data_4IXD
# 
_entry.id   4IXD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IXD         
RCSB  RCSB077328   
WWPDB D_1000077328 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1XDG 
_pdbx_database_related.details        'X-RAY STRUCTURE OF LFA-1 I-DOMAIN IN COMPLEX WITH LFA878 AT 2.1A RESOLUTION' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4IXD 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Kallen, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Identification and x-ray structure based investigation of an ICAM-1 binding enhancing small molecule activator of LFA-1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hintersteiner, M.' 1 
primary 'Kallen, J.'        2 
primary 'Schmied, M.'       3 
primary 'Jung, T.'          4 
primary 'Graf, C.'          5 
primary 'Mudd, G.'          6 
primary 'Gstach, H.'        7 
primary 'Auer, M.'          8 
# 
_cell.entry_id           4IXD 
_cell.length_a           45.300 
_cell.length_b           65.900 
_cell.length_c           133.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IXD 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-L'                                                             21425.561 1   ? ? 
'I-DOMAIN, UNP residues 152-336' ? 
2 non-polymer syn 'MAGNESIUM ION'                                                                24.305    1   ? ? ? ? 
3 non-polymer syn '4-(3-{4-[(3-aminopropyl)carbamoyl]phenyl}-1H-indazol-1-yl)-N-methylbenzamide' 427.498   1   ? ? ? ? 
4 water       nat water                                                                          18.015    299 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CD11 antigen-like family member A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, Leukocyte function-associated molecule 1 alpha chain
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHML
LLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPAS
EFVKILDTFEKLKDLFTELQKKIYVIEG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHML
LLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPAS
EFVKILDTFEKLKDLFTELQKKIYVIEG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   GLY n 
1 6   ASN n 
1 7   VAL n 
1 8   ASP n 
1 9   LEU n 
1 10  VAL n 
1 11  PHE n 
1 12  LEU n 
1 13  PHE n 
1 14  ASP n 
1 15  GLY n 
1 16  SER n 
1 17  MET n 
1 18  SER n 
1 19  LEU n 
1 20  GLN n 
1 21  PRO n 
1 22  ASP n 
1 23  GLU n 
1 24  PHE n 
1 25  GLN n 
1 26  LYS n 
1 27  ILE n 
1 28  LEU n 
1 29  ASP n 
1 30  PHE n 
1 31  MET n 
1 32  LYS n 
1 33  ASP n 
1 34  VAL n 
1 35  MET n 
1 36  LYS n 
1 37  LYS n 
1 38  LEU n 
1 39  SER n 
1 40  ASN n 
1 41  THR n 
1 42  SER n 
1 43  TYR n 
1 44  GLN n 
1 45  PHE n 
1 46  ALA n 
1 47  ALA n 
1 48  VAL n 
1 49  GLN n 
1 50  PHE n 
1 51  SER n 
1 52  THR n 
1 53  SER n 
1 54  TYR n 
1 55  LYS n 
1 56  THR n 
1 57  GLU n 
1 58  PHE n 
1 59  ASP n 
1 60  PHE n 
1 61  SER n 
1 62  ASP n 
1 63  TYR n 
1 64  VAL n 
1 65  LYS n 
1 66  TRP n 
1 67  LYS n 
1 68  ASP n 
1 69  PRO n 
1 70  ASP n 
1 71  ALA n 
1 72  LEU n 
1 73  LEU n 
1 74  LYS n 
1 75  HIS n 
1 76  VAL n 
1 77  LYS n 
1 78  HIS n 
1 79  MET n 
1 80  LEU n 
1 81  LEU n 
1 82  LEU n 
1 83  THR n 
1 84  ASN n 
1 85  THR n 
1 86  PHE n 
1 87  GLY n 
1 88  ALA n 
1 89  ILE n 
1 90  ASN n 
1 91  TYR n 
1 92  VAL n 
1 93  ALA n 
1 94  THR n 
1 95  GLU n 
1 96  VAL n 
1 97  PHE n 
1 98  ARG n 
1 99  GLU n 
1 100 GLU n 
1 101 LEU n 
1 102 GLY n 
1 103 ALA n 
1 104 ARG n 
1 105 PRO n 
1 106 ASP n 
1 107 ALA n 
1 108 THR n 
1 109 LYS n 
1 110 VAL n 
1 111 LEU n 
1 112 ILE n 
1 113 ILE n 
1 114 ILE n 
1 115 THR n 
1 116 ASP n 
1 117 GLY n 
1 118 GLU n 
1 119 ALA n 
1 120 THR n 
1 121 ASP n 
1 122 SER n 
1 123 GLY n 
1 124 ASN n 
1 125 ILE n 
1 126 ASP n 
1 127 ALA n 
1 128 ALA n 
1 129 LYS n 
1 130 ASP n 
1 131 ILE n 
1 132 ILE n 
1 133 ARG n 
1 134 TYR n 
1 135 ILE n 
1 136 ILE n 
1 137 GLY n 
1 138 ILE n 
1 139 GLY n 
1 140 LYS n 
1 141 HIS n 
1 142 PHE n 
1 143 GLN n 
1 144 THR n 
1 145 LYS n 
1 146 GLU n 
1 147 SER n 
1 148 GLN n 
1 149 GLU n 
1 150 THR n 
1 151 LEU n 
1 152 HIS n 
1 153 LYS n 
1 154 PHE n 
1 155 ALA n 
1 156 SER n 
1 157 LYS n 
1 158 PRO n 
1 159 ALA n 
1 160 SER n 
1 161 GLU n 
1 162 PHE n 
1 163 VAL n 
1 164 LYS n 
1 165 ILE n 
1 166 LEU n 
1 167 ASP n 
1 168 THR n 
1 169 PHE n 
1 170 GLU n 
1 171 LYS n 
1 172 LEU n 
1 173 LYS n 
1 174 ASP n 
1 175 LEU n 
1 176 PHE n 
1 177 THR n 
1 178 GLU n 
1 179 LEU n 
1 180 GLN n 
1 181 LYS n 
1 182 LYS n 
1 183 ILE n 
1 184 TYR n 
1 185 VAL n 
1 186 ILE n 
1 187 GLU n 
1 188 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ITGAL, CD11A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET17B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITAL_HUMAN 
_struct_ref.pdbx_db_accession          P20701 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLT
NTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFV
KILDTFEKLKDLFTELQKKIYVIEG
;
_struct_ref.pdbx_align_begin           152 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4IXD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 188 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P20701 
_struct_ref_seq.db_align_beg                  152 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  336 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       127 
_struct_ref_seq.pdbx_auth_seq_align_end       311 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4IXD MET A 1  ? UNP P20701 ?   ?   'EXPRESSION TAG' 124 1 
1 4IXD ALA A 2  ? UNP P20701 ?   ?   'EXPRESSION TAG' 125 2 
1 4IXD SER A 3  ? UNP P20701 ?   ?   'EXPRESSION TAG' 126 3 
1 4IXD TRP A 66 ? UNP P20701 ARG 214 'SEE REMARK 999' 189 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1HV non-polymer         . '4-(3-{4-[(3-aminopropyl)carbamoyl]phenyl}-1H-indazol-1-yl)-N-methylbenzamide' ? 'C25 H25 N5 O2'  
427.498 
ALA 'L-peptide linking' y ALANINE                                                                        ? 'C3 H7 N O2'     89.093 
ARG 'L-peptide linking' y ARGININE                                                                       ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                     ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                ? 'C4 H7 N O4'     
133.103 
GLN 'L-peptide linking' y GLUTAMINE                                                                      ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                                        ? 'C2 H5 N O2'     75.067 
HIS 'L-peptide linking' y HISTIDINE                                                                      ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                          ? 'H2 O'           18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                                     ? 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                        ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                                         ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                     ? 'C5 H11 N O2 S'  
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                ? 'Mg 2'           24.305 
PHE 'L-peptide linking' y PHENYLALANINE                                                                  ? 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                                        ? 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                                                         ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                                      ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                     ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                       ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                                         ? 'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          4IXD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'0.085M sodium acetate, pH4.6, 0.17M ammonium acetate, 15% glycerol and 25.5% (w/v) PEG4000 , VAPOR DIFFUSION, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2000-09-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.873 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM1A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM1A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.873 
# 
_reflns.entry_id                     4IXD 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             8.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   18688 
_reflns.number_all                   18740 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.134 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.6 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4IXD 
_refine.ls_number_reflns_obs                     17608 
_refine.ls_number_reflns_all                     17770 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.97 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    99.09 
_refine.ls_R_factor_obs                          0.17295 
_refine.ls_R_factor_all                          0.17295 
_refine.ls_R_factor_R_work                       0.17155 
_refine.ls_R_factor_R_free                       0.19934 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  961 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               15.010 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.03 
_refine.aniso_B[3][3]                            -0.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1XDG 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.132 
_refine.pdbx_overall_ESU_R_Free                  0.118 
_refine.overall_SU_ML                            0.064 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.996 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1468 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             299 
_refine_hist.number_atoms_total               1800 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        7.97 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.007  0.022  ? 1552 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    0.973  1.988  ? 2097 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.564  5.000  ? 187  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 31.690 25.362 ? 69   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 11.554 15.000 ? 287  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 17.097 15.000 ? 3    ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.070  0.200  ? 233  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.004  0.020  ? 1155 ? 'X-RAY DIFFRACTION' 
r_mcbond_it            0.341  1.500  ? 915  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           0.684  ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scbond_it            1.211  ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_scangle_it           2.097  ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.844 
_refine_ls_shell.number_reflns_R_work             1231 
_refine_ls_shell.R_factor_R_work                  0.175 
_refine_ls_shell.percent_reflns_obs               99.46 
_refine_ls_shell.R_factor_R_free                  0.199 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IXD 
_struct.title                     'X-ray structure of lfa-1 i-domain in complex with ibe-667 at 1.8a resolution' 
_struct.pdbx_descriptor           'Integrin alpha-L' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IXD 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'ROSSMAN-FOLD, I-DOMAIN, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 20  ? LEU A 38  ? GLN A 143 LEU A 161 1 ? 19 
HELX_P HELX_P2  2  ASP A 59  ? LYS A 67  ? ASP A 182 LYS A 190 1 ? 9  
HELX_P HELX_P3  3  ASP A 68  ? LEU A 73  ? ASP A 191 LEU A 196 1 ? 6  
HELX_P HELX_P4  4  ASN A 84  ? VAL A 96  ? ASN A 207 VAL A 219 1 ? 13 
HELX_P HELX_P5  5  ARG A 98  ? GLY A 102 ? ARG A 221 GLY A 225 5 ? 5  
HELX_P HELX_P6  6  ILE A 125 ? LYS A 129 ? ILE A 248 LYS A 252 5 ? 5  
HELX_P HELX_P7  7  LYS A 140 ? GLN A 143 ? LYS A 263 GLN A 266 5 ? 4  
HELX_P HELX_P8  8  THR A 144 ? THR A 150 ? THR A 267 THR A 273 1 ? 7  
HELX_P HELX_P9  9  LEU A 151 ? ALA A 155 ? LEU A 274 ALA A 278 5 ? 5  
HELX_P HELX_P10 10 PRO A 158 ? PHE A 162 ? PRO A 281 PHE A 285 1 ? 5  
HELX_P HELX_P11 11 GLU A 170 ? LYS A 181 ? GLU A 293 LYS A 304 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG  .   MG  ? ? ? 1_555 D HOH . O  ? ? A MG  401 A HOH 509 1_555 ? ? ? ? ? ? ? 2.023 ? 
metalc2 metalc ? ? A ASP 116 OD1 ? ? ? 1_555 B MG  . MG ? ? A ASP 239 A MG  401 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc3 metalc ? ? A SER 18  OG  ? ? ? 1_555 B MG  . MG ? ? A SER 141 A MG  401 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc4 metalc ? ? B MG  .   MG  ? ? ? 1_555 D HOH . O  ? ? A MG  401 A HOH 507 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc5 metalc ? ? B MG  .   MG  ? ? ? 1_555 D HOH . O  ? ? A MG  401 A HOH 504 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc6 metalc ? ? A SER 16  OG  ? ? ? 1_555 B MG  . MG ? ? A SER 139 A MG  401 1_555 ? ? ? ? ? ? ? 2.157 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           157 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            280 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    158 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     281 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.14 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 54  ? PHE A 58  ? TYR A 177 PHE A 181 
A 2 TYR A 43  ? PHE A 50  ? TYR A 166 PHE A 173 
A 3 VAL A 7   ? ASP A 14  ? VAL A 130 ASP A 137 
A 4 THR A 108 ? THR A 115 ? THR A 231 THR A 238 
A 5 ILE A 132 ? ILE A 138 ? ILE A 255 ILE A 261 
A 6 VAL A 163 ? LEU A 166 ? VAL A 286 LEU A 289 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 55  ? O LYS A 178 N GLN A 49  ? N GLN A 172 
A 2 3 O VAL A 48  ? O VAL A 171 N PHE A 11  ? N PHE A 134 
A 3 4 N ASP A 14  ? N ASP A 137 O ILE A 114 ? O ILE A 237 
A 4 5 N LEU A 111 ? N LEU A 234 O ILE A 132 ? O ILE A 255 
A 5 6 N ILE A 135 ? N ILE A 258 O LYS A 164 ? O LYS A 287 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 401'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE 1HV A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 16  ? SER A 139 . ? 1_555 ? 
2  AC1 6 SER A 18  ? SER A 141 . ? 1_555 ? 
3  AC1 6 ASP A 116 ? ASP A 239 . ? 1_555 ? 
4  AC1 6 HOH D .   ? HOH A 504 . ? 1_555 ? 
5  AC1 6 HOH D .   ? HOH A 507 . ? 1_555 ? 
6  AC1 6 HOH D .   ? HOH A 509 . ? 1_555 ? 
7  AC2 6 TYR A 43  ? TYR A 166 . ? 1_555 ? 
8  AC2 6 TYR A 134 ? TYR A 257 . ? 1_555 ? 
9  AC2 6 ILE A 136 ? ILE A 259 . ? 1_555 ? 
10 AC2 6 GLU A 178 ? GLU A 301 . ? 1_555 ? 
11 AC2 6 VAL A 185 ? VAL A 308 . ? 2_675 ? 
12 AC2 6 HOH D .   ? HOH A 519 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4IXD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4IXD 
_atom_sites.fract_transf_matrix[1][1]   0.022075 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015175 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007485 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 5   ? 12.562 60.664 73.716  1.00 16.02 ? 128 GLY A N   1 
ATOM   2    C  CA  . GLY A 1 5   ? 13.959 60.161 73.802  1.00 14.67 ? 128 GLY A CA  1 
ATOM   3    C  C   . GLY A 1 5   ? 14.241 59.456 75.113  1.00 14.10 ? 128 GLY A C   1 
ATOM   4    O  O   . GLY A 1 5   ? 14.967 59.976 75.959  1.00 14.41 ? 128 GLY A O   1 
ATOM   5    N  N   . ASN A 1 6   ? 13.652 58.278 75.294  1.00 13.10 ? 129 ASN A N   1 
ATOM   6    C  CA  . ASN A 1 6   ? 13.879 57.499 76.510  1.00 12.28 ? 129 ASN A CA  1 
ATOM   7    C  C   . ASN A 1 6   ? 15.132 56.650 76.391  1.00 11.29 ? 129 ASN A C   1 
ATOM   8    O  O   . ASN A 1 6   ? 15.422 56.122 75.317  1.00 11.26 ? 129 ASN A O   1 
ATOM   9    C  CB  . ASN A 1 6   ? 12.664 56.620 76.822  1.00 12.40 ? 129 ASN A CB  1 
ATOM   10   C  CG  . ASN A 1 6   ? 11.453 57.435 77.231  1.00 13.43 ? 129 ASN A CG  1 
ATOM   11   O  OD1 . ASN A 1 6   ? 11.587 58.523 77.789  1.00 14.54 ? 129 ASN A OD1 1 
ATOM   12   N  ND2 . ASN A 1 6   ? 10.264 56.911 76.959  1.00 14.09 ? 129 ASN A ND2 1 
ATOM   13   N  N   . VAL A 1 7   ? 15.879 56.539 77.488  1.00 10.00 ? 130 VAL A N   1 
ATOM   14   C  CA  . VAL A 1 7   ? 17.083 55.709 77.516  1.00 8.92  ? 130 VAL A CA  1 
ATOM   15   C  C   . VAL A 1 7   ? 16.956 54.664 78.619  1.00 8.44  ? 130 VAL A C   1 
ATOM   16   O  O   . VAL A 1 7   ? 16.780 55.004 79.792  1.00 8.05  ? 130 VAL A O   1 
ATOM   17   C  CB  . VAL A 1 7   ? 18.379 56.539 77.722  1.00 8.69  ? 130 VAL A CB  1 
ATOM   18   C  CG1 . VAL A 1 7   ? 19.603 55.624 77.749  1.00 8.43  ? 130 VAL A CG1 1 
ATOM   19   C  CG2 . VAL A 1 7   ? 18.534 57.592 76.625  1.00 8.35  ? 130 VAL A CG2 1 
ATOM   20   N  N   . ASP A 1 8   ? 17.014 53.397 78.220  1.00 8.15  ? 131 ASP A N   1 
ATOM   21   C  CA  . ASP A 1 8   ? 17.067 52.279 79.157  1.00 7.86  ? 131 ASP A CA  1 
ATOM   22   C  C   . ASP A 1 8   ? 18.516 51.829 79.248  1.00 7.62  ? 131 ASP A C   1 
ATOM   23   O  O   . ASP A 1 8   ? 19.074 51.322 78.274  1.00 7.66  ? 131 ASP A O   1 
ATOM   24   C  CB  . ASP A 1 8   ? 16.198 51.115 78.668  1.00 8.04  ? 131 ASP A CB  1 
ATOM   25   C  CG  . ASP A 1 8   ? 14.709 51.356 78.867  1.00 7.83  ? 131 ASP A CG  1 
ATOM   26   O  OD1 . ASP A 1 8   ? 14.325 52.333 79.541  1.00 7.79  ? 131 ASP A OD1 1 
ATOM   27   O  OD2 . ASP A 1 8   ? 13.914 50.547 78.348  1.00 9.95  ? 131 ASP A OD2 1 
ATOM   28   N  N   . LEU A 1 9   ? 19.129 52.022 80.412  1.00 7.48  ? 132 LEU A N   1 
ATOM   29   C  CA  . LEU A 1 9   ? 20.551 51.717 80.582  1.00 7.02  ? 132 LEU A CA  1 
ATOM   30   C  C   . LEU A 1 9   ? 20.770 50.602 81.596  1.00 7.00  ? 132 LEU A C   1 
ATOM   31   O  O   . LEU A 1 9   ? 20.241 50.647 82.705  1.00 6.91  ? 132 LEU A O   1 
ATOM   32   C  CB  . LEU A 1 9   ? 21.324 52.981 80.990  1.00 7.09  ? 132 LEU A CB  1 
ATOM   33   C  CG  . LEU A 1 9   ? 22.857 52.939 80.987  1.00 6.61  ? 132 LEU A CG  1 
ATOM   34   C  CD1 . LEU A 1 9   ? 23.414 54.315 80.669  1.00 6.05  ? 132 LEU A CD1 1 
ATOM   35   C  CD2 . LEU A 1 9   ? 23.412 52.428 82.321  1.00 7.05  ? 132 LEU A CD2 1 
ATOM   36   N  N   . VAL A 1 10  ? 21.567 49.609 81.209  1.00 6.84  ? 133 VAL A N   1 
ATOM   37   C  CA  . VAL A 1 10  ? 21.916 48.504 82.098  1.00 6.89  ? 133 VAL A CA  1 
ATOM   38   C  C   . VAL A 1 10  ? 23.398 48.565 82.444  1.00 6.90  ? 133 VAL A C   1 
ATOM   39   O  O   . VAL A 1 10  ? 24.236 48.727 81.556  1.00 6.92  ? 133 VAL A O   1 
ATOM   40   C  CB  . VAL A 1 10  ? 21.593 47.128 81.447  1.00 6.81  ? 133 VAL A CB  1 
ATOM   41   C  CG1 . VAL A 1 10  ? 22.120 45.964 82.302  1.00 7.18  ? 133 VAL A CG1 1 
ATOM   42   C  CG2 . VAL A 1 10  ? 20.093 46.985 81.218  1.00 6.89  ? 133 VAL A CG2 1 
ATOM   43   N  N   . PHE A 1 11  ? 23.711 48.458 83.737  1.00 7.07  ? 134 PHE A N   1 
ATOM   44   C  CA  . PHE A 1 11  ? 25.082 48.245 84.186  1.00 7.19  ? 134 PHE A CA  1 
ATOM   45   C  C   . PHE A 1 11  ? 25.301 46.747 84.299  1.00 7.18  ? 134 PHE A C   1 
ATOM   46   O  O   . PHE A 1 11  ? 24.583 46.075 85.041  1.00 7.15  ? 134 PHE A O   1 
ATOM   47   C  CB  . PHE A 1 11  ? 25.328 48.880 85.560  1.00 7.74  ? 134 PHE A CB  1 
ATOM   48   C  CG  . PHE A 1 11  ? 25.085 50.358 85.608  1.00 8.18  ? 134 PHE A CG  1 
ATOM   49   C  CD1 . PHE A 1 11  ? 26.081 51.255 85.227  1.00 9.32  ? 134 PHE A CD1 1 
ATOM   50   C  CD2 . PHE A 1 11  ? 23.864 50.856 86.052  1.00 8.90  ? 134 PHE A CD2 1 
ATOM   51   C  CE1 . PHE A 1 11  ? 25.855 52.634 85.280  1.00 9.11  ? 134 PHE A CE1 1 
ATOM   52   C  CE2 . PHE A 1 11  ? 23.629 52.229 86.110  1.00 9.15  ? 134 PHE A CE2 1 
ATOM   53   C  CZ  . PHE A 1 11  ? 24.631 53.119 85.719  1.00 9.31  ? 134 PHE A CZ  1 
ATOM   54   N  N   . LEU A 1 12  ? 26.283 46.230 83.567  1.00 7.01  ? 135 LEU A N   1 
ATOM   55   C  CA  . LEU A 1 12  ? 26.666 44.818 83.664  1.00 7.11  ? 135 LEU A CA  1 
ATOM   56   C  C   . LEU A 1 12  ? 28.040 44.735 84.314  1.00 7.15  ? 135 LEU A C   1 
ATOM   57   O  O   . LEU A 1 12  ? 29.051 45.078 83.689  1.00 7.21  ? 135 LEU A O   1 
ATOM   58   C  CB  . LEU A 1 12  ? 26.670 44.151 82.276  1.00 7.07  ? 135 LEU A CB  1 
ATOM   59   C  CG  . LEU A 1 12  ? 27.078 42.672 82.170  1.00 7.12  ? 135 LEU A CG  1 
ATOM   60   C  CD1 . LEU A 1 12  ? 26.151 41.759 82.978  1.00 8.43  ? 135 LEU A CD1 1 
ATOM   61   C  CD2 . LEU A 1 12  ? 27.138 42.222 80.710  1.00 7.42  ? 135 LEU A CD2 1 
ATOM   62   N  N   . PHE A 1 13  ? 28.076 44.285 85.568  1.00 7.64  ? 136 PHE A N   1 
ATOM   63   C  CA  . PHE A 1 13  ? 29.295 44.397 86.367  1.00 7.93  ? 136 PHE A CA  1 
ATOM   64   C  C   . PHE A 1 13  ? 29.891 43.084 86.841  1.00 8.24  ? 136 PHE A C   1 
ATOM   65   O  O   . PHE A 1 13  ? 29.195 42.208 87.347  1.00 8.70  ? 136 PHE A O   1 
ATOM   66   C  CB  . PHE A 1 13  ? 29.136 45.399 87.530  1.00 7.55  ? 136 PHE A CB  1 
ATOM   67   C  CG  . PHE A 1 13  ? 28.172 44.968 88.614  1.00 7.20  ? 136 PHE A CG  1 
ATOM   68   C  CD1 . PHE A 1 13  ? 26.797 45.117 88.449  1.00 7.21  ? 136 PHE A CD1 1 
ATOM   69   C  CD2 . PHE A 1 13  ? 28.648 44.461 89.822  1.00 7.27  ? 136 PHE A CD2 1 
ATOM   70   C  CE1 . PHE A 1 13  ? 25.901 44.738 89.463  1.00 6.60  ? 136 PHE A CE1 1 
ATOM   71   C  CE2 . PHE A 1 13  ? 27.765 44.083 90.841  1.00 7.04  ? 136 PHE A CE2 1 
ATOM   72   C  CZ  . PHE A 1 13  ? 26.395 44.218 90.661  1.00 7.22  ? 136 PHE A CZ  1 
ATOM   73   N  N   . ASP A 1 14  ? 31.205 42.999 86.657  1.00 8.75  ? 137 ASP A N   1 
ATOM   74   C  CA  . ASP A 1 14  ? 32.056 41.872 87.011  1.00 9.17  ? 137 ASP A CA  1 
ATOM   75   C  C   . ASP A 1 14  ? 32.006 41.608 88.518  1.00 9.53  ? 137 ASP A C   1 
ATOM   76   O  O   . ASP A 1 14  ? 32.227 42.515 89.320  1.00 9.74  ? 137 ASP A O   1 
ATOM   77   C  CB  . ASP A 1 14  ? 33.479 42.255 86.573  1.00 9.01  ? 137 ASP A CB  1 
ATOM   78   C  CG  . ASP A 1 14  ? 34.463 41.105 86.598  1.00 9.07  ? 137 ASP A CG  1 
ATOM   79   O  OD1 . ASP A 1 14  ? 34.464 40.308 87.557  1.00 9.84  ? 137 ASP A OD1 1 
ATOM   80   O  OD2 . ASP A 1 14  ? 35.286 41.039 85.662  1.00 8.57  ? 137 ASP A OD2 1 
ATOM   81   N  N   . GLY A 1 15  ? 31.701 40.368 88.894  1.00 9.79  ? 138 GLY A N   1 
ATOM   82   C  CA  . GLY A 1 15  ? 31.784 39.937 90.292  1.00 10.23 ? 138 GLY A CA  1 
ATOM   83   C  C   . GLY A 1 15  ? 32.746 38.777 90.487  1.00 10.71 ? 138 GLY A C   1 
ATOM   84   O  O   . GLY A 1 15  ? 32.535 37.924 91.357  1.00 10.92 ? 138 GLY A O   1 
ATOM   85   N  N   . SER A 1 16  ? 33.813 38.751 89.690  1.00 10.87 ? 139 SER A N   1 
ATOM   86   C  CA  . SER A 1 16  ? 34.775 37.641 89.701  1.00 11.21 ? 139 SER A CA  1 
ATOM   87   C  C   . SER A 1 16  ? 35.643 37.579 90.965  1.00 11.69 ? 139 SER A C   1 
ATOM   88   O  O   . SER A 1 16  ? 35.714 38.541 91.734  1.00 11.17 ? 139 SER A O   1 
ATOM   89   C  CB  . SER A 1 16  ? 35.667 37.677 88.459  1.00 11.17 ? 139 SER A CB  1 
ATOM   90   O  OG  . SER A 1 16  ? 36.505 38.827 88.457  1.00 10.69 ? 139 SER A OG  1 
ATOM   91   N  N   . MET A 1 17  ? 36.300 36.430 91.134  1.00 12.08 ? 140 MET A N   1 
ATOM   92   C  CA  A MET A 1 17  ? 37.117 36.144 92.313  0.50 12.66 ? 140 MET A CA  1 
ATOM   93   C  CA  B MET A 1 17  ? 37.143 36.117 92.297  0.50 12.70 ? 140 MET A CA  1 
ATOM   94   C  C   . MET A 1 17  ? 38.319 37.081 92.466  1.00 12.67 ? 140 MET A C   1 
ATOM   95   O  O   . MET A 1 17  ? 38.795 37.312 93.587  1.00 12.74 ? 140 MET A O   1 
ATOM   96   C  CB  A MET A 1 17  ? 37.577 34.686 92.270  0.50 12.81 ? 140 MET A CB  1 
ATOM   97   C  CB  B MET A 1 17  ? 37.653 34.672 92.181  0.50 12.86 ? 140 MET A CB  1 
ATOM   98   C  CG  A MET A 1 17  ? 38.075 34.132 93.591  0.50 14.30 ? 140 MET A CG  1 
ATOM   99   C  CG  B MET A 1 17  ? 38.577 34.200 93.305  0.50 14.57 ? 140 MET A CG  1 
ATOM   100  S  SD  A MET A 1 17  ? 38.451 32.383 93.424  0.50 17.62 ? 140 MET A SD  1 
ATOM   101  S  SD  B MET A 1 17  ? 37.754 34.086 94.903  0.50 17.88 ? 140 MET A SD  1 
ATOM   102  C  CE  A MET A 1 17  ? 39.110 32.355 91.760  0.50 16.66 ? 140 MET A CE  1 
ATOM   103  C  CE  B MET A 1 17  ? 39.076 33.444 95.928  0.50 17.35 ? 140 MET A CE  1 
ATOM   104  N  N   . SER A 1 18  ? 38.798 37.627 91.351  1.00 12.61 ? 141 SER A N   1 
ATOM   105  C  CA  . SER A 1 18  ? 39.949 38.536 91.361  1.00 12.62 ? 141 SER A CA  1 
ATOM   106  C  C   . SER A 1 18  ? 39.696 39.827 92.135  1.00 12.69 ? 141 SER A C   1 
ATOM   107  O  O   . SER A 1 18  ? 40.629 40.427 92.673  1.00 12.51 ? 141 SER A O   1 
