data_4IXU
# 
_entry.id   4IXU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IXU         
RCSB  RCSB077345   
WWPDB D_1000077345 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1D3V . unspecified 
PDB 1PQ3 . unspecified 
PDB 4IXV . unspecified 
# 
_pdbx_database_status.entry_id                        4IXU 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cousido-Siah, A.' 1  
'Mitschler, A.'    2  
'Ruiz, F.X.'       3  
'Whitehouse, D.'   4  
'Beckett, P.'      5  
'Van Zandt, M.C.'  6  
'Ji, M.K.'         7  
'Ryder, T.'        8  
'Jagdmann, R.'     9  
'Andreoli, M.'     10 
'Olczak, J.'       11 
'Mazur, M.'        12 
'Czestkowski, W.'  13 
'Piotrowska, W.'   14 
'Schroeter, H.'    15 
'Golebiowski, A.'  16 
'Podjarny, A.'     17 
# 
_citation.id                        primary 
_citation.title                     'Synthesis of quaternary alpha-amino acid-based arginase inhibitors via the Ugi reaction.' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            23 
_citation.page_first                4837 
_citation.page_last                 4841 
_citation.year                      2013 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23886684 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2013.06.092 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Golebiowski, A.'  1  
primary 'Whitehouse, D.'   2  
primary 'Beckett, R.P.'    3  
primary 'Van Zandt, M.'    4  
primary 'Ji, M.K.'         5  
primary 'Ryder, T.R.'      6  
primary 'Jagdmann, E.'     7  
primary 'Andreoli, M.'     8  
primary 'Lee, Y.'          9  
primary 'Sheeler, R.'      10 
primary 'Conway, B.'       11 
primary 'Olczak, J.'       12 
primary 'Mazur, M.'        13 
primary 'Czestkowski, W.'  14 
primary 'Piotrowska, W.'   15 
primary 'Cousido-Siah, A.' 16 
primary 'Ruiz, F.X.'       17 
primary 'Mitschler, A.'    18 
primary 'Podjarny, A.'     19 
primary 'Schroeter, H.'    20 
# 
_cell.entry_id           4IXU 
_cell.length_a           127.400 
_cell.length_b           127.400 
_cell.length_c           159.249 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4IXU 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arginase-2, mitochondrial' 33231.656 3   3.5.3.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION' 54.938    6   ?       ? ? ? 
3 non-polymer syn BENZAMIDINE 120.152   3   ?       ? ? ? 
4 non-polymer syn BETA-MERCAPTOETHANOL 78.133    6   ?       ? ? ? 
5 non-polymer syn 
'{(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)' 460.180   3 
?       ? ? ? 
6 water       nat water 18.015    798 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Kidney-type arginase, Non-hepatic arginase, Type II arginase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVV
SRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSW
IKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPAT
GTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVV
SRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSW
IKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPAT
GTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   SER n 
1 3   VAL n 
1 4   ALA n 
1 5   VAL n 
1 6   ILE n 
1 7   GLY n 
1 8   ALA n 
1 9   PRO n 
1 10  PHE n 
1 11  SER n 
1 12  GLN n 
1 13  GLY n 
1 14  GLN n 
1 15  LYS n 
1 16  ARG n 
1 17  LYS n 
1 18  GLY n 
1 19  VAL n 
1 20  GLU n 
1 21  HIS n 
1 22  GLY n 
1 23  PRO n 
1 24  ALA n 
1 25  ALA n 
1 26  ILE n 
1 27  ARG n 
1 28  GLU n 
1 29  ALA n 
1 30  GLY n 
1 31  LEU n 
1 32  MET n 
1 33  LYS n 
1 34  ARG n 
1 35  LEU n 
1 36  SER n 
1 37  SER n 
1 38  LEU n 
1 39  GLY n 
1 40  CYS n 
1 41  HIS n 
1 42  LEU n 
1 43  LYS n 
1 44  ASP n 
1 45  PHE n 
1 46  GLY n 
1 47  ASP n 
1 48  LEU n 
1 49  SER n 
1 50  PHE n 
1 51  THR n 
1 52  PRO n 
1 53  VAL n 
1 54  PRO n 
1 55  LYS n 
1 56  ASP n 
1 57  ASP n 
1 58  LEU n 
1 59  TYR n 
1 60  ASN n 
1 61  ASN n 
1 62  LEU n 
1 63  ILE n 
1 64  VAL n 
1 65  ASN n 
1 66  PRO n 
1 67  ARG n 
1 68  SER n 
1 69  VAL n 
1 70  GLY n 
1 71  LEU n 
1 72  ALA n 
1 73  ASN n 
1 74  GLN n 
1 75  GLU n 
1 76  LEU n 
1 77  ALA n 
1 78  GLU n 
1 79  VAL n 
1 80  VAL n 
1 81  SER n 
1 82  ARG n 
1 83  ALA n 
1 84  VAL n 
1 85  SER n 
1 86  ASP n 
1 87  GLY n 
1 88  TYR n 
1 89  SER n 
1 90  CYS n 
1 91  VAL n 
1 92  THR n 
1 93  LEU n 
1 94  GLY n 
1 95  GLY n 
1 96  ASP n 
1 97  HIS n 
1 98  SER n 
1 99  LEU n 
1 100 ALA n 
1 101 ILE n 
1 102 GLY n 
1 103 THR n 
1 104 ILE n 
1 105 SER n 
1 106 GLY n 
1 107 HIS n 
1 108 ALA n 
1 109 ARG n 
1 110 HIS n 
1 111 CYS n 
1 112 PRO n 
1 113 ASP n 
1 114 LEU n 
1 115 CYS n 
1 116 VAL n 
1 117 VAL n 
1 118 TRP n 
1 119 VAL n 
1 120 ASP n 
1 121 ALA n 
1 122 HIS n 
1 123 ALA n 
1 124 ASP n 
1 125 ILE n 
1 126 ASN n 
1 127 THR n 
1 128 PRO n 
1 129 LEU n 
1 130 THR n 
1 131 THR n 
1 132 SER n 
1 133 SER n 
1 134 GLY n 
1 135 ASN n 
1 136 LEU n 
1 137 HIS n 
1 138 GLY n 
1 139 GLN n 
1 140 PRO n 
1 141 VAL n 
1 142 SER n 
1 143 PHE n 
1 144 LEU n 
1 145 LEU n 
1 146 ARG n 
1 147 GLU n 
1 148 LEU n 
1 149 GLN n 
1 150 ASP n 
1 151 LYS n 
1 152 VAL n 
1 153 PRO n 
1 154 GLN n 
1 155 LEU n 
1 156 PRO n 
1 157 GLY n 
1 158 PHE n 
1 159 SER n 
1 160 TRP n 
1 161 ILE n 
1 162 LYS n 
1 163 PRO n 
1 164 CYS n 
1 165 ILE n 
1 166 SER n 
1 167 SER n 
1 168 ALA n 
1 169 SER n 
1 170 ILE n 
1 171 VAL n 
1 172 TYR n 
1 173 ILE n 
1 174 GLY n 
1 175 LEU n 
1 176 ARG n 
1 177 ASP n 
1 178 VAL n 
1 179 ASP n 
1 180 PRO n 
1 181 PRO n 
1 182 GLU n 
1 183 HIS n 
1 184 PHE n 
1 185 ILE n 
1 186 LEU n 
1 187 LYS n 
1 188 ASN n 
1 189 TYR n 
1 190 ASP n 
1 191 ILE n 
1 192 GLN n 
1 193 TYR n 
1 194 PHE n 
1 195 SER n 
1 196 MET n 
1 197 ARG n 
1 198 ASP n 
1 199 ILE n 
1 200 ASP n 
1 201 ARG n 
1 202 LEU n 
1 203 GLY n 
1 204 ILE n 
1 205 GLN n 
1 206 LYS n 
1 207 VAL n 
1 208 MET n 
1 209 GLU n 
1 210 ARG n 
1 211 THR n 
1 212 PHE n 
1 213 ASP n 
1 214 LEU n 
1 215 LEU n 
1 216 ILE n 
1 217 GLY n 
1 218 LYS n 
1 219 ARG n 
1 220 GLN n 
1 221 ARG n 
1 222 PRO n 
1 223 ILE n 
1 224 HIS n 
1 225 LEU n 
1 226 SER n 
1 227 PHE n 
1 228 ASP n 
1 229 ILE n 
1 230 ASP n 
1 231 ALA n 
1 232 PHE n 
1 233 ASP n 
1 234 PRO n 
1 235 THR n 
1 236 LEU n 
1 237 ALA n 
1 238 PRO n 
1 239 ALA n 
1 240 THR n 
1 241 GLY n 
1 242 THR n 
1 243 PRO n 
1 244 VAL n 
1 245 VAL n 
1 246 GLY n 
1 247 GLY n 
1 248 LEU n 
1 249 THR n 
1 250 TYR n 
1 251 ARG n 
1 252 GLU n 
1 253 GLY n 
1 254 MET n 
1 255 TYR n 
1 256 ILE n 
1 257 ALA n 
1 258 GLU n 
1 259 GLU n 
1 260 ILE n 
1 261 HIS n 
1 262 ASN n 
1 263 THR n 
1 264 GLY n 
1 265 LEU n 
1 266 LEU n 
1 267 SER n 
1 268 ALA n 
1 269 LEU n 
1 270 ASP n 
1 271 LEU n 
1 272 VAL n 
1 273 GLU n 
1 274 VAL n 
1 275 ASN n 
1 276 PRO n 
1 277 GLN n 
1 278 LEU n 
1 279 ALA n 
1 280 THR n 
1 281 SER n 
1 282 GLU n 
1 283 GLU n 
1 284 GLU n 
1 285 ALA n 
1 286 LYS n 
1 287 THR n 
1 288 THR n 
1 289 ALA n 
1 290 ASN n 
1 291 LEU n 
1 292 ALA n 
1 293 VAL n 
1 294 ASP n 
1 295 VAL n 
1 296 ILE n 
1 297 ALA n 
1 298 SER n 
1 299 SER n 
1 300 PHE n 
1 301 GLY n 
1 302 GLN n 
1 303 THR n 
1 304 ARG n 
1 305 GLU n 
1 306 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ARG2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET23b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARGI2_HUMAN 
_struct_ref.pdbx_db_accession          P78540 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVV
SRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSW
IKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPAT
GTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
;
_struct_ref.pdbx_align_begin           24 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4IXU A 1 ? 306 ? P78540 24 ? 329 ? 24 329 
2 1 4IXU B 1 ? 306 ? P78540 24 ? 329 ? 24 329 
3 1 4IXU C 1 ? 306 ? P78540 24 ? 329 ? 24 329 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
38I non-polymer         . 
'{(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)' ? 
'C20 H30 B Cl2 N2 O5 -1' 460.180 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'             89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'         175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'            132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'             133.103 
BEN non-polymer         . BENZAMIDINE ? 'C7 H8 N2'               120.152 
BME non-polymer         . BETA-MERCAPTOETHANOL ? 'C2 H6 O S'              78.133  
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'           121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'           146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'             147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'             75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'         156.162 
HOH non-polymer         . WATER ? 'H2 O'                   18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'            131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'            131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'         147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'          149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'                   54.938  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'            165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'             115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'             105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'             119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'          204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'            181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'            117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4IXU 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.24 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
;Crystals in condition H3 from Silver Bullet screen (Hampton Research) using Tacsimate in the reservoir, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M' 
_diffrn_detector.pdbx_collection_date   2011-07-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'BARTELS MONOCHROMATOR' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9191 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.pdbx_wavelength_list        0.9191 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
# 
_reflns.entry_id                     4IXU 
_reflns.B_iso_Wilson_estimate        24.110 
_reflns.observed_criterion_sigma_F   0.000 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.d_resolution_high            1.90 
_reflns.d_resolution_low             46.34 
_reflns.number_all                   103422 
_reflns.number_obs                   103343 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.082 
_reflns.pdbx_netI_over_sigmaI        19.3 
_reflns.pdbx_redundancy              6.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_Rsym_value        0.516 
_reflns_shell.pdbx_redundancy        6.4 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4IXU 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             46.3350 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9200 
_refine.ls_number_reflns_obs                     103326 
_refine.ls_number_reflns_all                     103326 
_refine.pdbx_ls_cross_valid_method               R-free 
_refine.pdbx_R_Free_selection_details            'Random 5%' 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.1686 
_refine.ls_R_factor_obs                          0.1686 
_refine.ls_R_factor_R_work                       0.1673 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1932 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  5167 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               19.1735 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      1D3V 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8844 
_refine.B_iso_max                                127.090 
_refine.B_iso_min                                4.530 
_refine.pdbx_overall_phase_error                 18.3000 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.pdbx_ls_sigma_I                          0.000 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7010 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         147 
_refine_hist.number_atoms_solvent             798 
_refine_hist.number_atoms_total               7955 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        46.3350 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           7491  0.009  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          10245 1.485  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     1177  0.126  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      1340  0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 2803  14.078 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
1.90   1.9207  30 99.0000  3175 . 0.2129 0.2812 . 177 . 3352 . . 'X-RAY DIFFRACTION' 
1.9207 1.9433  30 100.0000 3204 . 0.2038 0.2488 . 190 . 3394 . . 'X-RAY DIFFRACTION' 
1.9433 1.9670  30 100.0000 3251 . 0.2026 0.2304 . 166 . 3417 . . 'X-RAY DIFFRACTION' 
1.9670 1.9919  30 100.0000 3226 . 0.1957 0.2384 . 159 . 3385 . . 'X-RAY DIFFRACTION' 
1.9919 2.0181  30 100.0000 3257 . 0.1925 0.2173 . 166 . 3423 . . 'X-RAY DIFFRACTION' 
2.0181 2.0457  30 100.0000 3199 . 0.1924 0.2333 . 178 . 3377 . . 'X-RAY DIFFRACTION' 
2.0457 2.0749  30 100.0000 3241 . 0.1794 0.2381 . 162 . 3403 . . 'X-RAY DIFFRACTION' 
2.0749 2.1059  30 100.0000 3251 . 0.1726 0.2073 . 168 . 3419 . . 'X-RAY DIFFRACTION' 
2.1059 2.1388  30 100.0000 3222 . 0.1704 0.1898 . 170 . 3392 . . 'X-RAY DIFFRACTION' 
2.1388 2.1739  30 100.0000 3248 . 0.1735 0.2156 . 160 . 3408 . . 'X-RAY DIFFRACTION' 
2.1739 2.2114  30 100.0000 3268 . 0.1727 0.1839 . 155 . 3423 . . 'X-RAY DIFFRACTION' 
2.2114 2.2516  30 100.0000 3228 . 0.1698 0.1981 . 188 . 3416 . . 'X-RAY DIFFRACTION' 
2.2516 2.2949  30 100.0000 3241 . 0.1623 0.2165 . 161 . 3402 . . 'X-RAY DIFFRACTION' 
2.2949 2.3417  30 100.0000 3301 . 0.1667 0.1876 . 147 . 3448 . . 'X-RAY DIFFRACTION' 
2.3417 2.3926  30 100.0000 3197 . 0.1600 0.2082 . 190 . 3387 . . 'X-RAY DIFFRACTION' 
2.3926 2.4483  30 100.0000 3279 . 0.1641 0.1914 . 169 . 3448 . . 'X-RAY DIFFRACTION' 
2.4483 2.5095  30 100.0000 3248 . 0.1573 0.1919 . 173 . 3421 . . 'X-RAY DIFFRACTION' 
2.5095 2.5774  30 100.0000 3253 . 0.1658 0.2080 . 171 . 3424 . . 'X-RAY DIFFRACTION' 
2.5774 2.6532  30 100.0000 3279 . 0.1713 0.1959 . 180 . 3459 . . 'X-RAY DIFFRACTION' 
2.6532 2.7388  30 100.0000 3266 . 0.1743 0.2196 . 162 . 3428 . . 'X-RAY DIFFRACTION' 
2.7388 2.8367  30 100.0000 3291 . 0.1764 0.2216 . 170 . 3461 . . 'X-RAY DIFFRACTION' 
2.8367 2.9503  30 100.0000 3266 . 0.1749 0.2102 . 171 . 3437 . . 'X-RAY DIFFRACTION' 
2.9503 3.0845  30 100.0000 3289 . 0.1795 0.1984 . 161 . 3450 . . 'X-RAY DIFFRACTION' 
3.0845 3.2471  30 100.0000 3279 . 0.1711 0.2094 . 179 . 3458 . . 'X-RAY DIFFRACTION' 
3.2471 3.4505  30 100.0000 3300 . 0.1648 0.1808 . 192 . 3492 . . 'X-RAY DIFFRACTION' 
3.4505 3.7168  30 100.0000 3296 . 0.1535 0.1827 . 176 . 3472 . . 'X-RAY DIFFRACTION' 
3.7168 4.0906  30 100.0000 3335 . 0.1500 0.1682 . 175 . 3510 . . 'X-RAY DIFFRACTION' 
4.0906 4.6821  30 100.0000 3352 . 0.1352 0.1561 . 159 . 3511 . . 'X-RAY DIFFRACTION' 
4.6821 5.8970  30 100.0000 3370 . 0.1678 0.1613 . 211 . 3581 . . 'X-RAY DIFFRACTION' 
5.8970 46.3486 30 99.0000  3547 . 0.1783 0.1905 . 181 . 3728 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4IXU 
_struct.title                     
;Crystal structure of human Arginase-2 complexed with inhibitor 11d: {(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)
;
_struct.pdbx_descriptor           'Arginase-2, mitochondrial (E.C.3.5.3.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IXU 
_struct_keywords.text            
;metalloenzyme, alpha/beta fold, Hydrolase, Arginine metabolism, Manganese, boronate, Mitochondrion, HYDROLASE-HYDROLASE INHIBITOR complex
;
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 2 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 3 ? 
S N N 4 ? 
T N N 4 ? 
U N N 5 ? 
V N N 6 ? 
W N N 6 ? 
