ? 7   DA  D "C2'" 1 
ATOM   1756 C "C1'" . DA  D 3 7  ? 38.729 5.410   37.783  1.00 78.47  ? 7   DA  D "C1'" 1 
ATOM   1757 N N9    . DA  D 3 7  ? 39.172 5.545   36.394  1.00 66.91  ? 7   DA  D N9    1 
ATOM   1758 C C8    . DA  D 3 7  ? 40.240 6.245   35.892  1.00 62.12  ? 7   DA  D C8    1 
ATOM   1759 N N7    . DA  D 3 7  ? 40.422 6.083   34.603  1.00 61.21  ? 7   DA  D N7    1 
ATOM   1760 C C5    . DA  D 3 7  ? 39.408 5.212   34.231  1.00 66.80  ? 7   DA  D C5    1 
ATOM   1761 C C6    . DA  D 3 7  ? 39.032 4.666   32.985  1.00 69.77  ? 7   DA  D C6    1 
ATOM   1762 N N6    . DA  D 3 7  ? 39.668 4.920   31.837  1.00 62.71  ? 7   DA  D N6    1 
ATOM   1763 N N1    . DA  D 3 7  ? 37.957 3.846   32.958  1.00 65.38  ? 7   DA  D N1    1 
ATOM   1764 C C2    . DA  D 3 7  ? 37.312 3.597   34.106  1.00 61.83  ? 7   DA  D C2    1 
ATOM   1765 N N3    . DA  D 3 7  ? 37.570 4.045   35.334  1.00 63.65  ? 7   DA  D N3    1 
ATOM   1766 C C4    . DA  D 3 7  ? 38.637 4.863   35.326  1.00 68.02  ? 7   DA  D C4    1 
ATOM   1767 P P     . DC  D 3 8  ? 39.402 3.511   41.673  1.00 99.60  ? 8   DC  D P     1 
ATOM   1768 O OP1   . DC  D 3 8  ? 38.468 2.582   42.367  1.00 86.10  ? 8   DC  D OP1   1 
ATOM   1769 O OP2   . DC  D 3 8  ? 40.361 4.344   42.452  1.00 89.97  ? 8   DC  D OP2   1 
ATOM   1770 O "O5'" . DC  D 3 8  ? 40.307 2.705   40.642  1.00 94.21  ? 8   DC  D "O5'" 1 
ATOM   1771 C "C5'" . DC  D 3 8  ? 40.147 1.293   40.459  1.00 84.89  ? 8   DC  D "C5'" 1 
ATOM   1772 C "C4'" . DC  D 3 8  ? 39.081 1.001   39.431  1.00 85.05  ? 8   DC  D "C4'" 1 
ATOM   1773 O "O4'" . DC  D 3 8  ? 38.992 2.055   38.446  1.00 86.12  ? 8   DC  D "O4'" 1 
ATOM   1774 C "C3'" . DC  D 3 8  ? 39.353 -0.262  38.631  1.00 87.01  ? 8   DC  D "C3'" 1 
ATOM   1775 O "O3'" . DC  D 3 8  ? 38.830 -1.354  39.387  1.00 85.16  ? 8   DC  D "O3'" 1 
ATOM   1776 C "C2'" . DC  D 3 8  ? 38.619 -0.000  37.328  1.00 81.09  ? 8   DC  D "C2'" 1 
ATOM   1777 C "C1'" . DC  D 3 8  ? 38.792 1.506   37.141  1.00 80.45  ? 8   DC  D "C1'" 1 
ATOM   1778 N N1    . DC  D 3 8  ? 39.942 1.908   36.307  1.00 76.76  ? 8   DC  D N1    1 
ATOM   1779 C C2    . DC  D 3 8  ? 39.993 1.539   34.954  1.00 73.34  ? 8   DC  D C2    1 
ATOM   1780 O O2    . DC  D 3 8  ? 39.059 0.877   34.471  1.00 69.91  ? 8   DC  D O2    1 
ATOM   1781 N N3    . DC  D 3 8  ? 41.069 1.899   34.215  1.00 70.67  ? 8   DC  D N3    1 
ATOM   1782 C C4    . DC  D 3 8  ? 42.047 2.624   34.766  1.00 65.95  ? 8   DC  D C4    1 
ATOM   1783 N N4    . DC  D 3 8  ? 43.081 2.970   34.000  1.00 65.48  ? 8   DC  D N4    1 
ATOM   1784 C C5    . DC  D 3 8  ? 42.011 3.022   36.132  1.00 70.23  ? 8   DC  D C5    1 
ATOM   1785 C C6    . DC  D 3 8  ? 40.955 2.640   36.860  1.00 72.30  ? 8   DC  D C6    1 
ATOM   1786 P P     . DT  D 3 9  ? 39.654 -2.704  39.472  1.00 80.50  ? 9   DT  D P     1 
ATOM   1787 O OP1   . DT  D 3 9  ? 38.789 -3.740  40.110  1.00 73.11  ? 9   DT  D OP1   1 
ATOM   1788 O OP2   . DT  D 3 9  ? 41.012 -2.390  40.020  1.00 81.16  ? 9   DT  D OP2   1 
ATOM   1789 O "O5'" . DT  D 3 9  ? 39.744 -3.147  37.947  1.00 76.44  ? 9   DT  D "O5'" 1 
ATOM   1790 C "C5'" . DT  D 3 9  ? 38.622 -3.835  37.357  1.00 70.52  ? 9   DT  D "C5'" 1 
ATOM   1791 C "C4'" . DT  D 3 9  ? 39.050 -4.632  36.145  1.00 66.13  ? 9   DT  D "C4'" 1 
ATOM   1792 O "O4'" . DT  D 3 9  ? 39.670 -3.772  35.160  1.00 63.54  ? 9   DT  D "O4'" 1 
ATOM   1793 C "C3'" . DT  D 3 9  ? 40.041 -5.767  36.404  1.00 58.10  ? 9   DT  D "C3'" 1 
ATOM   1794 O "O3'" . DT  D 3 9  ? 39.532 -6.873  35.638  1.00 59.25  ? 9   DT  D "O3'" 1 
ATOM   1795 C "C2'" . DT  D 3 9  ? 41.371 -5.134  36.048  1.00 56.70  ? 9   DT  D "C2'" 1 
ATOM   1796 C "C1'" . DT  D 3 9  ? 40.987 -4.208  34.902  1.00 62.60  ? 9   DT  D "C1'" 1 
ATOM   1797 N N1    . DT  D 3 9  ? 41.831 -3.015  34.755  1.00 71.45  ? 9   DT  D N1    1 
ATOM   1798 C C2    . DT  D 3 9  ? 42.316 -2.729  33.500  1.00 83.79  ? 9   DT  D C2    1 
ATOM   1799 O O2    . DT  D 3 9  ? 42.067 -3.409  32.517  1.00 87.50  ? 9   DT  D O2    1 
ATOM   1800 N N3    . DT  D 3 9  ? 43.110 -1.609  33.438  1.00 83.50  ? 9   DT  D N3    1 
ATOM   1801 C C4    . DT  D 3 9  ? 43.452 -0.770  34.480  1.00 70.66  ? 9   DT  D C4    1 
ATOM   1802 O O4    . DT  D 3 9  ? 44.184 0.192   34.275  1.00 76.70  ? 9   DT  D O4    1 
ATOM   1803 C C5    . DT  D 3 9  ? 42.909 -1.132  35.765  1.00 65.84  ? 9   DT  D C5    1 
ATOM   1804 C C7    . DT  D 3 9  ? 43.254 -0.300  36.959  1.00 73.70  ? 9   DT  D C7    1 
ATOM   1805 C C6    . DT  D 3 9  ? 42.131 -2.217  35.837  1.00 68.60  ? 9   DT  D C6    1 
ATOM   1806 P P     . DA  D 3 10 ? 40.485 -7.947  34.932  1.00 66.25  ? 10  DA  D P     1 
ATOM   1807 O OP1   . DA  D 3 10 ? 39.636 -9.030  34.321  1.00 66.91  ? 10  DA  D OP1   1 
ATOM   1808 O OP2   . DA  D 3 10 ? 41.562 -8.294  35.879  1.00 66.80  ? 10  DA  D OP2   1 
ATOM   1809 O "O5'" . DA  D 3 10 ? 40.985 -7.171  33.645  1.00 59.65  ? 10  DA  D "O5'" 1 
ATOM   1810 C "C5'" . DA  D 3 10 ? 40.509 -7.580  32.362  1.00 58.01  ? 10  DA  D "C5'" 1 
ATOM   1811 C "C4'" . DA  D 3 10 ? 41.624 -7.328  31.388  1.00 55.81  ? 10  DA  D "C4'" 1 
ATOM   1812 O "O4'" . DA  D 3 10 ? 42.287 -6.144  31.862  1.00 65.76  ? 10  DA  D "O4'" 1 
ATOM   1813 C "C3'" . DA  D 3 10 ? 42.694 -8.419  31.342  1.00 51.08  ? 10  DA  D "C3'" 1 
ATOM   1814 O "O3'" . DA  D 3 10 ? 42.839 -8.771  29.974  1.00 53.40  ? 10  DA  D "O3'" 1 
ATOM   1815 C "C2'" . DA  D 3 10 ? 43.954 -7.739  31.853  1.00 51.69  ? 10  DA  D "C2'" 1 
ATOM   1816 C "C1'" . DA  D 3 10 ? 43.665 -6.276  31.629  1.00 62.17  ? 10  DA  D "C1'" 1 
ATOM   1817 N N9    . DA  D 3 10 ? 44.339 -5.356  32.532  1.00 71.42  ? 10  DA  D N9    1 
ATOM   1818 C C8    . DA  D 3 10 ? 44.190 -5.268  33.892  1.00 80.16  ? 10  DA  D C8    1 
ATOM   1819 N N7    . DA  D 3 10 ? 44.912 -4.323  34.444  1.00 84.75  ? 10  DA  D N7    1 
ATOM   1820 C C5    . DA  D 3 10 ? 45.564 -3.733  33.372  1.00 81.08  ? 10  DA  D C5    1 
ATOM   1821 C C6    . DA  D 3 10 ? 46.478 -2.668  33.291  1.00 82.14  ? 10  DA  D C6    1 
ATOM   1822 N N6    . DA  D 3 10 ? 46.910 -1.979  34.349  1.00 59.30  ? 10  DA  D N6    1 
ATOM   1823 N N1    . DA  D 3 10 ? 46.938 -2.327  32.066  1.00 99.27  ? 10  DA  D N1    1 
ATOM   1824 C C2    . DA  D 3 10 ? 46.506 -3.022  31.002  1.00 98.72  ? 10  DA  D C2    1 
ATOM   1825 N N3    . DA  D 3 10 ? 45.639 -4.035  30.950  1.00 88.44  ? 10  DA  D N3    1 
ATOM   1826 C C4    . DA  D 3 10 ? 45.201 -4.345  32.184  1.00 82.84  ? 10  DA  D C4    1 
ATOM   1827 P P     . DT  D 3 11 ? 43.533 -10.126 29.574  1.00 59.62  ? 11  DT  D P     1 
ATOM   1828 O OP1   . DT  D 3 11 ? 42.856 -10.704 28.369  1.00 51.59  ? 11  DT  D OP1   1 
ATOM   1829 O OP2   . DT  D 3 11 ? 43.667 -10.924 30.825  1.00 54.02  ? 11  DT  D OP2   1 
ATOM   1830 O "O5'" . DT  D 3 11 ? 44.898 -9.622  28.938  1.00 57.65  ? 11  DT  D "O5'" 1 
ATOM   1831 C "C5'" . DT  D 3 11 ? 44.885 -8.637  27.898  1.00 51.68  ? 11  DT  D "C5'" 1 
ATOM   1832 C "C4'" . DT  D 3 11 ? 46.146 -7.810  27.958  1.00 52.71  ? 11  DT  D "C4'" 1 
ATOM   1833 O "O4'" . DT  D 3 11 ? 46.311 -7.267  29.280  1.00 52.35  ? 11  DT  D "O4'" 1 
ATOM   1834 C "C3'" . DT  D 3 11 ? 47.458 -8.543  27.651  1.00 50.12  ? 11  DT  D "C3'" 1 
ATOM   1835 O "O3'" . DT  D 3 11 ? 48.050 -7.878  26.534  1.00 53.91  ? 11  DT  D "O3'" 1 
ATOM   1836 C "C2'" . DT  D 3 11 ? 48.298 -8.318  28.902  1.00 44.31  ? 11  DT  D "C2'" 1 
ATOM   1837 C "C1'" . DT  D 3 11 ? 47.686 -7.049  29.416  1.00 48.39  ? 11  DT  D "C1'" 1 
ATOM   1838 N N1    . DT  D 3 11 ? 47.935 -6.652  30.804  1.00 62.87  ? 11  DT  D N1    1 
ATOM   1839 C C2    . DT  D 3 11 ? 48.856 -5.651  31.033  1.00 71.38  ? 11  DT  D C2    1 
ATOM   1840 O O2    . DT  D 3 11 ? 49.511 -5.130  30.146  1.00 77.87  ? 11  DT  D O2    1 
ATOM   1841 N N3    . DT  D 3 11 ? 49.005 -5.302  32.351  1.00 70.32  ? 11  DT  D N3    1 
ATOM   1842 C C4    . DT  D 3 11 ? 48.306 -5.807  33.430  1.00 65.54  ? 11  DT  D C4    1 
ATOM   1843 O O4    . DT  D 3 11 ? 48.545 -5.388  34.556  1.00 74.29  ? 11  DT  D O4    1 
ATOM   1844 C C5    . DT  D 3 11 ? 47.336 -6.834  33.115  1.00 59.29  ? 11  DT  D C5    1 
ATOM   1845 C C7    . DT  D 3 11 ? 46.540 -7.448  34.223  1.00 60.53  ? 11  DT  D C7    1 
ATOM   1846 C C6    . DT  D 3 11 ? 47.195 -7.193  31.833  1.00 60.12  ? 11  DT  D C6    1 
ATOM   1847 P P     . DA  D 3 12 ? 48.497 -8.672  25.225  1.00 56.15  ? 12  DA  D P     1 
ATOM   1848 O OP1   . DA  D 3 12 ? 47.332 -8.789  24.349  1.00 55.93  ? 12  DA  D OP1   1 
ATOM   1849 O OP2   . DA  D 3 12 ? 49.255 -9.888  25.619  1.00 74.57  ? 12  DA  D OP2   1 
ATOM   1850 O "O5'" . DA  D 3 12 ? 49.618 -7.724  24.622  1.00 57.37  ? 12  DA  D "O5'" 1 
ATOM   1851 C "C5'" . DA  D 3 12 ? 49.269 -6.410  24.146  1.00 59.93  ? 12  DA  D "C5'" 1 
ATOM   1852 C "C4'" . DA  D 3 12 ? 50.271 -5.392  24.633  1.00 54.61  ? 12  DA  D "C4'" 1 
ATOM   1853 O "O4'" . DA  D 3 12 ? 50.404 -5.539  26.057  1.00 58.75  ? 12  DA  D "O4'" 1 
ATOM   1854 C "C3'" . DA  D 3 12 ? 51.694 -5.535  24.092  1.00 57.65  ? 12  DA  D "C3'" 1 
ATOM   1855 O "O3'" . DA  D 3 12 ? 52.252 -4.229  24.252  1.00 56.57  ? 12  DA  D "O3'" 1 
ATOM   1856 C "C2'" . DA  D 3 12 ? 52.355 -6.410  25.137  1.00 59.88  ? 12  DA  D "C2'" 1 
ATOM   1857 C "C1'" . DA  D 3 12 ? 51.769 -5.762  26.379  1.00 60.13  ? 12  DA  D "C1'" 1 
ATOM   1858 N N9    . DA  D 3 12 ? 51.812 -6.486  27.648  1.00 59.19  ? 12  DA  D N9    1 
ATOM   1859 C C8    . DA  D 3 12 ? 51.277 -7.713  27.961  1.00 60.31  ? 12  DA  D C8    1 
ATOM   1860 N N7    . DA  D 3 12 ? 51.398 -8.035  29.227  1.00 60.91  ? 12  DA  D N7    1 
ATOM   1861 C C5    . DA  D 3 12 ? 52.032 -6.936  29.790  1.00 67.52  ? 12  DA  D C5    1 
ATOM   1862 C C6    . DA  D 3 12 ? 52.463 -6.660  31.103  1.00 71.99  ? 12  DA  D C6    1 
ATOM   1863 N N6    . DA  D 3 12 ? 52.326 -7.512  32.117  1.00 69.89  ? 12  DA  D N6    1 
ATOM   1864 N N1    . DA  D 3 12 ? 53.076 -5.476  31.329  1.00 72.53  ? 12  DA  D N1    1 
ATOM   1865 C C2    . DA  D 3 12 ? 53.235 -4.632  30.298  1.00 79.96  ? 12  DA  D C2    1 
ATOM   1866 N N3    . DA  D 3 12 ? 52.855 -4.770  29.024  1.00 67.18  ? 12  DA  D N3    1 
ATOM   1867 C C4    . DA  D 3 12 ? 52.273 -5.966  28.831  1.00 62.44  ? 12  DA  D C4    1 
ATOM   1868 P P     . DG  D 3 13 ? 53.138 -3.587  23.107  1.00 62.42  ? 13  DG  D P     1 
ATOM   1869 O OP1   . DG  D 3 13 ? 52.933 -2.109  23.155  1.00 68.37  ? 13  DG  D OP1   1 
ATOM   1870 O OP2   . DG  D 3 13 ? 52.911 -4.331  21.838  1.00 59.33  ? 13  DG  D OP2   1 
ATOM   1871 O "O5'" . DG  D 3 13 ? 54.608 -3.786  23.658  1.00 55.62  ? 13  DG  D "O5'" 1 
ATOM   1872 C "C5'" . DG  D 3 13 ? 55.157 -2.686  24.370  1.00 66.64  ? 13  DG  D "C5'" 1 
ATOM   1873 C "C4'" . DG  D 3 13 ? 56.202 -3.154  25.345  1.00 61.76  ? 13  DG  D "C4'" 1 
ATOM   1874 O "O4'" . DG  D 3 13 ? 55.601 -3.990  26.362  1.00 64.12  ? 13  DG  D "O4'" 1 
ATOM   1875 C "C3'" . DG  D 3 13 ? 57.315 -3.975  24.688  1.00 59.10  ? 13  DG  D "C3'" 1 
ATOM   1876 O "O3'" . DG  D 3 13 ? 58.525 -3.216  24.888  1.00 61.97  ? 13  DG  D "O3'" 1 
ATOM   1877 C "C2'" . DG  D 3 13 ? 57.201 -5.330  25.363  1.00 64.64  ? 13  DG  D "C2'" 1 
ATOM   1878 C "C1'" . DG  D 3 13 ? 56.574 -4.943  26.690  1.00 68.77  ? 13  DG  D "C1'" 1 
ATOM   1879 N N9    . DG  D 3 13 ? 55.962 -6.006  27.485  1.00 66.00  ? 13  DG  D N9    1 
ATOM   1880 C C8    . DG  D 3 13 ? 55.301 -7.130  27.046  1.00 57.26  ? 13  DG  D C8    1 
ATOM   1881 N N7    . DG  D 3 13 ? 54.968 -7.939  28.015  1.00 57.32  ? 13  DG  D N7    1 
ATOM   1882 C C5    . DG  D 3 13 ? 55.461 -7.325  29.159  1.00 66.90  ? 13  DG  D C5    1 
ATOM   1883 C C6    . DG  D 3 13 ? 55.409 -7.730  30.523  1.00 68.86  ? 13  DG  D C6    1 
ATOM   1884 O O6    . DG  D 3 13 ? 54.895 -8.746  31.008  1.00 78.91  ? 13  DG  D O6    1 
ATOM   1885 N N1    . DG  D 3 13 ? 56.029 -6.804  31.355  1.00 61.27  ? 13  DG  D N1    1 
ATOM   1886 C C2    . DG  D 3 13 ? 56.616 -5.637  30.939  1.00 58.50  ? 13  DG  D C2    1 
ATOM   1887 N N2    . DG  D 3 13 ? 57.154 -4.873  31.897  1.00 53.64  ? 13  DG  D N2    1 
ATOM   1888 N N3    . DG  D 3 13 ? 56.684 -5.253  29.676  1.00 60.82  ? 13  DG  D N3    1 
ATOM   1889 C C4    . DG  D 3 13 ? 56.087 -6.137  28.846  1.00 67.07  ? 13  DG  D C4    1 
ATOM   1890 P P     . DT  D 3 14 ? 59.922 -3.920  25.265  1.00 59.95  ? 14  DT  D P     1 
ATOM   1891 O OP1   . DT  D 3 14 ? 61.036 -2.972  24.955  1.00 61.06  ? 14  DT  D OP1   1 
ATOM   1892 O OP2   . DT  D 3 14 ? 59.946 -5.269  24.626  1.00 64.04  ? 14  DT  D OP2   1 
ATOM   1893 O "O5'" . DT  D 3 14 ? 59.886 -3.925  26.852  1.00 47.48  ? 14  DT  D "O5'" 1 
ATOM   1894 C "C5'" . DT  D 3 14 ? 60.271 -2.739  27.546  1.00 50.45  ? 14  DT  D "C5'" 1 
ATOM   1895 C "C4'" . DT  D 3 14 ? 60.814 -3.075  28.914  1.00 58.97  ? 14  DT  D "C4'" 1 
ATOM   1896 O "O4'" . DT  D 3 14 ? 60.012 -4.083  29.574  1.00 70.41  ? 14  DT  D "O4'" 1 
ATOM   1897 C "C3'" . DT  D 3 14 ? 62.250 -3.588  28.930  1.00 62.72  ? 14  DT  D "C3'" 1 
ATOM   1898 O "O3'" . DT  D 3 14 ? 62.920 -2.778  29.891  1.00 66.96  ? 14  DT  D "O3'" 1 
ATOM   1899 C "C2'" . DT  D 3 14 ? 62.143 -5.034  29.402  1.00 65.87  ? 14  DT  D "C2'" 1 
ATOM   1900 C "C1'" . DT  D 3 14 ? 60.841 -5.070  30.173  1.00 61.56  ? 14  DT  D "C1'" 1 
ATOM   1901 N N1    . DT  D 3 14 ? 60.119 -6.349  30.109  1.00 58.58  ? 14  DT  D N1    1 
ATOM   1902 C C2    . DT  D 3 14 ? 59.663 -6.880  31.288  1.00 59.94  ? 14  DT  D C2    1 
ATOM   1903 O O2    . DT  D 3 14 ? 59.868 -6.359  32.371  1.00 67.78  ? 14  DT  D O2    1 
ATOM   1904 N N3    . DT  D 3 14 ? 58.950 -8.046  31.154  1.00 61.63  ? 14  DT  D N3    1 
ATOM   1905 C C4    . DT  D 3 14 ? 58.652 -8.712  29.984  1.00 64.85  ? 14  DT  D C4    1 
ATOM   1906 O O4    . DT  D 3 14 ? 58.005 -9.754  30.019  1.00 69.83  ? 14  DT  D O4    1 
ATOM   1907 C C5    . DT  D 3 14 ? 59.143 -8.087  28.780  1.00 73.65  ? 14  DT  D C5    1 
ATOM   1908 C C7    . DT  D 3 14 ? 58.865 -8.737  27.461  1.00 78.39  ? 14  DT  D C7    1 
ATOM   1909 C C6    . DT  D 3 14 ? 59.838 -6.948  28.901  1.00 66.54  ? 14  DT  D C6    1 
ATOM   1910 P P     . DC  D 3 15 ? 64.498 -2.707  29.914  1.00 70.87  ? 15  DC  D P     1 
ATOM   1911 O OP1   . DC  D 3 15 ? 64.877 -1.455  30.640  1.00 71.81  ? 15  DC  D OP1   1 
ATOM   1912 O OP2   . DC  D 3 15 ? 64.985 -2.946  28.519  1.00 58.49  ? 15  DC  D OP2   1 
ATOM   1913 O "O5'" . DC  D 3 15 ? 64.855 -3.921  30.880  1.00 75.72  ? 15  DC  D "O5'" 1 
ATOM   1914 C "C5'" . DC  D 3 15 ? 64.478 -3.851  32.272  1.00 81.90  ? 15  DC  D "C5'" 1 
ATOM   1915 C "C4'" . DC  D 3 15 ? 64.693 -5.186  32.943  1.00 87.67  ? 15  DC  D "C4'" 1 
ATOM   1916 O "O4'" . DC  D 3 15 ? 63.721 -6.140  32.455  1.00 84.53  ? 15  DC  D "O4'" 1 
ATOM   1917 C "C3'" . DC  D 3 15 ? 66.072 -5.821  32.699  1.00 92.36  ? 15  DC  D "C3'" 1 
ATOM   1918 O "O3'" . DC  D 3 15 ? 66.741 -6.071  33.946  1.00 93.41  ? 15  DC  D "O3'" 1 
ATOM   1919 C "C2'" . DC  D 3 15 ? 65.750 -7.131  31.994  1.00 89.94  ? 15  DC  D "C2'" 1 
ATOM   1920 C "C1'" . DC  D 3 15 ? 64.354 -7.397  32.504  1.00 83.08  ? 15  DC  D "C1'" 1 
ATOM   1921 N N1    . DC  D 3 15 ? 63.545 -8.352  31.742  1.00 77.28  ? 15  DC  D N1    1 
ATOM   1922 C C2    . DC  D 3 15 ? 62.706 -9.222  32.448  1.00 78.27  ? 15  DC  D C2    1 
ATOM   1923 O O2    . DC  D 3 15 ? 62.673 -9.150  33.685  1.00 74.37  ? 15  DC  D O2    1 
ATOM   1924 N N3    . DC  D 3 15 ? 61.955 -10.116 31.766  1.00 79.25  ? 15  DC  D N3    1 
ATOM   1925 C C4    . DC  D 3 15 ? 62.025 -10.166 30.434  1.00 81.09  ? 15  DC  D C4    1 
ATOM   1926 N N4    . DC  D 3 15 ? 61.261 -11.059 29.804  1.00 84.65  ? 15  DC  D N4    1 
ATOM   1927 C C5    . DC  D 3 15 ? 62.880 -9.299  29.689  1.00 77.07  ? 15  DC  D C5    1 
ATOM   1928 C C6    . DC  D 3 15 ? 63.609 -8.410  30.377  1.00 77.54  ? 15  DC  D C6    1 
ATOM   1929 P P     . DT  D 3 16 ? 68.366 -6.185  34.039  1.00 104.73 ? 16  DT  D P     1 
ATOM   1930 O OP1   . DT  D 3 16 ? 68.877 -4.971  34.738  1.00 105.78 ? 16  DT  D OP1   1 
ATOM   1931 O OP2   . DT  D 3 16 ? 68.934 -6.569  32.710  1.00 93.76  ? 16  DT  D OP2   1 
ATOM   1932 O "O5'" . DT  D 3 16 ? 68.575 -7.454  34.977  1.00 97.05  ? 16  DT  D "O5'" 1 
ATOM   1933 C "C5'" . DT  D 3 16 ? 67.675 -7.756  36.058  1.00 95.09  ? 16  DT  D "C5'" 1 
ATOM   1934 C "C4'" . DT  D 3 16 ? 67.669 -9.246  36.311  1.00 102.55 ? 16  DT  D "C4'" 1 
ATOM   1935 O "O4'" . DT  D 3 16 ? 66.685 -9.887  35.465  1.00 96.99  ? 16  DT  D "O4'" 1 
ATOM   1936 C "C3'" . DT  D 3 16 ? 68.996 -9.969  36.040  1.00 110.43 ? 16  DT  D "C3'" 1 
ATOM   1937 O "O3'" . DT  D 3 16 ? 69.297 -10.770 37.194  1.00 117.83 ? 16  DT  D "O3'" 1 
ATOM   1938 C "C2'" . DT  D 3 16 ? 68.706 -10.809 34.804  1.00 97.24  ? 16  DT  D "C2'" 1 
ATOM   1939 C "C1'" . DT  D 3 16 ? 67.231 -11.098 34.976  1.00 97.12  ? 16  DT  D "C1'" 1 
ATOM   1940 N N1    . DT  D 3 16 ? 66.500 -11.452 33.749  1.00 101.81 ? 16  DT  D N1    1 
ATOM   1941 C C2    . DT  D 3 16 ? 65.549 -12.448 33.813  1.00 101.04 ? 16  DT  D C2    1 
ATOM   1942 O O2    . DT  D 3 16 ? 65.312 -13.081 34.828  1.00 105.24 ? 16  DT  D O2    1 
ATOM   1943 N N3    . DT  D 3 16 ? 64.895 -12.690 32.631  1.00 93.36  ? 16  DT  D N3    1 
ATOM   1944 C C4    . DT  D 3 16 ? 65.088 -12.049 31.424  1.00 87.29  ? 16  DT  D C4    1 
ATOM   1945 O O4    . DT  D 3 16 ? 64.419 -12.374 30.449  1.00 88.54  ? 16  DT  D O4    1 
ATOM   1946 C C5    . DT  D 3 16 ? 66.094 -11.007 31.433  1.00 83.41  ? 16  DT  D C5    1 
ATOM   1947 C C7    . DT  D 3 16 ? 66.375 -10.255 30.171  1.00 94.30  ? 16  DT  D C7    1 
ATOM   1948 C C6    . DT  D 3 16 ? 66.734 -10.760 32.580  1.00 97.02  ? 16  DT  D C6    1 
ATOM   1949 P P     . DA  D 3 17 ? 70.721 -11.511 37.375  1.00 111.44 ? 17  DA  D P     1 
ATOM   1950 O OP1   . DA  D 3 17 ? 71.329 -11.021 38.639  1.00 114.61 ? 17  DA  D OP1   1 
ATOM   1951 O OP2   . DA  D 3 17 ? 71.485 -11.421 36.100  1.00 111.48 ? 17  DA  D OP2   1 
ATOM   1952 O "O5'" . DA  D 3 17 ? 70.291 -13.022 37.626  1.00 98.78  ? 17  DA  D "O5'" 1 
ATOM   1953 C "C5'" . DA  D 3 17 ? 68.902 -13.392 37.588  1.00 99.12  ? 17  DA  D "C5'" 1 
ATOM   1954 C "C4'" . DA  D 3 17 ? 68.754 -14.717 36.883  1.00 94.97  ? 17  DA  D "C4'" 1 
ATOM   1955 O "O4'" . DA  D 3 17 ? 67.982 -14.575 35.663  1.00 90.43  ? 17  DA  D "O4'" 1 
ATOM   1956 C "C3'" . DA  D 3 17 ? 70.088 -15.362 36.482  1.00 89.38  ? 17  DA  D "C3'" 1 
ATOM   1957 O "O3'" . DA  D 3 17 ? 69.999 -16.738 36.857  1.00 96.85  ? 17  DA  D "O3'" 1 
ATOM   1958 C "C2'" . DA  D 3 17 ? 70.110 -15.233 34.969  1.00 85.72  ? 17  DA  D "C2'" 1 
ATOM   1959 C "C1'" . DA  D 3 17 ? 68.627 -15.367 34.669  1.00 101.36 ? 17  DA  D "C1'" 1 
ATOM   1960 N N9    . DA  D 3 17 ? 68.160 -14.939 33.343  1.00 91.43  ? 17  DA  D N9    1 
ATOM   1961 C C8    . DA  D 3 17 ? 68.556 -13.858 32.594  1.00 83.59  ? 17  DA  D C8    1 
ATOM   1962 N N7    . DA  D 3 17 ? 67.949 -13.766 31.436  1.00 76.88  ? 17  DA  D N7    1 
ATOM   1963 C C5    . DA  D 3 17 ? 67.098 -14.863 31.418  1.00 83.28  ? 17  DA  D C5    1 
ATOM   1964 C C6    . DA  D 3 17 ? 66.154 -15.317 30.476  1.00 83.52  ? 17  DA  D C6    1 
ATOM   1965 N N6    . DA  D 3 17 ? 65.922 -14.714 29.307  1.00 79.22  ? 17  DA  D N6    1 
ATOM   1966 N N1    . DA  D 3 17 ? 65.456 -16.433 30.775  1.00 82.58  ? 17  DA  D N1    1 
ATOM   1967 C C2    . DA  D 3 17 ? 65.685 -17.037 31.947  1.00 83.28  ? 17  DA  D C2    1 
ATOM   1968 N N3    . DA  D 3 17 ? 66.543 -16.710 32.910  1.00 83.09  ? 17  DA  D N3    1 
ATOM   1969 C C4    . DA  D 3 17 ? 67.225 -15.598 32.582  1.00 83.43  ? 17  DA  D C4    1 
ATOM   1970 P P     . DC  D 3 18 ? 71.304 -17.592 37.178  1.00 93.21  ? 18  DC  D P     1 
ATOM   1971 O OP1   . DC  D 3 18 ? 71.216 -18.022 38.593  1.00 101.33 ? 18  DC  D OP1   1 
ATOM   1972 O OP2   . DC  D 3 18 ? 72.494 -16.828 36.712  1.00 97.75  ? 18  DC  D OP2   1 
ATOM   1973 O "O5'" . DC  D 3 18 ? 71.080 -18.911 36.318  1.00 88.11  ? 18  DC  D "O5'" 1 
ATOM   1974 C "C5'" . DC  D 3 18 ? 69.888 -19.677 36.548  1.00 95.96  ? 18  DC  D "C5'" 1 
ATOM   1975 C "C4'" . DC  D 3 18 ? 69.583 -20.559 35.363  1.00 98.40  ? 18  DC  D "C4'" 1 
ATOM   1976 O "O4'" . DC  D 3 18 ? 69.061 -19.780 34.267  1.00 99.37  ? 18  DC  D "O4'" 1 
ATOM   1977 C "C3'" . DC  D 3 18 ? 70.773 -21.345 34.811  1.00 100.36 ? 18  DC  D "C3'" 1 
ATOM   1978 O "O3'" . DC  D 3 18 ? 70.349 -22.708 34.866  1.00 95.60  ? 18  DC  D "O3'" 1 
ATOM   1979 C "C2'" . DC  D 3 18 ? 70.930 -20.829 33.387  1.00 105.83 ? 18  DC  D "C2'" 1 
ATOM   1980 C "C1'" . DC  D 3 18 ? 69.531 -20.346 33.061  1.00 99.31  ? 18  DC  D "C1'" 1 
ATOM   1981 N N1    . DC  D 3 18 ? 69.433 -19.318 32.010  1.00 99.25  ? 18  DC  D N1    1 
ATOM   1982 C C2    . DC  D 3 18 ? 68.321 -19.326 31.153  1.00 96.32  ? 18  DC  D C2    1 
ATOM   1983 O O2    . DC  D 3 18 ? 67.462 -20.213 31.286  1.00 83.99  ? 18  DC  D O2    1 
ATOM   1984 N N3    . DC  D 3 18 ? 68.217 -18.373 30.197  1.00 94.00  ? 18  DC  D N3    1 
ATOM   1985 C C4    . DC  D 3 18 ? 69.162 -17.437 30.084  1.00 100.28 ? 18  DC  D C4    1 
ATOM   1986 N N4    . DC  D 3 18 ? 69.019 -16.519 29.126  1.00 93.23  ? 18  DC  D N4    1 
ATOM   1987 C C5    . DC  D 3 18 ? 70.300 -17.402 30.946  1.00 104.58 ? 18  DC  D C5    1 
ATOM   1988 C C6    . DC  D 3 18 ? 70.389 -18.347 31.892  1.00 99.91  ? 18  DC  D C6    1 
ATOM   1989 P P     . DA  D 3 19 ? 71.303 -23.892 34.399  1.00 95.38  ? 19  DA  D P     1 
ATOM   1990 O OP1   . DA  D 3 19 ? 71.158 -24.994 35.378  1.00 92.89  ? 19  DA  D OP1   1 
ATOM   1991 O OP2   . DA  D 3 19 ? 72.661 -23.343 34.082  1.00 81.45  ? 19  DA  D OP2   1 
ATOM   1992 O "O5'" . DA  D 3 19 ? 70.535 -24.426 33.118  1.00 83.93  ? 19  DA  D "O5'" 1 
ATOM   1993 C "C5'" . DA  D 3 19 ? 69.436 -25.320 33.313  1.00 74.60  ? 19  DA  D "C5'" 1 
ATOM   1994 C "C4'" . DA  D 3 19 ? 68.704 -25.509 32.009  1.00 76.45  ? 19  DA  D "C4'" 1 
ATOM   1995 O "O4'" . DA  D 3 19 ? 68.623 -24.233 31.334  1.00 81.17  ? 19  DA  D "O4'" 1 
ATOM   1996 C "C3'" . DA  D 3 19 ? 69.374 -26.474 31.029  1.00 73.07  ? 19  DA  D "C3'" 1 
ATOM   1997 O "O3'" . DA  D 3 19 ? 68.341 -27.266 30.433  1.00 71.03  ? 19  DA  D "O3'" 1 
ATOM   1998 C "C2'" . DA  D 3 19 ? 70.033 -25.551 30.016  1.00 73.75  ? 19  DA  D "C2'" 1 
ATOM   1999 C "C1'" . DA  D 3 19 ? 69.070 -24.374 30.003  1.00 77.10  ? 19  DA  D "C1'" 1 
ATOM   2000 N N9    . DA  D 3 19 ? 69.654 -23.100 29.594  1.00 75.01  ? 19  DA  D N9    1 
ATOM   2001 C C8    . DA  D 3 19 ? 70.730 -22.438 30.130  1.00 70.92  ? 19  DA  D C8    1 
ATOM   2002 N N7    . DA  D 3 19 ? 71.013 -21.311 29.522  1.00 71.39  ? 19  DA  D N7    1 
ATOM   2003 C C5    . DA  D 3 19 ? 70.055 -21.223 28.522  1.00 71.91  ? 19  DA  D C5    1 
ATOM   2004 C C6    . DA  D 3 19 ? 69.801 -20.252 27.535  1.00 72.85  ? 19  DA  D C6    1 
ATOM   2005 N N6    . DA  D 3 19 ? 70.526 -19.143 27.385  1.00 74.68  ? 19  DA  D N6    1 
ATOM   2006 N N1    . DA  D 3 19 ? 68.764 -20.465 26.694  1.00 73.65  ? 19  DA  D N1    1 
ATOM   2007 C C2    . DA  D 3 19 ? 68.033 -21.576 26.848  1.00 71.46  ? 19  DA  D C2    1 
ATOM   2008 N N3    . DA  D 3 19 ? 68.160 -22.550 27.749  1.00 75.04  ? 19  DA  D N3    1 
ATOM   2009 C C4    . DA  D 3 19 ? 69.204 -22.312 28.563  1.00 73.92  ? 19  DA  D C4    1 
ATOM   2010 N N     . GLU E 1 5  ? 62.767 -54.388 6.728   1.00 108.42 ? 2   GLU E N     1 
ATOM   2011 C CA    . GLU E 1 5  ? 62.458 -54.622 5.287   1.00 99.20  ? 2   GLU E CA    1 
ATOM   2012 C C     . GLU E 1 5  ? 61.541 -53.515 4.759   1.00 90.56  ? 2   GLU E C     1 
ATOM   2013 O O     . GLU E 1 5  ? 60.401 -53.789 4.360   1.00 93.72  ? 2   GLU E O     1 
ATOM   2014 C CB    . GLU E 1 5  ? 61.803 -56.006 5.146   1.00 105.95 ? 2   GLU E CB    1 
ATOM   2015 C CG    . GLU E 1 5  ? 62.762 -57.182 5.343   1.00 109.26 ? 2   GLU E CG    1 
ATOM   2016 C CD    . GLU E 1 5  ? 63.855 -57.248 4.270   1.00 107.08 ? 2   GLU E CD    1 
ATOM   2017 O OE1   . GLU E 1 5  ? 63.731 -58.060 3.318   1.00 101.98 ? 2   GLU E OE1   1 
ATOM   2018 O OE2   . GLU E 1 5  ? 64.837 -56.478 4.365   1.00 101.49 ? 2   GLU E OE2   1 
ATOM   2019 N N     . SER E 1 6  ? 62.046 -52.277 4.741   1.00 76.05  ? 3   SER E N     1 
ATOM   2020 C CA    . SER E 1 6  ? 61.183 -51.073 4.848   1.00 76.71  ? 3   SER E CA    1 
ATOM   2021 C C     . SER E 1 6  ? 59.833 -51.020 4.074   1.00 72.45  ? 3   SER E C     1 
ATOM   2022 O O     . SER E 1 6  ? 59.803 -50.981 2.844   1.00 65.05  ? 3   SER E O     1 
ATOM   2023 C CB    . SER E 1 6  ? 61.969 -49.782 4.617   1.00 68.39  ? 3   SER E CB    1 
ATOM   2024 O OG    . SER E 1 6  ? 61.054 -48.694 4.537   1.00 69.74  ? 3   SER E OG    1 
ATOM   2025 N N     . PHE E 1 7  ? 58.738 -50.974 4.829   1.00 69.45  ? 4   PHE E N     1 
ATOM   2026 C CA    . PHE E 1 7  ? 57.390 -50.903 4.262   1.00 72.69  ? 4   PHE E CA    1 
ATOM   2027 C C     . PHE E 1 7  ? 57.202 -49.807 3.213   1.00 76.76  ? 4   PHE E C     1 
ATOM   2028 O O     . PHE E 1 7  ? 57.153 -50.113 2.018   1.00 80.93  ? 4   PHE E O     1 
ATOM   2029 C CB    . PHE E 1 7  ? 56.335 -50.767 5.366   1.00 75.03  ? 4   PHE E CB    1 
ATOM   2030 C CG    . PHE E 1 7  ? 54.960 -50.421 4.853   1.00 79.05  ? 4   PHE E CG    1 
ATOM   2031 C CD1   . PHE E 1 7  ? 54.284 -51.283 4.000   1.00 87.56  ? 4   PHE E CD1   1 
ATOM   2032 C CD2   . PHE E 1 7  ? 54.334 -49.231 5.227   1.00 83.45  ? 4   PHE E CD2   1 
ATOM   2033 C CE1   . PHE E 1 7  ? 53.024 -50.961 3.524   1.00 84.77  ? 4   PHE E CE1   1 
ATOM   2034 C CE2   . PHE E 1 7  ? 53.070 -48.907 4.758   1.00 72.68  ? 4   PHE E CE2   1 
ATOM   2035 C CZ    . PHE E 1 7  ? 52.419 -49.774 3.904   1.00 77.79  ? 4   PHE E CZ    1 
ATOM   2036 N N     . LEU E 1 8  ? 57.089 -48.545 3.651   1.00 74.16  ? 5   LEU E N     1 
ATOM   2037 C CA    . LEU E 1 8  ? 56.813 -47.424 2.731   1.00 67.13  ? 5   LEU E CA    1 
ATOM   2038 C C     . LEU E 1 8  ? 57.841 -47.399 1.573   1.00 71.87  ? 5   LEU E C     1 
ATOM   2039 O O     . LEU E 1 8  ? 57.516 -47.060 0.437   1.00 59.13  ? 5   LEU E O     1 
ATOM   2040 C CB    . LEU E 1 8  ? 56.729 -46.075 3.478   1.00 64.94  ? 5   LEU E CB    1 
ATOM   2041 C CG    . LEU E 1 8  ? 57.095 -44.722 2.802   1.00 60.92  ? 5   LEU E CG    1 
ATOM   2042 C CD1   . LEU E 1 8  ? 55.995 -44.147 1.950   1.00 50.77  ? 5   LEU E CD1   1 
ATOM   2043 C CD2   . LEU E 1 8  ? 57.512 -43.665 3.811   1.00 64.62  ? 5   LEU E CD2   1 
ATOM   2044 N N     . LEU E 1 9  ? 59.073 -47.802 1.843   1.00 72.84  ? 6   LEU E N     1 
ATOM   2045 C CA    . LEU E 1 9  ? 60.036 -47.852 0.765   1.00 77.81  ? 6   LEU E CA    1 
ATOM   2046 C C     . LEU E 1 9  ? 59.528 -48.714 -0.385  1.00 78.20  ? 6   LEU E C     1 
ATOM   2047 O O     . LEU E 1 9  ? 59.590 -48.307 -1.554  1.00 80.49  ? 6   LEU E O     1 
ATOM   2048 C CB    . LEU E 1 9  ? 61.389 -48.352 1.272   1.00 84.68  ? 6   LEU E CB    1 
ATOM   2049 C CG    . LEU E 1 9  ? 62.641 -47.842 0.545   1.00 78.84  ? 6   LEU E CG    1 
ATOM   2050 C CD1   . LEU E 1 9  ? 62.572 -46.348 0.216   1.00 70.36  ? 6   LEU E CD1   1 
ATOM   2051 C CD2   . LEU E 1 9  ? 63.884 -48.194 1.365   1.00 85.15  ? 6   LEU E CD2   1 
ATOM   2052 N N     . SER E 1 10 ? 59.018 -49.900 -0.049  1.00 87.65  ? 7   SER E N     1 
ATOM   2053 C CA    . SER E 1 10 ? 58.422 -50.802 -1.054  1.00 90.28  ? 7   SER E CA    1 
ATOM   2054 C C     . SER E 1 10 ? 57.188 -50.177 -1.765  1.00 79.14  ? 7   SER E C     1 
ATOM   2055 O O     . SER E 1 10 ? 57.069 -50.269 -3.007  1.00 70.49  ? 7   SER E O     1 
ATOM   2056 C CB    . SER E 1 10 ? 58.130 -52.194 -0.465  1.00 86.09  ? 7   SER E CB    1 
ATOM   2057 O OG    . SER E 1 10 ? 57.070 -52.130 0.470   1.00 92.35  ? 7   SER E OG    1 
ATOM   2058 N N     . LYS E 1 11 ? 56.326 -49.503 -0.994  1.00 64.09  ? 8   LYS E N     1 
ATOM   2059 C CA    . LYS E 1 11 ? 55.184 -48.771 -1.564  1.00 65.04  ? 8   LYS E CA    1 
ATOM   2060 C C     . LYS E 1 11 ? 55.549 -47.553 -2.426  1.00 61.35  ? 8   LYS E C     1 
ATOM   2061 O O     . LYS E 1 11 ? 54.693 -46.820 -2.909  1.00 51.87  ? 8   LYS E O     1 
ATOM   2062 C CB    . LYS E 1 11 ? 54.164 -48.404 -0.479  1.00 72.13  ? 8   LYS E CB    1 
ATOM   2063 C CG    . LYS E 1 11 ? 53.438 -49.611 0.129   1.00 81.41  ? 8   LYS E CG    1 
ATOM   2064 C CD    . LYS E 1 11 ? 52.493 -50.299 -0.866  1.00 87.31  ? 8   LYS E CD    1 
ATOM   2065 C CE    . LYS E 1 11 ? 52.272 -51.772 -0.530  1.00 82.60  ? 8   LYS E CE    1 
ATOM   2066 N NZ    . LYS E 1 11 ? 51.934 -52.529 -1.767  1.00 74.69  ? 8   LYS E NZ    1 
ATOM   2067 N N     . VAL E 1 12 ? 56.839 -47.348 -2.639  1.00 71.98  ? 9   VAL E N     1 
ATOM   2068 C CA    . VAL E 1 12 ? 57.284 -46.313 -3.556  1.00 65.07  ? 9   VAL E CA    1 
ATOM   2069 C C     . VAL E 1 12 ? 57.849 -46.996 -4.792  1.00 66.40  ? 9   VAL E C     1 
ATOM   2070 O O     . VAL E 1 12 ? 57.487 -46.623 -5.916  1.00 72.02  ? 9   VAL E O     1 
ATOM   2071 C CB    . VAL E 1 12 ? 58.296 -45.318 -2.940  1.00 56.90  ? 9   VAL E CB    1 
ATOM   2072 C CG1   . VAL E 1 12 ? 58.342 -44.076 -3.804  1.00 63.10  ? 9   VAL E CG1   1 
ATOM   2073 C CG2   . VAL E 1 12 ? 57.877 -44.874 -1.555  1.00 51.09  ? 9   VAL E CG2   1 
ATOM   2074 N N     . SER E 1 13 ? 58.700 -48.006 -4.594  1.00 65.74  ? 10  SER E N     1 
ATOM   2075 C CA    . SER E 1 13 ? 59.229 -48.770 -5.736  1.00 78.01  ? 10  SER E CA    1 
ATOM   2076 C C     . SER E 1 13 ? 58.069 -49.281 -6.620  1.00 83.51  ? 10  SER E C     1 
ATOM   2077 O O     . SER E 1 13 ? 58.226 -49.527 -7.822  1.00 88.67  ? 10  SER E O     1 
ATOM   2078 C CB    . SER E 1 13 ? 60.096 -49.941 -5.260  1.00 76.46  ? 10  SER E CB    1 
ATOM   2079 O OG    . SER E 1 13 ? 59.314 -50.942 -4.611  1.00 76.74  ? 10  SER E OG    1 