ATOM   108  C  CB  . SER A 1 18  ? 40.358 38.886 89.935  1.00 12.59 ? 141 SER A CB  1 
ATOM   109  O  OG  . SER A 1 18  ? 39.270 39.489 89.249  1.00 12.47 ? 141 SER A OG  1 
ATOM   110  N  N   . LEU A 1 19  ? 38.438 40.258 92.182  1.00 12.70 ? 142 LEU A N   1 
ATOM   111  C  CA  . LEU A 1 19  ? 38.092 41.544 92.789  1.00 13.13 ? 142 LEU A CA  1 
ATOM   112  C  C   . LEU A 1 19  ? 38.171 41.549 94.315  1.00 13.44 ? 142 LEU A C   1 
ATOM   113  O  O   . LEU A 1 19  ? 37.534 40.739 94.991  1.00 13.73 ? 142 LEU A O   1 
ATOM   114  C  CB  . LEU A 1 19  ? 36.703 42.004 92.335  1.00 12.87 ? 142 LEU A CB  1 
ATOM   115  C  CG  . LEU A 1 19  ? 36.565 42.406 90.865  1.00 12.69 ? 142 LEU A CG  1 
ATOM   116  C  CD1 . LEU A 1 19  ? 35.122 42.297 90.420  1.00 11.75 ? 142 LEU A CD1 1 
ATOM   117  C  CD2 . LEU A 1 19  ? 37.091 43.813 90.640  1.00 12.29 ? 142 LEU A CD2 1 
ATOM   118  N  N   . GLN A 1 20  ? 38.956 42.476 94.846  1.00 14.01 ? 143 GLN A N   1 
ATOM   119  C  CA  . GLN A 1 20  ? 39.004 42.710 96.285  1.00 14.51 ? 143 GLN A CA  1 
ATOM   120  C  C   . GLN A 1 20  ? 37.743 43.459 96.717  1.00 14.64 ? 143 GLN A C   1 
ATOM   121  O  O   . GLN A 1 20  ? 37.115 44.117 95.887  1.00 14.31 ? 143 GLN A O   1 
ATOM   122  C  CB  . GLN A 1 20  ? 40.273 43.484 96.651  1.00 14.76 ? 143 GLN A CB  1 
ATOM   123  C  CG  . GLN A 1 20  ? 41.552 42.730 96.314  1.00 15.97 ? 143 GLN A CG  1 
ATOM   124  C  CD  . GLN A 1 20  ? 41.523 41.301 96.822  1.00 17.70 ? 143 GLN A CD  1 
ATOM   125  O  OE1 . GLN A 1 20  ? 41.477 41.064 98.028  1.00 18.15 ? 143 GLN A OE1 1 
ATOM   126  N  NE2 . GLN A 1 20  ? 41.524 40.340 95.899  1.00 18.17 ? 143 GLN A NE2 1 
ATOM   127  N  N   . PRO A 1 21  ? 37.347 43.334 98.003  1.00 14.80 ? 144 PRO A N   1 
ATOM   128  C  CA  . PRO A 1 21  ? 36.143 43.993 98.522  1.00 15.00 ? 144 PRO A CA  1 
ATOM   129  C  C   . PRO A 1 21  ? 36.042 45.483 98.187  1.00 15.19 ? 144 PRO A C   1 
ATOM   130  O  O   . PRO A 1 21  ? 34.967 45.951 97.793  1.00 15.23 ? 144 PRO A O   1 
ATOM   131  C  CB  . PRO A 1 21  ? 36.270 43.794 100.034 1.00 15.07 ? 144 PRO A CB  1 
ATOM   132  C  CG  . PRO A 1 21  ? 36.950 42.480 100.154 1.00 15.22 ? 144 PRO A CG  1 
ATOM   133  C  CD  . PRO A 1 21  ? 37.922 42.406 99.000  1.00 15.05 ? 144 PRO A CD  1 
ATOM   134  N  N   . ASP A 1 22  ? 37.146 46.215 98.335  1.00 15.07 ? 145 ASP A N   1 
ATOM   135  C  CA  . ASP A 1 22  ? 37.155 47.646 98.031  1.00 15.08 ? 145 ASP A CA  1 
ATOM   136  C  C   . ASP A 1 22  ? 37.058 47.940 96.528  1.00 14.46 ? 145 ASP A C   1 
ATOM   137  O  O   . ASP A 1 22  ? 36.473 48.947 96.128  1.00 14.58 ? 145 ASP A O   1 
ATOM   138  C  CB  . ASP A 1 22  ? 38.363 48.352 98.662  1.00 15.47 ? 145 ASP A CB  1 
ATOM   139  C  CG  . ASP A 1 22  ? 39.694 47.723 98.281  1.00 17.26 ? 145 ASP A CG  1 
ATOM   140  O  OD1 . ASP A 1 22  ? 39.760 46.501 98.022  1.00 18.94 ? 145 ASP A OD1 1 
ATOM   141  O  OD2 . ASP A 1 22  ? 40.697 48.461 98.269  1.00 20.42 ? 145 ASP A OD2 1 
ATOM   142  N  N   . GLU A 1 23  ? 37.624 47.055 95.708  1.00 13.71 ? 146 GLU A N   1 
ATOM   143  C  CA  . GLU A 1 23  ? 37.551 47.187 94.248  1.00 12.98 ? 146 GLU A CA  1 
ATOM   144  C  C   . GLU A 1 23  ? 36.124 46.951 93.748  1.00 12.48 ? 146 GLU A C   1 
ATOM   145  O  O   . GLU A 1 23  ? 35.623 47.701 92.906  1.00 12.26 ? 146 GLU A O   1 
ATOM   146  C  CB  . GLU A 1 23  ? 38.533 46.227 93.569  1.00 12.91 ? 146 GLU A CB  1 
ATOM   147  C  CG  . GLU A 1 23  ? 39.983 46.478 93.962  1.00 12.85 ? 146 GLU A CG  1 
ATOM   148  C  CD  . GLU A 1 23  ? 40.944 45.412 93.468  1.00 13.27 ? 146 GLU A CD  1 
ATOM   149  O  OE1 . GLU A 1 23  ? 40.503 44.289 93.126  1.00 12.21 ? 146 GLU A OE1 1 
ATOM   150  O  OE2 . GLU A 1 23  ? 42.156 45.705 93.426  1.00 13.48 ? 146 GLU A OE2 1 
ATOM   151  N  N   . PHE A 1 24  ? 35.484 45.908 94.278  1.00 11.82 ? 147 PHE A N   1 
ATOM   152  C  CA  . PHE A 1 24  ? 34.072 45.629 94.015  1.00 11.38 ? 147 PHE A CA  1 
ATOM   153  C  C   . PHE A 1 24  ? 33.193 46.814 94.430  1.00 11.23 ? 147 PHE A C   1 
ATOM   154  O  O   . PHE A 1 24  ? 32.293 47.215 93.690  1.00 10.90 ? 147 PHE A O   1 
ATOM   155  C  CB  . PHE A 1 24  ? 33.650 44.345 94.749  1.00 11.32 ? 147 PHE A CB  1 
ATOM   156  C  CG  . PHE A 1 24  ? 32.292 43.815 94.354  1.00 10.73 ? 147 PHE A CG  1 
ATOM   157  C  CD1 . PHE A 1 24  ? 32.068 43.293 93.080  1.00 10.71 ? 147 PHE A CD1 1 
ATOM   158  C  CD2 . PHE A 1 24  ? 31.245 43.802 95.276  1.00 10.49 ? 147 PHE A CD2 1 
ATOM   159  C  CE1 . PHE A 1 24  ? 30.815 42.784 92.721  1.00 10.10 ? 147 PHE A CE1 1 
ATOM   160  C  CE2 . PHE A 1 24  ? 29.983 43.300 94.932  1.00 10.70 ? 147 PHE A CE2 1 
ATOM   161  C  CZ  . PHE A 1 24  ? 29.769 42.785 93.648  1.00 10.29 ? 147 PHE A CZ  1 
ATOM   162  N  N   . GLN A 1 25  ? 33.465 47.391 95.601  1.00 10.83 ? 148 GLN A N   1 
ATOM   163  C  CA  . GLN A 1 25  ? 32.680 48.534 96.066  1.00 11.05 ? 148 GLN A CA  1 
ATOM   164  C  C   . GLN A 1 25  ? 32.868 49.755 95.164  1.00 10.61 ? 148 GLN A C   1 
ATOM   165  O  O   . GLN A 1 25  ? 31.917 50.493 94.922  1.00 10.60 ? 148 GLN A O   1 
ATOM   166  C  CB  . GLN A 1 25  ? 32.993 48.887 97.529  1.00 11.09 ? 148 GLN A CB  1 
ATOM   167  C  CG  . GLN A 1 25  ? 32.027 49.921 98.146  1.00 13.23 ? 148 GLN A CG  1 
ATOM   168  C  CD  . GLN A 1 25  ? 30.564 49.515 98.041  1.00 15.25 ? 148 GLN A CD  1 
ATOM   169  O  OE1 . GLN A 1 25  ? 30.175 48.435 98.487  1.00 17.74 ? 148 GLN A OE1 1 
ATOM   170  N  NE2 . GLN A 1 25  ? 29.745 50.384 97.454  1.00 16.40 ? 148 GLN A NE2 1 
ATOM   171  N  N   . LYS A 1 26  ? 34.088 49.956 94.667  1.00 10.46 ? 149 LYS A N   1 
ATOM   172  C  CA  . LYS A 1 26  ? 34.369 51.074 93.761  1.00 10.39 ? 149 LYS A CA  1 
ATOM   173  C  C   . LYS A 1 26  ? 33.568 50.964 92.459  1.00 10.08 ? 149 LYS A C   1 
ATOM   174  O  O   . LYS A 1 26  ? 33.129 51.980 91.903  1.00 10.20 ? 149 LYS A O   1 
ATOM   175  C  CB  . LYS A 1 26  ? 35.870 51.197 93.488  1.00 10.66 ? 149 LYS A CB  1 
ATOM   176  C  CG  . LYS A 1 26  ? 36.621 51.945 94.593  1.00 11.46 ? 149 LYS A CG  1 
ATOM   177  C  CD  . LYS A 1 26  ? 38.130 51.832 94.427  1.00 13.77 ? 149 LYS A CD  1 
ATOM   178  C  CE  . LYS A 1 26  ? 38.862 52.859 95.285  1.00 15.32 ? 149 LYS A CE  1 
ATOM   179  N  NZ  . LYS A 1 26  ? 38.651 52.621 96.740  1.00 16.86 ? 149 LYS A NZ  1 
ATOM   180  N  N   . ILE A 1 27  ? 33.369 49.731 91.992  1.00 9.72  ? 150 ILE A N   1 
ATOM   181  C  CA  . ILE A 1 27  ? 32.536 49.474 90.809  1.00 9.33  ? 150 ILE A CA  1 
ATOM   182  C  C   . ILE A 1 27  ? 31.086 49.870 91.101  1.00 9.40  ? 150 ILE A C   1 
ATOM   183  O  O   . ILE A 1 27  ? 30.453 50.581 90.313  1.00 9.22  ? 150 ILE A O   1 
ATOM   184  C  CB  . ILE A 1 27  ? 32.643 47.995 90.336  1.00 9.14  ? 150 ILE A CB  1 
ATOM   185  C  CG1 . ILE A 1 27  ? 34.042 47.726 89.753  1.00 8.92  ? 150 ILE A CG1 1 
ATOM   186  C  CG2 . ILE A 1 27  ? 31.551 47.667 89.317  1.00 9.67  ? 150 ILE A CG2 1 
ATOM   187  C  CD1 . ILE A 1 27  ? 34.317 46.259 89.386  1.00 8.49  ? 150 ILE A CD1 1 
ATOM   188  N  N   . LEU A 1 28  ? 30.578 49.423 92.249  1.00 9.43  ? 151 LEU A N   1 
ATOM   189  C  CA  . LEU A 1 28  ? 29.228 49.772 92.695  1.00 9.78  ? 151 LEU A CA  1 
ATOM   190  C  C   . LEU A 1 28  ? 29.047 51.282 92.855  1.00 9.82  ? 151 LEU A C   1 
ATOM   191  O  O   . LEU A 1 28  ? 28.030 51.834 92.439  1.00 9.36  ? 151 LEU A O   1 
ATOM   192  C  CB  . LEU A 1 28  ? 28.885 49.052 94.006  1.00 10.11 ? 151 LEU A CB  1 
ATOM   193  C  CG  . LEU A 1 28  ? 28.779 47.522 93.962  1.00 11.04 ? 151 LEU A CG  1 
ATOM   194  C  CD1 . LEU A 1 28  ? 28.634 46.964 95.369  1.00 12.16 ? 151 LEU A CD1 1 
ATOM   195  C  CD2 . LEU A 1 28  ? 27.614 47.067 93.081  1.00 12.20 ? 151 LEU A CD2 1 
ATOM   196  N  N   . ASP A 1 29  ? 30.047 51.942 93.438  1.00 9.91  ? 152 ASP A N   1 
ATOM   197  C  CA  . ASP A 1 29  ? 30.017 53.397 93.622  1.00 10.10 ? 152 ASP A CA  1 
ATOM   198  C  C   . ASP A 1 29  ? 29.933 54.166 92.309  1.00 9.83  ? 152 ASP A C   1 
ATOM   199  O  O   . ASP A 1 29  ? 29.192 55.147 92.217  1.00 9.74  ? 152 ASP A O   1 
ATOM   200  C  CB  . ASP A 1 29  ? 31.228 53.867 94.426  1.00 10.69 ? 152 ASP A CB  1 
ATOM   201  C  CG  . ASP A 1 29  ? 31.156 53.454 95.885  1.00 11.77 ? 152 ASP A CG  1 
ATOM   202  O  OD1 . ASP A 1 29  ? 30.086 53.001 96.345  1.00 13.27 ? 152 ASP A OD1 1 
ATOM   203  O  OD2 . ASP A 1 29  ? 32.182 53.588 96.577  1.00 15.06 ? 152 ASP A OD2 1 
ATOM   204  N  N   . PHE A 1 30  ? 30.689 53.720 91.305  1.00 9.38  ? 153 PHE A N   1 
ATOM   205  C  CA  . PHE A 1 30  ? 30.640 54.321 89.971  1.00 9.53  ? 153 PHE A CA  1 
ATOM   206  C  C   . PHE A 1 30  ? 29.230 54.226 89.390  1.00 9.28  ? 153 PHE A C   1 
ATOM   207  O  O   . PHE A 1 30  ? 28.697 55.206 88.862  1.00 9.23  ? 153 PHE A O   1 
ATOM   208  C  CB  . PHE A 1 30  ? 31.657 53.661 89.031  1.00 9.46  ? 153 PHE A CB  1 
ATOM   209  C  CG  . PHE A 1 30  ? 31.595 54.173 87.617  1.00 10.02 ? 153 PHE A CG  1 
ATOM   210  C  CD1 . PHE A 1 30  ? 32.265 55.341 87.258  1.00 10.12 ? 153 PHE A CD1 1 
ATOM   211  C  CD2 . PHE A 1 30  ? 30.861 53.493 86.645  1.00 10.16 ? 153 PHE A CD2 1 
ATOM   212  C  CE1 . PHE A 1 30  ? 32.208 55.825 85.953  1.00 10.21 ? 153 PHE A CE1 1 
ATOM   213  C  CE2 . PHE A 1 30  ? 30.792 53.973 85.334  1.00 10.13 ? 153 PHE A CE2 1 
ATOM   214  C  CZ  . PHE A 1 30  ? 31.469 55.141 84.990  1.00 10.43 ? 153 PHE A CZ  1 
ATOM   215  N  N   . MET A 1 31  ? 28.631 53.044 89.498  1.00 9.24  ? 154 MET A N   1 
ATOM   216  C  CA  . MET A 1 31  ? 27.253 52.833 89.066  1.00 9.65  ? 154 MET A CA  1 
ATOM   217  C  C   . MET A 1 31  ? 26.285 53.775 89.784  1.00 9.74  ? 154 MET A C   1 
ATOM   218  O  O   . MET A 1 31  ? 25.456 54.424 89.141  1.00 9.55  ? 154 MET A O   1 
ATOM   219  C  CB  . MET A 1 31  ? 26.847 51.373 89.270  1.00 9.89  ? 154 MET A CB  1 
ATOM   220  C  CG  . MET A 1 31  ? 27.575 50.411 88.348  1.00 10.67 ? 154 MET A CG  1 
ATOM   221  S  SD  . MET A 1 31  ? 27.406 48.675 88.810  1.00 14.56 ? 154 MET A SD  1 
ATOM   222  C  CE  . MET A 1 31  ? 25.690 48.566 89.284  1.00 13.57 ? 154 MET A CE  1 
ATOM   223  N  N   . LYS A 1 32  ? 26.405 53.854 91.110  1.00 9.89  ? 155 LYS A N   1 
ATOM   224  C  CA  . LYS A 1 32  ? 25.600 54.776 91.915  1.00 10.40 ? 155 LYS A CA  1 
ATOM   225  C  C   . LYS A 1 32  ? 25.805 56.231 91.493  1.00 10.23 ? 155 LYS A C   1 
ATOM   226  O  O   . LYS A 1 32  ? 24.835 56.980 91.377  1.00 10.43 ? 155 LYS A O   1 
ATOM   227  C  CB  . LYS A 1 32  ? 25.928 54.633 93.404  1.00 10.66 ? 155 LYS A CB  1 
ATOM   228  C  CG  . LYS A 1 32  ? 25.445 53.353 94.062  1.00 12.62 ? 155 LYS A CG  1 
ATOM   229  C  CD  . LYS A 1 32  ? 26.081 53.244 95.446  1.00 15.25 ? 155 LYS A CD  1 
ATOM   230  C  CE  . LYS A 1 32  ? 25.448 52.152 96.266  1.00 17.78 ? 155 LYS A CE  1 
ATOM   231  N  NZ  . LYS A 1 32  ? 25.823 52.320 97.705  1.00 18.75 ? 155 LYS A NZ  1 
ATOM   232  N  N   . ASP A 1 33  ? 27.060 56.623 91.267  1.00 10.00 ? 156 ASP A N   1 
ATOM   233  C  CA  . ASP A 1 33  ? 27.387 57.997 90.853  1.00 10.20 ? 156 ASP A CA  1 
ATOM   234  C  C   . ASP A 1 33  ? 26.655 58.386 89.566  1.00 9.83  ? 156 ASP A C   1 
ATOM   235  O  O   . ASP A 1 33  ? 26.053 59.462 89.481  1.00 9.69  ? 156 ASP A O   1 
ATOM   236  C  CB  . ASP A 1 33  ? 28.903 58.176 90.665  1.00 10.61 ? 156 ASP A CB  1 
ATOM   237  C  CG  . ASP A 1 33  ? 29.663 58.249 91.983  1.00 12.59 ? 156 ASP A CG  1 
ATOM   238  O  OD1 . ASP A 1 33  ? 29.044 58.508 93.037  1.00 15.16 ? 156 ASP A OD1 1 
ATOM   239  O  OD2 . ASP A 1 33  ? 30.894 58.049 91.957  1.00 15.29 ? 156 ASP A OD2 1 
ATOM   240  N  N   . VAL A 1 34  ? 26.696 57.495 88.576  1.00 9.38  ? 157 VAL A N   1 
ATOM   241  C  CA  . VAL A 1 34  ? 26.028 57.732 87.291  1.00 8.98  ? 157 VAL A CA  1 
ATOM   242  C  C   . VAL A 1 34  ? 24.517 57.867 87.483  1.00 8.91  ? 157 VAL A C   1 
ATOM   243  O  O   . VAL A 1 34  ? 23.906 58.817 86.993  1.00 8.77  ? 157 VAL A O   1 
ATOM   244  C  CB  . VAL A 1 34  ? 26.365 56.627 86.253  1.00 9.01  ? 157 VAL A CB  1 
ATOM   245  C  CG1 . VAL A 1 34  ? 25.527 56.799 84.981  1.00 8.37  ? 157 VAL A CG1 1 
ATOM   246  C  CG2 . VAL A 1 34  ? 27.854 56.662 85.912  1.00 8.98  ? 157 VAL A CG2 1 
ATOM   247  N  N   . MET A 1 35  ? 23.925 56.929 88.219  1.00 9.24  ? 158 MET A N   1 
ATOM   248  C  CA  . MET A 1 35  ? 22.484 56.939 88.454  1.00 9.57  ? 158 MET A CA  1 
ATOM   249  C  C   . MET A 1 35  ? 22.006 58.175 89.209  1.00 9.83  ? 158 MET A C   1 
ATOM   250  O  O   . MET A 1 35  ? 20.976 58.761 88.858  1.00 9.80  ? 158 MET A O   1 
ATOM   251  C  CB  . MET A 1 35  ? 22.051 55.671 89.182  1.00 9.74  ? 158 MET A CB  1 
ATOM   252  C  CG  . MET A 1 35  ? 22.081 54.451 88.294  1.00 10.56 ? 158 MET A CG  1 
ATOM   253  S  SD  . MET A 1 35  ? 21.350 53.026 89.102  1.00 12.81 ? 158 MET A SD  1 
ATOM   254  C  CE  . MET A 1 35  ? 22.770 52.338 89.938  1.00 12.30 ? 158 MET A CE  1 
ATOM   255  N  N   . LYS A 1 36  ? 22.754 58.565 90.239  1.00 10.06 ? 159 LYS A N   1 
ATOM   256  C  CA  . LYS A 1 36  ? 22.415 59.748 91.032  1.00 10.18 ? 159 LYS A CA  1 
ATOM   257  C  C   . LYS A 1 36  ? 22.448 61.011 90.172  1.00 10.04 ? 159 LYS A C   1 
ATOM   258  O  O   . LYS A 1 36  ? 21.557 61.854 90.267  1.00 9.81  ? 159 LYS A O   1 
ATOM   259  C  CB  . LYS A 1 36  ? 23.360 59.884 92.232  1.00 10.56 ? 159 LYS A CB  1 
ATOM   260  C  CG  . LYS A 1 36  ? 23.120 58.823 93.311  1.00 11.52 ? 159 LYS A CG  1 
ATOM   261  C  CD  . LYS A 1 36  ? 24.166 58.868 94.417  1.00 13.35 ? 159 LYS A CD  1 
ATOM   262  C  CE  . LYS A 1 36  ? 23.975 57.698 95.389  1.00 15.02 ? 159 LYS A CE  1 
ATOM   263  N  NZ  . LYS A 1 36  ? 24.885 57.794 96.576  1.00 16.31 ? 159 LYS A NZ  1 
ATOM   264  N  N   . LYS A 1 37  ? 23.466 61.121 89.320  1.00 9.94  ? 160 LYS A N   1 
ATOM   265  C  CA  . LYS A 1 37  ? 23.611 62.283 88.442  1.00 9.94  ? 160 LYS A CA  1 
ATOM   266  C  C   . LYS A 1 37  ? 22.449 62.370 87.447  1.00 9.98  ? 160 LYS A C   1 
ATOM   267  O  O   . LYS A 1 37  ? 22.001 63.466 87.097  1.00 9.92  ? 160 LYS A O   1 
ATOM   268  C  CB  . LYS A 1 37  ? 24.959 62.244 87.708  1.00 9.88  ? 160 LYS A CB  1 
ATOM   269  C  CG  . LYS A 1 37  ? 25.359 63.560 87.025  1.00 10.44 ? 160 LYS A CG  1 
ATOM   270  C  CD  . LYS A 1 37  ? 25.393 64.722 88.010  1.00 10.78 ? 160 LYS A CD  1 
ATOM   271  C  CE  . LYS A 1 37  ? 25.833 66.013 87.341  1.00 10.59 ? 160 LYS A CE  1 
ATOM   272  N  NZ  . LYS A 1 37  ? 25.912 67.118 88.340  1.00 11.22 ? 160 LYS A NZ  1 
ATOM   273  N  N   . LEU A 1 38  ? 21.956 61.209 87.017  1.00 10.04 ? 161 LEU A N   1 
ATOM   274  C  CA  . LEU A 1 38  ? 20.878 61.138 86.022  1.00 10.17 ? 161 LEU A CA  1 
ATOM   275  C  C   . LEU A 1 38  ? 19.501 60.815 86.621  1.00 10.21 ? 161 LEU A C   1 
ATOM   276  O  O   . LEU A 1 38  ? 18.603 60.336 85.925  1.00 10.19 ? 161 LEU A O   1 
ATOM   277  C  CB  . LEU A 1 38  ? 21.254 60.152 84.905  1.00 9.99  ? 161 LEU A CB  1 
ATOM   278  C  CG  . LEU A 1 38  ? 22.512 60.510 84.103  1.00 10.24 ? 161 LEU A CG  1 
ATOM   279  C  CD1 . LEU A 1 38  ? 22.951 59.346 83.209  1.00 10.65 ? 161 LEU A CD1 1 
ATOM   280  C  CD2 . LEU A 1 38  ? 22.310 61.785 83.278  1.00 10.23 ? 161 LEU A CD2 1 
ATOM   281  N  N   . SER A 1 39  ? 19.335 61.099 87.913  1.00 10.25 ? 162 SER A N   1 
ATOM   282  C  CA  . SER A 1 39  ? 18.027 60.984 88.562  1.00 10.22 ? 162 SER A CA  1 
ATOM   283  C  C   . SER A 1 39  ? 17.038 61.964 87.930  1.00 10.21 ? 162 SER A C   1 
ATOM   284  O  O   . SER A 1 39  ? 17.436 63.031 87.451  1.00 9.98  ? 162 SER A O   1 
ATOM   285  C  CB  . SER A 1 39  ? 18.152 61.265 90.061  1.00 10.41 ? 162 SER A CB  1 
ATOM   286  O  OG  . SER A 1 39  ? 18.569 62.601 90.283  1.00 10.71 ? 162 SER A OG  1 
ATOM   287  N  N   . ASN A 1 40  ? 15.760 61.585 87.915  1.00 10.22 ? 163 ASN A N   1 
ATOM   288  C  CA  . ASN A 1 40  ? 14.682 62.445 87.412  1.00 10.34 ? 163 ASN A CA  1 
ATOM   289  C  C   . ASN A 1 40  ? 14.853 62.888 85.957  1.00 10.02 ? 163 ASN A C   1 
ATOM   290  O  O   . ASN A 1 40  ? 14.490 64.008 85.593  1.00 10.02 ? 163 ASN A O   1 
ATOM   291  C  CB  . ASN A 1 40  ? 14.506 63.666 88.328  1.00 11.11 ? 163 ASN A CB  1 
ATOM   292  C  CG  . ASN A 1 40  ? 14.382 63.280 89.786  1.00 12.37 ? 163 ASN A CG  1 
ATOM   293  O  OD1 . ASN A 1 40  ? 13.569 62.431 90.146  1.00 14.49 ? 163 ASN A OD1 1 
ATOM   294  N  ND2 . ASN A 1 40  ? 15.194 63.899 90.632  1.00 15.29 ? 163 ASN A ND2 1 
ATOM   295  N  N   . THR A 1 41  ? 15.422 62.010 85.134  1.00 9.63  ? 164 THR A N   1 
ATOM   296  C  CA  . THR A 1 41  ? 15.605 62.287 83.710  1.00 9.25  ? 164 THR A CA  1 
ATOM   297  C  C   . THR A 1 41  ? 14.824 61.253 82.903  1.00 9.33  ? 164 THR A C   1 
ATOM   298  O  O   . THR A 1 41  ? 13.976 60.547 83.457  1.00 9.45  ? 164 THR A O   1 
ATOM   299  C  CB  . THR A 1 41  ? 17.101 62.237 83.302  1.00 9.25  ? 164 THR A CB  1 
ATOM   300  O  OG1 . THR A 1 41  ? 17.593 60.901 83.448  1.00 9.01  ? 164 THR A OG1 1 
ATOM   301  C  CG2 . THR A 1 41  ? 17.942 63.181 84.163  1.00 8.78  ? 164 THR A CG2 1 
ATOM   302  N  N   . SER A 1 42  ? 15.112 61.165 81.605  1.00 8.96  ? 165 SER A N   1 
ATOM   303  C  CA  . SER A 1 42  ? 14.513 60.135 80.750  1.00 9.34  ? 165 SER A CA  1 
ATOM   304  C  C   . SER A 1 42  ? 15.242 58.788 80.866  1.00 9.22  ? 165 SER A C   1 
ATOM   305  O  O   . SER A 1 42  ? 14.863 57.816 80.209  1.00 9.21  ? 165 SER A O   1 
ATOM   306  C  CB  . SER A 1 42  ? 14.452 60.600 79.289  1.00 9.35  ? 165 SER A CB  1 
ATOM   307  O  OG  . SER A 1 42  ? 13.615 61.741 79.160  1.00 11.42 ? 165 SER A OG  1 
ATOM   308  N  N   . TYR A 1 43  ? 16.275 58.737 81.708  1.00 8.96  ? 166 TYR A N   1 
ATOM   309  C  CA  . TYR A 1 43  ? 17.019 57.498 81.958  1.00 9.01  ? 166 TYR A CA  1 
ATOM   310  C  C   . TYR A 1 43  ? 16.329 56.651 83.014  1.00 8.84  ? 166 TYR A C   1 
ATOM   311  O  O   . TYR A 1 43  ? 15.864 57.161 84.037  1.00 9.00  ? 166 TYR A O   1 
ATOM   312  C  CB  . TYR A 1 43  ? 18.445 57.785 82.440  1.00 8.91  ? 166 TYR A CB  1 
ATOM   313  C  CG  . TYR A 1 43  ? 19.395 58.276 81.376  1.00 9.30  ? 166 TYR A CG  1 
ATOM   314  C  CD1 . TYR A 1 43  ? 19.316 59.583 80.895  1.00 9.08  ? 166 TYR A CD1 1 
ATOM   315  C  CD2 . TYR A 1 43  ? 20.388 57.443 80.865  1.00 9.36  ? 166 TYR A CD2 1 
ATOM   316  C  CE1 . TYR A 1 43  ? 20.189 60.040 79.925  1.00 8.83  ? 166 TYR A CE1 1 
ATOM   317  C  CE2 . TYR A 1 43  ? 21.275 57.894 79.889  1.00 8.78  ? 166 TYR A CE2 1 
ATOM   318  C  CZ  . TYR A 1 43  ? 21.165 59.195 79.424  1.00 9.02  ? 166 TYR A CZ  1 
ATOM   319  O  OH  . TYR A 1 43  ? 22.027 59.661 78.462  1.00 9.40  ? 166 TYR A OH  1 
ATOM   320  N  N   . GLN A 1 44  ? 16.267 55.352 82.754  1.00 8.98  ? 167 GLN A N   1 
ATOM   321  C  CA  . GLN A 1 44  ? 15.876 54.376 83.764  1.00 8.81  ? 167 GLN A CA  1 
ATOM   322  C  C   . GLN A 1 44  ? 16.874 53.235 83.699  1.00 8.55  ? 167 GLN A C   1 
ATOM   323  O  O   . GLN A 1 44  ? 17.448 52.981 82.643  1.00 8.35  ? 167 GLN A O   1 
ATOM   324  C  CB  . GLN A 1 44  ? 14.421 53.929 83.567  1.00 9.39  ? 167 GLN A CB  1 
ATOM   325  C  CG  . GLN A 1 44  ? 13.443 55.057 83.931  1.00 10.60 ? 167 GLN A CG  1 
ATOM   326  C  CD  . GLN A 1 44  ? 11.977 54.782 83.628  1.00 12.82 ? 167 GLN A CD  1 
ATOM   327  O  OE1 . GLN A 1 44  ? 11.607 53.752 83.060  1.00 13.78 ? 167 GLN A OE1 1 
ATOM   328  N  NE2 . GLN A 1 44  ? 11.127 55.726 84.020  1.00 12.01 ? 167 GLN A NE2 1 
ATOM   329  N  N   . PHE A 1 45  ? 17.092 52.567 84.830  1.00 8.36  ? 168 PHE A N   1 
ATOM   330  C  CA  . PHE A 1 45  ? 18.257 51.703 84.993  1.00 8.19  ? 168 PHE A CA  1 
ATOM   331  C  C   . PHE A 1 45  ? 17.935 50.292 85.465  1.00 8.12  ? 168 PHE A C   1 
ATOM   332  O  O   . PHE A 1 45  ? 16.931 50.056 86.138  1.00 8.21  ? 168 PHE A O   1 
ATOM   333  C  CB  . PHE A 1 45  ? 19.243 52.333 85.989  1.00 8.24  ? 168 PHE A CB  1 
ATOM   334  C  CG  . PHE A 1 45  ? 19.719 53.707 85.598  1.00 8.22  ? 168 PHE A CG  1 
ATOM   335  C  CD1 . PHE A 1 45  ? 20.795 53.859 84.732  1.00 8.81  ? 168 PHE A CD1 1 
ATOM   336  C  CD2 . PHE A 1 45  ? 19.099 54.847 86.109  1.00 9.08  ? 168 PHE A CD2 1 
ATOM   337  C  CE1 . PHE A 1 45  ? 21.250 55.125 84.367  1.00 9.31  ? 168 PHE A CE1 1 
ATOM   338  C  CE2 . PHE A 1 45  ? 19.546 56.121 85.754  1.00 8.95  ? 168 PHE A CE2 1 
ATOM   339  C  CZ  . PHE A 1 45  ? 20.624 56.259 84.876  1.00 8.90  ? 168 PHE A CZ  1 
ATOM   340  N  N   . ALA A 1 46  ? 18.819 49.369 85.098  1.00 7.90  ? 169 ALA A N   1 
ATOM   341  C  CA  . ALA A 1 46  ? 18.863 48.024 85.656  1.00 7.72  ? 169 ALA A CA  1 
ATOM   342  C  C   . ALA A 1 46  ? 20.330 47.684 85.902  1.00 7.71  ? 169 ALA A C   1 
ATOM   343  O  O   . ALA A 1 46  ? 21.216 48.251 85.260  1.00 7.82  ? 169 ALA A O   1 
ATOM   344  C  CB  . ALA A 1 46  ? 18.237 47.027 84.684  1.00 7.78  ? 169 ALA A CB  1 
ATOM   345  N  N   . ALA A 1 47  ? 20.593 46.776 86.838  1.00 7.34  ? 170 ALA A N   1 
ATOM   346  C  CA  . ALA A 1 47  ? 21.965 46.350 87.116  1.00 7.29  ? 170 ALA A CA  1 
ATOM   347  C  C   . ALA A 1 47  ? 22.055 44.838 87.219  1.00 7.41  ? 170 ALA A C   1 
ATOM   348  O  O   . ALA A 1 47  ? 21.246 44.206 87.900  1.00 7.32  ? 170 ALA A O   1 
ATOM   349  C  CB  . ALA A 1 47  ? 22.474 46.993 88.384  1.00 7.63  ? 170 ALA A CB  1 
ATOM   350  N  N   . VAL A 1 48  ? 23.057 44.274 86.549  1.00 7.20  ? 171 VAL A N   1 
ATOM   351  C  CA  . VAL A 1 48  ? 23.249 42.829 86.484  1.00 7.62  ? 171 VAL A CA  1 
ATOM   352  C  C   . VAL A 1 48  ? 24.675 42.490 86.905  1.00 7.45  ? 171 VAL A C   1 
ATOM   353  O  O   . VAL A 1 48  ? 25.627 42.994 86.312  1.00 7.69  ? 171 VAL A O   1 
ATOM   354  C  CB  . VAL A 1 48  ? 23.011 42.300 85.043  1.00 7.36  ? 171 VAL A CB  1 
ATOM   355  C  CG1 . VAL A 1 48  ? 23.211 40.780 84.977  1.00 8.00  ? 171 VAL A CG1 1 
ATOM   356  C  CG2 . VAL A 1 48  ? 21.618 42.683 84.549  1.00 8.70  ? 171 VAL A CG2 1 
ATOM   357  N  N   . GLN A 1 49  ? 24.826 41.653 87.932  1.00 7.67  ? 172 GLN A N   1 
ATOM   358  C  CA  . GLN A 1 49  ? 26.143 41.137 88.292  1.00 7.55  ? 172 GLN A CA  1 
ATOM   359  C  C   . GLN A 1 49  ? 26.421 39.892 87.463  1.00 7.65  ? 172 GLN A C   1 
ATOM   360  O  O   . GLN A 1 49  ? 25.539 39.049 87.299  1.00 7.62  ? 172 GLN A O   1 
ATOM   361  C  CB  . GLN A 1 49  ? 26.249 40.797 89.788  1.00 7.69  ? 172 GLN A CB  1 
ATOM   362  C  CG  . GLN A 1 49  ? 27.695 40.495 90.217  1.00 8.29  ? 172 GLN A CG  1 
ATOM   363  C  CD  . GLN A 1 49  ? 27.860 40.012 91.659  1.00 8.68  ? 172 GLN A CD  1 
ATOM   364  O  OE1 . GLN A 1 49  ? 28.937 39.547 92.036  1.00 8.59  ? 172 GLN A OE1 1 
ATOM   365  N  NE2 . GLN A 1 49  ? 26.804 40.122 92.465  1.00 9.04  ? 172 GLN A NE2 1 
ATOM   366  N  N   . PHE A 1 50  ? 27.639 39.784 86.938  1.00 7.36  ? 173 PHE A N   1 
ATOM   367  C  CA  . PHE A 1 50  ? 28.051 38.566 86.245  1.00 7.31  ? 173 PHE A CA  1 
ATOM   368  C  C   . PHE A 1 50  ? 29.377 38.021 86.759  1.00 7.55  ? 173 PHE A C   1 
ATOM   369  O  O   . PHE A 1 50  ? 30.296 38.776 87.086  1.00 7.28  ? 173 PHE A O   1 
ATOM   370  C  CB  . PHE A 1 50  ? 28.071 38.756 84.719  1.00 7.41  ? 173 PHE A CB  1 
ATOM   371  C  CG  . PHE A 1 50  ? 29.310 39.435 84.180  1.00 7.05  ? 173 PHE A CG  1 
ATOM   372  C  CD1 . PHE A 1 50  ? 29.435 40.820 84.217  1.00 6.24  ? 173 PHE A CD1 1 
ATOM   373  C  CD2 . PHE A 1 50  ? 30.334 38.685 83.599  1.00 6.90  ? 173 PHE A CD2 1 
ATOM   374  C  CE1 . PHE A 1 50  ? 30.567 41.453 83.705  1.00 6.59  ? 173 PHE A CE1 1 
ATOM   375  C  CE2 . PHE A 1 50  ? 31.470 39.307 83.074  1.00 6.70  ? 173 PHE A CE2 1 
ATOM   376  C  CZ  . PHE A 1 50  ? 31.586 40.701 83.131  1.00 6.85  ? 173 PHE A CZ  1 
ATOM   377  N  N   . SER A 1 51  ? 29.454 36.699 86.835  1.00 7.29  ? 174 SER A N   1 
ATOM   378  C  CA  . SER A 1 51  ? 30.695 36.023 87.153  1.00 7.95  ? 174 SER A CA  1 
ATOM   379  C  C   . SER A 1 51  ? 30.683 34.734 86.341  1.00 7.96  ? 174 SER A C   1 
ATOM   380  O  O   . SER A 1 51  ? 30.873 34.777 85.125  1.00 8.33  ? 174 SER A O   1 
ATOM   381  C  CB  . SER A 1 51  ? 30.815 35.782 88.660  1.00 7.63  ? 174 SER A CB  1 
ATOM   382  O  OG  . SER A 1 51  ? 32.144 35.435 89.010  1.00 7.94  ? 174 SER A OG  1 
ATOM   383  N  N   . THR A 1 52  ? 30.427 33.601 86.986  1.00 8.55  ? 175 THR A N   1 
ATOM   384  C  CA  . THR A 1 52  ? 30.181 32.363 86.250  1.00 8.86  ? 175 THR A CA  1 
ATOM   385  C  C   . THR A 1 52  ? 28.758 32.383 85.688  1.00 8.93  ? 175 THR A C   1 
ATOM   386  O  O   . THR A 1 52  ? 28.521 31.967 84.551  1.00 9.14  ? 175 THR A O   1 
ATOM   387  C  CB  . THR A 1 52  ? 30.441 31.114 87.120  1.00 8.72  ? 175 THR A CB  1 