X N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'biological assembly is a homotrimer with one copy in the asymmetric unit' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 18  ? GLU A 20  ? GLY A 41  GLU A 43  5 ? 3  
HELX_P HELX_P2  2  HIS A 21  ? ALA A 29  ? HIS A 44  ALA A 52  1 ? 9  
HELX_P HELX_P3  3  GLY A 30  ? LEU A 38  ? GLY A 53  LEU A 61  1 ? 9  
HELX_P HELX_P4  4  ASN A 65  ? ASP A 86  ? ASN A 88  ASP A 109 1 ? 22 
HELX_P HELX_P5  5  SER A 98  ? CYS A 111 ? SER A 121 CYS A 134 1 ? 14 
HELX_P HELX_P6  6  ASN A 135 ? GLY A 138 ? ASN A 158 GLY A 161 5 ? 4  
HELX_P HELX_P7  7  GLN A 139 ? LEU A 145 ? GLN A 162 LEU A 168 1 ? 7  
HELX_P HELX_P8  8  ARG A 146 ? VAL A 152 ? ARG A 169 VAL A 175 5 ? 7  
HELX_P HELX_P9  9  SER A 166 ? ALA A 168 ? SER A 189 ALA A 191 5 ? 3  
HELX_P HELX_P10 10 ASP A 179 ? TYR A 189 ? ASP A 202 TYR A 212 1 ? 11 
HELX_P HELX_P11 11 MET A 196 ? GLY A 203 ? MET A 219 GLY A 226 1 ? 8  
HELX_P HELX_P12 12 GLY A 203 ? GLY A 217 ? GLY A 226 GLY A 240 1 ? 15 
HELX_P HELX_P13 13 ASP A 230 ? PHE A 232 ? ASP A 253 PHE A 255 5 ? 3  
HELX_P HELX_P14 14 THR A 249 ? THR A 263 ? THR A 272 THR A 286 1 ? 15 
HELX_P HELX_P15 15 ASN A 275 ? ALA A 279 ? ASN A 298 ALA A 302 5 ? 5  
HELX_P HELX_P16 16 SER A 281 ? PHE A 300 ? SER A 304 PHE A 323 1 ? 20 
HELX_P HELX_P17 17 GLY B 18  ? GLU B 20  ? GLY B 41  GLU B 43  5 ? 3  
HELX_P HELX_P18 18 HIS B 21  ? ALA B 29  ? HIS B 44  ALA B 52  1 ? 9  
HELX_P HELX_P19 19 GLY B 30  ? LEU B 38  ? GLY B 53  LEU B 61  1 ? 9  
HELX_P HELX_P20 20 ASN B 65  ? ASP B 86  ? ASN B 88  ASP B 109 1 ? 22 
HELX_P HELX_P21 21 SER B 98  ? CYS B 111 ? SER B 121 CYS B 134 1 ? 14 
HELX_P HELX_P22 22 ASN B 135 ? GLY B 138 ? ASN B 158 GLY B 161 5 ? 4  
HELX_P HELX_P23 23 GLN B 139 ? LEU B 145 ? GLN B 162 LEU B 168 1 ? 7  
HELX_P HELX_P24 24 ARG B 146 ? VAL B 152 ? ARG B 169 VAL B 175 5 ? 7  
HELX_P HELX_P25 25 SER B 166 ? ALA B 168 ? SER B 189 ALA B 191 5 ? 3  
HELX_P HELX_P26 26 ASP B 179 ? TYR B 189 ? ASP B 202 TYR B 212 1 ? 11 
HELX_P HELX_P27 27 MET B 196 ? GLY B 203 ? MET B 219 GLY B 226 1 ? 8  
HELX_P HELX_P28 28 GLY B 203 ? GLY B 217 ? GLY B 226 GLY B 240 1 ? 15 
HELX_P HELX_P29 29 ASP B 230 ? PHE B 232 ? ASP B 253 PHE B 255 5 ? 3  
HELX_P HELX_P30 30 THR B 249 ? THR B 263 ? THR B 272 THR B 286 1 ? 15 
HELX_P HELX_P31 31 ASN B 275 ? ALA B 279 ? ASN B 298 ALA B 302 5 ? 5  
HELX_P HELX_P32 32 SER B 281 ? PHE B 300 ? SER B 304 PHE B 323 1 ? 20 
HELX_P HELX_P33 33 GLY C 18  ? GLU C 20  ? GLY C 41  GLU C 43  5 ? 3  
HELX_P HELX_P34 34 HIS C 21  ? ALA C 29  ? HIS C 44  ALA C 52  1 ? 9  
HELX_P HELX_P35 35 GLY C 30  ? LEU C 38  ? GLY C 53  LEU C 61  1 ? 9  
HELX_P HELX_P36 36 ASN C 65  ? ASP C 86  ? ASN C 88  ASP C 109 1 ? 22 
HELX_P HELX_P37 37 SER C 98  ? CYS C 111 ? SER C 121 CYS C 134 1 ? 14 
HELX_P HELX_P38 38 ASN C 135 ? GLY C 138 ? ASN C 158 GLY C 161 5 ? 4  
HELX_P HELX_P39 39 GLN C 139 ? LEU C 145 ? GLN C 162 LEU C 168 1 ? 7  
HELX_P HELX_P40 40 ARG C 146 ? VAL C 152 ? ARG C 169 VAL C 175 5 ? 7  
HELX_P HELX_P41 41 SER C 166 ? ALA C 168 ? SER C 189 ALA C 191 5 ? 3  
HELX_P HELX_P42 42 ASP C 179 ? TYR C 189 ? ASP C 202 TYR C 212 1 ? 11 
HELX_P HELX_P43 43 MET C 196 ? GLY C 203 ? MET C 219 GLY C 226 1 ? 8  
HELX_P HELX_P44 44 GLY C 203 ? GLY C 217 ? GLY C 226 GLY C 240 1 ? 15 
HELX_P HELX_P45 45 ASP C 230 ? PHE C 232 ? ASP C 253 PHE C 255 5 ? 3  
HELX_P HELX_P46 46 THR C 249 ? THR C 263 ? THR C 272 THR C 286 1 ? 15 
HELX_P HELX_P47 47 ASN C 275 ? ALA C 279 ? ASN C 298 ALA C 302 5 ? 5  
HELX_P HELX_P48 48 SER C 281 ? PHE C 300 ? SER C 304 PHE C 323 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B ASP 120 OD2 ? ? ? 1_555 J MN  . MN  ? ? B ASP 143 B MN  401 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc2  metalc ? ? A ASP 124 OD2 ? ? ? 1_555 D MN  . MN  ? ? A ASP 147 A MN  401 1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc3  metalc ? ? C HIS 97  ND1 ? ? ? 1_555 Q MN  . MN  ? ? C HIS 120 C MN  402 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc4  metalc ? ? C ASP 124 OD2 ? ? ? 1_555 Q MN  . MN  ? ? C ASP 147 C MN  402 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc5  metalc ? ? B ASP 124 OD2 ? ? ? 1_555 J MN  . MN  ? ? B ASP 147 B MN  401 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc6  metalc ? ? Q MN  .   MN  ? ? ? 1_555 U 38I . O12 ? ? C MN  402 C 38I 406 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc7  metalc ? ? C ASP 120 OD2 ? ? ? 1_555 Q MN  . MN  ? ? C ASP 143 C MN  402 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc8  metalc ? ? A ASP 120 OD2 ? ? ? 1_555 D MN  . MN  ? ? A ASP 143 A MN  401 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc9  metalc ? ? B ASP 120 OD1 ? ? ? 1_555 K MN  . MN  ? ? B ASP 143 B MN  402 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc10 metalc ? ? K MN  .   MN  ? ? ? 1_555 O 38I . O12 ? ? B MN  402 B 38I 406 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc11 metalc ? ? A ASP 120 OD1 ? ? ? 1_555 E MN  . MN  ? ? A ASP 143 A MN  402 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc12 metalc ? ? C ASP 120 OD1 ? ? ? 1_555 P MN  . MN  ? ? C ASP 143 C MN  401 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc13 metalc ? ? A HIS 97  ND1 ? ? ? 1_555 D MN  . MN  ? ? A HIS 120 A MN  401 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc14 metalc ? ? E MN  .   MN  ? ? ? 1_555 I 38I . O12 ? ? A MN  402 A 38I 406 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc15 metalc ? ? D MN  .   MN  ? ? ? 1_555 I 38I . O12 ? ? A MN  401 A 38I 406 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc16 metalc ? ? C HIS 122 ND1 ? ? ? 1_555 P MN  . MN  ? ? C HIS 145 C MN  401 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc17 metalc ? ? A ASP 230 OD2 ? ? ? 1_555 E MN  . MN  ? ? A ASP 253 A MN  402 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc18 metalc ? ? C ASP 230 OD2 ? ? ? 1_555 P MN  . MN  ? ? C ASP 253 C MN  401 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc19 metalc ? ? B HIS 97  ND1 ? ? ? 1_555 J MN  . MN  ? ? B HIS 120 B MN  401 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc20 metalc ? ? J MN  .   MN  ? ? ? 1_555 O 38I . O30 ? ? B MN  401 B 38I 406 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc21 metalc ? ? B ASP 228 OD2 ? ? ? 1_555 J MN  . MN  ? ? B ASP 251 B MN  401 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc22 metalc ? ? B HIS 122 ND1 ? ? ? 1_555 K MN  . MN  ? ? B HIS 145 B MN  402 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc23 metalc ? ? J MN  .   MN  ? ? ? 1_555 O 38I . O12 ? ? B MN  401 B 38I 406 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc24 metalc ? ? A ASP 228 OD2 ? ? ? 1_555 E MN  . MN  ? ? A ASP 251 A MN  402 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc25 metalc ? ? B ASP 230 OD2 ? ? ? 1_555 K MN  . MN  ? ? B ASP 253 B MN  402 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc26 metalc ? ? C ASP 228 OD2 ? ? ? 1_555 P MN  . MN  ? ? C ASP 251 C MN  401 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc27 metalc ? ? P MN  .   MN  ? ? ? 1_555 U 38I . O12 ? ? C MN  401 C 38I 406 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc28 metalc ? ? A HIS 122 ND1 ? ? ? 1_555 E MN  . MN  ? ? A HIS 145 A MN  402 1_555 ? ? ? ? ? ? ? 2.260 ? 
metalc29 metalc ? ? C ASP 228 OD2 ? ? ? 1_555 Q MN  . MN  ? ? C ASP 251 C MN  402 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc30 metalc ? ? D MN  .   MN  ? ? ? 1_555 I 38I . O30 ? ? A MN  401 A 38I 406 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc31 metalc ? ? A ASP 228 OD2 ? ? ? 1_555 D MN  . MN  ? ? A ASP 251 A MN  401 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc32 metalc ? ? Q MN  .   MN  ? ? ? 1_555 U 38I . O30 ? ? C MN  402 C 38I 406 1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc33 metalc ? ? B ASP 228 OD2 ? ? ? 1_555 K MN  . MN  ? ? B ASP 251 B MN  402 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc34 metalc ? ? B ASP 230 OD1 ? ? ? 1_555 K MN  . MN  ? ? B ASP 253 B MN  402 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc35 metalc ? ? C ASP 230 OD1 ? ? ? 1_555 P MN  . MN  ? ? C ASP 253 C MN  401 1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc36 metalc ? ? A ASP 230 OD1 ? ? ? 1_555 E MN  . MN  ? ? A ASP 253 A MN  402 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc37 metalc ? ? P MN  .   MN  ? ? ? 1_555 U 38I . O13 ? ? C MN  401 C 38I 406 1_555 ? ? ? ? ? ? ? 2.777 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 94 A . ? GLY 117 A GLY 95 A ? GLY 118 A 1 2.25 
2 GLY 94 B . ? GLY 117 B GLY 95 B ? GLY 118 B 1 2.06 
3 GLY 94 C . ? GLY 117 C GLY 95 C ? GLY 118 C 1 2.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
C ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
B 7 8 ? parallel 
C 1 2 ? parallel 
C 2 3 ? parallel 
C 3 4 ? parallel 
C 4 5 ? parallel 
C 5 6 ? parallel 
C 6 7 ? parallel 
C 7 8 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 41  ? ASP A 47  ? HIS A 64  ASP A 70  
A 2 SER A 2   ? ALA A 8   ? SER A 25  ALA A 31  
A 3 SER A 89  ? GLY A 94  ? SER A 112 GLY A 117 
A 4 LEU A 266 ? VAL A 272 ? LEU A 289 VAL A 295 
A 5 ILE A 223 ? ASP A 228 ? ILE A 246 ASP A 251 
A 6 CYS A 115 ? VAL A 119 ? CYS A 138 VAL A 142 
A 7 ILE A 170 ? LEU A 175 ? ILE A 193 LEU A 198 
A 8 GLN A 192 ? SER A 195 ? GLN A 215 SER A 218 
B 1 HIS B 41  ? ASP B 47  ? HIS B 64  ASP B 70  
B 2 SER B 2   ? GLY B 7   ? SER B 25  GLY B 30  
B 3 SER B 89  ? LEU B 93  ? SER B 112 LEU B 116 
B 4 LEU B 266 ? VAL B 272 ? LEU B 289 VAL B 295 
B 5 ILE B 223 ? ASP B 228 ? ILE B 246 ASP B 251 
B 6 CYS B 115 ? VAL B 119 ? CYS B 138 VAL B 142 
B 7 ILE B 170 ? LEU B 175 ? ILE B 193 LEU B 198 
B 8 GLN B 192 ? SER B 195 ? GLN B 215 SER B 218 
C 1 HIS C 41  ? ASP C 47  ? HIS C 64  ASP C 70  
C 2 SER C 2   ? GLY C 7   ? SER C 25  GLY C 30  
C 3 SER C 89  ? LEU C 93  ? SER C 112 LEU C 116 
C 4 LEU C 266 ? VAL C 272 ? LEU C 289 VAL C 295 
C 5 ILE C 223 ? ASP C 228 ? ILE C 246 ASP C 251 
C 6 CYS C 115 ? VAL C 119 ? CYS C 138 VAL C 142 
C 7 ILE C 170 ? LEU C 175 ? ILE C 193 LEU C 198 
C 8 GLN C 192 ? SER C 195 ? GLN C 215 SER C 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 41  ? O HIS A 64  N VAL A 3   ? N VAL A 26  
A 2 3 N ALA A 4   ? N ALA A 27  O VAL A 91  ? O VAL A 114 
A 3 4 N THR A 92  ? N THR A 115 O LEU A 269 ? O LEU A 292 
A 4 5 O SER A 267 ? O SER A 290 N ILE A 223 ? N ILE A 246 
A 5 6 O ASP A 228 ? O ASP A 251 N VAL A 119 ? N VAL A 142 
A 6 7 N TRP A 118 ? N TRP A 141 O VAL A 171 ? O VAL A 194 
A 7 8 N GLY A 174 ? N GLY A 197 O PHE A 194 ? O PHE A 217 
B 1 2 O GLY B 46  ? O GLY B 69  N GLY B 7   ? N GLY B 30  
B 2 3 N ALA B 4   ? N ALA B 27  O VAL B 91  ? O VAL B 114 
B 3 4 N CYS B 90  ? N CYS B 113 O LEU B 269 ? O LEU B 292 
B 4 5 O SER B 267 ? O SER B 290 N ILE B 223 ? N ILE B 246 
B 5 6 O ASP B 228 ? O ASP B 251 N VAL B 119 ? N VAL B 142 
B 6 7 N TRP B 118 ? N TRP B 141 O VAL B 171 ? O VAL B 194 
B 7 8 N GLY B 174 ? N GLY B 197 O PHE B 194 ? O PHE B 217 
C 1 2 O PHE C 45  ? O PHE C 68  N VAL C 5   ? N VAL C 28  
C 2 3 N ALA C 4   ? N ALA C 27  O VAL C 91  ? O VAL C 114 
C 3 4 N THR C 92  ? N THR C 115 O LEU C 269 ? O LEU C 292 
C 4 5 O SER C 267 ? O SER C 290 N ILE C 223 ? N ILE C 246 
C 5 6 O ASP C 228 ? O ASP C 251 N VAL C 119 ? N VAL C 142 
C 6 7 N TRP C 118 ? N TRP C 141 O VAL C 171 ? O VAL C 194 
C 7 8 N GLY C 174 ? N GLY C 197 O PHE C 194 ? O PHE C 217 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 401'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 402'  
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BEN A 403' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE BME A 404' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE BME A 405' 
AC6 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 38I A 406' 
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 401'  
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 402'  
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BEN B 403' 
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE BME B 404' 
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE BME B 405' 
BC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE 38I B 406' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 401'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN C 402'  
BC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BEN C 403' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE BME C 404' 
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE BME C 405' 
BC9 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE 38I C 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  HIS A 97  ? HIS A 120 . ? 1_555 ? 