ATOM   2080 N N     . PHE E 1 14 ? 56.904 -49.423 -5.994  1.00 87.00  ? 11  PHE E N     1 
ATOM   2081 C CA    . PHE E 1 14 ? 55.682 -49.880 -6.656  1.00 85.32  ? 11  PHE E CA    1 
ATOM   2082 C C     . PHE E 1 14 ? 55.046 -48.762 -7.497  1.00 74.31  ? 11  PHE E C     1 
ATOM   2083 O O     . PHE E 1 14 ? 54.964 -48.878 -8.727  1.00 65.70  ? 11  PHE E O     1 
ATOM   2084 C CB    . PHE E 1 14 ? 54.712 -50.426 -5.601  1.00 83.38  ? 11  PHE E CB    1 
ATOM   2085 C CG    . PHE E 1 14 ? 53.500 -51.129 -6.163  1.00 97.43  ? 11  PHE E CG    1 
ATOM   2086 C CD1   . PHE E 1 14 ? 53.609 -52.388 -6.756  1.00 96.53  ? 11  PHE E CD1   1 
ATOM   2087 C CD2   . PHE E 1 14 ? 52.218 -50.550 -6.043  1.00 97.53  ? 11  PHE E CD2   1 
ATOM   2088 C CE1   . PHE E 1 14 ? 52.472 -53.034 -7.238  1.00 95.25  ? 11  PHE E CE1   1 
ATOM   2089 C CE2   . PHE E 1 14 ? 51.088 -51.189 -6.526  1.00 81.30  ? 11  PHE E CE2   1 
ATOM   2090 C CZ    . PHE E 1 14 ? 51.217 -52.433 -7.122  1.00 90.81  ? 11  PHE E CZ    1 
ATOM   2091 N N     . VAL E 1 15 ? 54.640 -47.676 -6.838  1.00 66.74  ? 12  VAL E N     1 
ATOM   2092 C CA    . VAL E 1 15 ? 53.965 -46.571 -7.521  1.00 68.62  ? 12  VAL E CA    1 
ATOM   2093 C C     . VAL E 1 15 ? 54.750 -45.911 -8.658  1.00 80.66  ? 12  VAL E C     1 
ATOM   2094 O O     . VAL E 1 15 ? 54.159 -45.347 -9.592  1.00 83.73  ? 12  VAL E O     1 
ATOM   2095 C CB    . VAL E 1 15 ? 53.552 -45.470 -6.561  1.00 65.56  ? 12  VAL E CB    1 
ATOM   2096 C CG1   . VAL E 1 15 ? 53.190 -44.216 -7.352  1.00 56.94  ? 12  VAL E CG1   1 
ATOM   2097 C CG2   . VAL E 1 15 ? 52.399 -45.940 -5.680  1.00 58.17  ? 12  VAL E CG2   1 
ATOM   2098 N N     . ILE E 1 16 ? 56.076 -45.966 -8.586  1.00 82.91  ? 13  ILE E N     1 
ATOM   2099 C CA    . ILE E 1 16 ? 56.890 -45.503 -9.700  1.00 72.39  ? 13  ILE E CA    1 
ATOM   2100 C C     . ILE E 1 16 ? 56.781 -46.453 -10.896 1.00 80.00  ? 13  ILE E C     1 
ATOM   2101 O O     . ILE E 1 16 ? 56.276 -46.040 -11.967 1.00 84.52  ? 13  ILE E O     1 
ATOM   2102 C CB    . ILE E 1 16 ? 58.330 -45.345 -9.275  1.00 67.99  ? 13  ILE E CB    1 
ATOM   2103 C CG1   . ILE E 1 16 ? 58.459 -44.115 -8.391  1.00 67.30  ? 13  ILE E CG1   1 
ATOM   2104 C CG2   . ILE E 1 16 ? 59.231 -45.240 -10.491 1.00 72.83  ? 13  ILE E CG2   1 
ATOM   2105 C CD1   . ILE E 1 16 ? 59.631 -44.209 -7.438  1.00 69.50  ? 13  ILE E CD1   1 
ATOM   2106 N N     . LYS E 1 17 ? 57.221 -47.713 -10.696 1.00 76.09  ? 14  LYS E N     1 
ATOM   2107 C CA    . LYS E 1 17 ? 57.189 -48.773 -11.723 1.00 63.07  ? 14  LYS E CA    1 
ATOM   2108 C C     . LYS E 1 17 ? 55.843 -48.824 -12.400 1.00 65.02  ? 14  LYS E C     1 
ATOM   2109 O O     . LYS E 1 17 ? 55.734 -49.101 -13.603 1.00 65.45  ? 14  LYS E O     1 
ATOM   2110 C CB    . LYS E 1 17 ? 57.512 -50.134 -11.120 1.00 59.68  ? 14  LYS E CB    1 
ATOM   2111 C CG    . LYS E 1 17 ? 56.855 -51.323 -11.826 1.00 55.71  ? 14  LYS E CG    1 
ATOM   2112 C CD    . LYS E 1 17 ? 57.825 -52.493 -11.964 1.00 55.43  ? 14  LYS E CD    1 
ATOM   2113 C CE    . LYS E 1 17 ? 58.704 -52.376 -13.213 1.00 56.46  ? 14  LYS E CE    1 
ATOM   2114 N NZ    . LYS E 1 17 ? 59.782 -53.404 -13.393 1.00 56.58  ? 14  LYS E NZ    1 
ATOM   2115 N N     . LYS E 1 18 ? 54.810 -48.538 -11.613 1.00 73.97  ? 15  LYS E N     1 
ATOM   2116 C CA    . LYS E 1 18 ? 53.465 -48.421 -12.159 1.00 72.09  ? 15  LYS E CA    1 
ATOM   2117 C C     . LYS E 1 18 ? 53.428 -47.239 -13.104 1.00 65.16  ? 15  LYS E C     1 
ATOM   2118 O O     . LYS E 1 18 ? 53.367 -47.486 -14.304 1.00 67.82  ? 15  LYS E O     1 
ATOM   2119 C CB    . LYS E 1 18 ? 52.393 -48.336 -11.072 1.00 81.39  ? 15  LYS E CB    1 
ATOM   2120 C CG    . LYS E 1 18 ? 51.040 -48.893 -11.504 1.00 88.41  ? 15  LYS E CG    1 
ATOM   2121 C CD    . LYS E 1 18 ? 49.967 -48.671 -10.445 1.00 80.14  ? 15  LYS E CD    1 
ATOM   2122 C CE    . LYS E 1 18 ? 48.620 -48.547 -11.124 1.00 86.91  ? 15  LYS E CE    1 
ATOM   2123 N NZ    . LYS E 1 18 ? 47.518 -48.517 -10.132 1.00 88.79  ? 15  LYS E NZ    1 
ATOM   2124 N N     . ILE E 1 19 ? 53.552 -45.990 -12.613 1.00 54.61  ? 16  ILE E N     1 
ATOM   2125 C CA    . ILE E 1 19 ? 53.321 -44.851 -13.520 1.00 57.11  ? 16  ILE E CA    1 
ATOM   2126 C C     . ILE E 1 19 ? 54.202 -44.937 -14.746 1.00 58.36  ? 16  ILE E C     1 
ATOM   2127 O O     . ILE E 1 19 ? 53.848 -44.455 -15.837 1.00 59.93  ? 16  ILE E O     1 
ATOM   2128 C CB    . ILE E 1 19 ? 53.493 -43.456 -12.923 1.00 53.99  ? 16  ILE E CB    1 
ATOM   2129 C CG1   . ILE E 1 19 ? 52.835 -43.360 -11.560 1.00 59.88  ? 16  ILE E CG1   1 
ATOM   2130 C CG2   . ILE E 1 19 ? 52.808 -42.441 -13.839 1.00 52.10  ? 16  ILE E CG2   1 
ATOM   2131 C CD1   . ILE E 1 19 ? 53.063 -42.034 -10.845 1.00 54.88  ? 16  ILE E CD1   1 
ATOM   2132 N N     . ARG E 1 20 ? 55.333 -45.589 -14.568 1.00 59.16  ? 17  ARG E N     1 
ATOM   2133 C CA    . ARG E 1 20 ? 56.198 -45.832 -15.698 1.00 69.87  ? 17  ARG E CA    1 
ATOM   2134 C C     . ARG E 1 20 ? 55.474 -46.564 -16.856 1.00 77.15  ? 17  ARG E C     1 
ATOM   2135 O O     . ARG E 1 20 ? 55.367 -46.025 -17.974 1.00 78.89  ? 17  ARG E O     1 
ATOM   2136 C CB    . ARG E 1 20 ? 57.478 -46.551 -15.254 1.00 65.60  ? 17  ARG E CB    1 
ATOM   2137 C CG    . ARG E 1 20 ? 58.478 -46.783 -16.356 1.00 58.28  ? 17  ARG E CG    1 
ATOM   2138 C CD    . ARG E 1 20 ? 59.756 -47.301 -15.744 1.00 71.74  ? 17  ARG E CD    1 
ATOM   2139 N NE    . ARG E 1 20 ? 59.673 -48.739 -15.509 1.00 77.00  ? 17  ARG E NE    1 
ATOM   2140 C CZ    . ARG E 1 20 ? 59.862 -49.661 -16.446 1.00 79.85  ? 17  ARG E CZ    1 
ATOM   2141 N NH1   . ARG E 1 20 ? 60.154 -49.319 -17.700 1.00 88.17  ? 17  ARG E NH1   1 
ATOM   2142 N NH2   . ARG E 1 20 ? 59.767 -50.935 -16.125 1.00 82.63  ? 17  ARG E NH2   1 
ATOM   2143 N N     . LEU E 1 21 ? 54.976 -47.774 -16.578 1.00 78.37  ? 18  LEU E N     1 
ATOM   2144 C CA    . LEU E 1 21 ? 54.482 -48.670 -17.631 1.00 65.66  ? 18  LEU E CA    1 
ATOM   2145 C C     . LEU E 1 21 ? 53.205 -48.076 -18.170 1.00 66.83  ? 18  LEU E C     1 
ATOM   2146 O O     . LEU E 1 21 ? 52.887 -48.180 -19.352 1.00 65.45  ? 18  LEU E O     1 
ATOM   2147 C CB    . LEU E 1 21 ? 54.281 -50.075 -17.070 1.00 59.20  ? 18  LEU E CB    1 
ATOM   2148 C CG    . LEU E 1 21 ? 55.607 -50.624 -16.567 1.00 56.00  ? 18  LEU E CG    1 
ATOM   2149 C CD1   . LEU E 1 21 ? 55.501 -52.101 -16.263 1.00 56.86  ? 18  LEU E CD1   1 
ATOM   2150 C CD2   . LEU E 1 21 ? 56.700 -50.394 -17.598 1.00 59.95  ? 18  LEU E CD2   1 
ATOM   2151 N N     . GLU E 1 22 ? 52.518 -47.391 -17.270 1.00 66.89  ? 19  GLU E N     1 
ATOM   2152 C CA    . GLU E 1 22 ? 51.347 -46.631 -17.577 1.00 67.34  ? 19  GLU E CA    1 
ATOM   2153 C C     . GLU E 1 22 ? 51.602 -45.535 -18.612 1.00 65.34  ? 19  GLU E C     1 
ATOM   2154 O O     . GLU E 1 22 ? 50.637 -45.005 -19.146 1.00 77.45  ? 19  GLU E O     1 
ATOM   2155 C CB    . GLU E 1 22 ? 50.746 -46.046 -16.292 1.00 74.16  ? 19  GLU E CB    1 
ATOM   2156 C CG    . GLU E 1 22 ? 49.505 -45.185 -16.531 1.00 82.96  ? 19  GLU E CG    1 
ATOM   2157 C CD    . GLU E 1 22 ? 49.263 -44.184 -15.418 1.00 82.81  ? 19  GLU E CD    1 
ATOM   2158 O OE1   . GLU E 1 22 ? 49.651 -42.993 -15.575 1.00 75.74  ? 19  GLU E OE1   1 
ATOM   2159 O OE2   . GLU E 1 22 ? 48.692 -44.610 -14.385 1.00 78.61  ? 19  GLU E OE2   1 
ATOM   2160 N N     . LYS E 1 23 ? 52.859 -45.188 -18.891 1.00 62.10  ? 20  LYS E N     1 
ATOM   2161 C CA    . LYS E 1 23 ? 53.217 -44.329 -20.066 1.00 59.31  ? 20  LYS E CA    1 
ATOM   2162 C C     . LYS E 1 23 ? 54.194 -45.015 -21.040 1.00 58.75  ? 20  LYS E C     1 
ATOM   2163 O O     . LYS E 1 23 ? 54.756 -44.367 -21.945 1.00 51.25  ? 20  LYS E O     1 
ATOM   2164 C CB    . LYS E 1 23 ? 53.778 -42.963 -19.627 1.00 57.95  ? 20  LYS E CB    1 
ATOM   2165 C CG    . LYS E 1 23 ? 53.205 -42.460 -18.316 1.00 57.62  ? 20  LYS E CG    1 
ATOM   2166 C CD    . LYS E 1 23 ? 52.891 -40.987 -18.399 1.00 60.29  ? 20  LYS E CD    1 
ATOM   2167 C CE    . LYS E 1 23 ? 52.115 -40.537 -17.164 1.00 69.84  ? 20  LYS E CE    1 
ATOM   2168 N NZ    . LYS E 1 23 ? 52.944 -39.866 -16.103 1.00 64.90  ? 20  LYS E NZ    1 
ATOM   2169 N N     . GLY E 1 24 ? 54.392 -46.323 -20.816 1.00 62.34  ? 21  GLY E N     1 
ATOM   2170 C CA    . GLY E 1 24 ? 55.282 -47.181 -21.596 1.00 56.19  ? 21  GLY E CA    1 
ATOM   2171 C C     . GLY E 1 24 ? 56.653 -46.587 -21.808 1.00 57.01  ? 21  GLY E C     1 
ATOM   2172 O O     . GLY E 1 24 ? 57.049 -46.373 -22.942 1.00 64.46  ? 21  GLY E O     1 
ATOM   2173 N N     . MET E 1 25 ? 57.376 -46.297 -20.728 1.00 55.25  ? 22  MET E N     1 
ATOM   2174 C CA    . MET E 1 25 ? 58.745 -45.786 -20.843 1.00 52.85  ? 22  MET E CA    1 
ATOM   2175 C C     . MET E 1 25 ? 59.617 -46.927 -20.472 1.00 58.79  ? 22  MET E C     1 
ATOM   2176 O O     . MET E 1 25 ? 59.263 -47.681 -19.549 1.00 68.17  ? 22  MET E O     1 
ATOM   2177 C CB    . MET E 1 25 ? 59.004 -44.674 -19.844 1.00 53.70  ? 22  MET E CB    1 
ATOM   2178 C CG    . MET E 1 25 ? 57.946 -43.587 -19.835 1.00 61.82  ? 22  MET E CG    1 
ATOM   2179 S SD    . MET E 1 25 ? 58.414 -42.181 -18.813 1.00 67.42  ? 22  MET E SD    1 
ATOM   2180 C CE    . MET E 1 25 ? 60.131 -41.952 -19.300 1.00 74.19  ? 22  MET E CE    1 
ATOM   2181 N N     . THR E 1 26 ? 60.746 -47.093 -21.156 1.00 53.03  ? 23  THR E N     1 
ATOM   2182 C CA    . THR E 1 26 ? 61.669 -48.123 -20.724 1.00 53.98  ? 23  THR E CA    1 
ATOM   2183 C C     . THR E 1 26 ? 62.427 -47.516 -19.550 1.00 64.50  ? 23  THR E C     1 
ATOM   2184 O O     . THR E 1 26 ? 62.434 -46.293 -19.371 1.00 71.30  ? 23  THR E O     1 
ATOM   2185 C CB    . THR E 1 26 ? 62.624 -48.533 -21.855 1.00 53.25  ? 23  THR E CB    1 
ATOM   2186 O OG1   . THR E 1 26 ? 63.775 -47.683 -21.873 1.00 62.66  ? 23  THR E OG1   1 
ATOM   2187 C CG2   . THR E 1 26 ? 61.962 -48.415 -23.176 1.00 52.64  ? 23  THR E CG2   1 
ATOM   2188 N N     . GLN E 1 27 ? 63.111 -48.319 -18.758 1.00 70.00  ? 24  GLN E N     1 
ATOM   2189 C CA    . GLN E 1 27 ? 63.968 -47.695 -17.755 1.00 74.38  ? 24  GLN E CA    1 
ATOM   2190 C C     . GLN E 1 27 ? 64.850 -46.610 -18.394 1.00 74.98  ? 24  GLN E C     1 
ATOM   2191 O O     . GLN E 1 27 ? 64.726 -45.421 -18.036 1.00 78.49  ? 24  GLN E O     1 
ATOM   2192 C CB    . GLN E 1 27 ? 64.749 -48.730 -16.947 1.00 72.61  ? 24  GLN E CB    1 
ATOM   2193 C CG    . GLN E 1 27 ? 63.940 -49.292 -15.773 1.00 66.89  ? 24  GLN E CG    1 
ATOM   2194 C CD    . GLN E 1 27 ? 64.409 -50.680 -15.353 1.00 66.10  ? 24  GLN E CD    1 
ATOM   2195 O OE1   . GLN E 1 27 ? 65.134 -51.334 -16.097 1.00 70.56  ? 24  GLN E OE1   1 
ATOM   2196 N NE2   . GLN E 1 27 ? 63.983 -51.144 -14.167 1.00 61.92  ? 24  GLN E NE2   1 
ATOM   2197 N N     . GLU E 1 28 ? 65.673 -46.985 -19.378 1.00 76.80  ? 25  GLU E N     1 
ATOM   2198 C CA    . GLU E 1 28 ? 66.537 -46.008 -20.083 1.00 81.68  ? 25  GLU E CA    1 
ATOM   2199 C C     . GLU E 1 28 ? 65.792 -44.704 -20.450 1.00 79.44  ? 25  GLU E C     1 
ATOM   2200 O O     . GLU E 1 28 ? 66.421 -43.662 -20.609 1.00 77.83  ? 25  GLU E O     1 
ATOM   2201 C CB    . GLU E 1 28 ? 67.200 -46.641 -21.320 1.00 94.33  ? 25  GLU E CB    1 
ATOM   2202 C CG    . GLU E 1 28 ? 68.245 -45.784 -22.046 1.00 113.66 ? 25  GLU E CG    1 
ATOM   2203 C CD    . GLU E 1 28 ? 68.145 -45.854 -23.585 1.00 126.70 ? 25  GLU E CD    1 
ATOM   2204 O OE1   . GLU E 1 28 ? 69.105 -45.438 -24.279 1.00 127.09 ? 25  GLU E OE1   1 
ATOM   2205 O OE2   . GLU E 1 28 ? 67.103 -46.302 -24.123 1.00 125.22 ? 25  GLU E OE2   1 
ATOM   2206 N N     . ASP E 1 29 ? 64.459 -44.761 -20.563 1.00 70.11  ? 26  ASP E N     1 
ATOM   2207 C CA    . ASP E 1 29 ? 63.673 -43.568 -20.859 1.00 61.77  ? 26  ASP E CA    1 
ATOM   2208 C C     . ASP E 1 29 ? 63.650 -42.609 -19.671 1.00 65.94  ? 26  ASP E C     1 
ATOM   2209 O O     . ASP E 1 29 ? 64.029 -41.446 -19.792 1.00 66.92  ? 26  ASP E O     1 
ATOM   2210 C CB    . ASP E 1 29 ? 62.241 -43.945 -21.238 1.00 57.33  ? 26  ASP E CB    1 
ATOM   2211 C CG    . ASP E 1 29 ? 62.101 -44.375 -22.673 1.00 53.96  ? 26  ASP E CG    1 
ATOM   2212 O OD1   . ASP E 1 29 ? 63.138 -44.501 -23.376 1.00 47.11  ? 26  ASP E OD1   1 
ATOM   2213 O OD2   . ASP E 1 29 ? 60.930 -44.565 -23.098 1.00 53.14  ? 26  ASP E OD2   1 
ATOM   2214 N N     . LEU E 1 30 ? 63.198 -43.125 -18.526 1.00 74.22  ? 27  LEU E N     1 
ATOM   2215 C CA    . LEU E 1 30 ? 63.052 -42.365 -17.270 1.00 63.95  ? 27  LEU E CA    1 
ATOM   2216 C C     . LEU E 1 30 ? 64.418 -42.004 -16.749 1.00 62.66  ? 27  LEU E C     1 
ATOM   2217 O O     . LEU E 1 30 ? 64.635 -40.882 -16.284 1.00 63.66  ? 27  LEU E O     1 
ATOM   2218 C CB    . LEU E 1 30 ? 62.347 -43.212 -16.204 1.00 59.63  ? 27  LEU E CB    1 
ATOM   2219 C CG    . LEU E 1 30 ? 61.829 -42.475 -14.962 1.00 58.03  ? 27  LEU E CG    1 
ATOM   2220 C CD1   . LEU E 1 30 ? 60.479 -41.779 -15.257 1.00 56.63  ? 27  LEU E CD1   1 
ATOM   2221 C CD2   . LEU E 1 30 ? 61.775 -43.375 -13.719 1.00 43.60  ? 27  LEU E CD2   1 
ATOM   2222 N N     . ALA E 1 31 ? 65.350 -42.950 -16.868 1.00 58.96  ? 28  ALA E N     1 
ATOM   2223 C CA    . ALA E 1 31 ? 66.685 -42.721 -16.380 1.00 58.55  ? 28  ALA E CA    1 
ATOM   2224 C C     . ALA E 1 31 ? 67.273 -41.571 -17.171 1.00 54.75  ? 28  ALA E C     1 
ATOM   2225 O O     . ALA E 1 31 ? 68.219 -40.925 -16.726 1.00 54.99  ? 28  ALA E O     1 
ATOM   2226 C CB    . ALA E 1 31 ? 67.540 -43.975 -16.519 1.00 61.73  ? 28  ALA E CB    1 
ATOM   2227 N N     . TYR E 1 32 ? 66.710 -41.319 -18.344 1.00 51.28  ? 29  TYR E N     1 
ATOM   2228 C CA    . TYR E 1 32 ? 67.120 -40.158 -19.119 1.00 51.45  ? 29  TYR E CA    1 
ATOM   2229 C C     . TYR E 1 32 ? 66.354 -38.889 -18.733 1.00 51.02  ? 29  TYR E C     1 
ATOM   2230 O O     . TYR E 1 32 ? 66.895 -37.790 -18.795 1.00 59.84  ? 29  TYR E O     1 
ATOM   2231 C CB    . TYR E 1 32 ? 67.041 -40.431 -20.619 1.00 48.30  ? 29  TYR E CB    1 
ATOM   2232 C CG    . TYR E 1 32 ? 66.975 -39.198 -21.426 1.00 44.94  ? 29  TYR E CG    1 
ATOM   2233 C CD1   . TYR E 1 32 ? 68.110 -38.567 -21.875 1.00 47.90  ? 29  TYR E CD1   1 
ATOM   2234 C CD2   . TYR E 1 32 ? 65.764 -38.639 -21.719 1.00 50.80  ? 29  TYR E CD2   1 
ATOM   2235 C CE1   . TYR E 1 32 ? 68.008 -37.401 -22.626 1.00 52.60  ? 29  TYR E CE1   1 
ATOM   2236 C CE2   . TYR E 1 32 ? 65.651 -37.482 -22.455 1.00 50.15  ? 29  TYR E CE2   1 
ATOM   2237 C CZ    . TYR E 1 32 ? 66.756 -36.867 -22.907 1.00 45.23  ? 29  TYR E CZ    1 
ATOM   2238 O OH    . TYR E 1 32 ? 66.561 -35.729 -23.621 1.00 45.72  ? 29  TYR E OH    1 
ATOM   2239 N N     . LYS E 1 33 ? 65.105 -39.025 -18.337 1.00 45.64  ? 30  LYS E N     1 
ATOM   2240 C CA    . LYS E 1 33 ? 64.380 -37.842 -17.976 1.00 48.16  ? 30  LYS E CA    1 
ATOM   2241 C C     . LYS E 1 33 ? 64.662 -37.539 -16.505 1.00 50.23  ? 30  LYS E C     1 
ATOM   2242 O O     . LYS E 1 33 ? 64.220 -36.547 -15.923 1.00 49.61  ? 30  LYS E O     1 
ATOM   2243 C CB    . LYS E 1 33 ? 62.900 -37.967 -18.373 1.00 47.74  ? 30  LYS E CB    1 
ATOM   2244 C CG    . LYS E 1 33 ? 62.743 -37.966 -19.903 1.00 48.76  ? 30  LYS E CG    1 
ATOM   2245 C CD    . LYS E 1 33 ? 61.418 -37.445 -20.448 1.00 53.98  ? 30  LYS E CD    1 
ATOM   2246 C CE    . LYS E 1 33 ? 60.265 -38.411 -20.137 1.00 60.70  ? 30  LYS E CE    1 
ATOM   2247 N NZ    . LYS E 1 33 ? 59.092 -38.401 -21.078 1.00 66.05  ? 30  LYS E NZ    1 
ATOM   2248 N N     . SER E 1 34 ? 65.483 -38.377 -15.915 1.00 56.73  ? 31  SER E N     1 
ATOM   2249 C CA    . SER E 1 34 ? 65.719 -38.223 -14.505 1.00 70.16  ? 31  SER E CA    1 
ATOM   2250 C C     . SER E 1 34 ? 67.057 -37.598 -14.231 1.00 78.31  ? 31  SER E C     1 
ATOM   2251 O O     . SER E 1 34 ? 67.232 -36.898 -13.230 1.00 95.21  ? 31  SER E O     1 
ATOM   2252 C CB    . SER E 1 34 ? 65.595 -39.560 -13.790 1.00 70.13  ? 31  SER E CB    1 
ATOM   2253 O OG    . SER E 1 34 ? 64.220 -39.783 -13.532 1.00 78.10  ? 31  SER E OG    1 
ATOM   2254 N N     . ASN E 1 35 ? 68.008 -37.826 -15.124 1.00 67.96  ? 32  ASN E N     1 
ATOM   2255 C CA    . ASN E 1 35 ? 69.357 -37.424 -14.844 1.00 64.52  ? 32  ASN E CA    1 
ATOM   2256 C C     . ASN E 1 35 ? 69.975 -38.488 -13.959 1.00 71.21  ? 32  ASN E C     1 
ATOM   2257 O O     . ASN E 1 35 ? 71.185 -38.444 -13.673 1.00 83.98  ? 32  ASN E O     1 
ATOM   2258 C CB    . ASN E 1 35 ? 69.386 -36.050 -14.155 1.00 65.68  ? 32  ASN E CB    1 
ATOM   2259 C CG    . ASN E 1 35 ? 69.653 -34.893 -15.130 1.00 72.87  ? 32  ASN E CG    1 
ATOM   2260 O OD1   . ASN E 1 35 ? 69.348 -34.963 -16.328 1.00 71.71  ? 32  ASN E OD1   1 
ATOM   2261 N ND2   . ASN E 1 35 ? 70.238 -33.815 -14.609 1.00 73.63  ? 32  ASN E ND2   1 
ATOM   2262 N N     . LEU E 1 36 ? 69.152 -39.466 -13.551 1.00 66.29  ? 33  LEU E N     1 
ATOM   2263 C CA    . LEU E 1 36 ? 69.609 -40.609 -12.732 1.00 58.09  ? 33  LEU E CA    1 
ATOM   2264 C C     . LEU E 1 36 ? 70.029 -41.797 -13.589 1.00 53.80  ? 33  LEU E C     1 
ATOM   2265 O O     . LEU E 1 36 ? 69.619 -41.887 -14.742 1.00 47.52  ? 33  LEU E O     1 
ATOM   2266 C CB    . LEU E 1 36 ? 68.522 -40.998 -11.746 1.00 58.51  ? 33  LEU E CB    1 
ATOM   2267 C CG    . LEU E 1 36 ? 68.167 -39.812 -10.843 1.00 60.40  ? 33  LEU E CG    1 
ATOM   2268 C CD1   . LEU E 1 36 ? 66.809 -39.956 -10.184 1.00 58.48  ? 33  LEU E CD1   1 
ATOM   2269 C CD2   . LEU E 1 36 ? 69.251 -39.597 -9.796  1.00 63.39  ? 33  LEU E CD2   1 
ATOM   2270 N N     . ASP E 1 37 ? 70.856 -42.694 -13.048 1.00 53.92  ? 34  ASP E N     1 
ATOM   2271 C CA    . ASP E 1 37 ? 71.307 -43.840 -13.835 1.00 56.53  ? 34  ASP E CA    1 
ATOM   2272 C C     . ASP E 1 37 ? 70.295 -44.939 -13.933 1.00 60.50  ? 34  ASP E C     1 
ATOM   2273 O O     . ASP E 1 37 ? 69.565 -45.219 -12.991 1.00 62.85  ? 34  ASP E O     1 
ATOM   2274 C CB    . ASP E 1 37 ? 72.569 -44.453 -13.302 1.00 65.51  ? 34  ASP E CB    1 
ATOM   2275 C CG    . ASP E 1 37 ? 73.598 -44.618 -14.380 1.00 79.37  ? 34  ASP E CG    1 
ATOM   2276 O OD1   . ASP E 1 37 ? 73.971 -43.571 -14.956 1.00 89.49  ? 34  ASP E OD1   1 
ATOM   2277 O OD2   . ASP E 1 37 ? 74.017 -45.766 -14.674 1.00 78.75  ? 34  ASP E OD2   1 
ATOM   2278 N N     . ARG E 1 38 ? 70.260 -45.557 -15.108 1.00 65.61  ? 35  ARG E N     1 
ATOM   2279 C CA    . ARG E 1 38 ? 69.441 -46.729 -15.375 1.00 62.65  ? 35  ARG E CA    1 
ATOM   2280 C C     . ARG E 1 38 ? 69.618 -47.709 -14.254 1.00 60.97  ? 35  ARG E C     1 
ATOM   2281 O O     . ARG E 1 38 ? 68.653 -48.238 -13.716 1.00 65.86  ? 35  ARG E O     1 
ATOM   2282 C CB    . ARG E 1 38 ? 69.882 -47.406 -16.674 1.00 58.37  ? 35  ARG E CB    1 
ATOM   2283 C CG    . ARG E 1 38 ? 68.782 -48.259 -17.318 1.00 58.23  ? 35  ARG E CG    1 
ATOM   2284 C CD    . ARG E 1 38 ? 69.340 -49.035 -18.523 1.00 61.78  ? 35  ARG E CD    1 
ATOM   2285 N NE    . ARG E 1 38 ? 70.367 -50.042 -18.188 1.00 55.80  ? 35  ARG E NE    1 
ATOM   2286 C CZ    . ARG E 1 38 ? 70.162 -51.102 -17.396 1.00 52.99  ? 35  ARG E CZ    1 
ATOM   2287 N NH1   . ARG E 1 38 ? 71.156 -51.940 -17.192 1.00 52.15  ? 35  ARG E NH1   1 
ATOM   2288 N NH2   . ARG E 1 38 ? 68.978 -51.333 -16.809 1.00 45.57  ? 35  ARG E NH2   1 
ATOM   2289 N N     . THR E 1 39 ? 70.860 -47.919 -13.886 1.00 55.64  ? 36  THR E N     1 
ATOM   2290 C CA    . THR E 1 39 ? 71.186 -48.889 -12.878 1.00 65.87  ? 36  THR E CA    1 
ATOM   2291 C C     . THR E 1 39 ? 70.644 -48.517 -11.488 1.00 66.99  ? 36  THR E C     1 
ATOM   2292 O O     . THR E 1 39 ? 70.436 -49.385 -10.646 1.00 79.76  ? 36  THR E O     1 
ATOM   2293 C CB    . THR E 1 39 ? 72.695 -49.029 -12.831 1.00 73.56  ? 36  THR E CB    1 
ATOM   2294 O OG1   . THR E 1 39 ? 73.244 -47.712 -12.958 1.00 89.63  ? 36  THR E OG1   1 
ATOM   2295 C CG2   . THR E 1 39 ? 73.182 -49.861 -14.030 1.00 72.40  ? 36  THR E CG2   1 
ATOM   2296 N N     . PHE E 1 40 ? 70.411 -47.232 -11.239 1.00 63.81  ? 37  PHE E N     1 
ATOM   2297 C CA    . PHE E 1 40 ? 69.839 -46.778 -9.956  1.00 53.06  ? 37  PHE E CA    1 
ATOM   2298 C C     . PHE E 1 40 ? 68.352 -47.026 -9.997  1.00 52.48  ? 37  PHE E C     1 
ATOM   2299 O O     . PHE E 1 40 ? 67.767 -47.546 -9.056  1.00 57.34  ? 37  PHE E O     1 
ATOM   2300 C CB    . PHE E 1 40 ? 70.106 -45.268 -9.729  1.00 48.44  ? 37  PHE E CB    1 
ATOM   2301 C CG    . PHE E 1 40 ? 69.794 -44.774 -8.337  1.00 42.38  ? 37  PHE E CG    1 
ATOM   2302 C CD1   . PHE E 1 40 ? 70.273 -45.468 -7.203  1.00 39.34  ? 37  PHE E CD1   1 
ATOM   2303 C CD2   . PHE E 1 40 ? 69.017 -43.595 -8.148  1.00 39.24  ? 37  PHE E CD2   1 
ATOM   2304 C CE1   . PHE E 1 40 ? 69.966 -45.009 -5.911  1.00 37.97  ? 37  PHE E CE1   1 
ATOM   2305 C CE2   . PHE E 1 40 ? 68.718 -43.131 -6.849  1.00 36.41  ? 37  PHE E CE2   1 
ATOM   2306 C CZ    . PHE E 1 40 ? 69.196 -43.846 -5.740  1.00 38.17  ? 37  PHE E CZ    1 
ATOM   2307 N N     . ILE E 1 41 ? 67.729 -46.618 -11.094 1.00 49.15  ? 38  ILE E N     1 
ATOM   2308 C CA    . ILE E 1 41 ? 66.297 -46.796 -11.247 1.00 41.59  ? 38  ILE E CA    1 
ATOM   2309 C C     . ILE E 1 41 ? 65.902 -48.222 -10.970 1.00 43.22  ? 38  ILE E C     1 
ATOM   2310 O O     . ILE E 1 41 ? 65.216 -48.477 -10.000 1.00 39.98  ? 38  ILE E O     1 
ATOM   2311 C CB    . ILE E 1 41 ? 65.864 -46.469 -12.650 1.00 39.46  ? 38  ILE E CB    1 
ATOM   2312 C CG1   . ILE E 1 41 ? 65.918 -44.946 -12.929 1.00 42.56  ? 38  ILE E CG1   1 
ATOM   2313 C CG2   . ILE E 1 41 ? 64.468 -46.974 -12.825 1.00 40.29  ? 38  ILE E CG2   1 
ATOM   2314 C CD1   . ILE E 1 41 ? 65.054 -44.042 -12.039 1.00 32.49  ? 38  ILE E CD1   1 
ATOM   2315 N N     . SER E 1 42 ? 66.369 -49.148 -11.814 1.00 48.71  ? 39  SER E N     1 
ATOM   2316 C CA    . SER E 1 42 ? 66.173 -50.576 -11.600 1.00 50.86  ? 39  SER E CA    1 
ATOM   2317 C C     . SER E 1 42 ? 66.319 -50.957 -10.129 1.00 49.86  ? 39  SER E C     1 
ATOM   2318 O O     . SER E 1 42 ? 65.423 -51.591 -9.543  1.00 47.11  ? 39  SER E O     1 
ATOM   2319 C CB    . SER E 1 42 ? 67.209 -51.364 -12.414 1.00 65.15  ? 39  SER E CB    1 
ATOM   2320 O OG    . SER E 1 42 ? 67.329 -52.723 -11.973 1.00 70.85  ? 39  SER E OG    1 
ATOM   2321 N N     . GLY E 1 43 ? 67.477 -50.609 -9.559  1.00 48.57  ? 40  GLY E N     1 
ATOM   2322 C CA    . GLY E 1 43 ? 67.771 -50.885 -8.146  1.00 51.72  ? 40  GLY E CA    1 
ATOM   2323 C C     . GLY E 1 43 ? 66.620 -50.551 -7.207  1.00 61.37  ? 40  GLY E C     1 
ATOM   2324 O O     . GLY E 1 43 ? 66.344 -51.320 -6.286  1.00 68.76  ? 40  GLY E O     1 
ATOM   2325 N N     . ILE E 1 44 ? 65.926 -49.433 -7.460  1.00 64.29  ? 41  ILE E N     1 
ATOM   2326 C CA    . ILE E 1 44 ? 64.799 -48.994 -6.639  1.00 73.52  ? 41  ILE E CA    1 
ATOM   2327 C C     . ILE E 1 44 ? 63.624 -49.894 -6.892  1.00 79.68  ? 41  ILE E C     1 
ATOM   2328 O O     . ILE E 1 44 ? 62.991 -50.368 -5.943  1.00 86.29  ? 41  ILE E O     1 
ATOM   2329 C CB    . ILE E 1 44 ? 64.372 -47.539 -6.954  1.00 80.31  ? 41  ILE E CB    1 
ATOM   2330 C CG1   . ILE E 1 44 ? 65.586 -46.605 -6.919  1.00 86.35  ? 41  ILE E CG1   1 
ATOM   2331 C CG2   . ILE E 1 44 ? 63.341 -47.056 -5.945  1.00 82.45  ? 41  ILE E CG2   1 
ATOM   2332 C CD1   . ILE E 1 44 ? 65.419 -45.360 -7.766  1.00 86.95  ? 41  ILE E CD1   1 
ATOM   2333 N N     . GLU E 1 45 ? 63.343 -50.121 -8.179  1.00 83.83  ? 42  GLU E N     1 
ATOM   2334 C CA    . GLU E 1 45 ? 62.189 -50.914 -8.603  1.00 74.08  ? 42  GLU E CA    1 
ATOM   2335 C C     . GLU E 1 45 ? 62.361 -52.334 -8.084  1.00 71.02  ? 42  GLU E C     1 
ATOM   2336 O O     . GLU E 1 45 ? 61.425 -52.910 -7.546  1.00 78.22  ? 42  GLU E O     1 
ATOM   2337 C CB    . GLU E 1 45 ? 62.015 -50.890 -10.126 1.00 70.56  ? 42  GLU E CB    1 
ATOM   2338 C CG    . GLU E 1 45 ? 61.653 -49.533 -10.737 1.00 71.83  ? 42  GLU E CG    1 
ATOM   2339 C CD    . GLU E 1 45 ? 61.243 -49.615 -12.233 1.00 86.73  ? 42  GLU E CD    1 
ATOM   2340 O OE1   . GLU E 1 45 ? 60.266 -48.900 -12.641 1.00 80.75  ? 42  GLU E OE1   1 
ATOM   2341 O OE2   . GLU E 1 45 ? 61.887 -50.395 -13.012 1.00 73.28  ? 42  GLU E OE2   1 
ATOM   2342 N N     . ARG E 1 46 ? 63.571 -52.871 -8.188  1.00 66.32  ? 43  ARG E N     1 
ATOM   2343 C CA    . ARG E 1 46 ? 63.829 -54.215 -7.704  1.00 77.53  ? 43  ARG E CA    1 
ATOM   2344 C C     . ARG E 1 46 ? 63.967 -54.231 -6.203  1.00 86.05  ? 43  ARG E C     1 
ATOM   2345 O O     . ARG E 1 46 ? 63.032 -54.643 -5.506  1.00 101.00 ? 43  ARG E O     1 
ATOM   2346 C CB    . ARG E 1 46 ? 65.095 -54.819 -8.326  1.00 90.76  ? 43  ARG E CB    1 
ATOM   2347 C CG    . ARG E 1 46 ? 65.144 -56.345 -8.262  1.00 96.03  ? 43  ARG E CG    1 
ATOM   2348 C CD    . ARG E 1 46 ? 64.609 -56.981 -9.537  1.00 110.01 ? 43  ARG E CD    1 
ATOM   2349 N NE    . ARG E 1 46 ? 63.607 -56.144 -10.211 1.00 121.96 ? 43  ARG E NE    1 
ATOM   2350 C CZ    . ARG E 1 46 ? 62.308 -56.126 -9.918  1.00 124.30 ? 43  ARG E CZ    1 
ATOM   2351 N NH1   . ARG E 1 46 ? 61.826 -56.903 -8.954  1.00 123.40 ? 43  ARG E NH1   1 
ATOM   2352 N NH2   . ARG E 1 46 ? 61.489 -55.324 -10.592 1.00 131.17 ? 43  ARG E NH2   1 
ATOM   2353 N N     . ASN E 1 47 ? 65.120 -53.775 -5.707  1.00 85.71  ? 44  ASN E N     1 
ATOM   2354 C CA    . ASN E 1 47 ? 65.493 -53.965 -4.289  1.00 86.40  ? 44  ASN E CA    1 
ATOM   2355 C C     . ASN E 1 47 ? 64.788 -53.067 -3.282  1.00 85.31  ? 44  ASN E C     1 
ATOM   2356 O O     . ASN E 1 47 ? 64.885 -53.286 -2.066  1.00 71.39  ? 44  ASN E O     1 
ATOM   2357 C CB    . ASN E 1 47 ? 67.000 -53.841 -4.114  1.00 91.05  ? 44  ASN E CB    1 
ATOM   2358 C CG    . ASN E 1 47 ? 67.761 -54.511 -5.230  1.00 100.85 ? 44  ASN E CG    1 
ATOM   2359 O OD1   . ASN E 1 47 ? 68.805 -54.024 -5.657  1.00 102.89 ? 44  ASN E OD1   1 
ATOM   2360 N ND2   . ASN E 1 47 ? 67.227 -55.626 -5.731  1.00 112.51 ? 44  ASN E ND2   1 
ATOM   2361 N N     . SER E 1 48 ? 64.076 -52.064 -3.798  1.00 89.24  ? 45  SER E N     1 
ATOM   2362 C CA    . SER E 1 48 ? 63.397 -51.089 -2.960  1.00 92.55  ? 45  SER E CA    1 
ATOM   2363 C C     . SER E 1 48 ? 64.408 -50.132 -2.327  1.00 94.47  ? 45  SER E C     1 
ATOM   2364 O O     . SER E 1 48 ? 64.208 -49.716 -1.195  1.00 92.05  ? 45  SER E O     1 
ATOM   2365 C CB    . SER E 1 48 ? 62.605 -51.810 -1.861  1.00 95.23  ? 45  SER E CB    1 
ATOM   2366 O OG    . SER E 1 48 ? 61.372 -51.167 -1.596  1.00 101.00 ? 45  SER E OG    1 
ATOM   2367 N N     . ARG E 1 49 ? 65.493 -49.814 -3.050  1.00 86.68  ? 46  ARG E N     1 
ATOM   2368 C CA    . ARG E 1 49 ? 66.537 -48.880 -2.615  1.00 70.64  ? 46  ARG E CA    1 
ATOM   2369 C C     . ARG E 1 49 ? 65.983 -47.623 -1.985  1.00 75.17  ? 46  ARG E C     1 
ATOM   2370 O O     . ARG E 1 49 ? 64.836 -47.231 -2.291  1.00 86.36  ? 46  ARG E O     1 
ATOM   2371 C CB    . ARG E 1 49 ? 67.342 -48.455 -3.815  1.00 71.08  ? 46  ARG E CB    1 
ATOM   2372 C CG    . ARG E 1 49 ? 68.456 -49.433 -4.182  1.00 72.19  ? 46  ARG E CG    1 
ATOM   2373 C CD    . ARG E 1 49 ? 69.503 -48.763 -5.070  1.00 71.04  ? 46  ARG E CD    1 
ATOM   2374 N NE    . ARG E 1 49 ? 70.587 -48.111 -4.332  1.00 75.37  ? 46  ARG E NE    1 
ATOM   2375 C CZ    . ARG E 1 49 ? 71.890 -48.304 -4.582  1.00 83.73  ? 46  ARG E CZ    1 
ATOM   2376 N NH1   . ARG E 1 49 ? 72.268 -49.137 -5.543  1.00 79.63  ? 46  ARG E NH1   1 
ATOM   2377 N NH2   . ARG E 1 49 ? 72.828 -47.670 -3.875  1.00 79.98  ? 46  ARG E NH2   1 
ATOM   2378 N N     . ASN E 1 50 ? 66.771 -46.989 -1.109  1.00 66.08  ? 47  ASN E N     1 
ATOM   2379 C CA    . ASN E 1 50 ? 66.249 -45.878 -0.316  1.00 57.74  ? 47  ASN E CA    1 
ATOM   2380 C C     . ASN E 1 50 ? 66.686 -44.608 -0.921  1.00 55.47  ? 47  ASN E C     1 
ATOM   2381 O O     . ASN E 1 50 ? 67.697 -44.095 -0.511  1.00 80.72  ? 47  ASN E O     1 
ATOM   2382 C CB    . ASN E 1 50 ? 66.729 -45.951 1.142   1.00 55.49  ? 47  ASN E CB    1 
ATOM   2383 C CG    . ASN E 1 50 ? 66.315 -44.748 1.965   1.00 55.03  ? 47  ASN E CG    1 
ATOM   2384 O OD1   . ASN E 1 50 ? 65.526 -43.908 1.535   1.00 59.96  ? 47  ASN E OD1   1 
ATOM   2385 N ND2   . ASN E 1 50 ? 66.860 -44.658 3.164   1.00 60.31  ? 47  ASN E ND2   1 
ATOM   2386 N N     . LEU E 1 51 ? 65.932 -44.068 -1.861  1.00 46.14  ? 48  LEU E N     1 
ATOM   2387 C CA    . LEU E 1 51 ? 66.273 -42.766 -2.419  1.00 45.35  ? 48  LEU E CA    1 
ATOM   2388 C C     . LEU E 1 51 ? 66.118 -41.494 -1.507  1.00 55.54  ? 48  LEU E C     1 
ATOM   2389 O O     . LEU E 1 51 ? 65.854 -41.552 -0.264  1.00 46.24  ? 48  LEU E O     1 
ATOM   2390 C CB    . LEU E 1 51 ? 65.557 -42.579 -3.747  1.00 42.85  ? 48  LEU E CB    1 
ATOM   2391 C CG    . LEU E 1 51 ? 64.091 -42.326 -3.958  1.00 41.65  ? 48  LEU E CG    1 
ATOM   2392 C CD1   . LEU E 1 51 ? 63.746 -42.275 -5.437  1.00 39.32  ? 48  LEU E CD1   1 
ATOM   2393 C CD2   . LEU E 1 51 ? 63.320 -43.435 -3.321  1.00 51.12  ? 48  LEU E CD2   1 
ATOM   2394 N N     . THR E 1 52 ? 66.347 -40.338 -2.137  1.00 65.37  ? 49  THR E N     1 
ATOM   2395 C CA    . THR E 1 52 ? 66.203 -39.023 -1.485  1.00 57.56  ? 49  THR E CA    1 
ATOM   2396 C C     . THR E 1 52 ? 65.039 -38.411 -2.125  1.00 51.77  ? 49  THR E C     1 
ATOM   2397 O O     . THR E 1 52 ? 64.668 -38.819 -3.209  1.00 50.23  ? 49  THR E O     1 
ATOM   2398 C CB    . THR E 1 52 ? 67.374 -38.065 -1.780  1.00 54.52  ? 49  THR E CB    1 
ATOM   2399 O OG1   . THR E 1 52 ? 67.578 -37.947 -3.209  1.00 44.22  ? 49  THR E OG1   1 
ATOM   2400 C CG2   . THR E 1 52 ? 68.620 -38.551 -1.079  1.00 50.59  ? 49  THR E CG2   1 
ATOM   2401 N N     . ILE E 1 53 ? 64.513 -37.387 -1.470  1.00 56.16  ? 50  ILE E N     1 
ATOM   2402 C CA    . ILE E 1 53 ? 63.390 -36.602 -1.980  1.00 55.06  ? 50  ILE E CA    1 
ATOM   2403 C C     . ILE E 1 53 ? 63.826 -35.902 -3.250  1.00 58.68  ? 50  ILE E C     1 
ATOM   2404 O O     . ILE E 1 53 ? 63.034 -35.828 -4.182  1.00 64.40  ? 50  ILE E O     1 