ATOM   388  O  OG1 . THR A 1 52  ? 31.843 31.028 87.392  1.00 9.47  ? 175 THR A OG1 1 
ATOM   389  C  CG2 . THR A 1 52  ? 30.014 29.846 86.394  1.00 9.69  ? 175 THR A CG2 1 
ATOM   390  N  N   . SER A 1 53  ? 27.824 32.882 86.494  1.00 8.93  ? 176 SER A N   1 
ATOM   391  C  CA  . SER A 1 53  ? 26.454 33.110 86.057  1.00 8.81  ? 176 SER A CA  1 
ATOM   392  C  C   . SER A 1 53  ? 26.035 34.558 86.325  1.00 8.94  ? 176 SER A C   1 
ATOM   393  O  O   . SER A 1 53  ? 26.882 35.430 86.558  1.00 8.67  ? 176 SER A O   1 
ATOM   394  C  CB  . SER A 1 53  ? 25.493 32.133 86.737  1.00 8.70  ? 176 SER A CB  1 
ATOM   395  O  OG  . SER A 1 53  ? 24.232 32.152 86.090  1.00 9.10  ? 176 SER A OG  1 
ATOM   396  N  N   . TYR A 1 54  ? 24.731 34.808 86.290  1.00 8.83  ? 177 TYR A N   1 
ATOM   397  C  CA  . TYR A 1 54  ? 24.217 36.174 86.213  1.00 9.30  ? 177 TYR A CA  1 
ATOM   398  C  C   . TYR A 1 54  ? 23.113 36.402 87.224  1.00 9.36  ? 177 TYR A C   1 
ATOM   399  O  O   . TYR A 1 54  ? 22.350 35.488 87.531  1.00 9.31  ? 177 TYR A O   1 
ATOM   400  C  CB  . TYR A 1 54  ? 23.713 36.458 84.791  1.00 9.33  ? 177 TYR A CB  1 
ATOM   401  C  CG  . TYR A 1 54  ? 24.413 35.601 83.757  1.00 10.16 ? 177 TYR A CG  1 
ATOM   402  C  CD1 . TYR A 1 54  ? 25.761 35.807 83.442  1.00 10.45 ? 177 TYR A CD1 1 
ATOM   403  C  CD2 . TYR A 1 54  ? 23.741 34.553 83.131  1.00 10.83 ? 177 TYR A CD2 1 
ATOM   404  C  CE1 . TYR A 1 54  ? 26.414 34.990 82.523  1.00 11.10 ? 177 TYR A CE1 1 
ATOM   405  C  CE2 . TYR A 1 54  ? 24.382 33.739 82.206  1.00 11.19 ? 177 TYR A CE2 1 
ATOM   406  C  CZ  . TYR A 1 54  ? 25.711 33.963 81.907  1.00 11.23 ? 177 TYR A CZ  1 
ATOM   407  O  OH  . TYR A 1 54  ? 26.336 33.149 80.992  1.00 12.47 ? 177 TYR A OH  1 
ATOM   408  N  N   . LYS A 1 55  ? 23.042 37.624 87.747  1.00 9.71  ? 178 LYS A N   1 
ATOM   409  C  CA  . LYS A 1 55  ? 21.966 38.010 88.653  1.00 10.11 ? 178 LYS A CA  1 
ATOM   410  C  C   . LYS A 1 55  ? 21.535 39.440 88.382  1.00 10.05 ? 178 LYS A C   1 
ATOM   411  O  O   . LYS A 1 55  ? 22.344 40.369 88.464  1.00 10.08 ? 178 LYS A O   1 
ATOM   412  C  CB  . LYS A 1 55  ? 22.381 37.840 90.122  1.00 10.35 ? 178 LYS A CB  1 
ATOM   413  C  CG  . LYS A 1 55  ? 21.303 38.230 91.135  1.00 11.91 ? 178 LYS A CG  1 
ATOM   414  C  CD  . LYS A 1 55  ? 21.722 37.831 92.550  1.00 14.93 ? 178 LYS A CD  1 
ATOM   415  C  CE  . LYS A 1 55  ? 20.592 38.019 93.558  1.00 17.18 ? 178 LYS A CE  1 
ATOM   416  N  NZ  . LYS A 1 55  ? 20.413 39.445 93.958  1.00 18.61 ? 178 LYS A NZ  1 
ATOM   417  N  N   . THR A 1 56  ? 20.258 39.603 88.044  1.00 10.08 ? 179 THR A N   1 
ATOM   418  C  CA  . THR A 1 56  ? 19.663 40.924 87.911  1.00 10.16 ? 179 THR A CA  1 
ATOM   419  C  C   . THR A 1 56  ? 19.437 41.458 89.318  1.00 10.33 ? 179 THR A C   1 
ATOM   420  O  O   . THR A 1 56  ? 18.475 41.074 89.998  1.00 10.60 ? 179 THR A O   1 
ATOM   421  C  CB  . THR A 1 56  ? 18.336 40.879 87.113  1.00 10.35 ? 179 THR A CB  1 
ATOM   422  O  OG1 . THR A 1 56  ? 18.578 40.307 85.822  1.00 10.14 ? 179 THR A OG1 1 
ATOM   423  C  CG2 . THR A 1 56  ? 17.748 42.280 86.937  1.00 10.17 ? 179 THR A CG2 1 
ATOM   424  N  N   . GLU A 1 57  ? 20.343 42.330 89.754  1.00 10.21 ? 180 GLU A N   1 
ATOM   425  C  CA  . GLU A 1 57  ? 20.302 42.880 91.105  1.00 10.38 ? 180 GLU A CA  1 
ATOM   426  C  C   . GLU A 1 57  ? 19.100 43.798 91.309  1.00 10.37 ? 180 GLU A C   1 
ATOM   427  O  O   . GLU A 1 57  ? 18.508 43.826 92.385  1.00 10.52 ? 180 GLU A O   1 
ATOM   428  C  CB  . GLU A 1 57  ? 21.616 43.595 91.446  1.00 10.27 ? 180 GLU A CB  1 
ATOM   429  C  CG  . GLU A 1 57  ? 22.869 42.708 91.359  1.00 10.76 ? 180 GLU A CG  1 
ATOM   430  C  CD  . GLU A 1 57  ? 22.930 41.612 92.425  1.00 11.48 ? 180 GLU A CD  1 
ATOM   431  O  OE1 . GLU A 1 57  ? 23.875 40.796 92.377  1.00 12.55 ? 180 GLU A OE1 1 
ATOM   432  O  OE2 . GLU A 1 57  ? 22.044 41.556 93.307  1.00 11.51 ? 180 GLU A OE2 1 
ATOM   433  N  N   . PHE A 1 58  ? 18.760 44.558 90.273  1.00 10.30 ? 181 PHE A N   1 
ATOM   434  C  CA  . PHE A 1 58  ? 17.476 45.252 90.195  1.00 10.26 ? 181 PHE A CA  1 
ATOM   435  C  C   . PHE A 1 58  ? 17.129 45.494 88.733  1.00 10.46 ? 181 PHE A C   1 
ATOM   436  O  O   . PHE A 1 58  ? 18.021 45.610 87.888  1.00 10.06 ? 181 PHE A O   1 
ATOM   437  C  CB  . PHE A 1 58  ? 17.463 46.560 91.011  1.00 10.19 ? 181 PHE A CB  1 
ATOM   438  C  CG  . PHE A 1 58  ? 18.336 47.656 90.454  1.00 9.49  ? 181 PHE A CG  1 
ATOM   439  C  CD1 . PHE A 1 58  ? 17.845 48.542 89.492  1.00 9.45  ? 181 PHE A CD1 1 
ATOM   440  C  CD2 . PHE A 1 58  ? 19.638 47.826 90.914  1.00 9.48  ? 181 PHE A CD2 1 
ATOM   441  C  CE1 . PHE A 1 58  ? 18.648 49.562 88.981  1.00 8.68  ? 181 PHE A CE1 1 
ATOM   442  C  CE2 . PHE A 1 58  ? 20.444 48.850 90.418  1.00 9.15  ? 181 PHE A CE2 1 
ATOM   443  C  CZ  . PHE A 1 58  ? 19.948 49.717 89.446  1.00 9.12  ? 181 PHE A CZ  1 
ATOM   444  N  N   . ASP A 1 59  ? 15.836 45.541 88.431  1.00 10.88 ? 182 ASP A N   1 
ATOM   445  C  CA  . ASP A 1 59  ? 15.402 45.792 87.060  1.00 11.48 ? 182 ASP A CA  1 
ATOM   446  C  C   . ASP A 1 59  ? 14.822 47.196 86.919  1.00 11.39 ? 182 ASP A C   1 
ATOM   447  O  O   . ASP A 1 59  ? 14.797 47.966 87.887  1.00 11.31 ? 182 ASP A O   1 
ATOM   448  C  CB  . ASP A 1 59  ? 14.423 44.711 86.579  1.00 11.76 ? 182 ASP A CB  1 
ATOM   449  C  CG  . ASP A 1 59  ? 13.119 44.696 87.357  1.00 13.45 ? 182 ASP A CG  1 
ATOM   450  O  OD1 . ASP A 1 59  ? 12.710 45.743 87.899  1.00 14.09 ? 182 ASP A OD1 1 
ATOM   451  O  OD2 . ASP A 1 59  ? 12.490 43.618 87.409  1.00 15.80 ? 182 ASP A OD2 1 
ATOM   452  N  N   . PHE A 1 60  ? 14.357 47.525 85.716  1.00 11.34 ? 183 PHE A N   1 
ATOM   453  C  CA  . PHE A 1 60  ? 13.850 48.869 85.433  1.00 11.48 ? 183 PHE A CA  1 
ATOM   454  C  C   . PHE A 1 60  ? 12.657 49.242 86.316  1.00 12.00 ? 183 PHE A C   1 
ATOM   455  O  O   . PHE A 1 60  ? 12.571 50.370 86.806  1.00 11.88 ? 183 PHE A O   1 
ATOM   456  C  CB  . PHE A 1 60  ? 13.502 49.008 83.952  1.00 11.37 ? 183 PHE A CB  1 
ATOM   457  C  CG  . PHE A 1 60  ? 14.657 48.731 83.032  1.00 10.67 ? 183 PHE A CG  1 
ATOM   458  C  CD1 . PHE A 1 60  ? 15.675 49.669 82.866  1.00 9.43  ? 183 PHE A CD1 1 
ATOM   459  C  CD2 . PHE A 1 60  ? 14.728 47.533 82.328  1.00 10.13 ? 183 PHE A CD2 1 
ATOM   460  C  CE1 . PHE A 1 60  ? 16.743 49.418 82.013  1.00 8.61  ? 183 PHE A CE1 1 
ATOM   461  C  CE2 . PHE A 1 60  ? 15.798 47.272 81.471  1.00 9.92  ? 183 PHE A CE2 1 
ATOM   462  C  CZ  . PHE A 1 60  ? 16.807 48.219 81.318  1.00 9.71  ? 183 PHE A CZ  1 
ATOM   463  N  N   . SER A 1 61  ? 11.758 48.284 86.530  1.00 12.61 ? 184 SER A N   1 
ATOM   464  C  CA  . SER A 1 61  ? 10.598 48.489 87.399  1.00 13.43 ? 184 SER A CA  1 
ATOM   465  C  C   . SER A 1 61  ? 11.020 48.787 88.835  1.00 13.51 ? 184 SER A C   1 
ATOM   466  O  O   . SER A 1 61  ? 10.424 49.647 89.495  1.00 14.00 ? 184 SER A O   1 
ATOM   467  C  CB  . SER A 1 61  ? 9.670  47.277 87.350  1.00 13.46 ? 184 SER A CB  1 
ATOM   468  O  OG  . SER A 1 61  ? 8.947  47.257 86.131  1.00 14.94 ? 184 SER A OG  1 
ATOM   469  N  N   . ASP A 1 62  ? 12.048 48.082 89.308  1.00 13.56 ? 185 ASP A N   1 
ATOM   470  C  CA  . ASP A 1 62  ? 12.642 48.351 90.621  1.00 13.53 ? 185 ASP A CA  1 
ATOM   471  C  C   . ASP A 1 62  ? 13.155 49.782 90.694  1.00 13.63 ? 185 ASP A C   1 
ATOM   472  O  O   . ASP A 1 62  ? 12.944 50.473 91.695  1.00 13.40 ? 185 ASP A O   1 
ATOM   473  C  CB  . ASP A 1 62  ? 13.798 47.388 90.917  1.00 13.51 ? 185 ASP A CB  1 
ATOM   474  C  CG  . ASP A 1 62  ? 13.344 45.952 91.101  1.00 13.93 ? 185 ASP A CG  1 
ATOM   475  O  OD1 . ASP A 1 62  ? 12.212 45.724 91.585  1.00 13.73 ? 185 ASP A OD1 1 
ATOM   476  O  OD2 . ASP A 1 62  ? 14.137 45.042 90.772  1.00 14.02 ? 185 ASP A OD2 1 
ATOM   477  N  N   . TYR A 1 63  ? 13.832 50.224 89.631  1.00 13.46 ? 186 TYR A N   1 
ATOM   478  C  CA  . TYR A 1 63  ? 14.356 51.579 89.596  1.00 13.70 ? 186 TYR A CA  1 
ATOM   479  C  C   . TYR A 1 63  ? 13.238 52.628 89.646  1.00 14.22 ? 186 TYR A C   1 
ATOM   480  O  O   . TYR A 1 63  ? 13.337 53.599 90.394  1.00 14.21 ? 186 TYR A O   1 
ATOM   481  C  CB  . TYR A 1 63  ? 15.290 51.834 88.398  1.00 13.62 ? 186 TYR A CB  1 
ATOM   482  C  CG  . TYR A 1 63  ? 15.764 53.264 88.414  1.00 13.07 ? 186 TYR A CG  1 
ATOM   483  C  CD1 . TYR A 1 63  ? 16.786 53.665 89.276  1.00 13.26 ? 186 TYR A CD1 1 
ATOM   484  C  CD2 . TYR A 1 63  ? 15.138 54.234 87.633  1.00 13.45 ? 186 TYR A CD2 1 
ATOM   485  C  CE1 . TYR A 1 63  ? 17.191 54.987 89.335  1.00 13.22 ? 186 TYR A CE1 1 
ATOM   486  C  CE2 . TYR A 1 63  ? 15.538 55.554 87.683  1.00 13.37 ? 186 TYR A CE2 1 
ATOM   487  C  CZ  . TYR A 1 63  ? 16.561 55.924 88.536  1.00 13.44 ? 186 TYR A CZ  1 
ATOM   488  O  OH  . TYR A 1 63  ? 16.954 57.236 88.593  1.00 14.53 ? 186 TYR A OH  1 
ATOM   489  N  N   . VAL A 1 64  ? 12.188 52.431 88.852  1.00 14.74 ? 187 VAL A N   1 
ATOM   490  C  CA  . VAL A 1 64  ? 11.047 53.358 88.841  1.00 15.47 ? 187 VAL A CA  1 
ATOM   491  C  C   . VAL A 1 64  ? 10.430 53.477 90.241  1.00 15.99 ? 187 VAL A C   1 
ATOM   492  O  O   . VAL A 1 64  ? 10.180 54.584 90.727  1.00 16.18 ? 187 VAL A O   1 
ATOM   493  C  CB  . VAL A 1 64  ? 9.986  52.953 87.787  1.00 15.41 ? 187 VAL A CB  1 
ATOM   494  C  CG1 . VAL A 1 64  ? 8.716  53.799 87.924  1.00 15.87 ? 187 VAL A CG1 1 
ATOM   495  C  CG2 . VAL A 1 64  ? 10.557 53.095 86.383  1.00 15.54 ? 187 VAL A CG2 1 
ATOM   496  N  N   . LYS A 1 65  ? 10.230 52.335 90.894  1.00 16.43 ? 188 LYS A N   1 
ATOM   497  C  CA  . LYS A 1 65  ? 9.643  52.294 92.234  1.00 16.84 ? 188 LYS A CA  1 
ATOM   498  C  C   . LYS A 1 65  ? 10.490 53.014 93.288  1.00 16.88 ? 188 LYS A C   1 
ATOM   499  O  O   . LYS A 1 65  ? 9.966  53.829 94.052  1.00 16.78 ? 188 LYS A O   1 
ATOM   500  C  CB  . LYS A 1 65  ? 9.383  50.848 92.664  1.00 17.10 ? 188 LYS A CB  1 
ATOM   501  C  CG  . LYS A 1 65  ? 8.647  50.730 93.991  1.00 18.53 ? 188 LYS A CG  1 
ATOM   502  C  CD  . LYS A 1 65  ? 8.495  49.290 94.420  1.00 21.15 ? 188 LYS A CD  1 
ATOM   503  C  CE  . LYS A 1 65  ? 7.809  49.212 95.771  1.00 22.07 ? 188 LYS A CE  1 
ATOM   504  N  NZ  . LYS A 1 65  ? 7.552  47.803 96.159  1.00 23.36 ? 188 LYS A NZ  1 
ATOM   505  N  N   . TRP A 1 66  ? 11.790 52.725 93.312  1.00 16.74 ? 189 TRP A N   1 
ATOM   506  C  CA  . TRP A 1 66  ? 12.678 53.207 94.376  1.00 16.95 ? 189 TRP A CA  1 
ATOM   507  C  C   . TRP A 1 66  ? 13.434 54.496 94.080  1.00 16.88 ? 189 TRP A C   1 
ATOM   508  O  O   . TRP A 1 66  ? 13.589 55.331 94.972  1.00 16.70 ? 189 TRP A O   1 
ATOM   509  C  CB  . TRP A 1 66  ? 13.666 52.111 94.781  1.00 17.05 ? 189 TRP A CB  1 
ATOM   510  C  CG  . TRP A 1 66  ? 13.005 50.984 95.498  1.00 17.75 ? 189 TRP A CG  1 
ATOM   511  C  CD1 . TRP A 1 66  ? 12.537 49.824 94.950  1.00 18.13 ? 189 TRP A CD1 1 
ATOM   512  C  CD2 . TRP A 1 66  ? 12.717 50.913 96.899  1.00 18.69 ? 189 TRP A CD2 1 
ATOM   513  N  NE1 . TRP A 1 66  ? 11.978 49.031 95.925  1.00 18.26 ? 189 TRP A NE1 1 
ATOM   514  C  CE2 . TRP A 1 66  ? 12.076 49.675 97.131  1.00 18.96 ? 189 TRP A CE2 1 
ATOM   515  C  CE3 . TRP A 1 66  ? 12.937 51.775 97.982  1.00 19.52 ? 189 TRP A CE3 1 
ATOM   516  C  CZ2 . TRP A 1 66  ? 11.655 49.273 98.406  1.00 19.60 ? 189 TRP A CZ2 1 
ATOM   517  C  CZ3 . TRP A 1 66  ? 12.517 51.376 99.251  1.00 19.84 ? 189 TRP A CZ3 1 
ATOM   518  C  CH2 . TRP A 1 66  ? 11.884 50.133 99.449  1.00 19.87 ? 189 TRP A CH2 1 
ATOM   519  N  N   . LYS A 1 67  ? 13.924 54.643 92.847  1.00 17.05 ? 190 LYS A N   1 
ATOM   520  C  CA  . LYS A 1 67  ? 14.705 55.824 92.436  1.00 17.31 ? 190 LYS A CA  1 
ATOM   521  C  C   . LYS A 1 67  ? 15.836 56.169 93.415  1.00 17.31 ? 190 LYS A C   1 
ATOM   522  O  O   . LYS A 1 67  ? 16.148 57.342 93.639  1.00 17.43 ? 190 LYS A O   1 
ATOM   523  C  CB  . LYS A 1 67  ? 13.782 57.036 92.234  1.00 17.57 ? 190 LYS A CB  1 
ATOM   524  C  CG  . LYS A 1 67  ? 12.744 56.863 91.131  1.00 18.52 ? 190 LYS A CG  1 
ATOM   525  C  CD  . LYS A 1 67  ? 11.876 58.107 91.005  1.00 20.65 ? 190 LYS A CD  1 
ATOM   526  C  CE  . LYS A 1 67  ? 11.004 58.065 89.758  1.00 22.08 ? 190 LYS A CE  1 
ATOM   527  N  NZ  . LYS A 1 67  ? 9.858  57.120 89.887  1.00 24.30 ? 190 LYS A NZ  1 
ATOM   528  N  N   . ASP A 1 68  ? 16.441 55.137 93.999  1.00 17.34 ? 191 ASP A N   1 
ATOM   529  C  CA  . ASP A 1 68  ? 17.446 55.305 95.040  1.00 17.40 ? 191 ASP A CA  1 
ATOM   530  C  C   . ASP A 1 68  ? 18.559 54.277 94.837  1.00 17.16 ? 191 ASP A C   1 
ATOM   531  O  O   . ASP A 1 68  ? 18.418 53.123 95.252  1.00 16.81 ? 191 ASP A O   1 
ATOM   532  C  CB  . ASP A 1 68  ? 16.809 55.148 96.431  1.00 17.84 ? 191 ASP A CB  1 
ATOM   533  C  CG  . ASP A 1 68  ? 17.759 55.523 97.566  1.00 18.91 ? 191 ASP A CG  1 
ATOM   534  O  OD1 . ASP A 1 68  ? 18.905 55.027 97.592  1.00 20.27 ? 191 ASP A OD1 1 
ATOM   535  O  OD2 . ASP A 1 68  ? 17.351 56.309 98.449  1.00 20.50 ? 191 ASP A OD2 1 
ATOM   536  N  N   . PRO A 1 69  ? 19.666 54.693 94.189  1.00 17.01 ? 192 PRO A N   1 
ATOM   537  C  CA  . PRO A 1 69  ? 20.777 53.788 93.883  1.00 16.96 ? 192 PRO A CA  1 
ATOM   538  C  C   . PRO A 1 69  ? 21.367 53.100 95.117  1.00 16.98 ? 192 PRO A C   1 
ATOM   539  O  O   . PRO A 1 69  ? 21.717 51.919 95.049  1.00 16.90 ? 192 PRO A O   1 
ATOM   540  C  CB  . PRO A 1 69  ? 21.808 54.709 93.219  1.00 16.87 ? 192 PRO A CB  1 
ATOM   541  C  CG  . PRO A 1 69  ? 20.988 55.799 92.624  1.00 17.13 ? 192 PRO A CG  1 
ATOM   542  C  CD  . PRO A 1 69  ? 19.878 56.031 93.606  1.00 17.13 ? 192 PRO A CD  1 
ATOM   543  N  N   . ASP A 1 70  ? 21.460 53.823 96.232  1.00 17.14 ? 193 ASP A N   1 
ATOM   544  C  CA  . ASP A 1 70  ? 21.964 53.242 97.482  1.00 17.35 ? 193 ASP A CA  1 
ATOM   545  C  C   . ASP A 1 70  ? 21.093 52.076 97.961  1.00 16.96 ? 193 ASP A C   1 
ATOM   546  O  O   . ASP A 1 70  ? 21.609 51.022 98.325  1.00 16.92 ? 193 ASP A O   1 
ATOM   547  C  CB  . ASP A 1 70  ? 22.105 54.311 98.576  1.00 17.68 ? 193 ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 70  ? 23.215 55.311 98.284  1.00 18.91 ? 193 ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 70  ? 24.201 54.947 97.612  1.00 20.63 ? 193 ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 70  ? 23.111 56.470 98.738  1.00 21.24 ? 193 ASP A OD2 1 
ATOM   551  N  N   . ALA A 1 71  ? 19.776 52.260 97.938  1.00 16.72 ? 194 ALA A N   1 
ATOM   552  C  CA  . ALA A 1 71  ? 18.849 51.211 98.354  1.00 16.42 ? 194 ALA A CA  1 
ATOM   553  C  C   . ALA A 1 71  ? 18.828 50.035 97.375  1.00 16.45 ? 194 ALA A C   1 
ATOM   554  O  O   . ALA A 1 71  ? 18.759 48.871 97.787  1.00 16.22 ? 194 ALA A O   1 
ATOM   555  C  CB  . ALA A 1 71  ? 17.448 51.782 98.542  1.00 16.61 ? 194 ALA A CB  1 
ATOM   556  N  N   . LEU A 1 72  ? 18.909 50.344 96.081  1.00 16.08 ? 195 LEU A N   1 
ATOM   557  C  CA  . LEU A 1 72  ? 18.790 49.332 95.029  1.00 16.06 ? 195 LEU A CA  1 
ATOM   558  C  C   . LEU A 1 72  ? 19.968 48.359 94.982  1.00 16.45 ? 195 LEU A C   1 
ATOM   559  O  O   . LEU A 1 72  ? 19.813 47.215 94.551  1.00 16.64 ? 195 LEU A O   1 
ATOM   560  C  CB  . LEU A 1 72  ? 18.591 49.998 93.661  1.00 15.69 ? 195 LEU A CB  1 
ATOM   561  C  CG  . LEU A 1 72  ? 17.209 50.605 93.401  1.00 14.87 ? 195 LEU A CG  1 
ATOM   562  C  CD1 . LEU A 1 72  ? 17.274 51.648 92.293  1.00 14.19 ? 195 LEU A CD1 1 
ATOM   563  C  CD2 . LEU A 1 72  ? 16.179 49.531 93.071  1.00 13.82 ? 195 LEU A CD2 1 
ATOM   564  N  N   . LEU A 1 73  ? 21.132 48.820 95.436  1.00 16.89 ? 196 LEU A N   1 
ATOM   565  C  CA  . LEU A 1 73  ? 22.362 48.029 95.399  1.00 17.53 ? 196 LEU A CA  1 
ATOM   566  C  C   . LEU A 1 73  ? 22.881 47.650 96.792  1.00 18.39 ? 196 LEU A C   1 
ATOM   567  O  O   . LEU A 1 73  ? 23.993 47.134 96.928  1.00 18.46 ? 196 LEU A O   1 
ATOM   568  C  CB  . LEU A 1 73  ? 23.445 48.780 94.611  1.00 17.40 ? 196 LEU A CB  1 
ATOM   569  C  CG  . LEU A 1 73  ? 23.231 48.948 93.101  1.00 16.77 ? 196 LEU A CG  1 
ATOM   570  C  CD1 . LEU A 1 73  ? 24.184 49.991 92.526  1.00 16.74 ? 196 LEU A CD1 1 
ATOM   571  C  CD2 . LEU A 1 73  ? 23.379 47.618 92.363  1.00 16.00 ? 196 LEU A CD2 1 
ATOM   572  N  N   . LYS A 1 74  ? 22.069 47.888 97.821  1.00 19.11 ? 197 LYS A N   1 
ATOM   573  C  CA  . LYS A 1 74  ? 22.489 47.649 99.205  1.00 19.94 ? 197 LYS A CA  1 
ATOM   574  C  C   . LYS A 1 74  ? 22.726 46.172 99.527  1.00 20.22 ? 197 LYS A C   1 
ATOM   575  O  O   . LYS A 1 74  ? 23.557 45.848 100.378 1.00 20.78 ? 197 LYS A O   1 
ATOM   576  C  CB  . LYS A 1 74  ? 21.486 48.265 100.193 1.00 20.10 ? 197 LYS A CB  1 
ATOM   577  C  CG  . LYS A 1 74  ? 22.008 48.377 101.628 1.00 21.00 ? 197 LYS A CG  1 
ATOM   578  C  CD  . LYS A 1 74  ? 21.080 49.189 102.518 1.00 22.82 ? 197 LYS A CD  1 
ATOM   579  C  CE  . LYS A 1 74  ? 21.298 50.686 102.344 1.00 23.52 ? 197 LYS A CE  1 
ATOM   580  N  NZ  . LYS A 1 74  ? 20.391 51.491 103.221 1.00 24.74 ? 197 LYS A NZ  1 
ATOM   581  N  N   . HIS A 1 75  ? 22.012 45.283 98.842  1.00 20.40 ? 198 HIS A N   1 
ATOM   582  C  CA  . HIS A 1 75  ? 22.080 43.854 99.152  1.00 20.60 ? 198 HIS A CA  1 
ATOM   583  C  C   . HIS A 1 75  ? 22.682 42.997 98.027  1.00 19.85 ? 198 HIS A C   1 
ATOM   584  O  O   . HIS A 1 75  ? 22.282 41.851 97.809  1.00 19.95 ? 198 HIS A O   1 
ATOM   585  C  CB  . HIS A 1 75  ? 20.704 43.357 99.604  1.00 20.99 ? 198 HIS A CB  1 
ATOM   586  C  CG  . HIS A 1 75  ? 20.164 44.116 100.780 1.00 22.85 ? 198 HIS A CG  1 
ATOM   587  N  ND1 . HIS A 1 75  ? 19.446 45.286 100.644 1.00 24.67 ? 198 HIS A ND1 1 
ATOM   588  C  CD2 . HIS A 1 75  ? 20.273 43.894 102.111 1.00 24.42 ? 198 HIS A CD2 1 
ATOM   589  C  CE1 . HIS A 1 75  ? 19.119 45.741 101.841 1.00 25.31 ? 198 HIS A CE1 1 
ATOM   590  N  NE2 . HIS A 1 75  ? 19.609 44.916 102.749 1.00 25.30 ? 198 HIS A NE2 1 
ATOM   591  N  N   . VAL A 1 76  ? 23.662 43.569 97.331  1.00 19.02 ? 199 VAL A N   1 
ATOM   592  C  CA  . VAL A 1 76  ? 24.455 42.839 96.341  1.00 17.87 ? 199 VAL A CA  1 
ATOM   593  C  C   . VAL A 1 76  ? 25.477 41.963 97.061  1.00 17.35 ? 199 VAL A C   1 
ATOM   594  O  O   . VAL A 1 76  ? 26.188 42.434 97.949  1.00 17.38 ? 199 VAL A O   1 
ATOM   595  C  CB  . VAL A 1 76  ? 25.192 43.808 95.376  1.00 17.86 ? 199 VAL A CB  1 
ATOM   596  C  CG1 . VAL A 1 76  ? 26.106 43.043 94.415  1.00 17.20 ? 199 VAL A CG1 1 
ATOM   597  C  CG2 . VAL A 1 76  ? 24.190 44.647 94.598  1.00 17.73 ? 199 VAL A CG2 1 
ATOM   598  N  N   . LYS A 1 77  ? 25.548 40.694 96.673  1.00 16.70 ? 200 LYS A N   1 
ATOM   599  C  CA  . LYS A 1 77  ? 26.554 39.787 97.215  1.00 16.19 ? 200 LYS A CA  1 
ATOM   600  C  C   . LYS A 1 77  ? 27.570 39.387 96.151  1.00 15.27 ? 200 LYS A C   1 
ATOM   601  O  O   . LYS A 1 77  ? 27.215 38.808 95.123  1.00 14.99 ? 200 LYS A O   1 
ATOM   602  C  CB  . LYS A 1 77  ? 25.900 38.554 97.848  1.00 16.56 ? 200 LYS A CB  1 
ATOM   603  C  CG  . LYS A 1 77  ? 25.089 38.862 99.110  1.00 18.51 ? 200 LYS A CG  1 
ATOM   604  C  CD  . LYS A 1 77  ? 25.965 39.423 100.231 1.00 21.54 ? 200 LYS A CD  1 
ATOM   605  C  CE  . LYS A 1 77  ? 25.138 40.132 101.297 1.00 22.70 ? 200 LYS A CE  1 
ATOM   606  N  NZ  . LYS A 1 77  ? 24.562 41.422 100.808 1.00 24.22 ? 200 LYS A NZ  1 
ATOM   607  N  N   . HIS A 1 78  ? 28.831 39.721 96.413  1.00 14.38 ? 201 HIS A N   1 
ATOM   608  C  CA  . HIS A 1 78  ? 29.946 39.436 95.512  1.00 13.31 ? 201 HIS A CA  1 
ATOM   609  C  C   . HIS A 1 78  ? 30.026 37.935 95.211  1.00 12.99 ? 201 HIS A C   1 
ATOM   610  O  O   . HIS A 1 78  ? 30.226 37.116 96.118  1.00 12.71 ? 201 HIS A O   1 
ATOM   611  C  CB  . HIS A 1 78  ? 31.246 39.934 96.149  1.00 13.35 ? 201 HIS A CB  1 
ATOM   612  C  CG  . HIS A 1 78  ? 32.425 39.949 95.225  1.00 12.65 ? 201 HIS A CG  1 
ATOM   613  N  ND1 . HIS A 1 78  ? 33.640 40.484 95.591  1.00 12.65 ? 201 HIS A ND1 1 
ATOM   614  C  CD2 . HIS A 1 78  ? 32.575 39.515 93.950  1.00 11.76 ? 201 HIS A CD2 1 
ATOM   615  C  CE1 . HIS A 1 78  ? 34.493 40.363 94.589  1.00 12.16 ? 201 HIS A CE1 1 
ATOM   616  N  NE2 . HIS A 1 78  ? 33.872 39.774 93.584  1.00 11.92 ? 201 HIS A NE2 1 
ATOM   617  N  N   . MET A 1 79  ? 29.861 37.590 93.934  1.00 12.16 ? 202 MET A N   1 
ATOM   618  C  CA  . MET A 1 79  ? 29.799 36.193 93.485  1.00 11.89 ? 202 MET A CA  1 
ATOM   619  C  C   . MET A 1 79  ? 31.106 35.426 93.673  1.00 11.71 ? 202 MET A C   1 
ATOM   620  O  O   . MET A 1 79  ? 31.089 34.257 94.079  1.00 11.83 ? 202 MET A O   1 
ATOM   621  C  CB  . MET A 1 79  ? 29.364 36.122 92.021  1.00 11.73 ? 202 MET A CB  1 
ATOM   622  C  CG  . MET A 1 79  ? 27.888 36.380 91.805  1.00 11.65 ? 202 MET A CG  1 
ATOM   623  S  SD  . MET A 1 79  ? 27.540 36.633 90.060  1.00 11.69 ? 202 MET A SD  1 
ATOM   624  C  CE  . MET A 1 79  ? 25.758 36.518 90.055  1.00 12.05 ? 202 MET A CE  1 
ATOM   625  N  N   . LEU A 1 80  ? 32.219 36.088 93.360  1.00 11.54 ? 203 LEU A N   1 
ATOM   626  C  CA  . LEU A 1 80  ? 33.582 35.566 93.557  1.00 11.66 ? 203 LEU A CA  1 
ATOM   627  C  C   . LEU A 1 80  ? 33.915 34.336 92.705  1.00 11.61 ? 203 LEU A C   1 
ATOM   628  O  O   . LEU A 1 80  ? 34.556 33.397 93.182  1.00 11.50 ? 203 LEU A O   1 
ATOM   629  C  CB  . LEU A 1 80  ? 33.860 35.284 95.046  1.00 11.82 ? 203 LEU A CB  1 
ATOM   630  C  CG  . LEU A 1 80  ? 33.916 36.480 96.000  1.00 12.46 ? 203 LEU A CG  1 
ATOM   631  C  CD1 . LEU A 1 80  ? 33.695 36.037 97.441  1.00 13.38 ? 203 LEU A CD1 1 
ATOM   632  C  CD2 . LEU A 1 80  ? 35.236 37.228 95.854  1.00 12.90 ? 203 LEU A CD2 1 
ATOM   633  N  N   . LEU A 1 81  ? 33.488 34.345 91.444  1.00 11.46 ? 204 LEU A N   1 
ATOM   634  C  CA  . LEU A 1 81  ? 33.738 33.206 90.567  1.00 11.25 ? 204 LEU A CA  1 
ATOM   635  C  C   . LEU A 1 81  ? 34.462 33.626 89.279  1.00 11.02 ? 204 LEU A C   1 
ATOM   636  O  O   . LEU A 1 81  ? 35.430 34.388 89.346  1.00 11.16 ? 204 LEU A O   1 
ATOM   637  C  CB  . LEU A 1 81  ? 32.442 32.413 90.319  1.00 11.07 ? 204 LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 81  ? 31.837 31.733 91.565  1.00 11.46 ? 204 LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 81  ? 30.418 31.255 91.303  1.00 12.09 ? 204 LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 81  ? 32.711 30.588 92.087  1.00 12.26 ? 204 LEU A CD2 1 
ATOM   641  N  N   . LEU A 1 82  ? 34.007 33.145 88.125  1.00 10.79 ? 205 LEU A N   1 
ATOM   642  C  CA  . LEU A 1 82  ? 34.712 33.394 86.858  1.00 10.60 ? 205 LEU A CA  1 
ATOM   643  C  C   . LEU A 1 82  ? 34.221 34.654 86.127  1.00 10.07 ? 205 LEU A C   1 
ATOM   644  O  O   . LEU A 1 82  ? 33.710 35.569 86.766  1.00 9.83  ? 205 LEU A O   1 
ATOM   645  C  CB  . LEU A 1 82  ? 34.679 32.149 85.964  1.00 11.05 ? 205 LEU A CB  1 
ATOM   646  C  CG  . LEU A 1 82  ? 35.236 30.887 86.635  1.00 11.70 ? 205 LEU A CG  1 
ATOM   647  C  CD1 . LEU A 1 82  ? 34.999 29.679 85.744  1.00 13.66 ? 205 LEU A CD1 1 
ATOM   648  C  CD2 . LEU A 1 82  ? 36.717 31.037 86.994  1.00 12.91 ? 205 LEU A CD2 1 
ATOM   649  N  N   . THR A 1 83  ? 34.406 34.710 84.806  1.00 9.47  ? 206 THR A N   1 
ATOM   650  C  CA  . THR A 1 83  ? 34.115 35.929 84.039  1.00 9.15  ? 206 THR A CA  1 
ATOM   651  C  C   . THR A 1 83  ? 33.482 35.603 82.683  1.00 8.83  ? 206 THR A C   1 
ATOM   652  O  O   . THR A 1 83  ? 34.081 35.827 81.629  1.00 8.50  ? 206 THR A O   1 
ATOM   653  C  CB  . THR A 1 83  ? 35.394 36.791 83.852  1.00 9.27  ? 206 THR A CB  1 
ATOM   654  O  OG1 . THR A 1 83  ? 36.118 36.852 85.085  1.00 9.38  ? 206 THR A OG1 1 
ATOM   655  C  CG2 . THR A 1 83  ? 35.047 38.216 83.387  1.00 8.80  ? 206 THR A CG2 1 
ATOM   656  N  N   . ASN A 1 84  ? 32.260 35.078 82.717  1.00 8.52  ? 207 ASN A N   1 
ATOM   657  C  CA  . ASN A 1 84  ? 31.594 34.632 81.495  1.00 8.30  ? 207 ASN A CA  1 
ATOM   658  C  C   . ASN A 1 84  ? 30.876 35.777 80.778  1.00 8.11  ? 207 ASN A C   1 
ATOM   659  O  O   . ASN A 1 84  ? 29.647 35.853 80.749  1.00 8.25  ? 207 ASN A O   1 
ATOM   660  C  CB  . ASN A 1 84  ? 30.676 33.440 81.789  1.00 8.40  ? 207 ASN A CB  1 
ATOM   661  C  CG  . ASN A 1 84  ? 31.454 32.194 82.184  1.00 9.41  ? 207 ASN A CG  1 
ATOM   662  O  OD1 . ASN A 1 84  ? 32.584 31.984 81.734  1.00 10.62 ? 207 ASN A OD1 1 
ATOM   663  N  ND2 . ASN A 1 84  ? 30.856 31.362 83.032  1.00 8.81  ? 207 ASN A ND2 1 
ATOM   664  N  N   . THR A 1 85  ? 31.686 36.655 80.187  1.00 8.01  ? 208 THR A N   1 
ATOM   665  C  CA  . THR A 1 85  ? 31.231 37.912 79.586  1.00 7.83  ? 208 THR A CA  1 