2   AC1 6  ASP A 120 ? ASP A 143 . ? 1_555 ? 
3   AC1 6  ASP A 124 ? ASP A 147 . ? 1_555 ? 
4   AC1 6  ASP A 228 ? ASP A 251 . ? 1_555 ? 
5   AC1 6  MN  E .   ? MN  A 402 . ? 1_555 ? 
6   AC1 6  38I I .   ? 38I A 406 . ? 1_555 ? 
7   AC2 6  ASP A 120 ? ASP A 143 . ? 1_555 ? 
8   AC2 6  HIS A 122 ? HIS A 145 . ? 1_555 ? 
9   AC2 6  ASP A 228 ? ASP A 251 . ? 1_555 ? 
10  AC2 6  ASP A 230 ? ASP A 253 . ? 1_555 ? 
11  AC2 6  MN  D .   ? MN  A 401 . ? 1_555 ? 
12  AC2 6  38I I .   ? 38I A 406 . ? 1_555 ? 
13  AC3 8  ASN A 60  ? ASN A 83  . ? 8_666 ? 
14  AC3 8  ASN A 60  ? ASN A 83  . ? 1_555 ? 
15  AC3 8  ASN A 61  ? ASN A 84  . ? 1_555 ? 
16  AC3 8  LEU A 62  ? LEU A 85  . ? 8_666 ? 
17  AC3 8  PRO A 128 ? PRO A 151 . ? 8_666 ? 
18  AC3 8  LEU A 129 ? LEU A 152 . ? 8_666 ? 
19  AC3 8  THR A 130 ? THR A 153 . ? 8_666 ? 
20  AC3 8  THR A 131 ? THR A 154 . ? 8_666 ? 
21  AC4 2  LEU A 35  ? LEU A 58  . ? 1_555 ? 
22  AC4 2  PHE A 300 ? PHE A 323 . ? 1_555 ? 
23  AC5 3  HIS A 110 ? HIS A 133 . ? 1_555 ? 
24  AC5 3  CYS A 111 ? CYS A 134 . ? 1_555 ? 
25  AC5 3  SER A 267 ? SER A 290 . ? 1_555 ? 
26  AC6 22 LEU A 58  ? LEU A 81  . ? 8_666 ? 
27  AC6 22 HIS A 97  ? HIS A 120 . ? 1_555 ? 
28  AC6 22 ASP A 120 ? ASP A 143 . ? 1_555 ? 
29  AC6 22 HIS A 122 ? HIS A 145 . ? 1_555 ? 
30  AC6 22 ASP A 124 ? ASP A 147 . ? 1_555 ? 
31  AC6 22 ASN A 126 ? ASN A 149 . ? 1_555 ? 
32  AC6 22 SER A 133 ? SER A 156 . ? 1_555 ? 
33  AC6 22 HIS A 137 ? HIS A 160 . ? 1_555 ? 
34  AC6 22 ASP A 179 ? ASP A 202 . ? 1_555 ? 
35  AC6 22 ASP A 228 ? ASP A 251 . ? 1_555 ? 
36  AC6 22 ASP A 230 ? ASP A 253 . ? 1_555 ? 
37  AC6 22 THR A 242 ? THR A 265 . ? 1_555 ? 
38  AC6 22 GLU A 273 ? GLU A 296 . ? 1_555 ? 
39  AC6 22 MN  D .   ? MN  A 401 . ? 1_555 ? 
40  AC6 22 MN  E .   ? MN  A 402 . ? 1_555 ? 
41  AC6 22 HOH V .   ? HOH A 503 . ? 1_555 ? 
42  AC6 22 HOH V .   ? HOH A 526 . ? 1_555 ? 
43  AC6 22 HOH V .   ? HOH A 531 . ? 1_555 ? 
44  AC6 22 HOH V .   ? HOH A 544 . ? 1_555 ? 
45  AC6 22 HOH V .   ? HOH A 643 . ? 1_555 ? 
46  AC6 22 HOH V .   ? HOH A 659 . ? 1_555 ? 
47  AC6 22 HOH V .   ? HOH A 671 . ? 1_555 ? 
48  AC7 6  HIS B 97  ? HIS B 120 . ? 1_555 ? 
49  AC7 6  ASP B 120 ? ASP B 143 . ? 1_555 ? 
50  AC7 6  ASP B 124 ? ASP B 147 . ? 1_555 ? 
51  AC7 6  ASP B 228 ? ASP B 251 . ? 1_555 ? 
52  AC7 6  MN  K .   ? MN  B 402 . ? 1_555 ? 
53  AC7 6  38I O .   ? 38I B 406 . ? 1_555 ? 
54  AC8 6  ASP B 120 ? ASP B 143 . ? 1_555 ? 
55  AC8 6  HIS B 122 ? HIS B 145 . ? 1_555 ? 
56  AC8 6  ASP B 228 ? ASP B 251 . ? 1_555 ? 
57  AC8 6  ASP B 230 ? ASP B 253 . ? 1_555 ? 
58  AC8 6  MN  J .   ? MN  B 401 . ? 1_555 ? 
59  AC8 6  38I O .   ? 38I B 406 . ? 1_555 ? 
60  AC9 8  ASN B 60  ? ASN B 83  . ? 2_665 ? 
61  AC9 8  ASN B 60  ? ASN B 83  . ? 1_555 ? 
62  AC9 8  ASN B 61  ? ASN B 84  . ? 1_555 ? 
63  AC9 8  LEU B 62  ? LEU B 85  . ? 2_665 ? 
64  AC9 8  PRO B 128 ? PRO B 151 . ? 2_665 ? 
65  AC9 8  LEU B 129 ? LEU B 152 . ? 2_665 ? 
66  AC9 8  THR B 130 ? THR B 153 . ? 2_665 ? 
67  AC9 8  THR B 131 ? THR B 154 . ? 2_665 ? 
68  BC1 2  CYS B 40  ? CYS B 63  . ? 1_555 ? 
69  BC1 2  PHE B 300 ? PHE B 323 . ? 1_555 ? 
70  BC2 5  ASP A 113 ? ASP A 136 . ? 5_545 ? 
71  BC2 5  CYS B 111 ? CYS B 134 . ? 1_555 ? 
72  BC2 5  HOH W .   ? HOH B 552 . ? 1_555 ? 
73  BC2 5  HOH W .   ? HOH B 568 . ? 1_555 ? 
74  BC2 5  HOH W .   ? HOH B 767 . ? 1_555 ? 
75  BC3 23 LEU B 58  ? LEU B 81  . ? 2_665 ? 
76  BC3 23 HIS B 97  ? HIS B 120 . ? 1_555 ? 
77  BC3 23 ASP B 120 ? ASP B 143 . ? 1_555 ? 
78  BC3 23 HIS B 122 ? HIS B 145 . ? 1_555 ? 
79  BC3 23 ASP B 124 ? ASP B 147 . ? 1_555 ? 
80  BC3 23 ASN B 126 ? ASN B 149 . ? 1_555 ? 
81  BC3 23 SER B 132 ? SER B 155 . ? 1_555 ? 
82  BC3 23 SER B 133 ? SER B 156 . ? 1_555 ? 
83  BC3 23 HIS B 137 ? HIS B 160 . ? 1_555 ? 
84  BC3 23 ASP B 179 ? ASP B 202 . ? 1_555 ? 
85  BC3 23 ASP B 228 ? ASP B 251 . ? 1_555 ? 
86  BC3 23 ASP B 230 ? ASP B 253 . ? 1_555 ? 
87  BC3 23 THR B 242 ? THR B 265 . ? 1_555 ? 
88  BC3 23 GLU B 273 ? GLU B 296 . ? 1_555 ? 
89  BC3 23 MN  J .   ? MN  B 401 . ? 1_555 ? 
90  BC3 23 MN  K .   ? MN  B 402 . ? 1_555 ? 
91  BC3 23 HOH W .   ? HOH B 502 . ? 1_555 ? 
92  BC3 23 HOH W .   ? HOH B 505 . ? 1_555 ? 
93  BC3 23 HOH W .   ? HOH B 532 . ? 1_555 ? 
94  BC3 23 HOH W .   ? HOH B 533 . ? 1_555 ? 
95  BC3 23 HOH W .   ? HOH B 548 . ? 1_555 ? 
96  BC3 23 HOH W .   ? HOH B 677 . ? 1_555 ? 
97  BC3 23 HOH W .   ? HOH B 689 . ? 1_555 ? 
98  BC4 6  ASP C 120 ? ASP C 143 . ? 1_555 ? 
99  BC4 6  HIS C 122 ? HIS C 145 . ? 1_555 ? 
100 BC4 6  ASP C 228 ? ASP C 251 . ? 1_555 ? 
101 BC4 6  ASP C 230 ? ASP C 253 . ? 1_555 ? 
102 BC4 6  MN  Q .   ? MN  C 402 . ? 1_555 ? 
103 BC4 6  38I U .   ? 38I C 406 . ? 1_555 ? 
104 BC5 6  HIS C 97  ? HIS C 120 . ? 1_555 ? 
105 BC5 6  ASP C 120 ? ASP C 143 . ? 1_555 ? 
106 BC5 6  ASP C 124 ? ASP C 147 . ? 1_555 ? 
107 BC5 6  ASP C 228 ? ASP C 251 . ? 1_555 ? 
108 BC5 6  MN  P .   ? MN  C 401 . ? 1_555 ? 
109 BC5 6  38I U .   ? 38I C 406 . ? 1_555 ? 
110 BC6 8  ASN C 60  ? ASN C 83  . ? 7_556 ? 
111 BC6 8  ASN C 60  ? ASN C 83  . ? 1_555 ? 
112 BC6 8  ASN C 61  ? ASN C 84  . ? 1_555 ? 
113 BC6 8  LEU C 62  ? LEU C 85  . ? 7_556 ? 
114 BC6 8  PRO C 128 ? PRO C 151 . ? 7_556 ? 
115 BC6 8  LEU C 129 ? LEU C 152 . ? 7_556 ? 
116 BC6 8  THR C 130 ? THR C 153 . ? 7_556 ? 
117 BC6 8  THR C 131 ? THR C 154 . ? 7_556 ? 
118 BC7 5  HIS C 1   ? HIS C 24  . ? 1_555 ? 
119 BC7 5  VAL C 3   ? VAL C 26  . ? 1_555 ? 
120 BC7 5  LEU C 35  ? LEU C 58  . ? 1_555 ? 
121 BC7 5  CYS C 40  ? CYS C 63  . ? 1_555 ? 
122 BC7 5  PHE C 300 ? PHE C 323 . ? 1_555 ? 
123 BC8 4  VAL C 84  ? VAL C 107 . ? 1_555 ? 
124 BC8 4  HIS C 107 ? HIS C 130 . ? 1_555 ? 
125 BC8 4  HIS C 110 ? HIS C 133 . ? 1_555 ? 
126 BC8 4  PRO C 112 ? PRO C 135 . ? 1_555 ? 
127 BC9 22 LEU C 58  ? LEU C 81  . ? 7_556 ? 
128 BC9 22 HIS C 97  ? HIS C 120 . ? 1_555 ? 
129 BC9 22 ASP C 120 ? ASP C 143 . ? 1_555 ? 
130 BC9 22 HIS C 122 ? HIS C 145 . ? 1_555 ? 
131 BC9 22 ASP C 124 ? ASP C 147 . ? 1_555 ? 
132 BC9 22 ASN C 126 ? ASN C 149 . ? 1_555 ? 
133 BC9 22 SER C 133 ? SER C 156 . ? 1_555 ? 
134 BC9 22 HIS C 137 ? HIS C 160 . ? 1_555 ? 
135 BC9 22 ASP C 179 ? ASP C 202 . ? 1_555 ? 
136 BC9 22 ASP C 228 ? ASP C 251 . ? 1_555 ? 
137 BC9 22 ASP C 230 ? ASP C 253 . ? 1_555 ? 
138 BC9 22 THR C 242 ? THR C 265 . ? 1_555 ? 
139 BC9 22 GLU C 273 ? GLU C 296 . ? 1_555 ? 
140 BC9 22 MN  P .   ? MN  C 401 . ? 1_555 ? 
141 BC9 22 MN  Q .   ? MN  C 402 . ? 1_555 ? 
142 BC9 22 HOH X .   ? HOH C 501 . ? 1_555 ? 
143 BC9 22 HOH X .   ? HOH C 513 . ? 1_555 ? 
144 BC9 22 HOH X .   ? HOH C 522 . ? 1_555 ? 
145 BC9 22 HOH X .   ? HOH C 539 . ? 1_555 ? 
146 BC9 22 HOH X .   ? HOH C 602 . ? 1_555 ? 
147 BC9 22 HOH X .   ? HOH C 633 . ? 1_555 ? 
148 BC9 22 HOH X .   ? HOH C 634 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4IXU 
_atom_sites.fract_transf_matrix[1][1]   0.007849 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007849 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006279 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
B  
C  
CL 
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 1   ? 44.157 87.664  37.934  1.00 62.22  ? 24  HIS A N   1 
ATOM   2    C  CA  . HIS A 1 1   ? 45.514 87.381  37.510  1.00 52.85  ? 24  HIS A CA  1 
ATOM   3    C  C   . HIS A 1 1   ? 46.513 88.061  38.399  1.00 45.34  ? 24  HIS A C   1 
ATOM   4    O  O   . HIS A 1 1   ? 47.631 87.546  38.616  1.00 32.34  ? 24  HIS A O   1 
ATOM   5    C  CB  . HIS A 1 1   ? 45.722 87.813  36.063  1.00 59.79  ? 24  HIS A CB  1 
ATOM   6    C  CG  . HIS A 1 1   ? 46.698 86.947  35.303  1.00 74.73  ? 24  HIS A CG  1 
ATOM   7    N  ND1 . HIS A 1 1   ? 46.950 87.120  33.993  1.00 69.40  ? 24  HIS A ND1 1 
ATOM   8    C  CD2 . HIS A 1 1   ? 47.490 85.878  35.719  1.00 77.92  ? 24  HIS A CD2 1 
ATOM   9    C  CE1 . HIS A 1 1   ? 47.856 86.210  33.588  1.00 72.39  ? 24  HIS A CE1 1 
ATOM   10   N  NE2 . HIS A 1 1   ? 48.186 85.451  34.645  1.00 78.28  ? 24  HIS A NE2 1 
ATOM   11   N  N   . SER A 1 2   ? 46.135 89.221  38.926  1.00 27.43  ? 25  SER A N   1 
ATOM   12   C  CA  . SER A 1 2   ? 47.011 89.983  39.808  1.00 23.96  ? 25  SER A CA  1 
ATOM   13   C  C   . SER A 1 2   ? 46.538 89.905  41.256  1.00 18.34  ? 25  SER A C   1 
ATOM   14   O  O   . SER A 1 2   ? 45.360 90.114  41.546  1.00 19.83  ? 25  SER A O   1 
ATOM   15   C  CB  . SER A 1 2   ? 47.086 91.443  39.357  1.00 35.60  ? 25  SER A CB  1 
ATOM   16   O  OG  . SER A 1 2   ? 47.375 91.536  37.973  1.00 45.29  ? 25  SER A OG  1 
ATOM   17   N  N   . VAL A 1 3   ? 47.463 89.602  42.160  1.00 16.93  ? 26  VAL A N   1 
ATOM   18   C  CA  . VAL A 1 3   ? 47.142 89.494  43.576  1.00 13.64  ? 26  VAL A CA  1 
ATOM   19   C  C   . VAL A 1 3   ? 48.062 90.397  44.370  1.00 14.22  ? 26  VAL A C   1 
ATOM   20   O  O   . VAL A 1 3   ? 49.284 90.356  44.200  1.00 13.97  ? 26  VAL A O   1 
ATOM   21   C  CB  . VAL A 1 3   ? 47.292 88.041  44.086  1.00 13.41  ? 26  VAL A CB  1 
ATOM   22   C  CG1 . VAL A 1 3   ? 47.075 87.976  45.606  1.00 13.82  ? 26  VAL A CG1 1 
ATOM   23   C  CG2 . VAL A 1 3   ? 46.330 87.121  43.366  1.00 18.08  ? 26  VAL A CG2 1 
ATOM   24   N  N   . ALA A 1 4   ? 47.472 91.221  45.231  1.00 13.79  ? 27  ALA A N   1 
ATOM   25   C  CA  . ALA A 1 4   ? 48.254 92.009  46.169  1.00 12.63  ? 27  ALA A CA  1 
ATOM   26   C  C   . ALA A 1 4   ? 48.263 91.306  47.515  1.00 15.15  ? 27  ALA A C   1 
ATOM   27   O  O   . ALA A 1 4   ? 47.242 90.779  47.956  1.00 14.92  ? 27  ALA A O   1 
ATOM   28   C  CB  . ALA A 1 4   ? 47.678 93.437  46.312  1.00 15.46  ? 27  ALA A CB  1 
ATOM   29   N  N   . VAL A 1 5   ? 49.419 91.297  48.166  1.00 10.33  ? 28  VAL A N   1 
ATOM   30   C  CA  . VAL A 1 5   ? 49.520 90.708  49.489  1.00 11.65  ? 28  VAL A CA  1 
ATOM   31   C  C   . VAL A 1 5   ? 49.923 91.793  50.476  1.00 12.64  ? 28  VAL A C   1 
ATOM   32   O  O   . VAL A 1 5   ? 50.936 92.475  50.292  1.00 16.44  ? 28  VAL A O   1 
ATOM   33   C  CB  . VAL A 1 5   ? 50.535 89.529  49.524  1.00 13.32  ? 28  VAL A CB  1 
ATOM   34   C  CG1 . VAL A 1 5   ? 50.667 88.969  50.956  1.00 12.96  ? 28  VAL A CG1 1 
ATOM   35   C  CG2 . VAL A 1 5   ? 50.110 88.419  48.538  1.00 12.28  ? 28  VAL A CG2 1 
ATOM   36   N  N   . ILE A 1 6   ? 49.106 91.959  51.506  1.00 8.88   ? 29  ILE A N   1 
ATOM   37   C  CA  . ILE A 1 6   ? 49.348 92.958  52.534  1.00 10.73  ? 29  ILE A CA  1 
ATOM   38   C  C   . ILE A 1 6   ? 49.416 92.280  53.879  1.00 10.95  ? 29  ILE A C   1 
ATOM   39   O  O   . ILE A 1 6   ? 48.479 91.591  54.267  1.00 11.80  ? 29  ILE A O   1 
ATOM   40   C  CB  . ILE A 1 6   ? 48.205 93.961  52.630  1.00 7.57   ? 29  ILE A CB  1 
ATOM   41   C  CG1 . ILE A 1 6   ? 48.001 94.685  51.303  1.00 9.68   ? 29  ILE A CG1 1 
ATOM   42   C  CG2 . ILE A 1 6   ? 48.478 94.973  53.752  1.00 13.39  ? 29  ILE A CG2 1 
ATOM   43   C  CD1 . ILE A 1 6   ? 46.727 95.531  51.308  1.00 14.86  ? 29  ILE A CD1 1 
ATOM   44   N  N   . GLY A 1 7   ? 50.525 92.465  54.591  1.00 11.52  ? 30  GLY A N   1 
ATOM   45   C  CA  . GLY A 1 7   ? 50.619 91.989  55.960  1.00 13.35  ? 30  GLY A CA  1 
ATOM   46   C  C   . GLY A 1 7   ? 50.047 93.040  56.900  1.00 14.72  ? 30  GLY A C   1 
ATOM   47   O  O   . GLY A 1 7   ? 50.468 94.200  56.855  1.00 13.10  ? 30  GLY A O   1 
ATOM   48   N  N   . ALA A 1 8   ? 49.075 92.649  57.720  1.00 9.96   ? 31  ALA A N   1 
ATOM   49   C  CA  . ALA A 1 8   ? 48.448 93.562  58.676  1.00 9.46   ? 31  ALA A CA  1 
ATOM   50   C  C   . ALA A 1 8   ? 48.590 93.021  60.083  1.00 13.28  ? 31  ALA A C   1 
ATOM   51   O  O   . ALA A 1 8   ? 47.698 92.359  60.602  1.00 14.14  ? 31  ALA A O   1 
ATOM   52   C  CB  . ALA A 1 8   ? 46.984 93.777  58.337  1.00 10.73  ? 31  ALA A CB  1 
ATOM   53   N  N   . PRO A 1 9   ? 49.732 93.298  60.712  1.00 17.24  ? 32  PRO A N   1 
ATOM   54   C  CA  . PRO A 1 9   ? 49.954 92.662  62.016  1.00 17.06  ? 32  PRO A CA  1 
ATOM   55   C  C   . PRO A 1 9   ? 49.167 93.294  63.185  1.00 13.54  ? 32  PRO A C   1 
ATOM   56   O  O   . PRO A 1 9   ? 49.770 93.691  64.176  1.00 23.43  ? 32  PRO A O   1 
ATOM   57   C  CB  . PRO A 1 9   ? 51.469 92.771  62.204  1.00 18.28  ? 32  PRO A CB  1 
ATOM   58   C  CG  . PRO A 1 9   ? 51.917 93.874  61.291  1.00 26.07  ? 32  PRO A CG  1 
ATOM   59   C  CD  . PRO A 1 9   ? 50.939 93.942  60.161  1.00 18.00  ? 32  PRO A CD  1 
ATOM   60   N  N   . PHE A 1 10  ? 47.842 93.367  63.060  1.00 19.41  ? 33  PHE A N   1 
ATOM   61   C  CA  A PHE A 1 10  ? 46.962 93.852  64.129  0.71 15.95  ? 33  PHE A CA  1 
ATOM   62   C  C   . PHE A 1 10  ? 47.019 92.924  65.312  1.00 12.65  ? 33  PHE A C   1 
ATOM   63   O  O   . PHE A 1 10  ? 46.856 91.725  65.143  1.00 14.82  ? 33  PHE A O   1 
ATOM   64   C  CB  A PHE A 1 10  ? 45.504 93.784  63.683  0.71 15.59  ? 33  PHE A CB  1 
ATOM   65   C  CG  A PHE A 1 10  ? 45.012 94.995  62.968  0.71 15.58  ? 33  PHE A CG  1 
ATOM   66   C  CD1 A PHE A 1 10  ? 45.605 95.407  61.788  0.71 17.10  ? 33  PHE A CD1 1 
ATOM   67   C  CD2 A PHE A 1 10  ? 43.906 95.692  63.447  0.71 15.84  ? 33  PHE A CD2 1 
ATOM   68   C  CE1 A PHE A 1 10  ? 45.129 96.520  61.104  0.71 16.29  ? 33  PHE A CE1 1 
ATOM   69   C  CE2 A PHE A 1 10  ? 43.418 96.800  62.771  0.71 10.83  ? 33  PHE A CE2 1 
ATOM   70   C  CZ  A PHE A 1 10  ? 44.035 97.218  61.597  0.71 13.35  ? 33  PHE A CZ  1 
ATOM   71   N  N   . SER A 1 11  ? 47.191 93.453  66.520  1.00 9.13   ? 34  SER A N   1 
ATOM   72   C  CA  . SER A 1 11  ? 46.965 92.626  67.701  1.00 9.40   ? 34  SER A CA  1 
ATOM   73   C  C   . SER A 1 11  ? 46.021 93.317  68.679  1.00 11.94  ? 34  SER A C   1 
ATOM   74   O  O   . SER A 1 11  ? 45.513 92.700  69.616  1.00 11.57  ? 34  SER A O   1 
ATOM   75   C  CB  . SER A 1 11  ? 48.288 92.268  68.392  1.00 11.66  ? 34  SER A CB  1 
ATOM   76   O  OG  . SER A 1 11  ? 48.880 93.419  68.939  1.00 14.08  ? 34  SER A OG  1 
ATOM   77   N  N   . GLN A 1 12  ? 45.781 94.607  68.464  1.00 12.14  ? 35  GLN A N   1 