ATOM   2405 C CB    . ILE E 1 53 ? 62.877 -35.595 -0.926  1.00 56.39  ? 50  ILE E CB    1 
ATOM   2406 C CG1   . ILE E 1 53 ? 62.451 -36.294 0.404   1.00 48.89  ? 50  ILE E CG1   1 
ATOM   2407 C CG2   . ILE E 1 53 ? 61.804 -34.673 -1.482  1.00 64.38  ? 50  ILE E CG2   1 
ATOM   2408 C CD1   . ILE E 1 53 ? 61.156 -37.070 0.405   1.00 37.33  ? 50  ILE E CD1   1 
ATOM   2409 N N     . LYS E 1 54 ? 65.090 -35.448 -3.327  1.00 63.77  ? 51  LYS E N     1 
ATOM   2410 C CA    . LYS E 1 54 ? 65.582 -34.818 -4.568  1.00 63.32  ? 51  LYS E CA    1 
ATOM   2411 C C     . LYS E 1 54 ? 65.413 -35.759 -5.737  1.00 58.06  ? 51  LYS E C     1 
ATOM   2412 O O     . LYS E 1 54 ? 64.697 -35.422 -6.684  1.00 51.66  ? 51  LYS E O     1 
ATOM   2413 C CB    . LYS E 1 54 ? 67.020 -34.338 -4.461  1.00 79.50  ? 51  LYS E CB    1 
ATOM   2414 C CG    . LYS E 1 54 ? 67.177 -32.820 -4.554  1.00 106.38 ? 51  LYS E CG    1 
ATOM   2415 C CD    . LYS E 1 54 ? 68.547 -32.355 -4.049  1.00 129.46 ? 51  LYS E CD    1 
ATOM   2416 C CE    . LYS E 1 54 ? 68.480 -31.026 -3.293  1.00 124.65 ? 51  LYS E CE    1 
ATOM   2417 N NZ    . LYS E 1 54 ? 69.592 -30.872 -2.306  1.00 126.51 ? 51  LYS E NZ    1 
ATOM   2418 N N     . SER E 1 55 ? 66.027 -36.950 -5.604  1.00 57.92  ? 52  SER E N     1 
ATOM   2419 C CA    . SER E 1 55 ? 65.932 -38.100 -6.537  1.00 49.15  ? 52  SER E CA    1 
ATOM   2420 C C     . SER E 1 55 ? 64.500 -38.396 -6.852  1.00 44.40  ? 52  SER E C     1 
ATOM   2421 O O     . SER E 1 55 ? 64.087 -38.404 -8.015  1.00 41.37  ? 52  SER E O     1 
ATOM   2422 C CB    . SER E 1 55 ? 66.529 -39.352 -5.912  1.00 51.88  ? 52  SER E CB    1 
ATOM   2423 O OG    . SER E 1 55 ? 67.948 -39.321 -5.895  1.00 59.93  ? 52  SER E OG    1 
ATOM   2424 N N     . LEU E 1 56 ? 63.695 -38.598 -5.825  1.00 43.34  ? 53  LEU E N     1 
ATOM   2425 C CA    . LEU E 1 56 ? 62.299 -38.829 -6.113  1.00 46.96  ? 53  LEU E CA    1 
ATOM   2426 C C     . LEU E 1 56 ? 61.794 -37.702 -7.015  1.00 50.96  ? 53  LEU E C     1 
ATOM   2427 O O     . LEU E 1 56 ? 61.312 -37.995 -8.121  1.00 47.84  ? 53  LEU E O     1 
ATOM   2428 C CB    . LEU E 1 56 ? 61.446 -38.999 -4.860  1.00 50.46  ? 53  LEU E CB    1 
ATOM   2429 C CG    . LEU E 1 56 ? 59.930 -38.798 -5.134  1.00 63.64  ? 53  LEU E CG    1 
ATOM   2430 C CD1   . LEU E 1 56 ? 59.236 -40.002 -5.765  1.00 61.55  ? 53  LEU E CD1   1 
ATOM   2431 C CD2   . LEU E 1 56 ? 59.184 -38.379 -3.865  1.00 68.34  ? 53  LEU E CD2   1 
ATOM   2432 N N     . GLU E 1 57 ? 61.993 -36.435 -6.584  1.00 50.75  ? 54  GLU E N     1 
ATOM   2433 C CA    . GLU E 1 57 ? 61.302 -35.290 -7.173  1.00 44.11  ? 54  GLU E CA    1 
ATOM   2434 C C     . GLU E 1 57 ? 61.683 -35.125 -8.609  1.00 44.51  ? 54  GLU E C     1 
ATOM   2435 O O     . GLU E 1 57 ? 60.863 -34.708 -9.460  1.00 37.22  ? 54  GLU E O     1 
ATOM   2436 C CB    . GLU E 1 57 ? 61.642 -34.023 -6.471  1.00 48.82  ? 54  GLU E CB    1 
ATOM   2437 C CG    . GLU E 1 57 ? 60.731 -32.892 -6.926  1.00 50.50  ? 54  GLU E CG    1 
ATOM   2438 C CD    . GLU E 1 57 ? 61.418 -31.547 -6.824  1.00 57.28  ? 54  GLU E CD    1 
ATOM   2439 O OE1   . GLU E 1 57 ? 62.610 -31.453 -7.229  1.00 52.60  ? 54  GLU E OE1   1 
ATOM   2440 O OE2   . GLU E 1 57 ? 60.766 -30.594 -6.336  1.00 63.63  ? 54  GLU E OE2   1 
ATOM   2441 N N     . LEU E 1 58 ? 62.952 -35.438 -8.868  1.00 43.49  ? 55  LEU E N     1 
ATOM   2442 C CA    . LEU E 1 58 ? 63.388 -35.670 -10.230 1.00 45.08  ? 55  LEU E CA    1 
ATOM   2443 C C     . LEU E 1 58 ? 62.469 -36.718 -10.816 1.00 46.63  ? 55  LEU E C     1 
ATOM   2444 O O     . LEU E 1 58 ? 61.740 -36.403 -11.771 1.00 52.67  ? 55  LEU E O     1 
ATOM   2445 C CB    . LEU E 1 58 ? 64.848 -36.128 -10.324 1.00 40.20  ? 55  LEU E CB    1 
ATOM   2446 C CG    . LEU E 1 58 ? 65.969 -35.159 -9.961  1.00 39.25  ? 55  LEU E CG    1 
ATOM   2447 C CD1   . LEU E 1 58 ? 67.275 -35.927 -10.181 1.00 38.44  ? 55  LEU E CD1   1 
ATOM   2448 C CD2   . LEU E 1 58 ? 65.944 -33.847 -10.750 1.00 37.45  ? 55  LEU E CD2   1 
ATOM   2449 N N     . ILE E 1 59 ? 62.471 -37.938 -10.253 1.00 41.41  ? 56  ILE E N     1 
ATOM   2450 C CA    . ILE E 1 59 ? 61.776 -39.060 -10.933 1.00 44.57  ? 56  ILE E CA    1 
ATOM   2451 C C     . ILE E 1 59 ? 60.349 -38.699 -11.352 1.00 45.38  ? 56  ILE E C     1 
ATOM   2452 O O     . ILE E 1 59 ? 60.008 -38.825 -12.506 1.00 47.28  ? 56  ILE E O     1 
ATOM   2453 C CB    . ILE E 1 59 ? 61.774 -40.353 -10.134 1.00 42.15  ? 56  ILE E CB    1 
ATOM   2454 C CG1   . ILE E 1 59 ? 63.145 -40.988 -10.191 1.00 44.57  ? 56  ILE E CG1   1 
ATOM   2455 C CG2   . ILE E 1 59 ? 60.781 -41.317 -10.730 1.00 38.49  ? 56  ILE E CG2   1 
ATOM   2456 C CD1   . ILE E 1 59 ? 63.531 -41.745 -8.910  1.00 48.26  ? 56  ILE E CD1   1 
ATOM   2457 N N     . MET E 1 60 ? 59.549 -38.203 -10.422 1.00 49.98  ? 57  MET E N     1 
ATOM   2458 C CA    . MET E 1 60 ? 58.289 -37.532 -10.765 1.00 61.91  ? 57  MET E CA    1 
ATOM   2459 C C     . MET E 1 60 ? 58.365 -36.472 -11.883 1.00 64.12  ? 57  MET E C     1 
ATOM   2460 O O     . MET E 1 60 ? 57.399 -36.316 -12.623 1.00 67.83  ? 57  MET E O     1 
ATOM   2461 C CB    . MET E 1 60 ? 57.692 -36.833 -9.546  1.00 67.21  ? 57  MET E CB    1 
ATOM   2462 C CG    . MET E 1 60 ? 56.811 -37.674 -8.653  1.00 68.76  ? 57  MET E CG    1 
ATOM   2463 S SD    . MET E 1 60 ? 56.334 -36.607 -7.284  1.00 76.27  ? 57  MET E SD    1 
ATOM   2464 C CE    . MET E 1 60 ? 57.929 -36.212 -6.591  1.00 77.18  ? 57  MET E CE    1 
ATOM   2465 N N     . LYS E 1 61 ? 59.457 -35.710 -11.977 1.00 62.41  ? 58  LYS E N     1 
ATOM   2466 C CA    . LYS E 1 61 ? 59.607 -34.795 -13.106 1.00 63.10  ? 58  LYS E CA    1 
ATOM   2467 C C     . LYS E 1 61 ? 59.630 -35.659 -14.320 1.00 57.44  ? 58  LYS E C     1 
ATOM   2468 O O     . LYS E 1 61 ? 58.945 -35.375 -15.305 1.00 57.92  ? 58  LYS E O     1 
ATOM   2469 C CB    . LYS E 1 61 ? 60.896 -33.948 -13.037 1.00 72.20  ? 58  LYS E CB    1 
ATOM   2470 C CG    . LYS E 1 61 ? 61.026 -32.911 -14.163 1.00 67.52  ? 58  LYS E CG    1 
ATOM   2471 C CD    . LYS E 1 61 ? 61.495 -31.567 -13.646 1.00 68.39  ? 58  LYS E CD    1 
ATOM   2472 C CE    . LYS E 1 61 ? 60.436 -30.980 -12.720 1.00 76.13  ? 58  LYS E CE    1 
ATOM   2473 N NZ    . LYS E 1 61 ? 61.025 -30.133 -11.644 1.00 76.99  ? 58  LYS E NZ    1 
ATOM   2474 N N     . GLY E 1 62 ? 60.410 -36.733 -14.217 1.00 61.21  ? 59  GLY E N     1 
ATOM   2475 C CA    . GLY E 1 62 ? 60.629 -37.669 -15.335 1.00 72.40  ? 59  GLY E CA    1 
ATOM   2476 C C     . GLY E 1 62 ? 59.366 -38.323 -15.863 1.00 64.16  ? 59  GLY E C     1 
ATOM   2477 O O     . GLY E 1 62 ? 59.053 -38.244 -17.059 1.00 66.35  ? 59  GLY E O     1 
ATOM   2478 N N     . LEU E 1 63 ? 58.640 -38.948 -14.946 1.00 57.44  ? 60  LEU E N     1 
ATOM   2479 C CA    . LEU E 1 63 ? 57.318 -39.498 -15.213 1.00 58.66  ? 60  LEU E CA    1 
ATOM   2480 C C     . LEU E 1 63 ? 56.330 -38.514 -15.801 1.00 61.16  ? 60  LEU E C     1 
ATOM   2481 O O     . LEU E 1 63 ? 55.304 -38.943 -16.308 1.00 66.72  ? 60  LEU E O     1 
ATOM   2482 C CB    . LEU E 1 63 ? 56.732 -40.110 -13.937 1.00 55.87  ? 60  LEU E CB    1 
ATOM   2483 C CG    . LEU E 1 63 ? 57.410 -41.418 -13.482 1.00 57.88  ? 60  LEU E CG    1 
ATOM   2484 C CD1   . LEU E 1 63 ? 56.905 -41.821 -12.101 1.00 50.17  ? 60  LEU E CD1   1 
ATOM   2485 C CD2   . LEU E 1 63 ? 57.269 -42.555 -14.506 1.00 55.30  ? 60  LEU E CD2   1 
ATOM   2486 N N     . GLU E 1 64 ? 56.667 -37.218 -15.763 1.00 68.32  ? 61  GLU E N     1 
ATOM   2487 C CA    . GLU E 1 64 ? 55.742 -36.092 -16.020 1.00 65.08  ? 61  GLU E CA    1 
ATOM   2488 C C     . GLU E 1 64 ? 54.363 -36.279 -15.335 1.00 70.74  ? 61  GLU E C     1 
ATOM   2489 O O     . GLU E 1 64 ? 53.279 -36.181 -15.960 1.00 70.55  ? 61  GLU E O     1 
ATOM   2490 C CB    . GLU E 1 64 ? 55.646 -35.764 -17.509 1.00 71.50  ? 61  GLU E CB    1 
ATOM   2491 C CG    . GLU E 1 64 ? 56.860 -35.026 -18.060 1.00 86.35  ? 61  GLU E CG    1 
ATOM   2492 C CD    . GLU E 1 64 ? 57.233 -35.418 -19.500 1.00 93.67  ? 61  GLU E CD    1 
ATOM   2493 O OE1   . GLU E 1 64 ? 56.430 -36.096 -20.195 1.00 75.75  ? 61  GLU E OE1   1 
ATOM   2494 O OE2   . GLU E 1 64 ? 58.359 -35.047 -19.938 1.00 98.22  ? 61  GLU E OE2   1 
ATOM   2495 N N     . VAL E 1 65 ? 54.443 -36.582 -14.038 1.00 67.08  ? 62  VAL E N     1 
ATOM   2496 C CA    . VAL E 1 65 ? 53.298 -36.601 -13.139 1.00 73.93  ? 62  VAL E CA    1 
ATOM   2497 C C     . VAL E 1 65 ? 53.490 -35.483 -12.107 1.00 83.20  ? 62  VAL E C     1 
ATOM   2498 O O     . VAL E 1 65 ? 54.624 -35.235 -11.664 1.00 87.76  ? 62  VAL E O     1 
ATOM   2499 C CB    . VAL E 1 65 ? 53.162 -37.973 -12.422 1.00 70.19  ? 62  VAL E CB    1 
ATOM   2500 C CG1   . VAL E 1 65 ? 54.375 -38.289 -11.571 1.00 71.64  ? 62  VAL E CG1   1 
ATOM   2501 C CG2   . VAL E 1 65 ? 51.965 -37.972 -11.509 1.00 74.00  ? 62  VAL E CG2   1 
ATOM   2502 N N     . SER E 1 66 ? 52.407 -34.807 -11.717 1.00 84.98  ? 63  SER E N     1 
ATOM   2503 C CA    . SER E 1 66 ? 52.508 -33.861 -10.590 1.00 83.95  ? 63  SER E CA    1 
ATOM   2504 C C     . SER E 1 66 ? 52.522 -34.592 -9.235  1.00 81.63  ? 63  SER E C     1 
ATOM   2505 O O     . SER E 1 66 ? 51.872 -35.629 -9.064  1.00 83.27  ? 63  SER E O     1 
ATOM   2506 C CB    . SER E 1 66 ? 51.431 -32.763 -10.638 1.00 73.45  ? 63  SER E CB    1 
ATOM   2507 O OG    . SER E 1 66 ? 50.250 -33.133 -9.944  1.00 71.18  ? 63  SER E OG    1 
ATOM   2508 N N     . ASP E 1 67 ? 53.273 -34.041 -8.287  1.00 76.75  ? 64  ASP E N     1 
ATOM   2509 C CA    . ASP E 1 67 ? 53.365 -34.600 -6.947  1.00 79.26  ? 64  ASP E CA    1 
ATOM   2510 C C     . ASP E 1 67 ? 51.988 -34.942 -6.427  1.00 85.17  ? 64  ASP E C     1 
ATOM   2511 O O     . ASP E 1 67 ? 51.735 -36.055 -5.979  1.00 85.57  ? 64  ASP E O     1 
ATOM   2512 C CB    . ASP E 1 67 ? 54.023 -33.598 -5.987  1.00 77.10  ? 64  ASP E CB    1 
ATOM   2513 C CG    . ASP E 1 67 ? 55.151 -32.820 -6.636  1.00 75.61  ? 64  ASP E CG    1 
ATOM   2514 O OD1   . ASP E 1 67 ? 54.821 -31.817 -7.294  1.00 85.07  ? 64  ASP E OD1   1 
ATOM   2515 O OD2   . ASP E 1 67 ? 56.344 -33.210 -6.502  1.00 60.25  ? 64  ASP E OD2   1 
ATOM   2516 N N     . VAL E 1 68 ? 51.100 -33.956 -6.483  1.00 91.22  ? 65  VAL E N     1 
ATOM   2517 C CA    . VAL E 1 68 ? 49.736 -34.096 -6.014  1.00 80.73  ? 65  VAL E CA    1 
ATOM   2518 C C     . VAL E 1 68 ? 49.193 -35.441 -6.463  1.00 81.81  ? 65  VAL E C     1 
ATOM   2519 O O     . VAL E 1 68 ? 48.425 -36.082 -5.748  1.00 81.58  ? 65  VAL E O     1 
ATOM   2520 C CB    . VAL E 1 68 ? 48.832 -32.995 -6.620  1.00 77.92  ? 65  VAL E CB    1 
ATOM   2521 C CG1   . VAL E 1 68 ? 47.636 -32.773 -5.719  1.00 85.12  ? 65  VAL E CG1   1 
ATOM   2522 C CG2   . VAL E 1 68 ? 49.593 -31.689 -6.799  1.00 76.88  ? 65  VAL E CG2   1 
ATOM   2523 N N     . VAL E 1 69 ? 49.591 -35.852 -7.664  1.00 76.19  ? 66  VAL E N     1 
ATOM   2524 C CA    . VAL E 1 69 ? 49.091 -37.079 -8.259  1.00 74.50  ? 66  VAL E CA    1 
ATOM   2525 C C     . VAL E 1 69 ? 49.894 -38.284 -7.767  1.00 70.47  ? 66  VAL E C     1 
ATOM   2526 O O     . VAL E 1 69 ? 49.327 -39.309 -7.420  1.00 72.28  ? 66  VAL E O     1 
ATOM   2527 C CB    . VAL E 1 69 ? 49.111 -36.995 -9.793  1.00 69.28  ? 66  VAL E CB    1 
ATOM   2528 C CG1   . VAL E 1 69 ? 48.376 -38.184 -10.394 1.00 65.63  ? 66  VAL E CG1   1 
ATOM   2529 C CG2   . VAL E 1 69 ? 48.518 -35.665 -10.253 1.00 61.98  ? 66  VAL E CG2   1 
ATOM   2530 N N     . PHE E 1 70 ? 51.214 -38.154 -7.749  1.00 69.37  ? 67  PHE E N     1 
ATOM   2531 C CA    . PHE E 1 70 ? 52.074 -39.219 -7.276  1.00 69.91  ? 67  PHE E CA    1 
ATOM   2532 C C     . PHE E 1 70 ? 51.608 -39.644 -5.905  1.00 72.75  ? 67  PHE E C     1 
ATOM   2533 O O     . PHE E 1 70 ? 51.472 -40.830 -5.617  1.00 74.75  ? 67  PHE E O     1 
ATOM   2534 C CB    . PHE E 1 70 ? 53.536 -38.775 -7.211  1.00 71.50  ? 67  PHE E CB    1 
ATOM   2535 C CG    . PHE E 1 70 ? 54.510 -39.907 -6.902  1.00 70.99  ? 67  PHE E CG    1 
ATOM   2536 C CD1   . PHE E 1 70 ? 54.854 -40.216 -5.603  1.00 66.68  ? 67  PHE E CD1   1 
ATOM   2537 C CD2   . PHE E 1 70 ? 55.073 -40.657 -7.919  1.00 71.21  ? 67  PHE E CD2   1 
ATOM   2538 C CE1   . PHE E 1 70 ? 55.718 -41.252 -5.332  1.00 72.27  ? 67  PHE E CE1   1 
ATOM   2539 C CE2   . PHE E 1 70 ? 55.944 -41.690 -7.655  1.00 72.03  ? 67  PHE E CE2   1 
ATOM   2540 C CZ    . PHE E 1 70 ? 56.265 -41.992 -6.357  1.00 74.24  ? 67  PHE E CZ    1 
ATOM   2541 N N     . PHE E 1 71 ? 51.345 -38.661 -5.063  1.00 80.58  ? 68  PHE E N     1 
ATOM   2542 C CA    . PHE E 1 71 ? 51.001 -38.935 -3.676  1.00 86.73  ? 68  PHE E CA    1 
ATOM   2543 C C     . PHE E 1 71 ? 49.569 -39.488 -3.537  1.00 92.31  ? 68  PHE E C     1 
ATOM   2544 O O     . PHE E 1 71 ? 49.352 -40.504 -2.854  1.00 85.23  ? 68  PHE E O     1 
ATOM   2545 C CB    . PHE E 1 71 ? 51.202 -37.677 -2.825  1.00 86.03  ? 68  PHE E CB    1 
ATOM   2546 C CG    . PHE E 1 71 ? 52.641 -37.220 -2.720  1.00 85.80  ? 68  PHE E CG    1 
ATOM   2547 C CD1   . PHE E 1 71 ? 53.627 -38.042 -2.127  1.00 91.56  ? 68  PHE E CD1   1 
ATOM   2548 C CD2   . PHE E 1 71 ? 53.018 -35.956 -3.178  1.00 77.94  ? 68  PHE E CD2   1 
ATOM   2549 C CE1   . PHE E 1 71 ? 54.954 -37.615 -2.009  1.00 74.91  ? 68  PHE E CE1   1 
ATOM   2550 C CE2   . PHE E 1 71 ? 54.334 -35.530 -3.067  1.00 77.31  ? 68  PHE E CE2   1 
ATOM   2551 C CZ    . PHE E 1 71 ? 55.299 -36.354 -2.478  1.00 76.29  ? 68  PHE E CZ    1 
ATOM   2552 N N     . GLU E 1 72 ? 48.608 -38.830 -4.201  1.00 96.17  ? 69  GLU E N     1 
ATOM   2553 C CA    . GLU E 1 72 ? 47.207 -39.270 -4.183  1.00 81.45  ? 69  GLU E CA    1 
ATOM   2554 C C     . GLU E 1 72 ? 47.265 -40.735 -4.551  1.00 73.33  ? 69  GLU E C     1 
ATOM   2555 O O     . GLU E 1 72 ? 46.723 -41.588 -3.843  1.00 75.56  ? 69  GLU E O     1 
ATOM   2556 C CB    . GLU E 1 72 ? 46.340 -38.466 -5.168  1.00 75.56  ? 69  GLU E CB    1 
ATOM   2557 C CG    . GLU E 1 72 ? 45.937 -37.074 -4.673  1.00 84.94  ? 69  GLU E CG    1 
ATOM   2558 C CD    . GLU E 1 72 ? 45.181 -36.230 -5.721  1.00 105.22 ? 69  GLU E CD    1 
ATOM   2559 O OE1   . GLU E 1 72 ? 44.814 -36.756 -6.804  1.00 120.47 ? 69  GLU E OE1   1 
ATOM   2560 O OE2   . GLU E 1 72 ? 44.929 -35.022 -5.466  1.00 98.42  ? 69  GLU E OE2   1 
ATOM   2561 N N     . MET E 1 73 ? 48.001 -41.012 -5.620  1.00 66.71  ? 70  MET E N     1 
ATOM   2562 C CA    . MET E 1 73 ? 48.232 -42.369 -6.107  1.00 72.08  ? 70  MET E CA    1 
ATOM   2563 C C     . MET E 1 73 ? 48.858 -43.292 -5.071  1.00 71.48  ? 70  MET E C     1 
ATOM   2564 O O     . MET E 1 73 ? 48.443 -44.461 -4.946  1.00 62.07  ? 70  MET E O     1 
ATOM   2565 C CB    . MET E 1 73 ? 49.133 -42.332 -7.332  1.00 75.59  ? 70  MET E CB    1 
ATOM   2566 C CG    . MET E 1 73 ? 48.409 -42.137 -8.642  1.00 78.51  ? 70  MET E CG    1 
ATOM   2567 S SD    . MET E 1 73 ? 49.174 -43.285 -9.791  1.00 83.02  ? 70  MET E SD    1 
ATOM   2568 C CE    . MET E 1 73 ? 48.798 -44.848 -8.971  1.00 80.74  ? 70  MET E CE    1 
ATOM   2569 N N     . LEU E 1 74 ? 49.874 -42.760 -4.366  1.00 75.21  ? 71  LEU E N     1 
ATOM   2570 C CA    . LEU E 1 74 ? 50.581 -43.475 -3.293  1.00 71.38  ? 71  LEU E CA    1 
ATOM   2571 C C     . LEU E 1 74 ? 49.632 -43.781 -2.126  1.00 76.27  ? 71  LEU E C     1 
ATOM   2572 O O     . LEU E 1 74 ? 49.513 -44.946 -1.696  1.00 80.75  ? 71  LEU E O     1 
ATOM   2573 C CB    . LEU E 1 74 ? 51.814 -42.707 -2.815  1.00 58.35  ? 71  LEU E CB    1 
ATOM   2574 C CG    . LEU E 1 74 ? 52.720 -43.347 -1.737  1.00 58.31  ? 71  LEU E CG    1 
ATOM   2575 C CD1   . LEU E 1 74 ? 53.479 -44.583 -2.201  1.00 56.48  ? 71  LEU E CD1   1 
ATOM   2576 C CD2   . LEU E 1 74 ? 53.702 -42.362 -1.131  1.00 53.32  ? 71  LEU E CD2   1 
ATOM   2577 N N     . ILE E 1 75 ? 48.929 -42.755 -1.645  1.00 74.57  ? 72  ILE E N     1 
ATOM   2578 C CA    . ILE E 1 75 ? 47.981 -42.935 -0.530  1.00 81.01  ? 72  ILE E CA    1 
ATOM   2579 C C     . ILE E 1 75 ? 47.157 -44.228 -0.699  1.00 85.54  ? 72  ILE E C     1 
ATOM   2580 O O     . ILE E 1 75 ? 47.086 -45.051 0.234   1.00 76.10  ? 72  ILE E O     1 
ATOM   2581 C CB    . ILE E 1 75 ? 47.066 -41.703 -0.326  1.00 76.39  ? 72  ILE E CB    1 
ATOM   2582 C CG1   . ILE E 1 75 ? 47.907 -40.429 -0.307  1.00 79.12  ? 72  ILE E CG1   1 
ATOM   2583 C CG2   . ILE E 1 75 ? 46.256 -41.825 0.962   1.00 65.36  ? 72  ILE E CG2   1 
ATOM   2584 C CD1   . ILE E 1 75 ? 47.086 -39.169 -0.127  1.00 102.33 ? 72  ILE E CD1   1 
ATOM   2585 N N     . LYS E 1 76 ? 46.583 -44.407 -1.897  1.00 82.76  ? 73  LYS E N     1 
ATOM   2586 C CA    . LYS E 1 76 ? 45.795 -45.588 -2.225  1.00 87.04  ? 73  LYS E CA    1 
ATOM   2587 C C     . LYS E 1 76 ? 46.513 -46.907 -1.960  1.00 90.12  ? 73  LYS E C     1 
ATOM   2588 O O     . LYS E 1 76 ? 45.932 -47.816 -1.369  1.00 106.69 ? 73  LYS E O     1 
ATOM   2589 C CB    . LYS E 1 76 ? 45.343 -45.558 -3.674  1.00 86.67  ? 73  LYS E CB    1 
ATOM   2590 C CG    . LYS E 1 76 ? 44.132 -44.691 -3.919  1.00 96.48  ? 73  LYS E CG    1 
ATOM   2591 C CD    . LYS E 1 76 ? 43.902 -44.563 -5.414  1.00 102.71 ? 73  LYS E CD    1 
ATOM   2592 C CE    . LYS E 1 76 ? 43.482 -43.145 -5.800  1.00 112.72 ? 73  LYS E CE    1 
ATOM   2593 N NZ    . LYS E 1 76 ? 43.744 -42.836 -7.241  1.00 100.74 ? 73  LYS E NZ    1 
ATOM   2594 N N     . GLU E 1 77 ? 47.762 -47.028 -2.374  1.00 77.70  ? 74  GLU E N     1 
ATOM   2595 C CA    . GLU E 1 77 ? 48.394 -48.321 -2.254  1.00 89.49  ? 74  GLU E CA    1 
ATOM   2596 C C     . GLU E 1 77 ? 48.861 -48.676 -0.817  1.00 101.38 ? 74  GLU E C     1 
ATOM   2597 O O     . GLU E 1 77 ? 49.320 -49.799 -0.565  1.00 110.68 ? 74  GLU E O     1 
ATOM   2598 C CB    . GLU E 1 77 ? 49.499 -48.457 -3.296  1.00 102.33 ? 74  GLU E CB    1 
ATOM   2599 C CG    . GLU E 1 77 ? 49.028 -48.169 -4.720  1.00 110.31 ? 74  GLU E CG    1 
ATOM   2600 C CD    . GLU E 1 77 ? 48.055 -49.212 -5.252  1.00 119.52 ? 74  GLU E CD    1 
ATOM   2601 O OE1   . GLU E 1 77 ? 48.199 -50.409 -4.911  1.00 133.38 ? 74  GLU E OE1   1 
ATOM   2602 O OE2   . GLU E 1 77 ? 47.147 -48.837 -6.022  1.00 109.42 ? 74  GLU E OE2   1 
ATOM   2603 N N     . ILE E 1 78 ? 48.739 -47.732 0.120   1.00 99.31  ? 75  ILE E N     1 
ATOM   2604 C CA    . ILE E 1 78 ? 48.891 -48.061 1.552   1.00 105.36 ? 75  ILE E CA    1 
ATOM   2605 C C     . ILE E 1 78 ? 47.587 -48.610 2.160   1.00 98.43  ? 75  ILE E C     1 
ATOM   2606 O O     . ILE E 1 78 ? 47.609 -49.665 2.803   1.00 91.23  ? 75  ILE E O     1 
ATOM   2607 C CB    . ILE E 1 78 ? 49.424 -46.898 2.449   1.00 110.52 ? 75  ILE E CB    1 
ATOM   2608 C CG1   . ILE E 1 78 ? 49.330 -45.529 1.761   1.00 111.47 ? 75  ILE E CG1   1 
ATOM   2609 C CG2   . ILE E 1 78 ? 50.830 -47.186 2.953   1.00 103.30 ? 75  ILE E CG2   1 
ATOM   2610 C CD1   . ILE E 1 78 ? 50.531 -45.166 0.922   1.00 108.24 ? 75  ILE E CD1   1 
ATOM   2611 N N     . LEU E 1 79 ? 46.474 -47.895 1.960   1.00 92.77  ? 76  LEU E N     1 
ATOM   2612 C CA    . LEU E 1 79 ? 45.145 -48.378 2.370   1.00 85.13  ? 76  LEU E CA    1 
ATOM   2613 C C     . LEU E 1 79 ? 44.887 -49.639 1.592   1.00 87.03  ? 76  LEU E C     1 
ATOM   2614 O O     . LEU E 1 79 ? 44.107 -49.633 0.650   1.00 78.27  ? 76  LEU E O     1 
ATOM   2615 C CB    . LEU E 1 79 ? 44.025 -47.379 2.054   1.00 66.84  ? 76  LEU E CB    1 
ATOM   2616 C CG    . LEU E 1 79 ? 44.251 -45.943 1.606   1.00 60.35  ? 76  LEU E CG    1 
ATOM   2617 C CD1   . LEU E 1 79 ? 43.162 -45.635 0.623   1.00 56.54  ? 76  LEU E CD1   1 
ATOM   2618 C CD2   . LEU E 1 79 ? 44.183 -44.936 2.732   1.00 54.86  ? 76  LEU E CD2   1 
ATOM   2619 N N     . LYS E 1 80 ? 45.586 -50.707 1.980   1.00 94.21  ? 77  LYS E N     1 
ATOM   2620 C CA    . LYS E 1 80 ? 45.690 -51.921 1.174   1.00 84.93  ? 77  LYS E CA    1 
ATOM   2621 C C     . LYS E 1 80 ? 45.521 -53.168 2.014   1.00 89.24  ? 77  LYS E C     1 
ATOM   2622 O O     . LYS E 1 80 ? 46.410 -54.022 2.046   1.00 95.67  ? 77  LYS E O     1 
ATOM   2623 C CB    . LYS E 1 80 ? 47.013 -51.943 0.405   1.00 71.17  ? 77  LYS E CB    1 
ATOM   2624 C CG    . LYS E 1 80 ? 46.837 -52.257 -1.078  1.00 79.09  ? 77  LYS E CG    1 
ATOM   2625 C CD    . LYS E 1 80 ? 45.461 -51.787 -1.585  1.00 79.03  ? 77  LYS E CD    1 
ATOM   2626 C CE    . LYS E 1 80 ? 45.266 -51.924 -3.095  1.00 81.12  ? 77  LYS E CE    1 
ATOM   2627 N NZ    . LYS E 1 80 ? 45.345 -53.316 -3.638  1.00 79.72  ? 77  LYS E NZ    1 
ATOM   2628 N N     . HIS E 1 81 ? 44.360 -53.256 2.672   1.00 97.35  ? 78  HIS E N     1 
ATOM   2629 C CA    . HIS E 1 81 ? 43.990 -54.359 3.580   1.00 106.86 ? 78  HIS E CA    1 
ATOM   2630 C C     . HIS E 1 81 ? 43.792 -55.720 2.887   1.00 105.20 ? 78  HIS E C     1 
ATOM   2631 O O     . HIS E 1 81 ? 44.582 -56.660 3.073   1.00 89.22  ? 78  HIS E O     1 
ATOM   2632 C CB    . HIS E 1 81 ? 42.733 -53.983 4.393   1.00 108.66 ? 78  HIS E CB    1 
ATOM   2633 C CG    . HIS E 1 81 ? 43.024 -53.549 5.802   1.00 111.39 ? 78  HIS E CG    1 
ATOM   2634 N ND1   . HIS E 1 81 ? 42.786 -54.359 6.896   1.00 113.51 ? 78  HIS E ND1   1 
ATOM   2635 C CD2   . HIS E 1 81 ? 43.546 -52.397 6.293   1.00 107.69 ? 78  HIS E CD2   1 
ATOM   2636 C CE1   . HIS E 1 81 ? 43.152 -53.727 7.998   1.00 111.51 ? 78  HIS E CE1   1 
ATOM   2637 N NE2   . HIS E 1 81 ? 43.612 -52.534 7.661   1.00 110.33 ? 78  HIS E NE2   1 
ATOM   2638 N N     . GLU F 1 5  ? 67.699 -24.153 -5.377  1.00 79.35  ? 2   GLU F N     1 
ATOM   2639 C CA    . GLU F 1 5  ? 66.680 -24.624 -4.374  1.00 83.20  ? 2   GLU F CA    1 
ATOM   2640 C C     . GLU F 1 5  ? 65.577 -25.459 -5.040  1.00 78.89  ? 2   GLU F C     1 
ATOM   2641 O O     . GLU F 1 5  ? 65.291 -25.284 -6.222  1.00 80.29  ? 2   GLU F O     1 
ATOM   2642 C CB    . GLU F 1 5  ? 66.092 -23.452 -3.536  1.00 82.11  ? 2   GLU F CB    1 
ATOM   2643 C CG    . GLU F 1 5  ? 66.610 -23.325 -2.075  1.00 77.20  ? 2   GLU F CG    1 
ATOM   2644 C CD    . GLU F 1 5  ? 65.590 -23.738 -0.969  1.00 82.09  ? 2   GLU F CD    1 
ATOM   2645 O OE1   . GLU F 1 5  ? 64.393 -23.985 -1.291  1.00 79.01  ? 2   GLU F OE1   1 
ATOM   2646 O OE2   . GLU F 1 5  ? 65.959 -23.808 0.246   1.00 68.62  ? 2   GLU F OE2   1 
ATOM   2647 N N     . SER F 1 6  ? 64.987 -26.363 -4.253  1.00 78.59  ? 3   SER F N     1 
ATOM   2648 C CA    . SER F 1 6  ? 64.051 -27.400 -4.699  1.00 72.94  ? 3   SER F CA    1 
ATOM   2649 C C     . SER F 1 6  ? 62.725 -27.270 -3.988  1.00 72.16  ? 3   SER F C     1 
ATOM   2650 O O     . SER F 1 6  ? 62.676 -27.246 -2.761  1.00 81.01  ? 3   SER F O     1 
ATOM   2651 C CB    . SER F 1 6  ? 64.603 -28.788 -4.362  1.00 67.75  ? 3   SER F CB    1 
ATOM   2652 O OG    . SER F 1 6  ? 63.546 -29.630 -3.929  1.00 60.33  ? 3   SER F OG    1 
ATOM   2653 N N     . PHE F 1 7  ? 61.652 -27.273 -4.768  1.00 75.92  ? 4   PHE F N     1 
ATOM   2654 C CA    . PHE F 1 7  ? 60.288 -26.986 -4.294  1.00 69.60  ? 4   PHE F CA    1 
ATOM   2655 C C     . PHE F 1 7  ? 59.685 -27.963 -3.274  1.00 70.36  ? 4   PHE F C     1 
ATOM   2656 O O     . PHE F 1 7  ? 59.399 -27.562 -2.147  1.00 76.31  ? 4   PHE F O     1 
ATOM   2657 C CB    . PHE F 1 7  ? 59.367 -26.861 -5.492  1.00 60.98  ? 4   PHE F CB    1 
ATOM   2658 C CG    . PHE F 1 7  ? 57.925 -26.742 -5.137  1.00 70.65  ? 4   PHE F CG    1 
ATOM   2659 C CD1   . PHE F 1 7  ? 57.358 -25.489 -4.869  1.00 74.90  ? 4   PHE F CD1   1 
ATOM   2660 C CD2   . PHE F 1 7  ? 57.101 -27.879 -5.101  1.00 77.44  ? 4   PHE F CD2   1 
ATOM   2661 C CE1   . PHE F 1 7  ? 56.001 -25.377 -4.562  1.00 68.80  ? 4   PHE F CE1   1 
ATOM   2662 C CE2   . PHE F 1 7  ? 55.749 -27.771 -4.801  1.00 71.50  ? 4   PHE F CE2   1 
ATOM   2663 C CZ    . PHE F 1 7  ? 55.207 -26.517 -4.526  1.00 71.72  ? 4   PHE F CZ    1 
ATOM   2664 N N     . LEU F 1 8  ? 59.457 -29.213 -3.683  1.00 67.43  ? 5   LEU F N     1 
ATOM   2665 C CA    . LEU F 1 8  ? 58.949 -30.284 -2.807  1.00 68.90  ? 5   LEU F CA    1 
ATOM   2666 C C     . LEU F 1 8  ? 59.646 -30.326 -1.417  1.00 70.60  ? 5   LEU F C     1 
ATOM   2667 O O     . LEU F 1 8  ? 59.010 -30.424 -0.346  1.00 62.99  ? 5   LEU F O     1 
ATOM   2668 C CB    . LEU F 1 8  ? 59.149 -31.634 -3.525  1.00 64.19  ? 5   LEU F CB    1 
ATOM   2669 C CG    . LEU F 1 8  ? 58.673 -32.922 -2.844  1.00 59.35  ? 5   LEU F CG    1 
ATOM   2670 C CD1   . LEU F 1 8  ? 57.150 -33.011 -2.925  1.00 57.27  ? 5   LEU F CD1   1 
ATOM   2671 C CD2   . LEU F 1 8  ? 59.313 -34.145 -3.478  1.00 51.03  ? 5   LEU F CD2   1 
ATOM   2672 N N     . LEU F 1 9  ? 60.969 -30.222 -1.468  1.00 70.43  ? 6   LEU F N     1 
ATOM   2673 C CA    . LEU F 1 9  ? 61.835 -30.478 -0.334  1.00 70.08  ? 6   LEU F CA    1 
ATOM   2674 C C     . LEU F 1 9  ? 61.724 -29.449 0.766   1.00 72.07  ? 6   LEU F C     1 
ATOM   2675 O O     . LEU F 1 9  ? 62.114 -29.721 1.908   1.00 75.27  ? 6   LEU F O     1 
ATOM   2676 C CB    . LEU F 1 9  ? 63.269 -30.523 -0.811  1.00 72.20  ? 6   LEU F CB    1 
ATOM   2677 C CG    . LEU F 1 9  ? 64.265 -31.220 0.094   1.00 79.32  ? 6   LEU F CG    1 
ATOM   2678 C CD1   . LEU F 1 9  ? 63.974 -32.709 0.033   1.00 77.88  ? 6   LEU F CD1   1 
ATOM   2679 C CD2   . LEU F 1 9  ? 65.704 -30.899 -0.318  1.00 74.97  ? 6   LEU F CD2   1 
ATOM   2680 N N     . SER F 1 10 ? 61.249 -28.251 0.428   1.00 75.91  ? 7   SER F N     1 
ATOM   2681 C CA    . SER F 1 10 ? 60.990 -27.260 1.463   1.00 73.00  ? 7   SER F CA    1 
ATOM   2682 C C     . SER F 1 10 ? 59.611 -27.569 2.033   1.00 76.98  ? 7   SER F C     1 
ATOM   2683 O O     . SER F 1 10 ? 59.506 -27.828 3.242   1.00 76.62  ? 7   SER F O     1 
ATOM   2684 C CB    . SER F 1 10 ? 61.089 -25.838 0.948   1.00 64.41  ? 7   SER F CB    1 
ATOM   2685 O OG    . SER F 1 10 ? 59.978 -25.567 0.124   1.00 67.22  ? 7   SER F OG    1 
ATOM   2686 N N     . LYS F 1 11 ? 58.568 -27.547 1.180   1.00 71.14  ? 8   LYS F N     1 
ATOM   2687 C CA    . LYS F 1 11 ? 57.233 -28.023 1.570   1.00 62.79  ? 8   LYS F CA    1 
ATOM   2688 C C     . LYS F 1 11 ? 57.364 -29.140 2.618   1.00 70.27  ? 8   LYS F C     1 
ATOM   2689 O O     . LYS F 1 11 ? 56.827 -28.981 3.738   1.00 66.62  ? 8   LYS F O     1 
ATOM   2690 C CB    . LYS F 1 11 ? 56.455 -28.526 0.366   1.00 66.82  ? 8   LYS F CB    1 
ATOM   2691 C CG    . LYS F 1 11 ? 56.221 -27.468 -0.717  1.00 84.96  ? 8   LYS F CG    1 
ATOM   2692 C CD    . LYS F 1 11 ? 55.222 -26.382 -0.290  1.00 92.30  ? 8   LYS F CD    1 
ATOM   2693 C CE    . LYS F 1 11 ? 55.281 -25.118 -1.148  1.00 80.44  ? 8   LYS F CE    1 
ATOM   2694 N NZ    . LYS F 1 11 ? 55.427 -23.895 -0.298  1.00 72.53  ? 8   LYS F NZ    1 
ATOM   2695 N N     . VAL F 1 12 ? 58.155 -30.202 2.314   1.00 63.99  ? 9   VAL F N     1 
ATOM   2696 C CA    . VAL F 1 12 ? 58.268 -31.347 3.237   1.00 51.96  ? 9   VAL F CA    1 
ATOM   2697 C C     . VAL F 1 12 ? 58.714 -30.933 4.631   1.00 57.90  ? 9   VAL F C     1 
ATOM   2698 O O     . VAL F 1 12 ? 58.055 -31.239 5.643   1.00 61.10  ? 9   VAL F O     1 
ATOM   2699 C CB    . VAL F 1 12 ? 59.090 -32.520 2.699   1.00 44.33  ? 9   VAL F CB    1 
ATOM   2700 C CG1   . VAL F 1 12 ? 59.072 -33.706 3.663   1.00 39.68  ? 9   VAL F CG1   1 
ATOM   2701 C CG2   . VAL F 1 12 ? 58.524 -32.993 1.385   1.00 50.04  ? 9   VAL F CG2   1 
ATOM   2702 N N     . SER F 1 13 ? 59.807 -30.197 4.698   1.00 71.34  ? 10  SER F N     1 
ATOM   2703 C CA    . SER F 1 13 ? 60.243 -29.647 5.991   1.00 81.24  ? 10  SER F CA    1 
ATOM   2704 C C     . SER F 1 13 ? 59.110 -28.845 6.626   1.00 78.08  ? 10  SER F C     1 
ATOM   2705 O O     . SER F 1 13 ? 58.803 -29.045 7.819   1.00 70.02  ? 10  SER F O     1 
ATOM   2706 C CB    . SER F 1 13 ? 61.538 -28.817 5.874   1.00 78.95  ? 10  SER F CB    1 
ATOM   2707 O OG    . SER F 1 13 ? 61.799 -28.426 4.529   1.00 86.18  ? 10  SER F OG    1 
ATOM   2708 N N     . PHE F 1 14 ? 58.458 -28.006 5.801   1.00 73.38  ? 11  PHE F N     1 
ATOM   2709 C CA    . PHE F 1 14 ? 57.415 -27.087 6.286   1.00 72.64  ? 11  PHE F CA    1 
ATOM   2710 C C     . PHE F 1 14 ? 56.279 -27.789 7.022   1.00 63.89  ? 11  PHE F C     1 
ATOM   2711 O O     . PHE F 1 14 ? 55.653 -27.216 7.907   1.00 60.97  ? 11  PHE F O     1 
ATOM   2712 C CB    . PHE F 1 14 ? 56.860 -26.241 5.160   1.00 72.25  ? 11  PHE F CB    1 
ATOM   2713 C CG    . PHE F 1 14 ? 55.784 -25.309 5.597   1.00 77.95  ? 11  PHE F CG    1 
ATOM   2714 C CD1   . PHE F 1 14 ? 56.100 -24.061 6.109   1.00 86.20  ? 11  PHE F CD1   1 
ATOM   2715 C CD2   . PHE F 1 14 ? 54.446 -25.677 5.503   1.00 79.56  ? 11  PHE F CD2   1 
ATOM   2716 C CE1   . PHE F 1 14 ? 55.092 -23.193 6.514   1.00 99.15  ? 11  PHE F CE1   1 
ATOM   2717 C CE2   . PHE F 1 14 ? 53.442 -24.817 5.912   1.00 85.40  ? 11  PHE F CE2   1 
ATOM   2718 C CZ    . PHE F 1 14 ? 53.761 -23.569 6.414   1.00 84.94  ? 11  PHE F CZ    1 
ATOM   2719 N N     . VAL F 1 15 ? 56.043 -29.040 6.646   1.00 63.33  ? 12  VAL F N     1 
ATOM   2720 C CA    . VAL F 1 15 ? 55.152 -29.922 7.382   1.00 57.18  ? 12  VAL F CA    1 
ATOM   2721 C C     . VAL F 1 15 ? 55.820 -30.447 8.632   1.00 53.39  ? 12  VAL F C     1 
ATOM   2722 O O     . VAL F 1 15 ? 55.296 -30.279 9.718   1.00 52.31  ? 12  VAL F O     1 
ATOM   2723 C CB    . VAL F 1 15 ? 54.640 -31.085 6.517   1.00 56.84  ? 12  VAL F CB    1 
ATOM   2724 C CG1   . VAL F 1 15 ? 54.134 -32.212 7.398   1.00 54.95  ? 12  VAL F CG1   1 
ATOM   2725 C CG2   . VAL F 1 15 ? 53.509 -30.586 5.607   1.00 57.22  ? 12  VAL F CG2   1 
ATOM   2726 N N     . ILE F 1 16 ? 56.984 -31.064 8.500   1.00 55.35  ? 13  ILE F N     1 
ATOM   2727 C CA    . ILE F 1 16 ? 57.583 -31.687 9.674   1.00 59.80  ? 13  ILE F CA    1 
ATOM   2728 C C     . ILE F 1 16 ? 57.641 -30.689 10.811  1.00 66.34  ? 13  ILE F C     1 
ATOM   2729 O O     . ILE F 1 16 ? 57.280 -31.036 11.944  1.00 59.57  ? 13  ILE F O     1 