ATOM   666  C  C   . THR A 1 85  ? 30.294 37.721 78.390  1.00 7.86  ? 208 THR A C   1 
ATOM   667  O  O   . THR A 1 85  ? 29.318 38.462 78.244  1.00 7.57  ? 208 THR A O   1 
ATOM   668  C  CB  . THR A 1 85  ? 32.443 38.782 79.174  1.00 7.93  ? 208 THR A CB  1 
ATOM   669  O  OG1 . THR A 1 85  ? 33.396 38.802 80.246  1.00 7.85  ? 208 THR A OG1 1 
ATOM   670  C  CG2 . THR A 1 85  ? 32.016 40.214 78.844  1.00 7.74  ? 208 THR A CG2 1 
ATOM   671  N  N   . PHE A 1 86  ? 30.586 36.744 77.532  1.00 8.10  ? 209 PHE A N   1 
ATOM   672  C  CA  . PHE A 1 86  ? 29.712 36.473 76.386  1.00 7.99  ? 209 PHE A CA  1 
ATOM   673  C  C   . PHE A 1 86  ? 28.313 36.104 76.869  1.00 7.81  ? 209 PHE A C   1 
ATOM   674  O  O   . PHE A 1 86  ? 27.320 36.694 76.433  1.00 7.31  ? 209 PHE A O   1 
ATOM   675  C  CB  . PHE A 1 86  ? 30.263 35.343 75.511  1.00 8.34  ? 209 PHE A CB  1 
ATOM   676  C  CG  . PHE A 1 86  ? 31.354 35.766 74.567  1.00 9.45  ? 209 PHE A CG  1 
ATOM   677  C  CD1 . PHE A 1 86  ? 31.047 36.203 73.278  1.00 10.84 ? 209 PHE A CD1 1 
ATOM   678  C  CD2 . PHE A 1 86  ? 32.691 35.688 74.949  1.00 10.24 ? 209 PHE A CD2 1 
ATOM   679  C  CE1 . PHE A 1 86  ? 32.055 36.573 72.392  1.00 11.26 ? 209 PHE A CE1 1 
ATOM   680  C  CE2 . PHE A 1 86  ? 33.709 36.056 74.065  1.00 11.17 ? 209 PHE A CE2 1 
ATOM   681  C  CZ  . PHE A 1 86  ? 33.389 36.497 72.788  1.00 10.72 ? 209 PHE A CZ  1 
ATOM   682  N  N   . GLY A 1 87  ? 28.246 35.135 77.783  1.00 7.74  ? 210 GLY A N   1 
ATOM   683  C  CA  . GLY A 1 87  ? 26.977 34.683 78.344  1.00 7.84  ? 210 GLY A CA  1 
ATOM   684  C  C   . GLY A 1 87  ? 26.230 35.801 79.042  1.00 7.94  ? 210 GLY A C   1 
ATOM   685  O  O   . GLY A 1 87  ? 25.007 35.894 78.943  1.00 7.70  ? 210 GLY A O   1 
ATOM   686  N  N   . ALA A 1 88  ? 26.981 36.652 79.739  1.00 7.61  ? 211 ALA A N   1 
ATOM   687  C  CA  . ALA A 1 88  ? 26.420 37.778 80.486  1.00 7.89  ? 211 ALA A CA  1 
ATOM   688  C  C   . ALA A 1 88  ? 25.743 38.798 79.586  1.00 7.79  ? 211 ALA A C   1 
ATOM   689  O  O   . ALA A 1 88  ? 24.620 39.211 79.858  1.00 8.42  ? 211 ALA A O   1 
ATOM   690  C  CB  . ALA A 1 88  ? 27.498 38.448 81.321  1.00 7.78  ? 211 ALA A CB  1 
ATOM   691  N  N   . ILE A 1 89  ? 26.428 39.198 78.517  1.00 7.80  ? 212 ILE A N   1 
ATOM   692  C  CA  . ILE A 1 89  ? 25.878 40.164 77.561  1.00 7.76  ? 212 ILE A CA  1 
ATOM   693  C  C   . ILE A 1 89  ? 24.619 39.592 76.898  1.00 7.80  ? 212 ILE A C   1 
ATOM   694  O  O   . ILE A 1 89  ? 23.627 40.300 76.714  1.00 7.67  ? 212 ILE A O   1 
ATOM   695  C  CB  . ILE A 1 89  ? 26.936 40.586 76.510  1.00 7.55  ? 212 ILE A CB  1 
ATOM   696  C  CG1 . ILE A 1 89  ? 28.020 41.441 77.182  1.00 7.85  ? 212 ILE A CG1 1 
ATOM   697  C  CG2 . ILE A 1 89  ? 26.292 41.357 75.362  1.00 7.45  ? 212 ILE A CG2 1 
ATOM   698  C  CD1 . ILE A 1 89  ? 29.315 41.538 76.395  1.00 7.72  ? 212 ILE A CD1 1 
ATOM   699  N  N   . ASN A 1 90  ? 24.661 38.305 76.565  1.00 8.05  ? 213 ASN A N   1 
ATOM   700  C  CA  . ASN A 1 90  ? 23.487 37.619 76.029  1.00 8.42  ? 213 ASN A CA  1 
ATOM   701  C  C   . ASN A 1 90  ? 22.329 37.560 77.025  1.00 8.38  ? 213 ASN A C   1 
ATOM   702  O  O   . ASN A 1 90  ? 21.169 37.729 76.641  1.00 8.47  ? 213 ASN A O   1 
ATOM   703  C  CB  . ASN A 1 90  ? 23.859 36.228 75.516  1.00 8.57  ? 213 ASN A CB  1 
ATOM   704  C  CG  . ASN A 1 90  ? 24.508 36.278 74.149  1.00 10.26 ? 213 ASN A CG  1 
ATOM   705  O  OD1 . ASN A 1 90  ? 23.877 36.668 73.167  1.00 12.32 ? 213 ASN A OD1 1 
ATOM   706  N  ND2 . ASN A 1 90  ? 25.773 35.893 74.079  1.00 11.10 ? 213 ASN A ND2 1 
ATOM   707  N  N   . TYR A 1 91  ? 22.650 37.341 78.299  1.00 8.20  ? 214 TYR A N   1 
ATOM   708  C  CA  . TYR A 1 91  ? 21.639 37.373 79.362  1.00 8.14  ? 214 TYR A CA  1 
ATOM   709  C  C   . TYR A 1 91  ? 20.957 38.746 79.440  1.00 7.98  ? 214 TYR A C   1 
ATOM   710  O  O   . TYR A 1 91  ? 19.735 38.830 79.536  1.00 7.57  ? 214 TYR A O   1 
ATOM   711  C  CB  . TYR A 1 91  ? 22.248 36.981 80.717  1.00 8.22  ? 214 TYR A CB  1 
ATOM   712  C  CG  . TYR A 1 91  ? 21.254 36.971 81.864  1.00 9.87  ? 214 TYR A CG  1 
ATOM   713  C  CD1 . TYR A 1 91  ? 20.464 35.850 82.119  1.00 11.63 ? 214 TYR A CD1 1 
ATOM   714  C  CD2 . TYR A 1 91  ? 21.105 38.084 82.691  1.00 10.79 ? 214 TYR A CD2 1 
ATOM   715  C  CE1 . TYR A 1 91  ? 19.547 35.844 83.169  1.00 12.95 ? 214 TYR A CE1 1 
ATOM   716  C  CE2 . TYR A 1 91  ? 20.197 38.086 83.742  1.00 13.71 ? 214 TYR A CE2 1 
ATOM   717  C  CZ  . TYR A 1 91  ? 19.420 36.962 83.972  1.00 13.87 ? 214 TYR A CZ  1 
ATOM   718  O  OH  . TYR A 1 91  ? 18.519 36.963 85.013  1.00 16.80 ? 214 TYR A OH  1 
ATOM   719  N  N   . VAL A 1 92  ? 21.747 39.817 79.396  1.00 7.59  ? 215 VAL A N   1 
ATOM   720  C  CA  . VAL A 1 92  ? 21.187 41.171 79.406  1.00 7.81  ? 215 VAL A CA  1 
ATOM   721  C  C   . VAL A 1 92  ? 20.233 41.382 78.225  1.00 8.35  ? 215 VAL A C   1 
ATOM   722  O  O   . VAL A 1 92  ? 19.110 41.865 78.401  1.00 8.17  ? 215 VAL A O   1 
ATOM   723  C  CB  . VAL A 1 92  ? 22.296 42.254 79.424  1.00 7.77  ? 215 VAL A CB  1 
ATOM   724  C  CG1 . VAL A 1 92  ? 21.713 43.647 79.145  1.00 7.19  ? 215 VAL A CG1 1 
ATOM   725  C  CG2 . VAL A 1 92  ? 23.019 42.240 80.767  1.00 7.02  ? 215 VAL A CG2 1 
ATOM   726  N  N   . ALA A 1 93  ? 20.682 40.991 77.035  1.00 8.92  ? 216 ALA A N   1 
ATOM   727  C  CA  . ALA A 1 93  ? 19.924 41.205 75.800  1.00 9.83  ? 216 ALA A CA  1 
ATOM   728  C  C   . ALA A 1 93  ? 18.583 40.468 75.793  1.00 10.21 ? 216 ALA A C   1 
ATOM   729  O  O   . ALA A 1 93  ? 17.578 41.015 75.342  1.00 10.63 ? 216 ALA A O   1 
ATOM   730  C  CB  . ALA A 1 93  ? 20.765 40.805 74.588  1.00 9.69  ? 216 ALA A CB  1 
ATOM   731  N  N   . THR A 1 94  ? 18.569 39.249 76.330  1.00 10.77 ? 217 THR A N   1 
ATOM   732  C  CA  . THR A 1 94  ? 17.394 38.372 76.257  1.00 11.37 ? 217 THR A CA  1 
ATOM   733  C  C   . THR A 1 94  ? 16.557 38.275 77.541  1.00 10.93 ? 217 THR A C   1 
ATOM   734  O  O   . THR A 1 94  ? 15.380 37.908 77.484  1.00 11.12 ? 217 THR A O   1 
ATOM   735  C  CB  . THR A 1 94  ? 17.798 36.942 75.817  1.00 11.45 ? 217 THR A CB  1 
ATOM   736  O  OG1 . THR A 1 94  ? 18.660 36.362 76.805  1.00 12.97 ? 217 THR A OG1 1 
ATOM   737  C  CG2 . THR A 1 94  ? 18.525 36.981 74.478  1.00 12.53 ? 217 THR A CG2 1 
ATOM   738  N  N   . GLU A 1 95  ? 17.148 38.601 78.692  1.00 10.43 ? 218 GLU A N   1 
ATOM   739  C  CA  . GLU A 1 95  ? 16.464 38.405 79.978  1.00 10.15 ? 218 GLU A CA  1 
ATOM   740  C  C   . GLU A 1 95  ? 16.294 39.670 80.814  1.00 9.65  ? 218 GLU A C   1 
ATOM   741  O  O   . GLU A 1 95  ? 15.632 39.638 81.853  1.00 9.57  ? 218 GLU A O   1 
ATOM   742  C  CB  . GLU A 1 95  ? 17.185 37.345 80.826  1.00 10.38 ? 218 GLU A CB  1 
ATOM   743  C  CG  . GLU A 1 95  ? 17.530 36.054 80.098  1.00 10.41 ? 218 GLU A CG  1 
ATOM   744  C  CD  . GLU A 1 95  ? 16.315 35.245 79.689  1.00 10.89 ? 218 GLU A CD  1 
ATOM   745  O  OE1 . GLU A 1 95  ? 16.507 34.267 78.943  1.00 10.44 ? 218 GLU A OE1 1 
ATOM   746  O  OE2 . GLU A 1 95  ? 15.178 35.584 80.093  1.00 10.51 ? 218 GLU A OE2 1 
ATOM   747  N  N   . VAL A 1 96  ? 16.894 40.774 80.373  1.00 9.17  ? 219 VAL A N   1 
ATOM   748  C  CA  . VAL A 1 96  ? 16.856 42.025 81.143  1.00 8.99  ? 219 VAL A CA  1 
ATOM   749  C  C   . VAL A 1 96  ? 16.142 43.145 80.378  1.00 9.19  ? 219 VAL A C   1 
ATOM   750  O  O   . VAL A 1 96  ? 15.247 43.788 80.922  1.00 9.00  ? 219 VAL A O   1 
ATOM   751  C  CB  . VAL A 1 96  ? 18.273 42.472 81.597  1.00 8.92  ? 219 VAL A CB  1 
ATOM   752  C  CG1 . VAL A 1 96  ? 18.205 43.761 82.417  1.00 8.38  ? 219 VAL A CG1 1 
ATOM   753  C  CG2 . VAL A 1 96  ? 18.942 41.366 82.409  1.00 8.76  ? 219 VAL A CG2 1 
ATOM   754  N  N   . PHE A 1 97  ? 16.549 43.374 79.131  1.00 9.61  ? 220 PHE A N   1 
ATOM   755  C  CA  . PHE A 1 97  ? 15.850 44.306 78.247  1.00 10.16 ? 220 PHE A CA  1 
ATOM   756  C  C   . PHE A 1 97  ? 14.540 43.671 77.801  1.00 10.91 ? 220 PHE A C   1 
ATOM   757  O  O   . PHE A 1 97  ? 14.434 43.137 76.693  1.00 11.12 ? 220 PHE A O   1 
ATOM   758  C  CB  . PHE A 1 97  ? 16.709 44.669 77.035  1.00 9.90  ? 220 PHE A CB  1 
ATOM   759  C  CG  . PHE A 1 97  ? 17.734 45.732 77.310  1.00 9.42  ? 220 PHE A CG  1 
ATOM   760  C  CD1 . PHE A 1 97  ? 17.348 47.054 77.529  1.00 8.96  ? 220 PHE A CD1 1 
ATOM   761  C  CD2 . PHE A 1 97  ? 19.088 45.417 77.334  1.00 9.30  ? 220 PHE A CD2 1 
ATOM   762  C  CE1 . PHE A 1 97  ? 18.300 48.045 77.773  1.00 9.06  ? 220 PHE A CE1 1 
ATOM   763  C  CE2 . PHE A 1 97  ? 20.047 46.399 77.577  1.00 9.11  ? 220 PHE A CE2 1 
ATOM   764  C  CZ  . PHE A 1 97  ? 19.653 47.718 77.796  1.00 8.78  ? 220 PHE A CZ  1 
ATOM   765  N  N   . ARG A 1 98  ? 13.560 43.723 78.696  1.00 11.62 ? 221 ARG A N   1 
ATOM   766  C  CA  . ARG A 1 98  ? 12.277 43.062 78.518  1.00 12.59 ? 221 ARG A CA  1 
ATOM   767  C  C   . ARG A 1 98  ? 11.183 43.950 79.087  1.00 12.81 ? 221 ARG A C   1 
ATOM   768  O  O   . ARG A 1 98  ? 11.313 44.473 80.196  1.00 12.75 ? 221 ARG A O   1 
ATOM   769  C  CB  . ARG A 1 98  ? 12.268 41.720 79.264  1.00 12.79 ? 221 ARG A CB  1 
ATOM   770  C  CG  . ARG A 1 98  ? 13.272 40.692 78.771  1.00 13.47 ? 221 ARG A CG  1 
ATOM   771  C  CD  . ARG A 1 98  ? 12.735 39.898 77.600  1.00 14.89 ? 221 ARG A CD  1 
ATOM   772  N  NE  . ARG A 1 98  ? 11.469 39.238 77.923  1.00 15.44 ? 221 ARG A NE  1 
ATOM   773  C  CZ  . ARG A 1 98  ? 11.356 38.072 78.551  1.00 16.03 ? 221 ARG A CZ  1 
ATOM   774  N  NH1 . ARG A 1 98  ? 12.436 37.402 78.933  1.00 16.70 ? 221 ARG A NH1 1 
ATOM   775  N  NH2 . ARG A 1 98  ? 10.149 37.568 78.789  1.00 16.02 ? 221 ARG A NH2 1 
ATOM   776  N  N   . GLU A 1 99  ? 10.100 44.116 78.331  1.00 13.60 ? 222 GLU A N   1 
ATOM   777  C  CA  . GLU A 1 99  ? 8.962  44.909 78.795  1.00 13.99 ? 222 GLU A CA  1 
ATOM   778  C  C   . GLU A 1 99  ? 8.427  44.407 80.136  1.00 14.35 ? 222 GLU A C   1 
ATOM   779  O  O   . GLU A 1 99  ? 8.047  45.206 80.991  1.00 14.30 ? 222 GLU A O   1 
ATOM   780  C  CB  . GLU A 1 99  ? 7.847  44.904 77.757  1.00 14.04 ? 222 GLU A CB  1 
ATOM   781  C  CG  . GLU A 1 99  ? 8.181  45.646 76.487  1.00 14.44 ? 222 GLU A CG  1 
ATOM   782  C  CD  . GLU A 1 99  ? 7.036  45.618 75.507  1.00 15.47 ? 222 GLU A CD  1 
ATOM   783  O  OE1 . GLU A 1 99  ? 5.972  46.190 75.820  1.00 15.93 ? 222 GLU A OE1 1 
ATOM   784  O  OE2 . GLU A 1 99  ? 7.199  45.021 74.426  1.00 17.51 ? 222 GLU A OE2 1 
ATOM   785  N  N   . GLU A 1 100 ? 8.425  43.084 80.317  1.00 15.11 ? 223 GLU A N   1 
ATOM   786  C  CA  . GLU A 1 100 ? 7.978  42.454 81.567  1.00 15.85 ? 223 GLU A CA  1 
ATOM   787  C  C   . GLU A 1 100 ? 8.709  43.003 82.792  1.00 15.66 ? 223 GLU A C   1 
ATOM   788  O  O   . GLU A 1 100 ? 8.158  43.023 83.894  1.00 16.16 ? 223 GLU A O   1 
ATOM   789  C  CB  . GLU A 1 100 ? 8.173  40.931 81.511  1.00 16.29 ? 223 GLU A CB  1 
ATOM   790  C  CG  . GLU A 1 100 ? 7.251  40.186 80.551  1.00 17.74 ? 223 GLU A CG  1 
ATOM   791  C  CD  . GLU A 1 100 ? 7.806  40.058 79.139  1.00 19.44 ? 223 GLU A CD  1 
ATOM   792  O  OE1 . GLU A 1 100 ? 8.717  40.822 78.756  1.00 20.61 ? 223 GLU A OE1 1 
ATOM   793  O  OE2 . GLU A 1 100 ? 7.317  39.182 78.395  1.00 20.26 ? 223 GLU A OE2 1 
ATOM   794  N  N   . LEU A 1 101 ? 9.951  43.441 82.587  1.00 15.26 ? 224 LEU A N   1 
ATOM   795  C  CA  . LEU A 1 101 ? 10.803 43.925 83.671  1.00 14.78 ? 224 LEU A CA  1 
ATOM   796  C  C   . LEU A 1 101 ? 10.927 45.446 83.706  1.00 14.08 ? 224 LEU A C   1 
ATOM   797  O  O   . LEU A 1 101 ? 11.775 45.992 84.413  1.00 13.89 ? 224 LEU A O   1 
ATOM   798  C  CB  . LEU A 1 101 ? 12.185 43.274 83.592  1.00 15.19 ? 224 LEU A CB  1 
ATOM   799  C  CG  . LEU A 1 101 ? 12.249 41.760 83.801  1.00 16.27 ? 224 LEU A CG  1 
ATOM   800  C  CD1 . LEU A 1 101 ? 13.693 41.327 83.865  1.00 17.62 ? 224 LEU A CD1 1 
ATOM   801  C  CD2 . LEU A 1 101 ? 11.497 41.324 85.064  1.00 17.52 ? 224 LEU A CD2 1 
ATOM   802  N  N   . GLY A 1 102 ? 10.070 46.117 82.942  1.00 13.38 ? 225 GLY A N   1 
ATOM   803  C  CA  . GLY A 1 102 ? 9.978  47.573 82.967  1.00 12.70 ? 225 GLY A CA  1 
ATOM   804  C  C   . GLY A 1 102 ? 10.714 48.289 81.853  1.00 12.09 ? 225 GLY A C   1 
ATOM   805  O  O   . GLY A 1 102 ? 10.736 49.522 81.826  1.00 12.08 ? 225 GLY A O   1 
ATOM   806  N  N   . ALA A 1 103 ? 11.326 47.532 80.938  1.00 11.87 ? 226 ALA A N   1 
ATOM   807  C  CA  . ALA A 1 103 ? 11.951 48.130 79.754  1.00 11.59 ? 226 ALA A CA  1 
ATOM   808  C  C   . ALA A 1 103 ? 10.892 48.789 78.878  1.00 11.63 ? 226 ALA A C   1 
ATOM   809  O  O   . ALA A 1 103 ? 9.779  48.274 78.733  1.00 11.34 ? 226 ALA A O   1 
ATOM   810  C  CB  . ALA A 1 103 ? 12.729 47.101 78.963  1.00 11.62 ? 226 ALA A CB  1 
ATOM   811  N  N   . ARG A 1 104 ? 11.246 49.934 78.306  1.00 11.48 ? 227 ARG A N   1 
ATOM   812  C  CA  . ARG A 1 104 ? 10.310 50.721 77.514  1.00 12.04 ? 227 ARG A CA  1 
ATOM   813  C  C   . ARG A 1 104 ? 10.492 50.425 76.036  1.00 12.46 ? 227 ARG A C   1 
ATOM   814  O  O   . ARG A 1 104 ? 11.613 50.497 75.526  1.00 11.94 ? 227 ARG A O   1 
ATOM   815  C  CB  . ARG A 1 104 ? 10.497 52.217 77.789  1.00 11.57 ? 227 ARG A CB  1 
ATOM   816  C  CG  . ARG A 1 104 ? 10.066 52.629 79.185  1.00 12.09 ? 227 ARG A CG  1 
ATOM   817  C  CD  . ARG A 1 104 ? 10.520 54.038 79.535  1.00 11.62 ? 227 ARG A CD  1 
ATOM   818  N  NE  . ARG A 1 104 ? 11.969 54.124 79.735  1.00 11.28 ? 227 ARG A NE  1 
ATOM   819  C  CZ  . ARG A 1 104 ? 12.611 55.214 80.149  1.00 11.08 ? 227 ARG A CZ  1 
ATOM   820  N  NH1 . ARG A 1 104 ? 11.943 56.334 80.408  1.00 10.36 ? 227 ARG A NH1 1 
ATOM   821  N  NH2 . ARG A 1 104 ? 13.928 55.187 80.298  1.00 10.06 ? 227 ARG A NH2 1 
ATOM   822  N  N   . PRO A 1 105 ? 9.388  50.079 75.339  1.00 13.45 ? 228 PRO A N   1 
ATOM   823  C  CA  . PRO A 1 105 ? 9.473  49.849 73.906  1.00 14.12 ? 228 PRO A CA  1 
ATOM   824  C  C   . PRO A 1 105 ? 10.049 51.064 73.189  1.00 14.30 ? 228 PRO A C   1 
ATOM   825  O  O   . PRO A 1 105 ? 9.715  52.207 73.524  1.00 14.97 ? 228 PRO A O   1 
ATOM   826  C  CB  . PRO A 1 105 ? 8.012  49.605 73.487  1.00 14.33 ? 228 PRO A CB  1 
ATOM   827  C  CG  . PRO A 1 105 ? 7.179  50.056 74.635  1.00 14.64 ? 228 PRO A CG  1 
ATOM   828  C  CD  . PRO A 1 105 ? 8.023  49.867 75.849  1.00 13.51 ? 228 PRO A CD  1 
ATOM   829  N  N   . ASP A 1 106 ? 10.946 50.800 72.244  1.00 14.32 ? 229 ASP A N   1 
ATOM   830  C  CA  . ASP A 1 106 ? 11.535 51.827 71.376  1.00 14.09 ? 229 ASP A CA  1 
ATOM   831  C  C   . ASP A 1 106 ? 12.520 52.778 72.066  1.00 13.57 ? 229 ASP A C   1 
ATOM   832  O  O   . ASP A 1 106 ? 13.020 53.715 71.434  1.00 13.59 ? 229 ASP A O   1 
ATOM   833  C  CB  . ASP A 1 106 ? 10.439 52.611 70.636  1.00 14.50 ? 229 ASP A CB  1 
ATOM   834  C  CG  . ASP A 1 106 ? 9.470  51.704 69.892  1.00 15.22 ? 229 ASP A CG  1 
ATOM   835  O  OD1 . ASP A 1 106 ? 9.910  50.692 69.298  1.00 16.78 ? 229 ASP A OD1 1 
ATOM   836  O  OD2 . ASP A 1 106 ? 8.262  52.002 69.904  1.00 16.98 ? 229 ASP A OD2 1 
ATOM   837  N  N   . ALA A 1 107 ? 12.806 52.542 73.347  1.00 12.60 ? 230 ALA A N   1 
ATOM   838  C  CA  . ALA A 1 107 ? 13.798 53.347 74.061  1.00 11.80 ? 230 ALA A CA  1 
ATOM   839  C  C   . ALA A 1 107 ? 15.183 53.055 73.501  1.00 11.33 ? 230 ALA A C   1 
ATOM   840  O  O   . ALA A 1 107 ? 15.431 51.977 72.958  1.00 10.94 ? 230 ALA A O   1 
ATOM   841  C  CB  . ALA A 1 107 ? 13.765 53.057 75.555  1.00 11.79 ? 230 ALA A CB  1 
ATOM   842  N  N   . THR A 1 108 ? 16.078 54.028 73.620  1.00 10.68 ? 231 THR A N   1 
ATOM   843  C  CA  . THR A 1 108 ? 17.476 53.807 73.279  1.00 10.57 ? 231 THR A CA  1 
ATOM   844  C  C   . THR A 1 108 ? 18.069 52.897 74.352  1.00 10.15 ? 231 THR A C   1 
ATOM   845  O  O   . THR A 1 108 ? 17.972 53.191 75.540  1.00 10.14 ? 231 THR A O   1 
ATOM   846  C  CB  . THR A 1 108 ? 18.251 55.134 73.212  1.00 10.61 ? 231 THR A CB  1 
ATOM   847  O  OG1 . THR A 1 108 ? 17.655 55.980 72.221  1.00 11.18 ? 231 THR A OG1 1 
ATOM   848  C  CG2 . THR A 1 108 ? 19.714 54.891 72.849  1.00 10.93 ? 231 THR A CG2 1 
ATOM   849  N  N   . LYS A 1 109 ? 18.656 51.781 73.925  1.00 10.00 ? 232 LYS A N   1 
ATOM   850  C  CA  . LYS A 1 109 ? 19.262 50.829 74.854  1.00 9.84  ? 232 LYS A CA  1 
ATOM   851  C  C   . LYS A 1 109 ? 20.751 51.091 74.987  1.00 9.51  ? 232 LYS A C   1 
ATOM   852  O  O   . LYS A 1 109 ? 21.453 51.239 73.981  1.00 9.47  ? 232 LYS A O   1 
ATOM   853  C  CB  . LYS A 1 109 ? 19.045 49.391 74.378  1.00 9.87  ? 232 LYS A CB  1 
ATOM   854  C  CG  . LYS A 1 109 ? 17.591 48.958 74.324  1.00 10.62 ? 232 LYS A CG  1 
ATOM   855  C  CD  . LYS A 1 109 ? 17.499 47.500 73.901  1.00 12.42 ? 232 LYS A CD  1 
ATOM   856  C  CE  . LYS A 1 109 ? 16.058 47.061 73.775  1.00 14.99 ? 232 LYS A CE  1 
ATOM   857  N  NZ  . LYS A 1 109 ? 15.952 45.677 73.234  1.00 15.02 ? 232 LYS A NZ  1 
ATOM   858  N  N   . VAL A 1 110 ? 21.221 51.142 76.234  1.00 9.21  ? 233 VAL A N   1 
ATOM   859  C  CA  . VAL A 1 110 ? 22.640 51.341 76.537  1.00 8.69  ? 233 VAL A CA  1 
ATOM   860  C  C   . VAL A 1 110 ? 23.125 50.291 77.540  1.00 8.39  ? 233 VAL A C   1 
ATOM   861  O  O   . VAL A 1 110 ? 22.419 49.950 78.493  1.00 8.41  ? 233 VAL A O   1 
ATOM   862  C  CB  . VAL A 1 110 ? 22.932 52.766 77.093  1.00 8.73  ? 233 VAL A CB  1 
ATOM   863  C  CG1 . VAL A 1 110 ? 24.428 52.954 77.343  1.00 8.89  ? 233 VAL A CG1 1 
ATOM   864  C  CG2 . VAL A 1 110 ? 22.422 53.843 76.135  1.00 8.89  ? 233 VAL A CG2 1 
ATOM   865  N  N   . LEU A 1 111 ? 24.323 49.772 77.294  1.00 7.99  ? 234 LEU A N   1 
ATOM   866  C  CA  . LEU A 1 111 ? 25.005 48.893 78.234  1.00 7.92  ? 234 LEU A CA  1 
ATOM   867  C  C   . LEU A 1 111 ? 26.297 49.535 78.687  1.00 7.75  ? 234 LEU A C   1 
ATOM   868  O  O   . LEU A 1 111 ? 27.059 50.046 77.870  1.00 7.75  ? 234 LEU A O   1 
ATOM   869  C  CB  . LEU A 1 111 ? 25.331 47.543 77.586  1.00 7.80  ? 234 LEU A CB  1 
ATOM   870  C  CG  . LEU A 1 111 ? 24.633 46.272 78.072  1.00 8.28  ? 234 LEU A CG  1 
ATOM   871  C  CD1 . LEU A 1 111 ? 24.994 45.111 77.156  1.00 8.06  ? 234 LEU A CD1 1 
ATOM   872  C  CD2 . LEU A 1 111 ? 25.016 45.945 79.519  1.00 7.99  ? 234 LEU A CD2 1 
ATOM   873  N  N   . ILE A 1 112 ? 26.537 49.518 79.993  1.00 7.55  ? 235 ILE A N   1 
ATOM   874  C  CA  . ILE A 1 112 ? 27.857 49.849 80.516  1.00 7.30  ? 235 ILE A CA  1 
ATOM   875  C  C   . ILE A 1 112 ? 28.382 48.579 81.172  1.00 7.05  ? 235 ILE A C   1 
ATOM   876  O  O   . ILE A 1 112 ? 27.868 48.144 82.203  1.00 7.05  ? 235 ILE A O   1 
ATOM   877  C  CB  . ILE A 1 112 ? 27.823 51.024 81.516  1.00 7.46  ? 235 ILE A CB  1 
ATOM   878  C  CG1 . ILE A 1 112 ? 27.390 52.311 80.804  1.00 7.94  ? 235 ILE A CG1 1 
ATOM   879  C  CG2 . ILE A 1 112 ? 29.197 51.212 82.173  1.00 7.62  ? 235 ILE A CG2 1 
ATOM   880  C  CD1 . ILE A 1 112 ? 27.123 53.496 81.731  1.00 8.49  ? 235 ILE A CD1 1 
ATOM   881  N  N   . ILE A 1 113 ? 29.384 47.982 80.542  1.00 7.26  ? 236 ILE A N   1 
ATOM   882  C  CA  . ILE A 1 113 ? 29.998 46.746 81.016  1.00 7.35  ? 236 ILE A CA  1 
ATOM   883  C  C   . ILE A 1 113 ? 31.259 47.115 81.793  1.00 7.43  ? 236 ILE A C   1 
ATOM   884  O  O   . ILE A 1 113 ? 32.091 47.871 81.295  1.00 7.86  ? 236 ILE A O   1 
ATOM   885  C  CB  . ILE A 1 113 ? 30.365 45.813 79.831  1.00 7.30  ? 236 ILE A CB  1 
ATOM   886  C  CG1 . ILE A 1 113 ? 29.140 45.549 78.943  1.00 7.81  ? 236 ILE A CG1 1 
ATOM   887  C  CG2 . ILE A 1 113 ? 30.987 44.505 80.336  1.00 7.27  ? 236 ILE A CG2 1 
ATOM   888  C  CD1 . ILE A 1 113 ? 29.487 45.173 77.502  1.00 9.10  ? 236 ILE A CD1 1 
ATOM   889  N  N   . ILE A 1 114 ? 31.390 46.594 83.012  1.00 7.48  ? 237 ILE A N   1 
ATOM   890  C  CA  . ILE A 1 114 ? 32.530 46.913 83.877  1.00 7.51  ? 237 ILE A CA  1 
ATOM   891  C  C   . ILE A 1 114 ? 33.231 45.619 84.293  1.00 7.49  ? 237 ILE A C   1 
ATOM   892  O  O   . ILE A 1 114 ? 32.619 44.756 84.926  1.00 7.48  ? 237 ILE A O   1 
ATOM   893  C  CB  . ILE A 1 114 ? 32.089 47.711 85.132  1.00 7.41  ? 237 ILE A CB  1 
ATOM   894  C  CG1 . ILE A 1 114 ? 31.188 48.891 84.727  1.00 7.91  ? 237 ILE A CG1 1 
ATOM   895  C  CG2 . ILE A 1 114 ? 33.317 48.189 85.919  1.00 7.67  ? 237 ILE A CG2 1 
ATOM   896  C  CD1 . ILE A 1 114 ? 30.499 49.598 85.883  1.00 8.69  ? 237 ILE A CD1 1 
ATOM   897  N  N   . THR A 1 115 ? 34.503 45.482 83.924  1.00 7.51  ? 238 THR A N   1 
ATOM   898  C  CA  . THR A 1 115 ? 35.205 44.206 84.105  1.00 7.61  ? 238 THR A CA  1 
ATOM   899  C  C   . THR A 1 115 ? 36.683 44.369 84.494  1.00 7.96  ? 238 THR A C   1 
ATOM   900  O  O   . THR A 1 115 ? 37.298 45.389 84.179  1.00 7.56  ? 238 THR A O   1 
ATOM   901  C  CB  . THR A 1 115 ? 35.046 43.312 82.845  1.00 7.53  ? 238 THR A CB  1 
ATOM   902  O  OG1 . THR A 1 115 ? 35.522 41.990 83.124  1.00 7.50  ? 238 THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 115 ? 35.784 43.900 81.628  1.00 7.22  ? 238 THR A CG2 1 
ATOM   904  N  N   . ASP A 1 116 ? 37.234 43.369 85.190  1.00 8.17  ? 239 ASP A N   1 
ATOM   905  C  CA  . ASP A 1 116 ? 38.654 43.380 85.577  1.00 8.68  ? 239 ASP A CA  1 
ATOM   906  C  C   . ASP A 1 116 ? 39.446 42.182 85.021  1.00 8.90  ? 239 ASP A C   1 
ATOM   907  O  O   . ASP A 1 116 ? 40.563 41.895 85.467  1.00 9.32  ? 239 ASP A O   1 
ATOM   908  C  CB  . ASP A 1 116 ? 38.819 43.510 87.109  1.00 8.61  ? 239 ASP A CB  1 
ATOM   909  C  CG  . ASP A 1 116 ? 38.776 42.165 87.839  1.00 9.09  ? 239 ASP A CG  1 
ATOM   910  O  OD1 . ASP A 1 116 ? 38.109 41.212 87.365  1.00 8.47  ? 239 ASP A OD1 1 
ATOM   911  O  OD2 . ASP A 1 116 ? 39.419 42.058 88.907  1.00 9.40  ? 239 ASP A OD2 1 
ATOM   912  N  N   . GLY A 1 117 ? 38.872 41.493 84.042  1.00 8.96  ? 240 GLY A N   1 
ATOM   913  C  CA  . GLY A 1 117 ? 39.556 40.352 83.431  1.00 9.21  ? 240 GLY A CA  1 
ATOM   914  C  C   . GLY A 1 117 ? 39.036 39.988 82.062  1.00 9.36  ? 240 GLY A C   1 
ATOM   915  O  O   . GLY A 1 117 ? 37.959 40.430 81.657  1.00 9.25  ? 240 GLY A O   1 
ATOM   916  N  N   . GLU A 1 118 ? 39.812 39.182 81.341  1.00 9.61  ? 241 GLU A N   1 
ATOM   917  C  CA  . GLU A 1 118 ? 39.382 38.665 80.050  1.00 9.83  ? 241 GLU A CA  1 
ATOM   918  C  C   . GLU A 1 118 ? 38.242 37.670 80.250  1.00 9.76  ? 241 GLU A C   1 
ATOM   919  O  O   . GLU A 1 118 ? 38.138 37.036 81.309  1.00 9.84  ? 241 GLU A O   1 
ATOM   920  C  CB  . GLU A 1 118 ? 40.548 37.998 79.315  1.00 9.96  ? 241 GLU A CB  1 
ATOM   921  C  CG  . GLU A 1 118 ? 41.606 38.984 78.809  1.00 10.83 ? 241 GLU A CG  1 
ATOM   922  C  CD  . GLU A 1 118 ? 42.757 38.304 78.090  1.00 12.92 ? 241 GLU A CD  1 
ATOM   923  O  OE1 . GLU A 1 118 ? 43.922 38.676 78.354  1.00 13.38 ? 241 GLU A OE1 1 
ATOM   924  O  OE2 . GLU A 1 118 ? 42.504 37.404 77.262  1.00 13.14 ? 241 GLU A OE2 1 
ATOM   925  N  N   . ALA A 1 119 ? 37.383 37.561 79.241  1.00 9.83  ? 242 ALA A N   1 
ATOM   926  C  CA  . ALA A 1 119 ? 36.261 36.629 79.268  1.00 9.96  ? 242 ALA A CA  1 
ATOM   927  C  C   . ALA A 1 119 ? 36.765 35.199 79.399  1.00 10.08 ? 242 ALA A C   1 
ATOM   928  O  O   . ALA A 1 119 ? 37.763 34.823 78.776  1.00 10.17 ? 242 ALA A O   1 
ATOM   929  C  CB  . ALA A 1 119 ? 35.413 36.774 78.009  1.00 9.90  ? 242 ALA A CB  1 
ATOM   930  N  N   . THR A 1 120 ? 36.075 34.415 80.218  1.00 10.29 ? 243 THR A N   1 
ATOM   931  C  CA  . THR A 1 120 ? 36.418 33.007 80.423  1.00 10.63 ? 243 THR A CA  1 
ATOM   932  C  C   . THR A 1 120 ? 35.552 32.088 79.556  1.00 10.97 ? 243 THR A C   1 
ATOM   933  O  O   . THR A 1 120 ? 35.691 30.863 79.604  1.00 11.08 ? 243 THR A O   1 
ATOM   934  C  CB  . THR A 1 120 ? 36.324 32.609 81.913  1.00 10.72 ? 243 THR A CB  1 
ATOM   935  O  OG1 . THR A 1 120 ? 35.050 33.002 82.436  1.00 10.88 ? 243 THR A OG1 1 
ATOM   936  C  CG2 . THR A 1 120 ? 37.419 33.296 82.716  1.00 11.16 ? 243 THR A CG2 1 
ATOM   937  N  N   . ASP A 1 121 ? 34.667 32.691 78.762  1.00 10.96 ? 244 ASP A N   1 
ATOM   938  C  CA  . ASP A 1 121 ? 33.857 31.955 77.788  1.00 11.17 ? 244 ASP A CA  1 
ATOM   939  C  C   . ASP A 1 121 ? 34.070 32.468 76.356  1.00 11.72 ? 244 ASP A C   1 
ATOM   940  O  O   . ASP A 1 121 ? 34.974 33.275 76.105  1.00 11.52 ? 244 ASP A O   1 
ATOM   941  C  CB  . ASP A 1 121 ? 32.366 31.948 78.184  1.00 10.83 ? 244 ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 121 ? 31.733 33.346 78.208  1.00 10.70 ? 244 ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 121 ? 32.444 34.365 78.079  1.00 9.54  ? 244 ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 121 ? 30.497 33.414 78.365  1.00 10.07 ? 244 ASP A OD2 1 