ATOM   78   C  CA  . GLN A 1 12  ? 45.056 95.391  69.456  1.00 9.82   ? 35  GLN A CA  1 
ATOM   79   C  C   . GLN A 1 12  ? 43.534 95.240  69.420  1.00 11.58  ? 35  GLN A C   1 
ATOM   80   O  O   . GLN A 1 12  ? 42.837 95.820  70.252  1.00 12.48  ? 35  GLN A O   1 
ATOM   81   C  CB  . GLN A 1 12  ? 45.497 96.852  69.401  1.00 10.61  ? 35  GLN A CB  1 
ATOM   82   C  CG  . GLN A 1 12  ? 46.957 96.990  69.878  1.00 17.93  ? 35  GLN A CG  1 
ATOM   83   C  CD  . GLN A 1 12  ? 47.485 98.401  69.794  1.00 27.59  ? 35  GLN A CD  1 
ATOM   84   O  OE1 . GLN A 1 12  ? 46.894 99.330  70.336  1.00 24.48  ? 35  GLN A OE1 1 
ATOM   85   N  NE2 . GLN A 1 12  ? 48.616 98.568  69.113  1.00 37.82  ? 35  GLN A NE2 1 
ATOM   86   N  N   . GLY A 1 13  ? 43.026 94.425  68.492  1.00 7.91   ? 36  GLY A N   1 
ATOM   87   C  CA  . GLY A 1 13  ? 41.615 94.044  68.505  1.00 9.32   ? 36  GLY A CA  1 
ATOM   88   C  C   . GLY A 1 13  ? 41.311 92.990  69.565  1.00 10.19  ? 36  GLY A C   1 
ATOM   89   O  O   . GLY A 1 13  ? 40.164 92.597  69.769  1.00 9.85   ? 36  GLY A O   1 
ATOM   90   N  N   . GLN A 1 14  ? 42.353 92.513  70.238  1.00 9.06   ? 37  GLN A N   1 
ATOM   91   C  CA  . GLN A 1 14  ? 42.175 91.490  71.259  1.00 12.36  ? 37  GLN A CA  1 
ATOM   92   C  C   . GLN A 1 14  ? 43.318 91.546  72.273  1.00 18.26  ? 37  GLN A C   1 
ATOM   93   O  O   . GLN A 1 14  ? 44.161 92.438  72.198  1.00 13.82  ? 37  GLN A O   1 
ATOM   94   C  CB  . GLN A 1 14  ? 42.010 90.108  70.612  1.00 9.96   ? 37  GLN A CB  1 
ATOM   95   C  CG  . GLN A 1 14  ? 43.086 89.749  69.584  1.00 10.45  ? 37  GLN A CG  1 
ATOM   96   C  CD  . GLN A 1 14  ? 44.311 89.139  70.230  1.00 15.73  ? 37  GLN A CD  1 
ATOM   97   O  OE1 . GLN A 1 14  ? 44.262 88.007  70.715  1.00 17.29  ? 37  GLN A OE1 1 
ATOM   98   N  NE2 . GLN A 1 14  ? 45.412 89.890  70.264  1.00 15.29  ? 37  GLN A NE2 1 
ATOM   99   N  N   . LYS A 1 15  ? 43.363 90.599  73.204  1.00 13.58  ? 38  LYS A N   1 
ATOM   100  C  CA  . LYS A 1 15  ? 44.257 90.755  74.358  1.00 17.73  ? 38  LYS A CA  1 
ATOM   101  C  C   . LYS A 1 15  ? 45.440 89.790  74.406  1.00 25.26  ? 38  LYS A C   1 
ATOM   102  O  O   . LYS A 1 15  ? 46.309 89.932  75.260  1.00 21.88  ? 38  LYS A O   1 
ATOM   103  C  CB  . LYS A 1 15  ? 43.468 90.700  75.679  1.00 18.27  ? 38  LYS A CB  1 
ATOM   104  C  CG  . LYS A 1 15  ? 42.468 91.858  75.886  1.00 20.11  ? 38  LYS A CG  1 
ATOM   105  C  CD  . LYS A 1 15  ? 41.859 91.809  77.305  1.00 20.36  ? 38  LYS A CD  1 
ATOM   106  C  CE  . LYS A 1 15  ? 40.878 92.946  77.551  1.00 28.66  ? 38  LYS A CE  1 
ATOM   107  N  NZ  . LYS A 1 15  ? 39.530 92.672  76.978  1.00 17.82  ? 38  LYS A NZ  1 
ATOM   108  N  N   . ARG A 1 16  ? 45.482 88.820  73.495  1.00 20.89  ? 39  ARG A N   1 
ATOM   109  C  CA  . ARG A 1 16  ? 46.548 87.817  73.506  1.00 19.15  ? 39  ARG A CA  1 
ATOM   110  C  C   . ARG A 1 16  ? 47.721 88.210  72.622  1.00 20.89  ? 39  ARG A C   1 
ATOM   111  O  O   . ARG A 1 16  ? 47.551 88.552  71.453  1.00 19.46  ? 39  ARG A O   1 
ATOM   112  C  CB  . ARG A 1 16  ? 46.011 86.438  73.094  1.00 19.85  ? 39  ARG A CB  1 
ATOM   113  C  CG  . ARG A 1 16  ? 44.794 85.985  73.882  1.00 22.25  ? 39  ARG A CG  1 
ATOM   114  C  CD  . ARG A 1 16  ? 45.108 84.685  74.572  1.00 43.38  ? 39  ARG A CD  1 
ATOM   115  N  NE  . ARG A 1 16  ? 44.327 83.572  74.059  1.00 42.81  ? 39  ARG A NE  1 
ATOM   116  C  CZ  . ARG A 1 16  ? 44.532 82.305  74.401  1.00 45.61  ? 39  ARG A CZ  1 
ATOM   117  N  NH1 . ARG A 1 16  ? 45.519 81.987  75.231  1.00 39.65  ? 39  ARG A NH1 1 
ATOM   118  N  NH2 . ARG A 1 16  ? 43.771 81.350  73.884  1.00 35.10  ? 39  ARG A NH2 1 
ATOM   119  N  N   . LYS A 1 17  ? 48.921 88.152  73.178  1.00 17.74  ? 40  LYS A N   1 
ATOM   120  C  CA  . LYS A 1 17  ? 50.110 88.496  72.412  1.00 19.86  ? 40  LYS A CA  1 
ATOM   121  C  C   . LYS A 1 17  ? 50.423 87.420  71.384  1.00 14.67  ? 40  LYS A C   1 
ATOM   122  O  O   . LYS A 1 17  ? 50.233 86.221  71.645  1.00 15.98  ? 40  LYS A O   1 
ATOM   123  C  CB  . LYS A 1 17  ? 51.308 88.682  73.352  1.00 29.06  ? 40  LYS A CB  1 
ATOM   124  C  CG  . LYS A 1 17  ? 51.050 89.714  74.426  1.00 31.03  ? 40  LYS A CG  1 
ATOM   125  C  CD  . LYS A 1 17  ? 52.205 89.815  75.414  1.00 49.78  ? 40  LYS A CD  1 
ATOM   126  C  CE  . LYS A 1 17  ? 51.791 90.641  76.628  1.00 61.00  ? 40  LYS A CE  1 
ATOM   127  N  NZ  . LYS A 1 17  ? 50.526 90.128  77.236  1.00 59.88  ? 40  LYS A NZ  1 
ATOM   128  N  N   . GLY A 1 18  ? 50.886 87.856  70.215  1.00 13.39  ? 41  GLY A N   1 
ATOM   129  C  CA  . GLY A 1 18  ? 51.477 86.953  69.243  1.00 15.98  ? 41  GLY A CA  1 
ATOM   130  C  C   . GLY A 1 18  ? 50.811 86.942  67.884  1.00 13.12  ? 41  GLY A C   1 
ATOM   131  O  O   . GLY A 1 18  ? 51.439 86.588  66.899  1.00 12.35  ? 41  GLY A O   1 
ATOM   132  N  N   . VAL A 1 19  ? 49.543 87.341  67.829  1.00 12.22  ? 42  VAL A N   1 
ATOM   133  C  CA  . VAL A 1 19  ? 48.809 87.316  66.572  1.00 11.14  ? 42  VAL A CA  1 
ATOM   134  C  C   . VAL A 1 19  ? 49.407 88.308  65.563  1.00 11.83  ? 42  VAL A C   1 
ATOM   135  O  O   . VAL A 1 19  ? 49.217 88.183  64.347  1.00 10.96  ? 42  VAL A O   1 
ATOM   136  C  CB  . VAL A 1 19  ? 47.295 87.533  66.821  1.00 11.43  ? 42  VAL A CB  1 
ATOM   137  C  CG1 . VAL A 1 19  ? 47.011 88.962  67.321  1.00 11.13  ? 42  VAL A CG1 1 
ATOM   138  C  CG2 . VAL A 1 19  ? 46.470 87.176  65.580  1.00 11.21  ? 42  VAL A CG2 1 
ATOM   139  N  N   . GLU A 1 20  ? 50.168 89.285  66.055  1.00 9.96   ? 43  GLU A N   1 
ATOM   140  C  CA  . GLU A 1 20  ? 50.855 90.194  65.139  1.00 15.37  ? 43  GLU A CA  1 
ATOM   141  C  C   . GLU A 1 20  ? 51.926 89.475  64.321  1.00 12.63  ? 43  GLU A C   1 
ATOM   142  O  O   . GLU A 1 20  ? 52.399 90.000  63.313  1.00 13.19  ? 43  GLU A O   1 
ATOM   143  C  CB  . GLU A 1 20  ? 51.442 91.412  65.872  1.00 16.00  ? 43  GLU A CB  1 
ATOM   144  C  CG  . GLU A 1 20  ? 52.626 91.108  66.766  1.00 13.38  ? 43  GLU A CG  1 
ATOM   145  C  CD  . GLU A 1 20  ? 52.203 90.682  68.163  1.00 24.10  ? 43  GLU A CD  1 
ATOM   146  O  OE1 . GLU A 1 20  ? 51.111 90.086  68.322  1.00 17.52  ? 43  GLU A OE1 1 
ATOM   147  O  OE2 . GLU A 1 20  ? 52.950 90.979  69.116  1.00 29.27  ? 43  GLU A OE2 1 
ATOM   148  N  N   . HIS A 1 21  ? 52.304 88.271  64.748  1.00 13.10  ? 44  HIS A N   1 
ATOM   149  C  CA  . HIS A 1 21  ? 53.285 87.481  64.009  1.00 11.77  ? 44  HIS A CA  1 
ATOM   150  C  C   . HIS A 1 21  ? 52.674 86.527  62.985  1.00 14.85  ? 44  HIS A C   1 
ATOM   151  O  O   . HIS A 1 21  ? 53.393 85.788  62.311  1.00 10.67  ? 44  HIS A O   1 
ATOM   152  C  CB  . HIS A 1 21  ? 54.191 86.729  64.982  1.00 16.85  ? 44  HIS A CB  1 
ATOM   153  C  CG  . HIS A 1 21  ? 54.959 87.639  65.880  1.00 18.41  ? 44  HIS A CG  1 
ATOM   154  N  ND1 . HIS A 1 21  ? 55.818 88.601  65.388  1.00 20.91  ? 44  HIS A ND1 1 
ATOM   155  C  CD2 . HIS A 1 21  ? 54.977 87.765  67.227  1.00 20.32  ? 44  HIS A CD2 1 
ATOM   156  C  CE1 . HIS A 1 21  ? 56.348 89.266  66.399  1.00 27.62  ? 44  HIS A CE1 1 
ATOM   157  N  NE2 . HIS A 1 21  ? 55.860 88.777  67.526  1.00 25.01  ? 44  HIS A NE2 1 
ATOM   158  N  N   . GLY A 1 22  ? 51.348 86.552  62.876  1.00 12.86  ? 45  GLY A N   1 
ATOM   159  C  CA  . GLY A 1 22  ? 50.648 85.768  61.873  1.00 12.92  ? 45  GLY A CA  1 
ATOM   160  C  C   . GLY A 1 22  ? 51.123 85.968  60.447  1.00 11.71  ? 45  GLY A C   1 
ATOM   161  O  O   . GLY A 1 22  ? 51.369 84.986  59.737  1.00 13.49  ? 45  GLY A O   1 
ATOM   162  N  N   . PRO A 1 23  ? 51.233 87.232  60.000  1.00 10.34  ? 46  PRO A N   1 
ATOM   163  C  CA  . PRO A 1 23  ? 51.656 87.441  58.612  1.00 12.82  ? 46  PRO A CA  1 
ATOM   164  C  C   . PRO A 1 23  ? 53.016 86.845  58.296  1.00 14.28  ? 46  PRO A C   1 
ATOM   165  O  O   . PRO A 1 23  ? 53.155 86.232  57.239  1.00 13.39  ? 46  PRO A O   1 
ATOM   166  C  CB  . PRO A 1 23  ? 51.701 88.971  58.481  1.00 10.91  ? 46  PRO A CB  1 
ATOM   167  C  CG  . PRO A 1 23  ? 50.673 89.454  59.482  1.00 12.36  ? 46  PRO A CG  1 
ATOM   168  C  CD  . PRO A 1 23  ? 50.817 88.495  60.646  1.00 12.95  ? 46  PRO A CD  1 
ATOM   169  N  N   . ALA A 1 24  ? 54.001 87.016  59.173  1.00 11.05  ? 47  ALA A N   1 
ATOM   170  C  CA  . ALA A 1 24  ? 55.308 86.423  58.915  1.00 15.02  ? 47  ALA A CA  1 
ATOM   171  C  C   . ALA A 1 24  ? 55.196 84.900  58.889  1.00 13.45  ? 47  ALA A C   1 
ATOM   172  O  O   . ALA A 1 24  ? 55.830 84.238  58.057  1.00 14.85  ? 47  ALA A O   1 
ATOM   173  C  CB  . ALA A 1 24  ? 56.336 86.863  59.962  1.00 16.69  ? 47  ALA A CB  1 
ATOM   174  N  N   . ALA A 1 25  ? 54.407 84.342  59.799  1.00 12.36  ? 48  ALA A N   1 
ATOM   175  C  CA  . ALA A 1 25  ? 54.259 82.879  59.849  1.00 13.86  ? 48  ALA A CA  1 
ATOM   176  C  C   . ALA A 1 25  ? 53.687 82.341  58.544  1.00 16.16  ? 48  ALA A C   1 
ATOM   177  O  O   . ALA A 1 25  ? 54.131 81.313  58.027  1.00 12.34  ? 48  ALA A O   1 
ATOM   178  C  CB  . ALA A 1 25  ? 53.386 82.462  61.024  1.00 11.64  ? 48  ALA A CB  1 
ATOM   179  N  N   . ILE A 1 26  ? 52.707 83.049  58.003  1.00 12.63  ? 49  ILE A N   1 
ATOM   180  C  CA  . ILE A 1 26  ? 52.077 82.633  56.761  1.00 11.47  ? 49  ILE A CA  1 
ATOM   181  C  C   . ILE A 1 26  ? 53.016 82.759  55.575  1.00 13.87  ? 49  ILE A C   1 
ATOM   182  O  O   . ILE A 1 26  ? 53.087 81.864  54.723  1.00 11.10  ? 49  ILE A O   1 
ATOM   183  C  CB  . ILE A 1 26  ? 50.744 83.405  56.538  1.00 9.06   ? 49  ILE A CB  1 
ATOM   184  C  CG1 . ILE A 1 26  ? 49.741 82.988  57.626  1.00 10.42  ? 49  ILE A CG1 1 
ATOM   185  C  CG2 . ILE A 1 26  ? 50.186 83.104  55.159  1.00 12.88  ? 49  ILE A CG2 1 
ATOM   186  C  CD1 . ILE A 1 26  ? 48.441 83.840  57.676  1.00 9.93   ? 49  ILE A CD1 1 
ATOM   187  N  N   . ARG A 1 27  ? 53.766 83.853  55.520  1.00 9.63   ? 50  ARG A N   1 
ATOM   188  C  CA  . ARG A 1 27  ? 54.769 83.999  54.469  1.00 12.57  ? 50  ARG A CA  1 
ATOM   189  C  C   . ARG A 1 27  ? 55.821 82.903  54.531  1.00 13.95  ? 50  ARG A C   1 
ATOM   190  O  O   . ARG A 1 27  ? 56.241 82.388  53.500  1.00 15.71  ? 50  ARG A O   1 
ATOM   191  C  CB  . ARG A 1 27  ? 55.484 85.342  54.572  1.00 16.22  ? 50  ARG A CB  1 
ATOM   192  C  CG  . ARG A 1 27  ? 54.661 86.534  54.140  1.00 17.74  ? 50  ARG A CG  1 
ATOM   193  C  CD  . ARG A 1 27  ? 55.476 87.787  54.396  1.00 26.24  ? 50  ARG A CD  1 
ATOM   194  N  NE  . ARG A 1 27  ? 54.677 88.988  54.210  1.00 29.01  ? 50  ARG A NE  1 
ATOM   195  C  CZ  . ARG A 1 27  ? 54.433 89.540  53.029  1.00 32.08  ? 50  ARG A CZ  1 
ATOM   196  N  NH1 . ARG A 1 27  ? 54.931 88.994  51.927  1.00 29.37  ? 50  ARG A NH1 1 
ATOM   197  N  NH2 . ARG A 1 27  ? 53.695 90.641  52.953  1.00 27.26  ? 50  ARG A NH2 1 
ATOM   198  N  N   . GLU A 1 28  ? 56.274 82.586  55.741  1.00 14.17  ? 51  GLU A N   1 
ATOM   199  C  CA  A GLU A 1 28  ? 57.320 81.587  55.944  0.38 16.88  ? 51  GLU A CA  1 
ATOM   200  C  CA  B GLU A 1 28  ? 57.337 81.596  55.892  0.62 16.88  ? 51  GLU A CA  1 
ATOM   201  C  C   . GLU A 1 28  ? 56.835 80.210  55.490  1.00 16.07  ? 51  GLU A C   1 
ATOM   202  O  O   . GLU A 1 28  ? 57.622 79.356  55.077  1.00 19.55  ? 51  GLU A O   1 
ATOM   203  C  CB  A GLU A 1 28  ? 57.744 81.560  57.421  0.38 17.80  ? 51  GLU A CB  1 
ATOM   204  C  CB  B GLU A 1 28  ? 57.903 81.608  57.320  0.62 17.96  ? 51  GLU A CB  1 
ATOM   205  C  CG  A GLU A 1 28  ? 58.578 82.767  57.861  0.38 15.60  ? 51  GLU A CG  1 
ATOM   206  C  CG  B GLU A 1 28  ? 58.988 80.554  57.603  0.62 11.85  ? 51  GLU A CG  1 
ATOM   207  C  CD  A GLU A 1 28  ? 58.745 82.869  59.377  0.38 23.14  ? 51  GLU A CD  1 
ATOM   208  C  CD  B GLU A 1 28  ? 60.243 80.693  56.734  0.62 21.19  ? 51  GLU A CD  1 
ATOM   209  O  OE1 A GLU A 1 28  ? 58.383 81.910  60.094  0.38 23.11  ? 51  GLU A OE1 1 
ATOM   210  O  OE1 B GLU A 1 28  ? 60.924 79.668  56.518  0.62 26.32  ? 51  GLU A OE1 1 
ATOM   211  O  OE2 A GLU A 1 28  ? 59.234 83.917  59.855  0.38 20.53  ? 51  GLU A OE2 1 
ATOM   212  O  OE2 B GLU A 1 28  ? 60.557 81.810  56.274  0.62 22.88  ? 51  GLU A OE2 1 
ATOM   213  N  N   . ALA A 1 29  ? 55.524 80.003  55.563  1.00 14.02  ? 52  ALA A N   1 
ATOM   214  C  CA  . ALA A 1 29  ? 54.931 78.738  55.126  1.00 13.79  ? 52  ALA A CA  1 
ATOM   215  C  C   . ALA A 1 29  ? 54.838 78.645  53.607  1.00 17.44  ? 52  ALA A C   1 
ATOM   216  O  O   . ALA A 1 29  ? 54.270 77.689  53.073  1.00 18.40  ? 52  ALA A O   1 
ATOM   217  C  CB  . ALA A 1 29  ? 53.571 78.524  55.765  1.00 13.57  ? 52  ALA A CB  1 
ATOM   218  N  N   . GLY A 1 30  ? 55.364 79.649  52.909  1.00 13.07  ? 53  GLY A N   1 
ATOM   219  C  CA  . GLY A 1 30  ? 55.505 79.574  51.461  1.00 12.63  ? 53  GLY A CA  1 
ATOM   220  C  C   . GLY A 1 30  ? 54.400 80.193  50.624  1.00 14.74  ? 53  GLY A C   1 
ATOM   221  O  O   . GLY A 1 30  ? 54.225 79.828  49.463  1.00 11.20  ? 53  GLY A O   1 
ATOM   222  N  N   . LEU A 1 31  ? 53.677 81.159  51.182  1.00 10.85  ? 54  LEU A N   1 
ATOM   223  C  CA  . LEU A 1 31  ? 52.547 81.769  50.471  1.00 13.16  ? 54  LEU A CA  1 
ATOM   224  C  C   . LEU A 1 31  ? 52.890 82.316  49.084  1.00 14.05  ? 54  LEU A C   1 
ATOM   225  O  O   . LEU A 1 31  ? 52.185 82.035  48.111  1.00 13.49  ? 54  LEU A O   1 
ATOM   226  C  CB  . LEU A 1 31  ? 51.919 82.894  51.302  1.00 12.01  ? 54  LEU A CB  1 
ATOM   227  C  CG  . LEU A 1 31  ? 50.750 83.595  50.587  1.00 13.92  ? 54  LEU A CG  1 
ATOM   228  C  CD1 . LEU A 1 31  ? 49.569 82.643  50.339  1.00 14.47  ? 54  LEU A CD1 1 
ATOM   229  C  CD2 . LEU A 1 31  ? 50.295 84.805  51.387  1.00 14.77  ? 54  LEU A CD2 1 
ATOM   230  N  N   . MET A 1 32  ? 53.953 83.112  48.989  1.00 14.84  ? 55  MET A N   1 
ATOM   231  C  CA  . MET A 1 32  ? 54.219 83.809  47.732  1.00 11.36  ? 55  MET A CA  1 
ATOM   232  C  C   . MET A 1 32  ? 54.516 82.842  46.591  1.00 13.64  ? 55  MET A C   1 
ATOM   233  O  O   . MET A 1 32  ? 53.962 82.992  45.510  1.00 12.85  ? 55  MET A O   1 