ATOM   2730 C CB    . ILE F 1 16 ? 58.999 -32.187 9.426   1.00 61.73  ? 13  ILE F CB    1 
ATOM   2731 C CG1   . ILE F 1 16 ? 59.032 -33.175 8.250   1.00 59.10  ? 13  ILE F CG1   1 
ATOM   2732 C CG2   . ILE F 1 16 ? 59.575 -32.774 10.701  1.00 53.22  ? 13  ILE F CG2   1 
ATOM   2733 C CD1   . ILE F 1 16 ? 60.451 -33.402 7.754   1.00 54.61  ? 13  ILE F CD1   1 
ATOM   2734 N N     . LYS F 1 17 ? 58.087 -29.460 10.490  1.00 75.01  ? 14  LYS F N     1 
ATOM   2735 C CA    . LYS F 1 17 ? 58.080 -28.322 11.430  1.00 73.35  ? 14  LYS F CA    1 
ATOM   2736 C C     . LYS F 1 17 ? 56.666 -28.081 11.956  1.00 72.88  ? 14  LYS F C     1 
ATOM   2737 O O     . LYS F 1 17 ? 56.438 -28.142 13.171  1.00 71.58  ? 14  LYS F O     1 
ATOM   2738 C CB    . LYS F 1 17 ? 58.643 -27.036 10.813  1.00 74.25  ? 14  LYS F CB    1 
ATOM   2739 C CG    . LYS F 1 17 ? 58.680 -25.883 11.823  1.00 78.51  ? 14  LYS F CG    1 
ATOM   2740 C CD    . LYS F 1 17 ? 59.778 -24.833 11.601  1.00 77.09  ? 14  LYS F CD    1 
ATOM   2741 C CE    . LYS F 1 17 ? 60.252 -24.252 12.935  1.00 72.42  ? 14  LYS F CE    1 
ATOM   2742 N NZ    . LYS F 1 17 ? 60.685 -22.823 12.890  1.00 75.06  ? 14  LYS F NZ    1 
ATOM   2743 N N     . LYS F 1 18 ? 55.715 -27.850 11.049  1.00 67.63  ? 15  LYS F N     1 
ATOM   2744 C CA    . LYS F 1 18 ? 54.320 -27.651 11.455  1.00 69.84  ? 15  LYS F CA    1 
ATOM   2745 C C     . LYS F 1 18 ? 53.811 -28.707 12.473  1.00 70.89  ? 15  LYS F C     1 
ATOM   2746 O O     . LYS F 1 18 ? 53.403 -28.344 13.586  1.00 75.49  ? 15  LYS F O     1 
ATOM   2747 C CB    . LYS F 1 18 ? 53.398 -27.564 10.239  1.00 67.44  ? 15  LYS F CB    1 
ATOM   2748 C CG    . LYS F 1 18 ? 51.935 -27.657 10.610  1.00 74.68  ? 15  LYS F CG    1 
ATOM   2749 C CD    . LYS F 1 18 ? 51.056 -27.505 9.382   1.00 78.47  ? 15  LYS F CD    1 
ATOM   2750 C CE    . LYS F 1 18 ? 49.572 -27.665 9.700   1.00 63.78  ? 15  LYS F CE    1 
ATOM   2751 N NZ    . LYS F 1 18 ? 48.930 -28.015 8.411   1.00 61.56  ? 15  LYS F NZ    1 
ATOM   2752 N N     . ILE F 1 19 ? 53.837 -29.988 12.087  1.00 61.41  ? 16  ILE F N     1 
ATOM   2753 C CA    . ILE F 1 19 ? 53.523 -31.092 12.985  1.00 56.23  ? 16  ILE F CA    1 
ATOM   2754 C C     . ILE F 1 19 ? 54.344 -31.038 14.287  1.00 60.84  ? 16  ILE F C     1 
ATOM   2755 O O     . ILE F 1 19 ? 53.759 -30.934 15.349  1.00 63.46  ? 16  ILE F O     1 
ATOM   2756 C CB    . ILE F 1 19 ? 53.696 -32.445 12.291  1.00 53.47  ? 16  ILE F CB    1 
ATOM   2757 C CG1   . ILE F 1 19 ? 52.535 -32.674 11.314  1.00 53.93  ? 16  ILE F CG1   1 
ATOM   2758 C CG2   . ILE F 1 19 ? 53.882 -33.572 13.313  1.00 48.05  ? 16  ILE F CG2   1 
ATOM   2759 C CD1   . ILE F 1 19 ? 52.869 -33.566 10.122  1.00 53.41  ? 16  ILE F CD1   1 
ATOM   2760 N N     . ARG F 1 20 ? 55.674 -31.078 14.231  1.00 57.82  ? 17  ARG F N     1 
ATOM   2761 C CA    . ARG F 1 20 ? 56.479 -31.042 15.469  1.00 62.50  ? 17  ARG F CA    1 
ATOM   2762 C C     . ARG F 1 20 ? 55.969 -29.989 16.454  1.00 70.49  ? 17  ARG F C     1 
ATOM   2763 O O     . ARG F 1 20 ? 55.972 -30.237 17.661  1.00 69.58  ? 17  ARG F O     1 
ATOM   2764 C CB    . ARG F 1 20 ? 57.940 -30.776 15.174  1.00 60.57  ? 17  ARG F CB    1 
ATOM   2765 C CG    . ARG F 1 20 ? 58.932 -31.415 16.154  1.00 66.36  ? 17  ARG F CG    1 
ATOM   2766 C CD    . ARG F 1 20 ? 60.323 -30.847 15.922  1.00 64.76  ? 17  ARG F CD    1 
ATOM   2767 N NE    . ARG F 1 20 ? 60.225 -29.393 15.703  1.00 75.69  ? 17  ARG F NE    1 
ATOM   2768 C CZ    . ARG F 1 20 ? 60.508 -28.463 16.617  1.00 74.65  ? 17  ARG F CZ    1 
ATOM   2769 N NH1   . ARG F 1 20 ? 60.956 -28.826 17.823  1.00 78.92  ? 17  ARG F NH1   1 
ATOM   2770 N NH2   . ARG F 1 20 ? 60.372 -27.171 16.325  1.00 60.80  ? 17  ARG F NH2   1 
ATOM   2771 N N     . LEU F 1 21 ? 55.498 -28.845 15.926  1.00 75.57  ? 18  LEU F N     1 
ATOM   2772 C CA    . LEU F 1 21 ? 54.940 -27.731 16.725  1.00 72.93  ? 18  LEU F CA    1 
ATOM   2773 C C     . LEU F 1 21 ? 53.568 -27.965 17.349  1.00 67.87  ? 18  LEU F C     1 
ATOM   2774 O O     . LEU F 1 21 ? 53.320 -27.547 18.471  1.00 65.04  ? 18  LEU F O     1 
ATOM   2775 C CB    . LEU F 1 21 ? 54.878 -26.463 15.887  1.00 70.18  ? 18  LEU F CB    1 
ATOM   2776 C CG    . LEU F 1 21 ? 56.243 -25.884 15.543  1.00 66.81  ? 18  LEU F CG    1 
ATOM   2777 C CD1   . LEU F 1 21 ? 56.110 -24.433 15.101  1.00 67.94  ? 18  LEU F CD1   1 
ATOM   2778 C CD2   . LEU F 1 21 ? 57.192 -26.030 16.722  1.00 67.41  ? 18  LEU F CD2   1 
ATOM   2779 N N     . GLU F 1 22 ? 52.720 -28.691 16.629  1.00 69.38  ? 19  GLU F N     1 
ATOM   2780 C CA    . GLU F 1 22 ? 51.303 -28.886 16.958  1.00 69.51  ? 19  GLU F CA    1 
ATOM   2781 C C     . GLU F 1 22 ? 50.823 -29.347 18.369  1.00 79.90  ? 19  GLU F C     1 
ATOM   2782 O O     . GLU F 1 22 ? 49.972 -28.641 18.900  1.00 103.98 ? 19  GLU F O     1 
ATOM   2783 C CB    . GLU F 1 22 ? 50.619 -29.729 15.877  1.00 75.63  ? 19  GLU F CB    1 
ATOM   2784 C CG    . GLU F 1 22 ? 50.120 -28.965 14.660  1.00 84.16  ? 19  GLU F CG    1 
ATOM   2785 C CD    . GLU F 1 22 ? 49.127 -29.785 13.831  1.00 89.23  ? 19  GLU F CD    1 
ATOM   2786 O OE1   . GLU F 1 22 ? 48.643 -30.833 14.343  1.00 84.78  ? 19  GLU F OE1   1 
ATOM   2787 O OE2   . GLU F 1 22 ? 48.844 -29.393 12.665  1.00 82.50  ? 19  GLU F OE2   1 
ATOM   2788 N N     . LYS F 1 23 ? 51.266 -30.437 19.040  1.00 78.65  ? 20  LYS F N     1 
ATOM   2789 C CA    . LYS F 1 23 ? 52.401 -31.315 18.795  1.00 70.99  ? 20  LYS F CA    1 
ATOM   2790 C C     . LYS F 1 23 ? 53.617 -30.582 19.271  1.00 78.09  ? 20  LYS F C     1 
ATOM   2791 O O     . LYS F 1 23 ? 54.391 -30.056 18.450  1.00 83.42  ? 20  LYS F O     1 
ATOM   2792 C CB    . LYS F 1 23 ? 52.508 -31.642 17.329  1.00 67.48  ? 20  LYS F CB    1 
ATOM   2793 C CG    . LYS F 1 23 ? 51.397 -32.555 16.890  1.00 64.95  ? 20  LYS F CG    1 
ATOM   2794 C CD    . LYS F 1 23 ? 51.535 -33.852 17.625  1.00 67.16  ? 20  LYS F CD    1 
ATOM   2795 C CE    . LYS F 1 23 ? 50.899 -34.928 16.782  1.00 64.64  ? 20  LYS F CE    1 
ATOM   2796 N NZ    . LYS F 1 23 ? 51.825 -36.088 16.744  1.00 77.22  ? 20  LYS F NZ    1 
ATOM   2797 N N     . GLY F 1 24 ? 53.791 -30.511 20.584  1.00 72.87  ? 21  GLY F N     1 
ATOM   2798 C CA    . GLY F 1 24 ? 54.700 -29.503 21.147  1.00 72.72  ? 21  GLY F CA    1 
ATOM   2799 C C     . GLY F 1 24 ? 56.131 -29.955 21.350  1.00 67.29  ? 21  GLY F C     1 
ATOM   2800 O O     . GLY F 1 24 ? 56.729 -29.687 22.376  1.00 64.11  ? 21  GLY F O     1 
ATOM   2801 N N     . MET F 1 25 ? 56.677 -30.619 20.348  1.00 66.98  ? 22  MET F N     1 
ATOM   2802 C CA    . MET F 1 25 ? 57.871 -31.410 20.512  1.00 71.82  ? 22  MET F CA    1 
ATOM   2803 C C     . MET F 1 25 ? 59.153 -30.587 20.335  1.00 71.99  ? 22  MET F C     1 
ATOM   2804 O O     . MET F 1 25 ? 59.179 -29.601 19.616  1.00 80.52  ? 22  MET F O     1 
ATOM   2805 C CB    . MET F 1 25 ? 57.827 -32.604 19.552  1.00 73.56  ? 22  MET F CB    1 
ATOM   2806 C CG    . MET F 1 25 ? 56.812 -33.672 19.915  1.00 74.99  ? 22  MET F CG    1 
ATOM   2807 S SD    . MET F 1 25 ? 56.872 -35.115 18.822  1.00 93.78  ? 22  MET F SD    1 
ATOM   2808 C CE    . MET F 1 25 ? 58.193 -36.100 19.548  1.00 69.53  ? 22  MET F CE    1 
ATOM   2809 N N     . THR F 1 26 ? 60.205 -30.984 21.024  1.00 68.10  ? 23  THR F N     1 
ATOM   2810 C CA    . THR F 1 26 ? 61.505 -30.375 20.813  1.00 71.71  ? 23  THR F CA    1 
ATOM   2811 C C     . THR F 1 26 ? 62.283 -31.161 19.759  1.00 73.65  ? 23  THR F C     1 
ATOM   2812 O O     . THR F 1 26 ? 62.085 -32.388 19.569  1.00 70.53  ? 23  THR F O     1 
ATOM   2813 C CB    . THR F 1 26 ? 62.347 -30.321 22.104  1.00 65.38  ? 23  THR F CB    1 
ATOM   2814 O OG1   . THR F 1 26 ? 62.878 -31.610 22.374  1.00 68.67  ? 23  THR F OG1   1 
ATOM   2815 C CG2   . THR F 1 26 ? 61.508 -29.883 23.277  1.00 60.53  ? 23  THR F CG2   1 
ATOM   2816 N N     . GLN F 1 27 ? 63.179 -30.469 19.075  1.00 65.46  ? 24  GLN F N     1 
ATOM   2817 C CA    . GLN F 1 27 ? 63.859 -31.123 18.000  1.00 64.16  ? 24  GLN F CA    1 
ATOM   2818 C C     . GLN F 1 27 ? 64.448 -32.410 18.576  1.00 68.13  ? 24  GLN F C     1 
ATOM   2819 O O     . GLN F 1 27 ? 64.268 -33.482 17.979  1.00 64.38  ? 24  GLN F O     1 
ATOM   2820 C CB    . GLN F 1 27 ? 64.892 -30.203 17.357  1.00 61.41  ? 24  GLN F CB    1 
ATOM   2821 C CG    . GLN F 1 27 ? 64.295 -29.117 16.480  1.00 56.12  ? 24  GLN F CG    1 
ATOM   2822 C CD    . GLN F 1 27 ? 65.358 -28.242 15.793  1.00 66.71  ? 24  GLN F CD    1 
ATOM   2823 O OE1   . GLN F 1 27 ? 66.539 -28.205 16.194  1.00 69.42  ? 24  GLN F OE1   1 
ATOM   2824 N NE2   . GLN F 1 27 ? 64.935 -27.523 14.748  1.00 61.55  ? 24  GLN F NE2   1 
ATOM   2825 N N     . GLU F 1 28 ? 65.102 -32.291 19.752  1.00 74.77  ? 25  GLU F N     1 
ATOM   2826 C CA    . GLU F 1 28 ? 65.723 -33.426 20.490  1.00 70.26  ? 25  GLU F CA    1 
ATOM   2827 C C     . GLU F 1 28 ? 64.696 -34.536 20.756  1.00 70.31  ? 25  GLU F C     1 
ATOM   2828 O O     . GLU F 1 28 ? 64.971 -35.715 20.492  1.00 67.16  ? 25  GLU F O     1 
ATOM   2829 C CB    . GLU F 1 28 ? 66.387 -32.974 21.807  1.00 69.74  ? 25  GLU F CB    1 
ATOM   2830 C CG    . GLU F 1 28 ? 67.668 -33.771 22.139  1.00 90.60  ? 25  GLU F CG    1 
ATOM   2831 C CD    . GLU F 1 28 ? 68.146 -33.703 23.612  1.00 94.42  ? 25  GLU F CD    1 
ATOM   2832 O OE1   . GLU F 1 28 ? 69.210 -34.282 23.924  1.00 81.02  ? 25  GLU F OE1   1 
ATOM   2833 O OE2   . GLU F 1 28 ? 67.479 -33.088 24.475  1.00 102.00 ? 25  GLU F OE2   1 
ATOM   2834 N N     . ASP F 1 29 ? 63.506 -34.137 21.232  1.00 67.76  ? 26  ASP F N     1 
ATOM   2835 C CA    . ASP F 1 29 ? 62.377 -35.051 21.420  1.00 63.49  ? 26  ASP F CA    1 
ATOM   2836 C C     . ASP F 1 29 ? 62.222 -35.904 20.188  1.00 63.83  ? 26  ASP F C     1 
ATOM   2837 O O     . ASP F 1 29 ? 62.516 -37.109 20.215  1.00 62.11  ? 26  ASP F O     1 
ATOM   2838 C CB    . ASP F 1 29 ? 61.087 -34.292 21.660  1.00 59.50  ? 26  ASP F CB    1 
ATOM   2839 C CG    . ASP F 1 29 ? 60.998 -33.695 23.050  1.00 64.87  ? 26  ASP F CG    1 
ATOM   2840 O OD1   . ASP F 1 29 ? 61.699 -34.146 23.978  1.00 59.90  ? 26  ASP F OD1   1 
ATOM   2841 O OD2   . ASP F 1 29 ? 60.192 -32.754 23.220  1.00 75.50  ? 26  ASP F OD2   1 
ATOM   2842 N N     . LEU F 1 30 ? 61.822 -35.246 19.097  1.00 66.09  ? 27  LEU F N     1 
ATOM   2843 C CA    . LEU F 1 30 ? 61.617 -35.914 17.817  1.00 63.01  ? 27  LEU F CA    1 
ATOM   2844 C C     . LEU F 1 30 ? 62.807 -36.786 17.435  1.00 63.44  ? 27  LEU F C     1 
ATOM   2845 O O     . LEU F 1 30 ? 62.648 -37.992 17.232  1.00 70.95  ? 27  LEU F O     1 
ATOM   2846 C CB    . LEU F 1 30 ? 61.267 -34.912 16.717  1.00 58.06  ? 27  LEU F CB    1 
ATOM   2847 C CG    . LEU F 1 30 ? 61.181 -35.417 15.258  1.00 53.09  ? 27  LEU F CG    1 
ATOM   2848 C CD1   . LEU F 1 30 ? 60.341 -36.677 15.066  1.00 46.24  ? 27  LEU F CD1   1 
ATOM   2849 C CD2   . LEU F 1 30 ? 60.658 -34.304 14.358  1.00 47.24  ? 27  LEU F CD2   1 
ATOM   2850 N N     . ALA F 1 31 ? 63.999 -36.206 17.391  1.00 59.08  ? 28  ALA F N     1 
ATOM   2851 C CA    . ALA F 1 31 ? 65.144 -36.992 17.022  1.00 61.82  ? 28  ALA F CA    1 
ATOM   2852 C C     . ALA F 1 31 ? 65.352 -38.169 17.961  1.00 66.56  ? 28  ALA F C     1 
ATOM   2853 O O     . ALA F 1 31 ? 65.836 -39.201 17.518  1.00 69.76  ? 28  ALA F O     1 
ATOM   2854 C CB    . ALA F 1 31 ? 66.387 -36.136 16.911  1.00 65.14  ? 28  ALA F CB    1 
ATOM   2855 N N     . TYR F 1 32 ? 64.971 -38.048 19.241  1.00 76.64  ? 29  TYR F N     1 
ATOM   2856 C CA    . TYR F 1 32 ? 65.025 -39.233 20.132  1.00 77.17  ? 29  TYR F CA    1 
ATOM   2857 C C     . TYR F 1 32 ? 64.085 -40.343 19.627  1.00 78.19  ? 29  TYR F C     1 
ATOM   2858 O O     . TYR F 1 32 ? 64.485 -41.527 19.600  1.00 81.76  ? 29  TYR F O     1 
ATOM   2859 C CB    . TYR F 1 32 ? 64.716 -38.928 21.613  1.00 70.72  ? 29  TYR F CB    1 
ATOM   2860 C CG    . TYR F 1 32 ? 64.309 -40.186 22.366  1.00 65.22  ? 29  TYR F CG    1 
ATOM   2861 C CD1   . TYR F 1 32 ? 65.222 -41.210 22.599  1.00 66.46  ? 29  TYR F CD1   1 
ATOM   2862 C CD2   . TYR F 1 32 ? 63.000 -40.373 22.789  1.00 64.46  ? 29  TYR F CD2   1 
ATOM   2863 C CE1   . TYR F 1 32 ? 64.841 -42.373 23.241  1.00 64.73  ? 29  TYR F CE1   1 
ATOM   2864 C CE2   . TYR F 1 32 ? 62.611 -41.529 23.435  1.00 61.54  ? 29  TYR F CE2   1 
ATOM   2865 C CZ    . TYR F 1 32 ? 63.539 -42.524 23.653  1.00 64.40  ? 29  TYR F CZ    1 
ATOM   2866 O OH    . TYR F 1 32 ? 63.169 -43.676 24.300  1.00 69.22  ? 29  TYR F OH    1 
ATOM   2867 N N     . LYS F 1 33 ? 62.861 -39.941 19.237  1.00 64.58  ? 30  LYS F N     1 
ATOM   2868 C CA    . LYS F 1 33 ? 61.838 -40.843 18.735  1.00 62.52  ? 30  LYS F CA    1 
ATOM   2869 C C     . LYS F 1 33 ? 62.241 -41.488 17.412  1.00 72.20  ? 30  LYS F C     1 
ATOM   2870 O O     . LYS F 1 33 ? 62.014 -42.687 17.199  1.00 81.36  ? 30  LYS F O     1 
ATOM   2871 C CB    . LYS F 1 33 ? 60.512 -40.099 18.512  1.00 66.10  ? 30  LYS F CB    1 
ATOM   2872 C CG    . LYS F 1 33 ? 59.822 -39.532 19.758  1.00 71.93  ? 30  LYS F CG    1 
ATOM   2873 C CD    . LYS F 1 33 ? 59.293 -40.577 20.753  1.00 66.30  ? 30  LYS F CD    1 
ATOM   2874 C CE    . LYS F 1 33 ? 57.884 -41.033 20.432  1.00 67.19  ? 30  LYS F CE    1 
ATOM   2875 N NZ    . LYS F 1 33 ? 56.924 -39.897 20.363  1.00 71.13  ? 30  LYS F NZ    1 
ATOM   2876 N N     . SER F 1 34 ? 62.851 -40.693 16.533  1.00 70.10  ? 31  SER F N     1 
ATOM   2877 C CA    . SER F 1 34 ? 63.102 -41.081 15.147  1.00 63.22  ? 31  SER F CA    1 
ATOM   2878 C C     . SER F 1 34 ? 64.426 -41.811 15.005  1.00 61.84  ? 31  SER F C     1 
ATOM   2879 O O     . SER F 1 34 ? 64.771 -42.310 13.941  1.00 58.83  ? 31  SER F O     1 
ATOM   2880 C CB    . SER F 1 34 ? 63.131 -39.829 14.289  1.00 65.70  ? 31  SER F CB    1 
ATOM   2881 O OG    . SER F 1 34 ? 62.135 -38.929 14.720  1.00 69.94  ? 31  SER F OG    1 
ATOM   2882 N N     . ASN F 1 35 ? 65.167 -41.879 16.094  1.00 69.41  ? 32  ASN F N     1 
ATOM   2883 C CA    . ASN F 1 35 ? 66.495 -42.466 16.076  1.00 80.52  ? 32  ASN F CA    1 
ATOM   2884 C C     . ASN F 1 35 ? 67.353 -41.853 14.962  1.00 78.62  ? 32  ASN F C     1 
ATOM   2885 O O     . ASN F 1 35 ? 67.791 -42.522 14.011  1.00 77.33  ? 32  ASN F O     1 
ATOM   2886 C CB    . ASN F 1 35 ? 66.432 -43.977 15.968  1.00 88.98  ? 32  ASN F CB    1 
ATOM   2887 C CG    . ASN F 1 35 ? 67.797 -44.579 15.943  1.00 101.25 ? 32  ASN F CG    1 
ATOM   2888 O OD1   . ASN F 1 35 ? 68.716 -44.065 16.593  1.00 103.90 ? 32  ASN F OD1   1 
ATOM   2889 N ND2   . ASN F 1 35 ? 67.964 -45.645 15.165  1.00 110.89 ? 32  ASN F ND2   1 
ATOM   2890 N N     . LEU F 1 36 ? 67.535 -40.543 15.116  1.00 76.16  ? 33  LEU F N     1 
ATOM   2891 C CA    . LEU F 1 36 ? 68.221 -39.651 14.204  1.00 62.11  ? 33  LEU F CA    1 
ATOM   2892 C C     . LEU F 1 36 ? 68.919 -38.642 15.080  1.00 68.56  ? 33  LEU F C     1 
ATOM   2893 O O     . LEU F 1 36 ? 68.459 -38.367 16.200  1.00 71.12  ? 33  LEU F O     1 
ATOM   2894 C CB    . LEU F 1 36 ? 67.211 -38.928 13.309  1.00 56.63  ? 33  LEU F CB    1 
ATOM   2895 C CG    . LEU F 1 36 ? 66.620 -39.724 12.132  1.00 58.99  ? 33  LEU F CG    1 
ATOM   2896 C CD1   . LEU F 1 36 ? 65.839 -38.802 11.226  1.00 52.01  ? 33  LEU F CD1   1 
ATOM   2897 C CD2   . LEU F 1 36 ? 67.670 -40.483 11.307  1.00 58.96  ? 33  LEU F CD2   1 
ATOM   2898 N N     . ASP F 1 37 ? 70.040 -38.104 14.594  1.00 79.27  ? 34  ASP F N     1 
ATOM   2899 C CA    . ASP F 1 37 ? 70.726 -37.002 15.282  1.00 71.71  ? 34  ASP F CA    1 
ATOM   2900 C C     . ASP F 1 37 ? 69.927 -35.706 15.260  1.00 68.13  ? 34  ASP F C     1 
ATOM   2901 O O     . ASP F 1 37 ? 69.216 -35.379 14.273  1.00 61.66  ? 34  ASP F O     1 
ATOM   2902 C CB    . ASP F 1 37 ? 72.099 -36.762 14.723  1.00 71.77  ? 34  ASP F CB    1 
ATOM   2903 C CG    . ASP F 1 37 ? 73.056 -36.292 15.784  1.00 76.69  ? 34  ASP F CG    1 
ATOM   2904 O OD1   . ASP F 1 37 ? 73.082 -35.063 16.025  1.00 74.65  ? 34  ASP F OD1   1 
ATOM   2905 O OD2   . ASP F 1 37 ? 73.760 -37.152 16.386  1.00 70.95  ? 34  ASP F OD2   1 
ATOM   2906 N N     . ARG F 1 38 ? 70.006 -34.998 16.382  1.00 62.38  ? 35  ARG F N     1 
ATOM   2907 C CA    . ARG F 1 38 ? 69.188 -33.822 16.553  1.00 63.08  ? 35  ARG F CA    1 
ATOM   2908 C C     . ARG F 1 38 ? 69.562 -32.885 15.459  1.00 66.67  ? 35  ARG F C     1 
ATOM   2909 O O     . ARG F 1 38 ? 68.708 -32.259 14.838  1.00 66.47  ? 35  ARG F O     1 
ATOM   2910 C CB    . ARG F 1 38 ? 69.466 -33.140 17.859  1.00 57.60  ? 35  ARG F CB    1 
ATOM   2911 C CG    . ARG F 1 38 ? 68.506 -31.997 18.084  1.00 63.16  ? 35  ARG F CG    1 
ATOM   2912 C CD    . ARG F 1 38 ? 68.865 -31.327 19.398  1.00 70.74  ? 35  ARG F CD    1 
ATOM   2913 N NE    . ARG F 1 38 ? 70.114 -30.579 19.302  1.00 66.69  ? 35  ARG F NE    1 
ATOM   2914 C CZ    . ARG F 1 38 ? 70.211 -29.389 18.719  1.00 61.72  ? 35  ARG F CZ    1 
ATOM   2915 N NH1   . ARG F 1 38 ? 71.383 -28.778 18.670  1.00 64.43  ? 35  ARG F NH1   1 
ATOM   2916 N NH2   . ARG F 1 38 ? 69.141 -28.826 18.175  1.00 54.20  ? 35  ARG F NH2   1 
ATOM   2917 N N     . THR F 1 39 ? 70.862 -32.826 15.208  1.00 64.63  ? 36  THR F N     1 
ATOM   2918 C CA    . THR F 1 39 ? 71.387 -31.835 14.318  1.00 61.94  ? 36  THR F CA    1 
ATOM   2919 C C     . THR F 1 39 ? 70.636 -31.993 13.013  1.00 64.11  ? 36  THR F C     1 
ATOM   2920 O O     . THR F 1 39 ? 69.973 -31.062 12.573  1.00 68.29  ? 36  THR F O     1 
ATOM   2921 C CB    . THR F 1 39 ? 72.896 -31.980 14.139  1.00 60.61  ? 36  THR F CB    1 
ATOM   2922 O OG1   . THR F 1 39 ? 73.171 -33.259 13.572  1.00 70.32  ? 36  THR F OG1   1 
ATOM   2923 C CG2   . THR F 1 39 ? 73.610 -31.849 15.495  1.00 58.06  ? 36  THR F CG2   1 
ATOM   2924 N N     . PHE F 1 40 ? 70.707 -33.193 12.440  1.00 67.20  ? 37  PHE F N     1 
ATOM   2925 C CA    . PHE F 1 40 ? 70.043 -33.544 11.185  1.00 58.14  ? 37  PHE F CA    1 
ATOM   2926 C C     . PHE F 1 40 ? 68.721 -32.833 11.104  1.00 52.07  ? 37  PHE F C     1 
ATOM   2927 O O     . PHE F 1 40 ? 68.510 -31.969 10.248  1.00 48.62  ? 37  PHE F O     1 
ATOM   2928 C CB    . PHE F 1 40 ? 69.774 -35.053 11.144  1.00 64.90  ? 37  PHE F CB    1 
ATOM   2929 C CG    . PHE F 1 40 ? 69.614 -35.609 9.752   1.00 75.79  ? 37  PHE F CG    1 
ATOM   2930 C CD1   . PHE F 1 40 ? 69.013 -34.860 8.739   1.00 78.91  ? 37  PHE F CD1   1 
ATOM   2931 C CD2   . PHE F 1 40 ? 70.044 -36.887 9.450   1.00 71.29  ? 37  PHE F CD2   1 
ATOM   2932 C CE1   . PHE F 1 40 ? 68.859 -35.369 7.459   1.00 73.83  ? 37  PHE F CE1   1 
ATOM   2933 C CE2   . PHE F 1 40 ? 69.893 -37.390 8.174   1.00 70.85  ? 37  PHE F CE2   1 
ATOM   2934 C CZ    . PHE F 1 40 ? 69.312 -36.631 7.174   1.00 72.74  ? 37  PHE F CZ    1 
ATOM   2935 N N     . ILE F 1 41 ? 67.837 -33.186 12.028  1.00 51.81  ? 38  ILE F N     1 
ATOM   2936 C CA    . ILE F 1 41 ? 66.520 -32.556 12.118  1.00 54.92  ? 38  ILE F CA    1 
ATOM   2937 C C     . ILE F 1 41 ? 66.624 -31.044 11.877  1.00 59.34  ? 38  ILE F C     1 
ATOM   2938 O O     . ILE F 1 41 ? 66.123 -30.551 10.864  1.00 64.77  ? 38  ILE F O     1 
ATOM   2939 C CB    . ILE F 1 41 ? 65.810 -32.852 13.470  1.00 55.23  ? 38  ILE F CB    1 
ATOM   2940 C CG1   . ILE F 1 41 ? 65.650 -34.380 13.730  1.00 55.85  ? 38  ILE F CG1   1 
ATOM   2941 C CG2   . ILE F 1 41 ? 64.524 -32.034 13.617  1.00 48.00  ? 38  ILE F CG2   1 
ATOM   2942 C CD1   . ILE F 1 41 ? 65.038 -35.193 12.612  1.00 46.68  ? 38  ILE F CD1   1 
ATOM   2943 N N     . SER F 1 42 ? 67.287 -30.311 12.775  1.00 54.98  ? 39  SER F N     1 
ATOM   2944 C CA    . SER F 1 42 ? 67.539 -28.899 12.527  1.00 53.91  ? 39  SER F CA    1 
ATOM   2945 C C     . SER F 1 42 ? 67.789 -28.570 11.036  1.00 52.17  ? 39  SER F C     1 
ATOM   2946 O O     . SER F 1 42 ? 67.041 -27.772 10.476  1.00 50.62  ? 39  SER F O     1 
ATOM   2947 C CB    . SER F 1 42 ? 68.668 -28.362 13.373  1.00 55.98  ? 39  SER F CB    1 
ATOM   2948 O OG    . SER F 1 42 ? 68.761 -26.967 13.128  1.00 62.54  ? 39  SER F OG    1 
ATOM   2949 N N     . GLY F 1 43 ? 68.797 -29.186 10.406  1.00 43.85  ? 40  GLY F N     1 
ATOM   2950 C CA    . GLY F 1 43 ? 69.039 -28.982 8.987   1.00 46.23  ? 40  GLY F CA    1 
ATOM   2951 C C     . GLY F 1 43 ? 67.836 -29.168 8.060   1.00 49.46  ? 40  GLY F C     1 
ATOM   2952 O O     . GLY F 1 43 ? 67.550 -28.329 7.165   1.00 47.18  ? 40  GLY F O     1 
ATOM   2953 N N     . ILE F 1 44 ? 67.120 -30.267 8.264   1.00 45.23  ? 41  ILE F N     1 
ATOM   2954 C CA    . ILE F 1 44 ? 65.860 -30.495 7.526   1.00 45.27  ? 41  ILE F CA    1 
ATOM   2955 C C     . ILE F 1 44 ? 64.899 -29.339 7.662   1.00 44.96  ? 41  ILE F C     1 
ATOM   2956 O O     . ILE F 1 44 ? 64.417 -28.886 6.678   1.00 50.98  ? 41  ILE F O     1 
ATOM   2957 C CB    . ILE F 1 44 ? 65.212 -31.810 7.976   1.00 42.78  ? 41  ILE F CB    1 
ATOM   2958 C CG1   . ILE F 1 44 ? 66.188 -32.958 7.682   1.00 50.16  ? 41  ILE F CG1   1 
ATOM   2959 C CG2   . ILE F 1 44 ? 63.914 -32.063 7.300   1.00 35.92  ? 41  ILE F CG2   1 
ATOM   2960 C CD1   . ILE F 1 44 ? 66.063 -34.167 8.601   1.00 50.72  ? 41  ILE F CD1   1 
ATOM   2961 N N     . GLU F 1 45 ? 64.649 -28.851 8.876   1.00 51.37  ? 42  GLU F N     1 
ATOM   2962 C CA    . GLU F 1 45 ? 63.680 -27.761 9.110   1.00 55.96  ? 42  GLU F CA    1 
ATOM   2963 C C     . GLU F 1 45 ? 64.234 -26.404 8.694   1.00 59.42  ? 42  GLU F C     1 
ATOM   2964 O O     . GLU F 1 45 ? 63.522 -25.549 8.144   1.00 59.56  ? 42  GLU F O     1 
ATOM   2965 C CB    . GLU F 1 45 ? 63.337 -27.631 10.589  1.00 56.40  ? 42  GLU F CB    1 
ATOM   2966 C CG    . GLU F 1 45 ? 62.358 -28.603 11.207  1.00 64.62  ? 42  GLU F CG    1 
ATOM   2967 C CD    . GLU F 1 45 ? 61.986 -28.144 12.610  1.00 80.97  ? 42  GLU F CD    1 
ATOM   2968 O OE1   . GLU F 1 45 ? 61.683 -28.981 13.493  1.00 82.42  ? 42  GLU F OE1   1 
ATOM   2969 O OE2   . GLU F 1 45 ? 62.020 -26.914 12.838  1.00 91.97  ? 42  GLU F OE2   1 
ATOM   2970 N N     . ARG F 1 46 ? 65.501 -26.195 9.004   1.00 57.79  ? 43  ARG F N     1 
ATOM   2971 C CA    . ARG F 1 46 ? 66.096 -24.888 8.902   1.00 60.72  ? 43  ARG F CA    1 
ATOM   2972 C C     . ARG F 1 46 ? 66.404 -24.704 7.479   1.00 60.61  ? 43  ARG F C     1 
ATOM   2973 O O     . ARG F 1 46 ? 65.783 -23.901 6.812   1.00 66.19  ? 43  ARG F O     1 
ATOM   2974 C CB    . ARG F 1 46 ? 67.410 -24.876 9.686   1.00 74.24  ? 43  ARG F CB    1 
ATOM   2975 C CG    . ARG F 1 46 ? 67.935 -23.522 10.134  1.00 81.32  ? 43  ARG F CG    1 
ATOM   2976 C CD    . ARG F 1 46 ? 66.806 -22.573 10.495  1.00 76.53  ? 43  ARG F CD    1 
ATOM   2977 N NE    . ARG F 1 46 ? 66.355 -22.000 9.253   1.00 70.52  ? 43  ARG F NE    1 
ATOM   2978 C CZ    . ARG F 1 46 ? 66.869 -20.893 8.755   1.00 80.39  ? 43  ARG F CZ    1 
ATOM   2979 N NH1   . ARG F 1 46 ? 67.809 -20.243 9.436   1.00 79.62  ? 43  ARG F NH1   1 
ATOM   2980 N NH2   . ARG F 1 46 ? 66.435 -20.430 7.596   1.00 86.62  ? 43  ARG F NH2   1 
ATOM   2981 N N     . ASN F 1 47 ? 67.323 -25.540 7.010   1.00 64.31  ? 44  ASN F N     1 
ATOM   2982 C CA    . ASN F 1 47 ? 68.089 -25.299 5.791   1.00 60.39  ? 44  ASN F CA    1 
ATOM   2983 C C     . ASN F 1 47 ? 67.581 -26.000 4.552   1.00 58.59  ? 44  ASN F C     1 
ATOM   2984 O O     . ASN F 1 47 ? 68.162 -25.845 3.461   1.00 56.32  ? 44  ASN F O     1 
ATOM   2985 C CB    . ASN F 1 47 ? 69.540 -25.667 6.041   1.00 58.40  ? 44  ASN F CB    1 
ATOM   2986 C CG    . ASN F 1 47 ? 70.258 -24.616 6.851   1.00 69.43  ? 44  ASN F CG    1 
ATOM   2987 O OD1   . ASN F 1 47 ? 71.396 -24.816 7.271   1.00 82.93  ? 44  ASN F OD1   1 
ATOM   2988 N ND2   . ASN F 1 47 ? 69.600 -23.479 7.076   1.00 71.55  ? 44  ASN F ND2   1 
ATOM   2989 N N     . SER F 1 48 ? 66.493 -26.757 4.735   1.00 51.54  ? 45  SER F N     1 
ATOM   2990 C CA    . SER F 1 48 ? 65.991 -27.674 3.717   1.00 44.37  ? 45  SER F CA    1 
ATOM   2991 C C     . SER F 1 48 ? 66.913 -28.814 3.252   1.00 47.45  ? 45  SER F C     1 
ATOM   2992 O O     . SER F 1 48 ? 66.729 -29.356 2.171   1.00 46.58  ? 45  SER F O     1 
ATOM   2993 C CB    . SER F 1 48 ? 65.457 -26.911 2.549   1.00 39.16  ? 45  SER F CB    1 
ATOM   2994 O OG    . SER F 1 48 ? 64.108 -26.629 2.874   1.00 49.11  ? 45  SER F OG    1 
ATOM   2995 N N     . ARG F 1 49 ? 67.877 -29.194 4.093   1.00 47.30  ? 46  ARG F N     1 
ATOM   2996 C CA    . ARG F 1 49 ? 68.620 -30.420 3.884   1.00 43.42  ? 46  ARG F CA    1 
ATOM   2997 C C     . ARG F 1 49 ? 67.654 -31.456 3.316   1.00 44.00  ? 46  ARG F C     1 
ATOM   2998 O O     . ARG F 1 49 ? 66.434 -31.465 3.642   1.00 41.34  ? 46  ARG F O     1 
ATOM   2999 C CB    . ARG F 1 49 ? 69.222 -30.913 5.216   1.00 46.56  ? 46  ARG F CB    1 
ATOM   3000 C CG    . ARG F 1 49 ? 70.721 -31.220 5.143   1.00 51.31  ? 46  ARG F CG    1 
ATOM   3001 C CD    . ARG F 1 49 ? 71.275 -31.716 6.463   1.00 46.42  ? 46  ARG F CD    1 
ATOM   3002 N NE    . ARG F 1 49 ? 72.252 -32.773 6.224   1.00 48.20  ? 46  ARG F NE    1 
ATOM   3003 C CZ    . ARG F 1 49 ? 73.302 -33.017 7.006   1.00 48.38  ? 46  ARG F CZ    1 
ATOM   3004 N NH1   . ARG F 1 49 ? 73.542 -32.283 8.091   1.00 46.06  ? 46  ARG F NH1   1 
ATOM   3005 N NH2   . ARG F 1 49 ? 74.118 -34.007 6.708   1.00 51.66  ? 46  ARG F NH2   1 
ATOM   3006 N N     . ASN F 1 50 ? 68.189 -32.320 2.471   1.00 43.02  ? 47  ASN F N     1 
ATOM   3007 C CA    . ASN F 1 50 ? 67.405 -33.324 1.805   1.00 49.80  ? 47  ASN F CA    1 
ATOM   3008 C C     . ASN F 1 50 ? 67.691 -34.666 2.460   1.00 55.20  ? 47  ASN F C     1 
ATOM   3009 O O     . ASN F 1 50 ? 68.827 -35.030 2.739   1.00 63.16  ? 47  ASN F O     1 
ATOM   3010 C CB    . ASN F 1 50 ? 67.732 -33.280 0.325   1.00 58.40  ? 47  ASN F CB    1 
ATOM   3011 C CG    . ASN F 1 50 ? 67.576 -34.607 -0.363  1.00 69.36  ? 47  ASN F CG    1 
ATOM   3012 O OD1   . ASN F 1 50 ? 66.466 -35.109 -0.542  1.00 79.63  ? 47  ASN F OD1   1 
ATOM   3013 N ND2   . ASN F 1 50 ? 68.697 -35.164 -0.808  1.00 67.53  ? 47  ASN F ND2   1 
ATOM   3014 N N     . LEU F 1 51 ? 66.630 -35.374 2.779   1.00 64.24  ? 48  LEU F N     1 
ATOM   3015 C CA    . LEU F 1 51 ? 66.715 -36.648 3.463   1.00 59.70  ? 48  LEU F CA    1 
ATOM   3016 C C     . LEU F 1 51 ? 66.272 -37.719 2.503   1.00 57.13  ? 48  LEU F C     1 
ATOM   3017 O O     . LEU F 1 51 ? 65.821 -37.431 1.369   1.00 53.16  ? 48  LEU F O     1 
ATOM   3018 C CB    . LEU F 1 51 ? 65.760 -36.647 4.652   1.00 66.18  ? 48  LEU F CB    1 
ATOM   3019 C CG    . LEU F 1 51 ? 64.279 -36.426 4.290   1.00 65.95  ? 48  LEU F CG    1 
ATOM   3020 C CD1   . LEU F 1 51 ? 63.380 -36.831 5.436   1.00 68.66  ? 48  LEU F CD1   1 
ATOM   3021 C CD2   . LEU F 1 51 ? 63.998 -34.985 3.895   1.00 70.39  ? 48  LEU F CD2   1 
ATOM   3022 N N     . THR F 1 52 ? 66.368 -38.955 2.968   1.00 51.58  ? 49  THR F N     1 
ATOM   3023 C CA    . THR F 1 52 ? 65.907 -40.084 2.181   1.00 47.69  ? 49  THR F CA    1 
ATOM   3024 C C     . THR F 1 52 ? 64.495 -40.380 2.622   1.00 51.86  ? 49  THR F C     1 
ATOM   3025 O O     . THR F 1 52 ? 63.858 -39.544 3.267   1.00 50.77  ? 49  THR F O     1 
ATOM   3026 C CB    . THR F 1 52 ? 66.709 -41.311 2.482   1.00 40.95  ? 49  THR F CB    1 
ATOM   3027 O OG1   . THR F 1 52 ? 66.709 -41.471 3.899   1.00 39.56  ? 49  THR F OG1   1 
ATOM   3028 C CG2   . THR F 1 52 ? 68.098 -41.170 2.004   1.00 43.39  ? 49  THR F CG2   1 
ATOM   3029 N N     . ILE F 1 53 ? 64.026 -41.579 2.275   1.00 55.37  ? 50  ILE F N     1 
ATOM   3030 C CA    . ILE F 1 53 ? 62.727 -42.095 2.667   1.00 51.14  ? 50  ILE F CA    1 
ATOM   3031 C C     . ILE F 1 53 ? 62.810 -42.899 3.997   1.00 57.05  ? 50  ILE F C     1 
ATOM   3032 O O     . ILE F 1 53 ? 62.002 -42.698 4.942   1.00 47.59  ? 50  ILE F O     1 
ATOM   3033 C CB    . ILE F 1 53 ? 62.185 -42.959 1.523   1.00 50.00  ? 50  ILE F CB    1 
ATOM   3034 C CG1   . ILE F 1 53 ? 61.979 -42.110 0.252   1.00 48.38  ? 50  ILE F CG1   1 
ATOM   3035 C CG2   . ILE F 1 53 ? 60.897 -43.689 1.935   1.00 54.95  ? 50  ILE F CG2   1 
ATOM   3036 C CD1   . ILE F 1 53 ? 61.205 -40.811 0.455   1.00 40.98  ? 50  ILE F CD1   1 
ATOM   3037 N N     . LYS F 1 54 ? 63.794 -43.795 4.088   1.00 62.50  ? 51  LYS F N     1 
ATOM   3038 C CA    . LYS F 1 54 ? 63.984 -44.567 5.328   1.00 78.00  ? 51  LYS F CA    1 
ATOM   3039 C C     . LYS F 1 54 ? 64.200 -43.633 6.512   1.00 73.08  ? 51  LYS F C     1 
ATOM   3040 O O     . LYS F 1 54 ? 64.212 -44.056 7.671   1.00 65.57  ? 51  LYS F O     1 
ATOM   3041 C CB    . LYS F 1 54 ? 65.145 -45.577 5.224   1.00 77.98  ? 51  LYS F CB    1 
ATOM   3042 C CG    . LYS F 1 54 ? 64.711 -47.004 4.891   1.00 87.61  ? 51  LYS F CG    1 
ATOM   3043 C CD    . LYS F 1 54 ? 65.858 -47.858 4.359   1.00 93.42  ? 51  LYS F CD    1 
ATOM   3044 C CE    . LYS F 1 54 ? 65.744 -49.311 4.812   1.00 90.74  ? 51  LYS F CE    1 
ATOM   3045 N NZ    . LYS F 1 54 ? 66.766 -50.129 4.109   1.00 93.85  ? 51  LYS F NZ    1 
ATOM   3046 N N     . SER F 1 55 ? 64.375 -42.356 6.189   1.00 68.31  ? 52  SER F N     1 
ATOM   3047 C CA    . SER F 1 55 ? 64.530 -41.320 7.189   1.00 65.03  ? 52  SER F CA    1 
ATOM   3048 C C     . SER F 1 55 ? 63.256 -40.559 7.395   1.00 59.93  ? 52  SER F C     1 
ATOM   3049 O O     . SER F 1 55 ? 62.911 -40.164 8.524   1.00 58.69  ? 52  SER F O     1 
ATOM   3050 C CB    . SER F 1 55 ? 65.644 -40.386 6.784   1.00 64.12  ? 52  SER F CB    1 
ATOM   3051 O OG    . SER F 1 55 ? 66.802 -40.815 7.464   1.00 67.26  ? 52  SER F OG    1 
ATOM   3052 N N     . LEU F 1 56 ? 62.557 -40.373 6.287   1.00 57.64  ? 53  LEU F N     1 
ATOM   3053 C CA    . LEU F 1 56 ? 61.226 -39.868 6.321   1.00 53.49  ? 53  LEU F CA    1 