ATOM   945  N  N   . SER A 1 122 ? 33.248 31.988 75.426  1.00 12.27 ? 245 SER A N   1 
ATOM   946  C  CA  . SER A 1 122 ? 33.347 32.387 74.026  1.00 13.07 ? 245 SER A CA  1 
ATOM   947  C  C   . SER A 1 122 ? 31.983 32.340 73.342  1.00 13.16 ? 245 SER A C   1 
ATOM   948  O  O   . SER A 1 122 ? 30.982 31.966 73.954  1.00 13.62 ? 245 SER A O   1 
ATOM   949  C  CB  . SER A 1 122 ? 34.363 31.513 73.283  1.00 13.36 ? 245 SER A CB  1 
ATOM   950  O  OG  . SER A 1 122 ? 33.957 30.160 73.281  1.00 14.78 ? 245 SER A OG  1 
ATOM   951  N  N   . GLY A 1 123 ? 31.950 32.744 72.077  1.00 13.22 ? 246 GLY A N   1 
ATOM   952  C  CA  . GLY A 1 123 ? 30.722 32.729 71.299  1.00 13.27 ? 246 GLY A CA  1 
ATOM   953  C  C   . GLY A 1 123 ? 30.557 34.018 70.532  1.00 13.19 ? 246 GLY A C   1 
ATOM   954  O  O   . GLY A 1 123 ? 31.491 34.489 69.881  1.00 13.76 ? 246 GLY A O   1 
ATOM   955  N  N   . ASN A 1 124 ? 29.361 34.587 70.612  1.00 13.11 ? 247 ASN A N   1 
ATOM   956  C  CA  . ASN A 1 124 ? 29.070 35.869 69.981  1.00 12.80 ? 247 ASN A CA  1 
ATOM   957  C  C   . ASN A 1 124 ? 28.069 36.662 70.805  1.00 12.53 ? 247 ASN A C   1 
ATOM   958  O  O   . ASN A 1 124 ? 27.346 36.098 71.629  1.00 12.70 ? 247 ASN A O   1 
ATOM   959  C  CB  . ASN A 1 124 ? 28.548 35.673 68.547  1.00 13.04 ? 247 ASN A CB  1 
ATOM   960  C  CG  . ASN A 1 124 ? 27.138 35.096 68.502  1.00 13.65 ? 247 ASN A CG  1 
ATOM   961  O  OD1 . ASN A 1 124 ? 26.156 35.798 68.757  1.00 14.18 ? 247 ASN A OD1 1 
ATOM   962  N  ND2 . ASN A 1 124 ? 27.033 33.819 68.157  1.00 15.24 ? 247 ASN A ND2 1 
ATOM   963  N  N   . ILE A 1 125 ? 28.029 37.970 70.572  1.00 12.04 ? 248 ILE A N   1 
ATOM   964  C  CA  . ILE A 1 125 ? 27.032 38.825 71.210  1.00 11.76 ? 248 ILE A CA  1 
ATOM   965  C  C   . ILE A 1 125 ? 26.072 39.455 70.193  1.00 11.62 ? 248 ILE A C   1 
ATOM   966  O  O   . ILE A 1 125 ? 25.602 40.579 70.383  1.00 11.42 ? 248 ILE A O   1 
ATOM   967  C  CB  . ILE A 1 125 ? 27.686 39.907 72.103  1.00 11.39 ? 248 ILE A CB  1 
ATOM   968  C  CG1 . ILE A 1 125 ? 28.591 40.827 71.280  1.00 10.93 ? 248 ILE A CG1 1 
ATOM   969  C  CG2 . ILE A 1 125 ? 28.466 39.246 73.247  1.00 11.45 ? 248 ILE A CG2 1 
ATOM   970  C  CD1 . ILE A 1 125 ? 28.689 42.236 71.837  1.00 11.30 ? 248 ILE A CD1 1 
ATOM   971  N  N   . ASP A 1 126 ? 25.769 38.715 69.126  1.00 11.86 ? 249 ASP A N   1 
ATOM   972  C  CA  . ASP A 1 126 ? 24.818 39.175 68.103  1.00 12.04 ? 249 ASP A CA  1 
ATOM   973  C  C   . ASP A 1 126 ? 23.491 39.660 68.698  1.00 11.68 ? 249 ASP A C   1 
ATOM   974  O  O   . ASP A 1 126 ? 22.968 40.698 68.291  1.00 11.80 ? 249 ASP A O   1 
ATOM   975  C  CB  . ASP A 1 126 ? 24.543 38.077 67.066  1.00 12.26 ? 249 ASP A CB  1 
ATOM   976  C  CG  . ASP A 1 126 ? 25.715 37.839 66.119  1.00 13.33 ? 249 ASP A CG  1 
ATOM   977  O  OD1 . ASP A 1 126 ? 26.693 38.615 66.136  1.00 13.72 ? 249 ASP A OD1 1 
ATOM   978  O  OD2 . ASP A 1 126 ? 25.650 36.862 65.338  1.00 13.92 ? 249 ASP A OD2 1 
ATOM   979  N  N   . ALA A 1 127 ? 22.961 38.911 69.667  1.00 11.60 ? 250 ALA A N   1 
ATOM   980  C  CA  . ALA A 1 127 ? 21.679 39.234 70.304  1.00 11.31 ? 250 ALA A CA  1 
ATOM   981  C  C   . ALA A 1 127 ? 21.649 40.626 70.944  1.00 11.18 ? 250 ALA A C   1 
ATOM   982  O  O   . ALA A 1 127 ? 20.572 41.193 71.148  1.00 11.21 ? 250 ALA A O   1 
ATOM   983  C  CB  . ALA A 1 127 ? 21.310 38.170 71.334  1.00 11.55 ? 250 ALA A CB  1 
ATOM   984  N  N   . ALA A 1 128 ? 22.827 41.171 71.244  1.00 10.69 ? 251 ALA A N   1 
ATOM   985  C  CA  . ALA A 1 128 ? 22.947 42.454 71.941  1.00 10.59 ? 251 ALA A CA  1 
ATOM   986  C  C   . ALA A 1 128 ? 23.410 43.598 71.037  1.00 10.53 ? 251 ALA A C   1 
ATOM   987  O  O   . ALA A 1 128 ? 23.678 44.702 71.515  1.00 10.57 ? 251 ALA A O   1 
ATOM   988  C  CB  . ALA A 1 128 ? 23.901 42.312 73.124  1.00 10.54 ? 251 ALA A CB  1 
ATOM   989  N  N   . LYS A 1 129 ? 23.501 43.342 69.734  1.00 10.68 ? 252 LYS A N   1 
ATOM   990  C  CA  . LYS A 1 129 ? 24.159 44.284 68.828  1.00 10.89 ? 252 LYS A CA  1 
ATOM   991  C  C   . LYS A 1 129 ? 23.434 45.619 68.613  1.00 10.85 ? 252 LYS A C   1 
ATOM   992  O  O   . LYS A 1 129 ? 24.062 46.596 68.208  1.00 10.84 ? 252 LYS A O   1 
ATOM   993  C  CB  . LYS A 1 129 ? 24.515 43.617 67.493  1.00 11.25 ? 252 LYS A CB  1 
ATOM   994  C  CG  . LYS A 1 129 ? 25.868 42.918 67.529  1.00 12.41 ? 252 LYS A CG  1 
ATOM   995  C  CD  . LYS A 1 129 ? 26.267 42.380 66.169  1.00 15.33 ? 252 LYS A CD  1 
ATOM   996  C  CE  . LYS A 1 129 ? 27.676 41.814 66.212  1.00 17.89 ? 252 LYS A CE  1 
ATOM   997  N  NZ  . LYS A 1 129 ? 28.024 41.114 64.948  1.00 19.78 ? 252 LYS A NZ  1 
ATOM   998  N  N   . ASP A 1 130 ? 22.135 45.669 68.903  1.00 10.61 ? 253 ASP A N   1 
ATOM   999  C  CA  . ASP A 1 130 ? 21.387 46.930 68.779  1.00 10.70 ? 253 ASP A CA  1 
ATOM   1000 C  C   . ASP A 1 130 ? 21.462 47.798 70.039  1.00 10.43 ? 253 ASP A C   1 
ATOM   1001 O  O   . ASP A 1 130 ? 20.862 48.872 70.106  1.00 10.53 ? 253 ASP A O   1 
ATOM   1002 C  CB  . ASP A 1 130 ? 19.933 46.689 68.358  1.00 11.00 ? 253 ASP A CB  1 
ATOM   1003 C  CG  . ASP A 1 130 ? 19.192 45.733 69.272  1.00 11.87 ? 253 ASP A CG  1 
ATOM   1004 O  OD1 . ASP A 1 130 ? 19.785 45.171 70.220  1.00 12.22 ? 253 ASP A OD1 1 
ATOM   1005 O  OD2 . ASP A 1 130 ? 17.984 45.540 69.023  1.00 14.69 ? 253 ASP A OD2 1 
ATOM   1006 N  N   . ILE A 1 131 ? 22.204 47.316 71.030  1.00 9.86  ? 254 ILE A N   1 
ATOM   1007 C  CA  . ILE A 1 131 ? 22.459 48.064 72.252  1.00 9.33  ? 254 ILE A CA  1 
ATOM   1008 C  C   . ILE A 1 131 ? 23.755 48.848 72.082  1.00 9.18  ? 254 ILE A C   1 
ATOM   1009 O  O   . ILE A 1 131 ? 24.745 48.311 71.585  1.00 9.19  ? 254 ILE A O   1 
ATOM   1010 C  CB  . ILE A 1 131 ? 22.562 47.113 73.469  1.00 9.37  ? 254 ILE A CB  1 
ATOM   1011 C  CG1 . ILE A 1 131 ? 21.276 46.285 73.599  1.00 9.14  ? 254 ILE A CG1 1 
ATOM   1012 C  CG2 . ILE A 1 131 ? 22.850 47.896 74.757  1.00 8.47  ? 254 ILE A CG2 1 
ATOM   1013 C  CD1 . ILE A 1 131 ? 21.414 45.027 74.445  1.00 9.85  ? 254 ILE A CD1 1 
ATOM   1014 N  N   . ILE A 1 132 ? 23.735 50.117 72.483  1.00 9.04  ? 255 ILE A N   1 
ATOM   1015 C  CA  . ILE A 1 132 ? 24.943 50.933 72.534  1.00 8.95  ? 255 ILE A CA  1 
ATOM   1016 C  C   . ILE A 1 132 ? 25.781 50.418 73.702  1.00 8.88  ? 255 ILE A C   1 
ATOM   1017 O  O   . ILE A 1 132 ? 25.348 50.472 74.851  1.00 8.60  ? 255 ILE A O   1 
ATOM   1018 C  CB  . ILE A 1 132 ? 24.612 52.431 72.733  1.00 9.35  ? 255 ILE A CB  1 
ATOM   1019 C  CG1 . ILE A 1 132 ? 23.795 52.959 71.548  1.00 9.40  ? 255 ILE A CG1 1 
ATOM   1020 C  CG2 . ILE A 1 132 ? 25.900 53.242 72.938  1.00 9.27  ? 255 ILE A CG2 1 
ATOM   1021 C  CD1 . ILE A 1 132 ? 23.243 54.363 71.737  1.00 10.72 ? 255 ILE A CD1 1 
ATOM   1022 N  N   . ARG A 1 133 ? 26.972 49.912 73.398  1.00 8.92  ? 256 ARG A N   1 
ATOM   1023 C  CA  . ARG A 1 133 ? 27.762 49.179 74.387  1.00 8.89  ? 256 ARG A CA  1 
ATOM   1024 C  C   . ARG A 1 133 ? 29.092 49.841 74.726  1.00 8.73  ? 256 ARG A C   1 
ATOM   1025 O  O   . ARG A 1 133 ? 29.982 49.925 73.880  1.00 8.73  ? 256 ARG A O   1 
ATOM   1026 C  CB  . ARG A 1 133 ? 28.001 47.741 73.904  1.00 8.89  ? 256 ARG A CB  1 
ATOM   1027 C  CG  . ARG A 1 133 ? 26.755 46.862 73.936  1.00 9.39  ? 256 ARG A CG  1 
ATOM   1028 C  CD  . ARG A 1 133 ? 26.832 45.726 72.921  1.00 11.19 ? 256 ARG A CD  1 
ATOM   1029 N  NE  . ARG A 1 133 ? 26.555 46.176 71.555  1.00 12.51 ? 256 ARG A NE  1 
ATOM   1030 C  CZ  . ARG A 1 133 ? 27.413 46.107 70.538  1.00 12.82 ? 256 ARG A CZ  1 
ATOM   1031 N  NH1 . ARG A 1 133 ? 28.630 45.602 70.705  1.00 12.88 ? 256 ARG A NH1 1 
ATOM   1032 N  NH2 . ARG A 1 133 ? 27.047 46.543 69.341  1.00 13.06 ? 256 ARG A NH2 1 
ATOM   1033 N  N   . TYR A 1 134 ? 29.211 50.303 75.970  1.00 8.60  ? 257 TYR A N   1 
ATOM   1034 C  CA  . TYR A 1 134 ? 30.486 50.755 76.528  1.00 8.57  ? 257 TYR A CA  1 
ATOM   1035 C  C   . TYR A 1 134 ? 31.072 49.636 77.374  1.00 8.36  ? 257 TYR A C   1 
ATOM   1036 O  O   . TYR A 1 134 ? 30.335 48.894 78.027  1.00 8.17  ? 257 TYR A O   1 
ATOM   1037 C  CB  . TYR A 1 134 ? 30.300 52.003 77.401  1.00 8.77  ? 257 TYR A CB  1 
ATOM   1038 C  CG  . TYR A 1 134 ? 29.977 53.254 76.623  1.00 9.70  ? 257 TYR A CG  1 
ATOM   1039 C  CD1 . TYR A 1 134 ? 28.664 53.553 76.253  1.00 10.96 ? 257 TYR A CD1 1 
ATOM   1040 C  CD2 . TYR A 1 134 ? 30.986 54.146 76.257  1.00 10.92 ? 257 TYR A CD2 1 
ATOM   1041 C  CE1 . TYR A 1 134 ? 28.367 54.707 75.529  1.00 11.98 ? 257 TYR A CE1 1 
ATOM   1042 C  CE2 . TYR A 1 134 ? 30.696 55.305 75.534  1.00 11.93 ? 257 TYR A CE2 1 
ATOM   1043 C  CZ  . TYR A 1 134 ? 29.386 55.574 75.179  1.00 12.25 ? 257 TYR A CZ  1 
ATOM   1044 O  OH  . TYR A 1 134 ? 29.095 56.711 74.457  1.00 14.42 ? 257 TYR A OH  1 
ATOM   1045 N  N   . ILE A 1 135 ? 32.394 49.511 77.351  1.00 8.07  ? 258 ILE A N   1 
ATOM   1046 C  CA  . ILE A 1 135 ? 33.083 48.589 78.243  1.00 7.91  ? 258 ILE A CA  1 
ATOM   1047 C  C   . ILE A 1 135 ? 34.232 49.287 78.963  1.00 7.95  ? 258 ILE A C   1 
ATOM   1048 O  O   . ILE A 1 135 ? 35.006 50.029 78.354  1.00 8.20  ? 258 ILE A O   1 
ATOM   1049 C  CB  . ILE A 1 135 ? 33.546 47.289 77.521  1.00 7.84  ? 258 ILE A CB  1 
ATOM   1050 C  CG1 . ILE A 1 135 ? 33.928 46.208 78.546  1.00 8.42  ? 258 ILE A CG1 1 
ATOM   1051 C  CG2 . ILE A 1 135 ? 34.668 47.569 76.512  1.00 7.93  ? 258 ILE A CG2 1 
ATOM   1052 C  CD1 . ILE A 1 135 ? 33.967 44.782 77.984  1.00 8.37  ? 258 ILE A CD1 1 
ATOM   1053 N  N   . ILE A 1 136 ? 34.301 49.059 80.271  1.00 7.82  ? 259 ILE A N   1 
ATOM   1054 C  CA  . ILE A 1 136 ? 35.352 49.608 81.106  1.00 7.92  ? 259 ILE A CA  1 
ATOM   1055 C  C   . ILE A 1 136 ? 36.166 48.432 81.636  1.00 7.86  ? 259 ILE A C   1 
ATOM   1056 O  O   . ILE A 1 136 ? 35.656 47.608 82.397  1.00 7.70  ? 259 ILE A O   1 
ATOM   1057 C  CB  . ILE A 1 136 ? 34.778 50.448 82.272  1.00 7.95  ? 259 ILE A CB  1 
ATOM   1058 C  CG1 . ILE A 1 136 ? 33.824 51.527 81.742  1.00 8.09  ? 259 ILE A CG1 1 
ATOM   1059 C  CG2 . ILE A 1 136 ? 35.908 51.080 83.085  1.00 8.18  ? 259 ILE A CG2 1 
ATOM   1060 C  CD1 . ILE A 1 136 ? 32.865 52.077 82.786  1.00 9.98  ? 259 ILE A CD1 1 
ATOM   1061 N  N   . GLY A 1 137 ? 37.415 48.343 81.187  1.00 7.97  ? 260 GLY A N   1 
ATOM   1062 C  CA  . GLY A 1 137 ? 38.343 47.307 81.635  1.00 8.65  ? 260 GLY A CA  1 
ATOM   1063 C  C   . GLY A 1 137 ? 39.320 47.922 82.613  1.00 9.05  ? 260 GLY A C   1 
ATOM   1064 O  O   . GLY A 1 137 ? 39.982 48.905 82.287  1.00 9.39  ? 260 GLY A O   1 
ATOM   1065 N  N   . ILE A 1 138 ? 39.402 47.343 83.809  1.00 9.75  ? 261 ILE A N   1 
ATOM   1066 C  CA  . ILE A 1 138 ? 40.145 47.947 84.915  1.00 10.20 ? 261 ILE A CA  1 
ATOM   1067 C  C   . ILE A 1 138 ? 41.223 47.032 85.477  1.00 10.61 ? 261 ILE A C   1 
ATOM   1068 O  O   . ILE A 1 138 ? 40.977 45.853 85.727  1.00 10.42 ? 261 ILE A O   1 
ATOM   1069 C  CB  . ILE A 1 138 ? 39.219 48.324 86.097  1.00 10.33 ? 261 ILE A CB  1 
ATOM   1070 C  CG1 . ILE A 1 138 ? 37.991 49.106 85.618  1.00 10.44 ? 261 ILE A CG1 1 
ATOM   1071 C  CG2 . ILE A 1 138 ? 39.995 49.120 87.159  1.00 10.10 ? 261 ILE A CG2 1 
ATOM   1072 C  CD1 . ILE A 1 138 ? 36.893 49.210 86.655  1.00 10.13 ? 261 ILE A CD1 1 
ATOM   1073 N  N   . GLY A 1 139 ? 42.414 47.592 85.675  1.00 11.13 ? 262 GLY A N   1 
ATOM   1074 C  CA  . GLY A 1 139 ? 43.427 46.958 86.511  1.00 11.84 ? 262 GLY A CA  1 
ATOM   1075 C  C   . GLY A 1 139 ? 44.512 46.184 85.800  1.00 12.32 ? 262 GLY A C   1 
ATOM   1076 O  O   . GLY A 1 139 ? 44.644 46.241 84.574  1.00 12.27 ? 262 GLY A O   1 
ATOM   1077 N  N   . LYS A 1 140 ? 45.280 45.439 86.592  1.00 12.78 ? 263 LYS A N   1 
ATOM   1078 C  CA  . LYS A 1 140 ? 46.501 44.774 86.125  1.00 13.47 ? 263 LYS A CA  1 
ATOM   1079 C  C   . LYS A 1 140 ? 46.288 43.706 85.044  1.00 13.31 ? 263 LYS A C   1 
ATOM   1080 O  O   . LYS A 1 140 ? 47.199 43.422 84.270  1.00 13.16 ? 263 LYS A O   1 
ATOM   1081 C  CB  . LYS A 1 140 ? 47.294 44.202 87.315  1.00 13.86 ? 263 LYS A CB  1 
ATOM   1082 C  CG  . LYS A 1 140 ? 46.579 43.101 88.084  1.00 16.31 ? 263 LYS A CG  1 
ATOM   1083 C  CD  . LYS A 1 140 ? 47.257 42.814 89.417  1.00 20.13 ? 263 LYS A CD  1 
ATOM   1084 C  CE  . LYS A 1 140 ? 46.637 41.601 90.099  1.00 21.94 ? 263 LYS A CE  1 
ATOM   1085 N  NZ  . LYS A 1 140 ? 45.212 41.825 90.470  1.00 23.89 ? 263 LYS A NZ  1 
ATOM   1086 N  N   . HIS A 1 141 ? 45.092 43.126 84.973  1.00 13.16 ? 264 HIS A N   1 
ATOM   1087 C  CA  . HIS A 1 141 ? 44.811 42.134 83.931  1.00 13.45 ? 264 HIS A CA  1 
ATOM   1088 C  C   . HIS A 1 141 ? 44.697 42.742 82.529  1.00 13.36 ? 264 HIS A C   1 
ATOM   1089 O  O   . HIS A 1 141 ? 44.664 42.020 81.534  1.00 13.11 ? 264 HIS A O   1 
ATOM   1090 C  CB  . HIS A 1 141 ? 43.572 41.308 84.281  1.00 13.55 ? 264 HIS A CB  1 
ATOM   1091 C  CG  . HIS A 1 141 ? 43.747 40.458 85.499  1.00 14.42 ? 264 HIS A CG  1 
ATOM   1092 N  ND1 . HIS A 1 141 ? 44.440 39.266 85.479  1.00 15.85 ? 264 HIS A ND1 1 
ATOM   1093 C  CD2 . HIS A 1 141 ? 43.331 40.630 86.776  1.00 15.32 ? 264 HIS A CD2 1 
ATOM   1094 C  CE1 . HIS A 1 141 ? 44.438 38.738 86.690  1.00 15.83 ? 264 HIS A CE1 1 
ATOM   1095 N  NE2 . HIS A 1 141 ? 43.771 39.545 87.495  1.00 16.08 ? 264 HIS A NE2 1 
ATOM   1096 N  N   . PHE A 1 142 ? 44.655 44.070 82.458  1.00 13.57 ? 265 PHE A N   1 
ATOM   1097 C  CA  . PHE A 1 142 ? 44.611 44.767 81.171  1.00 13.76 ? 265 PHE A CA  1 
ATOM   1098 C  C   . PHE A 1 142 ? 45.863 45.609 80.926  1.00 14.43 ? 265 PHE A C   1 
ATOM   1099 O  O   . PHE A 1 142 ? 45.830 46.620 80.220  1.00 14.45 ? 265 PHE A O   1 
ATOM   1100 C  CB  . PHE A 1 142 ? 43.320 45.577 81.033  1.00 13.57 ? 265 PHE A CB  1 
ATOM   1101 C  CG  . PHE A 1 142 ? 42.087 44.720 80.968  1.00 12.79 ? 265 PHE A CG  1 
ATOM   1102 C  CD1 . PHE A 1 142 ? 41.870 43.881 79.881  1.00 12.33 ? 265 PHE A CD1 1 
ATOM   1103 C  CD2 . PHE A 1 142 ? 41.149 44.743 81.996  1.00 12.24 ? 265 PHE A CD2 1 
ATOM   1104 C  CE1 . PHE A 1 142 ? 40.736 43.073 79.815  1.00 12.39 ? 265 PHE A CE1 1 
ATOM   1105 C  CE2 . PHE A 1 142 ? 40.009 43.937 81.938  1.00 12.00 ? 265 PHE A CE2 1 
ATOM   1106 C  CZ  . PHE A 1 142 ? 39.804 43.106 80.846  1.00 11.72 ? 265 PHE A CZ  1 
ATOM   1107 N  N   . GLN A 1 143 ? 46.966 45.154 81.512  1.00 14.87 ? 266 GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 143 ? 48.279 45.768 81.345  1.00 15.82 ? 266 GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 143 ? 48.714 45.798 79.874  1.00 15.39 ? 266 GLN A C   1 
ATOM   1110 O  O   . GLN A 1 143 ? 49.128 46.841 79.367  1.00 15.76 ? 266 GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 143 ? 49.297 45.003 82.193  1.00 16.10 ? 266 GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 143 ? 50.691 45.595 82.216  1.00 19.00 ? 266 GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 143 ? 50.861 46.661 83.275  1.00 21.53 ? 266 GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 143 ? 50.453 46.483 84.422  1.00 23.72 ? 266 GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 143 ? 51.480 47.773 82.900  1.00 23.16 ? 266 GLN A NE2 1 
ATOM   1116 N  N   . THR A 1 144 ? 48.607 44.659 79.193  1.00 15.12 ? 267 THR A N   1 
ATOM   1117 C  CA  . THR A 1 144 ? 49.072 44.535 77.811  1.00 14.67 ? 267 THR A CA  1 
ATOM   1118 C  C   . THR A 1 144 ? 48.053 45.082 76.817  1.00 14.77 ? 267 THR A C   1 
ATOM   1119 O  O   . THR A 1 144 ? 46.844 45.010 77.054  1.00 14.53 ? 267 THR A O   1 
ATOM   1120 C  CB  . THR A 1 144 ? 49.393 43.065 77.429  1.00 14.68 ? 267 THR A CB  1 
ATOM   1121 O  OG1 . THR A 1 144 ? 48.176 42.323 77.271  1.00 13.61 ? 267 THR A OG1 1 
ATOM   1122 C  CG2 . THR A 1 144 ? 50.269 42.397 78.492  1.00 14.42 ? 267 THR A CG2 1 
ATOM   1123 N  N   . LYS A 1 145 ? 48.542 45.617 75.701  1.00 14.73 ? 268 LYS A N   1 
ATOM   1124 C  CA  . LYS A 1 145 ? 47.658 46.042 74.614  1.00 14.87 ? 268 LYS A CA  1 
ATOM   1125 C  C   . LYS A 1 145 ? 46.829 44.868 74.084  1.00 14.64 ? 268 LYS A C   1 
ATOM   1126 O  O   . LYS A 1 145 ? 45.668 45.043 73.712  1.00 14.41 ? 268 LYS A O   1 
ATOM   1127 C  CB  . LYS A 1 145 ? 48.449 46.707 73.481  1.00 15.03 ? 268 LYS A CB  1 
ATOM   1128 C  CG  . LYS A 1 145 ? 49.086 48.050 73.856  1.00 16.72 ? 268 LYS A CG  1 
ATOM   1129 C  CD  . LYS A 1 145 ? 48.050 49.160 74.056  1.00 19.70 ? 268 LYS A CD  1 
ATOM   1130 C  CE  . LYS A 1 145 ? 48.696 50.459 74.542  1.00 21.29 ? 268 LYS A CE  1 
ATOM   1131 N  NZ  . LYS A 1 145 ? 49.203 50.361 75.948  1.00 23.40 ? 268 LYS A NZ  1 
ATOM   1132 N  N   . GLU A 1 146 ? 47.429 43.676 74.071  1.00 14.39 ? 269 GLU A N   1 
ATOM   1133 C  CA  . GLU A 1 146 ? 46.745 42.457 73.632  1.00 14.51 ? 269 GLU A CA  1 
ATOM   1134 C  C   . GLU A 1 146 ? 45.480 42.173 74.447  1.00 13.84 ? 269 GLU A C   1 
ATOM   1135 O  O   . GLU A 1 146 ? 44.422 41.880 73.878  1.00 13.67 ? 269 GLU A O   1 
ATOM   1136 C  CB  . GLU A 1 146 ? 47.693 41.254 73.692  1.00 14.92 ? 269 GLU A CB  1 
ATOM   1137 C  CG  . GLU A 1 146 ? 47.125 39.982 73.071  1.00 17.24 ? 269 GLU A CG  1 
ATOM   1138 C  CD  . GLU A 1 146 ? 48.030 38.764 73.230  1.00 20.65 ? 269 GLU A CD  1 
ATOM   1139 O  OE1 . GLU A 1 146 ? 49.186 38.908 73.691  1.00 23.10 ? 269 GLU A OE1 1 
ATOM   1140 O  OE2 . GLU A 1 146 ? 47.578 37.649 72.892  1.00 22.42 ? 269 GLU A OE2 1 
ATOM   1141 N  N   . SER A 1 147 ? 45.590 42.264 75.770  1.00 13.21 ? 270 SER A N   1 
ATOM   1142 C  CA  . SER A 1 147 ? 44.452 42.004 76.655  1.00 12.93 ? 270 SER A CA  1 
ATOM   1143 C  C   . SER A 1 147 ? 43.349 43.051 76.471  1.00 12.63 ? 270 SER A C   1 
ATOM   1144 O  O   . SER A 1 147 ? 42.158 42.721 76.479  1.00 12.12 ? 270 SER A O   1 
ATOM   1145 C  CB  . SER A 1 147 ? 44.900 41.949 78.117  1.00 12.91 ? 270 SER A CB  1 
ATOM   1146 O  OG  . SER A 1 147 ? 45.456 43.187 78.528  1.00 13.61 ? 270 SER A OG  1 
ATOM   1147 N  N   . GLN A 1 148 ? 43.758 44.306 76.290  1.00 12.25 ? 271 GLN A N   1 
ATOM   1148 C  CA  . GLN A 1 148 ? 42.816 45.407 76.068  1.00 12.35 ? 271 GLN A CA  1 
ATOM   1149 C  C   . GLN A 1 148 ? 42.024 45.204 74.780  1.00 12.44 ? 271 GLN A C   1 
ATOM   1150 O  O   . GLN A 1 148 ? 40.822 45.487 74.730  1.00 12.30 ? 271 GLN A O   1 
ATOM   1151 C  CB  . GLN A 1 148 ? 43.551 46.754 76.022  1.00 12.13 ? 271 GLN A CB  1 
ATOM   1152 C  CG  . GLN A 1 148 ? 44.325 47.092 77.294  1.00 12.57 ? 271 GLN A CG  1 
ATOM   1153 C  CD  . GLN A 1 148 ? 45.297 48.250 77.116  1.00 13.29 ? 271 GLN A CD  1 
ATOM   1154 O  OE1 . GLN A 1 148 ? 45.234 48.987 76.133  1.00 12.71 ? 271 GLN A OE1 1 
ATOM   1155 N  NE2 . GLN A 1 148 ? 46.205 48.413 78.078  1.00 13.29 ? 271 GLN A NE2 1 
ATOM   1156 N  N   . GLU A 1 149 ? 42.710 44.714 73.747  1.00 12.45 ? 272 GLU A N   1 
ATOM   1157 C  CA  . GLU A 1 149 ? 42.105 44.432 72.447  1.00 12.87 ? 272 GLU A CA  1 
ATOM   1158 C  C   . GLU A 1 149 ? 40.980 43.393 72.520  1.00 12.15 ? 272 GLU A C   1 
ATOM   1159 O  O   . GLU A 1 149 ? 40.038 43.451 71.733  1.00 12.35 ? 272 GLU A O   1 
ATOM   1160 C  CB  . GLU A 1 149 ? 43.177 43.987 71.444  1.00 13.21 ? 272 GLU A CB  1 
ATOM   1161 C  CG  . GLU A 1 149 ? 42.754 44.050 69.977  1.00 16.40 ? 272 GLU A CG  1 
ATOM   1162 C  CD  . GLU A 1 149 ? 42.670 45.469 69.429  1.00 19.59 ? 272 GLU A CD  1 
ATOM   1163 O  OE1 . GLU A 1 149 ? 43.281 46.388 70.017  1.00 21.80 ? 272 GLU A OE1 1 
ATOM   1164 O  OE2 . GLU A 1 149 ? 41.997 45.663 68.393  1.00 22.45 ? 272 GLU A OE2 1 
ATOM   1165 N  N   . THR A 1 150 ? 41.069 42.463 73.472  1.00 11.64 ? 273 THR A N   1 
ATOM   1166 C  CA  . THR A 1 150 ? 40.049 41.410 73.615  1.00 10.77 ? 273 THR A CA  1 
ATOM   1167 C  C   . THR A 1 150 ? 38.682 41.970 74.010  1.00 10.48 ? 273 THR A C   1 
ATOM   1168 O  O   . THR A 1 150 ? 37.666 41.297 73.849  1.00 10.04 ? 273 THR A O   1 
ATOM   1169 C  CB  . THR A 1 150 ? 40.447 40.315 74.638  1.00 10.94 ? 273 THR A CB  1 
ATOM   1170 O  OG1 . THR A 1 150 ? 40.342 40.834 75.971  1.00 10.48 ? 273 THR A OG1 1 
ATOM   1171 C  CG2 . THR A 1 150 ? 41.868 39.796 74.374  1.00 11.22 ? 273 THR A CG2 1 
ATOM   1172 N  N   . LEU A 1 151 ? 38.664 43.199 74.526  1.00 10.01 ? 274 LEU A N   1 
ATOM   1173 C  CA  . LEU A 1 151 ? 37.411 43.836 74.940  1.00 9.81  ? 274 LEU A CA  1 
ATOM   1174 C  C   . LEU A 1 151 ? 36.678 44.517 73.783  1.00 9.65  ? 274 LEU A C   1 
ATOM   1175 O  O   . LEU A 1 151 ? 35.489 44.825 73.892  1.00 9.13  ? 274 LEU A O   1 
ATOM   1176 C  CB  . LEU A 1 151 ? 37.651 44.843 76.072  1.00 9.84  ? 274 LEU A CB  1 
ATOM   1177 C  CG  . LEU A 1 151 ? 38.291 44.343 77.373  1.00 10.01 ? 274 LEU A CG  1 
ATOM   1178 C  CD1 . LEU A 1 151 ? 38.357 45.479 78.375  1.00 10.11 ? 274 LEU A CD1 1 
ATOM   1179 C  CD2 . LEU A 1 151 ? 37.539 43.140 77.960  1.00 11.17 ? 274 LEU A CD2 1 
ATOM   1180 N  N   . HIS A 1 152 ? 37.385 44.743 72.676  1.00 9.46  ? 275 HIS A N   1 
ATOM   1181 C  CA  . HIS A 1 152 ? 36.816 45.471 71.537  1.00 9.86  ? 275 HIS A CA  1 
ATOM   1182 C  C   . HIS A 1 152 ? 35.551 44.821 70.968  1.00 9.72  ? 275 HIS A C   1 
ATOM   1183 O  O   . HIS A 1 152 ? 34.601 45.516 70.602  1.00 9.59  ? 275 HIS A O   1 
ATOM   1184 C  CB  . HIS A 1 152 ? 37.874 45.661 70.445  1.00 10.12 ? 275 HIS A CB  1 
ATOM   1185 C  CG  . HIS A 1 152 ? 38.961 46.620 70.826  1.00 10.66 ? 275 HIS A CG  1 
ATOM   1186 N  ND1 . HIS A 1 152 ? 39.732 47.283 69.895  1.00 11.53 ? 275 HIS A ND1 1 
ATOM   1187 C  CD2 . HIS A 1 152 ? 39.389 47.045 72.039  1.00 11.66 ? 275 HIS A CD2 1 
ATOM   1188 C  CE1 . HIS A 1 152 ? 40.597 48.063 70.518  1.00 11.21 ? 275 HIS A CE1 1 
ATOM   1189 N  NE2 . HIS A 1 152 ? 40.405 47.943 71.819  1.00 11.59 ? 275 HIS A NE2 1 
ATOM   1190 N  N   . LYS A 1 153 ? 35.545 43.490 70.912  1.00 9.64  ? 276 LYS A N   1 
ATOM   1191 C  CA  . LYS A 1 153 ? 34.427 42.739 70.339  1.00 9.84  ? 276 LYS A CA  1 
ATOM   1192 C  C   . LYS A 1 153 ? 33.116 42.929 71.106  1.00 9.88  ? 276 LYS A C   1 
ATOM   1193 O  O   . LYS A 1 153 ? 32.044 42.743 70.544  1.00 9.70  ? 276 LYS A O   1 
ATOM   1194 C  CB  . LYS A 1 153 ? 34.763 41.247 70.225  1.00 10.01 ? 276 LYS A CB  1 
ATOM   1195 C  CG  . LYS A 1 153 ? 34.993 40.541 71.558  1.00 11.06 ? 276 LYS A CG  1 
ATOM   1196 C  CD  . LYS A 1 153 ? 35.271 39.058 71.367  1.00 13.41 ? 276 LYS A CD  1 
ATOM   1197 C  CE  . LYS A 1 153 ? 36.747 38.774 71.160  1.00 14.36 ? 276 LYS A CE  1 
ATOM   1198 N  NZ  . LYS A 1 153 ? 37.543 38.983 72.412  1.00 14.84 ? 276 LYS A NZ  1 
ATOM   1199 N  N   . PHE A 1 154 ? 33.206 43.303 72.381  1.00 9.76  ? 277 PHE A N   1 
ATOM   1200 C  CA  . PHE A 1 154 ? 32.009 43.475 73.203  1.00 9.86  ? 277 PHE A CA  1 
ATOM   1201 C  C   . PHE A 1 154 ? 31.377 44.856 73.042  1.00 10.03 ? 277 PHE A C   1 
ATOM   1202 O  O   . PHE A 1 154 ? 30.178 45.017 73.256  1.00 10.43 ? 277 PHE A O   1 
ATOM   1203 C  CB  . PHE A 1 154 ? 32.320 43.205 74.675  1.00 9.78  ? 277 PHE A CB  1 
ATOM   1204 C  CG  . PHE A 1 154 ? 32.896 41.838 74.935  1.00 9.73  ? 277 PHE A CG  1 
ATOM   1205 C  CD1 . PHE A 1 154 ? 32.176 40.686 74.614  1.00 8.83  ? 277 PHE A CD1 1 
ATOM   1206 C  CD2 . PHE A 1 154 ? 34.154 41.704 75.503  1.00 9.40  ? 277 PHE A CD2 1 
ATOM   1207 C  CE1 . PHE A 1 154 ? 32.703 39.428 74.858  1.00 8.61  ? 277 PHE A CE1 1 
ATOM   1208 C  CE2 . PHE A 1 154 ? 34.696 40.438 75.756  1.00 9.62  ? 277 PHE A CE2 1 
ATOM   1209 C  CZ  . PHE A 1 154 ? 33.973 39.304 75.429  1.00 8.92  ? 277 PHE A CZ  1 
ATOM   1210 N  N   . ALA A 1 155 ? 32.188 45.838 72.650  1.00 9.91  ? 278 ALA A N   1 
ATOM   1211 C  CA  . ALA A 1 155 ? 31.773 47.238 72.610  1.00 9.91  ? 278 ALA A CA  1 
ATOM   1212 C  C   . ALA A 1 155 ? 31.300 47.700 71.233  1.00 10.12 ? 278 ALA A C   1 
ATOM   1213 O  O   . ALA A 1 155 ? 31.656 47.111 70.215  1.00 9.93  ? 278 ALA A O   1 
ATOM   1214 C  CB  . ALA A 1 155 ? 32.917 48.128 73.086  1.00 10.09 ? 278 ALA A CB  1 
ATOM   1215 N  N   . SER A 1 156 ? 30.516 48.777 71.213  1.00 10.20 ? 279 SER A N   1 
ATOM   1216 C  CA  . SER A 1 156 ? 30.152 49.436 69.963  1.00 10.32 ? 279 SER A CA  1 
ATOM   1217 C  C   . SER A 1 156 ? 31.403 50.040 69.321  1.00 10.68 ? 279 SER A C   1 
ATOM   1218 O  O   . SER A 1 156 ? 32.459 50.120 69.958  1.00 11.02 ? 279 SER A O   1 
ATOM   1219 C  CB  . SER A 1 156 ? 29.094 50.516 70.207  1.00 10.21 ? 279 SER A CB  1 
ATOM   1220 O  OG  . SER A 1 156 ? 27.882 49.935 70.660  1.00 9.23  ? 279 SER A OG  1 
ATOM   1221 N  N   . LYS A 1 157 ? 31.274 50.455 68.062  1.00 11.40 ? 280 LYS A N   1 
ATOM   1222 C  CA  . LYS A 1 157 ? 32.404 50.955 67.276  1.00 11.96 ? 280 LYS A CA  1 
ATOM   1223 C  C   . LYS A 1 157 ? 32.317 52.474 67.091  1.00 12.03 ? 280 LYS A C   1 