ATOM   234  C  CB  . MET A 1 32  ? 55.324 84.859  47.892  1.00 14.89  ? 55  MET A CB  1 
ATOM   235  C  CG  . MET A 1 32  ? 55.025 85.897  48.962  1.00 18.32  ? 55  MET A CG  1 
ATOM   236  S  SD  . MET A 1 32  ? 53.429 86.713  48.720  1.00 23.26  ? 55  MET A SD  1 
ATOM   237  C  CE  . MET A 1 32  ? 53.909 88.046  47.626  1.00 23.63  ? 55  MET A CE  1 
ATOM   238  N  N   . LYS A 1 33  ? 55.362 81.843  46.807  1.00 13.96  ? 56  LYS A N   1 
ATOM   239  C  CA  . LYS A 1 33  ? 55.605 80.852  45.781  1.00 14.92  ? 56  LYS A CA  1 
ATOM   240  C  C   . LYS A 1 33  ? 54.334 80.083  45.374  1.00 13.19  ? 56  LYS A C   1 
ATOM   241  O  O   . LYS A 1 33  ? 54.147 79.829  44.242  1.00 14.94  ? 56  LYS A O   1 
ATOM   242  C  CB  . LYS A 1 33  ? 56.691 79.874  46.163  1.00 16.58  ? 56  LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 33  ? 57.002 78.843  45.080  1.00 38.91  ? 56  LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 33  ? 57.111 79.350  43.617  1.00 37.68  ? 56  LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 33  ? 58.207 78.644  42.809  1.00 39.53  ? 56  LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 33  ? 58.307 79.074  41.378  1.00 49.94  ? 56  LYS A NZ  1 
ATOM   247  N  N   . ARG A 1 34  ? 53.506 79.718  46.339  1.00 10.12  ? 57  ARG A N   1 
ATOM   248  C  CA  . ARG A 1 34  ? 52.281 78.990  46.026  1.00 13.21  ? 57  ARG A CA  1 
ATOM   249  C  C   . ARG A 1 34  ? 51.390 79.781  45.081  1.00 16.51  ? 57  ARG A C   1 
ATOM   250  O  O   . ARG A 1 34  ? 50.836 79.233  44.123  1.00 12.34  ? 57  ARG A O   1 
ATOM   251  C  CB  . ARG A 1 34  ? 51.521 78.619  47.304  1.00 13.02  ? 57  ARG A CB  1 
ATOM   252  C  CG  . ARG A 1 34  ? 52.209 77.551  48.134  1.00 22.64  ? 57  ARG A CG  1 
ATOM   253  C  CD  . ARG A 1 34  ? 51.948 76.152  47.581  1.00 23.72  ? 57  ARG A CD  1 
ATOM   254  N  NE  . ARG A 1 34  ? 50.565 75.755  47.816  1.00 23.43  ? 57  ARG A NE  1 
ATOM   255  C  CZ  . ARG A 1 34  ? 50.099 75.327  48.989  1.00 17.38  ? 57  ARG A CZ  1 
ATOM   256  N  NH1 . ARG A 1 34  ? 50.913 75.223  50.032  1.00 20.04  ? 57  ARG A NH1 1 
ATOM   257  N  NH2 . ARG A 1 34  ? 48.826 74.986  49.112  1.00 19.88  ? 57  ARG A NH2 1 
ATOM   258  N  N   . LEU A 1 35  ? 51.258 81.077  45.348  1.00 11.00  ? 58  LEU A N   1 
ATOM   259  C  CA  . LEU A 1 35  ? 50.431 81.935  44.504  1.00 11.93  ? 58  LEU A CA  1 
ATOM   260  C  C   . LEU A 1 35  ? 51.058 82.126  43.120  1.00 9.13   ? 58  LEU A C   1 
ATOM   261  O  O   . LEU A 1 35  ? 50.366 82.087  42.109  1.00 14.96  ? 58  LEU A O   1 
ATOM   262  C  CB  . LEU A 1 35  ? 50.187 83.282  45.194  1.00 11.31  ? 58  LEU A CB  1 
ATOM   263  C  CG  . LEU A 1 35  ? 49.307 83.232  46.452  1.00 15.47  ? 58  LEU A CG  1 
ATOM   264  C  CD1 . LEU A 1 35  ? 49.204 84.611  47.102  1.00 16.85  ? 58  LEU A CD1 1 
ATOM   265  C  CD2 . LEU A 1 35  ? 47.923 82.716  46.126  1.00 14.33  ? 58  LEU A CD2 1 
ATOM   266  N  N   . SER A 1 36  ? 52.369 82.326  43.083  1.00 14.07  ? 59  SER A N   1 
ATOM   267  C  CA  A SER A 1 36  ? 53.079 82.466  41.815  0.70 16.06  ? 59  SER A CA  1 
ATOM   268  C  CA  B SER A 1 36  ? 53.093 82.461  41.821  0.30 16.01  ? 59  SER A CA  1 
ATOM   269  C  C   . SER A 1 36  ? 52.872 81.244  40.928  1.00 14.76  ? 59  SER A C   1 
ATOM   270  O  O   . SER A 1 36  ? 52.567 81.367  39.737  1.00 14.96  ? 59  SER A O   1 
ATOM   271  C  CB  A SER A 1 36  ? 54.573 82.689  42.058  0.70 14.69  ? 59  SER A CB  1 
ATOM   272  C  CB  B SER A 1 36  ? 54.588 82.635  42.098  0.30 14.70  ? 59  SER A CB  1 
ATOM   273  O  OG  A SER A 1 36  ? 54.798 83.971  42.605  0.70 11.22  ? 59  SER A OG  1 
ATOM   274  O  OG  B SER A 1 36  ? 55.295 82.961  40.919  0.30 16.06  ? 59  SER A OG  1 
ATOM   275  N  N   . SER A 1 37  ? 53.027 80.061  41.512  1.00 14.90  ? 60  SER A N   1 
ATOM   276  C  CA  A SER A 1 37  ? 52.885 78.834  40.736  0.28 17.06  ? 60  SER A CA  1 
ATOM   277  C  CA  B SER A 1 37  ? 52.860 78.812  40.773  0.72 17.03  ? 60  SER A CA  1 
ATOM   278  C  C   . SER A 1 37  ? 51.473 78.683  40.166  1.00 17.62  ? 60  SER A C   1 
ATOM   279  O  O   . SER A 1 37  ? 51.273 77.966  39.183  1.00 14.66  ? 60  SER A O   1 
ATOM   280  C  CB  A SER A 1 37  ? 53.308 77.601  41.549  0.28 18.52  ? 60  SER A CB  1 
ATOM   281  C  CB  B SER A 1 37  ? 53.148 77.615  41.677  0.72 18.44  ? 60  SER A CB  1 
ATOM   282  O  OG  A SER A 1 37  ? 52.593 77.502  42.762  0.28 19.78  ? 60  SER A OG  1 
ATOM   283  O  OG  B SER A 1 37  ? 54.466 77.693  42.163  0.72 15.54  ? 60  SER A OG  1 
ATOM   284  N  N   . LEU A 1 38  ? 50.504 79.378  40.755  1.00 16.58  ? 61  LEU A N   1 
ATOM   285  C  CA  . LEU A 1 38  ? 49.135 79.336  40.241  1.00 15.99  ? 61  LEU A CA  1 
ATOM   286  C  C   . LEU A 1 38  ? 48.920 80.330  39.109  1.00 26.76  ? 61  LEU A C   1 
ATOM   287  O  O   . LEU A 1 38  ? 47.840 80.393  38.524  1.00 27.00  ? 61  LEU A O   1 
ATOM   288  C  CB  . LEU A 1 38  ? 48.126 79.591  41.362  1.00 15.63  ? 61  LEU A CB  1 
ATOM   289  C  CG  . LEU A 1 38  ? 48.084 78.530  42.464  1.00 15.17  ? 61  LEU A CG  1 
ATOM   290  C  CD1 . LEU A 1 38  ? 47.250 79.019  43.648  1.00 18.07  ? 61  LEU A CD1 1 
ATOM   291  C  CD2 . LEU A 1 38  ? 47.531 77.207  41.922  1.00 17.91  ? 61  LEU A CD2 1 
ATOM   292  N  N   . GLY A 1 39  ? 49.942 81.120  38.811  1.00 17.14  ? 62  GLY A N   1 
ATOM   293  C  CA  . GLY A 1 39  ? 49.849 82.082  37.730  1.00 18.63  ? 62  GLY A CA  1 
ATOM   294  C  C   . GLY A 1 39  ? 49.483 83.475  38.203  1.00 22.12  ? 62  GLY A C   1 
ATOM   295  O  O   . GLY A 1 39  ? 49.223 84.368  37.386  1.00 18.94  ? 62  GLY A O   1 
ATOM   296  N  N   A CYS A 1 40  ? 49.481 83.677  39.519  0.88 12.86  ? 63  CYS A N   1 
ATOM   297  C  CA  A CYS A 1 40  ? 49.207 85.005  40.069  0.88 17.42  ? 63  CYS A CA  1 
ATOM   298  C  C   A CYS A 1 40  ? 50.383 85.948  39.891  0.88 18.43  ? 63  CYS A C   1 
ATOM   299  O  O   A CYS A 1 40  ? 51.488 85.646  40.335  0.88 15.06  ? 63  CYS A O   1 
ATOM   300  C  CB  A CYS A 1 40  ? 48.878 84.927  41.565  0.88 14.14  ? 63  CYS A CB  1 
ATOM   301  S  SG  A CYS A 1 40  ? 47.520 83.822  41.994  0.88 27.74  ? 63  CYS A SG  1 
ATOM   302  N  N   . HIS A 1 41  ? 50.133 87.099  39.271  1.00 16.49  ? 64  HIS A N   1 
ATOM   303  C  CA  . HIS A 1 41  ? 51.097 88.193  39.269  1.00 19.16  ? 64  HIS A CA  1 
ATOM   304  C  C   . HIS A 1 41  ? 50.979 88.886  40.620  1.00 18.91  ? 64  HIS A C   1 
ATOM   305  O  O   . HIS A 1 41  ? 49.884 89.280  41.012  1.00 19.01  ? 64  HIS A O   1 
ATOM   306  C  CB  . HIS A 1 41  ? 50.795 89.194  38.149  1.00 23.85  ? 64  HIS A CB  1 
ATOM   307  C  CG  . HIS A 1 41  ? 50.978 88.639  36.771  1.00 33.81  ? 64  HIS A CG  1 
ATOM   308  N  ND1 . HIS A 1 41  ? 50.247 87.570  36.292  1.00 43.34  ? 64  HIS A ND1 1 
ATOM   309  C  CD2 . HIS A 1 41  ? 51.819 88.996  35.771  1.00 34.43  ? 64  HIS A CD2 1 
ATOM   310  C  CE1 . HIS A 1 41  ? 50.624 87.303  35.053  1.00 44.15  ? 64  HIS A CE1 1 
ATOM   311  N  NE2 . HIS A 1 41  ? 51.577 88.152  34.714  1.00 41.46  ? 64  HIS A NE2 1 
ATOM   312  N  N   . LEU A 1 42  ? 52.096 89.036  41.327  1.00 18.05  ? 65  LEU A N   1 
ATOM   313  C  CA  . LEU A 1 42  ? 52.073 89.447  42.728  1.00 18.78  ? 65  LEU A CA  1 
ATOM   314  C  C   . LEU A 1 42  ? 52.601 90.849  42.971  1.00 22.50  ? 65  LEU A C   1 
ATOM   315  O  O   . LEU A 1 42  ? 53.640 91.234  42.446  1.00 21.25  ? 65  LEU A O   1 
ATOM   316  C  CB  . LEU A 1 42  ? 52.910 88.490  43.580  1.00 18.47  ? 65  LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 42  ? 52.504 87.026  43.642  1.00 15.78  ? 65  LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 42  ? 53.558 86.248  44.409  1.00 16.58  ? 65  LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 42  ? 51.154 86.951  44.342  1.00 19.89  ? 65  LEU A CD2 1 
ATOM   320  N  N   . LYS A 1 43  ? 51.888 91.597  43.803  1.00 17.54  ? 66  LYS A N   1 
ATOM   321  C  CA  . LYS A 1 43  ? 52.425 92.821  44.375  1.00 18.94  ? 66  LYS A CA  1 
ATOM   322  C  C   . LYS A 1 43  ? 52.460 92.624  45.887  1.00 23.11  ? 66  LYS A C   1 
ATOM   323  O  O   . LYS A 1 43  ? 51.424 92.458  46.519  1.00 17.53  ? 66  LYS A O   1 
ATOM   324  C  CB  . LYS A 1 43  ? 51.559 94.023  44.000  1.00 21.53  ? 66  LYS A CB  1 
ATOM   325  C  CG  . LYS A 1 43  ? 52.120 95.365  44.460  1.00 30.62  ? 66  LYS A CG  1 
ATOM   326  C  CD  . LYS A 1 43  ? 51.276 96.530  43.936  1.00 29.87  ? 66  LYS A CD  1 
ATOM   327  C  CE  . LYS A 1 43  ? 52.004 97.865  44.109  1.00 45.64  ? 66  LYS A CE  1 
ATOM   328  N  NZ  . LYS A 1 43  ? 52.592 98.009  45.470  1.00 50.49  ? 66  LYS A NZ  1 
ATOM   329  N  N   . ASP A 1 44  ? 53.652 92.601  46.467  1.00 13.43  ? 67  ASP A N   1 
ATOM   330  C  CA  . ASP A 1 44  ? 53.768 92.421  47.904  1.00 21.82  ? 67  ASP A CA  1 
ATOM   331  C  C   . ASP A 1 44  ? 53.911 93.785  48.555  1.00 29.59  ? 67  ASP A C   1 
ATOM   332  O  O   . ASP A 1 44  ? 54.889 94.489  48.308  1.00 24.17  ? 67  ASP A O   1 
ATOM   333  C  CB  . ASP A 1 44  ? 54.989 91.564  48.233  1.00 27.30  ? 67  ASP A CB  1 
ATOM   334  C  CG  . ASP A 1 44  ? 55.048 91.156  49.689  1.00 27.80  ? 67  ASP A CG  1 
ATOM   335  O  OD1 . ASP A 1 44  ? 54.214 91.623  50.501  1.00 24.46  ? 67  ASP A OD1 1 
ATOM   336  O  OD2 . ASP A 1 44  ? 55.959 90.376  50.025  1.00 32.16  ? 67  ASP A OD2 1 
ATOM   337  N  N   . PHE A 1 45  ? 52.940 94.163  49.380  1.00 24.22  ? 68  PHE A N   1 
ATOM   338  C  CA  . PHE A 1 45  ? 53.041 95.431  50.102  1.00 29.00  ? 68  PHE A CA  1 
ATOM   339  C  C   . PHE A 1 45  ? 53.870 95.280  51.377  1.00 30.11  ? 68  PHE A C   1 
ATOM   340  O  O   . PHE A 1 45  ? 54.086 96.251  52.099  1.00 33.58  ? 68  PHE A O   1 
ATOM   341  C  CB  . PHE A 1 45  ? 51.657 95.983  50.439  1.00 16.23  ? 68  PHE A CB  1 
ATOM   342  C  CG  . PHE A 1 45  ? 50.948 96.589  49.268  1.00 27.98  ? 68  PHE A CG  1 
ATOM   343  C  CD1 . PHE A 1 45  ? 50.319 95.788  48.320  1.00 26.09  ? 68  PHE A CD1 1 
ATOM   344  C  CD2 . PHE A 1 45  ? 50.929 97.964  49.099  1.00 28.61  ? 68  PHE A CD2 1 
ATOM   345  C  CE1 . PHE A 1 45  ? 49.675 96.352  47.230  1.00 26.75  ? 68  PHE A CE1 1 
ATOM   346  C  CE2 . PHE A 1 45  ? 50.294 98.532  48.019  1.00 21.81  ? 68  PHE A CE2 1 
ATOM   347  C  CZ  . PHE A 1 45  ? 49.659 97.734  47.083  1.00 27.35  ? 68  PHE A CZ  1 
ATOM   348  N  N   . GLY A 1 46  ? 54.325 94.060  51.660  1.00 26.17  ? 69  GLY A N   1 
ATOM   349  C  CA  . GLY A 1 46  ? 55.041 93.781  52.895  1.00 22.94  ? 69  GLY A CA  1 
ATOM   350  C  C   . GLY A 1 46  ? 54.139 93.874  54.114  1.00 23.40  ? 69  GLY A C   1 
ATOM   351  O  O   . GLY A 1 46  ? 52.910 93.836  53.985  1.00 17.67  ? 69  GLY A O   1 
ATOM   352  N  N   . ASP A 1 47  ? 54.741 93.987  55.298  1.00 19.67  ? 70  ASP A N   1 
ATOM   353  C  CA  . ASP A 1 47  ? 53.981 94.167  56.536  1.00 21.60  ? 70  ASP A CA  1 
ATOM   354  C  C   . ASP A 1 47  ? 53.861 95.633  56.881  1.00 21.82  ? 70  ASP A C   1 
ATOM   355  O  O   . ASP A 1 47  ? 54.870 96.316  57.024  1.00 17.62  ? 70  ASP A O   1 
ATOM   356  C  CB  . ASP A 1 47  ? 54.648 93.456  57.705  1.00 20.08  ? 70  ASP A CB  1 
ATOM   357  C  CG  . ASP A 1 47  ? 54.454 91.968  57.663  1.00 42.54  ? 70  ASP A CG  1 
ATOM   358  O  OD1 . ASP A 1 47  ? 54.073 91.461  56.584  1.00 29.64  ? 70  ASP A OD1 1 
ATOM   359  O  OD2 . ASP A 1 47  ? 54.673 91.322  58.716  1.00 42.04  ? 70  ASP A OD2 1 
ATOM   360  N  N   . LEU A 1 48  ? 52.631 96.111  57.020  1.00 14.61  ? 71  LEU A N   1 
ATOM   361  C  CA  . LEU A 1 48  ? 52.401 97.515  57.346  1.00 18.37  ? 71  LEU A CA  1 
ATOM   362  C  C   . LEU A 1 48  ? 52.792 97.834  58.783  1.00 17.24  ? 71  LEU A C   1 
ATOM   363  O  O   . LEU A 1 48  ? 52.711 96.979  59.666  1.00 17.40  ? 71  LEU A O   1 
ATOM   364  C  CB  . LEU A 1 48  ? 50.935 97.894  57.100  1.00 13.15  ? 71  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 48  ? 50.403 97.588  55.699  1.00 11.93  ? 71  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 48  ? 48.972 98.102  55.543  1.00 14.77  ? 71  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 48  ? 51.298 98.194  54.630  1.00 16.82  ? 71  LEU A CD2 1 
ATOM   368  N  N   . SER A 1 49  ? 53.240 99.069  58.996  1.00 18.22  ? 72  SER A N   1 
ATOM   369  C  CA  . SER A 1 49  ? 53.471 99.613  60.329  1.00 23.99  ? 72  SER A CA  1 
ATOM   370  C  C   . SER A 1 49  ? 52.400 100.661 60.570  1.00 17.43  ? 72  SER A C   1 
ATOM   371  O  O   . SER A 1 49  ? 52.313 101.643 59.836  1.00 21.51  ? 72  SER A O   1 
ATOM   372  C  CB  . SER A 1 49  ? 54.852 100.265 60.412  1.00 21.17  ? 72  SER A CB  1 
ATOM   373  O  OG  . SER A 1 49  ? 55.866 99.290  60.259  1.00 32.90  ? 72  SER A OG  1 
ATOM   374  N  N   . PHE A 1 50  ? 51.568 100.442 61.578  1.00 15.76  ? 73  PHE A N   1 
ATOM   375  C  CA  . PHE A 1 50  ? 50.455 101.348 61.841  1.00 18.41  ? 73  PHE A CA  1 
ATOM   376  C  C   . PHE A 1 50  ? 50.814 102.463 62.812  1.00 22.52  ? 73  PHE A C   1 
ATOM   377  O  O   . PHE A 1 50  ? 51.596 102.262 63.736  1.00 17.51  ? 73  PHE A O   1 
ATOM   378  C  CB  . PHE A 1 50  ? 49.235 100.560 62.317  1.00 14.30  ? 73  PHE A CB  1 
ATOM   379  C  CG  . PHE A 1 50  ? 48.771 99.537  61.318  1.00 15.95  ? 73  PHE A CG  1 
ATOM   380  C  CD1 . PHE A 1 50  ? 48.173 99.947  60.136  1.00 17.61  ? 73  PHE A CD1 1 
ATOM   381  C  CD2 . PHE A 1 50  ? 48.959 98.175  61.545  1.00 18.41  ? 73  PHE A CD2 1 
ATOM   382  C  CE1 . PHE A 1 50  ? 47.754 99.012  59.180  1.00 17.89  ? 73  PHE A CE1 1 
ATOM   383  C  CE2 . PHE A 1 50  ? 48.537 97.233  60.603  1.00 15.05  ? 73  PHE A CE2 1 
ATOM   384  C  CZ  . PHE A 1 50  ? 47.935 97.656  59.422  1.00 18.30  ? 73  PHE A CZ  1 
ATOM   385  N  N   . THR A 1 51  ? 50.226 103.635 62.605  1.00 19.27  ? 74  THR A N   1 
ATOM   386  C  CA  . THR A 1 51  ? 50.523 104.782 63.456  1.00 20.66  ? 74  THR A CA  1 
ATOM   387  C  C   . THR A 1 51  ? 49.935 104.582 64.852  1.00 16.67  ? 74  THR A C   1 
ATOM   388  O  O   . THR A 1 51  ? 48.734 104.352 64.992  1.00 16.85  ? 74  THR A O   1 