ATOM   3054 C C     . LEU F 1 56 ? 60.323 -40.874 7.005   1.00 56.36  ? 53  LEU F C     1 
ATOM   3055 O O     . LEU F 1 56 ? 59.554 -40.480 7.880   1.00 63.02  ? 53  LEU F O     1 
ATOM   3056 C CB    . LEU F 1 56 ? 60.747 -39.479 4.927   1.00 48.49  ? 53  LEU F CB    1 
ATOM   3057 C CG    . LEU F 1 56 ? 59.408 -38.771 5.142   1.00 52.28  ? 53  LEU F CG    1 
ATOM   3058 C CD1   . LEU F 1 56 ? 59.605 -37.607 6.123   1.00 50.20  ? 53  LEU F CD1   1 
ATOM   3059 C CD2   . LEU F 1 56 ? 58.649 -38.399 3.862   1.00 48.29  ? 53  LEU F CD2   1 
ATOM   3060 N N     . GLU F 1 57 ? 60.423 -42.163 6.663   1.00 61.28  ? 54  GLU F N     1 
ATOM   3061 C CA    . GLU F 1 57 ? 59.570 -43.177 7.359   1.00 64.40  ? 54  GLU F CA    1 
ATOM   3062 C C     . GLU F 1 57 ? 59.761 -43.093 8.871   1.00 57.07  ? 54  GLU F C     1 
ATOM   3063 O O     . GLU F 1 57 ? 58.812 -42.844 9.583   1.00 60.68  ? 54  GLU F O     1 
ATOM   3064 C CB    . GLU F 1 57 ? 59.789 -44.612 6.879   1.00 62.67  ? 54  GLU F CB    1 
ATOM   3065 C CG    . GLU F 1 57 ? 58.493 -45.393 6.800   1.00 72.19  ? 54  GLU F CG    1 
ATOM   3066 C CD    . GLU F 1 57 ? 58.698 -46.893 6.659   1.00 90.85  ? 54  GLU F CD    1 
ATOM   3067 O OE1   . GLU F 1 57 ? 59.852 -47.327 6.438   1.00 102.50 ? 54  GLU F OE1   1 
ATOM   3068 O OE2   . GLU F 1 57 ? 57.703 -47.647 6.776   1.00 95.62  ? 54  GLU F OE2   1 
ATOM   3069 N N     . LEU F 1 58 ? 61.003 -43.236 9.329   1.00 56.03  ? 55  LEU F N     1 
ATOM   3070 C CA    . LEU F 1 58 ? 61.389 -43.013 10.735  1.00 56.07  ? 55  LEU F CA    1 
ATOM   3071 C C     . LEU F 1 58 ? 60.994 -41.656 11.364  1.00 60.13  ? 55  LEU F C     1 
ATOM   3072 O O     . LEU F 1 58 ? 61.088 -41.528 12.601  1.00 62.87  ? 55  LEU F O     1 
ATOM   3073 C CB    . LEU F 1 58 ? 62.895 -43.272 10.964  1.00 48.51  ? 55  LEU F CB    1 
ATOM   3074 C CG    . LEU F 1 58 ? 63.577 -44.525 10.376  1.00 51.67  ? 55  LEU F CG    1 
ATOM   3075 C CD1   . LEU F 1 58 ? 65.036 -44.722 10.819  1.00 45.73  ? 55  LEU F CD1   1 
ATOM   3076 C CD2   . LEU F 1 58 ? 62.761 -45.788 10.656  1.00 59.53  ? 55  LEU F CD2   1 
ATOM   3077 N N     . ILE F 1 59 ? 60.590 -40.657 10.561  1.00 52.39  ? 56  ILE F N     1 
ATOM   3078 C CA    . ILE F 1 59 ? 60.255 -39.367 11.144  1.00 54.73  ? 56  ILE F CA    1 
ATOM   3079 C C     . ILE F 1 59 ? 58.819 -39.380 11.457  1.00 59.11  ? 56  ILE F C     1 
ATOM   3080 O O     . ILE F 1 59 ? 58.376 -38.731 12.401  1.00 68.77  ? 56  ILE F O     1 
ATOM   3081 C CB    . ILE F 1 59 ? 60.464 -38.150 10.232  1.00 62.07  ? 56  ILE F CB    1 
ATOM   3082 C CG1   . ILE F 1 59 ? 61.887 -37.604 10.361  1.00 59.46  ? 56  ILE F CG1   1 
ATOM   3083 C CG2   . ILE F 1 59 ? 59.470 -37.017 10.592  1.00 57.01  ? 56  ILE F CG2   1 
ATOM   3084 C CD1   . ILE F 1 59 ? 62.065 -36.302 9.605   1.00 57.15  ? 56  ILE F CD1   1 
ATOM   3085 N N     . MET F 1 60 ? 58.077 -40.089 10.623  1.00 63.59  ? 57  MET F N     1 
ATOM   3086 C CA    . MET F 1 60 ? 56.644 -40.196 10.803  1.00 66.94  ? 57  MET F CA    1 
ATOM   3087 C C     . MET F 1 60 ? 56.279 -40.983 12.093  1.00 64.30  ? 57  MET F C     1 
ATOM   3088 O O     . MET F 1 60 ? 55.702 -40.404 12.996  1.00 56.17  ? 57  MET F O     1 
ATOM   3089 C CB    . MET F 1 60 ? 56.005 -40.713 9.505   1.00 68.21  ? 57  MET F CB    1 
ATOM   3090 C CG    . MET F 1 60 ? 55.837 -39.596 8.466   1.00 66.10  ? 57  MET F CG    1 
ATOM   3091 S SD    . MET F 1 60 ? 55.247 -40.081 6.824   1.00 64.27  ? 57  MET F SD    1 
ATOM   3092 C CE    . MET F 1 60 ? 56.693 -41.089 6.379   1.00 69.41  ? 57  MET F CE    1 
ATOM   3093 N N     . LYS F 1 61 ? 56.664 -42.266 12.187  1.00 70.11  ? 58  LYS F N     1 
ATOM   3094 C CA    . LYS F 1 61 ? 56.601 -43.029 13.435  1.00 65.74  ? 58  LYS F CA    1 
ATOM   3095 C C     . LYS F 1 61 ? 57.044 -42.111 14.544  1.00 66.43  ? 58  LYS F C     1 
ATOM   3096 O O     . LYS F 1 61 ? 56.273 -41.877 15.468  1.00 67.22  ? 58  LYS F O     1 
ATOM   3097 C CB    . LYS F 1 61 ? 57.506 -44.278 13.413  1.00 73.93  ? 58  LYS F CB    1 
ATOM   3098 C CG    . LYS F 1 61 ? 57.544 -45.043 14.751  1.00 76.30  ? 58  LYS F CG    1 
ATOM   3099 C CD    . LYS F 1 61 ? 58.236 -46.389 14.626  1.00 71.37  ? 58  LYS F CD    1 
ATOM   3100 C CE    . LYS F 1 61 ? 57.290 -47.453 14.111  1.00 68.57  ? 58  LYS F CE    1 
ATOM   3101 N NZ    . LYS F 1 61 ? 57.838 -48.179 12.923  1.00 65.74  ? 58  LYS F NZ    1 
ATOM   3102 N N     . GLY F 1 62 ? 58.282 -41.602 14.449  1.00 64.82  ? 59  GLY F N     1 
ATOM   3103 C CA    . GLY F 1 62 ? 58.785 -40.589 15.376  1.00 67.98  ? 59  GLY F CA    1 
ATOM   3104 C C     . GLY F 1 62 ? 57.734 -39.562 15.838  1.00 78.77  ? 59  GLY F C     1 
ATOM   3105 O O     . GLY F 1 62 ? 57.512 -39.394 17.049  1.00 79.59  ? 59  GLY F O     1 
ATOM   3106 N N     . LEU F 1 63 ? 57.087 -38.877 14.888  1.00 69.70  ? 60  LEU F N     1 
ATOM   3107 C CA    . LEU F 1 63 ? 56.132 -37.825 15.190  1.00 69.29  ? 60  LEU F CA    1 
ATOM   3108 C C     . LEU F 1 63 ? 54.812 -38.451 15.546  1.00 75.85  ? 60  LEU F C     1 
ATOM   3109 O O     . LEU F 1 63 ? 53.802 -37.749 15.768  1.00 75.52  ? 60  LEU F O     1 
ATOM   3110 C CB    . LEU F 1 63 ? 55.906 -36.958 13.957  1.00 82.09  ? 60  LEU F CB    1 
ATOM   3111 C CG    . LEU F 1 63 ? 56.890 -35.830 13.665  1.00 90.14  ? 60  LEU F CG    1 
ATOM   3112 C CD1   . LEU F 1 63 ? 56.571 -35.245 12.302  1.00 90.70  ? 60  LEU F CD1   1 
ATOM   3113 C CD2   . LEU F 1 63 ? 56.853 -34.755 14.735  1.00 88.30  ? 60  LEU F CD2   1 
ATOM   3114 N N     . GLU F 1 64 ? 54.823 -39.784 15.580  1.00 76.42  ? 61  GLU F N     1 
ATOM   3115 C CA    . GLU F 1 64 ? 53.606 -40.611 15.734  1.00 78.20  ? 61  GLU F CA    1 
ATOM   3116 C C     . GLU F 1 64 ? 52.446 -40.221 14.780  1.00 77.26  ? 61  GLU F C     1 
ATOM   3117 O O     . GLU F 1 64 ? 51.352 -39.860 15.219  1.00 85.44  ? 61  GLU F O     1 
ATOM   3118 C CB    . GLU F 1 64 ? 53.182 -40.720 17.216  1.00 77.05  ? 61  GLU F CB    1 
ATOM   3119 C CG    . GLU F 1 64 ? 54.195 -41.474 18.085  1.00 78.37  ? 61  GLU F CG    1 
ATOM   3120 C CD    . GLU F 1 64 ? 53.752 -41.657 19.537  1.00 89.58  ? 61  GLU F CD    1 
ATOM   3121 O OE1   . GLU F 1 64 ? 52.717 -41.063 19.937  1.00 82.74  ? 61  GLU F OE1   1 
ATOM   3122 O OE2   . GLU F 1 64 ? 54.448 -42.404 20.283  1.00 93.74  ? 61  GLU F OE2   1 
ATOM   3123 N N     . VAL F 1 65 ? 52.717 -40.283 13.474  1.00 72.86  ? 62  VAL F N     1 
ATOM   3124 C CA    . VAL F 1 65 ? 51.692 -40.112 12.425  1.00 77.31  ? 62  VAL F CA    1 
ATOM   3125 C C     . VAL F 1 65 ? 51.892 -41.175 11.325  1.00 86.99  ? 62  VAL F C     1 
ATOM   3126 O O     . VAL F 1 65 ? 53.032 -41.544 10.991  1.00 77.71  ? 62  VAL F O     1 
ATOM   3127 C CB    . VAL F 1 65 ? 51.586 -38.655 11.844  1.00 72.56  ? 62  VAL F CB    1 
ATOM   3128 C CG1   . VAL F 1 65 ? 52.947 -38.051 11.534  1.00 74.14  ? 62  VAL F CG1   1 
ATOM   3129 C CG2   . VAL F 1 65 ? 50.719 -38.617 10.585  1.00 67.40  ? 62  VAL F CG2   1 
ATOM   3130 N N     . SER F 1 66 ? 50.771 -41.672 10.790  1.00 93.33  ? 63  SER F N     1 
ATOM   3131 C CA    . SER F 1 66 ? 50.797 -42.686 9.738   1.00 94.02  ? 63  SER F CA    1 
ATOM   3132 C C     . SER F 1 66 ? 51.250 -42.076 8.430   1.00 98.80  ? 63  SER F C     1 
ATOM   3133 O O     . SER F 1 66 ? 50.835 -40.967 8.062   1.00 94.87  ? 63  SER F O     1 
ATOM   3134 C CB    . SER F 1 66 ? 49.427 -43.343 9.560   1.00 100.11 ? 63  SER F CB    1 
ATOM   3135 O OG    . SER F 1 66 ? 48.392 -42.413 9.797   1.00 102.06 ? 63  SER F OG    1 
ATOM   3136 N N     . ASP F 1 67 ? 52.122 -42.802 7.736   1.00 93.90  ? 64  ASP F N     1 
ATOM   3137 C CA    . ASP F 1 67 ? 52.655 -42.346 6.463   1.00 78.91  ? 64  ASP F CA    1 
ATOM   3138 C C     . ASP F 1 67 ? 51.541 -41.669 5.635   1.00 80.79  ? 64  ASP F C     1 
ATOM   3139 O O     . ASP F 1 67 ? 51.776 -40.820 4.791   1.00 88.31  ? 64  ASP F O     1 
ATOM   3140 C CB    . ASP F 1 67 ? 53.319 -43.519 5.728   1.00 72.24  ? 64  ASP F CB    1 
ATOM   3141 C CG    . ASP F 1 67 ? 52.569 -44.819 5.897   1.00 75.39  ? 64  ASP F CG    1 
ATOM   3142 O OD1   . ASP F 1 67 ? 51.495 -44.803 6.545   1.00 89.27  ? 64  ASP F OD1   1 
ATOM   3143 O OD2   . ASP F 1 67 ? 53.040 -45.858 5.371   1.00 72.99  ? 64  ASP F OD2   1 
ATOM   3144 N N     . VAL F 1 68 ? 50.312 -41.973 5.966   1.00 79.64  ? 65  VAL F N     1 
ATOM   3145 C CA    . VAL F 1 68 ? 49.190 -41.608 5.132   1.00 82.78  ? 65  VAL F CA    1 
ATOM   3146 C C     . VAL F 1 68 ? 48.633 -40.251 5.478   1.00 78.27  ? 65  VAL F C     1 
ATOM   3147 O O     . VAL F 1 68 ? 48.277 -39.466 4.619   1.00 70.03  ? 65  VAL F O     1 
ATOM   3148 C CB    . VAL F 1 68 ? 48.068 -42.611 5.355   1.00 85.88  ? 65  VAL F CB    1 
ATOM   3149 C CG1   . VAL F 1 68 ? 46.932 -42.351 4.399   1.00 88.89  ? 65  VAL F CG1   1 
ATOM   3150 C CG2   . VAL F 1 68 ? 48.608 -44.016 5.194   1.00 95.27  ? 65  VAL F CG2   1 
ATOM   3151 N N     . VAL F 1 69 ? 48.538 -39.997 6.776   1.00 82.39  ? 66  VAL F N     1 
ATOM   3152 C CA    . VAL F 1 69 ? 48.072 -38.724 7.293   1.00 77.14  ? 66  VAL F CA    1 
ATOM   3153 C C     . VAL F 1 69 ? 49.107 -37.630 6.993   1.00 82.61  ? 66  VAL F C     1 
ATOM   3154 O O     . VAL F 1 69 ? 48.835 -36.445 7.160   1.00 74.70  ? 66  VAL F O     1 
ATOM   3155 C CB    . VAL F 1 69 ? 47.830 -38.824 8.818   1.00 69.51  ? 66  VAL F CB    1 
ATOM   3156 C CG1   . VAL F 1 69 ? 46.919 -37.700 9.299   1.00 78.35  ? 66  VAL F CG1   1 
ATOM   3157 C CG2   . VAL F 1 69 ? 47.232 -40.176 9.160   1.00 60.54  ? 66  VAL F CG2   1 
ATOM   3158 N N     . PHE F 1 70 ? 50.310 -38.039 6.589   1.00 81.41  ? 67  PHE F N     1 
ATOM   3159 C CA    . PHE F 1 70 ? 51.387 -37.100 6.382   1.00 78.37  ? 67  PHE F CA    1 
ATOM   3160 C C     . PHE F 1 70 ? 51.351 -36.614 4.953   1.00 80.38  ? 67  PHE F C     1 
ATOM   3161 O O     . PHE F 1 70 ? 51.823 -35.524 4.649   1.00 93.32  ? 67  PHE F O     1 
ATOM   3162 C CB    . PHE F 1 70 ? 52.739 -37.760 6.714   1.00 84.53  ? 67  PHE F CB    1 
ATOM   3163 C CG    . PHE F 1 70 ? 53.935 -36.868 6.504   1.00 81.94  ? 67  PHE F CG    1 
ATOM   3164 C CD1   . PHE F 1 70 ? 54.293 -35.925 7.456   1.00 90.01  ? 67  PHE F CD1   1 
ATOM   3165 C CD2   . PHE F 1 70 ? 54.706 -36.983 5.363   1.00 88.33  ? 67  PHE F CD2   1 
ATOM   3166 C CE1   . PHE F 1 70 ? 55.390 -35.105 7.264   1.00 100.32 ? 67  PHE F CE1   1 
ATOM   3167 C CE2   . PHE F 1 70 ? 55.810 -36.171 5.166   1.00 99.13  ? 67  PHE F CE2   1 
ATOM   3168 C CZ    . PHE F 1 70 ? 56.153 -35.229 6.117   1.00 100.52 ? 67  PHE F CZ    1 
ATOM   3169 N N     . PHE F 1 71 ? 50.817 -37.424 4.056   1.00 73.16  ? 68  PHE F N     1 
ATOM   3170 C CA    . PHE F 1 71 ? 50.896 -37.050 2.672   1.00 70.70  ? 68  PHE F CA    1 
ATOM   3171 C C     . PHE F 1 71 ? 49.795 -36.104 2.304   1.00 69.54  ? 68  PHE F C     1 
ATOM   3172 O O     . PHE F 1 71 ? 49.971 -35.266 1.435   1.00 70.00  ? 68  PHE F O     1 
ATOM   3173 C CB    . PHE F 1 71 ? 50.850 -38.282 1.794   1.00 72.09  ? 68  PHE F CB    1 
ATOM   3174 C CG    . PHE F 1 71 ? 52.086 -39.103 1.860   1.00 70.56  ? 68  PHE F CG    1 
ATOM   3175 C CD1   . PHE F 1 71 ? 53.339 -38.512 1.682   1.00 72.41  ? 68  PHE F CD1   1 
ATOM   3176 C CD2   . PHE F 1 71 ? 52.012 -40.474 2.090   1.00 72.51  ? 68  PHE F CD2   1 
ATOM   3177 C CE1   . PHE F 1 71 ? 54.498 -39.277 1.753   1.00 74.96  ? 68  PHE F CE1   1 
ATOM   3178 C CE2   . PHE F 1 71 ? 53.170 -41.249 2.144   1.00 77.76  ? 68  PHE F CE2   1 
ATOM   3179 C CZ    . PHE F 1 71 ? 54.417 -40.649 1.988   1.00 72.69  ? 68  PHE F CZ    1 
ATOM   3180 N N     . GLU F 1 72 ? 48.650 -36.244 2.965   1.00 77.65  ? 69  GLU F N     1 
ATOM   3181 C CA    . GLU F 1 72 ? 47.498 -35.409 2.625   1.00 83.65  ? 69  GLU F CA    1 
ATOM   3182 C C     . GLU F 1 72 ? 47.807 -34.000 3.042   1.00 80.05  ? 69  GLU F C     1 
ATOM   3183 O O     . GLU F 1 72 ? 47.647 -33.053 2.262   1.00 72.16  ? 69  GLU F O     1 
ATOM   3184 C CB    . GLU F 1 72 ? 46.215 -35.868 3.318   1.00 87.27  ? 69  GLU F CB    1 
ATOM   3185 C CG    . GLU F 1 72 ? 45.620 -37.190 2.828   1.00 96.32  ? 69  GLU F CG    1 
ATOM   3186 C CD    . GLU F 1 72 ? 45.783 -38.305 3.848   1.00 102.22 ? 69  GLU F CD    1 
ATOM   3187 O OE1   . GLU F 1 72 ? 46.533 -38.079 4.839   1.00 122.53 ? 69  GLU F OE1   1 
ATOM   3188 O OE2   . GLU F 1 72 ? 45.179 -39.395 3.668   1.00 89.01  ? 69  GLU F OE2   1 
ATOM   3189 N N     . MET F 1 73 ? 48.287 -33.900 4.285   1.00 87.83  ? 70  MET F N     1 
ATOM   3190 C CA    . MET F 1 73 ? 48.696 -32.651 4.895   1.00 82.95  ? 70  MET F CA    1 
ATOM   3191 C C     . MET F 1 73 ? 49.679 -31.958 3.976   1.00 85.38  ? 70  MET F C     1 
ATOM   3192 O O     . MET F 1 73 ? 49.614 -30.725 3.783   1.00 79.33  ? 70  MET F O     1 
ATOM   3193 C CB    . MET F 1 73 ? 49.300 -32.915 6.267   1.00 75.26  ? 70  MET F CB    1 
ATOM   3194 C CG    . MET F 1 73 ? 48.436 -32.362 7.391   1.00 76.65  ? 70  MET F CG    1 
ATOM   3195 S SD    . MET F 1 73 ? 49.288 -31.909 8.943   1.00 88.23  ? 70  MET F SD    1 
ATOM   3196 C CE    . MET F 1 73 ? 50.653 -30.871 8.436   1.00 81.84  ? 70  MET F CE    1 
ATOM   3197 N N     . LEU F 1 74 ? 50.556 -32.788 3.399   1.00 83.86  ? 71  LEU F N     1 
ATOM   3198 C CA    . LEU F 1 74 ? 51.527 -32.391 2.377   1.00 77.95  ? 71  LEU F CA    1 
ATOM   3199 C C     . LEU F 1 74 ? 50.837 -31.805 1.148   1.00 81.46  ? 71  LEU F C     1 
ATOM   3200 O O     . LEU F 1 74 ? 51.027 -30.626 0.847   1.00 83.93  ? 71  LEU F O     1 
ATOM   3201 C CB    . LEU F 1 74 ? 52.367 -33.604 1.985   1.00 73.32  ? 71  LEU F CB    1 
ATOM   3202 C CG    . LEU F 1 74 ? 53.428 -33.523 0.893   1.00 77.51  ? 71  LEU F CG    1 
ATOM   3203 C CD1   . LEU F 1 74 ? 54.529 -32.512 1.201   1.00 78.75  ? 71  LEU F CD1   1 
ATOM   3204 C CD2   . LEU F 1 74 ? 54.008 -34.920 0.743   1.00 80.90  ? 71  LEU F CD2   1 
ATOM   3205 N N     . ILE F 1 75 ? 50.040 -32.636 0.467   1.00 79.41  ? 72  ILE F N     1 
ATOM   3206 C CA    . ILE F 1 75 ? 49.267 -32.275 -0.742  1.00 80.98  ? 72  ILE F CA    1 
ATOM   3207 C C     . ILE F 1 75 ? 48.430 -30.992 -0.596  1.00 82.61  ? 72  ILE F C     1 
ATOM   3208 O O     . ILE F 1 75 ? 48.294 -30.198 -1.548  1.00 70.75  ? 72  ILE F O     1 
ATOM   3209 C CB    . ILE F 1 75 ? 48.303 -33.429 -1.135  1.00 82.83  ? 72  ILE F CB    1 
ATOM   3210 C CG1   . ILE F 1 75 ? 49.085 -34.713 -1.427  1.00 88.02  ? 72  ILE F CG1   1 
ATOM   3211 C CG2   . ILE F 1 75 ? 47.423 -33.052 -2.323  1.00 66.01  ? 72  ILE F CG2   1 
ATOM   3212 C CD1   . ILE F 1 75 ? 48.258 -35.968 -1.253  1.00 89.87  ? 72  ILE F CD1   1 
ATOM   3213 N N     . LYS F 1 76 ? 47.842 -30.815 0.588   1.00 86.93  ? 73  LYS F N     1 
ATOM   3214 C CA    . LYS F 1 76 ? 47.171 -29.559 0.936   1.00 86.69  ? 73  LYS F CA    1 
ATOM   3215 C C     . LYS F 1 76 ? 48.142 -28.376 0.778   1.00 83.64  ? 73  LYS F C     1 
ATOM   3216 O O     . LYS F 1 76 ? 47.844 -27.402 0.066   1.00 70.97  ? 73  LYS F O     1 
ATOM   3217 C CB    . LYS F 1 76 ? 46.653 -29.602 2.379   1.00 100.46 ? 73  LYS F CB    1 
ATOM   3218 C CG    . LYS F 1 76 ? 45.650 -30.701 2.704   1.00 112.20 ? 73  LYS F CG    1 
ATOM   3219 C CD    . LYS F 1 76 ? 45.279 -30.664 4.185   1.00 126.63 ? 73  LYS F CD    1 
ATOM   3220 C CE    . LYS F 1 76 ? 43.955 -31.372 4.450   1.00 135.47 ? 73  LYS F CE    1 
ATOM   3221 N NZ    . LYS F 1 76 ? 43.461 -31.155 5.839   1.00 139.48 ? 73  LYS F NZ    1 
ATOM   3222 N N     . GLU F 1 77 ? 49.308 -28.494 1.429   1.00 76.72  ? 74  GLU F N     1 
ATOM   3223 C CA    . GLU F 1 77 ? 50.285 -27.430 1.474   1.00 77.95  ? 74  GLU F CA    1 
ATOM   3224 C C     . GLU F 1 77 ? 50.878 -27.187 0.107   1.00 79.49  ? 74  GLU F C     1 
ATOM   3225 O O     . GLU F 1 77 ? 51.204 -26.047 -0.254  1.00 77.92  ? 74  GLU F O     1 
ATOM   3226 C CB    . GLU F 1 77 ? 51.391 -27.760 2.475   1.00 89.05  ? 74  GLU F CB    1 
ATOM   3227 C CG    . GLU F 1 77 ? 51.005 -27.570 3.944   1.00 94.10  ? 74  GLU F CG    1 
ATOM   3228 C CD    . GLU F 1 77 ? 50.565 -26.156 4.301   1.00 82.73  ? 74  GLU F CD    1 
ATOM   3229 O OE1   . GLU F 1 77 ? 51.185 -25.169 3.846   1.00 88.12  ? 74  GLU F OE1   1 
ATOM   3230 O OE2   . GLU F 1 77 ? 49.587 -26.035 5.055   1.00 75.61  ? 74  GLU F OE2   1 
ATOM   3231 N N     . ILE F 1 78 ? 50.999 -28.267 -0.659  1.00 77.12  ? 75  ILE F N     1 
ATOM   3232 C CA    . ILE F 1 78 ? 51.652 -28.201 -1.959  1.00 79.33  ? 75  ILE F CA    1 
ATOM   3233 C C     . ILE F 1 78 ? 50.887 -27.258 -2.869  1.00 82.05  ? 75  ILE F C     1 
ATOM   3234 O O     . ILE F 1 78 ? 51.471 -26.564 -3.739  1.00 74.30  ? 75  ILE F O     1 
ATOM   3235 C CB    . ILE F 1 78 ? 51.839 -29.596 -2.611  1.00 73.88  ? 75  ILE F CB    1 
ATOM   3236 C CG1   . ILE F 1 78 ? 53.153 -30.223 -2.099  1.00 74.12  ? 75  ILE F CG1   1 
ATOM   3237 C CG2   . ILE F 1 78 ? 51.881 -29.473 -4.131  1.00 61.79  ? 75  ILE F CG2   1 
ATOM   3238 C CD1   . ILE F 1 78 ? 53.456 -31.631 -2.576  1.00 69.41  ? 75  ILE F CD1   1 
ATOM   3239 N N     . LEU F 1 79 ? 49.579 -27.203 -2.643  1.00 84.49  ? 76  LEU F N     1 
ATOM   3240 C CA    . LEU F 1 79 ? 48.736 -26.503 -3.581  1.00 94.46  ? 76  LEU F CA    1 
ATOM   3241 C C     . LEU F 1 79 ? 48.926 -24.973 -3.617  1.00 112.65 ? 76  LEU F C     1 
ATOM   3242 O O     . LEU F 1 79 ? 48.449 -24.310 -4.546  1.00 126.13 ? 76  LEU F O     1 
ATOM   3243 C CB    . LEU F 1 79 ? 47.300 -27.005 -3.496  1.00 83.85  ? 76  LEU F CB    1 
ATOM   3244 C CG    . LEU F 1 79 ? 47.250 -28.377 -4.207  1.00 80.69  ? 76  LEU F CG    1 
ATOM   3245 C CD1   . LEU F 1 79 ? 46.110 -29.208 -3.666  1.00 87.32  ? 76  LEU F CD1   1 
ATOM   3246 C CD2   . LEU F 1 79 ? 47.183 -28.325 -5.738  1.00 70.45  ? 76  LEU F CD2   1 
ATOM   3247 N N     . LYS F 1 80 ? 49.685 -24.449 -2.642  1.00 117.51 ? 77  LYS F N     1 
ATOM   3248 C CA    . LYS F 1 80 ? 50.229 -23.072 -2.639  1.00 104.23 ? 77  LYS F CA    1 
ATOM   3249 C C     . LYS F 1 80 ? 49.210 -21.978 -3.006  1.00 100.82 ? 77  LYS F C     1 
ATOM   3250 O O     . LYS F 1 80 ? 47.996 -22.147 -2.841  1.00 92.57  ? 77  LYS F O     1 
ATOM   3251 C CB    . LYS F 1 80 ? 51.501 -22.964 -3.520  1.00 98.99  ? 77  LYS F CB    1 
ATOM   3252 C CG    . LYS F 1 80 ? 51.290 -22.276 -4.869  1.00 104.11 ? 77  LYS F CG    1 
ATOM   3253 C CD    . LYS F 1 80 ? 51.569 -23.171 -6.078  1.00 107.29 ? 77  LYS F CD    1 
ATOM   3254 C CE    . LYS F 1 80 ? 50.440 -23.181 -7.114  1.00 103.82 ? 77  LYS F CE    1 
ATOM   3255 N NZ    . LYS F 1 80 ? 49.542 -21.987 -7.100  1.00 103.82 ? 77  LYS F NZ    1 
ATOM   3256 O "O5'" . DA  G 2 1  ? 65.164 -51.747 -23.656 1.00 65.09  ? 1   DA  G "O5'" 1 
ATOM   3257 C "C5'" . DA  G 2 1  ? 63.748 -51.973 -23.791 1.00 67.29  ? 1   DA  G "C5'" 1 
ATOM   3258 C "C4'" . DA  G 2 1  ? 63.216 -52.888 -22.708 1.00 68.40  ? 1   DA  G "C4'" 1 
ATOM   3259 O "O4'" . DA  G 2 1  ? 63.760 -54.224 -22.826 1.00 71.44  ? 1   DA  G "O4'" 1 
ATOM   3260 C "C3'" . DA  G 2 1  ? 63.477 -52.457 -21.271 1.00 63.06  ? 1   DA  G "C3'" 1 
ATOM   3261 O "O3'" . DA  G 2 1  ? 62.353 -52.748 -20.440 1.00 64.27  ? 1   DA  G "O3'" 1 
ATOM   3262 C "C2'" . DA  G 2 1  ? 64.666 -53.299 -20.851 1.00 63.85  ? 1   DA  G "C2'" 1 
ATOM   3263 C "C1'" . DA  G 2 1  ? 64.643 -54.515 -21.758 1.00 62.46  ? 1   DA  G "C1'" 1 
ATOM   3264 N N9    . DA  G 2 1  ? 65.933 -54.840 -22.356 1.00 68.12  ? 1   DA  G N9    1 
ATOM   3265 C C8    . DA  G 2 1  ? 66.499 -54.287 -23.481 1.00 71.13  ? 1   DA  G C8    1 
ATOM   3266 N N7    . DA  G 2 1  ? 67.650 -54.821 -23.814 1.00 62.36  ? 1   DA  G N7    1 
ATOM   3267 C C5    . DA  G 2 1  ? 67.849 -55.802 -22.853 1.00 65.04  ? 1   DA  G C5    1 
ATOM   3268 C C6    . DA  G 2 1  ? 68.890 -56.725 -22.645 1.00 65.29  ? 1   DA  G C6    1 
ATOM   3269 N N6    . DA  G 2 1  ? 69.958 -56.825 -23.441 1.00 58.91  ? 1   DA  G N6    1 
ATOM   3270 N N1    . DA  G 2 1  ? 68.798 -57.545 -21.573 1.00 63.17  ? 1   DA  G N1    1 
ATOM   3271 C C2    . DA  G 2 1  ? 67.709 -57.461 -20.793 1.00 64.53  ? 1   DA  G C2    1 
ATOM   3272 N N3    . DA  G 2 1  ? 66.658 -56.647 -20.895 1.00 59.76  ? 1   DA  G N3    1 
ATOM   3273 C C4    . DA  G 2 1  ? 66.799 -55.824 -21.948 1.00 65.18  ? 1   DA  G C4    1 
ATOM   3274 P P     . DT  G 2 2  ? 62.249 -52.062 -19.002 1.00 71.78  ? 2   DT  G P     1 
ATOM   3275 O OP1   . DT  G 2 2  ? 60.865 -52.236 -18.494 1.00 61.37  ? 2   DT  G OP1   1 
ATOM   3276 O OP2   . DT  G 2 2  ? 62.797 -50.687 -19.146 1.00 82.33  ? 2   DT  G OP2   1 
ATOM   3277 O "O5'" . DT  G 2 2  ? 63.208 -52.965 -18.092 1.00 68.02  ? 2   DT  G "O5'" 1 
ATOM   3278 C "C5'" . DT  G 2 2  ? 62.988 -54.391 -17.955 1.00 68.62  ? 2   DT  G "C5'" 1 
ATOM   3279 C "C4'" . DT  G 2 2  ? 64.162 -55.111 -17.325 1.00 69.67  ? 2   DT  G "C4'" 1 
ATOM   3280 O "O4'" . DT  G 2 2  ? 65.298 -55.167 -18.215 1.00 72.66  ? 2   DT  G "O4'" 1 
ATOM   3281 C "C3'" . DT  G 2 2  ? 64.702 -54.533 -16.017 1.00 69.32  ? 2   DT  G "C3'" 1 
ATOM   3282 O "O3'" . DT  G 2 2  ? 64.214 -55.320 -14.929 1.00 68.15  ? 2   DT  G "O3'" 1 
ATOM   3283 C "C2'" . DT  G 2 2  ? 66.221 -54.610 -16.158 1.00 66.03  ? 2   DT  G "C2'" 1 
ATOM   3284 C "C1'" . DT  G 2 2  ? 66.446 -55.403 -17.430 1.00 56.02  ? 2   DT  G "C1'" 1 
ATOM   3285 N N1    . DT  G 2 2  ? 67.610 -55.061 -18.249 1.00 58.39  ? 2   DT  G N1    1 
ATOM   3286 C C2    . DT  G 2 2  ? 68.680 -55.929 -18.271 1.00 67.97  ? 2   DT  G C2    1 
ATOM   3287 O O2    . DT  G 2 2  ? 68.737 -56.932 -17.581 1.00 81.20  ? 2   DT  G O2    1 
ATOM   3288 N N3    . DT  G 2 2  ? 69.691 -55.573 -19.132 1.00 65.74  ? 2   DT  G N3    1 
ATOM   3289 C C4    . DT  G 2 2  ? 69.729 -54.470 -19.966 1.00 65.31  ? 2   DT  G C4    1 
ATOM   3290 O O4    . DT  G 2 2  ? 70.702 -54.285 -20.697 1.00 53.24  ? 2   DT  G O4    1 
ATOM   3291 C C5    . DT  G 2 2  ? 68.556 -53.620 -19.913 1.00 70.39  ? 2   DT  G C5    1 
ATOM   3292 C C7    . DT  G 2 2  ? 68.501 -52.405 -20.785 1.00 78.86  ? 2   DT  G C7    1 
ATOM   3293 C C6    . DT  G 2 2  ? 67.567 -53.960 -19.075 1.00 64.13  ? 2   DT  G C6    1 
ATOM   3294 P P     . DG  G 2 3  ? 64.323 -54.766 -13.431 1.00 77.94  ? 3   DG  G P     1 
ATOM   3295 O OP1   . DG  G 2 3  ? 62.941 -54.803 -12.820 1.00 60.13  ? 3   DG  G OP1   1 
ATOM   3296 O OP2   . DG  G 2 3  ? 65.081 -53.479 -13.483 1.00 67.92  ? 3   DG  G OP2   1 
ATOM   3297 O "O5'" . DG  G 2 3  ? 65.306 -55.823 -12.750 1.00 70.02  ? 3   DG  G "O5'" 1 
ATOM   3298 C "C5'" . DG  G 2 3  ? 65.644 -57.048 -13.422 1.00 65.59  ? 3   DG  G "C5'" 1 
ATOM   3299 C "C4'" . DG  G 2 3  ? 67.077 -57.435 -13.148 1.00 74.94  ? 3   DG  G "C4'" 1 
ATOM   3300 O "O4'" . DG  G 2 3  ? 67.902 -56.935 -14.214 1.00 70.30  ? 3   DG  G "O4'" 1 
ATOM   3301 C "C3'" . DG  G 2 3  ? 67.706 -56.916 -11.845 1.00 85.89  ? 3   DG  G "C3'" 1 
ATOM   3302 O "O3'" . DG  G 2 3  ? 68.070 -58.024 -11.000 1.00 93.60  ? 3   DG  G "O3'" 1 
ATOM   3303 C "C2'" . DG  G 2 3  ? 68.920 -56.114 -12.308 1.00 82.21  ? 3   DG  G "C2'" 1 
ATOM   3304 C "C1'" . DG  G 2 3  ? 69.182 -56.686 -13.681 1.00 71.37  ? 3   DG  G "C1'" 1 
ATOM   3305 N N9    . DG  G 2 3  ? 69.888 -55.847 -14.638 1.00 68.10  ? 3   DG  G N9    1 
ATOM   3306 C C8    . DG  G 2 3  ? 69.409 -54.709 -15.238 1.00 70.91  ? 3   DG  G C8    1 
ATOM   3307 N N7    . DG  G 2 3  ? 70.219 -54.225 -16.141 1.00 74.09  ? 3   DG  G N7    1 
ATOM   3308 C C5    . DG  G 2 3  ? 71.295 -55.102 -16.143 1.00 71.33  ? 3   DG  G C5    1 
ATOM   3309 C C6    . DG  G 2 3  ? 72.490 -55.090 -16.913 1.00 71.91  ? 3   DG  G C6    1 
ATOM   3310 O O6    . DG  G 2 3  ? 72.853 -54.269 -17.764 1.00 65.88  ? 3   DG  G O6    1 
ATOM   3311 N N1    . DG  G 2 3  ? 73.299 -56.184 -16.616 1.00 71.66  ? 3   DG  G N1    1 
ATOM   3312 C C2    . DG  G 2 3  ? 73.009 -57.151 -15.686 1.00 72.85  ? 3   DG  G C2    1 
ATOM   3313 N N2    . DG  G 2 3  ? 73.923 -58.118 -15.538 1.00 85.72  ? 3   DG  G N2    1 
ATOM   3314 N N3    . DG  G 2 3  ? 71.902 -57.171 -14.958 1.00 67.04  ? 3   DG  G N3    1 
ATOM   3315 C C4    . DG  G 2 3  ? 71.095 -56.124 -15.238 1.00 72.07  ? 3   DG  G C4    1 
ATOM   3316 P P     . DT  G 2 4  ? 68.813 -57.782 -9.589  1.00 109.46 ? 4   DT  G P     1 
ATOM   3317 O OP1   . DT  G 2 4  ? 68.529 -58.933 -8.694  1.00 112.94 ? 4   DT  G OP1   1 
ATOM   3318 O OP2   . DT  G 2 4  ? 68.482 -56.409 -9.116  1.00 98.27  ? 4   DT  G OP2   1 
ATOM   3319 O "O5'" . DT  G 2 4  ? 70.344 -57.961 -9.987  1.00 99.26  ? 4   DT  G "O5'" 1 
ATOM   3320 C "C5'" . DT  G 2 4  ? 70.805 -59.213 -10.524 1.00 98.87  ? 4   DT  G "C5'" 1 
ATOM   3321 C "C4'" . DT  G 2 4  ? 72.315 -59.236 -10.587 1.00 104.40 ? 4   DT  G "C4'" 1 
ATOM   3322 O "O4'" . DT  G 2 4  ? 72.784 -58.433 -11.697 1.00 105.87 ? 4   DT  G "O4'" 1 
ATOM   3323 C "C3'" . DT  G 2 4  ? 73.037 -58.696 -9.351  1.00 106.24 ? 4   DT  G "C3'" 1 
ATOM   3324 O "O3'" . DT  G 2 4  ? 74.244 -59.448 -9.201  1.00 111.30 ? 4   DT  G "O3'" 1 
ATOM   3325 C "C2'" . DT  G 2 4  ? 73.418 -57.287 -9.764  1.00 104.74 ? 4   DT  G "C2'" 1 
ATOM   3326 C "C1'" . DT  G 2 4  ? 73.751 -57.506 -11.224 1.00 94.46  ? 4   DT  G "C1'" 1 
ATOM   3327 N N1    . DT  G 2 4  ? 73.692 -56.307 -12.079 1.00 87.94  ? 4   DT  G N1    1 
ATOM   3328 C C2    . DT  G 2 4  ? 74.616 -56.213 -13.097 1.00 85.19  ? 4   DT  G C2    1 
ATOM   3329 O O2    . DT  G 2 4  ? 75.449 -57.076 -13.321 1.00 90.15  ? 4   DT  G O2    1 
ATOM   3330 N N3    . DT  G 2 4  ? 74.521 -55.073 -13.856 1.00 75.63  ? 4   DT  G N3    1 
ATOM   3331 C C4    . DT  G 2 4  ? 73.608 -54.047 -13.709 1.00 66.92  ? 4   DT  G C4    1 
ATOM   3332 O O4    . DT  G 2 4  ? 73.636 -53.093 -14.479 1.00 58.29  ? 4   DT  G O4    1 
ATOM   3333 C C5    . DT  G 2 4  ? 72.665 -54.209 -12.618 1.00 66.95  ? 4   DT  G C5    1 
ATOM   3334 C C7    . DT  G 2 4  ? 71.654 -53.136 -12.367 1.00 63.33  ? 4   DT  G C7    1 
ATOM   3335 C C6    . DT  G 2 4  ? 72.755 -55.315 -11.867 1.00 72.26  ? 4   DT  G C6    1 
ATOM   3336 P P     . DA  G 2 5  ? 75.188 -59.242 -7.934  1.00 101.57 ? 5   DA  G P     1 
ATOM   3337 O OP1   . DA  G 2 5  ? 75.604 -60.589 -7.470  1.00 113.86 ? 5   DA  G OP1   1 
ATOM   3338 O OP2   . DA  G 2 5  ? 74.506 -58.328 -6.981  1.00 98.77  ? 5   DA  G OP2   1 
ATOM   3339 O "O5'" . DA  G 2 5  ? 76.482 -58.580 -8.580  1.00 87.83  ? 5   DA  G "O5'" 1 
ATOM   3340 C "C5'" . DA  G 2 5  ? 77.499 -59.425 -9.140  1.00 90.81  ? 5   DA  G "C5'" 1 
ATOM   3341 C "C4'" . DA  G 2 5  ? 78.371 -58.630 -10.081 1.00 103.40 ? 5   DA  G "C4'" 1 
ATOM   3342 O "O4'" . DA  G 2 5  ? 77.568 -57.683 -10.805 1.00 113.70 ? 5   DA  G "O4'" 1 
ATOM   3343 C "C3'" . DA  G 2 5  ? 79.414 -57.774 -9.384  1.00 113.48 ? 5   DA  G "C3'" 1 
ATOM   3344 O "O3'" . DA  G 2 5  ? 80.584 -58.550 -9.147  1.00 130.45 ? 5   DA  G "O3'" 1 
ATOM   3345 C "C2'" . DA  G 2 5  ? 79.684 -56.672 -10.393 1.00 112.78 ? 5   DA  G "C2'" 1 
ATOM   3346 C "C1'" . DA  G 2 5  ? 78.406 -56.608 -11.225 1.00 106.73 ? 5   DA  G "C1'" 1 
ATOM   3347 N N9    . DA  G 2 5  ? 77.644 -55.366 -11.104 1.00 88.49  ? 5   DA  G N9    1 
ATOM   3348 C C8    . DA  G 2 5  ? 76.653 -55.048 -10.205 1.00 78.57  ? 5   DA  G C8    1 
ATOM   3349 N N7    . DA  G 2 5  ? 76.134 -53.859 -10.389 1.00 78.18  ? 5   DA  G N7    1 
ATOM   3350 C C5    . DA  G 2 5  ? 76.835 -53.354 -11.478 1.00 78.84  ? 5   DA  G C5    1 
ATOM   3351 C C6    . DA  G 2 5  ? 76.765 -52.127 -12.165 1.00 72.71  ? 5   DA  G C6    1 
ATOM   3352 N N6    . DA  G 2 5  ? 75.923 -51.146 -11.837 1.00 65.59  ? 5   DA  G N6    1 
ATOM   3353 N N1    . DA  G 2 5  ? 77.618 -51.934 -13.198 1.00 67.88  ? 5   DA  G N1    1 
ATOM   3354 C C2    . DA  G 2 5  ? 78.457 -52.925 -13.529 1.00 73.90  ? 5   DA  G C2    1 
ATOM   3355 N N3    . DA  G 2 5  ? 78.610 -54.124 -12.967 1.00 79.68  ? 5   DA  G N3    1 
ATOM   3356 C C4    . DA  G 2 5  ? 77.767 -54.273 -11.928 1.00 80.35  ? 5   DA  G C4    1 
ATOM   3357 P P     . DG  G 2 6  ? 81.423 -58.312 -7.816  1.00 131.14 ? 6   DG  G P     1 
ATOM   3358 O OP1   . DG  G 2 6  ? 81.463 -59.595 -7.067  1.00 105.74 ? 6   DG  G OP1   1 
ATOM   3359 O OP2   . DG  G 2 6  ? 80.886 -57.089 -7.151  1.00 123.69 ? 6   DG  G OP2   1 
ATOM   3360 O "O5'" . DG  G 2 6  ? 82.881 -58.001 -8.380  1.00 135.06 ? 6   DG  G "O5'" 1 
ATOM   3361 C "C5'" . DG  G 2 6  ? 83.079 -57.418 -9.686  1.00 126.14 ? 6   DG  G "C5'" 1 
ATOM   3362 C "C4'" . DG  G 2 6  ? 83.330 -55.931 -9.568  1.00 126.88 ? 6   DG  G "C4'" 1 
ATOM   3363 O "O4'" . DG  G 2 6  ? 82.120 -55.179 -9.845  1.00 125.10 ? 6   DG  G "O4'" 1 
ATOM   3364 C "C3'" . DG  G 2 6  ? 83.836 -55.442 -8.199  1.00 126.03 ? 6   DG  G "C3'" 1 
ATOM   3365 O "O3'" . DG  G 2 6  ? 85.114 -54.812 -8.399  1.00 143.54 ? 6   DG  G "O3'" 1 
ATOM   3366 C "C2'" . DG  G 2 6  ? 82.763 -54.463 -7.743  1.00 111.70 ? 6   DG  G "C2'" 1 
ATOM   3367 C "C1'" . DG  G 2 6  ? 82.228 -53.999 -9.079  1.00 108.98 ? 6   DG  G "C1'" 1 
ATOM   3368 N N9    . DG  G 2 6  ? 80.946 -53.301 -9.082  1.00 83.21  ? 6   DG  G N9    1 
ATOM   3369 C C8    . DG  G 2 6  ? 79.910 -53.431 -8.185  1.00 76.98  ? 6   DG  G C8    1 
ATOM   3370 N N7    . DG  G 2 6  ? 78.926 -52.604 -8.417  1.00 67.63  ? 6   DG  G N7    1 
ATOM   3371 C C5    . DG  G 2 6  ? 79.348 -51.867 -9.518  1.00 74.45  ? 6   DG  G C5    1 
ATOM   3372 C C6    . DG  G 2 6  ? 78.708 -50.807 -10.220 1.00 70.49  ? 6   DG  G C6    1 
ATOM   3373 O O6    . DG  G 2 6  ? 77.601 -50.302 -10.007 1.00 76.63  ? 6   DG  G O6    1 
ATOM   3374 N N1    . DG  G 2 6  ? 79.494 -50.336 -11.268 1.00 62.80  ? 6   DG  G N1    1 
ATOM   3375 C C2    . DG  G 2 6  ? 80.746 -50.806 -11.590 1.00 71.06  ? 6   DG  G C2    1 
ATOM   3376 N N2    . DG  G 2 6  ? 81.349 -50.220 -12.639 1.00 64.48  ? 6   DG  G N2    1 
ATOM   3377 N N3    . DG  G 2 6  ? 81.359 -51.785 -10.938 1.00 69.76  ? 6   DG  G N3    1 
ATOM   3378 C C4    . DG  G 2 6  ? 80.603 -52.271 -9.926  1.00 74.79  ? 6   DG  G C4    1 