ATOM   1224 O  O   . LYS A 1 157 ? 31.218 53.010 66.927  1.00 12.13 ? 280 LYS A O   1 
ATOM   1225 C  CB  . LYS A 1 157 ? 32.451 50.241 65.922  1.00 12.24 ? 280 LYS A CB  1 
ATOM   1226 C  CG  . LYS A 1 157 ? 32.574 48.722 66.027  1.00 13.95 ? 280 LYS A CG  1 
ATOM   1227 C  CD  . LYS A 1 157 ? 32.194 48.041 64.719  1.00 17.04 ? 280 LYS A CD  1 
ATOM   1228 C  CE  . LYS A 1 157 ? 32.250 46.522 64.845  1.00 18.46 ? 280 LYS A CE  1 
ATOM   1229 N  NZ  . LYS A 1 157 ? 31.812 45.843 63.584  1.00 20.67 ? 280 LYS A NZ  1 
ATOM   1230 N  N   . PRO A 1 158 ? 33.471 53.176 67.108  1.00 12.03 ? 281 PRO A N   1 
ATOM   1231 C  CA  . PRO A 1 158 ? 34.830 52.653 67.242  1.00 12.12 ? 281 PRO A CA  1 
ATOM   1232 C  C   . PRO A 1 158 ? 35.230 52.369 68.689  1.00 11.93 ? 281 PRO A C   1 
ATOM   1233 O  O   . PRO A 1 158 ? 34.677 52.964 69.618  1.00 11.99 ? 281 PRO A O   1 
ATOM   1234 C  CB  . PRO A 1 158 ? 35.688 53.791 66.683  1.00 11.92 ? 281 PRO A CB  1 
ATOM   1235 C  CG  . PRO A 1 158 ? 34.932 55.013 67.018  1.00 12.46 ? 281 PRO A CG  1 
ATOM   1236 C  CD  . PRO A 1 158 ? 33.471 54.643 66.939  1.00 12.18 ? 281 PRO A CD  1 
ATOM   1237 N  N   . ALA A 1 159 ? 36.199 51.476 68.864  1.00 12.07 ? 282 ALA A N   1 
ATOM   1238 C  CA  . ALA A 1 159 ? 36.745 51.162 70.189  1.00 12.11 ? 282 ALA A CA  1 
ATOM   1239 C  C   . ALA A 1 159 ? 37.344 52.384 70.888  1.00 12.26 ? 282 ALA A C   1 
ATOM   1240 O  O   . ALA A 1 159 ? 37.312 52.481 72.118  1.00 12.18 ? 282 ALA A O   1 
ATOM   1241 C  CB  . ALA A 1 159 ? 37.776 50.059 70.082  1.00 12.07 ? 282 ALA A CB  1 
ATOM   1242 N  N   . SER A 1 160 ? 37.878 53.317 70.099  1.00 12.69 ? 283 SER A N   1 
ATOM   1243 C  CA  . SER A 1 160 ? 38.432 54.568 70.625  1.00 12.95 ? 283 SER A CA  1 
ATOM   1244 C  C   . SER A 1 160 ? 37.416 55.352 71.451  1.00 12.97 ? 283 SER A C   1 
ATOM   1245 O  O   . SER A 1 160 ? 37.788 56.113 72.350  1.00 13.14 ? 283 SER A O   1 
ATOM   1246 C  CB  . SER A 1 160 ? 38.957 55.444 69.480  1.00 12.97 ? 283 SER A CB  1 
ATOM   1247 O  OG  . SER A 1 160 ? 37.917 55.773 68.578  1.00 13.77 ? 283 SER A OG  1 
ATOM   1248 N  N   . GLU A 1 161 ? 36.136 55.155 71.140  1.00 12.79 ? 284 GLU A N   1 
ATOM   1249 C  CA  . GLU A 1 161 ? 35.042 55.811 71.851  1.00 12.78 ? 284 GLU A CA  1 
ATOM   1250 C  C   . GLU A 1 161 ? 34.459 54.939 72.976  1.00 12.04 ? 284 GLU A C   1 
ATOM   1251 O  O   . GLU A 1 161 ? 34.229 55.426 74.087  1.00 12.05 ? 284 GLU A O   1 
ATOM   1252 C  CB  . GLU A 1 161 ? 33.941 56.215 70.861  1.00 13.22 ? 284 GLU A CB  1 
ATOM   1253 C  CG  . GLU A 1 161 ? 32.703 56.849 71.494  1.00 15.31 ? 284 GLU A CG  1 
ATOM   1254 C  CD  . GLU A 1 161 ? 31.734 57.438 70.476  1.00 18.64 ? 284 GLU A CD  1 
ATOM   1255 O  OE1 . GLU A 1 161 ? 31.958 57.297 69.252  1.00 21.06 ? 284 GLU A OE1 1 
ATOM   1256 O  OE2 . GLU A 1 161 ? 30.733 58.051 70.906  1.00 21.56 ? 284 GLU A OE2 1 
ATOM   1257 N  N   . PHE A 1 162 ? 34.229 53.661 72.680  1.00 11.23 ? 285 PHE A N   1 
ATOM   1258 C  CA  . PHE A 1 162 ? 33.412 52.799 73.544  1.00 10.40 ? 285 PHE A CA  1 
ATOM   1259 C  C   . PHE A 1 162 ? 34.181 51.876 74.496  1.00 10.28 ? 285 PHE A C   1 
ATOM   1260 O  O   . PHE A 1 162 ? 33.581 51.267 75.391  1.00 10.01 ? 285 PHE A O   1 
ATOM   1261 C  CB  . PHE A 1 162 ? 32.411 52.005 72.698  1.00 10.24 ? 285 PHE A CB  1 
ATOM   1262 C  CG  . PHE A 1 162 ? 31.390 52.869 72.017  1.00 10.14 ? 285 PHE A CG  1 
ATOM   1263 C  CD1 . PHE A 1 162 ? 30.269 53.318 72.710  1.00 9.86  ? 285 PHE A CD1 1 
ATOM   1264 C  CD2 . PHE A 1 162 ? 31.557 53.254 70.689  1.00 10.38 ? 285 PHE A CD2 1 
ATOM   1265 C  CE1 . PHE A 1 162 ? 29.321 54.137 72.084  1.00 10.06 ? 285 PHE A CE1 1 
ATOM   1266 C  CE2 . PHE A 1 162 ? 30.623 54.067 70.056  1.00 9.91  ? 285 PHE A CE2 1 
ATOM   1267 C  CZ  . PHE A 1 162 ? 29.499 54.514 70.755  1.00 10.38 ? 285 PHE A CZ  1 
ATOM   1268 N  N   . VAL A 1 163 ? 35.496 51.781 74.305  1.00 9.93  ? 286 VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 163 ? 36.356 50.996 75.194  1.00 9.97  ? 286 VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 163 ? 37.186 51.933 76.072  1.00 10.22 ? 286 VAL A C   1 
ATOM   1271 O  O   . VAL A 1 163 ? 37.962 52.749 75.561  1.00 10.03 ? 286 VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 163 ? 37.288 50.047 74.395  1.00 10.05 ? 286 VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 163 ? 38.224 49.271 75.327  1.00 9.95  ? 286 VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 163 ? 36.464 49.089 73.539  1.00 10.04 ? 286 VAL A CG2 1 
ATOM   1275 N  N   . LYS A 1 164 ? 37.001 51.818 77.387  1.00 10.55 ? 287 LYS A N   1 
ATOM   1276 C  CA  . LYS A 1 164 ? 37.776 52.586 78.361  1.00 10.75 ? 287 LYS A CA  1 
ATOM   1277 C  C   . LYS A 1 164 ? 38.677 51.649 79.155  1.00 10.86 ? 287 LYS A C   1 
ATOM   1278 O  O   . LYS A 1 164 ? 38.188 50.738 79.817  1.00 10.63 ? 287 LYS A O   1 
ATOM   1279 C  CB  . LYS A 1 164 ? 36.851 53.329 79.331  1.00 11.02 ? 287 LYS A CB  1 
ATOM   1280 C  CG  . LYS A 1 164 ? 35.763 54.170 78.684  1.00 12.27 ? 287 LYS A CG  1 
ATOM   1281 C  CD  . LYS A 1 164 ? 36.352 55.316 77.889  1.00 14.44 ? 287 LYS A CD  1 
ATOM   1282 C  CE  . LYS A 1 164 ? 35.272 56.084 77.156  1.00 15.34 ? 287 LYS A CE  1 
ATOM   1283 N  NZ  . LYS A 1 164 ? 35.868 57.173 76.340  1.00 16.25 ? 287 LYS A NZ  1 
ATOM   1284 N  N   . ILE A 1 165 ? 39.988 51.886 79.093  1.00 10.69 ? 288 ILE A N   1 
ATOM   1285 C  CA  . ILE A 1 165 ? 40.954 51.107 79.868  1.00 10.83 ? 288 ILE A CA  1 
ATOM   1286 C  C   . ILE A 1 165 ? 41.481 51.959 81.024  1.00 11.13 ? 288 ILE A C   1 
ATOM   1287 O  O   . ILE A 1 165 ? 42.064 53.028 80.805  1.00 11.05 ? 288 ILE A O   1 
ATOM   1288 C  CB  . ILE A 1 165 ? 42.131 50.576 78.989  1.00 10.68 ? 288 ILE A CB  1 
ATOM   1289 C  CG1 . ILE A 1 165 ? 41.611 49.792 77.772  1.00 10.83 ? 288 ILE A CG1 1 
ATOM   1290 C  CG2 . ILE A 1 165 ? 43.099 49.725 79.812  1.00 11.13 ? 288 ILE A CG2 1 
ATOM   1291 C  CD1 . ILE A 1 165 ? 40.710 48.584 78.109  1.00 10.43 ? 288 ILE A CD1 1 
ATOM   1292 N  N   . LEU A 1 166 ? 41.250 51.475 82.242  1.00 11.24 ? 289 LEU A N   1 
ATOM   1293 C  CA  A LEU A 1 166 ? 41.676 52.164 83.459  0.50 11.65 ? 289 LEU A CA  1 
ATOM   1294 C  CA  B LEU A 1 166 ? 41.670 52.163 83.460  0.50 11.65 ? 289 LEU A CA  1 
ATOM   1295 C  C   . LEU A 1 166 ? 42.744 51.346 84.172  1.00 11.92 ? 289 LEU A C   1 
ATOM   1296 O  O   . LEU A 1 166 ? 42.578 50.147 84.387  1.00 11.65 ? 289 LEU A O   1 
ATOM   1297 C  CB  A LEU A 1 166 ? 40.487 52.387 84.396  0.50 11.50 ? 289 LEU A CB  1 
ATOM   1298 C  CB  B LEU A 1 166 ? 40.473 52.370 84.393  0.50 11.51 ? 289 LEU A CB  1 
ATOM   1299 C  CG  A LEU A 1 166 ? 39.311 53.217 83.876  0.50 11.37 ? 289 LEU A CG  1 
ATOM   1300 C  CG  B LEU A 1 166 ? 39.527 53.560 84.190  0.50 11.40 ? 289 LEU A CG  1 
ATOM   1301 C  CD1 A LEU A 1 166 ? 38.232 53.323 84.940  0.50 11.45 ? 289 LEU A CD1 1 
ATOM   1302 C  CD1 B LEU A 1 166 ? 39.002 53.671 82.764  0.50 11.39 ? 289 LEU A CD1 1 
ATOM   1303 C  CD2 A LEU A 1 166 ? 39.777 54.594 83.442  0.50 11.54 ? 289 LEU A CD2 1 
ATOM   1304 C  CD2 B LEU A 1 166 ? 38.371 53.462 85.175  0.50 11.70 ? 289 LEU A CD2 1 
ATOM   1305 N  N   . ASP A 1 167 ? 43.846 51.990 84.545  1.00 12.65 ? 290 ASP A N   1 
ATOM   1306 C  CA  . ASP A 1 167 ? 44.907 51.247 85.228  1.00 13.63 ? 290 ASP A CA  1 
ATOM   1307 C  C   . ASP A 1 167 ? 44.576 50.890 86.682  1.00 13.63 ? 290 ASP A C   1 
ATOM   1308 O  O   . ASP A 1 167 ? 45.078 49.897 87.198  1.00 13.81 ? 290 ASP A O   1 
ATOM   1309 C  CB  . ASP A 1 167 ? 46.282 51.924 85.095  1.00 14.61 ? 290 ASP A CB  1 
ATOM   1310 C  CG  . ASP A 1 167 ? 46.348 53.289 85.753  1.00 16.41 ? 290 ASP A CG  1 
ATOM   1311 O  OD1 . ASP A 1 167 ? 45.295 53.890 86.043  1.00 19.56 ? 290 ASP A OD1 1 
ATOM   1312 O  OD2 . ASP A 1 167 ? 47.483 53.771 85.972  1.00 20.35 ? 290 ASP A OD2 1 
ATOM   1313 N  N   . THR A 1 168 ? 43.729 51.687 87.332  1.00 13.40 ? 291 THR A N   1 
ATOM   1314 C  CA  . THR A 1 168 ? 43.342 51.423 88.721  1.00 13.51 ? 291 THR A CA  1 
ATOM   1315 C  C   . THR A 1 168 ? 41.850 51.642 88.933  1.00 13.43 ? 291 THR A C   1 
ATOM   1316 O  O   . THR A 1 168 ? 41.203 52.328 88.145  1.00 13.47 ? 291 THR A O   1 
ATOM   1317 C  CB  . THR A 1 168 ? 44.095 52.331 89.724  1.00 13.61 ? 291 THR A CB  1 
ATOM   1318 O  OG1 . THR A 1 168 ? 43.602 53.669 89.620  1.00 13.76 ? 291 THR A OG1 1 
ATOM   1319 C  CG2 . THR A 1 168 ? 45.613 52.308 89.484  1.00 13.51 ? 291 THR A CG2 1 
ATOM   1320 N  N   . PHE A 1 169 ? 41.316 51.073 90.012  1.00 13.50 ? 292 PHE A N   1 
ATOM   1321 C  CA  . PHE A 1 169 ? 39.907 51.260 90.363  1.00 13.55 ? 292 PHE A CA  1 
ATOM   1322 C  C   . PHE A 1 169 ? 39.625 52.680 90.857  1.00 13.71 ? 292 PHE A C   1 
ATOM   1323 O  O   . PHE A 1 169 ? 38.507 53.179 90.727  1.00 13.56 ? 292 PHE A O   1 
ATOM   1324 C  CB  . PHE A 1 169 ? 39.461 50.204 91.379  1.00 13.66 ? 292 PHE A CB  1 
ATOM   1325 C  CG  . PHE A 1 169 ? 39.434 48.813 90.815  1.00 13.31 ? 292 PHE A CG  1 
ATOM   1326 C  CD1 . PHE A 1 169 ? 40.585 48.025 90.809  1.00 13.28 ? 292 PHE A CD1 1 
ATOM   1327 C  CD2 . PHE A 1 169 ? 38.265 48.298 90.267  1.00 13.08 ? 292 PHE A CD2 1 
ATOM   1328 C  CE1 . PHE A 1 169 ? 40.571 46.743 90.270  1.00 13.16 ? 292 PHE A CE1 1 
ATOM   1329 C  CE2 . PHE A 1 169 ? 38.237 47.017 89.726  1.00 13.03 ? 292 PHE A CE2 1 
ATOM   1330 C  CZ  . PHE A 1 169 ? 39.393 46.237 89.725  1.00 13.32 ? 292 PHE A CZ  1 
ATOM   1331 N  N   . GLU A 1 170 ? 40.654 53.323 91.405  1.00 14.03 ? 293 GLU A N   1 
ATOM   1332 C  CA  . GLU A 1 170 ? 40.594 54.735 91.795  1.00 14.46 ? 293 GLU A CA  1 
ATOM   1333 C  C   . GLU A 1 170 ? 40.260 55.637 90.601  1.00 13.94 ? 293 GLU A C   1 
ATOM   1334 O  O   . GLU A 1 170 ? 39.627 56.684 90.763  1.00 14.04 ? 293 GLU A O   1 
ATOM   1335 C  CB  . GLU A 1 170 ? 41.921 55.167 92.436  1.00 14.71 ? 293 GLU A CB  1 
ATOM   1336 C  CG  . GLU A 1 170 ? 42.136 54.660 93.879  1.00 17.05 ? 293 GLU A CG  1 
ATOM   1337 C  CD  . GLU A 1 170 ? 42.498 53.179 93.974  1.00 19.32 ? 293 GLU A CD  1 
ATOM   1338 O  OE1 . GLU A 1 170 ? 42.860 52.559 92.948  1.00 20.47 ? 293 GLU A OE1 1 
ATOM   1339 O  OE2 . GLU A 1 170 ? 42.425 52.627 95.093  1.00 21.22 ? 293 GLU A OE2 1 
ATOM   1340 N  N   . LYS A 1 171 ? 40.674 55.211 89.406  1.00 13.60 ? 294 LYS A N   1 
ATOM   1341 C  CA  . LYS A 1 171 ? 40.441 55.960 88.166  1.00 13.37 ? 294 LYS A CA  1 
ATOM   1342 C  C   . LYS A 1 171 ? 38.970 56.006 87.727  1.00 12.72 ? 294 LYS A C   1 
ATOM   1343 O  O   . LYS A 1 171 ? 38.623 56.753 86.814  1.00 12.15 ? 294 LYS A O   1 
ATOM   1344 C  CB  . LYS A 1 171 ? 41.313 55.423 87.020  1.00 13.38 ? 294 LYS A CB  1 
ATOM   1345 C  CG  . LYS A 1 171 ? 42.825 55.651 87.172  1.00 15.12 ? 294 LYS A CG  1 
ATOM   1346 C  CD  . LYS A 1 171 ? 43.202 57.132 87.166  1.00 17.40 ? 294 LYS A CD  1 
ATOM   1347 C  CE  . LYS A 1 171 ? 44.585 57.378 86.561  1.00 19.34 ? 294 LYS A CE  1 
ATOM   1348 N  NZ  . LYS A 1 171 ? 45.669 56.592 87.216  1.00 21.41 ? 294 LYS A NZ  1 
ATOM   1349 N  N   . LEU A 1 172 ? 38.115 55.204 88.363  1.00 12.54 ? 295 LEU A N   1 
ATOM   1350 C  CA  . LEU A 1 172 ? 36.671 55.275 88.105  1.00 12.23 ? 295 LEU A CA  1 
ATOM   1351 C  C   . LEU A 1 172 ? 36.124 56.658 88.459  1.00 12.49 ? 295 LEU A C   1 
ATOM   1352 O  O   . LEU A 1 172 ? 35.203 57.157 87.807  1.00 12.07 ? 295 LEU A O   1 
ATOM   1353 C  CB  . LEU A 1 172 ? 35.912 54.184 88.867  1.00 12.12 ? 295 LEU A CB  1 
ATOM   1354 C  CG  . LEU A 1 172 ? 35.995 52.777 88.267  1.00 11.51 ? 295 LEU A CG  1 
ATOM   1355 C  CD1 . LEU A 1 172 ? 35.543 51.740 89.288  1.00 10.54 ? 295 LEU A CD1 1 
ATOM   1356 C  CD2 . LEU A 1 172 ? 35.168 52.672 86.985  1.00 11.52 ? 295 LEU A CD2 1 
ATOM   1357 N  N   . LYS A 1 173 ? 36.714 57.276 89.484  1.00 12.72 ? 296 LYS A N   1 
ATOM   1358 C  CA  . LYS A 1 173 ? 36.362 58.643 89.870  1.00 12.96 ? 296 LYS A CA  1 
ATOM   1359 C  C   . LYS A 1 173 ? 36.680 59.634 88.750  1.00 12.60 ? 296 LYS A C   1 
ATOM   1360 O  O   . LYS A 1 173 ? 35.865 60.511 88.435  1.00 12.54 ? 296 LYS A O   1 
ATOM   1361 C  CB  . LYS A 1 173 ? 37.079 59.048 91.165  1.00 13.44 ? 296 LYS A CB  1 
ATOM   1362 C  CG  . LYS A 1 173 ? 36.562 58.359 92.427  1.00 15.68 ? 296 LYS A CG  1 
ATOM   1363 C  CD  . LYS A 1 173 ? 35.152 58.806 92.774  1.00 19.61 ? 296 LYS A CD  1 
ATOM   1364 C  CE  . LYS A 1 173 ? 34.761 58.399 94.189  1.00 21.91 ? 296 LYS A CE  1 
ATOM   1365 N  NZ  . LYS A 1 173 ? 33.305 58.622 94.434  1.00 23.58 ? 296 LYS A NZ  1 
ATOM   1366 N  N   . ASP A 1 174 ? 37.865 59.477 88.156  1.00 12.34 ? 297 ASP A N   1 
ATOM   1367 C  CA  A ASP A 1 174 ? 38.289 60.330 87.055  0.50 12.11 ? 297 ASP A CA  1 
ATOM   1368 C  CA  B ASP A 1 174 ? 38.315 60.305 87.035  0.50 12.01 ? 297 ASP A CA  1 
ATOM   1369 C  C   . ASP A 1 174 ? 37.427 60.097 85.813  1.00 11.79 ? 297 ASP A C   1 
ATOM   1370 O  O   . ASP A 1 174 ? 37.114 61.043 85.092  1.00 11.33 ? 297 ASP A O   1 
ATOM   1371 C  CB  A ASP A 1 174 ? 39.773 60.119 86.749  0.50 12.27 ? 297 ASP A CB  1 
ATOM   1372 C  CB  B ASP A 1 174 ? 39.763 59.975 86.664  0.50 12.09 ? 297 ASP A CB  1 
ATOM   1373 C  CG  A ASP A 1 174 ? 40.667 60.497 87.918  0.50 12.83 ? 297 ASP A CG  1 
ATOM   1374 C  CG  B ASP A 1 174 ? 40.736 60.255 87.788  0.50 12.25 ? 297 ASP A CG  1 
ATOM   1375 O  OD1 A ASP A 1 174 ? 40.334 61.466 88.639  0.50 13.02 ? 297 ASP A OD1 1 
ATOM   1376 O  OD1 B ASP A 1 174 ? 40.564 59.683 88.887  0.50 11.60 ? 297 ASP A OD1 1 
ATOM   1377 O  OD2 A ASP A 1 174 ? 41.700 59.825 88.117  0.50 13.32 ? 297 ASP A OD2 1 
ATOM   1378 O  OD2 B ASP A 1 174 ? 41.682 61.041 87.564  0.50 12.39 ? 297 ASP A OD2 1 
ATOM   1379 N  N   . LEU A 1 175 ? 37.030 58.845 85.581  1.00 11.40 ? 298 LEU A N   1 
ATOM   1380 C  CA  . LEU A 1 175 ? 36.139 58.525 84.460  1.00 11.03 ? 298 LEU A CA  1 
ATOM   1381 C  C   . LEU A 1 175 ? 34.772 59.194 84.628  1.00 10.72 ? 298 LEU A C   1 
ATOM   1382 O  O   . LEU A 1 175 ? 34.215 59.725 83.664  1.00 10.38 ? 298 LEU A O   1 
ATOM   1383 C  CB  . LEU A 1 175 ? 35.991 57.007 84.272  1.00 11.21 ? 298 LEU A CB  1 
ATOM   1384 C  CG  . LEU A 1 175 ? 35.188 56.517 83.053  1.00 11.78 ? 298 LEU A CG  1 
ATOM   1385 C  CD1 . LEU A 1 175 ? 35.791 56.996 81.734  1.00 12.66 ? 298 LEU A CD1 1 
ATOM   1386 C  CD2 . LEU A 1 175 ? 35.062 54.996 83.060  1.00 12.01 ? 298 LEU A CD2 1 
ATOM   1387 N  N   . PHE A 1 176 ? 34.247 59.170 85.853  1.00 10.24 ? 299 PHE A N   1 
ATOM   1388 C  CA  . PHE A 1 176 ? 32.980 59.831 86.173  1.00 10.32 ? 299 PHE A CA  1 
ATOM   1389 C  C   . PHE A 1 176 ? 33.079 61.347 85.985  1.00 10.28 ? 299 PHE A C   1 
ATOM   1390 O  O   . PHE A 1 176 ? 32.144 61.979 85.489  1.00 10.03 ? 299 PHE A O   1 
ATOM   1391 C  CB  . PHE A 1 176 ? 32.514 59.477 87.594  1.00 10.32 ? 299 PHE A CB  1 
ATOM   1392 C  CG  . PHE A 1 176 ? 31.202 60.110 87.982  1.00 10.80 ? 299 PHE A CG  1 
ATOM   1393 C  CD1 . PHE A 1 176 ? 30.050 59.887 87.224  1.00 10.65 ? 299 PHE A CD1 1 
ATOM   1394 C  CD2 . PHE A 1 176 ? 31.115 60.923 89.110  1.00 11.24 ? 299 PHE A CD2 1 
ATOM   1395 C  CE1 . PHE A 1 176 ? 28.834 60.475 87.576  1.00 10.82 ? 299 PHE A CE1 1 
ATOM   1396 C  CE2 . PHE A 1 176 ? 29.900 61.512 89.478  1.00 11.04 ? 299 PHE A CE2 1 
ATOM   1397 C  CZ  . PHE A 1 176 ? 28.759 61.289 88.708  1.00 11.52 ? 299 PHE A CZ  1 
ATOM   1398 N  N   . THR A 1 177 ? 34.215 61.920 86.378  1.00 10.52 ? 300 THR A N   1 
ATOM   1399 C  CA  . THR A 1 177 ? 34.488 63.340 86.137  1.00 10.77 ? 300 THR A CA  1 
ATOM   1400 C  C   . THR A 1 177 ? 34.394 63.667 84.643  1.00 10.82 ? 300 THR A C   1 
ATOM   1401 O  O   . THR A 1 177 ? 33.716 64.626 84.248  1.00 10.67 ? 300 THR A O   1 
ATOM   1402 C  CB  . THR A 1 177 ? 35.871 63.747 86.698  1.00 10.79 ? 300 THR A CB  1 
ATOM   1403 O  OG1 . THR A 1 177 ? 35.832 63.698 88.128  1.00 11.16 ? 300 THR A OG1 1 
ATOM   1404 C  CG2 . THR A 1 177 ? 36.252 65.161 86.260  1.00 11.22 ? 300 THR A CG2 1 
ATOM   1405 N  N   . GLU A 1 178 ? 35.055 62.850 83.823  1.00 10.80 ? 301 GLU A N   1 
ATOM   1406 C  CA  . GLU A 1 178 ? 35.059 63.022 82.373  1.00 11.10 ? 301 GLU A CA  1 
ATOM   1407 C  C   . GLU A 1 178 ? 33.670 62.833 81.774  1.00 10.89 ? 301 GLU A C   1 
ATOM   1408 O  O   . GLU A 1 178 ? 33.256 63.615 80.918  1.00 10.72 ? 301 GLU A O   1 
ATOM   1409 C  CB  . GLU A 1 178 ? 36.047 62.058 81.711  1.00 11.41 ? 301 GLU A CB  1 
ATOM   1410 C  CG  . GLU A 1 178 ? 37.502 62.241 82.132  1.00 13.94 ? 301 GLU A CG  1 
ATOM   1411 C  CD  . GLU A 1 178 ? 38.397 61.096 81.673  1.00 17.76 ? 301 GLU A CD  1 
ATOM   1412 O  OE1 . GLU A 1 178 ? 37.902 60.173 80.986  1.00 19.27 ? 301 GLU A OE1 1 
ATOM   1413 O  OE2 . GLU A 1 178 ? 39.608 61.125 81.989  1.00 20.11 ? 301 GLU A OE2 1 
ATOM   1414 N  N   . LEU A 1 179 ? 32.958 61.799 82.230  1.00 10.75 ? 302 LEU A N   1 
ATOM   1415 C  CA  . LEU A 1 179 ? 31.608 61.484 81.735  1.00 10.80 ? 302 LEU A CA  1 
ATOM   1416 C  C   . LEU A 1 179 ? 30.658 62.674 81.904  1.00 10.91 ? 302 LEU A C   1 
ATOM   1417 O  O   . LEU A 1 179 ? 29.886 63.000 81.000  1.00 10.74 ? 302 LEU A O   1 
ATOM   1418 C  CB  . LEU A 1 179 ? 31.044 60.249 82.455  1.00 10.85 ? 302 LEU A CB  1 
ATOM   1419 C  CG  . LEU A 1 179 ? 29.670 59.676 82.073  1.00 11.66 ? 302 LEU A CG  1 
ATOM   1420 C  CD1 . LEU A 1 179 ? 29.598 58.192 82.424  1.00 12.57 ? 302 LEU A CD1 1 
ATOM   1421 C  CD2 . LEU A 1 179 ? 28.515 60.431 82.734  1.00 12.07 ? 302 LEU A CD2 1 
ATOM   1422 N  N   . GLN A 1 180 ? 30.739 63.322 83.061  1.00 10.96 ? 303 GLN A N   1 
ATOM   1423 C  CA  . GLN A 1 180 ? 29.845 64.427 83.404  1.00 11.04 ? 303 GLN A CA  1 
ATOM   1424 C  C   . GLN A 1 180 ? 30.020 65.655 82.518  1.00 11.14 ? 303 GLN A C   1 
ATOM   1425 O  O   . GLN A 1 180 ? 29.092 66.448 82.367  1.00 10.92 ? 303 GLN A O   1 
ATOM   1426 C  CB  . GLN A 1 180 ? 30.031 64.821 84.864  1.00 11.18 ? 303 GLN A CB  1 
ATOM   1427 C  CG  . GLN A 1 180 ? 29.470 63.821 85.853  1.00 11.73 ? 303 GLN A CG  1 
ATOM   1428 C  CD  . GLN A 1 180 ? 29.759 64.231 87.271  1.00 13.46 ? 303 GLN A CD  1 
ATOM   1429 O  OE1 . GLN A 1 180 ? 28.892 64.765 87.963  1.00 13.56 ? 303 GLN A OE1 1 
ATOM   1430 N  NE2 . GLN A 1 180 ? 30.992 64.009 87.711  1.00 13.94 ? 303 GLN A NE2 1 
ATOM   1431 N  N   . LYS A 1 181 ? 31.208 65.813 81.941  1.00 11.20 ? 304 LYS A N   1 
ATOM   1432 C  CA  . LYS A 1 181 ? 31.460 66.911 81.007  1.00 11.69 ? 304 LYS A CA  1 
ATOM   1433 C  C   . LYS A 1 181 ? 30.717 66.714 79.683  1.00 11.53 ? 304 LYS A C   1 
ATOM   1434 O  O   . LYS A 1 181 ? 30.676 67.614 78.837  1.00 11.46 ? 304 LYS A O   1 
ATOM   1435 C  CB  . LYS A 1 181 ? 32.965 67.091 80.774  1.00 12.12 ? 304 LYS A CB  1 
ATOM   1436 C  CG  . LYS A 1 181 ? 33.694 67.622 81.993  1.00 14.14 ? 304 LYS A CG  1 
ATOM   1437 C  CD  . LYS A 1 181 ? 35.068 68.161 81.636  1.00 18.03 ? 304 LYS A CD  1 
ATOM   1438 C  CE  . LYS A 1 181 ? 35.669 68.933 82.805  1.00 19.95 ? 304 LYS A CE  1 
ATOM   1439 N  NZ  . LYS A 1 181 ? 36.155 68.022 83.874  1.00 22.41 ? 304 LYS A NZ  1 
ATOM   1440 N  N   . LYS A 1 182 ? 30.118 65.535 79.525  1.00 11.25 ? 305 LYS A N   1 
ATOM   1441 C  CA  . LYS A 1 182 ? 29.351 65.195 78.330  1.00 11.34 ? 305 LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 182 ? 27.841 65.260 78.571  1.00 10.99 ? 305 LYS A C   1 
ATOM   1443 O  O   . LYS A 1 182 ? 27.052 64.812 77.736  1.00 10.96 ? 305 LYS A O   1 
ATOM   1444 C  CB  . LYS A 1 182 ? 29.761 63.808 77.815  1.00 11.66 ? 305 LYS A CB  1 
ATOM   1445 C  CG  . LYS A 1 182 ? 31.182 63.753 77.238  1.00 13.27 ? 305 LYS A CG  1 
ATOM   1446 C  CD  . LYS A 1 182 ? 31.291 64.552 75.943  1.00 15.61 ? 305 LYS A CD  1 
ATOM   1447 C  CE  . LYS A 1 182 ? 32.709 64.545 75.398  1.00 17.66 ? 305 LYS A CE  1 
ATOM   1448 N  NZ  . LYS A 1 182 ? 32.794 65.333 74.133  1.00 19.25 ? 305 LYS A NZ  1 
ATOM   1449 N  N   . ILE A 1 183 ? 27.448 65.836 79.707  1.00 10.75 ? 306 ILE A N   1 
ATOM   1450 C  CA  . ILE A 1 183 ? 26.037 65.958 80.078  1.00 10.45 ? 306 ILE A CA  1 
ATOM   1451 C  C   . ILE A 1 183 ? 25.470 67.304 79.628  1.00 10.75 ? 306 ILE A C   1 
ATOM   1452 O  O   . ILE A 1 183 ? 25.996 68.360 79.984  1.00 10.64 ? 306 ILE A O   1 
ATOM   1453 C  CB  . ILE A 1 183 ? 25.827 65.760 81.607  1.00 10.33 ? 306 ILE A CB  1 
ATOM   1454 C  CG1 . ILE A 1 183 ? 26.189 64.326 82.011  1.00 9.85  ? 306 ILE A CG1 1 
ATOM   1455 C  CG2 . ILE A 1 183 ? 24.392 66.065 82.001  1.00 10.36 ? 306 ILE A CG2 1 
ATOM   1456 C  CD1 . ILE A 1 183 ? 26.216 64.079 83.522  1.00 8.87  ? 306 ILE A CD1 1 
ATOM   1457 N  N   . TYR A 1 184 ? 24.400 67.256 78.839  1.00 10.90 ? 307 TYR A N   1 
ATOM   1458 C  CA  . TYR A 1 184 ? 23.772 68.474 78.319  1.00 11.24 ? 307 TYR A CA  1 
ATOM   1459 C  C   . TYR A 1 184 ? 22.257 68.425 78.394  1.00 11.75 ? 307 TYR A C   1 
ATOM   1460 O  O   . TYR A 1 184 ? 21.659 67.348 78.343  1.00 11.41 ? 307 TYR A O   1 
ATOM   1461 C  CB  . TYR A 1 184 ? 24.182 68.710 76.863  1.00 11.17 ? 307 TYR A CB  1 
ATOM   1462 C  CG  . TYR A 1 184 ? 25.667 68.875 76.662  1.00 11.25 ? 307 TYR A CG  1 
ATOM   1463 C  CD1 . TYR A 1 184 ? 26.265 70.129 76.757  1.00 10.97 ? 307 TYR A CD1 1 
ATOM   1464 C  CD2 . TYR A 1 184 ? 26.478 67.775 76.380  1.00 11.18 ? 307 TYR A CD2 1 
ATOM   1465 C  CE1 . TYR A 1 184 ? 27.637 70.286 76.581  1.00 10.70 ? 307 TYR A CE1 1 
ATOM   1466 C  CE2 . TYR A 1 184 ? 27.853 67.923 76.197  1.00 11.18 ? 307 TYR A CE2 1 
ATOM   1467 C  CZ  . TYR A 1 184 ? 28.421 69.179 76.299  1.00 10.95 ? 307 TYR A CZ  1 
ATOM   1468 O  OH  . TYR A 1 184 ? 29.777 69.330 76.124  1.00 11.57 ? 307 TYR A OH  1 
ATOM   1469 N  N   . VAL A 1 185 ? 21.642 69.600 78.513  1.00 12.48 ? 308 VAL A N   1 
ATOM   1470 C  CA  . VAL A 1 185 ? 20.217 69.740 78.230  1.00 13.32 ? 308 VAL A CA  1 
ATOM   1471 C  C   . VAL A 1 185 ? 20.100 69.911 76.716  1.00 14.17 ? 308 VAL A C   1 
ATOM   1472 O  O   . VAL A 1 185 ? 20.712 70.811 76.140  1.00 14.02 ? 308 VAL A O   1 
ATOM   1473 C  CB  . VAL A 1 185 ? 19.585 70.957 78.949  1.00 13.05 ? 308 VAL A CB  1 
ATOM   1474 C  CG1 . VAL A 1 185 ? 18.065 70.888 78.865  1.00 13.23 ? 308 VAL A CG1 1 
ATOM   1475 C  CG2 . VAL A 1 185 ? 20.037 71.020 80.416  1.00 12.54 ? 308 VAL A CG2 1 
ATOM   1476 N  N   . ILE A 1 186 ? 19.329 69.036 76.078  1.00 15.33 ? 309 ILE A N   1 
ATOM   1477 C  CA  . ILE A 1 186 ? 19.230 69.022 74.615  1.00 16.97 ? 309 ILE A CA  1 
ATOM   1478 C  C   . ILE A 1 186 ? 18.004 69.804 74.141  1.00 17.64 ? 309 ILE A C   1 
ATOM   1479 O  O   . ILE A 1 186 ? 18.066 70.556 73.165  1.00 18.44 ? 309 ILE A O   1 
ATOM   1480 C  CB  . ILE A 1 186 ? 19.254 67.567 74.047  1.00 16.94 ? 309 ILE A CB  1 
ATOM   1481 C  CG1 . ILE A 1 186 ? 20.546 66.837 74.451  1.00 17.60 ? 309 ILE A CG1 1 
ATOM   1482 C  CG2 . ILE A 1 186 ? 19.067 67.542 72.517  1.00 18.07 ? 309 ILE A CG2 1 
ATOM   1483 C  CD1 . ILE A 1 186 ? 21.843 67.571 74.107  1.00 19.39 ? 309 ILE A CD1 1 
HETATM 1484 MG MG  . MG  B 2 .   ? 38.361 39.150 87.406  1.00 9.77  ? 401 MG  A MG  1 
HETATM 1485 C  C11 . 1HV C 3 .   ? 32.363 56.049 80.017  1.00 18.58 ? 402 1HV A C11 1 
HETATM 1486 C  C12 . 1HV C 3 .   ? 29.652 55.251 79.641  1.00 17.82 ? 402 1HV A C12 1 
HETATM 1487 C  C13 . 1HV C 3 .   ? 32.642 59.960 77.363  1.00 21.09 ? 402 1HV A C13 1 
HETATM 1488 C  C14 . 1HV C 3 .   ? 34.827 60.837 77.967  1.00 22.98 ? 402 1HV A C14 1 
HETATM 1489 C  C15 . 1HV C 3 .   ? 34.846 59.972 79.076  1.00 21.81 ? 402 1HV A C15 1 
HETATM 1490 C  C16 . 1HV C 3 .   ? 33.713 60.822 77.112  1.00 22.47 ? 402 1HV A C16 1 
HETATM 1491 C  C17 . 1HV C 3 .   ? 33.771 59.106 79.330  1.00 20.72 ? 402 1HV A C17 1 
HETATM 1492 C  C18 . 1HV C 3 .   ? 27.097 56.876 78.798  1.00 15.85 ? 402 1HV A C18 1 
HETATM 1493 C  C19 . 1HV C 3 .   ? 25.457 57.474 77.092  1.00 15.78 ? 402 1HV A C19 1 
HETATM 1494 C  C20 . 1HV C 3 .   ? 26.490 58.044 76.336  1.00 15.76 ? 402 1HV A C20 1 
HETATM 1495 C  C21 . 1HV C 3 .   ? 25.771 56.887 78.333  1.00 15.46 ? 402 1HV A C21 1 
HETATM 1496 C  C22 . 1HV C 3 .   ? 27.809 58.033 76.801  1.00 16.61 ? 402 1HV A C22 1 
HETATM 1497 C  C23 . 1HV C 3 .   ? 35.998 61.769 77.705  1.00 24.72 ? 402 1HV A C23 1 
HETATM 1498 C  C26 . 1HV C 3 .   ? 24.046 57.520 76.529  1.00 15.62 ? 402 1HV A C26 1 
HETATM 1499 C  C29 . 1HV C 3 .   ? 38.329 62.485 78.001  1.00 29.20 ? 402 1HV A C29 1 
HETATM 1500 C  C30 . 1HV C 3 .   ? 39.658 61.991 78.651  1.00 30.86 ? 402 1HV A C30 1 
HETATM 1501 N  N1  . 1HV C 3 .   ? 41.934 62.699 79.394  1.00 33.41 ? 402 1HV A N1  1 