ATOM   389  C  CB  . THR A 1 51  ? 49.954 106.073 62.862  1.00 21.21  ? 74  THR A CB  1 
ATOM   390  O  OG1 . THR A 1 51  ? 50.341 106.183 61.485  1.00 19.80  ? 74  THR A OG1 1 
ATOM   391  C  CG2 . THR A 1 51  ? 50.445 107.291 63.646  1.00 19.36  ? 74  THR A CG2 1 
ATOM   392  N  N   . PRO A 1 52  ? 50.785 104.660 65.893  1.00 24.14  ? 75  PRO A N   1 
ATOM   393  C  CA  . PRO A 1 52  ? 50.276 104.540 67.266  1.00 21.50  ? 75  PRO A CA  1 
ATOM   394  C  C   . PRO A 1 52  ? 49.463 105.770 67.671  1.00 18.04  ? 75  PRO A C   1 
ATOM   395  O  O   . PRO A 1 52  ? 49.579 106.839 67.055  1.00 17.32  ? 75  PRO A O   1 
ATOM   396  C  CB  . PRO A 1 52  ? 51.554 104.433 68.115  1.00 19.96  ? 75  PRO A CB  1 
ATOM   397  C  CG  . PRO A 1 52  ? 52.610 105.107 67.308  1.00 24.96  ? 75  PRO A CG  1 
ATOM   398  C  CD  . PRO A 1 52  ? 52.243 104.877 65.850  1.00 25.64  ? 75  PRO A CD  1 
ATOM   399  N  N   . VAL A 1 53  ? 48.626 105.604 68.688  1.00 15.72  ? 76  VAL A N   1 
ATOM   400  C  CA  . VAL A 1 53  ? 47.804 106.691 69.208  1.00 15.73  ? 76  VAL A CA  1 
ATOM   401  C  C   . VAL A 1 53  ? 48.128 106.866 70.679  1.00 17.51  ? 76  VAL A C   1 
ATOM   402  O  O   . VAL A 1 53  ? 47.984 105.932 71.462  1.00 18.55  ? 76  VAL A O   1 
ATOM   403  C  CB  . VAL A 1 53  ? 46.311 106.370 69.062  1.00 18.35  ? 76  VAL A CB  1 
ATOM   404  C  CG1 . VAL A 1 53  ? 45.459 107.485 69.675  1.00 21.46  ? 76  VAL A CG1 1 
ATOM   405  C  CG2 . VAL A 1 53  ? 45.969 106.168 67.593  1.00 14.96  ? 76  VAL A CG2 1 
ATOM   406  N  N   . PRO A 1 54  ? 48.597 108.061 71.060  1.00 16.38  ? 77  PRO A N   1 
ATOM   407  C  CA  . PRO A 1 54  ? 48.909 108.255 72.479  1.00 22.16  ? 77  PRO A CA  1 
ATOM   408  C  C   . PRO A 1 54  ? 47.637 108.232 73.320  1.00 19.37  ? 77  PRO A C   1 
ATOM   409  O  O   . PRO A 1 54  ? 46.592 108.673 72.850  1.00 30.77  ? 77  PRO A O   1 
ATOM   410  C  CB  . PRO A 1 54  ? 49.534 109.656 72.519  1.00 20.24  ? 77  PRO A CB  1 
ATOM   411  C  CG  . PRO A 1 54  ? 49.849 110.015 71.104  1.00 28.14  ? 77  PRO A CG  1 
ATOM   412  C  CD  . PRO A 1 54  ? 48.863 109.264 70.253  1.00 18.24  ? 77  PRO A CD  1 
ATOM   413  N  N   . LYS A 1 55  ? 47.726 107.677 74.522  1.00 18.45  ? 78  LYS A N   1 
ATOM   414  C  CA  . LYS A 1 55  ? 46.650 107.741 75.512  1.00 24.86  ? 78  LYS A CA  1 
ATOM   415  C  C   . LYS A 1 55  ? 45.343 107.173 74.968  1.00 32.90  ? 78  LYS A C   1 
ATOM   416  O  O   . LYS A 1 55  ? 44.282 107.808 75.057  1.00 24.29  ? 78  LYS A O   1 
ATOM   417  C  CB  . LYS A 1 55  ? 46.445 109.185 75.995  1.00 25.32  ? 78  LYS A CB  1 
ATOM   418  C  CG  . LYS A 1 55  ? 45.848 109.285 77.412  1.00 32.10  ? 78  LYS A CG  1 
ATOM   419  C  CD  . LYS A 1 55  ? 46.944 109.083 78.450  1.00 33.66  ? 78  LYS A CD  1 
ATOM   420  C  CE  . LYS A 1 55  ? 46.497 109.436 79.863  1.00 35.88  ? 78  LYS A CE  1 
ATOM   421  N  NZ  . LYS A 1 55  ? 45.516 108.446 80.404  1.00 54.12  ? 78  LYS A NZ  1 
ATOM   422  N  N   . ASP A 1 56  ? 45.421 105.969 74.410  1.00 24.88  ? 79  ASP A N   1 
ATOM   423  C  CA  . ASP A 1 56  ? 44.242 105.315 73.849  1.00 20.72  ? 79  ASP A CA  1 
ATOM   424  C  C   . ASP A 1 56  ? 43.500 104.580 74.949  1.00 25.98  ? 79  ASP A C   1 
ATOM   425  O  O   . ASP A 1 56  ? 43.389 103.352 74.926  1.00 20.01  ? 79  ASP A O   1 
ATOM   426  C  CB  . ASP A 1 56  ? 44.661 104.345 72.743  1.00 21.42  ? 79  ASP A CB  1 
ATOM   427  C  CG  . ASP A 1 56  ? 43.473 103.750 71.996  1.00 18.02  ? 79  ASP A CG  1 
ATOM   428  O  OD1 . ASP A 1 56  ? 42.314 104.185 72.218  1.00 13.51  ? 79  ASP A OD1 1 
ATOM   429  O  OD2 . ASP A 1 56  ? 43.727 102.876 71.147  1.00 14.95  ? 79  ASP A OD2 1 
ATOM   430  N  N   . ASP A 1 57  ? 42.956 105.356 75.884  1.00 30.79  ? 80  ASP A N   1 
ATOM   431  C  CA  . ASP A 1 57  ? 42.209 104.827 77.018  1.00 31.15  ? 80  ASP A CA  1 
ATOM   432  C  C   . ASP A 1 57  ? 41.076 103.925 76.552  1.00 25.85  ? 80  ASP A C   1 
ATOM   433  O  O   . ASP A 1 57  ? 40.650 104.019 75.410  1.00 27.37  ? 80  ASP A O   1 
ATOM   434  C  CB  . ASP A 1 57  ? 41.601 105.977 77.830  1.00 38.88  ? 80  ASP A CB  1 
ATOM   435  C  CG  . ASP A 1 57  ? 42.649 106.875 78.458  1.00 47.33  ? 80  ASP A CG  1 
ATOM   436  O  OD1 . ASP A 1 57  ? 43.753 106.376 78.784  1.00 41.02  ? 80  ASP A OD1 1 
ATOM   437  O  OD2 . ASP A 1 57  ? 42.361 108.081 78.626  1.00 47.63  ? 80  ASP A OD2 1 
ATOM   438  N  N   . LEU A 1 58  ? 40.587 103.050 77.404  1.00 24.47  ? 81  LEU A N   1 
ATOM   439  C  CA  . LEU A 1 58  ? 39.430 102.278 77.073  1.00 20.98  ? 81  LEU A CA  1 
ATOM   440  C  C   . LEU A 1 58  ? 38.337 103.232 76.619  1.00 23.65  ? 81  LEU A C   1 
ATOM   441  O  O   . LEU A 1 58  ? 38.323 104.356 76.978  1.00 32.01  ? 81  LEU A O   1 
ATOM   442  C  CB  . LEU A 1 58  ? 38.913 101.506 78.309  1.00 25.95  ? 81  LEU A CB  1 
ATOM   443  C  CG  . LEU A 1 58  ? 39.595 100.253 78.883  1.00 35.67  ? 81  LEU A CG  1 
ATOM   444  C  CD1 . LEU A 1 58  ? 38.725 99.456  79.847  1.00 17.93  ? 81  LEU A CD1 1 
ATOM   445  C  CD2 . LEU A 1 58  ? 40.076 99.371  77.756  1.00 29.41  ? 81  LEU A CD2 1 
ATOM   446  N  N   . TYR A 1 59  ? 37.403 102.753 75.874  1.00 15.83  ? 82  TYR A N   1 
ATOM   447  C  CA  . TYR A 1 59  ? 36.169 103.475 75.650  1.00 19.66  ? 82  TYR A CA  1 
ATOM   448  C  C   . TYR A 1 59  ? 35.132 102.885 76.584  1.00 18.41  ? 82  TYR A C   1 
ATOM   449  O  O   . TYR A 1 59  ? 34.979 101.662 76.651  1.00 15.26  ? 82  TYR A O   1 
ATOM   450  C  CB  . TYR A 1 59  ? 35.734 103.364 74.191  1.00 16.77  ? 82  TYR A CB  1 
ATOM   451  C  CG  . TYR A 1 59  ? 34.325 103.842 73.947  1.00 18.21  ? 82  TYR A CG  1 
ATOM   452  C  CD1 . TYR A 1 59  ? 34.052 105.191 73.768  1.00 19.60  ? 82  TYR A CD1 1 
ATOM   453  C  CD2 . TYR A 1 59  ? 33.272 102.939 73.883  1.00 18.36  ? 82  TYR A CD2 1 
ATOM   454  C  CE1 . TYR A 1 59  ? 32.757 105.630 73.532  1.00 20.28  ? 82  TYR A CE1 1 
ATOM   455  C  CE2 . TYR A 1 59  ? 31.977 103.362 73.652  1.00 24.11  ? 82  TYR A CE2 1 
ATOM   456  C  CZ  . TYR A 1 59  ? 31.725 104.706 73.476  1.00 23.87  ? 82  TYR A CZ  1 
ATOM   457  O  OH  . TYR A 1 59  ? 30.427 105.117 73.246  1.00 24.73  ? 82  TYR A OH  1 
ATOM   458  N  N   . ASN A 1 60  ? 34.431 103.738 77.304  1.00 14.73  ? 83  ASN A N   1 
ATOM   459  C  CA  . ASN A 1 60  ? 33.388 103.283 78.168  1.00 14.16  ? 83  ASN A CA  1 
ATOM   460  C  C   . ASN A 1 60  ? 33.820 102.256 79.252  1.00 12.42  ? 83  ASN A C   1 
ATOM   461  O  O   . ASN A 1 60  ? 33.069 101.400 79.617  1.00 12.73  ? 83  ASN A O   1 
ATOM   462  C  CB  . ASN A 1 60  ? 32.250 102.739 77.341  1.00 15.09  ? 83  ASN A CB  1 
ATOM   463  C  CG  . ASN A 1 60  ? 30.899 102.949 77.973  1.00 26.25  ? 83  ASN A CG  1 
ATOM   464  O  OD1 . ASN A 1 60  ? 30.761 103.588 78.990  1.00 26.68  ? 83  ASN A OD1 1 
ATOM   465  N  ND2 . ASN A 1 60  ? 29.881 102.436 77.327  1.00 24.57  ? 83  ASN A ND2 1 
ATOM   466  N  N   . ASN A 1 61  ? 35.043 102.407 79.729  1.00 10.22  ? 84  ASN A N   1 
ATOM   467  C  CA  . ASN A 1 61  ? 35.617 101.459 80.689  1.00 13.43  ? 84  ASN A CA  1 
ATOM   468  C  C   . ASN A 1 61  ? 35.637 100.006 80.234  1.00 11.17  ? 84  ASN A C   1 
ATOM   469  O  O   . ASN A 1 61  ? 35.889 99.109  81.033  1.00 12.01  ? 84  ASN A O   1 
ATOM   470  C  CB  . ASN A 1 61  ? 35.055 101.672 82.097  1.00 12.85  ? 84  ASN A CB  1 
ATOM   471  C  CG  . ASN A 1 61  ? 35.626 102.911 82.763  1.00 16.33  ? 84  ASN A CG  1 
ATOM   472  O  OD1 . ASN A 1 61  ? 36.836 103.105 82.794  1.00 24.81  ? 84  ASN A OD1 1 
ATOM   473  N  ND2 . ASN A 1 61  ? 34.753 103.761 83.280  1.00 20.15  ? 84  ASN A ND2 1 
ATOM   474  N  N   . LEU A 1 62  ? 35.376 99.777  78.946  1.00 10.42  ? 85  LEU A N   1 
ATOM   475  C  CA  . LEU A 1 62  ? 35.322 98.410  78.432  1.00 14.22  ? 85  LEU A CA  1 
ATOM   476  C  C   . LEU A 1 62  ? 36.029 98.121  77.103  1.00 15.76  ? 85  LEU A C   1 
ATOM   477  O  O   . LEU A 1 62  ? 36.748 97.125  76.999  1.00 10.49  ? 85  LEU A O   1 
ATOM   478  C  CB  . LEU A 1 62  ? 33.831 98.091  78.312  1.00 9.83   ? 85  LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 62  ? 33.502 96.692  77.773  1.00 14.06  ? 85  LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 62  ? 34.063 95.594  78.690  1.00 12.23  ? 85  LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 62  ? 31.989 96.522  77.585  1.00 11.05  ? 85  LEU A CD2 1 
ATOM   482  N  N   . ILE A 1 63  ? 35.824 98.975  76.101  1.00 10.46  ? 86  ILE A N   1 
ATOM   483  C  CA  . ILE A 1 63  ? 36.344 98.704  74.756  1.00 12.59  ? 86  ILE A CA  1 
ATOM   484  C  C   . ILE A 1 63  ? 37.805 99.074  74.684  1.00 11.79  ? 86  ILE A C   1 
ATOM   485  O  O   . ILE A 1 63  ? 38.177 100.229 74.919  1.00 11.89  ? 86  ILE A O   1 
ATOM   486  C  CB  . ILE A 1 63  ? 35.620 99.511  73.673  1.00 14.69  ? 86  ILE A CB  1 
ATOM   487  C  CG1 . ILE A 1 63  ? 34.105 99.401  73.834  1.00 21.78  ? 86  ILE A CG1 1 
ATOM   488  C  CG2 . ILE A 1 63  ? 36.091 99.051  72.282  1.00 14.38  ? 86  ILE A CG2 1 
ATOM   489  C  CD1 . ILE A 1 63  ? 33.573 98.041  73.604  1.00 17.93  ? 86  ILE A CD1 1 
ATOM   490  N  N   . VAL A 1 64  ? 38.667 98.103  74.408  1.00 12.14  ? 87  VAL A N   1 
ATOM   491  C  CA  . VAL A 1 64  ? 40.078 98.413  74.460  1.00 13.37  ? 87  VAL A CA  1 
ATOM   492  C  C   . VAL A 1 64  ? 40.527 98.980  73.126  1.00 12.97  ? 87  VAL A C   1 
ATOM   493  O  O   . VAL A 1 64  ? 39.872 98.824  72.090  1.00 13.48  ? 87  VAL A O   1 
ATOM   494  C  CB  . VAL A 1 64  ? 40.948 97.188  74.873  1.00 29.01  ? 87  VAL A CB  1 
ATOM   495  C  CG1 . VAL A 1 64  ? 40.875 96.125  73.783  1.00 35.73  ? 87  VAL A CG1 1 
ATOM   496  C  CG2 . VAL A 1 64  ? 42.388 97.617  75.210  1.00 33.49  ? 87  VAL A CG2 1 
ATOM   497  N  N   . ASN A 1 65  ? 41.646 99.673  73.196  1.00 8.56   ? 88  ASN A N   1 
ATOM   498  C  CA  . ASN A 1 65  ? 42.358 100.214 72.043  1.00 10.51  ? 88  ASN A CA  1 
ATOM   499  C  C   . ASN A 1 65  ? 41.482 100.745 70.898  1.00 13.13  ? 88  ASN A C   1 
ATOM   500  O  O   . ASN A 1 65  ? 41.797 100.493 69.739  1.00 11.02  ? 88  ASN A O   1 
ATOM   501  C  CB  . ASN A 1 65  ? 43.343 99.182  71.460  1.00 8.73   ? 88  ASN A CB  1 
ATOM   502  C  CG  . ASN A 1 65  ? 44.234 98.536  72.514  1.00 19.10  ? 88  ASN A CG  1 
ATOM   503  O  OD1 . ASN A 1 65  ? 44.349 97.309  72.585  1.00 22.87  ? 88  ASN A OD1 1 
ATOM   504  N  ND2 . ASN A 1 65  ? 44.862 99.349  73.330  1.00 16.22  ? 88  ASN A ND2 1 
ATOM   505  N  N   . PRO A 1 66  ? 40.398 101.491 71.200  1.00 13.39  ? 89  PRO A N   1 
ATOM   506  C  CA  . PRO A 1 66  ? 39.569 101.874 70.046  1.00 11.65  ? 89  PRO A CA  1 
ATOM   507  C  C   . PRO A 1 66  ? 40.263 102.825 69.081  1.00 11.38  ? 89  PRO A C   1 
ATOM   508  O  O   . PRO A 1 66  ? 40.133 102.630 67.875  1.00 13.32  ? 89  PRO A O   1 
ATOM   509  C  CB  . PRO A 1 66  ? 38.358 102.563 70.687  1.00 13.27  ? 89  PRO A CB  1 
ATOM   510  C  CG  . PRO A 1 66  ? 38.879 103.084 72.011  1.00 16.62  ? 89  PRO A CG  1 
ATOM   511  C  CD  . PRO A 1 66  ? 39.868 102.031 72.466  1.00 14.30  ? 89  PRO A CD  1 
ATOM   512  N  N   . ARG A 1 67  ? 41.001 103.816 69.577  1.00 9.32   ? 90  ARG A N   1 
ATOM   513  C  CA  . ARG A 1 67  ? 41.651 104.753 68.667  1.00 12.66  ? 90  ARG A CA  1 
ATOM   514  C  C   . ARG A 1 67  ? 42.739 104.064 67.852  1.00 14.02  ? 90  ARG A C   1 
ATOM   515  O  O   . ARG A 1 67  ? 42.918 104.359 66.667  1.00 11.15  ? 90  ARG A O   1 
ATOM   516  C  CB  . ARG A 1 67  ? 42.204 105.967 69.433  1.00 11.52  ? 90  ARG A CB  1 
ATOM   517  C  CG  . ARG A 1 67  ? 41.122 106.708 70.236  1.00 11.77  ? 90  ARG A CG  1 
ATOM   518  C  CD  . ARG A 1 67  ? 41.742 107.623 71.308  1.00 13.67  ? 90  ARG A CD  1 
ATOM   519  N  NE  . ARG A 1 67  ? 40.746 108.128 72.251  1.00 17.73  ? 90  ARG A NE  1 
ATOM   520  C  CZ  . ARG A 1 67  ? 40.266 107.431 73.277  1.00 20.07  ? 90  ARG A CZ  1 
ATOM   521  N  NH1 . ARG A 1 67  ? 40.673 106.182 73.488  1.00 14.40  ? 90  ARG A NH1 1 
ATOM   522  N  NH2 . ARG A 1 67  ? 39.363 107.973 74.088  1.00 17.52  ? 90  ARG A NH2 1 
ATOM   523  N  N   . SER A 1 68  ? 43.466 103.142 68.480  1.00 7.62   ? 91  SER A N   1 
ATOM   524  C  CA  . SER A 1 68  ? 44.542 102.439 67.787  1.00 9.90   ? 91  SER A CA  1 
ATOM   525  C  C   . SER A 1 68  ? 43.980 101.527 66.698  1.00 13.79  ? 91  SER A C   1 
ATOM   526  O  O   . SER A 1 68  ? 44.505 101.478 65.573  1.00 10.24  ? 91  SER A O   1 
ATOM   527  C  CB  . SER A 1 68  ? 45.368 101.610 68.774  1.00 11.53  ? 91  SER A CB  1 
ATOM   528  O  OG  . SER A 1 68  ? 45.898 102.445 69.789  1.00 16.38  ? 91  SER A OG  1 
ATOM   529  N  N   . VAL A 1 69  ? 42.936 100.782 67.046  1.00 9.77   ? 92  VAL A N   1 
ATOM   530  C  CA  . VAL A 1 69  ? 42.284 99.909  66.075  1.00 10.69  ? 92  VAL A CA  1 
ATOM   531  C  C   . VAL A 1 69  ? 41.609 100.730 64.977  1.00 12.45  ? 92  VAL A C   1 
ATOM   532  O  O   . VAL A 1 69  ? 41.660 100.370 63.802  1.00 8.27   ? 92  VAL A O   1 
ATOM   533  C  CB  . VAL A 1 69  ? 41.259 98.984  66.755  1.00 12.67  ? 92  VAL A CB  1 
ATOM   534  C  CG1 . VAL A 1 69  ? 40.389 98.284  65.703  1.00 10.55  ? 92  VAL A CG1 1 
ATOM   535  C  CG2 . VAL A 1 69  ? 41.980 97.971  67.653  1.00 9.10   ? 92  VAL A CG2 1 
ATOM   536  N  N   . GLY A 1 70  ? 40.994 101.842 65.355  1.00 11.42  ? 93  GLY A N   1 
ATOM   537  C  CA  . GLY A 1 70  ? 40.346 102.700 64.376  1.00 9.68   ? 93  GLY A CA  1 
ATOM   538  C  C   . GLY A 1 70  ? 41.326 103.268 63.371  1.00 12.74  ? 93  GLY A C   1 
ATOM   539  O  O   . GLY A 1 70  ? 41.069 103.252 62.155  1.00 11.43  ? 93  GLY A O   1 
ATOM   540  N  N   . LEU A 1 71  ? 42.448 103.791 63.865  1.00 12.44  ? 94  LEU A N   1 
ATOM   541  C  CA  . LEU A 1 71  ? 43.427 104.423 62.982  1.00 11.83  ? 94  LEU A CA  1 
ATOM   542  C  C   . LEU A 1 71  ? 44.146 103.398 62.126  1.00 12.81  ? 94  LEU A C   1 
ATOM   543  O  O   . LEU A 1 71  ? 44.370 103.631 60.933  1.00 10.68  ? 94  LEU A O   1 
ATOM   544  C  CB  . LEU A 1 71  ? 44.448 105.258 63.771  1.00 11.29  ? 94  LEU A CB  1 