ATOM   3379 P P     . DA  G 2 7  ? 85.869 -53.977 -7.224  1.00 137.35 ? 7   DA  G P     1 
ATOM   3380 O OP1   . DA  G 2 7  ? 86.662 -54.937 -6.407  1.00 117.88 ? 7   DA  G OP1   1 
ATOM   3381 O OP2   . DA  G 2 7  ? 84.882 -53.086 -6.555  1.00 128.68 ? 7   DA  G OP2   1 
ATOM   3382 O "O5'" . DA  G 2 7  ? 86.839 -53.030 -8.063  1.00 122.57 ? 7   DA  G "O5'" 1 
ATOM   3383 C "C5'" . DA  G 2 7  ? 86.421 -52.510 -9.350  1.00 121.49 ? 7   DA  G "C5'" 1 
ATOM   3384 C "C4'" . DA  G 2 7  ? 86.070 -51.044 -9.240  1.00 116.06 ? 7   DA  G "C4'" 1 
ATOM   3385 O "O4'" . DA  G 2 7  ? 84.638 -50.863 -9.220  1.00 114.04 ? 7   DA  G "O4'" 1 
ATOM   3386 C "C3'" . DA  G 2 7  ? 86.597 -50.372 -7.971  1.00 111.24 ? 7   DA  G "C3'" 1 
ATOM   3387 O "O3'" . DA  G 2 7  ? 87.742 -49.583 -8.309  1.00 122.35 ? 7   DA  G "O3'" 1 
ATOM   3388 C "C2'" . DA  G 2 7  ? 85.433 -49.538 -7.459  1.00 102.00 ? 7   DA  G "C2'" 1 
ATOM   3389 C "C1'" . DA  G 2 7  ? 84.350 -49.668 -8.516  1.00 108.13 ? 7   DA  G "C1'" 1 
ATOM   3390 N N9    . DA  G 2 7  ? 83.009 -49.788 -7.938  1.00 102.19 ? 7   DA  G N9    1 
ATOM   3391 C C8    . DA  G 2 7  ? 82.614 -50.623 -6.922  1.00 97.69  ? 7   DA  G C8    1 
ATOM   3392 N N7    . DA  G 2 7  ? 81.352 -50.493 -6.591  1.00 93.69  ? 7   DA  G N7    1 
ATOM   3393 C C5    . DA  G 2 7  ? 80.889 -49.489 -7.430  1.00 98.41  ? 7   DA  G C5    1 
ATOM   3394 C C6    . DA  G 2 7  ? 79.625 -48.884 -7.577  1.00 95.92  ? 7   DA  G C6    1 
ATOM   3395 N N6    . DA  G 2 7  ? 78.556 -49.218 -6.851  1.00 100.67 ? 7   DA  G N6    1 
ATOM   3396 N N1    . DA  G 2 7  ? 79.496 -47.917 -8.512  1.00 89.17  ? 7   DA  G N1    1 
ATOM   3397 C C2    . DA  G 2 7  ? 80.568 -47.589 -9.244  1.00 97.90  ? 7   DA  G C2    1 
ATOM   3398 N N3    . DA  G 2 7  ? 81.807 -48.081 -9.198  1.00 100.87 ? 7   DA  G N3    1 
ATOM   3399 C C4    . DA  G 2 7  ? 81.901 -49.041 -8.262  1.00 100.26 ? 7   DA  G C4    1 
ATOM   3400 P P     . DC  G 2 8  ? 88.120 -48.293 -7.444  1.00 132.06 ? 8   DC  G P     1 
ATOM   3401 O OP1   . DC  G 2 8  ? 89.364 -47.705 -8.013  1.00 121.66 ? 8   DC  G OP1   1 
ATOM   3402 O OP2   . DC  G 2 8  ? 88.091 -48.686 -6.011  1.00 121.74 ? 8   DC  G OP2   1 
ATOM   3403 O "O5'" . DC  G 2 8  ? 86.935 -47.285 -7.790  1.00 114.82 ? 8   DC  G "O5'" 1 
ATOM   3404 C "C5'" . DC  G 2 8  ? 86.714 -46.854 -9.148  1.00 104.85 ? 8   DC  G "C5'" 1 
ATOM   3405 C "C4'" . DC  G 2 8  ? 86.034 -45.506 -9.149  1.00 99.45  ? 8   DC  G "C4'" 1 
ATOM   3406 O "O4'" . DC  G 2 8  ? 84.630 -45.686 -8.854  1.00 103.32 ? 8   DC  G "O4'" 1 
ATOM   3407 C "C3'" . DC  G 2 8  ? 86.567 -44.526 -8.104  1.00 96.87  ? 8   DC  G "C3'" 1 
ATOM   3408 O "O3'" . DC  G 2 8  ? 86.686 -43.237 -8.712  1.00 99.53  ? 8   DC  G "O3'" 1 
ATOM   3409 C "C2'" . DC  G 2 8  ? 85.507 -44.552 -7.019  1.00 100.23 ? 8   DC  G "C2'" 1 
ATOM   3410 C "C1'" . DC  G 2 8  ? 84.243 -44.809 -7.814  1.00 94.95  ? 8   DC  G "C1'" 1 
ATOM   3411 N N1    . DC  G 2 8  ? 83.170 -45.461 -7.042  1.00 84.17  ? 8   DC  G N1    1 
ATOM   3412 C C2    . DC  G 2 8  ? 81.850 -45.025 -7.209  1.00 90.41  ? 8   DC  G C2    1 
ATOM   3413 O O2    . DC  G 2 8  ? 81.613 -44.125 -8.031  1.00 95.94  ? 8   DC  G O2    1 
ATOM   3414 N N3    . DC  G 2 8  ? 80.865 -45.609 -6.488  1.00 89.05  ? 8   DC  G N3    1 
ATOM   3415 C C4    . DC  G 2 8  ? 81.160 -46.575 -5.614  1.00 86.53  ? 8   DC  G C4    1 
ATOM   3416 N N4    . DC  G 2 8  ? 80.156 -47.117 -4.921  1.00 80.60  ? 8   DC  G N4    1 
ATOM   3417 C C5    . DC  G 2 8  ? 82.497 -47.029 -5.414  1.00 82.61  ? 8   DC  G C5    1 
ATOM   3418 C C6    . DC  G 2 8  ? 83.460 -46.454 -6.148  1.00 85.56  ? 8   DC  G C6    1 
ATOM   3419 P P     . DT  G 2 9  ? 86.781 -41.906 -7.822  1.00 97.26  ? 9   DT  G P     1 
ATOM   3420 O OP1   . DT  G 2 9  ? 87.557 -40.898 -8.587  1.00 88.04  ? 9   DT  G OP1   1 
ATOM   3421 O OP2   . DT  G 2 9  ? 87.241 -42.283 -6.455  1.00 87.60  ? 9   DT  G OP2   1 
ATOM   3422 O "O5'" . DT  G 2 9  ? 85.262 -41.417 -7.805  1.00 84.44  ? 9   DT  G "O5'" 1 
ATOM   3423 C "C5'" . DT  G 2 9  ? 84.806 -40.404 -8.715  1.00 72.37  ? 9   DT  G "C5'" 1 
ATOM   3424 C "C4'" . DT  G 2 9  ? 83.505 -39.846 -8.202  1.00 65.59  ? 9   DT  G "C4'" 1 
ATOM   3425 O "O4'" . DT  G 2 9  ? 82.894 -40.881 -7.419  1.00 62.85  ? 9   DT  G "O4'" 1 
ATOM   3426 C "C3'" . DT  G 2 9  ? 83.630 -38.634 -7.274  1.00 65.27  ? 9   DT  G "C3'" 1 
ATOM   3427 O "O3'" . DT  G 2 9  ? 82.925 -37.561 -7.920  1.00 62.04  ? 9   DT  G "O3'" 1 
ATOM   3428 C "C2'" . DT  G 2 9  ? 83.055 -39.117 -5.942  1.00 62.12  ? 9   DT  G "C2'" 1 
ATOM   3429 C "C1'" . DT  G 2 9  ? 82.184 -40.281 -6.369  1.00 61.30  ? 9   DT  G "C1'" 1 
ATOM   3430 N N1    . DT  G 2 9  ? 81.919 -41.333 -5.376  1.00 65.02  ? 9   DT  G N1    1 
ATOM   3431 C C2    . DT  G 2 9  ? 80.612 -41.597 -5.023  1.00 69.40  ? 9   DT  G C2    1 
ATOM   3432 O O2    . DT  G 2 9  ? 79.660 -40.953 -5.442  1.00 76.36  ? 9   DT  G O2    1 
ATOM   3433 N N3    . DT  G 2 9  ? 80.460 -42.636 -4.136  1.00 60.30  ? 9   DT  G N3    1 
ATOM   3434 C C4    . DT  G 2 9  ? 81.456 -43.438 -3.612  1.00 58.84  ? 9   DT  G C4    1 
ATOM   3435 O O4    . DT  G 2 9  ? 81.171 -44.332 -2.826  1.00 58.88  ? 9   DT  G O4    1 
ATOM   3436 C C5    . DT  G 2 9  ? 82.793 -43.127 -4.051  1.00 65.32  ? 9   DT  G C5    1 
ATOM   3437 C C7    . DT  G 2 9  ? 83.935 -43.929 -3.511  1.00 70.33  ? 9   DT  G C7    1 
ATOM   3438 C C6    . DT  G 2 9  ? 82.954 -42.120 -4.921  1.00 64.30  ? 9   DT  G C6    1 
ATOM   3439 P P     . DA  G 2 10 ? 82.429 -36.289 -7.081  1.00 81.43  ? 10  DA  G P     1 
ATOM   3440 O OP1   . DA  G 2 10 ? 82.174 -35.172 -8.041  1.00 78.03  ? 10  DA  G OP1   1 
ATOM   3441 O OP2   . DA  G 2 10 ? 83.380 -36.085 -5.943  1.00 80.02  ? 10  DA  G OP2   1 
ATOM   3442 O "O5'" . DA  G 2 10 ? 81.014 -36.761 -6.507  1.00 73.84  ? 10  DA  G "O5'" 1 
ATOM   3443 C "C5'" . DA  G 2 10 ? 79.777 -36.133 -6.940  1.00 65.68  ? 10  DA  G "C5'" 1 
ATOM   3444 C "C4'" . DA  G 2 10 ? 78.764 -36.146 -5.817  1.00 58.78  ? 10  DA  G "C4'" 1 
ATOM   3445 O "O4'" . DA  G 2 10 ? 78.836 -37.429 -5.177  1.00 60.05  ? 10  DA  G "O4'" 1 
ATOM   3446 C "C3'" . DA  G 2 10 ? 78.986 -35.097 -4.722  1.00 54.35  ? 10  DA  G "C3'" 1 
ATOM   3447 O "O3'" . DA  G 2 10 ? 78.001 -34.074 -4.911  1.00 54.07  ? 10  DA  G "O3'" 1 
ATOM   3448 C "C2'" . DA  G 2 10 ? 78.984 -35.866 -3.413  1.00 53.29  ? 10  DA  G "C2'" 1 
ATOM   3449 C "C1'" . DA  G 2 10 ? 78.684 -37.319 -3.783  1.00 58.19  ? 10  DA  G "C1'" 1 
ATOM   3450 N N9    . DA  G 2 10 ? 79.585 -38.294 -3.177  1.00 58.73  ? 10  DA  G N9    1 
ATOM   3451 C C8    . DA  G 2 10 ? 80.941 -38.371 -3.368  1.00 66.04  ? 10  DA  G C8    1 
ATOM   3452 N N7    . DA  G 2 10 ? 81.513 -39.344 -2.704  1.00 71.51  ? 10  DA  G N7    1 
ATOM   3453 C C5    . DA  G 2 10 ? 80.461 -39.962 -2.044  1.00 59.82  ? 10  DA  G C5    1 
ATOM   3454 C C6    . DA  G 2 10 ? 80.408 -41.061 -1.163  1.00 60.13  ? 10  DA  G C6    1 
ATOM   3455 N N6    . DA  G 2 10 ? 81.475 -41.775 -0.805  1.00 61.48  ? 10  DA  G N6    1 
ATOM   3456 N N1    . DA  G 2 10 ? 79.204 -41.410 -0.664  1.00 65.19  ? 10  DA  G N1    1 
ATOM   3457 C C2    . DA  G 2 10 ? 78.126 -40.706 -1.044  1.00 69.76  ? 10  DA  G C2    1 
ATOM   3458 N N3    . DA  G 2 10 ? 78.046 -39.665 -1.874  1.00 65.87  ? 10  DA  G N3    1 
ATOM   3459 C C4    . DA  G 2 10 ? 79.264 -39.339 -2.344  1.00 58.25  ? 10  DA  G C4    1 
ATOM   3460 P P     . DT  G 2 11 ? 76.754 -33.875 -3.928  1.00 69.02  ? 11  DT  G P     1 
ATOM   3461 O OP1   . DT  G 2 11 ? 75.582 -33.470 -4.752  1.00 49.77  ? 11  DT  G OP1   1 
ATOM   3462 O OP2   . DT  G 2 11 ? 77.219 -33.030 -2.801  1.00 84.94  ? 11  DT  G OP2   1 
ATOM   3463 O "O5'" . DT  G 2 11 ? 76.456 -35.311 -3.286  1.00 76.60  ? 11  DT  G "O5'" 1 
ATOM   3464 C "C5'" . DT  G 2 11 ? 75.087 -35.744 -3.024  1.00 67.41  ? 11  DT  G "C5'" 1 
ATOM   3465 C "C4'" . DT  G 2 11 ? 74.881 -36.174 -1.588  1.00 62.69  ? 11  DT  G "C4'" 1 
ATOM   3466 O "O4'" . DT  G 2 11 ? 75.933 -37.097 -1.205  1.00 61.29  ? 11  DT  G "O4'" 1 
ATOM   3467 C "C3'" . DT  G 2 11 ? 74.911 -35.040 -0.548  1.00 64.58  ? 11  DT  G "C3'" 1 
ATOM   3468 O "O3'" . DT  G 2 11 ? 73.991 -35.158 0.555   1.00 56.24  ? 11  DT  G "O3'" 1 
ATOM   3469 C "C2'" . DT  G 2 11 ? 76.251 -35.244 0.134   1.00 69.11  ? 11  DT  G "C2'" 1 
ATOM   3470 C "C1'" . DT  G 2 11 ? 76.312 -36.751 0.111   1.00 61.69  ? 11  DT  G "C1'" 1 
ATOM   3471 N N1    . DT  G 2 11 ? 77.634 -37.309 0.383   1.00 60.70  ? 11  DT  G N1    1 
ATOM   3472 C C2    . DT  G 2 11 ? 77.734 -38.297 1.338   1.00 59.93  ? 11  DT  G C2    1 
ATOM   3473 O O2    . DT  G 2 11 ? 76.774 -38.750 1.930   1.00 66.29  ? 11  DT  G O2    1 
ATOM   3474 N N3    . DT  G 2 11 ? 79.007 -38.756 1.556   1.00 61.36  ? 11  DT  G N3    1 
ATOM   3475 C C4    . DT  G 2 11 ? 80.167 -38.311 0.958   1.00 58.10  ? 11  DT  G C4    1 
ATOM   3476 O O4    . DT  G 2 11 ? 81.242 -38.803 1.283   1.00 59.94  ? 11  DT  G O4    1 
ATOM   3477 C C5    . DT  G 2 11 ? 79.992 -37.250 -0.023  1.00 54.91  ? 11  DT  G C5    1 
ATOM   3478 C C7    . DT  G 2 11 ? 81.189 -36.702 -0.732  1.00 44.56  ? 11  DT  G C7    1 
ATOM   3479 C C6    . DT  G 2 11 ? 78.751 -36.799 -0.242  1.00 59.37  ? 11  DT  G C6    1 
ATOM   3480 P P     . DA  G 2 12 ? 72.455 -34.744 0.388   1.00 56.22  ? 12  DA  G P     1 
ATOM   3481 O OP1   . DA  G 2 12 ? 72.029 -35.147 -0.962  1.00 50.46  ? 12  DA  G OP1   1 
ATOM   3482 O OP2   . DA  G 2 12 ? 72.257 -33.342 0.871   1.00 60.82  ? 12  DA  G OP2   1 
ATOM   3483 O "O5'" . DA  G 2 12 ? 71.691 -35.658 1.439   1.00 55.04  ? 12  DA  G "O5'" 1 
ATOM   3484 C "C5'" . DA  G 2 12 ? 71.059 -36.879 1.011   1.00 53.35  ? 12  DA  G "C5'" 1 
ATOM   3485 C "C4'" . DA  G 2 12 ? 71.489 -38.045 1.874   1.00 53.70  ? 12  DA  G "C4'" 1 
ATOM   3486 O "O4'" . DA  G 2 12 ? 72.933 -38.074 2.082   1.00 49.01  ? 12  DA  G "O4'" 1 
ATOM   3487 C "C3'" . DA  G 2 12 ? 70.870 -38.053 3.272   1.00 52.90  ? 12  DA  G "C3'" 1 
ATOM   3488 O "O3'" . DA  G 2 12 ? 70.741 -39.411 3.652   1.00 50.83  ? 12  DA  G "O3'" 1 
ATOM   3489 C "C2'" . DA  G 2 12 ? 71.984 -37.491 4.133   1.00 59.66  ? 12  DA  G "C2'" 1 
ATOM   3490 C "C1'" . DA  G 2 12 ? 73.174 -38.163 3.481   1.00 53.41  ? 12  DA  G "C1'" 1 
ATOM   3491 N N9    . DA  G 2 12 ? 74.496 -37.610 3.762   1.00 60.73  ? 12  DA  G N9    1 
ATOM   3492 C C8    . DA  G 2 12 ? 75.107 -36.480 3.270   1.00 69.34  ? 12  DA  G C8    1 
ATOM   3493 N N7    . DA  G 2 12 ? 76.341 -36.321 3.688   1.00 65.55  ? 12  DA  G N7    1 
ATOM   3494 C C5    . DA  G 2 12 ? 76.560 -37.425 4.502   1.00 64.98  ? 12  DA  G C5    1 
ATOM   3495 C C6    . DA  G 2 12 ? 77.667 -37.838 5.257   1.00 75.84  ? 12  DA  G C6    1 
ATOM   3496 N N6    . DA  G 2 12 ? 78.817 -37.163 5.318   1.00 85.02  ? 12  DA  G N6    1 
ATOM   3497 N N1    . DA  G 2 12 ? 77.548 -38.974 5.977   1.00 82.73  ? 12  DA  G N1    1 
ATOM   3498 C C2    . DA  G 2 12 ? 76.399 -39.657 5.910   1.00 76.29  ? 12  DA  G C2    1 
ATOM   3499 N N3    . DA  G 2 12 ? 75.297 -39.385 5.221   1.00 63.29  ? 12  DA  G N3    1 
ATOM   3500 C C4    . DA  G 2 12 ? 75.437 -38.233 4.544   1.00 63.10  ? 12  DA  G C4    1 
ATOM   3501 P P     . DG  G 2 13 ? 69.699 -39.806 4.743   1.00 59.81  ? 13  DG  G P     1 
ATOM   3502 O OP1   . DG  G 2 13 ? 69.529 -41.298 4.674   1.00 65.47  ? 13  DG  G OP1   1 
ATOM   3503 O OP2   . DG  G 2 13 ? 68.517 -38.904 4.585   1.00 57.29  ? 13  DG  G OP2   1 
ATOM   3504 O "O5'" . DG  G 2 13 ? 70.449 -39.510 6.114   1.00 50.47  ? 13  DG  G "O5'" 1 
ATOM   3505 C "C5'" . DG  G 2 13 ? 70.479 -40.510 7.141   1.00 47.93  ? 13  DG  G "C5'" 1 
ATOM   3506 C "C4'" . DG  G 2 13 ? 71.634 -40.297 8.092   1.00 52.60  ? 13  DG  G "C4'" 1 
ATOM   3507 O "O4'" . DG  G 2 13 ? 72.692 -39.502 7.506   1.00 52.24  ? 13  DG  G "O4'" 1 
ATOM   3508 C "C3'" . DG  G 2 13 ? 71.254 -39.600 9.400   1.00 55.16  ? 13  DG  G "C3'" 1 
ATOM   3509 O "O3'" . DG  G 2 13 ? 71.164 -40.589 10.435  1.00 57.65  ? 13  DG  G "O3'" 1 
ATOM   3510 C "C2'" . DG  G 2 13 ? 72.345 -38.553 9.587   1.00 59.52  ? 13  DG  G "C2'" 1 
ATOM   3511 C "C1'" . DG  G 2 13 ? 73.409 -38.960 8.583   1.00 59.85  ? 13  DG  G "C1'" 1 
ATOM   3512 N N9    . DG  G 2 13 ? 74.252 -37.865 8.093   1.00 72.29  ? 13  DG  G N9    1 
ATOM   3513 C C8    . DG  G 2 13 ? 73.864 -36.771 7.357   1.00 66.94  ? 13  DG  G C8    1 
ATOM   3514 N N7    . DG  G 2 13 ? 74.845 -35.941 7.116   1.00 67.25  ? 13  DG  G N7    1 
ATOM   3515 C C5    . DG  G 2 13 ? 75.943 -36.510 7.747   1.00 68.08  ? 13  DG  G C5    1 
ATOM   3516 C C6    . DG  G 2 13 ? 77.290 -36.063 7.836   1.00 76.72  ? 13  DG  G C6    1 
ATOM   3517 O O6    . DG  G 2 13 ? 77.797 -35.039 7.362   1.00 81.05  ? 13  DG  G O6    1 
ATOM   3518 N N1    . DG  G 2 13 ? 78.080 -36.955 8.557   1.00 77.93  ? 13  DG  G N1    1 
ATOM   3519 C C2    . DG  G 2 13 ? 77.629 -38.118 9.135   1.00 75.58  ? 13  DG  G C2    1 
ATOM   3520 N N2    . DG  G 2 13 ? 78.537 -38.830 9.815   1.00 73.17  ? 13  DG  G N2    1 
ATOM   3521 N N3    . DG  G 2 13 ? 76.377 -38.541 9.066   1.00 71.21  ? 13  DG  G N3    1 
ATOM   3522 C C4    . DG  G 2 13 ? 75.594 -37.694 8.363   1.00 70.99  ? 13  DG  G C4    1 
ATOM   3523 P P     . DT  G 2 14 ? 71.544 -40.241 11.956  1.00 63.78  ? 14  DT  G P     1 
ATOM   3524 O OP1   . DT  G 2 14 ? 71.521 -41.493 12.752  1.00 69.48  ? 14  DT  G OP1   1 
ATOM   3525 O OP2   . DT  G 2 14 ? 70.774 -39.058 12.379  1.00 60.77  ? 14  DT  G OP2   1 
ATOM   3526 O "O5'" . DT  G 2 14 ? 73.092 -39.896 11.904  1.00 59.88  ? 14  DT  G "O5'" 1 
ATOM   3527 C "C5'" . DT  G 2 14 ? 74.027 -40.961 11.782  1.00 64.78  ? 14  DT  G "C5'" 1 
ATOM   3528 C "C4'" . DT  G 2 14 ? 75.061 -40.897 12.879  1.00 66.25  ? 14  DT  G "C4'" 1 
ATOM   3529 O "O4'" . DT  G 2 14 ? 76.069 -39.924 12.538  1.00 73.84  ? 14  DT  G "O4'" 1 
ATOM   3530 C "C3'" . DT  G 2 14 ? 74.585 -40.520 14.276  1.00 62.12  ? 14  DT  G "C3'" 1 
ATOM   3531 O "O3'" . DT  G 2 14 ? 75.551 -41.196 15.076  1.00 64.51  ? 14  DT  G "O3'" 1 
ATOM   3532 C "C2'" . DT  G 2 14 ? 74.822 -39.019 14.314  1.00 65.65  ? 14  DT  G "C2'" 1 
ATOM   3533 C "C1'" . DT  G 2 14 ? 76.099 -38.881 13.505  1.00 72.14  ? 14  DT  G "C1'" 1 
ATOM   3534 N N1    . DT  G 2 14 ? 76.329 -37.612 12.778  1.00 73.14  ? 14  DT  G N1    1 
ATOM   3535 C C2    . DT  G 2 14 ? 77.621 -37.142 12.770  1.00 68.29  ? 14  DT  G C2    1 
ATOM   3536 O O2    . DT  G 2 14 ? 78.524 -37.676 13.391  1.00 71.20  ? 14  DT  G O2    1 
ATOM   3537 N N3    . DT  G 2 14 ? 77.808 -35.992 12.041  1.00 62.29  ? 14  DT  G N3    1 
ATOM   3538 C C4    . DT  G 2 14 ? 76.855 -35.295 11.321  1.00 60.65  ? 14  DT  G C4    1 
ATOM   3539 O O4    . DT  G 2 14 ? 77.171 -34.278 10.709  1.00 57.68  ? 14  DT  G O4    1 
ATOM   3540 C C5    . DT  G 2 14 ? 75.528 -35.864 11.347  1.00 59.92  ? 14  DT  G C5    1 
ATOM   3541 C C7    . DT  G 2 14 ? 74.433 -35.179 10.592  1.00 58.81  ? 14  DT  G C7    1 
ATOM   3542 C C6    . DT  G 2 14 ? 75.336 -36.987 12.054  1.00 64.18  ? 14  DT  G C6    1 
ATOM   3543 P P     . DC  G 2 15 ? 75.366 -41.401 16.640  1.00 73.65  ? 15  DC  G P     1 
ATOM   3544 O OP1   . DC  G 2 15 ? 75.766 -42.801 16.955  1.00 74.35  ? 15  DC  G OP1   1 
ATOM   3545 O OP2   . DC  G 2 15 ? 74.028 -40.908 17.044  1.00 66.34  ? 15  DC  G OP2   1 
ATOM   3546 O "O5'" . DC  G 2 15 ? 76.432 -40.387 17.252  1.00 83.05  ? 15  DC  G "O5'" 1 
ATOM   3547 C "C5'" . DC  G 2 15 ? 77.842 -40.513 16.987  1.00 76.75  ? 15  DC  G "C5'" 1 
ATOM   3548 C "C4'" . DC  G 2 15 ? 78.572 -39.257 17.412  1.00 88.43  ? 15  DC  G "C4'" 1 
ATOM   3549 O "O4'" . DC  G 2 15 ? 78.472 -38.236 16.392  1.00 90.12  ? 15  DC  G "O4'" 1 
ATOM   3550 C "C3'" . DC  G 2 15 ? 78.105 -38.600 18.719  1.00 83.03  ? 15  DC  G "C3'" 1 
ATOM   3551 O "O3'" . DC  G 2 15 ? 79.146 -38.808 19.682  1.00 93.43  ? 15  DC  G "O3'" 1 
ATOM   3552 C "C2'" . DC  G 2 15 ? 77.945 -37.124 18.368  1.00 74.08  ? 15  DC  G "C2'" 1 
ATOM   3553 C "C1'" . DC  G 2 15 ? 78.654 -36.985 17.028  1.00 74.74  ? 15  DC  G "C1'" 1 
ATOM   3554 N N1    . DC  G 2 15 ? 78.084 -35.958 16.150  1.00 60.88  ? 15  DC  G N1    1 
ATOM   3555 C C2    . DC  G 2 15 ? 78.934 -35.112 15.422  1.00 57.74  ? 15  DC  G C2    1 
ATOM   3556 O O2    . DC  G 2 15 ? 80.164 -35.232 15.556  1.00 55.52  ? 15  DC  G O2    1 
ATOM   3557 N N3    . DC  G 2 15 ? 78.392 -34.178 14.607  1.00 54.68  ? 15  DC  G N3    1 
ATOM   3558 C C4    . DC  G 2 15 ? 77.061 -34.083 14.490  1.00 58.12  ? 15  DC  G C4    1 
ATOM   3559 N N4    . DC  G 2 15 ? 76.564 -33.156 13.667  1.00 52.94  ? 15  DC  G N4    1 
ATOM   3560 C C5    . DC  G 2 15 ? 76.180 -34.938 15.209  1.00 62.24  ? 15  DC  G C5    1 
ATOM   3561 C C6    . DC  G 2 15 ? 76.729 -35.855 16.016  1.00 63.06  ? 15  DC  G C6    1 
ATOM   3562 P P     . DG  G 2 16 ? 79.040 -38.248 21.196  1.00 91.96  ? 16  DG  G P     1 
ATOM   3563 O OP1   . DG  G 2 16 ? 79.996 -39.034 22.015  1.00 85.66  ? 16  DG  G OP1   1 
ATOM   3564 O OP2   . DG  G 2 16 ? 77.601 -38.134 21.599  1.00 64.28  ? 16  DG  G OP2   1 
ATOM   3565 O "O5'" . DG  G 2 16 ? 79.698 -36.806 21.082  1.00 94.57  ? 16  DG  G "O5'" 1 
ATOM   3566 C "C5'" . DG  G 2 16 ? 81.070 -36.653 20.665  1.00 90.30  ? 16  DG  G "C5'" 1 
ATOM   3567 C "C4'" . DG  G 2 16 ? 81.482 -35.211 20.838  1.00 93.28  ? 16  DG  G "C4'" 1 
ATOM   3568 O "O4'" . DG  G 2 16 ? 80.975 -34.416 19.740  1.00 85.80  ? 16  DG  G "O4'" 1 
ATOM   3569 C "C3'" . DG  G 2 16 ? 80.965 -34.549 22.120  1.00 105.31 ? 16  DG  G "C3'" 1 
ATOM   3570 O "O3'" . DG  G 2 16 ? 82.070 -33.840 22.701  1.00 119.05 ? 16  DG  G "O3'" 1 
ATOM   3571 C "C2'" . DG  G 2 16 ? 79.815 -33.673 21.642  1.00 86.93  ? 16  DG  G "C2'" 1 
ATOM   3572 C "C1'" . DG  G 2 16 ? 80.252 -33.297 20.237  1.00 89.58  ? 16  DG  G "C1'" 1 
ATOM   3573 N N9    . DG  G 2 16 ? 79.165 -33.019 19.301  1.00 90.16  ? 16  DG  G N9    1 
ATOM   3574 C C8    . DG  G 2 16 ? 77.935 -33.629 19.254  1.00 84.70  ? 16  DG  G C8    1 
ATOM   3575 N N7    . DG  G 2 16 ? 77.174 -33.174 18.297  1.00 71.31  ? 16  DG  G N7    1 
ATOM   3576 C C5    . DG  G 2 16 ? 77.951 -32.214 17.666  1.00 75.97  ? 16  DG  G C5    1 
ATOM   3577 C C6    . DG  G 2 16 ? 77.666 -31.389 16.547  1.00 80.14  ? 16  DG  G C6    1 
ATOM   3578 O O6    . DG  G 2 16 ? 76.627 -31.328 15.878  1.00 84.05  ? 16  DG  G O6    1 
ATOM   3579 N N1    . DG  G 2 16 ? 78.740 -30.567 16.231  1.00 76.12  ? 16  DG  G N1    1 
ATOM   3580 C C2    . DG  G 2 16 ? 79.927 -30.521 16.917  1.00 82.90  ? 16  DG  G C2    1 
ATOM   3581 N N2    . DG  G 2 16 ? 80.833 -29.641 16.468  1.00 87.90  ? 16  DG  G N2    1 
ATOM   3582 N N3    . DG  G 2 16 ? 80.205 -31.281 17.964  1.00 81.14  ? 16  DG  G N3    1 
ATOM   3583 C C4    . DG  G 2 16 ? 79.184 -32.106 18.273  1.00 81.01  ? 16  DG  G C4    1 
ATOM   3584 P P     . DA  G 2 17 ? 81.904 -32.976 24.042  1.00 115.65 ? 17  DA  G P     1 
ATOM   3585 O OP1   . DA  G 2 17 ? 83.106 -33.226 24.879  1.00 99.78  ? 17  DA  G OP1   1 
ATOM   3586 O OP2   . DA  G 2 17 ? 80.548 -33.224 24.610  1.00 109.15 ? 17  DA  G OP2   1 
ATOM   3587 O "O5'" . DA  G 2 17 ? 81.940 -31.480 23.492  1.00 109.29 ? 17  DA  G "O5'" 1 
ATOM   3588 C "C5'" . DA  G 2 17 ? 82.997 -31.020 22.614  1.00 101.19 ? 17  DA  G "C5'" 1 
ATOM   3589 C "C4'" . DA  G 2 17 ? 82.850 -29.535 22.368  1.00 94.48  ? 17  DA  G "C4'" 1 
ATOM   3590 O "O4'" . DA  G 2 17 ? 81.891 -29.328 21.300  1.00 95.13  ? 17  DA  G "O4'" 1 
ATOM   3591 C "C3'" . DA  G 2 17 ? 82.298 -28.759 23.565  1.00 93.57  ? 17  DA  G "C3'" 1 
ATOM   3592 O "O3'" . DA  G 2 17 ? 82.768 -27.401 23.605  1.00 99.10  ? 17  DA  G "O3'" 1 
ATOM   3593 C "C2'" . DA  G 2 17 ? 80.806 -28.788 23.307  1.00 82.09  ? 17  DA  G "C2'" 1 
ATOM   3594 C "C1'" . DA  G 2 17 ? 80.784 -28.589 21.804  1.00 84.37  ? 17  DA  G "C1'" 1 
ATOM   3595 N N9    . DA  G 2 17 ? 79.562 -29.063 21.146  1.00 78.82  ? 17  DA  G N9    1 
ATOM   3596 C C8    . DA  G 2 17 ? 78.732 -30.091 21.525  1.00 73.77  ? 17  DA  G C8    1 
ATOM   3597 N N7    . DA  G 2 17 ? 77.683 -30.233 20.753  1.00 63.25  ? 17  DA  G N7    1 
ATOM   3598 C C5    . DA  G 2 17 ? 77.820 -29.220 19.816  1.00 63.60  ? 17  DA  G C5    1 
ATOM   3599 C C6    . DA  G 2 17 ? 77.024 -28.827 18.726  1.00 72.62  ? 17  DA  G C6    1 
ATOM   3600 N N6    . DA  G 2 17 ? 75.893 -29.443 18.375  1.00 80.68  ? 17  DA  G N6    1 
ATOM   3601 N N1    . DA  G 2 17 ? 77.441 -27.772 17.990  1.00 75.88  ? 17  DA  G N1    1 
ATOM   3602 C C2    . DA  G 2 17 ? 78.582 -27.162 18.337  1.00 77.28  ? 17  DA  G C2    1 
ATOM   3603 N N3    . DA  G 2 17 ? 79.411 -27.433 19.344  1.00 71.32  ? 17  DA  G N3    1 
ATOM   3604 C C4    . DA  G 2 17 ? 78.965 -28.484 20.054  1.00 65.15  ? 17  DA  G C4    1 
ATOM   3605 P P     . DC  G 2 18 ? 82.398 -26.436 24.866  1.00 101.52 ? 18  DC  G P     1 
ATOM   3606 O OP1   . DC  G 2 18 ? 83.409 -26.661 25.935  1.00 83.66  ? 18  DC  G OP1   1 
ATOM   3607 O OP2   . DC  G 2 18 ? 80.954 -26.618 25.214  1.00 82.45  ? 18  DC  G OP2   1 
ATOM   3608 O "O5'" . DC  G 2 18 ? 82.569 -24.971 24.252  1.00 89.71  ? 18  DC  G "O5'" 1 
ATOM   3609 C "C5'" . DC  G 2 18 ? 82.829 -24.751 22.853  1.00 83.86  ? 18  DC  G "C5'" 1 
ATOM   3610 C "C4'" . DC  G 2 18 ? 81.745 -23.898 22.228  1.00 89.56  ? 18  DC  G "C4'" 1 
ATOM   3611 O "O4'" . DC  G 2 18 ? 80.678 -24.731 21.708  1.00 90.05  ? 18  DC  G "O4'" 1 
ATOM   3612 C "C3'" . DC  G 2 18 ? 81.071 -22.846 23.125  1.00 85.22  ? 18  DC  G "C3'" 1 
ATOM   3613 O "O3'" . DC  G 2 18 ? 81.143 -21.548 22.503  1.00 84.97  ? 18  DC  G "O3'" 1 
ATOM   3614 C "C2'" . DC  G 2 18 ? 79.613 -23.275 23.158  1.00 82.89  ? 18  DC  G "C2'" 1 
ATOM   3615 C "C1'" . DC  G 2 18 ? 79.471 -24.002 21.833  1.00 81.28  ? 18  DC  G "C1'" 1 
ATOM   3616 N N1    . DC  G 2 18 ? 78.337 -24.947 21.761  1.00 71.98  ? 18  DC  G N1    1 
ATOM   3617 C C2    . DC  G 2 18 ? 77.405 -24.813 20.725  1.00 77.30  ? 18  DC  G C2    1 
ATOM   3618 O O2    . DC  G 2 18 ? 77.584 -23.941 19.863  1.00 76.38  ? 18  DC  G O2    1 
ATOM   3619 N N3    . DC  G 2 18 ? 76.339 -25.646 20.683  1.00 84.99  ? 18  DC  G N3    1 
ATOM   3620 C C4    . DC  G 2 18 ? 76.186 -26.579 21.626  1.00 84.52  ? 18  DC  G C4    1 
ATOM   3621 N N4    . DC  G 2 18 ? 75.125 -27.384 21.543  1.00 84.21  ? 18  DC  G N4    1 
ATOM   3622 C C5    . DC  G 2 18 ? 77.113 -26.727 22.699  1.00 77.29  ? 18  DC  G C5    1 
ATOM   3623 C C6    . DC  G 2 18 ? 78.159 -25.893 22.731  1.00 71.51  ? 18  DC  G C6    1 
ATOM   3624 P P     . DA  G 2 19 ? 80.730 -20.213 23.310  1.00 76.71  ? 19  DA  G P     1 
ATOM   3625 O OP1   . DA  G 2 19 ? 81.925 -19.355 23.421  1.00 81.10  ? 19  DA  G OP1   1 
ATOM   3626 O OP2   . DA  G 2 19 ? 79.999 -20.596 24.532  1.00 85.50  ? 19  DA  G OP2   1 
ATOM   3627 O "O5'" . DA  G 2 19 ? 79.703 -19.502 22.331  1.00 82.24  ? 19  DA  G "O5'" 1 
ATOM   3628 C "C5'" . DA  G 2 19 ? 79.990 -19.380 20.921  1.00 92.81  ? 19  DA  G "C5'" 1 
ATOM   3629 C "C4'" . DA  G 2 19 ? 78.834 -18.700 20.226  1.00 86.01  ? 19  DA  G "C4'" 1 
ATOM   3630 O "O4'" . DA  G 2 19 ? 77.742 -19.642 20.085  1.00 84.62  ? 19  DA  G "O4'" 1 
ATOM   3631 C "C3'" . DA  G 2 19 ? 78.272 -17.511 21.004  1.00 80.22  ? 19  DA  G "C3'" 1 
ATOM   3632 O "O3'" . DA  G 2 19 ? 77.853 -16.492 20.095  1.00 87.26  ? 19  DA  G "O3'" 1 
ATOM   3633 C "C2'" . DA  G 2 19 ? 77.104 -18.105 21.774  1.00 83.29  ? 19  DA  G "C2'" 1 
ATOM   3634 C "C1'" . DA  G 2 19 ? 76.622 -19.232 20.869  1.00 87.96  ? 19  DA  G "C1'" 1 
ATOM   3635 N N9    . DA  G 2 19 ? 76.097 -20.411 21.572  1.00 91.96  ? 19  DA  G N9    1 
ATOM   3636 C C8    . DA  G 2 19 ? 76.466 -20.896 22.805  1.00 84.87  ? 19  DA  G C8    1 
ATOM   3637 N N7    . DA  G 2 19 ? 75.798 -21.962 23.177  1.00 79.32  ? 19  DA  G N7    1 
ATOM   3638 C C5    . DA  G 2 19 ? 74.926 -22.194 22.122  1.00 78.29  ? 19  DA  G C5    1 
ATOM   3639 C C6    . DA  G 2 19 ? 73.965 -23.190 21.894  1.00 74.43  ? 19  DA  G C6    1 
ATOM   3640 N N6    . DA  G 2 19 ? 73.691 -24.164 22.763  1.00 70.28  ? 19  DA  G N6    1 
ATOM   3641 N N1    . DA  G 2 19 ? 73.268 -23.139 20.737  1.00 87.86  ? 19  DA  G N1    1 
ATOM   3642 C C2    . DA  G 2 19 ? 73.535 -22.153 19.869  1.00 82.61  ? 19  DA  G C2    1 
ATOM   3643 N N3    . DA  G 2 19 ? 74.431 -21.174 19.958  1.00 82.58  ? 19  DA  G N3    1 
ATOM   3644 C C4    . DA  G 2 19 ? 75.099 -21.247 21.125  1.00 89.12  ? 19  DA  G C4    1 
ATOM   3645 O "O5'" . DT  H 3 1  ? 64.207 -27.711 24.561  1.00 78.00  ? 1   DT  H "O5'" 1 
ATOM   3646 C "C5'" . DT  H 3 1  ? 64.124 -26.289 24.788  1.00 74.13  ? 1   DT  H "C5'" 1 
ATOM   3647 C "C4'" . DT  H 3 1  ? 63.840 -25.530 23.509  1.00 75.40  ? 1   DT  H "C4'" 1 
ATOM   3648 O "O4'" . DT  H 3 1  ? 64.792 -24.451 23.421  1.00 71.24  ? 1   DT  H "O4'" 1 
ATOM   3649 C "C3'" . DT  H 3 1  ? 64.017 -26.300 22.201  1.00 72.47  ? 1   DT  H "C3'" 1 
ATOM   3650 O "O3'" . DT  H 3 1  ? 63.280 -25.653 21.143  1.00 69.96  ? 1   DT  H "O3'" 1 
ATOM   3651 C "C2'" . DT  H 3 1  ? 65.514 -26.200 21.985  1.00 68.09  ? 1   DT  H "C2'" 1 
ATOM   3652 C "C1'" . DT  H 3 1  ? 65.825 -24.796 22.501  1.00 64.17  ? 1   DT  H "C1'" 1 
ATOM   3653 N N1    . DT  H 3 1  ? 67.117 -24.625 23.189  1.00 54.91  ? 1   DT  H N1    1 
ATOM   3654 C C2    . DT  H 3 1  ? 67.991 -23.689 22.689  1.00 54.15  ? 1   DT  H C2    1 
ATOM   3655 O O2    . DT  H 3 1  ? 67.770 -23.037 21.681  1.00 49.18  ? 1   DT  H O2    1 
ATOM   3656 N N3    . DT  H 3 1  ? 69.149 -23.547 23.410  1.00 60.50  ? 1   DT  H N3    1 
ATOM   3657 C C4    . DT  H 3 1  ? 69.509 -24.223 24.556  1.00 64.18  ? 1   DT  H C4    1 
ATOM   3658 O O4    . DT  H 3 1  ? 70.594 -23.995 25.082  1.00 66.85  ? 1   DT  H O4    1 
ATOM   3659 C C5    . DT  H 3 1  ? 68.533 -25.177 25.039  1.00 67.42  ? 1   DT  H C5    1 
ATOM   3660 C C7    . DT  H 3 1  ? 68.830 -25.956 26.284  1.00 69.82  ? 1   DT  H C7    1 
ATOM   3661 C C6    . DT  H 3 1  ? 67.399 -25.322 24.342  1.00 58.90  ? 1   DT  H C6    1 
ATOM   3662 P P     . DT  H 3 2  ? 63.115 -26.351 19.697  1.00 72.06  ? 2   DT  H P     1 
ATOM   3663 O OP1   . DT  H 3 2  ? 61.863 -25.830 19.081  1.00 66.57  ? 2   DT  H OP1   1 
ATOM   3664 O OP2   . DT  H 3 2  ? 63.292 -27.814 19.886  1.00 72.27  ? 2   DT  H OP2   1 
ATOM   3665 O "O5'" . DT  H 3 2  ? 64.359 -25.784 18.858  1.00 73.19  ? 2   DT  H "O5'" 1 
ATOM   3666 C "C5'" . DT  H 3 2  ? 64.319 -24.454 18.256  1.00 78.80  ? 2   DT  H "C5'" 1 
ATOM   3667 C "C4'" . DT  H 3 2  ? 65.671 -23.956 17.780  1.00 73.05  ? 2   DT  H "C4'" 1 
ATOM   3668 O "O4'" . DT  H 3 2  ? 66.665 -23.977 18.835  1.00 77.19  ? 2   DT  H "O4'" 1 
ATOM   3669 C "C3'" . DT  H 3 2  ? 66.301 -24.690 16.589  1.00 68.48  ? 2   DT  H "C3'" 1 
ATOM   3670 O "O3'" . DT  H 3 2  ? 66.678 -23.769 15.557  1.00 66.26  ? 2   DT  H "O3'" 1 
ATOM   3671 C "C2'" . DT  H 3 2  ? 67.587 -25.262 17.159  1.00 73.22  ? 2   DT  H "C2'" 1 
ATOM   3672 C "C1'" . DT  H 3 2  ? 67.915 -24.247 18.231  1.00 68.61  ? 2   DT  H "C1'" 1 
ATOM   3673 N N1    . DT  H 3 2  ? 68.866 -24.678 19.281  1.00 67.45  ? 2   DT  H N1    1 
ATOM   3674 C C2    . DT  H 3 2  ? 70.048 -23.975 19.429  1.00 78.99  ? 2   DT  H C2    1 
ATOM   3675 O O2    . DT  H 3 2  ? 70.347 -23.009 18.744  1.00 82.98  ? 2   DT  H O2    1 
ATOM   3676 N N3    . DT  H 3 2  ? 70.873 -24.446 20.419  1.00 86.63  ? 2   DT  H N3    1 
ATOM   3677 C C4    . DT  H 3 2  ? 70.642 -25.516 21.262  1.00 89.26  ? 2   DT  H C4    1 
ATOM   3678 O O4    . DT  H 3 2  ? 71.473 -25.809 22.119  1.00 89.73  ? 2   DT  H O4    1 
ATOM   3679 C C5    . DT  H 3 2  ? 69.387 -26.207 21.052  1.00 83.15  ? 2   DT  H C5    1 
ATOM   3680 C C7    . DT  H 3 2  ? 69.046 -27.373 21.924  1.00 83.43  ? 2   DT  H C7    1 
ATOM   3681 C C6    . DT  H 3 2  ? 68.580 -25.767 20.076  1.00 71.23  ? 2   DT  H C6    1 
ATOM   3682 P P     . DG  H 3 3  ? 66.790 -24.260 14.015  1.00 69.36  ? 3   DG  H P     1 
ATOM   3683 O OP1   . DG  H 3 3  ? 65.640 -23.700 13.259  1.00 61.88  ? 3   DG  H OP1   1 
ATOM   3684 O OP2   . DG  H 3 3  ? 67.091 -25.724 14.009  1.00 59.73  ? 3   DG  H OP2   1 
ATOM   3685 O "O5'" . DG  H 3 3  ? 68.020 -23.440 13.435  1.00 63.33  ? 3   DG  H "O5'" 1 
ATOM   3686 C "C5'" . DG  H 3 3  ? 68.550 -22.328 14.165  1.00 66.94  ? 3   DG  H "C5'" 1 
ATOM   3687 C "C4'" . DG  H 3 3  ? 70.050 -22.233 14.002  1.00 62.54  ? 3   DG  H "C4'" 1 
ATOM   3688 O "O4'" . DG  H 3 3  ? 70.724 -22.772 15.163  1.00 53.10  ? 3   DG  H "O4'" 1 
ATOM   3689 C "C3'" . DG  H 3 3  ? 70.649 -22.931 12.780  1.00 59.20  ? 3   DG  H "C3'" 1 
ATOM   3690 O "O3'" . DG  H 3 3  ? 71.342 -21.917 12.033  1.00 62.31  ? 3   DG  H "O3'" 1 
ATOM   3691 C "C2'" . DG  H 3 3  ? 71.504 -24.043 13.378  1.00 60.89  ? 3   DG  H "C2'" 1 
ATOM   3692 C "C1'" . DG  H 3 3  ? 71.842 -23.522 14.763  1.00 56.82  ? 3   DG  H "C1'" 1 
ATOM   3693 N N9    . DG  H 3 3  ? 72.057 -24.533 15.788  1.00 60.10  ? 3   DG  H N9    1 
ATOM   3694 C C8    . DG  H 3 3  ? 71.214 -25.571 16.105  1.00 60.96  ? 3   DG  H C8    1 
ATOM   3695 N N7    . DG  H 3 3  ? 71.626 -26.271 17.127  1.00 60.21  ? 3   DG  H N7    1 
ATOM   3696 C C5    . DG  H 3 3  ? 72.796 -25.640 17.526  1.00 60.83  ? 3   DG  H C5    1 
ATOM   3697 C C6    . DG  H 3 3  ? 73.698 -25.961 18.570  1.00 68.82  ? 3   DG  H C6    1 
ATOM   3698 O O6    . DG  H 3 3  ? 73.641 -26.895 19.376  1.00 83.83  ? 3   DG  H O6    1 
ATOM   3699 N N1    . DG  H 3 3  ? 74.765 -25.068 18.617  1.00 66.78  ? 3   DG  H N1    1 
ATOM   3700 C C2    . DG  H 3 3  ? 74.948 -24.013 17.760  1.00 63.16  ? 3   DG  H C2    1 
ATOM   3701 N N2    . DG  H 3 3  ? 76.039 -23.273 17.969  1.00 70.43  ? 3   DG  H N2    1 
ATOM   3702 N N3    . DG  H 3 3  ? 74.123 -23.713 16.767  1.00 56.87  ? 3   DG  H N3    1 