HETATM 1502 N  N2  . 1HV C 3 .   ? 30.324 58.428 78.176  1.00 18.96 ? 402 1HV A N2  1 
HETATM 1503 N  N3  . 1HV C 3 .   ? 29.429 57.444 78.444  1.00 18.02 ? 402 1HV A N3  1 
HETATM 1504 C  C4  . 1HV C 3 .   ? 31.476 58.187 78.656  1.00 19.29 ? 402 1HV A C4  1 
HETATM 1505 C  C5  . 1HV C 3 .   ? 32.658 59.109 78.477  1.00 20.22 ? 402 1HV A C5  1 
HETATM 1506 C  C6  . 1HV C 3 .   ? 28.130 57.449 78.035  1.00 17.01 ? 402 1HV A C6  1 
HETATM 1507 C  C7  . 1HV C 3 .   ? 30.109 56.477 79.133  1.00 18.39 ? 402 1HV A C7  1 
HETATM 1508 C  C8  . 1HV C 3 .   ? 31.438 56.845 79.329  1.00 18.48 ? 402 1HV A C8  1 
HETATM 1509 C  C9  . 1HV C 3 .   ? 31.897 54.826 80.522  1.00 18.55 ? 402 1HV A C9  1 
HETATM 1510 C  C10 . 1HV C 3 .   ? 30.561 54.435 80.333  1.00 17.70 ? 402 1HV A C10 1 
HETATM 1511 N  N24 . 1HV C 3 .   ? 37.214 61.572 78.273  1.00 26.67 ? 402 1HV A N24 1 
HETATM 1512 O  O25 . 1HV C 3 .   ? 35.790 62.702 76.941  1.00 25.46 ? 402 1HV A O25 1 
HETATM 1513 O  O27 . 1HV C 3 .   ? 23.127 57.628 77.328  1.00 15.66 ? 402 1HV A O27 1 
HETATM 1514 N  N28 . 1HV C 3 .   ? 23.831 57.436 75.188  1.00 15.02 ? 402 1HV A N28 1 
HETATM 1515 C  C31 . 1HV C 3 .   ? 40.770 63.110 78.574  1.00 32.39 ? 402 1HV A C31 1 
HETATM 1516 C  C32 . 1HV C 3 .   ? 22.488 57.477 74.616  1.00 15.74 ? 402 1HV A C32 1 
HETATM 1517 O  O   . HOH D 4 .   ? 28.758 49.739 66.472  1.00 8.94  ? 501 HOH A O   1 
HETATM 1518 O  O   . HOH D 4 .   ? 12.735 51.526 81.803  1.00 9.65  ? 502 HOH A O   1 
HETATM 1519 O  O   . HOH D 4 .   ? 38.023 41.898 70.598  1.00 9.77  ? 503 HOH A O   1 
HETATM 1520 O  O   . HOH D 4 .   ? 40.311 39.411 86.596  1.00 10.36 ? 504 HOH A O   1 
HETATM 1521 O  O   . HOH D 4 .   ? 16.787 62.662 79.791  1.00 10.82 ? 505 HOH A O   1 
HETATM 1522 O  O   . HOH D 4 .   ? 35.352 40.592 80.618  1.00 10.14 ? 506 HOH A O   1 
HETATM 1523 O  O   . HOH D 4 .   ? 38.784 37.098 87.529  1.00 10.13 ? 507 HOH A O   1 
HETATM 1524 O  O   . HOH D 4 .   ? 28.255 33.537 89.253  1.00 11.44 ? 508 HOH A O   1 
HETATM 1525 O  O   . HOH D 4 .   ? 37.312 39.146 85.676  1.00 10.44 ? 509 HOH A O   1 
HETATM 1526 O  O   . HOH D 4 .   ? 15.986 59.153 85.911  1.00 12.05 ? 510 HOH A O   1 
HETATM 1527 O  O   . HOH D 4 .   ? 38.019 34.860 85.737  1.00 11.80 ? 511 HOH A O   1 
HETATM 1528 O  O   . HOH D 4 .   ? 34.765 48.254 69.869  1.00 11.78 ? 512 HOH A O   1 
HETATM 1529 O  O   . HOH D 4 .   ? 42.421 43.699 86.383  1.00 12.05 ? 513 HOH A O   1 
HETATM 1530 O  O   . HOH D 4 .   ? 41.459 37.477 85.008  1.00 13.84 ? 514 HOH A O   1 
HETATM 1531 O  O   . HOH D 4 .   ? 23.995 36.311 70.615  1.00 12.90 ? 515 HOH A O   1 
HETATM 1532 O  O   . HOH D 4 .   ? 39.420 36.336 83.576  1.00 13.34 ? 516 HOH A O   1 
HETATM 1533 O  O   . HOH D 4 .   ? 12.347 58.247 82.673  1.00 13.49 ? 517 HOH A O   1 
HETATM 1534 O  O   . HOH D 4 .   ? 12.097 65.105 85.936  1.00 13.79 ? 518 HOH A O   1 
HETATM 1535 O  O   . HOH D 4 .   ? 34.925 64.511 78.963  1.00 13.85 ? 519 HOH A O   1 
HETATM 1536 O  O   . HOH D 4 .   ? 42.312 38.323 82.491  1.00 14.70 ? 520 HOH A O   1 
HETATM 1537 O  O   . HOH D 4 .   ? 26.320 61.686 91.217  1.00 14.47 ? 521 HOH A O   1 
HETATM 1538 O  O   . HOH D 4 .   ? 41.474 49.315 73.921  1.00 14.58 ? 522 HOH A O   1 
HETATM 1539 O  O   . HOH D 4 .   ? 34.185 54.509 92.133  1.00 14.22 ? 523 HOH A O   1 
HETATM 1540 O  O   . HOH D 4 .   ? 37.017 54.749 92.423  1.00 13.90 ? 524 HOH A O   1 
HETATM 1541 O  O   . HOH D 4 .   ? 31.792 29.314 75.923  1.00 15.31 ? 525 HOH A O   1 
HETATM 1542 O  O   . HOH D 4 .   ? 24.410 63.608 91.495  1.00 15.53 ? 526 HOH A O   1 
HETATM 1543 O  O   . HOH D 4 .   ? 9.179  56.987 80.548  1.00 15.68 ? 527 HOH A O   1 
HETATM 1544 O  O   . HOH D 4 .   ? 33.169 56.659 90.498  1.00 15.18 ? 528 HOH A O   1 
HETATM 1545 O  O   . HOH D 4 .   ? 18.901 57.729 90.404  1.00 14.76 ? 529 HOH A O   1 
HETATM 1546 O  O   . HOH D 4 .   ? 38.099 39.175 76.819  1.00 16.31 ? 530 HOH A O   1 
HETATM 1547 O  O   . HOH D 4 .   ? 15.054 59.256 89.444  1.00 15.48 ? 531 HOH A O   1 
HETATM 1548 O  O   . HOH D 4 .   ? 18.731 37.239 87.690  1.00 14.70 ? 532 HOH A O   1 
HETATM 1549 O  O   . HOH D 4 .   ? 14.284 48.991 76.183  1.00 15.83 ? 533 HOH A O   1 
HETATM 1550 O  O   . HOH D 4 .   ? 24.011 39.353 94.745  1.00 16.34 ? 534 HOH A O   1 
HETATM 1551 O  O   . HOH D 4 .   ? 17.826 43.651 74.056  1.00 18.24 ? 535 HOH A O   1 
HETATM 1552 O  O   . HOH D 4 .   ? 22.343 65.952 85.532  0.50 13.84 ? 536 HOH A O   1 
HETATM 1553 O  O   . HOH D 4 .   ? 39.233 52.673 67.457  1.00 15.90 ? 537 HOH A O   1 
HETATM 1554 O  O   . HOH D 4 .   ? 13.726 46.268 75.798  1.00 17.03 ? 538 HOH A O   1 
HETATM 1555 O  O   . HOH D 4 .   ? 44.701 39.490 80.919  1.00 17.76 ? 539 HOH A O   1 
HETATM 1556 O  O   . HOH D 4 .   ? 4.981  43.260 73.895  1.00 16.30 ? 540 HOH A O   1 
HETATM 1557 O  O   . HOH D 4 .   ? 5.430  48.154 77.665  1.00 17.49 ? 541 HOH A O   1 
HETATM 1558 O  O   . HOH D 4 .   ? 27.270 33.395 74.901  1.00 17.08 ? 542 HOH A O   1 
HETATM 1559 O  O   . HOH D 4 .   ? 43.917 40.616 71.524  1.00 17.70 ? 543 HOH A O   1 
HETATM 1560 O  O   . HOH D 4 .   ? 36.802 34.823 74.832  1.00 18.38 ? 544 HOH A O   1 
HETATM 1561 O  O   . HOH D 4 .   ? 34.286 61.870 90.426  1.00 17.30 ? 545 HOH A O   1 
HETATM 1562 O  O   . HOH D 4 .   ? 27.354 32.895 72.133  1.00 18.43 ? 546 HOH A O   1 
HETATM 1563 O  O   . HOH D 4 .   ? 40.302 34.060 79.781  1.00 17.40 ? 547 HOH A O   1 
HETATM 1564 O  O   . HOH D 4 .   ? 30.006 38.961 68.619  1.00 17.70 ? 548 HOH A O   1 
HETATM 1565 O  O   . HOH D 4 .   ? 37.245 50.141 66.489  1.00 17.78 ? 549 HOH A O   1 
HETATM 1566 O  O   . HOH D 4 .   ? 23.777 67.052 90.279  1.00 18.55 ? 550 HOH A O   1 
HETATM 1567 O  O   . HOH D 4 .   ? 8.631  53.503 82.846  1.00 18.67 ? 551 HOH A O   1 
HETATM 1568 O  O   . HOH D 4 .   ? 29.182 31.888 75.992  1.00 18.19 ? 552 HOH A O   1 
HETATM 1569 O  O   . HOH D 4 .   ? 40.413 36.788 75.739  1.00 19.46 ? 553 HOH A O   1 
HETATM 1570 O  O   . HOH D 4 .   ? 16.605 46.829 66.652  1.00 18.76 ? 554 HOH A O   1 
HETATM 1571 O  O   . HOH D 4 .   ? 34.421 33.574 70.681  1.00 18.90 ? 555 HOH A O   1 
HETATM 1572 O  O   . HOH D 4 .   ? 44.246 49.336 73.619  1.00 18.90 ? 556 HOH A O   1 
HETATM 1573 O  O   . HOH D 4 .   ? 19.114 59.450 92.871  1.00 18.04 ? 557 HOH A O   1 
HETATM 1574 O  O   . HOH D 4 .   ? 43.980 54.859 83.529  1.00 19.85 ? 558 HOH A O   1 
HETATM 1575 O  O   . HOH D 4 .   ? 40.317 52.092 74.197  1.00 19.78 ? 559 HOH A O   1 
HETATM 1576 O  O   . HOH D 4 .   ? 12.850 63.639 76.706  1.00 21.73 ? 560 HOH A O   1 
HETATM 1577 O  O   . HOH D 4 .   ? 10.006 42.626 75.830  1.00 19.95 ? 561 HOH A O   1 
HETATM 1578 O  O   . HOH D 4 .   ? 32.621 28.775 88.446  1.00 20.21 ? 562 HOH A O   1 
HETATM 1579 O  O   . HOH D 4 .   ? 47.543 42.210 80.542  1.00 20.16 ? 563 HOH A O   1 
HETATM 1580 O  O   . HOH D 4 .   ? 41.391 43.143 90.672  1.00 20.46 ? 564 HOH A O   1 
HETATM 1581 O  O   . HOH D 4 .   ? 17.074 65.947 90.132  1.00 21.48 ? 565 HOH A O   1 
HETATM 1582 O  O   . HOH D 4 .   ? 33.611 29.437 81.548  1.00 21.48 ? 566 HOH A O   1 
HETATM 1583 O  O   . HOH D 4 .   ? 12.135 60.840 85.474  1.00 22.00 ? 567 HOH A O   1 
HETATM 1584 O  O   . HOH D 4 .   ? 19.310 55.834 100.586 1.00 22.81 ? 568 HOH A O   1 
HETATM 1585 O  O   . HOH D 4 .   ? 37.425 37.469 74.711  1.00 20.12 ? 569 HOH A O   1 
HETATM 1586 O  O   . HOH D 4 .   ? 11.986 56.585 73.316  1.00 20.35 ? 570 HOH A O   1 
HETATM 1587 O  O   . HOH D 4 .   ? 26.717 31.389 90.156  1.00 20.91 ? 571 HOH A O   1 
HETATM 1588 O  O   . HOH D 4 .   ? 44.226 48.342 82.868  1.00 22.00 ? 572 HOH A O   1 
HETATM 1589 O  O   . HOH D 4 .   ? 13.344 58.853 87.112  1.00 21.30 ? 573 HOH A O   1 
HETATM 1590 O  O   . HOH D 4 .   ? 31.343 41.386 68.436  1.00 21.77 ? 574 HOH A O   1 
HETATM 1591 O  O   . HOH D 4 .   ? 7.846  50.226 89.161  1.00 21.10 ? 575 HOH A O   1 
HETATM 1592 O  O   . HOH D 4 .   ? 37.760 55.405 74.916  1.00 20.22 ? 576 HOH A O   1 
HETATM 1593 O  O   . HOH D 4 .   ? 27.631 56.935 95.198  1.00 21.98 ? 577 HOH A O   1 
HETATM 1594 O  O   . HOH D 4 .   ? 26.436 43.151 61.934  1.00 20.99 ? 578 HOH A O   1 
HETATM 1595 O  O   . HOH D 4 .   ? 15.605 40.745 89.371  1.00 22.82 ? 579 HOH A O   1 
HETATM 1596 O  O   . HOH D 4 .   ? 24.948 31.792 79.243  1.00 20.44 ? 580 HOH A O   1 
HETATM 1597 O  O   . HOH D 4 .   ? 15.676 57.706 72.657  1.00 21.96 ? 581 HOH A O   1 
HETATM 1598 O  O   . HOH D 4 .   ? 32.435 64.221 90.160  1.00 21.56 ? 582 HOH A O   1 
HETATM 1599 O  O   . HOH D 4 .   ? 41.448 40.635 70.509  1.00 24.30 ? 583 HOH A O   1 
HETATM 1600 O  O   . HOH D 4 .   ? 25.854 49.983 68.201  1.00 22.40 ? 584 HOH A O   1 
HETATM 1601 O  O   . HOH D 4 .   ? 38.420 63.337 89.110  1.00 22.54 ? 585 HOH A O   1 
HETATM 1602 O  O   . HOH D 4 .   ? 32.661 44.714 98.527  1.00 22.41 ? 586 HOH A O   1 
HETATM 1603 O  O   . HOH D 4 .   ? 20.762 56.737 96.749  1.00 23.93 ? 587 HOH A O   1 
HETATM 1604 O  O   . HOH D 4 .   ? 16.415 39.263 84.581  1.00 21.76 ? 588 HOH A O   1 
HETATM 1605 O  O   . HOH D 4 .   ? 29.393 38.237 65.864  1.00 24.45 ? 589 HOH A O   1 
HETATM 1606 O  O   . HOH D 4 .   ? 32.630 45.497 68.222  1.00 22.99 ? 590 HOH A O   1 
HETATM 1607 O  O   . HOH D 4 .   ? 37.871 39.394 97.306  1.00 22.38 ? 591 HOH A O   1 
HETATM 1608 O  O   . HOH D 4 .   ? 21.447 34.512 89.854  1.00 22.94 ? 592 HOH A O   1 
HETATM 1609 O  O   . HOH D 4 .   ? 10.479 54.719 74.934  1.00 22.10 ? 593 HOH A O   1 
HETATM 1610 O  O   . HOH D 4 .   ? 29.791 41.242 98.954  1.00 24.61 ? 594 HOH A O   1 
HETATM 1611 O  O   . HOH D 4 .   ? 35.506 44.383 67.141  1.00 23.29 ? 595 HOH A O   1 
HETATM 1612 O  O   . HOH D 4 .   ? 26.420 56.908 73.327  1.00 25.33 ? 596 HOH A O   1 
HETATM 1613 O  O   . HOH D 4 .   ? 44.812 45.695 89.438  1.00 23.78 ? 597 HOH A O   1 
HETATM 1614 O  O   . HOH D 4 .   ? 33.989 41.156 98.189  1.00 24.30 ? 598 HOH A O   1 
HETATM 1615 O  O   . HOH D 4 .   ? 30.156 29.011 73.186  1.00 26.80 ? 599 HOH A O   1 
HETATM 1616 O  O   . HOH D 4 .   ? 43.781 38.341 90.003  1.00 25.55 ? 600 HOH A O   1 
HETATM 1617 O  O   . HOH D 4 .   ? 31.100 58.385 74.221  1.00 23.04 ? 601 HOH A O   1 
HETATM 1618 O  O   . HOH D 4 .   ? 11.653 56.797 86.577  1.00 23.45 ? 602 HOH A O   1 
HETATM 1619 O  O   . HOH D 4 .   ? 20.652 45.114 96.158  1.00 24.89 ? 603 HOH A O   1 
HETATM 1620 O  O   . HOH D 4 .   ? 20.221 42.806 94.817  1.00 24.85 ? 604 HOH A O   1 
HETATM 1621 O  O   . HOH D 4 .   ? 34.635 66.817 77.510  1.00 26.37 ? 605 HOH A O   1 
HETATM 1622 O  O   . HOH D 4 .   ? 34.359 70.813 79.358  1.00 26.74 ? 606 HOH A O   1 
HETATM 1623 O  O   . HOH D 4 .   ? 32.691 27.319 86.146  1.00 25.95 ? 607 HOH A O   1 
HETATM 1624 O  O   . HOH D 4 .   ? 14.485 49.851 71.388  1.00 25.64 ? 608 HOH A O   1 
HETATM 1625 O  O   . HOH D 4 .   ? 34.195 66.011 89.069  1.00 25.88 ? 609 HOH A O   1 
HETATM 1626 O  O   . HOH D 4 .   ? 9.133  37.350 81.962  1.00 25.33 ? 610 HOH A O   1 
HETATM 1627 O  O   . HOH D 4 .   ? 6.720  46.232 72.025  1.00 24.60 ? 611 HOH A O   1 
HETATM 1628 O  O   . HOH D 4 .   ? 26.120 56.342 70.664  1.00 27.19 ? 612 HOH A O   1 
HETATM 1629 O  O   . HOH D 4 .   ? 18.859 50.850 71.194  1.00 26.30 ? 613 HOH A O   1 
HETATM 1630 O  O   . HOH D 4 .   ? 40.008 38.372 71.134  1.00 26.61 ? 614 HOH A O   1 
HETATM 1631 O  O   . HOH D 4 .   ? 33.763 58.156 74.848  1.00 26.15 ? 615 HOH A O   1 
HETATM 1632 O  O   . HOH D 4 .   ? 45.131 55.696 90.680  1.00 26.32 ? 616 HOH A O   1 
HETATM 1633 O  O   . HOH D 4 .   ? 7.428  48.338 80.169  1.00 27.17 ? 617 HOH A O   1 
HETATM 1634 O  O   . HOH D 4 .   ? 36.005 47.365 67.591  1.00 26.03 ? 618 HOH A O   1 
HETATM 1635 O  O   . HOH D 4 .   ? 48.229 39.670 77.064  1.00 26.50 ? 619 HOH A O   1 
HETATM 1636 O  O   . HOH D 4 .   ? 36.028 51.067 98.277  1.00 26.00 ? 620 HOH A O   1 
HETATM 1637 O  O   . HOH D 4 .   ? 30.379 27.743 90.082  1.00 27.76 ? 621 HOH A O   1 
HETATM 1638 O  O   . HOH D 4 .   ? 11.766 61.178 76.268  1.00 28.52 ? 622 HOH A O   1 
HETATM 1639 O  O   . HOH D 4 .   ? 41.180 34.477 82.239  1.00 26.54 ? 623 HOH A O   1 
HETATM 1640 O  O   . HOH D 4 .   ? 32.142 28.524 83.671  1.00 28.44 ? 624 HOH A O   1 
HETATM 1641 O  O   . HOH D 4 .   ? 41.055 53.962 77.342  1.00 27.80 ? 625 HOH A O   1 
HETATM 1642 O  O   . HOH D 4 .   ? 11.151 61.485 89.086  1.00 27.23 ? 626 HOH A O   1 
HETATM 1643 O  O   . HOH D 4 .   ? 43.298 49.807 91.893  1.00 27.28 ? 627 HOH A O   1 
HETATM 1644 O  O   . HOH D 4 .   ? 38.253 56.083 94.297  1.00 24.95 ? 628 HOH A O   1 
HETATM 1645 O  O   . HOH D 4 .   ? 28.300 61.085 92.967  1.00 28.30 ? 629 HOH A O   1 
HETATM 1646 O  O   . HOH D 4 .   ? 23.106 35.476 65.342  1.00 29.17 ? 630 HOH A O   1 
HETATM 1647 O  O   . HOH D 4 .   ? 38.720 36.874 96.212  1.00 28.78 ? 631 HOH A O   1 
HETATM 1648 O  O   . HOH D 4 .   ? 17.836 48.238 100.335 1.00 28.53 ? 632 HOH A O   1 
HETATM 1649 O  O   . HOH D 4 .   ? 26.801 49.553 97.430  1.00 28.81 ? 633 HOH A O   1 
HETATM 1650 O  O   . HOH D 4 .   ? 38.673 56.435 66.175  1.00 27.64 ? 634 HOH A O   1 
HETATM 1651 O  O   . HOH D 4 .   ? 7.881  38.770 84.744  1.00 27.55 ? 635 HOH A O   1 
HETATM 1652 O  O   . HOH D 4 .   ? 16.155 46.515 70.560  1.00 26.52 ? 636 HOH A O   1 
HETATM 1653 O  O   . HOH D 4 .   ? 44.305 36.767 75.317  1.00 26.22 ? 637 HOH A O   1 
HETATM 1654 O  O   . HOH D 4 .   ? 8.757  50.909 82.798  1.00 28.11 ? 638 HOH A O   1 
HETATM 1655 O  O   . HOH D 4 .   ? 39.045 34.577 76.392  1.00 29.30 ? 639 HOH A O   1 
HETATM 1656 O  O   . HOH D 4 .   ? 20.511 53.455 69.359  1.00 29.38 ? 640 HOH A O   1 
HETATM 1657 O  O   . HOH D 4 .   ? 46.991 48.179 86.702  1.00 27.47 ? 641 HOH A O   1 
HETATM 1658 O  O   . HOH D 4 .   ? 36.055 32.648 97.563  1.00 29.81 ? 642 HOH A O   1 
HETATM 1659 O  O   . HOH D 4 .   ? 42.851 35.505 86.009  1.00 28.14 ? 643 HOH A O   1 
HETATM 1660 O  O   . HOH D 4 .   ? 6.658  53.982 84.932  1.00 28.57 ? 644 HOH A O   1 
HETATM 1661 O  O   . HOH D 4 .   ? 29.658 33.827 65.638  1.00 29.47 ? 645 HOH A O   1 
HETATM 1662 O  O   . HOH D 4 .   ? 16.085 47.354 96.473  1.00 30.50 ? 646 HOH A O   1 
HETATM 1663 O  O   . HOH D 4 .   ? 27.935 57.822 69.374  1.00 28.14 ? 647 HOH A O   1 
HETATM 1664 O  O   . HOH D 4 .   ? 30.497 37.172 98.767  1.00 27.55 ? 648 HOH A O   1 
HETATM 1665 O  O   . HOH D 4 .   ? 39.077 47.237 67.252  1.00 28.41 ? 649 HOH A O   1 
HETATM 1666 O  O   . HOH D 4 .   ? 8.071  44.685 86.024  1.00 31.49 ? 650 HOH A O   1 
HETATM 1667 O  O   . HOH D 4 .   ? 34.904 31.905 95.282  1.00 28.43 ? 651 HOH A O   1 
HETATM 1668 O  O   . HOH D 4 .   ? 18.114 39.818 70.902  1.00 32.63 ? 652 HOH A O   1 
HETATM 1669 O  O   . HOH D 4 .   ? 35.157 72.160 81.690  1.00 30.26 ? 653 HOH A O   1 
HETATM 1670 O  O   . HOH D 4 .   ? 12.490 55.943 97.361  1.00 30.44 ? 654 HOH A O   1 
HETATM 1671 O  O   . HOH D 4 .   ? 29.770 52.919 64.203  1.00 29.01 ? 655 HOH A O   1 
HETATM 1672 O  O   . HOH D 4 .   ? 14.293 42.503 91.470  1.00 27.15 ? 656 HOH A O   1 
HETATM 1673 O  O   . HOH D 4 .   ? 53.053 49.646 85.138  1.00 28.88 ? 657 HOH A O   1 
HETATM 1674 O  O   . HOH D 4 .   ? 37.855 31.652 77.087  1.00 30.09 ? 658 HOH A O   1 
HETATM 1675 O  O   . HOH D 4 .   ? 43.267 48.028 93.938  1.00 27.54 ? 659 HOH A O   1 
HETATM 1676 O  O   . HOH D 4 .   ? 25.902 66.004 91.482  1.00 29.33 ? 660 HOH A O   1 
HETATM 1677 O  O   . HOH D 4 .   ? 36.809 58.135 69.033  1.00 28.19 ? 661 HOH A O   1 
HETATM 1678 O  O   . HOH D 4 .   ? 28.361 53.492 98.561  1.00 27.51 ? 662 HOH A O   1 
HETATM 1679 O  O   . HOH D 4 .   ? 46.028 38.383 82.885  1.00 30.33 ? 663 HOH A O   1 
HETATM 1680 O  O   . HOH D 4 .   ? 13.903 41.557 87.536  1.00 29.30 ? 664 HOH A O   1 
HETATM 1681 O  O   . HOH D 4 .   ? 43.881 43.644 93.455  1.00 30.04 ? 665 HOH A O   1 
HETATM 1682 O  O   . HOH D 4 .   ? 17.393 45.760 94.675  1.00 32.16 ? 666 HOH A O   1 
HETATM 1683 O  O   . HOH D 4 .   ? 12.090 40.890 74.258  1.00 31.34 ? 667 HOH A O   1 
HETATM 1684 O  O   . HOH D 4 .   ? 42.129 45.596 99.165  1.00 32.25 ? 668 HOH A O   1 
HETATM 1685 O  O   . HOH D 4 .   ? 36.778 34.072 72.011  1.00 30.66 ? 669 HOH A O   1 
HETATM 1686 O  O   . HOH D 4 .   ? 28.706 32.973 94.483  1.00 28.48 ? 670 HOH A O   1 
HETATM 1687 O  O   . HOH D 4 .   ? 33.175 48.422 61.569  1.00 31.97 ? 671 HOH A O   1 
HETATM 1688 O  O   . HOH D 4 .   ? 10.835 63.031 86.906  1.00 30.43 ? 672 HOH A O   1 
HETATM 1689 O  O   . HOH D 4 .   ? 31.562 53.364 99.246  1.00 31.99 ? 673 HOH A O   1 
HETATM 1690 O  O   . HOH D 4 .   ? 23.852 58.012 70.499  1.00 32.58 ? 674 HOH A O   1 
HETATM 1691 O  O   . HOH D 4 .   ? 29.362 60.896 71.806  1.00 32.93 ? 675 HOH A O   1 
HETATM 1692 O  O   . HOH D 4 .   ? 7.402  54.445 69.977  1.00 29.51 ? 676 HOH A O   1 
HETATM 1693 O  O   . HOH D 4 .   ? 30.039 44.849 68.184  1.00 30.02 ? 677 HOH A O   1 
HETATM 1694 O  O   . HOH D 4 .   ? 26.561 32.910 92.992  1.00 31.34 ? 678 HOH A O   1 
HETATM 1695 O  O   . HOH D 4 .   ? 6.258  41.035 84.292  1.00 31.42 ? 679 HOH A O   1 
HETATM 1696 O  O   . HOH D 4 .   ? 36.129 69.032 78.357  1.00 30.28 ? 680 HOH A O   1 
HETATM 1697 O  O   . HOH D 4 .   ? 23.657 33.726 78.416  1.00 29.59 ? 681 HOH A O   1 
HETATM 1698 O  O   . HOH D 4 .   ? 34.365 28.786 75.499  1.00 33.32 ? 682 HOH A O   1 
HETATM 1699 O  O   . HOH D 4 .   ? 28.402 30.359 71.334  1.00 30.14 ? 683 HOH A O   1 
HETATM 1700 O  O   . HOH D 4 .   ? 37.905 58.489 77.910  1.00 32.50 ? 684 HOH A O   1 
HETATM 1701 O  O   . HOH D 4 .   ? 8.837  57.009 83.262  1.00 32.06 ? 685 HOH A O   1 
HETATM 1702 O  O   . HOH D 4 .   ? 24.761 36.753 94.542  1.00 33.18 ? 686 HOH A O   1 
HETATM 1703 O  O   . HOH D 4 .   ? 31.477 67.805 74.240  1.00 34.36 ? 687 HOH A O   1 
HETATM 1704 O  O   . HOH D 4 .   ? 28.259 44.402 98.131  1.00 33.48 ? 688 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? 42.160 57.009 83.528  1.00 34.17 ? 689 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? 37.273 65.247 80.225  1.00 33.53 ? 690 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? 39.585 30.597 84.356  1.00 36.21 ? 691 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? 20.103 62.013 92.952  1.00 33.20 ? 692 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? 6.190  50.468 70.318  1.00 31.03 ? 693 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? 45.882 38.611 76.376  1.00 35.98 ? 694 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? 48.704 49.378 80.345  1.00 35.56 ? 695 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? 38.274 29.670 80.356  1.00 31.85 ? 696 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? 17.799 40.178 92.632  1.00 33.03 ? 697 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? 24.970 32.301 76.047  1.00 33.06 ? 698 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? 32.489 60.404 92.038  1.00 37.24 ? 699 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? 35.145 28.824 89.924  1.00 33.34 ? 700 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? 4.953  43.404 71.235  1.00 33.53 ? 701 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? 14.880 40.962 74.790  1.00 33.81 ? 702 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? 22.924 53.710 68.144  1.00 35.27 ? 703 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? 19.612 59.135 95.472  1.00 33.60 ? 704 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? 22.707 63.380 93.773  1.00 35.75 ? 705 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? 45.663 41.391 69.722  1.00 36.16 ? 706 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? 30.362 26.445 86.796  1.00 34.03 ? 707 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? 16.523 43.023 70.395  1.00 33.97 ? 708 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? 22.486 71.054 73.852  1.00 33.26 ? 709 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? 37.394 68.996 86.092  1.00 37.96 ? 710 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? 9.977  43.319 87.375  1.00 29.19 ? 711 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? 18.427 59.148 72.944  1.00 35.38 ? 712 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? 34.286 55.275 95.084  1.00 34.61 ? 713 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? 26.139 53.788 68.758  1.00 33.18 ? 714 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? 39.932 31.522 79.574  1.00 36.57 ? 715 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? 7.773  58.176 77.916  1.00 37.02 ? 716 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? 10.463 46.563 95.870  1.00 35.79 ? 717 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? 37.592 65.534 82.867  1.00 34.38 ? 718 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? 32.315 45.515 60.232  1.00 36.96 ? 719 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? 44.976 51.666 76.740  1.00 36.06 ? 720 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 9.627  53.677 98.281  1.00 34.85 ? 721 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? 36.133 63.044 92.021  1.00 37.65 ? 722 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? 15.978 58.600 98.111  1.00 37.63 ? 723 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? 39.088 56.091 79.782  1.00 34.90 ? 724 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? 16.878 49.091 70.397  1.00 38.00 ? 725 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? 46.439 51.778 79.967  1.00 37.31 ? 726 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? 7.321  54.027 77.574  1.00 33.85 ? 727 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? 37.467 58.974 73.830  1.00 37.18 ? 728 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? 41.234 41.745 68.023  1.00 36.75 ? 729 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? 9.318  56.375 70.017  1.00 39.36 ? 730 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? 20.607 34.635 94.053  1.00 36.63 ? 731 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? 4.968  38.149 79.150  1.00 40.86 ? 732 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? 30.342 45.967 98.380  1.00 36.95 ? 733 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? 41.296 50.207 68.189  1.00 37.17 ? 734 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? 46.374 49.616 81.834  1.00 37.68 ? 735 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? 41.243 52.259 71.482  1.00 39.26 ? 736 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? 26.965 61.757 95.431  1.00 36.77 ? 737 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? 5.487  49.560 67.546  1.00 42.05 ? 738 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? 37.793 41.080 67.986  1.00 40.41 ? 739 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? 44.328 38.006 72.178  1.00 39.01 ? 740 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? 41.366 36.426 73.247  1.00 36.72 ? 741 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? 39.994 63.997 86.716  1.00 38.59 ? 742 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? 10.431 59.060 72.549  1.00 43.51 ? 743 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? 14.467 70.773 74.839  1.00 38.83 ? 744 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? 34.145 27.230 91.905  1.00 36.71 ? 745 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? 6.120  50.160 81.634  1.00 43.65 ? 746 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? 7.121  54.514 80.503  1.00 41.28 ? 747 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? 6.807  51.260 86.980  1.00 38.46 ? 748 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? 41.251 34.991 91.152  1.00 38.10 ? 749 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? 43.418 49.214 69.393  1.00 39.27 ? 750 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? 30.957 62.335 93.038  1.00 42.41 ? 751 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? 31.958 32.881 66.748  0.50 48.33 ? 752 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? 48.115 39.689 79.790  1.00 41.06 ? 753 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? 21.911 61.777 95.775  1.00 43.48 ? 754 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? 24.397 32.755 68.207  1.00 41.75 ? 755 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? 43.239 36.018 81.391  1.00 39.01 ? 756 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? 21.051 70.008 71.264  1.00 41.57 ? 757 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? 18.617 45.958 98.058  1.00 42.85 ? 758 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? 28.473 53.305 67.030  1.00 35.15 ? 759 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? 15.489 62.730 93.348  1.00 42.03 ? 760 HOH A O   1 