ATOM   545  C  CG  . LEU A 1 71  ? 45.498 106.008 62.932  1.00 13.61  ? 94  LEU A CG  1 
ATOM   546  C  CD1 . LEU A 1 71  ? 44.847 106.941 61.903  1.00 11.75  ? 94  LEU A CD1 1 
ATOM   547  C  CD2 . LEU A 1 71  ? 46.460 106.785 63.842  1.00 15.18  ? 94  LEU A CD2 1 
ATOM   548  N  N   . ALA A 1 72  ? 44.521 102.271 62.728  1.00 12.04  ? 95  ALA A N   1 
ATOM   549  C  CA  . ALA A 1 72  ? 45.170 101.202 61.967  1.00 12.46  ? 95  ALA A CA  1 
ATOM   550  C  C   . ALA A 1 72  ? 44.263 100.763 60.821  1.00 8.32   ? 95  ALA A C   1 
ATOM   551  O  O   . ALA A 1 72  ? 44.716 100.569 59.687  1.00 11.37  ? 95  ALA A O   1 
ATOM   552  C  CB  . ALA A 1 72  ? 45.499 100.017 62.874  1.00 10.39  ? 95  ALA A CB  1 
ATOM   553  N  N   . ASN A 1 73  ? 42.976 100.616 61.113  1.00 10.24  ? 96  ASN A N   1 
ATOM   554  C  CA  . ASN A 1 73  ? 42.025 100.241 60.060  1.00 8.60   ? 96  ASN A CA  1 
ATOM   555  C  C   . ASN A 1 73  ? 41.857 101.305 58.985  1.00 12.21  ? 96  ASN A C   1 
ATOM   556  O  O   . ASN A 1 73  ? 41.694 100.985 57.798  1.00 8.96   ? 96  ASN A O   1 
ATOM   557  C  CB  . ASN A 1 73  ? 40.671 99.861  60.655  1.00 7.73   ? 96  ASN A CB  1 
ATOM   558  C  CG  . ASN A 1 73  ? 40.620 98.407  61.074  1.00 12.88  ? 96  ASN A CG  1 
ATOM   559  O  OD1 . ASN A 1 73  ? 40.918 97.519  60.272  1.00 9.54   ? 96  ASN A OD1 1 
ATOM   560  N  ND2 . ASN A 1 73  ? 40.251 98.152  62.327  1.00 10.81  ? 96  ASN A ND2 1 
ATOM   561  N  N   . GLN A 1 74  ? 41.894 102.572 59.386  1.00 10.36  ? 97  GLN A N   1 
ATOM   562  C  CA  . GLN A 1 74  ? 41.822 103.657 58.406  1.00 12.30  ? 97  GLN A CA  1 
ATOM   563  C  C   . GLN A 1 74  ? 43.006 103.592 57.451  1.00 12.69  ? 97  GLN A C   1 
ATOM   564  O  O   . GLN A 1 74  ? 42.865 103.757 56.235  1.00 12.94  ? 97  GLN A O   1 
ATOM   565  C  CB  . GLN A 1 74  ? 41.755 105.025 59.108  1.00 10.33  ? 97  GLN A CB  1 
ATOM   566  C  CG  . GLN A 1 74  ? 41.452 106.186 58.149  1.00 14.68  ? 97  GLN A CG  1 
ATOM   567  C  CD  . GLN A 1 74  ? 41.274 107.506 58.881  1.00 23.77  ? 97  GLN A CD  1 
ATOM   568  O  OE1 . GLN A 1 74  ? 41.681 107.640 60.031  1.00 19.97  ? 97  GLN A OE1 1 
ATOM   569  N  NE2 . GLN A 1 74  ? 40.676 108.488 58.213  1.00 19.97  ? 97  GLN A NE2 1 
ATOM   570  N  N   . GLU A 1 75  ? 44.183 103.364 58.009  1.00 9.34   ? 98  GLU A N   1 
ATOM   571  C  CA  . GLU A 1 75  ? 45.384 103.276 57.208  1.00 10.11  ? 98  GLU A CA  1 
ATOM   572  C  C   . GLU A 1 75  ? 45.348 102.047 56.310  1.00 13.59  ? 98  GLU A C   1 
ATOM   573  O  O   . GLU A 1 75  ? 45.730 102.111 55.144  1.00 11.88  ? 98  GLU A O   1 
ATOM   574  C  CB  . GLU A 1 75  ? 46.614 103.290 58.117  1.00 14.11  ? 98  GLU A CB  1 
ATOM   575  C  CG  . GLU A 1 75  ? 46.756 104.619 58.879  1.00 13.91  ? 98  GLU A CG  1 
ATOM   576  C  CD  . GLU A 1 75  ? 47.978 104.669 59.777  1.00 24.15  ? 98  GLU A CD  1 
ATOM   577  O  OE1 . GLU A 1 75  ? 48.398 103.601 60.260  1.00 18.88  ? 98  GLU A OE1 1 
ATOM   578  O  OE2 . GLU A 1 75  ? 48.516 105.776 60.001  1.00 21.70  ? 98  GLU A OE2 1 
ATOM   579  N  N   . LEU A 1 76  ? 44.893 100.928 56.865  1.00 11.18  ? 99  LEU A N   1 
ATOM   580  C  CA  . LEU A 1 76  ? 44.771 99.692  56.100  1.00 12.64  ? 99  LEU A CA  1 
ATOM   581  C  C   . LEU A 1 76  ? 43.788 99.859  54.947  1.00 10.91  ? 99  LEU A C   1 
ATOM   582  O  O   . LEU A 1 76  ? 44.044 99.409  53.825  1.00 9.89   ? 99  LEU A O   1 
ATOM   583  C  CB  . LEU A 1 76  ? 44.325 98.547  57.014  1.00 9.90   ? 99  LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 76  ? 44.119 97.171  56.363  1.00 11.84  ? 99  LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 76  ? 45.361 96.740  55.563  1.00 11.31  ? 99  LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 76  ? 43.775 96.151  57.458  1.00 9.21   ? 99  LEU A CD2 1 
ATOM   587  N  N   . ALA A 1 77  ? 42.661 100.507 55.221  1.00 9.35   ? 100 ALA A N   1 
ATOM   588  C  CA  . ALA A 1 77  ? 41.647 100.711 54.188  1.00 9.99   ? 100 ALA A CA  1 
ATOM   589  C  C   . ALA A 1 77  ? 42.218 101.471 53.001  1.00 15.74  ? 100 ALA A C   1 
ATOM   590  O  O   . ALA A 1 77  ? 41.862 101.209 51.841  1.00 11.22  ? 100 ALA A O   1 
ATOM   591  C  CB  . ALA A 1 77  ? 40.437 101.452 54.763  1.00 9.98   ? 100 ALA A CB  1 
ATOM   592  N  N   . GLU A 1 78  ? 43.100 102.422 53.293  1.00 13.41  ? 101 GLU A N   1 
ATOM   593  C  CA  . GLU A 1 78  ? 43.739 103.211 52.242  1.00 14.38  ? 101 GLU A CA  1 
ATOM   594  C  C   . GLU A 1 78  ? 44.577 102.324 51.317  1.00 13.04  ? 101 GLU A C   1 
ATOM   595  O  O   . GLU A 1 78  ? 44.528 102.459 50.080  1.00 12.48  ? 101 GLU A O   1 
ATOM   596  C  CB  . GLU A 1 78  ? 44.621 104.284 52.885  1.00 20.07  ? 101 GLU A CB  1 
ATOM   597  C  CG  . GLU A 1 78  ? 45.085 105.355 51.944  1.00 40.35  ? 101 GLU A CG  1 
ATOM   598  C  CD  . GLU A 1 78  ? 43.985 106.348 51.648  1.00 55.63  ? 101 GLU A CD  1 
ATOM   599  O  OE1 . GLU A 1 78  ? 43.046 106.452 52.473  1.00 48.34  ? 101 GLU A OE1 1 
ATOM   600  O  OE2 . GLU A 1 78  ? 44.062 107.020 50.595  1.00 57.09  ? 101 GLU A OE2 1 
ATOM   601  N  N   . VAL A 1 79  ? 45.343 101.411 51.912  1.00 11.40  ? 102 VAL A N   1 
ATOM   602  C  CA  . VAL A 1 79  ? 46.185 100.499 51.135  1.00 12.14  ? 102 VAL A CA  1 
ATOM   603  C  C   . VAL A 1 79  ? 45.349 99.517  50.320  1.00 15.13  ? 102 VAL A C   1 
ATOM   604  O  O   . VAL A 1 79  ? 45.634 99.272  49.132  1.00 12.86  ? 102 VAL A O   1 
ATOM   605  C  CB  . VAL A 1 79  ? 47.200 99.739  52.034  1.00 10.36  ? 102 VAL A CB  1 
ATOM   606  C  CG1 . VAL A 1 79  ? 48.064 98.819  51.198  1.00 14.85  ? 102 VAL A CG1 1 
ATOM   607  C  CG2 . VAL A 1 79  ? 48.076 100.733 52.776  1.00 15.50  ? 102 VAL A CG2 1 
ATOM   608  N  N   . VAL A 1 80  ? 44.312 98.973  50.949  1.00 11.98  ? 103 VAL A N   1 
ATOM   609  C  CA  . VAL A 1 80  ? 43.433 98.022  50.274  1.00 10.24  ? 103 VAL A CA  1 
ATOM   610  C  C   . VAL A 1 80  ? 42.725 98.679  49.096  1.00 15.79  ? 103 VAL A C   1 
ATOM   611  O  O   . VAL A 1 80  ? 42.703 98.133  47.992  1.00 11.20  ? 103 VAL A O   1 
ATOM   612  C  CB  . VAL A 1 80  ? 42.390 97.416  51.252  1.00 7.99   ? 103 VAL A CB  1 
ATOM   613  C  CG1 . VAL A 1 80  ? 41.344 96.592  50.492  1.00 11.68  ? 103 VAL A CG1 1 
ATOM   614  C  CG2 . VAL A 1 80  ? 43.093 96.542  52.290  1.00 11.07  ? 103 VAL A CG2 1 
ATOM   615  N  N   . SER A 1 81  ? 42.178 99.868  49.330  1.00 11.04  ? 104 SER A N   1 
ATOM   616  C  CA  . SER A 1 81  ? 41.491 100.621 48.285  1.00 12.68  ? 104 SER A CA  1 
ATOM   617  C  C   . SER A 1 81  ? 42.401 100.845 47.080  1.00 12.14  ? 104 SER A C   1 
ATOM   618  O  O   . SER A 1 81  ? 41.993 100.686 45.925  1.00 15.86  ? 104 SER A O   1 
ATOM   619  C  CB  . SER A 1 81  ? 41.012 101.972 48.844  1.00 16.30  ? 104 SER A CB  1 
ATOM   620  O  OG  . SER A 1 81  ? 40.181 102.638 47.906  1.00 28.37  ? 104 SER A OG  1 
ATOM   621  N  N   . ARG A 1 82  ? 43.635 101.227 47.360  1.00 14.46  ? 105 ARG A N   1 
ATOM   622  C  CA  . ARG A 1 82  ? 44.615 101.482 46.318  1.00 21.15  ? 105 ARG A CA  1 
ATOM   623  C  C   . ARG A 1 82  ? 44.930 100.215 45.521  1.00 19.70  ? 105 ARG A C   1 
ATOM   624  O  O   . ARG A 1 82  ? 44.961 100.241 44.290  1.00 18.93  ? 105 ARG A O   1 
ATOM   625  C  CB  . ARG A 1 82  ? 45.864 102.091 46.959  1.00 25.34  ? 105 ARG A CB  1 
ATOM   626  C  CG  . ARG A 1 82  ? 47.004 102.496 46.046  1.00 43.40  ? 105 ARG A CG  1 
ATOM   627  C  CD  . ARG A 1 82  ? 46.659 103.538 45.001  1.00 55.93  ? 105 ARG A CD  1 
ATOM   628  N  NE  . ARG A 1 82  ? 47.764 103.658 44.049  1.00 72.44  ? 105 ARG A NE  1 
ATOM   629  C  CZ  . ARG A 1 82  ? 48.821 104.448 44.233  1.00 83.00  ? 105 ARG A CZ  1 
ATOM   630  N  NH1 . ARG A 1 82  ? 48.908 105.203 45.323  1.00 69.83  ? 105 ARG A NH1 1 
ATOM   631  N  NH2 . ARG A 1 82  ? 49.789 104.491 43.325  1.00 82.26  ? 105 ARG A NH2 1 
ATOM   632  N  N   . ALA A 1 83  ? 45.125 99.101  46.217  1.00 14.84  ? 106 ALA A N   1 
ATOM   633  C  CA  . ALA A 1 83  ? 45.431 97.840  45.547  1.00 16.68  ? 106 ALA A CA  1 
ATOM   634  C  C   . ALA A 1 83  ? 44.273 97.377  44.660  1.00 15.32  ? 106 ALA A C   1 
ATOM   635  O  O   . ALA A 1 83  ? 44.463 96.957  43.504  1.00 14.58  ? 106 ALA A O   1 
ATOM   636  C  CB  . ALA A 1 83  ? 45.798 96.756  46.582  1.00 15.27  ? 106 ALA A CB  1 
ATOM   637  N  N   . VAL A 1 84  ? 43.066 97.440  45.202  1.00 12.79  ? 107 VAL A N   1 
ATOM   638  C  CA  . VAL A 1 84  ? 41.903 96.995  44.450  1.00 11.49  ? 107 VAL A CA  1 
ATOM   639  C  C   . VAL A 1 84  ? 41.691 97.917  43.251  1.00 14.69  ? 107 VAL A C   1 
ATOM   640  O  O   . VAL A 1 84  ? 41.380 97.463  42.144  1.00 14.68  ? 107 VAL A O   1 
ATOM   641  C  CB  . VAL A 1 84  ? 40.660 96.932  45.349  1.00 11.80  ? 107 VAL A CB  1 
ATOM   642  C  CG1 . VAL A 1 84  ? 39.409 96.725  44.527  1.00 20.32  ? 107 VAL A CG1 1 
ATOM   643  C  CG2 . VAL A 1 84  ? 40.823 95.785  46.367  1.00 14.58  ? 107 VAL A CG2 1 
ATOM   644  N  N   . SER A 1 85  ? 41.894 99.211  43.467  1.00 13.07  ? 108 SER A N   1 
ATOM   645  C  CA  . SER A 1 85  ? 41.708 100.172 42.382  1.00 17.78  ? 108 SER A CA  1 
ATOM   646  C  C   . SER A 1 85  ? 42.730 99.956  41.260  1.00 20.83  ? 108 SER A C   1 
ATOM   647  O  O   . SER A 1 85  ? 42.442 100.251 40.097  1.00 18.17  ? 108 SER A O   1 
ATOM   648  C  CB  . SER A 1 85  ? 41.758 101.613 42.907  1.00 18.68  ? 108 SER A CB  1 
ATOM   649  O  OG  . SER A 1 85  ? 43.071 101.949 43.317  1.00 31.77  ? 108 SER A OG  1 
ATOM   650  N  N   . ASP A 1 86  ? 43.912 99.437  41.602  1.00 16.93  ? 109 ASP A N   1 
ATOM   651  C  CA  . ASP A 1 86  ? 44.930 99.115  40.593  1.00 19.91  ? 109 ASP A CA  1 
ATOM   652  C  C   . ASP A 1 86  ? 44.730 97.751  39.935  1.00 23.25  ? 109 ASP A C   1 
ATOM   653  O  O   . ASP A 1 86  ? 45.565 97.315  39.145  1.00 23.97  ? 109 ASP A O   1 
ATOM   654  C  CB  . ASP A 1 86  ? 46.340 99.178  41.186  1.00 17.81  ? 109 ASP A CB  1 
ATOM   655  C  CG  . ASP A 1 86  ? 46.763 100.585 41.536  1.00 34.56  ? 109 ASP A CG  1 
ATOM   656  O  OD1 . ASP A 1 86  ? 46.213 101.531 40.936  1.00 39.59  ? 109 ASP A OD1 1 
ATOM   657  O  OD2 . ASP A 1 86  ? 47.662 100.742 42.394  1.00 47.02  ? 109 ASP A OD2 1 
ATOM   658  N  N   . GLY A 1 87  ? 43.637 97.075  40.275  1.00 16.04  ? 110 GLY A N   1 
ATOM   659  C  CA  . GLY A 1 87  ? 43.250 95.835  39.614  1.00 20.31  ? 110 GLY A CA  1 
ATOM   660  C  C   . GLY A 1 87  ? 43.708 94.556  40.300  1.00 22.73  ? 110 GLY A C   1 
ATOM   661  O  O   . GLY A 1 87  ? 43.607 93.466  39.732  1.00 19.03  ? 110 GLY A O   1 
ATOM   662  N  N   . TYR A 1 88  ? 44.192 94.674  41.532  1.00 16.76  ? 111 TYR A N   1 
ATOM   663  C  CA  . TYR A 1 88  ? 44.630 93.496  42.283  1.00 14.35  ? 111 TYR A CA  1 
ATOM   664  C  C   . TYR A 1 88  ? 43.508 92.896  43.120  1.00 16.72  ? 111 TYR A C   1 
ATOM   665  O  O   . TYR A 1 88  ? 42.729 93.620  43.742  1.00 15.26  ? 111 TYR A O   1 
ATOM   666  C  CB  . TYR A 1 88  ? 45.784 93.855  43.215  1.00 12.57  ? 111 TYR A CB  1 
ATOM   667  C  CG  . TYR A 1 88  ? 47.064 94.231  42.514  1.00 21.66  ? 111 TYR A CG  1 
ATOM   668  C  CD1 . TYR A 1 88  ? 47.973 93.253  42.123  1.00 22.30  ? 111 TYR A CD1 1 
ATOM   669  C  CD2 . TYR A 1 88  ? 47.367 95.562  42.241  1.00 20.54  ? 111 TYR A CD2 1 
ATOM   670  C  CE1 . TYR A 1 88  ? 49.152 93.587  41.480  1.00 22.69  ? 111 TYR A CE1 1 
ATOM   671  C  CE2 . TYR A 1 88  ? 48.544 95.912  41.595  1.00 24.84  ? 111 TYR A CE2 1 
ATOM   672  C  CZ  . TYR A 1 88  ? 49.435 94.916  41.218  1.00 34.20  ? 111 TYR A CZ  1 
ATOM   673  O  OH  . TYR A 1 88  ? 50.613 95.246  40.580  1.00 33.96  ? 111 TYR A OH  1 
ATOM   674  N  N   . SER A 1 89  ? 43.439 91.569  43.151  1.00 11.64  ? 112 SER A N   1 
ATOM   675  C  CA  . SER A 1 89  ? 42.703 90.877  44.197  1.00 12.16  ? 112 SER A CA  1 
ATOM   676  C  C   . SER A 1 89  ? 43.566 91.035  45.434  1.00 15.73  ? 112 SER A C   1 
ATOM   677  O  O   . SER A 1 89  ? 44.775 90.793  45.383  1.00 17.20  ? 112 SER A O   1 
ATOM   678  C  CB  . SER A 1 89  ? 42.527 89.403  43.849  1.00 15.27  ? 112 SER A CB  1 
ATOM   679  O  OG  . SER A 1 89  ? 41.672 89.270  42.742  1.00 17.20  ? 112 SER A OG  1 
ATOM   680  N  N   . CYS A 1 90  ? 42.960 91.452  46.539  1.00 12.00  ? 113 CYS A N   1 
ATOM   681  C  CA  . CYS A 1 90  ? 43.735 91.862  47.702  1.00 10.87  ? 113 CYS A CA  1 
ATOM   682  C  C   . CYS A 1 90  ? 43.702 90.849  48.835  1.00 11.41  ? 113 CYS A C   1 
ATOM   683  O  O   . CYS A 1 90  ? 42.668 90.644  49.466  1.00 14.34  ? 113 CYS A O   1 
ATOM   684  C  CB  . CYS A 1 90  ? 43.223 93.208  48.213  1.00 17.46  ? 113 CYS A CB  1 
ATOM   685  S  SG  . CYS A 1 90  ? 44.329 93.976  49.380  1.00 22.64  ? 113 CYS A SG  1 
ATOM   686  N  N   . VAL A 1 91  ? 44.851 90.241  49.109  1.00 10.37  ? 114 VAL A N   1 
ATOM   687  C  CA  . VAL A 1 91  ? 44.981 89.289  50.203  1.00 8.45   ? 114 VAL A CA  1 
ATOM   688  C  C   . VAL A 1 91  ? 45.598 89.996  51.404  1.00 10.73  ? 114 VAL A C   1 
ATOM   689  O  O   . VAL A 1 91  ? 46.710 90.518  51.319  1.00 12.66  ? 114 VAL A O   1 
ATOM   690  C  CB  . VAL A 1 91  ? 45.913 88.111  49.822  1.00 10.11  ? 114 VAL A CB  1 
ATOM   691  C  CG1 . VAL A 1 91  ? 46.210 87.238  51.056  1.00 11.00  ? 114 VAL A CG1 1 
ATOM   692  C  CG2 . VAL A 1 91  ? 45.287 87.292  48.705  1.00 10.28  ? 114 VAL A CG2 1 
ATOM   693  N  N   . THR A 1 92  ? 44.863 90.045  52.505  1.00 9.28   ? 115 THR A N   1 
ATOM   694  C  CA  . THR A 1 92  ? 45.402 90.639  53.719  1.00 10.12  ? 115 THR A CA  1 
ATOM   695  C  C   . THR A 1 92  ? 45.631 89.562  54.769  1.00 9.37   ? 115 THR A C   1 
ATOM   696  O  O   . THR A 1 92  ? 44.721 88.808  55.102  1.00 8.50   ? 115 THR A O   1 
ATOM   697  C  CB  . THR A 1 92  ? 44.490 91.753  54.268  1.00 13.16  ? 115 THR A CB  1 
ATOM   698  O  OG1 . THR A 1 92  ? 44.280 92.744  53.250  1.00 11.76  ? 115 THR A OG1 1 
ATOM   699  C  CG2 . THR A 1 92  ? 45.124 92.422  55.503  1.00 9.75   ? 115 THR A CG2 1 