ATOM   3703 C C4    . DG  H 3 3  ? 73.071 -24.559 16.715  1.00 59.43  ? 3   DG  H C4    1 
ATOM   3704 P P     . DT  H 3 4  ? 72.026 -22.237 10.589  1.00 71.63  ? 4   DT  H P     1 
ATOM   3705 O OP1   . DT  H 3 4  ? 71.929 -21.021 9.743   1.00 74.31  ? 4   DT  H OP1   1 
ATOM   3706 O OP2   . DT  H 3 4  ? 71.476 -23.528 10.058  1.00 63.09  ? 4   DT  H OP2   1 
ATOM   3707 O "O5'" . DT  H 3 4  ? 73.573 -22.382 10.958  1.00 58.02  ? 4   DT  H "O5'" 1 
ATOM   3708 C "C5'" . DT  H 3 4  ? 74.176 -21.657 12.038  1.00 55.38  ? 4   DT  H "C5'" 1 
ATOM   3709 C "C4'" . DT  H 3 4  ? 75.521 -22.257 12.367  1.00 54.20  ? 4   DT  H "C4'" 1 
ATOM   3710 O "O4'" . DT  H 3 4  ? 75.411 -23.161 13.499  1.00 62.83  ? 4   DT  H "O4'" 1 
ATOM   3711 C "C3'" . DT  H 3 4  ? 76.125 -23.083 11.233  1.00 60.13  ? 4   DT  H "C3'" 1 
ATOM   3712 O "O3'" . DT  H 3 4  ? 77.537 -22.831 11.197  1.00 74.18  ? 4   DT  H "O3'" 1 
ATOM   3713 C "C2'" . DT  H 3 4  ? 75.884 -24.513 11.686  1.00 62.80  ? 4   DT  H "C2'" 1 
ATOM   3714 C "C1'" . DT  H 3 4  ? 76.117 -24.351 13.168  1.00 62.57  ? 4   DT  H "C1'" 1 
ATOM   3715 N N1    . DT  H 3 4  ? 75.662 -25.440 14.065  1.00 55.80  ? 4   DT  H N1    1 
ATOM   3716 C C2    . DT  H 3 4  ? 76.376 -25.644 15.227  1.00 60.69  ? 4   DT  H C2    1 
ATOM   3717 O O2    . DT  H 3 4  ? 77.338 -24.966 15.544  1.00 67.79  ? 4   DT  H O2    1 
ATOM   3718 N N3    . DT  H 3 4  ? 75.911 -26.668 16.015  1.00 62.53  ? 4   DT  H N3    1 
ATOM   3719 C C4    . DT  H 3 4  ? 74.828 -27.490 15.763  1.00 58.02  ? 4   DT  H C4    1 
ATOM   3720 O O4    . DT  H 3 4  ? 74.513 -28.356 16.578  1.00 56.87  ? 4   DT  H O4    1 
ATOM   3721 C C5    . DT  H 3 4  ? 74.134 -27.229 14.522  1.00 54.14  ? 4   DT  H C5    1 
ATOM   3722 C C7    . DT  H 3 4  ? 72.955 -28.076 14.161  1.00 52.25  ? 4   DT  H C7    1 
ATOM   3723 C C6    . DT  H 3 4  ? 74.580 -26.232 13.745  1.00 53.95  ? 4   DT  H C6    1 
ATOM   3724 P P     . DC  H 3 5  ? 78.335 -22.648 9.789   1.00 86.22  ? 5   DC  H P     1 
ATOM   3725 O OP1   . DC  H 3 5  ? 78.309 -21.199 9.427   1.00 82.03  ? 5   DC  H OP1   1 
ATOM   3726 O OP2   . DC  H 3 5  ? 77.826 -23.655 8.811   1.00 69.13  ? 5   DC  H OP2   1 
ATOM   3727 O "O5'" . DC  H 3 5  ? 79.824 -22.997 10.232  1.00 64.51  ? 5   DC  H "O5'" 1 
ATOM   3728 C "C5'" . DC  H 3 5  ? 80.200 -22.844 11.618  1.00 65.13  ? 5   DC  H "C5'" 1 
ATOM   3729 C "C4'" . DC  H 3 5  ? 81.167 -23.924 12.047  1.00 72.56  ? 5   DC  H "C4'" 1 
ATOM   3730 O "O4'" . DC  H 3 5  ? 80.510 -24.862 12.939  1.00 71.47  ? 5   DC  H "O4'" 1 
ATOM   3731 C "C3'" . DC  H 3 5  ? 81.757 -24.765 10.909  1.00 78.68  ? 5   DC  H "C3'" 1 
ATOM   3732 O "O3'" . DC  H 3 5  ? 83.153 -25.011 11.152  1.00 85.95  ? 5   DC  H "O3'" 1 
ATOM   3733 C "C2'" . DC  H 3 5  ? 80.968 -26.061 10.986  1.00 72.09  ? 5   DC  H "C2'" 1 
ATOM   3734 C "C1'" . DC  H 3 5  ? 80.739 -26.190 12.481  1.00 63.30  ? 5   DC  H "C1'" 1 
ATOM   3735 N N1    . DC  H 3 5  ? 79.576 -27.015 12.852  1.00 57.36  ? 5   DC  H N1    1 
ATOM   3736 C C2    . DC  H 3 5  ? 79.634 -27.784 14.021  1.00 62.39  ? 5   DC  H C2    1 
ATOM   3737 O O2    . DC  H 3 5  ? 80.659 -27.740 14.719  1.00 60.08  ? 5   DC  H O2    1 
ATOM   3738 N N3    . DC  H 3 5  ? 78.564 -28.540 14.371  1.00 64.77  ? 5   DC  H N3    1 
ATOM   3739 C C4    . DC  H 3 5  ? 77.467 -28.537 13.608  1.00 58.40  ? 5   DC  H C4    1 
ATOM   3740 N N4    . DC  H 3 5  ? 76.440 -29.309 13.982  1.00 50.52  ? 5   DC  H N4    1 
ATOM   3741 C C5    . DC  H 3 5  ? 77.378 -27.753 12.420  1.00 56.21  ? 5   DC  H C5    1 
ATOM   3742 C C6    . DC  H 3 5  ? 78.446 -27.015 12.082  1.00 53.88  ? 5   DC  H C6    1 
ATOM   3743 P P     . DG  H 3 6  ? 84.227 -25.027 9.941   1.00 82.00  ? 6   DG  H P     1 
ATOM   3744 O OP1   . DG  H 3 6  ? 84.891 -23.698 9.908   1.00 86.62  ? 6   DG  H OP1   1 
ATOM   3745 O OP2   . DG  H 3 6  ? 83.550 -25.531 8.720   1.00 75.59  ? 6   DG  H OP2   1 
ATOM   3746 O "O5'" . DG  H 3 6  ? 85.275 -26.131 10.410  1.00 67.87  ? 6   DG  H "O5'" 1 
ATOM   3747 C "C5'" . DG  H 3 6  ? 85.356 -26.547 11.786  1.00 65.76  ? 6   DG  H "C5'" 1 
ATOM   3748 C "C4'" . DG  H 3 6  ? 85.435 -28.054 11.874  1.00 71.40  ? 6   DG  H "C4'" 1 
ATOM   3749 O "O4'" . DG  H 3 6  ? 84.154 -28.601 12.276  1.00 73.43  ? 6   DG  H "O4'" 1 
ATOM   3750 C "C3'" . DG  H 3 6  ? 85.794 -28.757 10.562  1.00 79.66  ? 6   DG  H "C3'" 1 
ATOM   3751 O "O3'" . DG  H 3 6  ? 86.551 -29.922 10.874  1.00 80.55  ? 6   DG  H "O3'" 1 
ATOM   3752 C "C2'" . DG  H 3 6  ? 84.462 -29.299 10.073  1.00 76.06  ? 6   DG  H "C2'" 1 
ATOM   3753 C "C1'" . DG  H 3 6  ? 83.814 -29.658 11.389  1.00 71.09  ? 6   DG  H "C1'" 1 
ATOM   3754 N N9    . DG  H 3 6  ? 82.363 -29.768 11.339  1.00 71.15  ? 6   DG  H N9    1 
ATOM   3755 C C8    . DG  H 3 6  ? 81.516 -29.212 10.408  1.00 73.55  ? 6   DG  H C8    1 
ATOM   3756 N N7    . DG  H 3 6  ? 80.263 -29.512 10.613  1.00 69.26  ? 6   DG  H N7    1 
ATOM   3757 C C5    . DG  H 3 6  ? 80.284 -30.331 11.734  1.00 63.82  ? 6   DG  H C5    1 
ATOM   3758 C C6    . DG  H 3 6  ? 79.224 -30.974 12.422  1.00 64.37  ? 6   DG  H C6    1 
ATOM   3759 O O6    . DG  H 3 6  ? 78.010 -30.943 12.172  1.00 71.36  ? 6   DG  H O6    1 
ATOM   3760 N N1    . DG  H 3 6  ? 79.692 -31.718 13.502  1.00 66.25  ? 6   DG  H N1    1 
ATOM   3761 C C2    . DG  H 3 6  ? 81.010 -31.835 13.870  1.00 67.82  ? 6   DG  H C2    1 
ATOM   3762 N N2    . DG  H 3 6  ? 81.261 -32.616 14.927  1.00 70.35  ? 6   DG  H N2    1 
ATOM   3763 N N3    . DG  H 3 6  ? 82.008 -31.237 13.241  1.00 66.77  ? 6   DG  H N3    1 
ATOM   3764 C C4    . DG  H 3 6  ? 81.575 -30.507 12.188  1.00 70.45  ? 6   DG  H C4    1 
ATOM   3765 P P     . DA  H 3 7  ? 87.642 -30.467 9.864   1.00 84.23  ? 7   DA  H P     1 
ATOM   3766 O OP1   . DA  H 3 7  ? 88.427 -29.287 9.403   1.00 84.14  ? 7   DA  H OP1   1 
ATOM   3767 O OP2   . DA  H 3 7  ? 86.985 -31.334 8.848   1.00 82.15  ? 7   DA  H OP2   1 
ATOM   3768 O "O5'" . DA  H 3 7  ? 88.435 -31.472 10.813  1.00 83.51  ? 7   DA  H "O5'" 1 
ATOM   3769 C "C5'" . DA  H 3 7  ? 87.954 -31.719 12.156  1.00 83.06  ? 7   DA  H "C5'" 1 
ATOM   3770 C "C4'" . DA  H 3 7  ? 87.315 -33.087 12.253  1.00 89.88  ? 7   DA  H "C4'" 1 
ATOM   3771 O "O4'" . DA  H 3 7  ? 85.866 -33.010 12.258  1.00 91.10  ? 7   DA  H "O4'" 1 
ATOM   3772 C "C3'" . DA  H 3 7  ? 87.688 -34.055 11.128  1.00 90.29  ? 7   DA  H "C3'" 1 
ATOM   3773 O "O3'" . DA  H 3 7  ? 88.072 -35.273 11.753  1.00 94.17  ? 7   DA  H "O3'" 1 
ATOM   3774 C "C2'" . DA  H 3 7  ? 86.387 -34.280 10.377  1.00 84.47  ? 7   DA  H "C2'" 1 
ATOM   3775 C "C1'" . DA  H 3 7  ? 85.349 -34.067 11.462  1.00 82.86  ? 7   DA  H "C1'" 1 
ATOM   3776 N N9    . DA  H 3 7  ? 84.024 -33.671 10.971  1.00 76.87  ? 7   DA  H N9    1 
ATOM   3777 C C8    . DA  H 3 7  ? 83.722 -32.779 9.971   1.00 72.05  ? 7   DA  H C8    1 
ATOM   3778 N N7    . DA  H 3 7  ? 82.437 -32.653 9.745   1.00 70.25  ? 7   DA  H N7    1 
ATOM   3779 C C5    . DA  H 3 7  ? 81.853 -33.521 10.656  1.00 73.67  ? 7   DA  H C5    1 
ATOM   3780 C C6    . DA  H 3 7  ? 80.514 -33.843 10.928  1.00 82.31  ? 7   DA  H C6    1 
ATOM   3781 N N6    . DA  H 3 7  ? 79.479 -33.320 10.268  1.00 93.79  ? 7   DA  H N6    1 
ATOM   3782 N N1    . DA  H 3 7  ? 80.272 -34.750 11.900  1.00 86.06  ? 7   DA  H N1    1 
ATOM   3783 C C2    . DA  H 3 7  ? 81.312 -35.290 12.546  1.00 79.22  ? 7   DA  H C2    1 
ATOM   3784 N N3    . DA  H 3 7  ? 82.613 -35.079 12.371  1.00 80.89  ? 7   DA  H N3    1 
ATOM   3785 C C4    . DA  H 3 7  ? 82.819 -34.170 11.403  1.00 72.49  ? 7   DA  H C4    1 
ATOM   3786 P P     . DC  H 3 8  ? 88.614 -36.469 10.878  1.00 94.96  ? 8   DC  H P     1 
ATOM   3787 O OP1   . DC  H 3 8  ? 89.638 -37.165 11.693  1.00 83.65  ? 8   DC  H OP1   1 
ATOM   3788 O OP2   . DC  H 3 8  ? 88.936 -35.948 9.514   1.00 78.41  ? 8   DC  H OP2   1 
ATOM   3789 O "O5'" . DC  H 3 8  ? 87.354 -37.435 10.767  1.00 97.12  ? 8   DC  H "O5'" 1 
ATOM   3790 C "C5'" . DC  H 3 8  ? 87.217 -38.506 11.714  1.00 104.00 ? 8   DC  H "C5'" 1 
ATOM   3791 C "C4'" . DC  H 3 8  ? 85.782 -38.973 11.763  1.00 106.74 ? 8   DC  H "C4'" 1 
ATOM   3792 O "O4'" . DC  H 3 8  ? 84.899 -37.865 11.529  1.00 97.81  ? 8   DC  H "O4'" 1 
ATOM   3793 C "C3'" . DC  H 3 8  ? 85.415 -40.011 10.709  1.00 98.68  ? 8   DC  H "C3'" 1 
ATOM   3794 O "O3'" . DC  H 3 8  ? 85.542 -41.287 11.335  1.00 104.19 ? 8   DC  H "O3'" 1 
ATOM   3795 C "C2'" . DC  H 3 8  ? 83.943 -39.752 10.453  1.00 94.74  ? 8   DC  H "C2'" 1 
ATOM   3796 C "C1'" . DC  H 3 8  ? 83.675 -38.362 11.024  1.00 95.07  ? 8   DC  H "C1'" 1 
ATOM   3797 N N1    . DC  H 3 8  ? 83.200 -37.420 10.013  1.00 79.94  ? 8   DC  H N1    1 
ATOM   3798 C C2    . DC  H 3 8  ? 81.839 -37.191 9.916   1.00 74.87  ? 8   DC  H C2    1 
ATOM   3799 O O2    . DC  H 3 8  ? 81.079 -37.783 10.696  1.00 86.69  ? 8   DC  H O2    1 
ATOM   3800 N N3    . DC  H 3 8  ? 81.378 -36.336 8.976   1.00 71.27  ? 8   DC  H N3    1 
ATOM   3801 C C4    . DC  H 3 8  ? 82.233 -35.729 8.153   1.00 62.40  ? 8   DC  H C4    1 
ATOM   3802 N N4    . DC  H 3 8  ? 81.738 -34.876 7.253   1.00 66.09  ? 8   DC  H N4    1 
ATOM   3803 C C5    . DC  H 3 8  ? 83.631 -35.952 8.228   1.00 61.11  ? 8   DC  H C5    1 
ATOM   3804 C C6    . DC  H 3 8  ? 84.069 -36.799 9.163   1.00 71.70  ? 8   DC  H C6    1 
ATOM   3805 P P     . DT  H 3 9  ? 85.556 -42.612 10.466  1.00 107.01 ? 9   DT  H P     1 
ATOM   3806 O OP1   . DT  H 3 9  ? 85.940 -43.740 11.359  1.00 113.62 ? 9   DT  H OP1   1 
ATOM   3807 O OP2   . DT  H 3 9  ? 86.323 -42.344 9.223   1.00 97.46  ? 9   DT  H OP2   1 
ATOM   3808 O "O5'" . DT  H 3 9  ? 84.020 -42.815 10.114  1.00 110.40 ? 9   DT  H "O5'" 1 
ATOM   3809 C "C5'" . DT  H 3 9  ? 83.022 -42.738 11.146  1.00 116.24 ? 9   DT  H "C5'" 1 
ATOM   3810 C "C4'" . DT  H 3 9  ? 81.806 -43.544 10.750  1.00 117.34 ? 9   DT  H "C4'" 1 
ATOM   3811 O "O4'" . DT  H 3 9  ? 80.863 -42.747 9.995   1.00 101.37 ? 9   DT  H "O4'" 1 
ATOM   3812 C "C3'" . DT  H 3 9  ? 82.090 -44.775 9.897   1.00 111.86 ? 9   DT  H "C3'" 1 
ATOM   3813 O "O3'" . DT  H 3 9  ? 81.245 -45.791 10.452  1.00 105.55 ? 9   DT  H "O3'" 1 
ATOM   3814 C "C2'" . DT  H 3 9  ? 81.807 -44.299 8.478   1.00 106.56 ? 9   DT  H "C2'" 1 
ATOM   3815 C "C1'" . DT  H 3 9  ? 80.791 -43.172 8.643   1.00 96.17  ? 9   DT  H "C1'" 1 
ATOM   3816 N N1    . DT  H 3 9  ? 81.044 -41.992 7.807   1.00 96.76  ? 9   DT  H N1    1 
ATOM   3817 C C2    . DT  H 3 9  ? 80.011 -41.105 7.585   1.00 103.86 ? 9   DT  H C2    1 
ATOM   3818 O O2    . DT  H 3 9  ? 78.873 -41.279 8.002   1.00 91.32  ? 9   DT  H O2    1 
ATOM   3819 N N3    . DT  H 3 9  ? 80.355 -40.008 6.830   1.00 97.34  ? 9   DT  H N3    1 
ATOM   3820 C C4    . DT  H 3 9  ? 81.600 -39.715 6.301   1.00 86.94  ? 9   DT  H C4    1 
ATOM   3821 O O4    . DT  H 3 9  ? 81.760 -38.695 5.639   1.00 93.17  ? 9   DT  H O4    1 
ATOM   3822 C C5    . DT  H 3 9  ? 82.632 -40.683 6.580   1.00 83.90  ? 9   DT  H C5    1 
ATOM   3823 C C7    . DT  H 3 9  ? 84.008 -40.449 6.042   1.00 89.15  ? 9   DT  H C7    1 
ATOM   3824 C C6    . DT  H 3 9  ? 82.309 -41.755 7.315   1.00 85.43  ? 9   DT  H C6    1 
ATOM   3825 P P     . DA  H 3 10 ? 80.522 -46.861 9.529   1.00 95.36  ? 10  DA  H P     1 
ATOM   3826 O OP1   . DA  H 3 10 ? 79.844 -47.828 10.441  1.00 93.31  ? 10  DA  H OP1   1 
ATOM   3827 O OP2   . DA  H 3 10 ? 81.510 -47.360 8.541   1.00 87.05  ? 10  DA  H OP2   1 
ATOM   3828 O "O5'" . DA  H 3 10 ? 79.456 -45.983 8.728   1.00 87.18  ? 10  DA  H "O5'" 1 
ATOM   3829 C "C5'" . DA  H 3 10 ? 78.123 -45.799 9.239   1.00 80.82  ? 10  DA  H "C5'" 1 
ATOM   3830 C "C4'" . DA  H 3 10 ? 77.137 -45.626 8.108   1.00 82.02  ? 10  DA  H "C4'" 1 
ATOM   3831 O "O4'" . DA  H 3 10 ? 77.566 -44.560 7.230   1.00 92.03  ? 10  DA  H "O4'" 1 
ATOM   3832 C "C3'" . DA  H 3 10 ? 76.909 -46.853 7.221   1.00 86.08  ? 10  DA  H "C3'" 1 
ATOM   3833 O "O3'" . DA  H 3 10 ? 75.479 -47.038 7.171   1.00 88.78  ? 10  DA  H "O3'" 1 
ATOM   3834 C "C2'" . DA  H 3 10 ? 77.615 -46.495 5.918   1.00 84.49  ? 10  DA  H "C2'" 1 
ATOM   3835 C "C1'" . DA  H 3 10 ? 77.499 -44.980 5.879   1.00 83.44  ? 10  DA  H "C1'" 1 
ATOM   3836 N N9    . DA  H 3 10 ? 78.553 -44.275 5.158   1.00 80.24  ? 10  DA  H N9    1 
ATOM   3837 C C8    . DA  H 3 10 ? 79.861 -44.650 4.973   1.00 88.09  ? 10  DA  H C8    1 
ATOM   3838 N N7    . DA  H 3 10 ? 80.575 -43.768 4.317   1.00 92.48  ? 10  DA  H N7    1 
ATOM   3839 C C5    . DA  H 3 10 ? 79.685 -42.729 4.080   1.00 83.39  ? 10  DA  H C5    1 
ATOM   3840 C C6    . DA  H 3 10 ? 79.825 -41.490 3.426   1.00 73.91  ? 10  DA  H C6    1 
ATOM   3841 N N6    . DA  H 3 10 ? 80.964 -41.063 2.883   1.00 73.12  ? 10  DA  H N6    1 
ATOM   3842 N N1    . DA  H 3 10 ? 78.740 -40.692 3.353   1.00 73.40  ? 10  DA  H N1    1 
ATOM   3843 C C2    . DA  H 3 10 ? 77.595 -41.118 3.898   1.00 74.60  ? 10  DA  H C2    1 
ATOM   3844 N N3    . DA  H 3 10 ? 77.343 -42.248 4.555   1.00 81.45  ? 10  DA  H N3    1 
ATOM   3845 C C4    . DA  H 3 10 ? 78.441 -43.021 4.609   1.00 79.85  ? 10  DA  H C4    1 
ATOM   3846 P P     . DT  H 3 11 ? 74.771 -47.995 6.078   1.00 84.68  ? 11  DT  H P     1 
ATOM   3847 O OP1   . DT  H 3 11 ? 73.415 -48.293 6.568   1.00 72.91  ? 11  DT  H OP1   1 
ATOM   3848 O OP2   . DT  H 3 11 ? 75.691 -49.117 5.735   1.00 93.22  ? 11  DT  H OP2   1 
ATOM   3849 O "O5'" . DT  H 3 11 ? 74.671 -47.053 4.801   1.00 74.68  ? 11  DT  H "O5'" 1 
ATOM   3850 C "C5'" . DT  H 3 11 ? 74.012 -45.795 4.922   1.00 71.49  ? 11  DT  H "C5'" 1 
ATOM   3851 C "C4'" . DT  H 3 11 ? 73.909 -45.115 3.578   1.00 71.17  ? 11  DT  H "C4'" 1 
ATOM   3852 O "O4'" . DT  H 3 11 ? 75.176 -44.520 3.240   1.00 73.65  ? 11  DT  H "O4'" 1 
ATOM   3853 C "C3'" . DT  H 3 11 ? 73.532 -45.999 2.388   1.00 72.14  ? 11  DT  H "C3'" 1 
ATOM   3854 O "O3'" . DT  H 3 11 ? 72.654 -45.217 1.593   1.00 60.69  ? 11  DT  H "O3'" 1 
ATOM   3855 C "C2'" . DT  H 3 11 ? 74.811 -46.067 1.571   1.00 69.02  ? 11  DT  H "C2'" 1 
ATOM   3856 C "C1'" . DT  H 3 11 ? 75.387 -44.700 1.856   1.00 72.00  ? 11  DT  H "C1'" 1 
ATOM   3857 N N1    . DT  H 3 11 ? 76.825 -44.588 1.614   1.00 77.79  ? 11  DT  H N1    1 
ATOM   3858 C C2    . DT  H 3 11 ? 77.337 -43.393 1.162   1.00 77.98  ? 11  DT  H C2    1 
ATOM   3859 O O2    . DT  H 3 11 ? 76.643 -42.418 0.925   1.00 79.40  ? 11  DT  H O2    1 
ATOM   3860 N N3    . DT  H 3 11 ? 78.698 -43.385 0.988   1.00 74.85  ? 11  DT  H N3    1 
ATOM   3861 C C4    . DT  H 3 11 ? 79.575 -44.423 1.237   1.00 77.99  ? 11  DT  H C4    1 
ATOM   3862 O O4    . DT  H 3 11 ? 80.774 -44.267 1.034   1.00 97.11  ? 11  DT  H O4    1 
ATOM   3863 C C5    . DT  H 3 11 ? 78.967 -45.640 1.737   1.00 69.04  ? 11  DT  H C5    1 
ATOM   3864 C C7    . DT  H 3 11 ? 79.831 -46.824 2.031   1.00 64.65  ? 11  DT  H C7    1 
ATOM   3865 C C6    . DT  H 3 11 ? 77.644 -45.654 1.907   1.00 75.26  ? 11  DT  H C6    1 
ATOM   3866 P P     . DA  H 3 12 ? 71.237 -45.734 1.221   1.00 54.90  ? 12  DA  H P     1 
ATOM   3867 O OP1   . DA  H 3 12 ? 70.334 -45.379 2.333   1.00 58.58  ? 12  DA  H OP1   1 
ATOM   3868 O OP2   . DA  H 3 12 ? 71.380 -47.148 0.790   1.00 66.92  ? 12  DA  H OP2   1 
ATOM   3869 O "O5'" . DA  H 3 12 ? 70.833 -44.801 -0.011  1.00 51.84  ? 12  DA  H "O5'" 1 
ATOM   3870 C "C5'" . DA  H 3 12 ? 70.412 -43.437 0.214   1.00 48.33  ? 12  DA  H "C5'" 1 
ATOM   3871 C "C4'" . DA  H 3 12 ? 71.158 -42.481 -0.684  1.00 50.95  ? 12  DA  H "C4'" 1 
ATOM   3872 O "O4'" . DA  H 3 12 ? 72.558 -42.836 -0.745  1.00 63.87  ? 12  DA  H "O4'" 1 
ATOM   3873 C "C3'" . DA  H 3 12 ? 70.685 -42.411 -2.135  1.00 55.74  ? 12  DA  H "C3'" 1 
ATOM   3874 O "O3'" . DA  H 3 12 ? 70.668 -41.032 -2.504  1.00 55.09  ? 12  DA  H "O3'" 1 
ATOM   3875 C "C2'" . DA  H 3 12 ? 71.746 -43.177 -2.912  1.00 57.84  ? 12  DA  H "C2'" 1 
ATOM   3876 C "C1'" . DA  H 3 12 ? 72.983 -42.831 -2.102  1.00 66.00  ? 12  DA  H "C1'" 1 
ATOM   3877 N N9    . DA  H 3 12 ? 74.166 -43.689 -2.209  1.00 61.30  ? 12  DA  H N9    1 
ATOM   3878 C C8    . DA  H 3 12 ? 74.367 -44.967 -1.748  1.00 67.67  ? 12  DA  H C8    1 
ATOM   3879 N N7    . DA  H 3 12 ? 75.579 -45.421 -1.958  1.00 65.72  ? 12  DA  H N7    1 
ATOM   3880 C C5    . DA  H 3 12 ? 76.230 -44.357 -2.564  1.00 72.30  ? 12  DA  H C5    1 
ATOM   3881 C C6    . DA  H 3 12 ? 77.549 -44.190 -3.025  1.00 73.31  ? 12  DA  H C6    1 
ATOM   3882 N N6    . DA  H 3 12 ? 78.482 -45.142 -2.962  1.00 74.24  ? 12  DA  H N6    1 
ATOM   3883 N N1    . DA  H 3 12 ? 77.877 -43.000 -3.574  1.00 78.39  ? 12  DA  H N1    1 
ATOM   3884 C C2    . DA  H 3 12 ? 76.938 -42.046 -3.645  1.00 88.80  ? 12  DA  H C2    1 
ATOM   3885 N N3    . DA  H 3 12 ? 75.672 -42.076 -3.233  1.00 75.19  ? 12  DA  H N3    1 
ATOM   3886 C C4    . DA  H 3 12 ? 75.374 -43.278 -2.709  1.00 68.31  ? 12  DA  H C4    1 
ATOM   3887 P P     . DG  H 3 13 ? 69.791 -40.577 -3.752  1.00 67.32  ? 13  DG  H P     1 
ATOM   3888 O OP1   . DG  H 3 13 ? 69.555 -39.116 -3.659  1.00 61.33  ? 13  DG  H OP1   1 
ATOM   3889 O OP2   . DG  H 3 13 ? 68.587 -41.461 -3.806  1.00 67.64  ? 13  DG  H OP2   1 
ATOM   3890 O "O5'" . DG  H 3 13 ? 70.779 -40.877 -4.968  1.00 58.54  ? 13  DG  H "O5'" 1 
ATOM   3891 C "C5'" . DG  H 3 13 ? 71.733 -39.885 -5.378  1.00 57.07  ? 13  DG  H "C5'" 1 
ATOM   3892 C "C4'" . DG  H 3 13 ? 72.718 -40.447 -6.375  1.00 58.52  ? 13  DG  H "C4'" 1 
ATOM   3893 O "O4'" . DG  H 3 13 ? 73.529 -41.498 -5.792  1.00 61.41  ? 13  DG  H "O4'" 1 
ATOM   3894 C "C3'" . DG  H 3 13 ? 72.114 -41.038 -7.661  1.00 61.22  ? 13  DG  H "C3'" 1 
ATOM   3895 O "O3'" . DG  H 3 13 ? 72.604 -40.286 -8.786  1.00 65.71  ? 13  DG  H "O3'" 1 
ATOM   3896 C "C2'" . DG  H 3 13 ? 72.655 -42.460 -7.695  1.00 59.76  ? 13  DG  H "C2'" 1 
ATOM   3897 C "C1'" . DG  H 3 13 ? 73.916 -42.299 -6.889  1.00 58.64  ? 13  DG  H "C1'" 1 
ATOM   3898 N N9    . DG  H 3 13 ? 74.514 -43.529 -6.393  1.00 56.72  ? 13  DG  H N9    1 
ATOM   3899 C C8    . DG  H 3 13 ? 73.893 -44.580 -5.761  1.00 56.04  ? 13  DG  H C8    1 
ATOM   3900 N N7    . DG  H 3 13 ? 74.710 -45.552 -5.462  1.00 56.35  ? 13  DG  H N7    1 
ATOM   3901 C C5    . DG  H 3 13 ? 75.940 -45.128 -5.948  1.00 58.41  ? 13  DG  H C5    1 
ATOM   3902 C C6    . DG  H 3 13 ? 77.202 -45.772 -5.939  1.00 61.24  ? 13  DG  H C6    1 
ATOM   3903 O O6    . DG  H 3 13 ? 77.501 -46.871 -5.464  1.00 58.68  ? 13  DG  H O6    1 
ATOM   3904 N N1    . DG  H 3 13 ? 78.177 -44.997 -6.560  1.00 73.38  ? 13  DG  H N1    1 
ATOM   3905 C C2    . DG  H 3 13 ? 77.972 -43.752 -7.102  1.00 71.75  ? 13  DG  H C2    1 
ATOM   3906 N N2    . DG  H 3 13 ? 79.051 -43.156 -7.636  1.00 71.88  ? 13  DG  H N2    1 
ATOM   3907 N N3    . DG  H 3 13 ? 76.799 -43.136 -7.113  1.00 66.26  ? 13  DG  H N3    1 
ATOM   3908 C C4    . DG  H 3 13 ? 75.833 -43.883 -6.532  1.00 60.40  ? 13  DG  H C4    1 
ATOM   3909 P P     . DT  H 3 14 ? 72.668 -40.905 -10.298 1.00 65.06  ? 14  DT  H P     1 
ATOM   3910 O OP1   . DT  H 3 14 ? 72.356 -39.777 -11.247 1.00 60.27  ? 14  DT  H OP1   1 
ATOM   3911 O OP2   . DT  H 3 14 ? 71.820 -42.114 -10.353 1.00 53.99  ? 14  DT  H OP2   1 
ATOM   3912 O "O5'" . DT  H 3 14 ? 74.182 -41.434 -10.438 1.00 60.52  ? 14  DT  H "O5'" 1 
ATOM   3913 C "C5'" . DT  H 3 14 ? 75.322 -40.521 -10.387 1.00 61.78  ? 14  DT  H "C5'" 1 
ATOM   3914 C "C4'" . DT  H 3 14 ? 76.581 -40.994 -11.099 1.00 61.92  ? 14  DT  H "C4'" 1 
ATOM   3915 O "O4'" . DT  H 3 14 ? 77.182 -42.152 -10.477 1.00 54.48  ? 14  DT  H "O4'" 1 
ATOM   3916 C "C3'" . DT  H 3 14 ? 76.520 -41.304 -12.597 1.00 57.89  ? 14  DT  H "C3'" 1 
ATOM   3917 O "O3'" . DT  H 3 14 ? 77.723 -40.876 -13.246 1.00 52.80  ? 14  DT  H "O3'" 1 
ATOM   3918 C "C2'" . DT  H 3 14 ? 76.517 -42.822 -12.635 1.00 62.69  ? 14  DT  H "C2'" 1 
ATOM   3919 C "C1'" . DT  H 3 14 ? 77.392 -43.178 -11.442 1.00 57.76  ? 14  DT  H "C1'" 1 
ATOM   3920 N N1    . DT  H 3 14 ? 77.077 -44.451 -10.782 1.00 61.17  ? 14  DT  H N1    1 
ATOM   3921 C C2    . DT  H 3 14 ? 78.119 -45.309 -10.531 1.00 70.95  ? 14  DT  H C2    1 
ATOM   3922 O O2    . DT  H 3 14 ? 79.259 -45.098 -10.910 1.00 101.58 ? 14  DT  H O2    1 
ATOM   3923 N N3    . DT  H 3 14 ? 77.775 -46.441 -9.835  1.00 66.15  ? 14  DT  H N3    1 
ATOM   3924 C C4    . DT  H 3 14 ? 76.525 -46.784 -9.363  1.00 66.99  ? 14  DT  H C4    1 
ATOM   3925 O O4    . DT  H 3 14 ? 76.368 -47.846 -8.767  1.00 64.60  ? 14  DT  H O4    1 
ATOM   3926 C C5    . DT  H 3 14 ? 75.474 -45.829 -9.656  1.00 69.53  ? 14  DT  H C5    1 
ATOM   3927 C C7    . DT  H 3 14 ? 74.080 -46.115 -9.192  1.00 64.83  ? 14  DT  H C7    1 
ATOM   3928 C C6    . DT  H 3 14 ? 75.805 -44.716 -10.324 1.00 63.48  ? 14  DT  H C6    1 
ATOM   3929 P P     . DC  H 3 15 ? 77.687 -40.537 -14.820 1.00 65.71  ? 15  DC  H P     1 
ATOM   3930 O OP1   . DC  H 3 15 ? 78.114 -39.123 -14.996 1.00 65.34  ? 15  DC  H OP1   1 
ATOM   3931 O OP2   . DC  H 3 15 ? 76.375 -40.995 -15.392 1.00 58.50  ? 15  DC  H OP2   1 
ATOM   3932 O "O5'" . DC  H 3 15 ? 78.778 -41.517 -15.430 1.00 62.29  ? 15  DC  H "O5'" 1 
ATOM   3933 C "C5'" . DC  H 3 15 ? 79.793 -42.037 -14.585 1.00 71.44  ? 15  DC  H "C5'" 1 
ATOM   3934 C "C4'" . DC  H 3 15 ? 80.076 -43.483 -14.915 1.00 79.01  ? 15  DC  H "C4'" 1 
ATOM   3935 O "O4'" . DC  H 3 15 ? 79.455 -44.346 -13.935 1.00 75.08  ? 15  DC  H "O4'" 1 
ATOM   3936 C "C3'" . DC  H 3 15 ? 79.617 -44.003 -16.286 1.00 78.44  ? 15  DC  H "C3'" 1 
ATOM   3937 O "O3'" . DC  H 3 15 ? 80.728 -44.578 -17.007 1.00 88.76  ? 15  DC  H "O3'" 1 
ATOM   3938 C "C2'" . DC  H 3 15 ? 78.702 -45.163 -15.933 1.00 77.19  ? 15  DC  H "C2'" 1 
ATOM   3939 C "C1'" . DC  H 3 15 ? 79.281 -45.571 -14.597 1.00 74.68  ? 15  DC  H "C1'" 1 
ATOM   3940 N N1    . DC  H 3 15 ? 78.429 -46.410 -13.763 1.00 72.48  ? 15  DC  H N1    1 
ATOM   3941 C C2    . DC  H 3 15 ? 78.998 -47.478 -13.057 1.00 66.03  ? 15  DC  H C2    1 
ATOM   3942 O O2    . DC  H 3 15 ? 80.212 -47.696 -13.175 1.00 52.27  ? 15  DC  H O2    1 
ATOM   3943 N N3    . DC  H 3 15 ? 78.205 -48.251 -12.281 1.00 69.87  ? 15  DC  H N3    1 
ATOM   3944 C C4    . DC  H 3 15 ? 76.894 -47.996 -12.203 1.00 72.44  ? 15  DC  H C4    1 
ATOM   3945 N N4    . DC  H 3 15 ? 76.147 -48.780 -11.427 1.00 72.98  ? 15  DC  H N4    1 
ATOM   3946 C C5    . DC  H 3 15 ? 76.294 -46.914 -12.908 1.00 76.14  ? 15  DC  H C5    1 
ATOM   3947 C C6    . DC  H 3 15 ? 77.090 -46.152 -13.666 1.00 79.44  ? 15  DC  H C6    1 
ATOM   3948 P P     . DT  H 3 16 ? 80.665 -44.749 -18.617 1.00 93.57  ? 16  DT  H P     1 
ATOM   3949 O OP1   . DT  H 3 16 ? 81.413 -43.624 -19.232 1.00 101.71 ? 16  DT  H OP1   1 
ATOM   3950 O OP2   . DT  H 3 16 ? 79.262 -45.036 -19.019 1.00 87.23  ? 16  DT  H OP2   1 
ATOM   3951 O "O5'" . DT  H 3 16 ? 81.522 -46.052 -18.904 1.00 83.43  ? 16  DT  H "O5'" 1 
ATOM   3952 C "C5'" . DT  H 3 16 ? 82.474 -46.530 -17.958 1.00 77.65  ? 16  DT  H "C5'" 1 
ATOM   3953 C "C4'" . DT  H 3 16 ? 82.652 -48.012 -18.185 1.00 79.34  ? 16  DT  H "C4'" 1 
ATOM   3954 O "O4'" . DT  H 3 16 ? 81.902 -48.745 -17.189 1.00 72.38  ? 16  DT  H "O4'" 1 
ATOM   3955 C "C3'" . DT  H 3 16 ? 82.149 -48.516 -19.539 1.00 79.83  ? 16  DT  H "C3'" 1 
ATOM   3956 O "O3'" . DT  H 3 16 ? 83.080 -49.522 -19.964 1.00 93.59  ? 16  DT  H "O3'" 1 
ATOM   3957 C "C2'" . DT  H 3 16 ? 80.766 -49.047 -19.209 1.00 66.90  ? 16  DT  H "C2'" 1 
ATOM   3958 C "C1'" . DT  H 3 16 ? 81.003 -49.630 -17.830 1.00 69.06  ? 16  DT  H "C1'" 1 
ATOM   3959 N N1    . DT  H 3 16 ? 79.799 -49.704 -17.005 1.00 73.67  ? 16  DT  H N1    1 
ATOM   3960 C C2    . DT  H 3 16 ? 79.688 -50.720 -16.079 1.00 67.29  ? 16  DT  H C2    1 
ATOM   3961 O O2    . DT  H 3 16 ? 80.545 -51.570 -15.914 1.00 65.99  ? 16  DT  H O2    1 
ATOM   3962 N N3    . DT  H 3 16 ? 78.529 -50.703 -15.348 1.00 64.84  ? 16  DT  H N3    1 
ATOM   3963 C C4    . DT  H 3 16 ? 77.494 -49.796 -15.448 1.00 71.92  ? 16  DT  H C4    1 
ATOM   3964 O O4    . DT  H 3 16 ? 76.505 -49.920 -14.733 1.00 86.47  ? 16  DT  H O4    1 
ATOM   3965 C C5    . DT  H 3 16 ? 77.679 -48.752 -16.433 1.00 73.72  ? 16  DT  H C5    1 
ATOM   3966 C C7    . DT  H 3 16 ? 76.602 -47.732 -16.624 1.00 96.37  ? 16  DT  H C7    1 
ATOM   3967 C C6    . DT  H 3 16 ? 78.806 -48.760 -17.154 1.00 73.87  ? 16  DT  H C6    1 
ATOM   3968 P P     . DA  H 3 17 ? 82.810 -50.449 -21.260 1.00 97.28  ? 17  DA  H P     1 
ATOM   3969 O OP1   . DA  H 3 17 ? 83.540 -49.853 -22.408 1.00 94.03  ? 17  DA  H OP1   1 
ATOM   3970 O OP2   . DA  H 3 17 ? 81.342 -50.690 -21.383 1.00 97.70  ? 17  DA  H OP2   1 
ATOM   3971 O "O5'" . DA  H 3 17 ? 83.491 -51.822 -20.823 1.00 93.23  ? 17  DA  H "O5'" 1 
ATOM   3972 C "C5'" . DA  H 3 17 ? 83.582 -52.189 -19.427 1.00 88.37  ? 17  DA  H "C5'" 1 
ATOM   3973 C "C4'" . DA  H 3 17 ? 82.860 -53.493 -19.185 1.00 93.06  ? 17  DA  H "C4'" 1 
ATOM   3974 O "O4'" . DA  H 3 17 ? 81.654 -53.268 -18.415 1.00 86.47  ? 17  DA  H "O4'" 1 
ATOM   3975 C "C3'" . DA  H 3 17 ? 82.419 -54.244 -20.449 1.00 100.56 ? 17  DA  H "C3'" 1 
ATOM   3976 O "O3'" . DA  H 3 17 ? 82.830 -55.614 -20.312 1.00 110.88 ? 17  DA  H "O3'" 1 
ATOM   3977 C "C2'" . DA  H 3 17 ? 80.904 -54.087 -20.453 1.00 90.75  ? 17  DA  H "C2'" 1 
ATOM   3978 C "C1'" . DA  H 3 17 ? 80.625 -54.077 -18.966 1.00 89.25  ? 17  DA  H "C1'" 1 
ATOM   3979 N N9    . DA  H 3 17 ? 79.338 -53.525 -18.543 1.00 91.14  ? 17  DA  H N9    1 
ATOM   3980 C C8    . DA  H 3 17 ? 78.687 -52.407 -19.009 1.00 95.39  ? 17  DA  H C8    1 
ATOM   3981 N N7    . DA  H 3 17 ? 77.549 -52.166 -18.403 1.00 79.38  ? 17  DA  H N7    1 
ATOM   3982 C C5    . DA  H 3 17 ? 77.443 -53.191 -17.474 1.00 78.37  ? 17  DA  H C5    1 
ATOM   3983 C C6    . DA  H 3 17 ? 76.467 -53.495 -16.508 1.00 78.97  ? 17  DA  H C6    1 
ATOM   3984 N N6    . DA  H 3 17 ? 75.372 -52.760 -16.308 1.00 81.18  ? 17  DA  H N6    1 
ATOM   3985 N N1    . DA  H 3 17 ? 76.666 -54.586 -15.734 1.00 75.54  ? 17  DA  H N1    1 
ATOM   3986 C C2    . DA  H 3 17 ? 77.778 -55.312 -15.924 1.00 75.98  ? 17  DA  H C2    1 
ATOM   3987 N N3    . DA  H 3 17 ? 78.767 -55.128 -16.798 1.00 76.12  ? 17  DA  H N3    1 
ATOM   3988 C C4    . DA  H 3 17 ? 78.539 -54.035 -17.547 1.00 82.89  ? 17  DA  H C4    1 
ATOM   3989 P P     . DC  H 3 18 ? 82.568 -56.689 -21.486 1.00 127.78 ? 18  DC  H P     1 
ATOM   3990 O OP1   . DC  H 3 18 ? 83.721 -57.624 -21.504 1.00 135.37 ? 18  DC  H OP1   1 
ATOM   3991 O OP2   . DC  H 3 18 ? 82.196 -55.961 -22.742 1.00 100.49 ? 18  DC  H OP2   1 
ATOM   3992 O "O5'" . DC  H 3 18 ? 81.328 -57.527 -20.932 1.00 129.53 ? 18  DC  H "O5'" 1 
ATOM   3993 C "C5'" . DC  H 3 18 ? 81.440 -58.374 -19.767 1.00 110.15 ? 18  DC  H "C5'" 1 
ATOM   3994 C "C4'" . DC  H 3 18 ? 80.069 -58.855 -19.348 1.00 122.30 ? 18  DC  H "C4'" 1 
ATOM   3995 O "O4'" . DC  H 3 18 ? 79.203 -57.724 -19.045 1.00 122.67 ? 18  DC  H "O4'" 1 
ATOM   3996 C "C3'" . DC  H 3 18 ? 79.321 -59.699 -20.392 1.00 120.17 ? 18  DC  H "C3'" 1 
ATOM   3997 O "O3'" . DC  H 3 18 ? 78.875 -60.941 -19.814 1.00 126.82 ? 18  DC  H "O3'" 1 
ATOM   3998 C "C2'" . DC  H 3 18 ? 78.137 -58.824 -20.777 1.00 116.44 ? 18  DC  H "C2'" 1 
ATOM   3999 C "C1'" . DC  H 3 18 ? 77.901 -58.052 -19.493 1.00 105.76 ? 18  DC  H "C1'" 1 
ATOM   4000 N N1    . DC  H 3 18 ? 77.108 -56.808 -19.625 1.00 91.54  ? 18  DC  H N1    1 
ATOM   4001 C C2    . DC  H 3 18 ? 76.036 -56.598 -18.747 1.00 80.92  ? 18  DC  H C2    1 
ATOM   4002 O O2    . DC  H 3 18 ? 75.815 -57.433 -17.860 1.00 74.22  ? 18  DC  H O2    1 
ATOM   4003 N N3    . DC  H 3 18 ? 75.274 -55.490 -18.885 1.00 75.61  ? 18  DC  H N3    1 
ATOM   4004 C C4    . DC  H 3 18 ? 75.537 -54.617 -19.860 1.00 84.58  ? 18  DC  H C4    1 
ATOM   4005 N N4    . DC  H 3 18 ? 74.756 -53.540 -19.959 1.00 87.96  ? 18  DC  H N4    1 
ATOM   4006 C C5    . DC  H 3 18 ? 76.608 -54.815 -20.783 1.00 82.59  ? 18  DC  H C5    1 
ATOM   4007 C C6    . DC  H 3 18 ? 77.353 -55.921 -20.637 1.00 92.17  ? 18  DC  H C6    1 
ATOM   4008 P P     . DA  H 3 19 ? 78.119 -62.072 -20.714 1.00 128.75 ? 19  DA  H P     1 
ATOM   4009 O OP1   . DA  H 3 19 ? 79.155 -62.944 -21.316 1.00 137.93 ? 19  DA  H OP1   1 
ATOM   4010 O OP2   . DA  H 3 19 ? 77.135 -61.399 -21.607 1.00 117.44 ? 19  DA  H OP2   1 
ATOM   4011 O "O5'" . DA  H 3 19 ? 77.314 -62.939 -19.639 1.00 114.99 ? 19  DA  H "O5'" 1 
ATOM   4012 C "C5'" . DA  H 3 19 ? 77.120 -62.468 -18.282 1.00 125.60 ? 19  DA  H "C5'" 1 
ATOM   4013 C "C4'" . DA  H 3 19 ? 75.856 -63.023 -17.652 1.00 130.21 ? 19  DA  H "C4'" 1 
ATOM   4014 O "O4'" . DA  H 3 19 ? 74.869 -61.983 -17.445 1.00 125.60 ? 19  DA  H "O4'" 1 
ATOM   4015 C "C3'" . DA  H 3 19 ? 75.125 -64.120 -18.418 1.00 122.39 ? 19  DA  H "C3'" 1 
ATOM   4016 O "O3'" . DA  H 3 19 ? 74.484 -64.977 -17.469 1.00 122.49 ? 19  DA  H "O3'" 1 
ATOM   4017 C "C2'" . DA  H 3 19 ? 74.090 -63.354 -19.224 1.00 119.12 ? 19  DA  H "C2'" 1 
ATOM   4018 C "C1'" . DA  H 3 19 ? 73.844 -62.070 -18.429 1.00 112.51 ? 19  DA  H "C1'" 1 
ATOM   4019 N N9    . DA  H 3 19 ? 73.887 -60.842 -19.230 1.00 104.66 ? 19  DA  H N9    1 
ATOM   4020 C C8    . DA  H 3 19 ? 74.756 -60.516 -20.246 1.00 89.94  ? 19  DA  H C8    1 
ATOM   4021 N N7    . DA  H 3 19 ? 74.544 -59.330 -20.763 1.00 86.81  ? 19  DA  H N7    1 
ATOM   4022 C C5    . DA  H 3 19 ? 73.460 -58.842 -20.045 1.00 90.84  ? 19  DA  H C5    1 
ATOM   4023 C C6    . DA  H 3 19 ? 72.749 -57.626 -20.108 1.00 89.55  ? 19  DA  H C6    1 
ATOM   4024 N N6    . DA  H 3 19 ? 73.028 -56.646 -20.972 1.00 73.63  ? 19  DA  H N6    1 
ATOM   4025 N N1    . DA  H 3 19 ? 71.721 -57.455 -19.245 1.00 96.32  ? 19  DA  H N1    1 
ATOM   4026 C C2    . DA  H 3 19 ? 71.439 -58.440 -18.380 1.00 93.00  ? 19  DA  H C2    1 
ATOM   4027 N N3    . DA  H 3 19 ? 72.037 -59.620 -18.219 1.00 91.91  ? 19  DA  H N3    1 