HETATM 1777 O  O   . HOH D 4 .   ? 26.353 47.009 98.251  1.00 40.37 ? 761 HOH A O   1 
HETATM 1778 O  O   . HOH D 4 .   ? 41.635 36.443 99.369  1.00 41.28 ? 762 HOH A O   1 
HETATM 1779 O  O   . HOH D 4 .   ? 32.457 36.778 68.282  1.00 41.61 ? 763 HOH A O   1 
HETATM 1780 O  O   . HOH D 4 .   ? 20.031 34.686 71.983  1.00 41.67 ? 764 HOH A O   1 
HETATM 1781 O  O   . HOH D 4 .   ? 36.157 59.040 71.448  1.00 44.92 ? 765 HOH A O   1 
HETATM 1782 O  O   . HOH D 4 .   ? 7.449  56.459 73.867  1.00 43.05 ? 766 HOH A O   1 
HETATM 1783 O  O   . HOH D 4 .   ? 12.975 58.485 97.987  1.00 47.22 ? 767 HOH A O   1 
HETATM 1784 O  O   . HOH D 4 .   ? 33.952 52.694 98.307  1.00 40.73 ? 768 HOH A O   1 
HETATM 1785 O  O   . HOH D 4 .   ? 44.713 53.860 80.586  1.00 45.58 ? 769 HOH A O   1 
HETATM 1786 O  O   . HOH D 4 .   ? 24.096 50.594 98.884  1.00 48.81 ? 770 HOH A O   1 
HETATM 1787 O  O   . HOH D 4 .   ? 35.191 29.227 95.104  1.00 43.48 ? 771 HOH A O   1 
HETATM 1788 O  O   . HOH D 4 .   ? 50.795 42.290 87.121  1.00 52.25 ? 772 HOH A O   1 
HETATM 1789 O  O   . HOH D 4 .   ? 37.549 27.519 88.772  1.00 46.32 ? 773 HOH A O   1 
HETATM 1790 O  O   . HOH D 4 .   ? 7.137  47.740 90.354  1.00 45.96 ? 774 HOH A O   1 
HETATM 1791 O  O   . HOH D 4 .   ? 7.524  48.309 98.975  1.00 38.90 ? 775 HOH A O   1 
HETATM 1792 O  O   . HOH D 4 .   ? 16.070 60.039 92.574  1.00 43.45 ? 776 HOH A O   1 
HETATM 1793 O  O   . HOH D 4 .   ? 3.036  49.642 89.204  1.00 49.64 ? 777 HOH A O   1 
HETATM 1794 O  O   . HOH D 4 .   ? 8.376  36.603 76.260  1.00 50.26 ? 778 HOH A O   1 
HETATM 1795 O  O   . HOH D 4 .   ? 23.357 60.530 97.851  1.00 42.98 ? 779 HOH A O   1 
HETATM 1796 O  O   . HOH D 4 .   ? 41.499 37.520 96.741  1.00 43.83 ? 780 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? 18.519 62.184 73.161  1.00 46.02 ? 781 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? 15.661 44.012 93.577  1.00 45.66 ? 782 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? 39.710 58.072 83.105  1.00 46.44 ? 783 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? 13.629 49.918 73.819  1.00 47.80 ? 784 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? 16.066 39.777 72.658  1.00 46.10 ? 785 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? 6.667  50.894 79.079  1.00 43.61 ? 786 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? 42.551 58.811 90.746  1.00 50.52 ? 787 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? 9.888  39.346 87.373  1.00 48.70 ? 788 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? 43.771 39.020 92.887  1.00 46.31 ? 789 HOH A O   1 
HETATM 1806 O  O   . HOH D 4 .   ? 23.972 34.918 92.739  1.00 48.64 ? 790 HOH A O   1 
HETATM 1807 O  O   . HOH D 4 .   ? 3.812  51.181 87.098  1.00 46.34 ? 791 HOH A O   1 
HETATM 1808 O  O   . HOH D 4 .   ? 30.552 57.562 95.192  1.00 49.22 ? 792 HOH A O   1 
HETATM 1809 O  O   . HOH D 4 .   ? 40.534 62.323 84.191  1.00 53.53 ? 793 HOH A O   1 
HETATM 1810 O  O   . HOH D 4 .   ? 4.183  40.461 82.216  1.00 45.92 ? 794 HOH A O   1 
HETATM 1811 O  O   . HOH D 4 .   ? 22.651 65.898 94.834  0.50 45.76 ? 795 HOH A O   1 
HETATM 1812 O  O   . HOH D 4 .   ? 47.485 55.537 89.099  1.00 53.03 ? 796 HOH A O   1 
HETATM 1813 O  O   . HOH D 4 .   ? 42.964 35.920 88.685  1.00 58.94 ? 797 HOH A O   1 
HETATM 1814 O  O   . HOH D 4 .   ? 23.856 69.168 71.855  1.00 56.53 ? 798 HOH A O   1 
HETATM 1815 O  O   . HOH D 4 .   ? 28.373 29.372 89.413  1.00 60.68 ? 799 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   124 ?   ?   ?   A . n 
A 1 2   ALA 2   125 ?   ?   ?   A . n 
A 1 3   SER 3   126 ?   ?   ?   A . n 
A 1 4   LYS 4   127 ?   ?   ?   A . n 
A 1 5   GLY 5   128 128 GLY GLY A . n 
A 1 6   ASN 6   129 129 ASN ASN A . n 
A 1 7   VAL 7   130 130 VAL VAL A . n 
A 1 8   ASP 8   131 131 ASP ASP A . n 
A 1 9   LEU 9   132 132 LEU LEU A . n 
A 1 10  VAL 10  133 133 VAL VAL A . n 
A 1 11  PHE 11  134 134 PHE PHE A . n 
A 1 12  LEU 12  135 135 LEU LEU A . n 
A 1 13  PHE 13  136 136 PHE PHE A . n 
A 1 14  ASP 14  137 137 ASP ASP A . n 
A 1 15  GLY 15  138 138 GLY GLY A . n 
A 1 16  SER 16  139 139 SER SER A . n 
A 1 17  MET 17  140 140 MET MET A . n 
A 1 18  SER 18  141 141 SER SER A . n 
A 1 19  LEU 19  142 142 LEU LEU A . n 
A 1 20  GLN 20  143 143 GLN GLN A . n 
A 1 21  PRO 21  144 144 PRO PRO A . n 
A 1 22  ASP 22  145 145 ASP ASP A . n 
A 1 23  GLU 23  146 146 GLU GLU A . n 
A 1 24  PHE 24  147 147 PHE PHE A . n 
A 1 25  GLN 25  148 148 GLN GLN A . n 
A 1 26  LYS 26  149 149 LYS LYS A . n 
A 1 27  ILE 27  150 150 ILE ILE A . n 
A 1 28  LEU 28  151 151 LEU LEU A . n 
A 1 29  ASP 29  152 152 ASP ASP A . n 
A 1 30  PHE 30  153 153 PHE PHE A . n 
A 1 31  MET 31  154 154 MET MET A . n 
A 1 32  LYS 32  155 155 LYS LYS A . n 
A 1 33  ASP 33  156 156 ASP ASP A . n 
A 1 34  VAL 34  157 157 VAL VAL A . n 
A 1 35  MET 35  158 158 MET MET A . n 
A 1 36  LYS 36  159 159 LYS LYS A . n 
A 1 37  LYS 37  160 160 LYS LYS A . n 
A 1 38  LEU 38  161 161 LEU LEU A . n 
A 1 39  SER 39  162 162 SER SER A . n 
A 1 40  ASN 40  163 163 ASN ASN A . n 
A 1 41  THR 41  164 164 THR THR A . n 
A 1 42  SER 42  165 165 SER SER A . n 
A 1 43  TYR 43  166 166 TYR TYR A . n 
A 1 44  GLN 44  167 167 GLN GLN A . n 
A 1 45  PHE 45  168 168 PHE PHE A . n 
A 1 46  ALA 46  169 169 ALA ALA A . n 
A 1 47  ALA 47  170 170 ALA ALA A . n 
A 1 48  VAL 48  171 171 VAL VAL A . n 
A 1 49  GLN 49  172 172 GLN GLN A . n 
A 1 50  PHE 50  173 173 PHE PHE A . n 
A 1 51  SER 51  174 174 SER SER A . n 
A 1 52  THR 52  175 175 THR THR A . n 
A 1 53  SER 53  176 176 SER SER A . n 
A 1 54  TYR 54  177 177 TYR TYR A . n 
A 1 55  LYS 55  178 178 LYS LYS A . n 
A 1 56  THR 56  179 179 THR THR A . n 
A 1 57  GLU 57  180 180 GLU GLU A . n 
A 1 58  PHE 58  181 181 PHE PHE A . n 
A 1 59  ASP 59  182 182 ASP ASP A . n 
A 1 60  PHE 60  183 183 PHE PHE A . n 
A 1 61  SER 61  184 184 SER SER A . n 
A 1 62  ASP 62  185 185 ASP ASP A . n 
A 1 63  TYR 63  186 186 TYR TYR A . n 
A 1 64  VAL 64  187 187 VAL VAL A . n 
A 1 65  LYS 65  188 188 LYS LYS A . n 
A 1 66  TRP 66  189 189 TRP TRP A . n 
A 1 67  LYS 67  190 190 LYS LYS A . n 
A 1 68  ASP 68  191 191 ASP ASP A . n 
A 1 69  PRO 69  192 192 PRO PRO A . n 
A 1 70  ASP 70  193 193 ASP ASP A . n 
A 1 71  ALA 71  194 194 ALA ALA A . n 
A 1 72  LEU 72  195 195 LEU LEU A . n 
A 1 73  LEU 73  196 196 LEU LEU A . n 
A 1 74  LYS 74  197 197 LYS LYS A . n 
A 1 75  HIS 75  198 198 HIS HIS A . n 
A 1 76  VAL 76  199 199 VAL VAL A . n 
A 1 77  LYS 77  200 200 LYS LYS A . n 
A 1 78  HIS 78  201 201 HIS HIS A . n 
A 1 79  MET 79  202 202 MET MET A . n 
A 1 80  LEU 80  203 203 LEU LEU A . n 
A 1 81  LEU 81  204 204 LEU LEU A . n 
A 1 82  LEU 82  205 205 LEU LEU A . n 
A 1 83  THR 83  206 206 THR THR A . n 
A 1 84  ASN 84  207 207 ASN ASN A . n 
A 1 85  THR 85  208 208 THR THR A . n 
A 1 86  PHE 86  209 209 PHE PHE A . n 
A 1 87  GLY 87  210 210 GLY GLY A . n 
A 1 88  ALA 88  211 211 ALA ALA A . n 
A 1 89  ILE 89  212 212 ILE ILE A . n 
A 1 90  ASN 90  213 213 ASN ASN A . n 
A 1 91  TYR 91  214 214 TYR TYR A . n 
A 1 92  VAL 92  215 215 VAL VAL A . n 
A 1 93  ALA 93  216 216 ALA ALA A . n 
A 1 94  THR 94  217 217 THR THR A . n 
A 1 95  GLU 95  218 218 GLU GLU A . n 
A 1 96  VAL 96  219 219 VAL VAL A . n 
A 1 97  PHE 97  220 220 PHE PHE A . n 
A 1 98  ARG 98  221 221 ARG ARG A . n 
A 1 99  GLU 99  222 222 GLU GLU A . n 
A 1 100 GLU 100 223 223 GLU GLU A . n 
A 1 101 LEU 101 224 224 LEU LEU A . n 
A 1 102 GLY 102 225 225 GLY GLY A . n 
A 1 103 ALA 103 226 226 ALA ALA A . n 
A 1 104 ARG 104 227 227 ARG ARG A . n 
A 1 105 PRO 105 228 228 PRO PRO A . n 
A 1 106 ASP 106 229 229 ASP ASP A . n 
A 1 107 ALA 107 230 230 ALA ALA A . n 
A 1 108 THR 108 231 231 THR THR A . n 
A 1 109 LYS 109 232 232 LYS LYS A . n 
A 1 110 VAL 110 233 233 VAL VAL A . n 
A 1 111 LEU 111 234 234 LEU LEU A . n 
A 1 112 ILE 112 235 235 ILE ILE A . n 
A 1 113 ILE 113 236 236 ILE ILE A . n 
A 1 114 ILE 114 237 237 ILE ILE A . n 
A 1 115 THR 115 238 238 THR THR A . n 
A 1 116 ASP 116 239 239 ASP ASP A . n 
A 1 117 GLY 117 240 240 GLY GLY A . n 
A 1 118 GLU 118 241 241 GLU GLU A . n 
A 1 119 ALA 119 242 242 ALA ALA A . n 
A 1 120 THR 120 243 243 THR THR A . n 
A 1 121 ASP 121 244 244 ASP ASP A . n 
A 1 122 SER 122 245 245 SER SER A . n 
A 1 123 GLY 123 246 246 GLY GLY A . n 
A 1 124 ASN 124 247 247 ASN ASN A . n 
A 1 125 ILE 125 248 248 ILE ILE A . n 
A 1 126 ASP 126 249 249 ASP ASP A . n 
A 1 127 ALA 127 250 250 ALA ALA A . n 
A 1 128 ALA 128 251 251 ALA ALA A . n 
A 1 129 LYS 129 252 252 LYS LYS A . n 
A 1 130 ASP 130 253 253 ASP ASP A . n 
A 1 131 ILE 131 254 254 ILE ILE A . n 
A 1 132 ILE 132 255 255 ILE ILE A . n 
A 1 133 ARG 133 256 256 ARG ARG A . n 
A 1 134 TYR 134 257 257 TYR TYR A . n 
A 1 135 ILE 135 258 258 ILE ILE A . n 
A 1 136 ILE 136 259 259 ILE ILE A . n 
A 1 137 GLY 137 260 260 GLY GLY A . n 
A 1 138 ILE 138 261 261 ILE ILE A . n 
A 1 139 GLY 139 262 262 GLY GLY A . n 
A 1 140 LYS 140 263 263 LYS LYS A . n 
A 1 141 HIS 141 264 264 HIS HIS A . n 
A 1 142 PHE 142 265 265 PHE PHE A . n 
A 1 143 GLN 143 266 266 GLN GLN A . n 
A 1 144 THR 144 267 267 THR THR A . n 
A 1 145 LYS 145 268 268 LYS LYS A . n 
A 1 146 GLU 146 269 269 GLU GLU A . n 
A 1 147 SER 147 270 270 SER SER A . n 
A 1 148 GLN 148 271 271 GLN GLN A . n 
A 1 149 GLU 149 272 272 GLU GLU A . n 
A 1 150 THR 150 273 273 THR THR A . n 
A 1 151 LEU 151 274 274 LEU LEU A . n 
A 1 152 HIS 152 275 275 HIS HIS A . n 
A 1 153 LYS 153 276 276 LYS LYS A . n 
A 1 154 PHE 154 277 277 PHE PHE A . n 
A 1 155 ALA 155 278 278 ALA ALA A . n 
A 1 156 SER 156 279 279 SER SER A . n 
A 1 157 LYS 157 280 280 LYS LYS A . n 
A 1 158 PRO 158 281 281 PRO PRO A . n 
A 1 159 ALA 159 282 282 ALA ALA A . n 
A 1 160 SER 160 283 283 SER SER A . n 
A 1 161 GLU 161 284 284 GLU GLU A . n 
A 1 162 PHE 162 285 285 PHE PHE A . n 
A 1 163 VAL 163 286 286 VAL VAL A . n 
A 1 164 LYS 164 287 287 LYS LYS A . n 
A 1 165 ILE 165 288 288 ILE ILE A . n 
A 1 166 LEU 166 289 289 LEU LEU A . n 
A 1 167 ASP 167 290 290 ASP ASP A . n 
A 1 168 THR 168 291 291 THR THR A . n 
A 1 169 PHE 169 292 292 PHE PHE A . n 
A 1 170 GLU 170 293 293 GLU GLU A . n 
A 1 171 LYS 171 294 294 LYS LYS A . n 
A 1 172 LEU 172 295 295 LEU LEU A . n 
A 1 173 LYS 173 296 296 LYS LYS A . n 
A 1 174 ASP 174 297 297 ASP ASP A . n 
A 1 175 LEU 175 298 298 LEU LEU A . n 
A 1 176 PHE 176 299 299 PHE PHE A . n 
A 1 177 THR 177 300 300 THR THR A . n 
A 1 178 GLU 178 301 301 GLU GLU A . n 
A 1 179 LEU 179 302 302 LEU LEU A . n 
A 1 180 GLN 180 303 303 GLN GLN A . n 
A 1 181 LYS 181 304 304 LYS LYS A . n 
A 1 182 LYS 182 305 305 LYS LYS A . n 
A 1 183 ILE 183 306 306 ILE ILE A . n 
A 1 184 TYR 184 307 307 TYR TYR A . n 
A 1 185 VAL 185 308 308 VAL VAL A . n 
A 1 186 ILE 186 309 309 ILE ILE A . n 
A 1 187 GLU 187 310 ?   ?   ?   A . n 
A 1 188 GLY 188 311 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   401 1   MG  MG  A . 
C 3 1HV 1   402 1   1HV LI1 A . 
D 4 HOH 1   501 1   HOH HOH A . 
D 4 HOH 2   502 2   HOH HOH A . 
D 4 HOH 3   503 3   HOH HOH A . 
D 4 HOH 4   504 4   HOH HOH A . 
D 4 HOH 5   505 5   HOH HOH A . 
D 4 HOH 6   506 6   HOH HOH A . 
D 4 HOH 7   507 7   HOH HOH A . 
D 4 HOH 8   508 8   HOH HOH A . 
D 4 HOH 9   509 9   HOH HOH A . 
D 4 HOH 10  510 10  HOH HOH A . 
D 4 HOH 11  511 11  HOH HOH A . 
D 4 HOH 12  512 12  HOH HOH A . 
D 4 HOH 13  513 13  HOH HOH A . 
D 4 HOH 14  514 14  HOH HOH A . 
D 4 HOH 15  515 15  HOH HOH A . 
D 4 HOH 16  516 16  HOH HOH A . 
D 4 HOH 17  517 17  HOH HOH A . 
D 4 HOH 18  518 18  HOH HOH A . 
D 4 HOH 19  519 19  HOH HOH A . 
D 4 HOH 20  520 20  HOH HOH A . 
D 4 HOH 21  521 21  HOH HOH A . 
D 4 HOH 22  522 22  HOH HOH A . 
D 4 HOH 23  523 23  HOH HOH A . 
D 4 HOH 24  524 24  HOH HOH A . 
D 4 HOH 25  525 25  HOH HOH A . 
D 4 HOH 26  526 26  HOH HOH A . 
D 4 HOH 27  527 27  HOH HOH A . 
D 4 HOH 28  528 28  HOH HOH A . 
D 4 HOH 29  529 29  HOH HOH A . 
D 4 HOH 30  530 30  HOH HOH A . 
D 4 HOH 31  531 31  HOH HOH A . 
D 4 HOH 32  532 32  HOH HOH A . 
D 4 HOH 33  533 33  HOH HOH A . 
D 4 HOH 34  534 34  HOH HOH A . 
D 4 HOH 35  535 35  HOH HOH A . 
D 4 HOH 36  536 36  HOH HOH A . 
D 4 HOH 37  537 37  HOH HOH A . 
D 4 HOH 38  538 38  HOH HOH A . 
D 4 HOH 39  539 39  HOH HOH A . 
D 4 HOH 40  540 40  HOH HOH A . 
D 4 HOH 41  541 41  HOH HOH A . 
D 4 HOH 42  542 42  HOH HOH A . 
D 4 HOH 43  543 43  HOH HOH A . 
D 4 HOH 44  544 44  HOH HOH A . 
D 4 HOH 45  545 45  HOH HOH A . 
D 4 HOH 46  546 46  HOH HOH A . 
D 4 HOH 47  547 47  HOH HOH A . 
D 4 HOH 48  548 48  HOH HOH A . 
D 4 HOH 49  549 49  HOH HOH A . 
D 4 HOH 50  550 50  HOH HOH A . 
D 4 HOH 51  551 51  HOH HOH A . 
D 4 HOH 52  552 52  HOH HOH A . 
D 4 HOH 53  553 53  HOH HOH A . 
D 4 HOH 54  554 54  HOH HOH A . 
D 4 HOH 55  555 55  HOH HOH A . 
D 4 HOH 56  556 56  HOH HOH A . 
D 4 HOH 57  557 57  HOH HOH A . 
D 4 HOH 58  558 58  HOH HOH A . 
D 4 HOH 59  559 59  HOH HOH A . 
D 4 HOH 60  560 60  HOH HOH A . 
D 4 HOH 61  561 61  HOH HOH A . 
D 4 HOH 62  562 62  HOH HOH A . 
D 4 HOH 63  563 63  HOH HOH A . 
D 4 HOH 64  564 64  HOH HOH A . 
D 4 HOH 65  565 65  HOH HOH A . 
D 4 HOH 66  566 66  HOH HOH A . 
D 4 HOH 67  567 67  HOH HOH A . 
D 4 HOH 68  568 68  HOH HOH A . 
D 4 HOH 69  569 69  HOH HOH A . 
D 4 HOH 70  570 70  HOH HOH A . 
D 4 HOH 71  571 71  HOH HOH A . 
D 4 HOH 72  572 72  HOH HOH A . 
D 4 HOH 73  573 73  HOH HOH A . 
D 4 HOH 74  574 74  HOH HOH A . 
D 4 HOH 75  575 75  HOH HOH A . 
D 4 HOH 76  576 76  HOH HOH A . 
D 4 HOH 77  577 77  HOH HOH A . 
D 4 HOH 78  578 78  HOH HOH A . 
D 4 HOH 79  579 79  HOH HOH A . 
D 4 HOH 80  580 80  HOH HOH A . 
D 4 HOH 81  581 81  HOH HOH A . 
D 4 HOH 82  582 82  HOH HOH A . 
D 4 HOH 83  583 83  HOH HOH A . 
D 4 HOH 84  584 84  HOH HOH A . 
D 4 HOH 85  585 85  HOH HOH A . 
D 4 HOH 86  586 86  HOH HOH A . 
D 4 HOH 87  587 87  HOH HOH A . 
D 4 HOH 88  588 88  HOH HOH A . 
D 4 HOH 89  589 89  HOH HOH A . 
D 4 HOH 90  590 90  HOH HOH A . 
D 4 HOH 91  591 91  HOH HOH A . 
D 4 HOH 92  592 92  HOH HOH A . 
D 4 HOH 93  593 93  HOH HOH A . 
D 4 HOH 94  594 94  HOH HOH A . 
D 4 HOH 95  595 95  HOH HOH A . 
D 4 HOH 96  596 96  HOH HOH A . 
D 4 HOH 97  597 97  HOH HOH A . 
D 4 HOH 98  598 98  HOH HOH A . 
D 4 HOH 99  599 99  HOH HOH A . 
D 4 HOH 100 600 100 HOH HOH A . 
D 4 HOH 101 601 101 HOH HOH A . 
D 4 HOH 102 602 102 HOH HOH A . 
D 4 HOH 103 603 103 HOH HOH A . 
D 4 HOH 104 604 104 HOH HOH A . 
D 4 HOH 105 605 105 HOH HOH A . 
D 4 HOH 106 606 106 HOH HOH A . 
D 4 HOH 107 607 107 HOH HOH A . 
D 4 HOH 108 608 108 HOH HOH A . 
D 4 HOH 109 609 109 HOH HOH A . 
D 4 HOH 110 610 110 HOH HOH A . 
D 4 HOH 111 611 111 HOH HOH A . 
D 4 HOH 112 612 112 HOH HOH A . 
D 4 HOH 113 613 113 HOH HOH A . 
D 4 HOH 114 614 114 HOH HOH A . 
D 4 HOH 115 615 115 HOH HOH A . 
D 4 HOH 116 616 116 HOH HOH A . 
D 4 HOH 117 617 117 HOH HOH A . 
D 4 HOH 118 618 118 HOH HOH A . 
D 4 HOH 119 619 119 HOH HOH A . 
D 4 HOH 120 620 120 HOH HOH A . 
D 4 HOH 121 621 121 HOH HOH A . 
D 4 HOH 122 622 122 HOH HOH A . 
D 4 HOH 123 623 123 HOH HOH A . 
D 4 HOH 124 624 124 HOH HOH A . 
D 4 HOH 125 625 125 HOH HOH A . 
D 4 HOH 126 626 126 HOH HOH A . 
D 4 HOH 127 627 127 HOH HOH A . 
D 4 HOH 128 628 128 HOH HOH A . 
D 4 HOH 129 629 129 HOH HOH A . 
D 4 HOH 130 630 130 HOH HOH A . 
D 4 HOH 131 631 131 HOH HOH A . 
D 4 HOH 132 632 132 HOH HOH A . 
D 4 HOH 133 633 133 HOH HOH A . 
D 4 HOH 134 634 134 HOH HOH A . 
D 4 HOH 135 635 135 HOH HOH A . 
D 4 HOH 136 636 136 HOH HOH A . 
D 4 HOH 137 637 137 HOH HOH A . 
D 4 HOH 138 638 138 HOH HOH A . 
D 4 HOH 139 639 139 HOH HOH A . 
D 4 HOH 140 640 140 HOH HOH A . 
D 4 HOH 141 641 141 HOH HOH A . 
D 4 HOH 142 642 142 HOH HOH A . 
D 4 HOH 143 643 143 HOH HOH A . 
D 4 HOH 144 644 144 HOH HOH A . 
D 4 HOH 145 645 145 HOH HOH A . 
D 4 HOH 146 646 146 HOH HOH A . 
D 4 HOH 147 647 147 HOH HOH A . 
D 4 HOH 148 648 148 HOH HOH A . 
D 4 HOH 149 649 149 HOH HOH A . 
D 4 HOH 150 650 150 HOH HOH A . 
D 4 HOH 151 651 151 HOH HOH A . 
D 4 HOH 152 652 152 HOH HOH A . 
D 4 HOH 153 653 153 HOH HOH A . 
D 4 HOH 154 654 154 HOH HOH A . 
D 4 HOH 155 655 155 HOH HOH A . 
D 4 HOH 156 656 156 HOH HOH A . 
D 4 HOH 157 657 157 HOH HOH A . 
D 4 HOH 158 658 158 HOH HOH A . 
D 4 HOH 159 659 159 HOH HOH A . 
D 4 HOH 160 660 160 HOH HOH A . 
D 4 HOH 161 661 161 HOH HOH A . 
D 4 HOH 162 662 162 HOH HOH A . 
D 4 HOH 163 663 163 HOH HOH A . 
D 4 HOH 164 664 164 HOH HOH A . 
D 4 HOH 165 665 165 HOH HOH A . 
D 4 HOH 166 666 166 HOH HOH A . 
D 4 HOH 167 667 167 HOH HOH A . 
D 4 HOH 168 668 168 HOH HOH A . 
D 4 HOH 169 669 169 HOH HOH A . 
D 4 HOH 170 670 170 HOH HOH A . 
D 4 HOH 171 671 171 HOH HOH A . 
D 4 HOH 172 672 172 HOH HOH A . 
D 4 HOH 173 673 173 HOH HOH A . 
D 4 HOH 174 674 174 HOH HOH A . 
D 4 HOH 175 675 175 HOH HOH A . 
D 4 HOH 176 676 176 HOH HOH A . 
D 4 HOH 177 677 177 HOH HOH A . 
D 4 HOH 178 678 178 HOH HOH A . 
D 4 HOH 179 679 179 HOH HOH A . 
D 4 HOH 180 680 180 HOH HOH A . 
D 4 HOH 181 681 181 HOH HOH A . 
D 4 HOH 182 682 182 HOH HOH A . 
D 4 HOH 183 683 183 HOH HOH A . 
D 4 HOH 184 684 184 HOH HOH A . 
D 4 HOH 185 685 185 HOH HOH A . 
D 4 HOH 186 686 186 HOH HOH A . 
D 4 HOH 187 687 187 HOH HOH A . 
D 4 HOH 188 688 188 HOH HOH A . 
D 4 HOH 189 689 189 HOH HOH A . 
D 4 HOH 190 690 190 HOH HOH A . 
D 4 HOH 191 691 191 HOH HOH A . 
D 4 HOH 192 692 192 HOH HOH A . 
D 4 HOH 193 693 193 HOH HOH A . 
D 4 HOH 194 694 194 HOH HOH A . 
D 4 HOH 195 695 195 HOH HOH A . 
D 4 HOH 196 696 196 HOH HOH A . 
D 4 HOH 197 697 197 HOH HOH A . 
D 4 HOH 198 698 198 HOH HOH A . 
D 4 HOH 199 699 199 HOH HOH A . 
D 4 HOH 200 700 200 HOH HOH A . 
D 4 HOH 201 701 201 HOH HOH A . 
D 4 HOH 202 702 202 HOH HOH A . 
D 4 HOH 203 703 203 HOH HOH A . 
D 4 HOH 204 704 204 HOH HOH A . 
D 4 HOH 205 705 205 HOH HOH A . 
D 4 HOH 206 706 206 HOH HOH A . 
D 4 HOH 207 707 207 HOH HOH A . 
D 4 HOH 208 708 208 HOH HOH A . 
D 4 HOH 209 709 209 HOH HOH A . 
D 4 HOH 210 710 210 HOH HOH A . 
D 4 HOH 211 711 211 HOH HOH A . 
D 4 HOH 212 712 212 HOH HOH A . 
D 4 HOH 213 713 213 HOH HOH A . 
D 4 HOH 214 714 214 HOH HOH A . 
D 4 HOH 215 715 215 HOH HOH A . 
D 4 HOH 216 716 216 HOH HOH A . 
D 4 HOH 217 717 217 HOH HOH A . 
D 4 HOH 218 718 218 HOH HOH A . 
D 4 HOH 219 719 219 HOH HOH A . 
D 4 HOH 220 720 220 HOH HOH A . 
D 4 HOH 221 721 221 HOH HOH A . 
D 4 HOH 222 722 222 HOH HOH A . 
D 4 HOH 223 723 223 HOH HOH A . 
D 4 HOH 224 724 224 HOH HOH A . 
D 4 HOH 225 725 225 HOH HOH A . 
D 4 HOH 226 726 226 HOH HOH A . 
D 4 HOH 227 727 227 HOH HOH A . 
D 4 HOH 228 728 228 HOH HOH A . 
D 4 HOH 229 729 229 HOH HOH A . 
D 4 HOH 230 730 230 HOH HOH A . 
D 4 HOH 231 731 231 HOH HOH A . 
D 4 HOH 232 732 232 HOH HOH A . 
D 4 HOH 233 733 233 HOH HOH A . 
D 4 HOH 234 734 234 HOH HOH A . 
D 4 HOH 235 735 235 HOH HOH A . 
D 4 HOH 236 736 236 HOH HOH A . 
D 4 HOH 237 737 237 HOH HOH A . 
D 4 HOH 238 738 238 HOH HOH A . 
D 4 HOH 239 739 239 HOH HOH A . 
D 4 HOH 240 740 240 HOH HOH A . 
D 4 HOH 241 741 241 HOH HOH A . 
D 4 HOH 242 742 242 HOH HOH A . 
D 4 HOH 243 743 243 HOH HOH A . 
D 4 HOH 244 744 244 HOH HOH A . 
D 4 HOH 245 745 245 HOH HOH A . 
D 4 HOH 246 746 246 HOH HOH A . 
D 4 HOH 247 747 247 HOH HOH A . 
D 4 HOH 248 748 248 HOH HOH A . 
D 4 HOH 249 749 249 HOH HOH A . 
D 4 HOH 250 750 250 HOH HOH A . 
D 4 HOH 251 751 251 HOH HOH A . 
D 4 HOH 252 752 252 HOH HOH A . 
D 4 HOH 253 753 253 HOH HOH A . 
D 4 HOH 254 754 254 HOH HOH A . 
D 4 HOH 255 755 255 HOH HOH A . 
D 4 HOH 256 756 256 HOH HOH A . 
D 4 HOH 257 757 257 HOH HOH A . 
D 4 HOH 258 758 258 HOH HOH A . 
D 4 HOH 259 759 259 HOH HOH A . 
D 4 HOH 260 760 260 HOH HOH A . 
D 4 HOH 261 761 261 HOH HOH A . 
D 4 HOH 262 762 262 HOH HOH A . 
D 4 HOH 263 763 263 HOH HOH A . 
D 4 HOH 264 764 264 HOH HOH A . 
D 4 HOH 265 765 265 HOH HOH A . 
D 4 HOH 266 766 266 HOH HOH A . 
D 4 HOH 267 767 267 HOH HOH A . 
D 4 HOH 268 768 268 HOH HOH A . 
D 4 HOH 269 769 269 HOH HOH A . 
D 4 HOH 270 770 270 HOH HOH A . 
D 4 HOH 271 771 271 HOH HOH A . 
D 4 HOH 272 772 272 HOH HOH A . 
D 4 HOH 273 773 273 HOH HOH A . 
D 4 HOH 274 774 274 HOH HOH A . 
D 4 HOH 275 775 275 HOH HOH A . 
D 4 HOH 276 776 276 HOH HOH A . 
D 4 HOH 277 777 277 HOH HOH A . 
D 4 HOH 278 778 278 HOH HOH A . 
D 4 HOH 279 779 279 HOH HOH A . 
D 4 HOH 280 780 280 HOH HOH A . 
D 4 HOH 281 781 281 HOH HOH A . 
D 4 HOH 282 782 282 HOH HOH A . 
D 4 HOH 283 783 283 HOH HOH A . 
D 4 HOH 284 784 284 HOH HOH A . 
D 4 HOH 285 785 285 HOH HOH A . 
D 4 HOH 286 786 286 HOH HOH A . 
D 4 HOH 287 787 287 HOH HOH A . 
D 4 HOH 288 788 288 HOH HOH A . 
D 4 HOH 289 789 289 HOH HOH A . 
D 4 HOH 290 790 290 HOH HOH A . 
D 4 HOH 291 791 291 HOH HOH A . 
D 4 HOH 292 792 292 HOH HOH A . 
D 4 HOH 293 793 293 HOH HOH A . 
D 4 HOH 294 794 294 HOH HOH A . 
D 4 HOH 295 795 295 HOH HOH A . 
D 4 HOH 296 796 296 HOH HOH A . 
D 4 HOH 297 797 297 HOH HOH A . 
D 4 HOH 298 798 298 HOH HOH A . 
D 4 HOH 299 799 299 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D 
2 1,2 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 2110  ? 
2 MORE         -26   ? 
2 'SSA (A^2)'  16810 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_675 -x+1,-y+2,z -1.0000000000 0.0000000000 0.0000000000 45.3000000000 0.0000000000 -1.0000000000 
0.0000000000 131.8000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 752 ? D HOH . 
2 1 A HOH 795 ? D HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? D HOH .   ? A HOH 509 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OD1 ? A ASP 116 ? A ASP 239 ? 1_555 85.5  ? 
2  O   ? D HOH .   ? A HOH 509 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 18  ? A SER 141 ? 1_555 169.5 ? 
3  OD1 ? A ASP 116 ? A ASP 239 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 18  ? A SER 141 ? 1_555 84.8  ? 
4  O   ? D HOH .   ? A HOH 509 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 507 ? 1_555 98.8  ? 
5  OD1 ? A ASP 116 ? A ASP 239 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 507 ? 1_555 174.8 ? 
6  OG  ? A SER 18  ? A SER 141 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 507 ? 1_555 91.1  ? 
7  O   ? D HOH .   ? A HOH 509 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 504 ? 1_555 98.6  ? 
8  OD1 ? A ASP 116 ? A ASP 239 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 504 ? 1_555 89.0  ? 
9  OG  ? A SER 18  ? A SER 141 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 504 ? 1_555 85.2  ? 
10 O   ? D HOH .   ? A HOH 507 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O   ? D HOH .   ? A HOH 504 ? 1_555 87.6  ? 
11 O   ? D HOH .   ? A HOH 509 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 16  ? A SER 139 ? 1_555 88.3  ? 
12 OD1 ? A ASP 116 ? A ASP 239 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 16  ? A SER 139 ? 1_555 93.1  ? 
13 OG  ? A SER 18  ? A SER 141 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 16  ? A SER 139 ? 1_555 88.2  ? 
14 O   ? D HOH .   ? A HOH 507 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 16  ? A SER 139 ? 1_555 89.9  ? 
15 O   ? D HOH .   ? A HOH 504 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OG  ? A SER 16  ? A SER 139 ? 1_555 172.9 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-01-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
X-PLOR    'model building'  .        ? 2 
REFMAC    refinement        5.5.0063 ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
X-PLOR    phasing           .        ? 6 
# 
_pdbx_entry_details.entry_id             4IXD 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE RESIDUE 189 IS TRP ACCORDING TO LARSON R.S. ET AL. [J. CELL BIOL. 108:703-712(1989)] OR LOFTUS B.J. ET AL.[GENOMICS 60:295-308(1999)]
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 164 ? ? -118.58 -165.39 
2 1 SER A 174 ? ? -144.93 -104.51 
3 1 SER A 176 ? ? -125.93 -163.61 
4 1 LEU A 204 ? ? -124.78 -134.12 
5 1 LEU A 205 ? ? -91.40  -155.79 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 124 ? A MET 1   
2 1 Y 1 A ALA 125 ? A ALA 2   
3 1 Y 1 A SER 126 ? A SER 3   
4 1 Y 1 A LYS 127 ? A LYS 4   
5 1 Y 1 A GLU 310 ? A GLU 187 
6 1 Y 1 A GLY 311 ? A GLY 188 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                                                                MG  
3 '4-(3-{4-[(3-aminopropyl)carbamoyl]phenyl}-1H-indazol-1-yl)-N-methylbenzamide' 1HV 
4 water                                                                          HOH 
#