ATOM   4028 C C4    . DA  H 3 19 ? 73.049 -59.761 -19.093 1.00 95.14  ? 19  DA  H C4    1 
HETATM 4029 O O     . HOH I 4 .  ? 61.817 0.865   7.071   1.00 48.12  ? 101 HOH A O     1 
HETATM 4030 O O     . HOH J 4 .  ? 51.492 -1.916  26.697  1.00 31.82  ? 101 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -2 ?  ?   ?   A . n 
A 1 2  SER 2  -1 ?  ?   ?   A . n 
A 1 3  HIS 3  0  ?  ?   ?   A . n 
A 1 4  MET 4  1  ?  ?   ?   A . n 
A 1 5  GLU 5  2  2  GLU GLU A . n 
A 1 6  SER 6  3  3  SER SER A . n 
A 1 7  PHE 7  4  4  PHE PHE A . n 
A 1 8  LEU 8  5  5  LEU LEU A . n 
A 1 9  LEU 9  6  6  LEU LEU A . n 
A 1 10 SER 10 7  7  SER SER A . n 
A 1 11 LYS 11 8  8  LYS LYS A . n 
A 1 12 VAL 12 9  9  VAL VAL A . n 
A 1 13 SER 13 10 10 SER SER A . n 
A 1 14 PHE 14 11 11 PHE PHE A . n 
A 1 15 VAL 15 12 12 VAL VAL A . n 
A 1 16 ILE 16 13 13 ILE ILE A . n 
A 1 17 LYS 17 14 14 LYS LYS A . n 
A 1 18 LYS 18 15 15 LYS LYS A . n 
A 1 19 ILE 19 16 16 ILE ILE A . n 
A 1 20 ARG 20 17 17 ARG ARG A . n 
A 1 21 LEU 21 18 18 LEU LEU A . n 
A 1 22 GLU 22 19 19 GLU GLU A . n 
A 1 23 LYS 23 20 20 LYS LYS A . n 
A 1 24 GLY 24 21 21 GLY GLY A . n 
A 1 25 MET 25 22 22 MET MET A . n 
A 1 26 THR 26 23 23 THR THR A . n 
A 1 27 GLN 27 24 24 GLN GLN A . n 
A 1 28 GLU 28 25 25 GLU GLU A . n 
A 1 29 ASP 29 26 26 ASP ASP A . n 
A 1 30 LEU 30 27 27 LEU LEU A . n 
A 1 31 ALA 31 28 28 ALA ALA A . n 
A 1 32 TYR 32 29 29 TYR TYR A . n 
A 1 33 LYS 33 30 30 LYS LYS A . n 
A 1 34 SER 34 31 31 SER SER A . n 
A 1 35 ASN 35 32 32 ASN ASN A . n 
A 1 36 LEU 36 33 33 LEU LEU A . n 
A 1 37 ASP 37 34 34 ASP ASP A . n 
A 1 38 ARG 38 35 35 ARG ARG A . n 
A 1 39 THR 39 36 36 THR THR A . n 
A 1 40 PHE 40 37 37 PHE PHE A . n 
A 1 41 ILE 41 38 38 ILE ILE A . n 
A 1 42 SER 42 39 39 SER SER A . n 
A 1 43 GLY 43 40 40 GLY GLY A . n 
A 1 44 ILE 44 41 41 ILE ILE A . n 
A 1 45 GLU 45 42 42 GLU GLU A . n 
A 1 46 ARG 46 43 43 ARG ARG A . n 
A 1 47 ASN 47 44 44 ASN ASN A . n 
A 1 48 SER 48 45 45 SER SER A . n 
A 1 49 ARG 49 46 46 ARG ARG A . n 
A 1 50 ASN 50 47 47 ASN ASN A . n 
A 1 51 LEU 51 48 48 LEU LEU A . n 
A 1 52 THR 52 49 49 THR THR A . n 
A 1 53 ILE 53 50 50 ILE ILE A . n 
A 1 54 LYS 54 51 51 LYS LYS A . n 
A 1 55 SER 55 52 52 SER SER A . n 
A 1 56 LEU 56 53 53 LEU LEU A . n 
A 1 57 GLU 57 54 54 GLU GLU A . n 
A 1 58 LEU 58 55 55 LEU LEU A . n 
A 1 59 ILE 59 56 56 ILE ILE A . n 
A 1 60 MET 60 57 57 MET MET A . n 
A 1 61 LYS 61 58 58 LYS LYS A . n 
A 1 62 GLY 62 59 59 GLY GLY A . n 
A 1 63 LEU 63 60 60 LEU LEU A . n 
A 1 64 GLU 64 61 61 GLU GLU A . n 
A 1 65 VAL 65 62 62 VAL VAL A . n 
A 1 66 SER 66 63 63 SER SER A . n 
A 1 67 ASP 67 64 64 ASP ASP A . n 
A 1 68 VAL 68 65 65 VAL VAL A . n 
A 1 69 VAL 69 66 66 VAL VAL A . n 
A 1 70 PHE 70 67 67 PHE PHE A . n 
A 1 71 PHE 71 68 68 PHE PHE A . n 
A 1 72 GLU 72 69 69 GLU GLU A . n 
A 1 73 MET 73 70 70 MET MET A . n 
A 1 74 LEU 74 71 71 LEU LEU A . n 
A 1 75 ILE 75 72 72 ILE ILE A . n 
A 1 76 LYS 76 73 73 LYS LYS A . n 
A 1 77 GLU 77 74 74 GLU GLU A . n 
A 1 78 ILE 78 75 75 ILE ILE A . n 
A 1 79 LEU 79 76 76 LEU LEU A . n 
A 1 80 LYS 80 77 77 LYS LYS A . n 
A 1 81 HIS 81 78 ?  ?   ?   A . n 
A 1 82 ASP 82 79 ?  ?   ?   A . n 
B 1 1  GLY 1  -2 ?  ?   ?   B . n 
B 1 2  SER 2  -1 ?  ?   ?   B . n 
B 1 3  HIS 3  0  ?  ?   ?   B . n 
B 1 4  MET 4  1  ?  ?   ?   B . n 
B 1 5  GLU 5  2  2  GLU GLU B . n 
B 1 6  SER 6  3  3  SER SER B . n 
B 1 7  PHE 7  4  4  PHE PHE B . n 
B 1 8  LEU 8  5  5  LEU LEU B . n 
B 1 9  LEU 9  6  6  LEU LEU B . n 
B 1 10 SER 10 7  7  SER SER B . n 
B 1 11 LYS 11 8  8  LYS LYS B . n 
B 1 12 VAL 12 9  9  VAL VAL B . n 
B 1 13 SER 13 10 10 SER SER B . n 
B 1 14 PHE 14 11 11 PHE PHE B . n 
B 1 15 VAL 15 12 12 VAL VAL B . n 
B 1 16 ILE 16 13 13 ILE ILE B . n 
B 1 17 LYS 17 14 14 LYS LYS B . n 
B 1 18 LYS 18 15 15 LYS LYS B . n 
B 1 19 ILE 19 16 16 ILE ILE B . n 
B 1 20 ARG 20 17 17 ARG ARG B . n 
B 1 21 LEU 21 18 18 LEU LEU B . n 
B 1 22 GLU 22 19 19 GLU GLU B . n 
B 1 23 LYS 23 20 20 LYS LYS B . n 
B 1 24 GLY 24 21 21 GLY GLY B . n 
B 1 25 MET 25 22 22 MET MET B . n 
B 1 26 THR 26 23 23 THR THR B . n 
B 1 27 GLN 27 24 24 GLN GLN B . n 
B 1 28 GLU 28 25 25 GLU GLU B . n 
B 1 29 ASP 29 26 26 ASP ASP B . n 
B 1 30 LEU 30 27 27 LEU LEU B . n 
B 1 31 ALA 31 28 28 ALA ALA B . n 
B 1 32 TYR 32 29 29 TYR TYR B . n 
B 1 33 LYS 33 30 30 LYS LYS B . n 
B 1 34 SER 34 31 31 SER SER B . n 
B 1 35 ASN 35 32 32 ASN ASN B . n 
B 1 36 LEU 36 33 33 LEU LEU B . n 
B 1 37 ASP 37 34 34 ASP ASP B . n 
B 1 38 ARG 38 35 35 ARG ARG B . n 
B 1 39 THR 39 36 36 THR THR B . n 
B 1 40 PHE 40 37 37 PHE PHE B . n 
B 1 41 ILE 41 38 38 ILE ILE B . n 
B 1 42 SER 42 39 39 SER SER B . n 
B 1 43 GLY 43 40 40 GLY GLY B . n 
B 1 44 ILE 44 41 41 ILE ILE B . n 
B 1 45 GLU 45 42 42 GLU GLU B . n 
B 1 46 ARG 46 43 43 ARG ARG B . n 
B 1 47 ASN 47 44 44 ASN ASN B . n 
B 1 48 SER 48 45 45 SER SER B . n 
B 1 49 ARG 49 46 46 ARG ARG B . n 
B 1 50 ASN 50 47 47 ASN ASN B . n 
B 1 51 LEU 51 48 48 LEU LEU B . n 
B 1 52 THR 52 49 49 THR THR B . n 
B 1 53 ILE 53 50 50 ILE ILE B . n 
B 1 54 LYS 54 51 51 LYS LYS B . n 
B 1 55 SER 55 52 52 SER SER B . n 
B 1 56 LEU 56 53 53 LEU LEU B . n 
B 1 57 GLU 57 54 54 GLU GLU B . n 
B 1 58 LEU 58 55 55 LEU LEU B . n 
B 1 59 ILE 59 56 56 ILE ILE B . n 
B 1 60 MET 60 57 57 MET MET B . n 
B 1 61 LYS 61 58 58 LYS LYS B . n 
B 1 62 GLY 62 59 59 GLY GLY B . n 
B 1 63 LEU 63 60 60 LEU LEU B . n 
B 1 64 GLU 64 61 61 GLU GLU B . n 
B 1 65 VAL 65 62 62 VAL VAL B . n 
B 1 66 SER 66 63 63 SER SER B . n 
B 1 67 ASP 67 64 64 ASP ASP B . n 
B 1 68 VAL 68 65 65 VAL VAL B . n 
B 1 69 VAL 69 66 66 VAL VAL B . n 
B 1 70 PHE 70 67 67 PHE PHE B . n 
B 1 71 PHE 71 68 68 PHE PHE B . n 
B 1 72 GLU 72 69 69 GLU GLU B . n 
B 1 73 MET 73 70 70 MET MET B . n 
B 1 74 LEU 74 71 71 LEU LEU B . n 
B 1 75 ILE 75 72 72 ILE ILE B . n 
B 1 76 LYS 76 73 73 LYS LYS B . n 
B 1 77 GLU 77 74 74 GLU GLU B . n 
B 1 78 ILE 78 75 75 ILE ILE B . n 
B 1 79 LEU 79 76 76 LEU LEU B . n 
B 1 80 LYS 80 77 77 LYS LYS B . n 
B 1 81 HIS 81 78 ?  ?   ?   B . n 
B 1 82 ASP 82 79 ?  ?   ?   B . n 
C 2 1  DA  1  1  1  DA  DA  C . n 
C 2 2  DT  2  2  2  DT  DT  C . n 
C 2 3  DG  3  3  3  DG  DG  C . n 
C 2 4  DT  4  4  4  DT  DT  C . n 
C 2 5  DA  5  5  5  DA  DA  C . n 
C 2 6  DG  6  6  6  DG  DG  C . n 
C 2 7  DA  7  7  7  DA  DA  C . n 
C 2 8  DC  8  8  8  DC  DC  C . n 
C 2 9  DT  9  9  9  DT  DT  C . n 
C 2 10 DA  10 10 10 DA  DA  C . n 
C 2 11 DT  11 11 11 DT  DT  C . n 
C 2 12 DA  12 12 12 DA  DA  C . n 
C 2 13 DG  13 13 13 DG  DG  C . n 
C 2 14 DT  14 14 14 DT  DT  C . n 
C 2 15 DC  15 15 15 DC  DC  C . n 
C 2 16 DG  16 16 16 DG  DG  C . n 
C 2 17 DA  17 17 17 DA  DA  C . n 
C 2 18 DC  18 18 18 DC  DC  C . n 
C 2 19 DA  19 19 19 DA  DA  C . n 
D 3 1  DT  1  1  1  DT  DT  D . n 
D 3 2  DT  2  2  2  DT  DT  D . n 
D 3 3  DG  3  3  3  DG  DG  D . n 
D 3 4  DT  4  4  4  DT  DT  D . n 
D 3 5  DC  5  5  5  DC  DC  D . n 
D 3 6  DG  6  6  6  DG  DG  D . n 
D 3 7  DA  7  7  7  DA  DA  D . n 
D 3 8  DC  8  8  8  DC  DC  D . n 
D 3 9  DT  9  9  9  DT  DT  D . n 
D 3 10 DA  10 10 10 DA  DA  D . n 
D 3 11 DT  11 11 11 DT  DT  D . n 
D 3 12 DA  12 12 12 DA  DA  D . n 
D 3 13 DG  13 13 13 DG  DG  D . n 
D 3 14 DT  14 14 14 DT  DT  D . n 
D 3 15 DC  15 15 15 DC  DC  D . n 
D 3 16 DT  16 16 16 DT  DT  D . n 
D 3 17 DA  17 17 17 DA  DA  D . n 
D 3 18 DC  18 18 18 DC  DC  D . n 
D 3 19 DA  19 19 19 DA  DA  D . n 
E 1 1  GLY 1  -2 ?  ?   ?   E . n 
E 1 2  SER 2  -1 ?  ?   ?   E . n 
E 1 3  HIS 3  0  ?  ?   ?   E . n 
E 1 4  MET 4  1  ?  ?   ?   E . n 
E 1 5  GLU 5  2  2  GLU GLU E . n 
E 1 6  SER 6  3  3  SER SER E . n 
E 1 7  PHE 7  4  4  PHE PHE E . n 
E 1 8  LEU 8  5  5  LEU LEU E . n 
E 1 9  LEU 9  6  6  LEU LEU E . n 
E 1 10 SER 10 7  7  SER SER E . n 
E 1 11 LYS 11 8  8  LYS LYS E . n 
E 1 12 VAL 12 9  9  VAL VAL E . n 
E 1 13 SER 13 10 10 SER SER E . n 
E 1 14 PHE 14 11 11 PHE PHE E . n 
E 1 15 VAL 15 12 12 VAL VAL E . n 
E 1 16 ILE 16 13 13 ILE ILE E . n 
E 1 17 LYS 17 14 14 LYS LYS E . n 
E 1 18 LYS 18 15 15 LYS LYS E . n 
E 1 19 ILE 19 16 16 ILE ILE E . n 
E 1 20 ARG 20 17 17 ARG ARG E . n 
E 1 21 LEU 21 18 18 LEU LEU E . n 
E 1 22 GLU 22 19 19 GLU GLU E . n 
E 1 23 LYS 23 20 20 LYS LYS E . n 
E 1 24 GLY 24 21 21 GLY GLY E . n 
E 1 25 MET 25 22 22 MET MET E . n 
E 1 26 THR 26 23 23 THR THR E . n 
E 1 27 GLN 27 24 24 GLN GLN E . n 
E 1 28 GLU 28 25 25 GLU GLU E . n 
E 1 29 ASP 29 26 26 ASP ASP E . n 
E 1 30 LEU 30 27 27 LEU LEU E . n 
E 1 31 ALA 31 28 28 ALA ALA E . n 
E 1 32 TYR 32 29 29 TYR TYR E . n 
E 1 33 LYS 33 30 30 LYS LYS E . n 
E 1 34 SER 34 31 31 SER SER E . n 
E 1 35 ASN 35 32 32 ASN ASN E . n 
E 1 36 LEU 36 33 33 LEU LEU E . n 
E 1 37 ASP 37 34 34 ASP ASP E . n 
E 1 38 ARG 38 35 35 ARG ARG E . n 
E 1 39 THR 39 36 36 THR THR E . n 
E 1 40 PHE 40 37 37 PHE PHE E . n 
E 1 41 ILE 41 38 38 ILE ILE E . n 
E 1 42 SER 42 39 39 SER SER E . n 
E 1 43 GLY 43 40 40 GLY GLY E . n 
E 1 44 ILE 44 41 41 ILE ILE E . n 
E 1 45 GLU 45 42 42 GLU GLU E . n 
E 1 46 ARG 46 43 43 ARG ARG E . n 
E 1 47 ASN 47 44 44 ASN ASN E . n 
E 1 48 SER 48 45 45 SER SER E . n 
E 1 49 ARG 49 46 46 ARG ARG E . n 
E 1 50 ASN 50 47 47 ASN ASN E . n 
E 1 51 LEU 51 48 48 LEU LEU E . n 
E 1 52 THR 52 49 49 THR THR E . n 
E 1 53 ILE 53 50 50 ILE ILE E . n 
E 1 54 LYS 54 51 51 LYS LYS E . n 
E 1 55 SER 55 52 52 SER SER E . n 
E 1 56 LEU 56 53 53 LEU LEU E . n 
E 1 57 GLU 57 54 54 GLU GLU E . n 
E 1 58 LEU 58 55 55 LEU LEU E . n 
E 1 59 ILE 59 56 56 ILE ILE E . n 
E 1 60 MET 60 57 57 MET MET E . n 
E 1 61 LYS 61 58 58 LYS LYS E . n 
E 1 62 GLY 62 59 59 GLY GLY E . n 
E 1 63 LEU 63 60 60 LEU LEU E . n 
E 1 64 GLU 64 61 61 GLU GLU E . n 
E 1 65 VAL 65 62 62 VAL VAL E . n 
E 1 66 SER 66 63 63 SER SER E . n 
E 1 67 ASP 67 64 64 ASP ASP E . n 
E 1 68 VAL 68 65 65 VAL VAL E . n 
E 1 69 VAL 69 66 66 VAL VAL E . n 
E 1 70 PHE 70 67 67 PHE PHE E . n 
E 1 71 PHE 71 68 68 PHE PHE E . n 
E 1 72 GLU 72 69 69 GLU GLU E . n 
E 1 73 MET 73 70 70 MET MET E . n 
E 1 74 LEU 74 71 71 LEU LEU E . n 
E 1 75 ILE 75 72 72 ILE ILE E . n 
E 1 76 LYS 76 73 73 LYS LYS E . n 
E 1 77 GLU 77 74 74 GLU GLU E . n 
E 1 78 ILE 78 75 75 ILE ILE E . n 
E 1 79 LEU 79 76 76 LEU LEU E . n 
E 1 80 LYS 80 77 77 LYS LYS E . n 
E 1 81 HIS 81 78 78 HIS HIS E . n 
E 1 82 ASP 82 79 ?  ?   ?   E . n 
F 1 1  GLY 1  -2 ?  ?   ?   F . n 
F 1 2  SER 2  -1 ?  ?   ?   F . n 
F 1 3  HIS 3  0  ?  ?   ?   F . n 
F 1 4  MET 4  1  ?  ?   ?   F . n 
F 1 5  GLU 5  2  2  GLU GLU F . n 
F 1 6  SER 6  3  3  SER SER F . n 
F 1 7  PHE 7  4  4  PHE PHE F . n 
F 1 8  LEU 8  5  5  LEU LEU F . n 
F 1 9  LEU 9  6  6  LEU LEU F . n 
F 1 10 SER 10 7  7  SER SER F . n 
F 1 11 LYS 11 8  8  LYS LYS F . n 
F 1 12 VAL 12 9  9  VAL VAL F . n 
F 1 13 SER 13 10 10 SER SER F . n 
F 1 14 PHE 14 11 11 PHE PHE F . n 
F 1 15 VAL 15 12 12 VAL VAL F . n 
F 1 16 ILE 16 13 13 ILE ILE F . n 
F 1 17 LYS 17 14 14 LYS LYS F . n 
F 1 18 LYS 18 15 15 LYS LYS F . n 
F 1 19 ILE 19 16 16 ILE ILE F . n 
F 1 20 ARG 20 17 17 ARG ARG F . n 
F 1 21 LEU 21 18 18 LEU LEU F . n 
F 1 22 GLU 22 19 19 GLU GLU F . n 
F 1 23 LYS 23 20 20 LYS LYS F . n 
F 1 24 GLY 24 21 21 GLY GLY F . n 
F 1 25 MET 25 22 22 MET MET F . n 
F 1 26 THR 26 23 23 THR THR F . n 
F 1 27 GLN 27 24 24 GLN GLN F . n 
F 1 28 GLU 28 25 25 GLU GLU F . n 
F 1 29 ASP 29 26 26 ASP ASP F . n 
F 1 30 LEU 30 27 27 LEU LEU F . n 
F 1 31 ALA 31 28 28 ALA ALA F . n 
F 1 32 TYR 32 29 29 TYR TYR F . n 
F 1 33 LYS 33 30 30 LYS LYS F . n 
F 1 34 SER 34 31 31 SER SER F . n 
F 1 35 ASN 35 32 32 ASN ASN F . n 
F 1 36 LEU 36 33 33 LEU LEU F . n 
F 1 37 ASP 37 34 34 ASP ASP F . n 
F 1 38 ARG 38 35 35 ARG ARG F . n 
F 1 39 THR 39 36 36 THR THR F . n 
F 1 40 PHE 40 37 37 PHE PHE F . n 
F 1 41 ILE 41 38 38 ILE ILE F . n 
F 1 42 SER 42 39 39 SER SER F . n 
F 1 43 GLY 43 40 40 GLY GLY F . n 
F 1 44 ILE 44 41 41 ILE ILE F . n 
F 1 45 GLU 45 42 42 GLU GLU F . n 
F 1 46 ARG 46 43 43 ARG ARG F . n 
F 1 47 ASN 47 44 44 ASN ASN F . n 
F 1 48 SER 48 45 45 SER SER F . n 
F 1 49 ARG 49 46 46 ARG ARG F . n 
F 1 50 ASN 50 47 47 ASN ASN F . n 
F 1 51 LEU 51 48 48 LEU LEU F . n 
F 1 52 THR 52 49 49 THR THR F . n 
F 1 53 ILE 53 50 50 ILE ILE F . n 
F 1 54 LYS 54 51 51 LYS LYS F . n 
F 1 55 SER 55 52 52 SER SER F . n 
F 1 56 LEU 56 53 53 LEU LEU F . n 
F 1 57 GLU 57 54 54 GLU GLU F . n 
F 1 58 LEU 58 55 55 LEU LEU F . n 
F 1 59 ILE 59 56 56 ILE ILE F . n 
F 1 60 MET 60 57 57 MET MET F . n 
F 1 61 LYS 61 58 58 LYS LYS F . n 
F 1 62 GLY 62 59 59 GLY GLY F . n 
F 1 63 LEU 63 60 60 LEU LEU F . n 
F 1 64 GLU 64 61 61 GLU GLU F . n 
F 1 65 VAL 65 62 62 VAL VAL F . n 
F 1 66 SER 66 63 63 SER SER F . n 
F 1 67 ASP 67 64 64 ASP ASP F . n 
F 1 68 VAL 68 65 65 VAL VAL F . n 
F 1 69 VAL 69 66 66 VAL VAL F . n 
F 1 70 PHE 70 67 67 PHE PHE F . n 
F 1 71 PHE 71 68 68 PHE PHE F . n 
F 1 72 GLU 72 69 69 GLU GLU F . n 
F 1 73 MET 73 70 70 MET MET F . n 
F 1 74 LEU 74 71 71 LEU LEU F . n 
F 1 75 ILE 75 72 72 ILE ILE F . n 
F 1 76 LYS 76 73 73 LYS LYS F . n 
F 1 77 GLU 77 74 74 GLU GLU F . n 
F 1 78 ILE 78 75 75 ILE ILE F . n 
F 1 79 LEU 79 76 76 LEU LEU F . n 
F 1 80 LYS 80 77 77 LYS LYS F . n 
F 1 81 HIS 81 78 ?  ?   ?   F . n 
F 1 82 ASP 82 79 ?  ?   ?   F . n 
G 2 1  DA  1  1  1  DA  DA  G . n 
G 2 2  DT  2  2  2  DT  DT  G . n 
G 2 3  DG  3  3  3  DG  DG  G . n 
G 2 4  DT  4  4  4  DT  DT  G . n 
G 2 5  DA  5  5  5  DA  DA  G . n 
G 2 6  DG  6  6  6  DG  DG  G . n 
G 2 7  DA  7  7  7  DA  DA  G . n 
G 2 8  DC  8  8  8  DC  DC  G . n 
G 2 9  DT  9  9  9  DT  DT  G . n 
G 2 10 DA  10 10 10 DA  DA  G . n 
G 2 11 DT  11 11 11 DT  DT  G . n 
G 2 12 DA  12 12 12 DA  DA  G . n 
G 2 13 DG  13 13 13 DG  DG  G . n 
G 2 14 DT  14 14 14 DT  DT  G . n 
G 2 15 DC  15 15 15 DC  DC  G . n 
G 2 16 DG  16 16 16 DG  DG  G . n 
G 2 17 DA  17 17 17 DA  DA  G . n 
G 2 18 DC  18 18 18 DC  DC  G . n 
G 2 19 DA  19 19 19 DA  DA  G . n 
H 3 1  DT  1  1  1  DT  DT  H . n 
H 3 2  DT  2  2  2  DT  DT  H . n 
H 3 3  DG  3  3  3  DG  DG  H . n 
H 3 4  DT  4  4  4  DT  DT  H . n 
H 3 5  DC  5  5  5  DC  DC  H . n 
H 3 6  DG  6  6  6  DG  DG  H . n 
H 3 7  DA  7  7  7  DA  DA  H . n 
H 3 8  DC  8  8  8  DC  DC  H . n 
H 3 9  DT  9  9  9  DT  DT  H . n 
H 3 10 DA  10 10 10 DA  DA  H . n 
H 3 11 DT  11 11 11 DT  DT  H . n 
H 3 12 DA  12 12 12 DA  DA  H . n 
H 3 13 DG  13 13 13 DG  DG  H . n 
H 3 14 DT  14 14 14 DT  DT  H . n 
H 3 15 DC  15 15 15 DC  DC  H . n 
H 3 16 DT  16 16 16 DT  DT  H . n 
H 3 17 DA  17 17 17 DA  DA  H . n 
H 3 18 DC  18 18 18 DC  DC  H . n 
H 3 19 DA  19 19 19 DA  DA  H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,I,J 
2 1 E,F,G,H     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6670  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  12310 ? 
2 'ABSA (A^2)' 6680  ? 
2 MORE         -47   ? 
2 'SSA (A^2)'  12400 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-01-29 
2 'Structure model' 1 1 2014-06-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_phasing_MR.entry_id                     4IVZ 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.100 
_pdbx_phasing_MR.d_res_low_rotation           45.380 
_pdbx_phasing_MR.d_res_high_translation       3.100 
_pdbx_phasing_MR.d_res_low_translation        45.380 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .      ?                                 package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/          ?          ? 
2 Aimless     0.1.26 03/07/12                          program 'Phil Evans'         ?                           'data scaling'    
http://www.mrc-lmb.cam.ac.uk/harry/pre/aimless.html ?          ? 
3 PHASER      2.5.1  'Tue Jul 10 12:42:19 2012 (svn )' program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/         ?          ? 
4 REFMAC      .      ?                                 program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html        Fortran_77 ? 
5 PDB_EXTRACT 3.11   'April 22, 2011'                  package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/           C++        ? 
6 GDA         .      ?                                 ?       ?                    ?                           'data collection' 
?                                                   ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   F ARG 17 ? ? O  F LYS 20 ? ? 1.78 
2 1 NH2 F ARG 46 ? ? N7 G DG  13 ? ? 2.11 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C1'" C DC 15 ? ? "O4'" C DC 15 ? ? "C4'" C DC 15 ? ? 103.66 110.10 -6.44 1.00 N 
2 1 "C1'" D DT 2  ? ? "O4'" D DT 2  ? ? "C4'" D DT 2  ? ? 102.44 110.10 -7.66 1.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 20 ? ? -55.31  -5.65   
2  1 ASP A 64 ? ? -60.04  14.35   
3  1 PHE A 67 ? ? -45.07  -72.80  
4  1 ASN B 32 ? ? 30.87   53.59   
5  1 ASN B 44 ? ? -140.15 39.63   
6  1 SER B 45 ? ? 38.58   51.94   
7  1 LEU B 53 ? ? -43.00  -70.00  
8  1 PHE E 4  ? ? -50.60  -76.10  
9  1 LYS E 8  ? ? -66.83  4.51    
10 1 ASN E 32 ? ? 81.05   -5.20   
11 1 ARG E 43 ? ? -77.56  -76.28  
12 1 SER E 45 ? ? 73.33   33.99   
13 1 ARG E 46 ? ? -43.90  154.04  
14 1 LEU E 48 ? ? -69.42  -174.73 
15 1 LEU E 76 ? ? -61.98  73.02   
16 1 LYS F 20 ? ? 77.40   74.87   
17 1 ARG F 46 ? ? -36.20  147.09  
18 1 LYS F 51 ? ? -57.74  -9.52   
19 1 ASP F 64 ? ? -39.92  -20.62  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2 ? A GLY 1  
2  1 Y 1 A SER -1 ? A SER 2  
3  1 Y 1 A HIS 0  ? A HIS 3  
4  1 Y 1 A MET 1  ? A MET 4  
5  1 Y 1 A HIS 78 ? A HIS 81 
6  1 Y 1 A ASP 79 ? A ASP 82 
7  1 Y 1 B GLY -2 ? B GLY 1  
8  1 Y 1 B SER -1 ? B SER 2  
9  1 Y 1 B HIS 0  ? B HIS 3  
10 1 Y 1 B MET 1  ? B MET 4  
11 1 Y 1 B HIS 78 ? B HIS 81 
12 1 Y 1 B ASP 79 ? B ASP 82 
13 1 Y 1 E GLY -2 ? E GLY 1  
14 1 Y 1 E SER -1 ? E SER 2  
15 1 Y 1 E HIS 0  ? E HIS 3  
16 1 Y 1 E MET 1  ? E MET 4  
17 1 Y 1 E ASP 79 ? E ASP 82 
18 1 Y 1 F GLY -2 ? F GLY 1  
19 1 Y 1 F SER -1 ? F SER 2  
20 1 Y 1 F HIS 0  ? F HIS 3  
21 1 Y 1 F MET 1  ? F MET 4  
22 1 Y 1 F HIS 78 ? F HIS 81 
23 1 Y 1 F ASP 79 ? F ASP 82 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4IVZ 'double helix'        
4IVZ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 D DT 2  1_555 C DA 19 1_555 -0.238 -0.186 0.690  -17.333 -8.587  -8.464  1  D_DT2:DA19_C  D 2  ? C 19 ? 20 1 
1 D DG 3  1_555 C DC 18 1_555 -1.448 0.088  0.041  -4.708  -11.235 2.540   2  D_DG3:DC18_C  D 3  ? C 18 ? ?  1 
1 D DT 4  1_555 C DA 17 1_555 -0.265 -0.019 -0.112 8.346   -14.849 2.832   3  D_DT4:DA17_C  D 4  ? C 17 ? 20 1 
1 D DC 5  1_555 C DG 16 1_555 -0.259 0.363  0.055  9.458   -5.912  -2.848  4  D_DC5:DG16_C  D 5  ? C 16 ? 19 1 
1 D DG 6  1_555 C DC 15 1_555 0.627  -0.216 0.585  33.395  -4.860  -10.064 5  D_DG6:DC15_C  D 6  ? C 15 ? 19 1 
1 D DA 7  1_555 C DT 14 1_555 -0.521 -0.087 0.063  17.227  -21.771 7.214   6  D_DA7:DT14_C  D 7  ? C 14 ? 20 1 
1 D DC 8  1_555 C DG 13 1_555 -0.224 0.092  0.928  7.071   -27.991 2.093   7  D_DC8:DG13_C  D 8  ? C 13 ? ?  1 
1 D DT 9  1_555 C DA 12 1_555 -0.733 -0.020 0.335  5.732   -10.990 7.509   8  D_DT9:DA12_C  D 9  ? C 12 ? 20 1 
1 D DA 10 1_555 C DT 11 1_555 0.189  -0.146 -0.671 -17.469 -9.680  -0.118  9  D_DA10:DT11_C D 10 ? C 11 ? 20 1 
1 D DT 11 1_555 C DA 10 1_555 0.252  -0.033 0.299  -15.661 -9.764  8.096   10 D_DT11:DA10_C D 11 ? C 10 ? 20 1 
1 D DA 12 1_555 C DT 9  1_555 -0.116 0.028  -0.398 -14.829 -28.930 5.957   11 D_DA12:DT9_C  D 12 ? C 9  ? 20 1 
1 D DG 13 1_555 C DC 8  1_555 -0.247 0.041  -0.280 -4.319  -15.119 2.915   12 D_DG13:DC8_C  D 13 ? C 8  ? 19 1 
1 D DT 14 1_555 C DA 7  1_555 0.735  -0.224 -0.882 -0.982  -11.226 4.093   13 D_DT14:DA7_C  D 14 ? C 7  ? 20 1 
1 D DC 15 1_555 C DG 6  1_555 0.111  -0.195 -0.532 -6.468  -18.620 5.434   14 D_DC15:DG6_C  D 15 ? C 6  ? 19 1 
1 D DT 16 1_555 C DA 5  1_555 -0.444 -0.265 0.112  -2.005  -8.304  0.542   15 D_DT16:DA5_C  D 16 ? C 5  ? 20 1 
1 D DA 17 1_555 C DT 4  1_555 -0.068 -0.136 -0.008 -11.045 -0.967  -5.751  16 D_DA17:DT4_C  D 17 ? C 4  ? 20 1 
1 D DC 18 1_555 C DG 3  1_555 0.082  0.040  -0.157 17.114  2.132   -1.713  17 D_DC18:DG3_C  D 18 ? C 3  ? 19 1 
1 D DA 19 1_555 C DT 2  1_555 0.111  -0.208 -0.503 6.258   -8.418  0.701   18 D_DA19:DT2_C  D 19 ? C 2  ? 20 1 
1 H DT 1  1_555 C DA 1  1_555 -0.827 0.250  0.712  -3.552  -8.794  37.934  19 H_DT1:DA1_C   H 1  ? C 1  ? ?  1 
1 H DT 2  1_555 G DA 19 1_555 -0.195 -0.275 -0.116 -13.060 -9.353  -0.004  20 H_DT2:DA19_G  H 2  ? G 19 ? 20 1 
1 H DG 3  1_555 G DC 18 1_555 -0.603 -0.408 -0.003 -3.010  -2.771  2.263   21 H_DG3:DC18_G  H 3  ? G 18 ? 19 1 
1 H DT 4  1_555 G DA 17 1_555 -0.387 -0.283 -0.754 9.316   -2.920  -7.101  22 H_DT4:DA17_G  H 4  ? G 17 ? 20 1 
1 H DC 5  1_555 G DG 16 1_555 -0.202 -0.182 -0.542 5.766   -0.717  0.492   23 H_DC5:DG16_G  H 5  ? G 16 ? 19 1 
1 H DG 6  1_555 G DC 15 1_555 0.461  -0.091 -0.709 8.221   -8.950  4.543   24 H_DG6:DC15_G  H 6  ? G 15 ? 19 1 
1 H DA 7  1_555 G DT 14 1_555 0.255  -0.270 -0.077 13.686  -7.309  -5.520  25 H_DA7:DT14_G  H 7  ? G 14 ? 20 1 
1 H DC 8  1_555 G DG 13 1_555 0.787  0.509  -0.416 13.181  -20.544 16.963  26 H_DC8:DG13_G  H 8  ? G 13 ? ?  1 
1 H DT 9  1_555 G DA 12 1_555 0.739  0.047  -0.283 25.437  -23.762 0.637   27 H_DT9:DA12_G  H 9  ? G 12 ? 20 1 
1 H DA 10 1_555 G DT 11 1_555 -0.268 -0.383 0.036  17.305  -5.737  3.430   28 H_DA10:DT11_G H 10 ? G 11 ? 20 1 
1 H DT 11 1_555 G DA 10 1_555 0.117  -0.178 -0.694 18.028  -4.754  13.234  29 H_DT11:DA10_G H 11 ? G 10 ? 20 1 
1 H DA 12 1_555 G DT 9  1_555 -0.163 -0.349 0.295  -0.771  -21.617 -2.464  30 H_DA12:DT9_G  H 12 ? G 9  ? 20 1 
1 H DG 13 1_555 G DC 8  1_555 0.137  -0.218 0.324  -4.250  -16.085 -4.309  31 H_DG13:DC8_G  H 13 ? G 8  ? 19 1 
1 H DT 14 1_555 G DA 7  1_555 -0.642 -0.324 0.873  -6.567  -14.049 7.113   32 H_DT14:DA7_G  H 14 ? G 7  ? 20 1 
1 H DC 15 1_555 G DG 6  1_555 0.509  -0.440 0.070  -4.423  -15.850 -2.704  33 H_DC15:DG6_G  H 15 ? G 6  ? 19 1 
1 H DT 16 1_555 G DA 5  1_555 -1.029 -0.395 0.460  3.063   -18.222 10.028  34 H_DT16:DA5_G  H 16 ? G 5  ? 20 1 
1 H DA 17 1_555 G DT 4  1_555 0.127  -0.146 -0.388 -8.119  -8.714  -9.291  35 H_DA17:DT4_G  H 17 ? G 4  ? 20 1 
1 H DC 18 1_555 G DG 3  1_555 1.407  -0.405 -0.101 10.197  -1.152  -0.587  36 H_DC18:DG3_G  H 18 ? G 3  ? 19 1 
1 H DA 19 1_555 G DT 2  1_555 0.054  -0.131 0.087  12.193  -3.397  10.114  37 H_DA19:DT2_G  H 19 ? G 2  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 D DT 2  1_555 C DA 19 1_555 D DG 3  1_555 C DC 18 1_555 0.518  -0.254 2.987 4.381   1.464   36.033 -0.596 -0.267 3.015 2.355   
-7.047  36.318 1  DD_DT2DG3:DC18DA19_CC   D 2  ? C 19 ? D 3  ? C 18 ? 
1 D DG 3  1_555 C DC 18 1_555 D DT 4  1_555 C DA 17 1_555 -0.115 -0.071 3.122 0.069   0.818   33.285 -0.254 0.212  3.120 1.428   
-0.121  33.295 2  DD_DG3DT4:DA17DC18_CC   D 3  ? C 18 ? D 4  ? C 17 ? 
1 D DT 4  1_555 C DA 17 1_555 D DC 5  1_555 C DG 16 1_555 -0.238 -0.310 3.416 -2.480  6.225   33.164 -1.577 -0.007 3.314 10.769  
4.290   33.815 3  DD_DT4DC5:DG16DA17_CC   D 4  ? C 17 ? D 5  ? C 16 ? 
1 D DC 5  1_555 C DG 16 1_555 D DG 6  1_555 C DC 15 1_555 0.202  0.019  2.715 -2.221  8.829   34.055 -1.058 -0.608 2.621 14.750  
3.711   35.216 4  DD_DC5DG6:DC15DG16_CC   D 5  ? C 16 ? D 6  ? C 15 ? 
1 D DG 6  1_555 C DC 15 1_555 D DA 7  1_555 C DT 14 1_555 0.351  -0.700 3.657 5.667   13.407  23.250 -5.064 0.773  2.847 29.812  
-12.600 27.378 5  DD_DG6DA7:DT14DC15_CC   D 6  ? C 15 ? D 7  ? C 14 ? 
1 D DA 7  1_555 C DT 14 1_555 D DC 8  1_555 C DG 13 1_555 0.891  -0.806 3.610 -6.483  -11.075 38.095 0.238  -2.127 3.510 -16.408 
9.606   40.123 6  DD_DA7DC8:DG13DT14_CC   D 7  ? C 14 ? D 8  ? C 13 ? 
1 D DC 8  1_555 C DG 13 1_555 D DT 9  1_555 C DA 12 1_555 -0.257 -1.078 3.235 5.300   12.526  33.674 -3.367 1.104  2.614 20.609  
-8.720  36.244 7  DD_DC8DT9:DA12DG13_CC   D 8  ? C 13 ? D 9  ? C 12 ? 
1 D DT 9  1_555 C DA 12 1_555 D DA 10 1_555 C DT 11 1_555 0.106  -0.040 3.911 4.891   -4.416  48.486 0.353  0.316  3.893 -5.349  
-5.923  48.905 8  DD_DT9DA10:DT11DA12_CC  D 9  ? C 12 ? D 10 ? C 11 ? 
1 D DA 10 1_555 C DT 11 1_555 D DT 11 1_555 C DA 10 1_555 0.004  -0.279 3.199 -7.672  4.490   27.433 -1.536 -1.676 3.006 9.167   
15.664  28.811 9  DD_DA10DT11:DA10DT11_CC D 10 ? C 11 ? D 11 ? C 10 ? 
1 D DT 11 1_555 C DA 10 1_555 D DA 12 1_555 C DT 9  1_555 -1.148 1.124  3.505 -1.160  -11.459 44.490 2.470  1.368  3.165 -14.842 
1.502   45.883 10 DD_DT11DA12:DT9DA10_CC  D 11 ? C 10 ? D 12 ? C 9  ? 
1 D DA 12 1_555 C DT 9  1_555 D DG 13 1_555 C DC 8  1_555 0.006  0.193  3.113 -7.582  1.034   33.342 0.172  -1.152 3.043 1.773   
13.003  34.185 11 DD_DA12DG13:DC8DT9_CC   D 12 ? C 9  ? D 13 ? C 8  ? 
1 D DG 13 1_555 C DC 8  1_555 D DT 14 1_555 C DA 7  1_555 -0.413 -0.921 3.176 6.025   -0.636  36.957 -1.354 1.406  3.088 -0.995  
-9.427  37.433 12 DD_DG13DT14:DA7DC8_CC   D 13 ? C 8  ? D 14 ? C 7  ? 
1 D DT 14 1_555 C DA 7  1_555 D DC 15 1_555 C DG 6  1_555 0.798  0.189  3.316 5.788   13.477  29.087 -2.148 -0.359 3.191 24.934  
-10.708 32.505 13 DD_DT14DC15:DG6DA7_CC   D 14 ? C 7  ? D 15 ? C 6  ? 
1 D DC 15 1_555 C DG 6  1_555 D DT 16 1_555 C DA 5  1_555 -0.398 0.299  3.368 -7.185  13.700  28.140 -2.102 -0.665 3.180 25.853  
13.558  32.037 14 DD_DC15DT16:DA5DG6_CC   D 15 ? C 6  ? D 16 ? C 5  ? 
1 D DT 16 1_555 C DA 5  1_555 D DA 17 1_555 C DT 4  1_555 0.498  -0.301 3.514 0.583   9.431   32.044 -2.190 -0.764 3.304 16.637  
-1.028  33.373 15 DD_DT16DA17:DT4DA5_CC   D 16 ? C 5  ? D 17 ? C 4  ? 
1 D DA 17 1_555 C DT 4  1_555 D DC 18 1_555 C DG 3  1_555 -0.065 -0.464 2.717 2.708   1.447   27.964 -1.234 0.659  2.672 2.984   
-5.582  28.128 16 DD_DA17DC18:DG3DT4_CC   D 17 ? C 4  ? D 18 ? C 3  ? 
1 D DC 18 1_555 C DG 3  1_555 D DA 19 1_555 C DT 2  1_555 0.052  -0.075 3.803 3.282   6.968   36.013 -1.219 0.437  3.715 11.114  
-5.235  36.800 17 DD_DC18DA19:DT2DG3_CC   D 18 ? C 3  ? D 19 ? C 2  ? 
1 D DA 19 1_555 C DT 2  1_555 H DT 1  1_555 C DA 1  1_555 -0.338 -0.768 3.834 -11.479 -11.757 50.823 0.051  -0.509 3.898 -13.307 
12.992  53.245 18 DH_DA19DT1:DA1DT2_CC    D 19 ? C 2  ? H 1  ? C 1  ? 
1 H DT 1  1_555 C DA 1  1_555 H DT 2  1_555 G DA 19 1_555 -0.518 -0.103 3.402 7.103   -1.807  49.649 0.013  1.138  3.305 -2.139  
-8.406  50.153 19 HH_DT1DT2:DA19DA1_GC    H 1  ? C 1  ? H 2  ? G 19 ? 
1 H DT 2  1_555 G DA 19 1_555 H DG 3  1_555 G DC 18 1_555 0.291  0.051  3.366 -2.677  0.202   37.850 0.053  -0.799 3.339 0.311   
4.121   37.941 20 HH_DT2DG3:DC18DA19_GG   H 2  ? G 19 ? H 3  ? G 18 ? 
1 H DG 3  1_555 G DC 18 1_555 H DT 4  1_555 G DA 17 1_555 -0.175 -0.402 3.044 4.728   0.709   28.388 -0.956 1.332  2.966 1.433   
-9.556  28.780 21 HH_DG3DT4:DA17DC18_GG   H 3  ? G 18 ? H 4  ? G 17 ? 
1 H DT 4  1_555 G DA 17 1_555 H DC 5  1_555 G DG 16 1_555 0.315  0.101  3.463 -1.941  13.127  32.753 -1.908 -0.827 3.242 22.178  
3.280   35.271 22 HH_DT4DC5:DG16DA17_GG   H 4  ? G 17 ? H 5  ? G 16 ? 
1 H DC 5  1_555 G DG 16 1_555 H DG 6  1_555 G DC 15 1_555 0.025  0.654  3.263 0.402   19.433  30.661 -1.858 0.019  3.122 32.928  
-0.681  36.177 23 HH_DC5DG6:DC15DG16_GG   H 5  ? G 16 ? H 6  ? G 15 ? 
1 H DG 6  1_555 G DC 15 1_555 H DA 7  1_555 G DT 14 1_555 -0.679 -0.116 3.002 -6.654  1.323   31.980 -0.422 0.126  3.070 2.368   
11.910  32.673 24 HH_DG6DA7:DT14DC15_GG   H 6  ? G 15 ? H 7  ? G 14 ? 
1 H DA 7  1_555 G DT 14 1_555 H DC 8  1_555 G DG 13 1_555 1.278  -0.756 3.278 3.281   2.507   37.045 -1.519 -1.561 3.318 3.931   
-5.144  37.267 25 HH_DA7DC8:DG13DT14_GG   H 7  ? G 14 ? H 8  ? G 13 ? 
1 H DC 8  1_555 G DG 13 1_555 H DT 9  1_555 G DA 12 1_555 -1.053 -0.107 3.196 3.923   5.517   35.001 -0.943 2.267  3.013 9.068   
-6.449  35.629 26 HH_DC8DT9:DA12DG13_GG   H 8  ? G 13 ? H 9  ? G 12 ? 
1 H DT 9  1_555 G DA 12 1_555 H DA 10 1_555 G DT 11 1_555 1.192  0.405  3.641 3.389   -13.454 37.090 2.359  -1.320 3.391 -20.300 
-5.114  39.514 27 HH_DT9DA10:DT11DA12_GG  H 9  ? G 12 ? H 10 ? G 11 ? 
1 H DA 10 1_555 G DT 11 1_555 H DT 11 1_555 G DA 10 1_555 0.830  -0.543 3.246 6.741   2.664   28.364 -1.661 -0.162 3.288 5.327   
-13.480 29.257 28 HH_DA10DT11:DA10DT11_GG H 10 ? G 11 ? H 11 ? G 10 ? 
1 H DT 11 1_555 G DA 10 1_555 H DA 12 1_555 G DT 9  1_555 -0.701 0.491  3.889 -3.006  -1.894  43.269 0.883  0.600  3.903 -2.563  
4.069   43.407 29 HH_DT11DA12:DT9DA10_GG  H 11 ? G 10 ? H 12 ? G 9  ? 
1 H DA 12 1_555 G DT 9  1_555 H DG 13 1_555 G DC 8  1_555 0.318  -0.757 3.387 -0.049  3.306   35.391 -1.735 -0.529 3.305 5.424   
0.080   35.540 30 HH_DA12DG13:DC8DT9_GG   H 12 ? G 9  ? H 13 ? G 8  ? 
1 H DG 13 1_555 G DC 8  1_555 H DT 14 1_555 G DA 7  1_555 0.254  -1.248 3.351 -1.210  3.855   32.460 -2.883 -0.661 3.175 6.862   
2.154   32.704 31 HH_DG13DT14:DA7DC8_GG   H 13 ? G 8  ? H 14 ? G 7  ? 
1 H DT 14 1_555 G DA 7  1_555 H DC 15 1_555 G DG 6  1_555 -0.344 -0.158 3.098 2.184   6.427   35.449 -1.111 0.847  2.999 10.437  
-3.546  36.072 32 HH_DT14DC15:DG6DA7_GG   H 14 ? G 7  ? H 15 ? G 6  ? 
1 H DC 15 1_555 G DG 6  1_555 H DT 16 1_555 G DA 5  1_555 -0.265 0.096  3.071 -5.635  16.948  23.166 -3.368 -0.658 2.554 36.103  
12.005  29.177 33 HH_DC15DT16:DA5DG6_GG   H 15 ? G 6  ? H 16 ? G 5  ? 
1 H DT 16 1_555 G DA 5  1_555 H DA 17 1_555 G DT 4  1_555 -0.876 -0.400 3.691 2.379   -0.235  38.125 -0.578 1.674  3.635 -0.360  
-3.638  38.197 34 HH_DT16DA17:DT4DA5_GG   H 16 ? G 5  ? H 17 ? G 4  ? 
1 H DA 17 1_555 G DT 4  1_555 H DC 18 1_555 G DG 3  1_555 0.857  -0.416 2.888 -2.334  -0.324  35.409 -0.641 -1.705 2.831 -0.531  
3.832   35.485 35 HH_DA17DC18:DG3DT4_GG   H 17 ? G 4  ? H 18 ? G 3  ? 
1 H DC 18 1_555 G DG 3  1_555 H DA 19 1_555 G DT 2  1_555 -0.129 -0.107 3.237 0.081   3.569   33.500 -0.758 0.235  3.208 6.170   
-0.140  33.684 36 HH_DC18DA19:DT2DG3_GG   H 18 ? G 3  ? H 19 ? G 2  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 4 HOH 1 101 2 HOH HOH A . 
J 4 HOH 1 101 1 HOH HOH D . 
#