ATOM   700  N  N   . LEU A 1 93  ? 46.852 89.511  55.292  1.00 10.63  ? 116 LEU A N   1 
ATOM   701  C  CA  . LEU A 1 93  ? 47.224 88.533  56.310  1.00 8.87   ? 116 LEU A CA  1 
ATOM   702  C  C   . LEU A 1 93  ? 47.182 89.175  57.691  1.00 7.84   ? 116 LEU A C   1 
ATOM   703  O  O   . LEU A 1 93  ? 47.832 90.190  57.924  1.00 9.61   ? 116 LEU A O   1 
ATOM   704  C  CB  . LEU A 1 93  ? 48.640 88.026  56.045  1.00 8.69   ? 116 LEU A CB  1 
ATOM   705  C  CG  . LEU A 1 93  ? 48.944 87.585  54.615  1.00 11.11  ? 116 LEU A CG  1 
ATOM   706  C  CD1 . LEU A 1 93  ? 50.409 87.182  54.483  1.00 10.13  ? 116 LEU A CD1 1 
ATOM   707  C  CD2 . LEU A 1 93  ? 48.028 86.432  54.227  1.00 9.58   ? 116 LEU A CD2 1 
ATOM   708  N  N   . GLY A 1 94  ? 46.413 88.581  58.606  1.00 9.22   ? 117 GLY A N   1 
ATOM   709  C  CA  . GLY A 1 94  ? 46.334 89.071  59.973  1.00 9.84   ? 117 GLY A CA  1 
ATOM   710  C  C   . GLY A 1 94  ? 47.270 88.313  60.907  1.00 11.40  ? 117 GLY A C   1 
ATOM   711  O  O   . GLY A 1 94  ? 47.888 87.327  60.499  1.00 12.79  ? 117 GLY A O   1 
ATOM   712  N  N   . GLY A 1 95  ? 47.371 88.755  62.162  1.00 9.66   ? 118 GLY A N   1 
ATOM   713  C  CA  . GLY A 1 95  ? 46.601 89.881  62.677  1.00 8.13   ? 118 GLY A CA  1 
ATOM   714  C  C   . GLY A 1 95  ? 45.218 89.456  63.128  1.00 10.38  ? 118 GLY A C   1 
ATOM   715  O  O   . GLY A 1 95  ? 44.661 88.484  62.614  1.00 11.85  ? 118 GLY A O   1 
ATOM   716  N  N   . ASP A 1 96  ? 44.651 90.166  64.096  1.00 7.95   ? 119 ASP A N   1 
ATOM   717  C  CA  . ASP A 1 96  ? 43.331 89.799  64.594  1.00 6.37   ? 119 ASP A CA  1 
ATOM   718  C  C   . ASP A 1 96  ? 42.227 90.294  63.671  1.00 7.89   ? 119 ASP A C   1 
ATOM   719  O  O   . ASP A 1 96  ? 42.465 91.142  62.799  1.00 10.38  ? 119 ASP A O   1 
ATOM   720  C  CB  . ASP A 1 96  ? 43.114 90.285  66.033  1.00 9.02   ? 119 ASP A CB  1 
ATOM   721  C  CG  . ASP A 1 96  ? 42.952 91.790  66.121  1.00 12.63  ? 119 ASP A CG  1 
ATOM   722  O  OD1 . ASP A 1 96  ? 41.888 92.286  65.703  1.00 10.18  ? 119 ASP A OD1 1 
ATOM   723  O  OD2 . ASP A 1 96  ? 43.872 92.479  66.614  1.00 13.10  ? 119 ASP A OD2 1 
ATOM   724  N  N   . HIS A 1 97  ? 41.019 89.778  63.875  1.00 7.42   ? 120 HIS A N   1 
ATOM   725  C  CA  . HIS A 1 97  ? 39.932 90.003  62.931  1.00 7.69   ? 120 HIS A CA  1 
ATOM   726  C  C   . HIS A 1 97  ? 39.367 91.422  62.917  1.00 11.88  ? 120 HIS A C   1 
ATOM   727  O  O   . HIS A 1 97  ? 38.539 91.716  62.073  1.00 7.21   ? 120 HIS A O   1 
ATOM   728  C  CB  . HIS A 1 97  ? 38.792 89.010  63.166  1.00 6.97   ? 120 HIS A CB  1 
ATOM   729  C  CG  . HIS A 1 97  ? 38.154 88.506  61.896  1.00 8.80   ? 120 HIS A CG  1 
ATOM   730  N  ND1 . HIS A 1 97  ? 37.491 87.311  61.834  1.00 9.69   ? 120 HIS A ND1 1 
ATOM   731  C  CD2 . HIS A 1 97  ? 38.119 89.053  60.659  1.00 7.53   ? 120 HIS A CD2 1 
ATOM   732  C  CE1 . HIS A 1 97  ? 37.052 87.132  60.590  1.00 9.73   ? 120 HIS A CE1 1 
ATOM   733  N  NE2 . HIS A 1 97  ? 37.422 88.155  59.862  1.00 8.33   ? 120 HIS A NE2 1 
ATOM   734  N  N   . SER A 1 98  ? 39.783 92.302  63.833  1.00 8.40   ? 121 SER A N   1 
ATOM   735  C  CA  . SER A 1 98  ? 39.305 93.686  63.749  1.00 7.90   ? 121 SER A CA  1 
ATOM   736  C  C   . SER A 1 98  ? 39.798 94.357  62.456  1.00 8.91   ? 121 SER A C   1 
ATOM   737  O  O   . SER A 1 98  ? 39.273 95.386  62.031  1.00 8.85   ? 121 SER A O   1 
ATOM   738  C  CB  . SER A 1 98  ? 39.714 94.511  64.980  1.00 8.77   ? 121 SER A CB  1 
ATOM   739  O  OG  . SER A 1 98  ? 41.099 94.802  64.986  1.00 8.85   ? 121 SER A OG  1 
ATOM   740  N  N   A LEU A 1 99  ? 40.814 93.781  61.828  0.95 8.59   ? 122 LEU A N   1 
ATOM   741  C  CA  A LEU A 1 99  ? 41.329 94.360  60.594  0.95 7.81   ? 122 LEU A CA  1 
ATOM   742  C  C   A LEU A 1 99  ? 40.337 94.266  59.432  0.95 6.47   ? 122 LEU A C   1 
ATOM   743  O  O   A LEU A 1 99  ? 40.507 94.933  58.407  0.95 9.09   ? 122 LEU A O   1 
ATOM   744  C  CB  A LEU A 1 99  ? 42.665 93.741  60.224  0.95 9.20   ? 122 LEU A CB  1 
ATOM   745  C  CG  A LEU A 1 99  ? 42.707 92.278  59.807  0.95 18.77  ? 122 LEU A CG  1 
ATOM   746  C  CD1 A LEU A 1 99  ? 42.401 92.118  58.320  0.95 15.02  ? 122 LEU A CD1 1 
ATOM   747  C  CD2 A LEU A 1 99  ? 44.073 91.711  60.163  0.95 17.89  ? 122 LEU A CD2 1 
ATOM   748  N  N   . ALA A 1 100 ? 39.321 93.424  59.567  1.00 9.24   ? 123 ALA A N   1 
ATOM   749  C  CA  . ALA A 1 100 ? 38.295 93.326  58.527  1.00 13.76  ? 123 ALA A CA  1 
ATOM   750  C  C   . ALA A 1 100 ? 37.537 94.639  58.395  1.00 11.58  ? 123 ALA A C   1 
ATOM   751  O  O   . ALA A 1 100 ? 36.926 94.907  57.362  1.00 9.76   ? 123 ALA A O   1 
ATOM   752  C  CB  . ALA A 1 100 ? 37.326 92.177  58.806  1.00 9.08   ? 123 ALA A CB  1 
ATOM   753  N  N   . ILE A 1 101 ? 37.547 95.449  59.446  1.00 6.93   ? 124 ILE A N   1 
ATOM   754  C  CA  . ILE A 1 101 ? 36.937 96.776  59.338  1.00 8.83   ? 124 ILE A CA  1 
ATOM   755  C  C   . ILE A 1 101 ? 37.641 97.541  58.232  1.00 6.99   ? 124 ILE A C   1 
ATOM   756  O  O   . ILE A 1 101 ? 37.005 98.105  57.339  1.00 9.17   ? 124 ILE A O   1 
ATOM   757  C  CB  . ILE A 1 101 ? 37.032 97.547  60.655  1.00 8.67   ? 124 ILE A CB  1 
ATOM   758  C  CG1 . ILE A 1 101 ? 36.228 96.831  61.741  1.00 10.33  ? 124 ILE A CG1 1 
ATOM   759  C  CG2 . ILE A 1 101 ? 36.515 98.976  60.481  1.00 12.51  ? 124 ILE A CG2 1 
ATOM   760  C  CD1 . ILE A 1 101 ? 36.418 97.441  63.140  1.00 11.59  ? 124 ILE A CD1 1 
ATOM   761  N  N   . GLY A 1 102 ? 38.964 97.515  58.274  1.00 8.10   ? 125 GLY A N   1 
ATOM   762  C  CA  . GLY A 1 102 ? 39.773 98.184  57.271  1.00 8.52   ? 125 GLY A CA  1 
ATOM   763  C  C   . GLY A 1 102 ? 39.764 97.539  55.898  1.00 10.40  ? 125 GLY A C   1 
ATOM   764  O  O   . GLY A 1 102 ? 39.699 98.239  54.885  1.00 7.23   ? 125 GLY A O   1 
ATOM   765  N  N   . THR A 1 103 ? 39.864 96.216  55.832  1.00 6.58   ? 126 THR A N   1 
ATOM   766  C  CA  . THR A 1 103 ? 39.906 95.575  54.510  1.00 6.87   ? 126 THR A CA  1 
ATOM   767  C  C   . THR A 1 103 ? 38.585 95.694  53.773  1.00 8.41   ? 126 THR A C   1 
ATOM   768  O  O   . THR A 1 103 ? 38.549 95.956  52.565  1.00 8.51   ? 126 THR A O   1 
ATOM   769  C  CB  . THR A 1 103 ? 40.329 94.101  54.580  1.00 8.91   ? 126 THR A CB  1 
ATOM   770  O  OG1 . THR A 1 103 ? 39.330 93.356  55.285  1.00 9.10   ? 126 THR A OG1 1 
ATOM   771  C  CG2 . THR A 1 103 ? 41.681 93.977  55.291  1.00 11.00  ? 126 THR A CG2 1 
ATOM   772  N  N   . ILE A 1 104 ? 37.495 95.478  54.491  1.00 7.21   ? 127 ILE A N   1 
ATOM   773  C  CA  . ILE A 1 104 ? 36.191 95.553  53.847  1.00 8.47   ? 127 ILE A CA  1 
ATOM   774  C  C   . ILE A 1 104 ? 35.845 96.998  53.499  1.00 10.58  ? 127 ILE A C   1 
ATOM   775  O  O   . ILE A 1 104 ? 35.313 97.268  52.419  1.00 9.63   ? 127 ILE A O   1 
ATOM   776  C  CB  . ILE A 1 104 ? 35.095 94.890  54.689  1.00 7.69   ? 127 ILE A CB  1 
ATOM   777  C  CG1 . ILE A 1 104 ? 35.343 93.377  54.771  1.00 7.82   ? 127 ILE A CG1 1 
ATOM   778  C  CG2 . ILE A 1 104 ? 33.726 95.153  54.082  1.00 9.86   ? 127 ILE A CG2 1 
ATOM   779  C  CD1 . ILE A 1 104 ? 34.423 92.666  55.721  1.00 9.58   ? 127 ILE A CD1 1 
ATOM   780  N  N   . SER A 1 105 ? 36.165 97.931  54.392  1.00 7.62   ? 128 SER A N   1 
ATOM   781  C  CA  . SER A 1 105 ? 35.946 99.343  54.074  1.00 8.45   ? 128 SER A CA  1 
ATOM   782  C  C   . SER A 1 105 ? 36.725 99.753  52.837  1.00 11.26  ? 128 SER A C   1 
ATOM   783  O  O   . SER A 1 105 ? 36.176 100.390 51.926  1.00 10.07  ? 128 SER A O   1 
ATOM   784  C  CB  . SER A 1 105 ? 36.326 100.249 55.247  1.00 8.33   ? 128 SER A CB  1 
ATOM   785  O  OG  . SER A 1 105 ? 35.421 100.062 56.313  1.00 10.63  ? 128 SER A OG  1 
ATOM   786  N  N   . GLY A 1 106 ? 38.005 99.382  52.807  1.00 7.64   ? 129 GLY A N   1 
ATOM   787  C  CA  . GLY A 1 106 ? 38.875 99.721  51.689  1.00 9.00   ? 129 GLY A CA  1 
ATOM   788  C  C   . GLY A 1 106 ? 38.442 99.072  50.393  1.00 11.45  ? 129 GLY A C   1 
ATOM   789  O  O   . GLY A 1 106 ? 38.506 99.679  49.320  1.00 10.40  ? 129 GLY A O   1 
ATOM   790  N  N   . HIS A 1 107 ? 38.034 97.812  50.492  1.00 9.25   ? 130 HIS A N   1 
ATOM   791  C  CA  . HIS A 1 107 ? 37.525 97.079  49.342  1.00 8.36   ? 130 HIS A CA  1 
ATOM   792  C  C   . HIS A 1 107 ? 36.273 97.746  48.805  1.00 7.02   ? 130 HIS A C   1 
ATOM   793  O  O   . HIS A 1 107 ? 36.142 97.965  47.584  1.00 12.52  ? 130 HIS A O   1 
ATOM   794  C  CB  . HIS A 1 107 ? 37.183 95.655  49.781  1.00 8.11   ? 130 HIS A CB  1 
ATOM   795  C  CG  . HIS A 1 107 ? 36.906 94.715  48.657  1.00 8.32   ? 130 HIS A CG  1 
ATOM   796  N  ND1 . HIS A 1 107 ? 36.600 93.385  48.869  1.00 10.80  ? 130 HIS A ND1 1 
ATOM   797  C  CD2 . HIS A 1 107 ? 36.888 94.896  47.314  1.00 12.39  ? 130 HIS A CD2 1 
ATOM   798  C  CE1 . HIS A 1 107 ? 36.437 92.784  47.710  1.00 12.95  ? 130 HIS A CE1 1 
ATOM   799  N  NE2 . HIS A 1 107 ? 36.583 93.678  46.745  1.00 14.34  ? 130 HIS A NE2 1 
ATOM   800  N  N   . ALA A 1 108 ? 35.360 98.087  49.711  1.00 7.28   ? 131 ALA A N   1 
ATOM   801  C  CA  . ALA A 1 108 ? 34.072 98.657  49.309  1.00 7.76   ? 131 ALA A CA  1 
ATOM   802  C  C   . ALA A 1 108 ? 34.250 100.045 48.700  1.00 12.84  ? 131 ALA A C   1 
ATOM   803  O  O   . ALA A 1 108 ? 33.410 100.517 47.915  1.00 9.54   ? 131 ALA A O   1 
ATOM   804  C  CB  . ALA A 1 108 ? 33.118 98.719  50.493  1.00 11.30  ? 131 ALA A CB  1 
ATOM   805  N  N   . ARG A 1 109 ? 35.345 100.697 49.070  1.00 8.89   ? 132 ARG A N   1 
ATOM   806  C  CA  . ARG A 1 109 ? 35.670 102.019 48.541  1.00 11.49  ? 132 ARG A CA  1 
ATOM   807  C  C   . ARG A 1 109 ? 35.842 101.954 47.019  1.00 14.14  ? 132 ARG A C   1 
ATOM   808  O  O   . ARG A 1 109 ? 35.543 102.923 46.316  1.00 13.75  ? 132 ARG A O   1 
ATOM   809  C  CB  . ARG A 1 109 ? 36.908 102.579 49.238  1.00 15.31  ? 132 ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 109 ? 37.119 104.076 49.096  1.00 18.94  ? 132 ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 109 ? 38.242 104.509 50.049  1.00 12.97  ? 132 ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 109 ? 37.835 104.375 51.449  1.00 13.79  ? 132 ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 109 ? 38.673 104.429 52.478  1.00 21.03  ? 132 ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 109 ? 38.216 104.300 53.715  1.00 16.76  ? 132 ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 109 ? 39.971 104.597 52.263  1.00 15.37  ? 132 ARG A NH2 1 
ATOM   816  N  N   . HIS A 1 110 ? 36.355 100.832 46.504  1.00 8.25   ? 133 HIS A N   1 
ATOM   817  C  CA  . HIS A 1 110 ? 36.443 100.683 45.053  1.00 9.93   ? 133 HIS A CA  1 
ATOM   818  C  C   . HIS A 1 110 ? 35.330 99.819  44.462  1.00 13.61  ? 133 HIS A C   1 
ATOM   819  O  O   . HIS A 1 110 ? 34.963 99.989  43.304  1.00 13.87  ? 133 HIS A O   1 
ATOM   820  C  CB  . HIS A 1 110 ? 37.802 100.115 44.630  1.00 12.05  ? 133 HIS A CB  1 
ATOM   821  C  CG  . HIS A 1 110 ? 38.034 100.174 43.148  1.00 16.25  ? 133 HIS A CG  1 
ATOM   822  N  ND1 . HIS A 1 110 ? 38.328 101.348 42.492  1.00 20.05  ? 133 HIS A ND1 1 
ATOM   823  C  CD2 . HIS A 1 110 ? 37.985 99.203  42.203  1.00 19.10  ? 133 HIS A CD2 1 
ATOM   824  C  CE1 . HIS A 1 110 ? 38.467 101.095 41.196  1.00 22.27  ? 133 HIS A CE1 1 
ATOM   825  N  NE2 . HIS A 1 110 ? 38.264 99.813  40.996  1.00 18.49  ? 133 HIS A NE2 1 
ATOM   826  N  N   A CYS A 1 111 ? 34.765 98.928  45.265  1.00 7.88   ? 134 CYS A N   1 
ATOM   827  C  CA  A CYS A 1 111 ? 33.736 97.999  44.793  1.00 8.77   ? 134 CYS A CA  1 
ATOM   828  C  C   A CYS A 1 111 ? 32.521 98.027  45.694  1.00 12.32  ? 134 CYS A C   1 
ATOM   829  O  O   A CYS A 1 111 ? 32.347 97.146  46.537  1.00 12.11  ? 134 CYS A O   1 
ATOM   830  C  CB  A CYS A 1 111 ? 34.286 96.576  44.722  1.00 15.91  ? 134 CYS A CB  1 
ATOM   831  S  SG  A CYS A 1 111 ? 35.822 96.386  43.782  1.00 32.56  ? 134 CYS A SG  1 
ATOM   832  N  N   . PRO A 1 112 ? 31.679 99.053  45.545  1.00 15.02  ? 135 PRO A N   1 
ATOM   833  C  CA  . PRO A 1 112 ? 30.584 99.230  46.507  1.00 13.91  ? 135 PRO A CA  1 
ATOM   834  C  C   . PRO A 1 112 ? 29.543 98.110  46.496  1.00 13.38  ? 135 PRO A C   1 
ATOM   835  O  O   . PRO A 1 112 ? 28.828 97.950  47.481  1.00 12.80  ? 135 PRO A O   1 
ATOM   836  C  CB  . PRO A 1 112 ? 29.951 100.571 46.086  1.00 18.02  ? 135 PRO A CB  1 
ATOM   837  C  CG  . PRO A 1 112 ? 30.327 100.736 44.655  1.00 15.64  ? 135 PRO A CG  1 
ATOM   838  C  CD  . PRO A 1 112 ? 31.686 100.092 44.498  1.00 13.95  ? 135 PRO A CD  1 
ATOM   839  N  N   . ASP A 1 113 ? 29.467 97.325  45.427  1.00 10.21  ? 136 ASP A N   1 
ATOM   840  C  CA  . ASP A 1 113 ? 28.469 96.256  45.394  1.00 12.02  ? 136 ASP A CA  1 
ATOM   841  C  C   . ASP A 1 113 ? 29.043 94.912  45.869  1.00 12.08  ? 136 ASP A C   1 
ATOM   842  O  O   . ASP A 1 113 ? 28.502 93.858  45.553  1.00 10.34  ? 136 ASP A O   1 
ATOM   843  C  CB  . ASP A 1 113 ? 27.866 96.116  43.990  1.00 11.83  ? 136 ASP A CB  1 
ATOM   844  C  CG  . ASP A 1 113 ? 26.570 95.317  43.987  1.00 12.98  ? 136 ASP A CG  1 
ATOM   845  O  OD1 . ASP A 1 113 ? 25.868 95.309  45.021  1.00 14.03  ? 136 ASP A OD1 1 
ATOM   846  O  OD2 . ASP A 1 113 ? 26.258 94.686  42.952  1.00 16.42  ? 136 ASP A OD2 1 
ATOM   847  N  N   . LEU A 1 114 ? 30.111 94.943  46.634  1.00 11.65  ? 137 LEU A N   1 
ATOM   848  C  CA  . LEU A 1 114 ? 30.713 93.716  47.103  1.00 12.13  ? 137 LEU A CA  1 
ATOM   849  C  C   . LEU A 1 114 ? 29.773 92.905  48.000  1.00 10.69  ? 137 LEU A C   1 
ATOM   850  O  O   . LEU A 1 114 ? 28.882 93.414  48.563  1.00 10.93  ? 137 LEU A O   1 
ATOM   851  C  CB  . LEU A 1 114 ? 32.010 93.981  47.828  1.00 12.34  ? 137 LEU A CB  1 
ATOM   852  C  CG  . LEU A 1 114 ? 31.986 94.486  49.249  1.00 13.45  ? 137 LEU A CG  1 
ATOM   853  C  CD1 . LEU A 1 114 ? 33.395 94.839  49.708  1.00 8.68   ? 137 LEU A CD1 1 
ATOM   854  C  CD2 . LEU A 1 114 ? 31.096 95.700  49.350  1.00 25.28  ? 137 LEU A CD2 1 
ATOM   855  N  N   . CYS A 1 115 ? 30.037 91.620  48.114  1.00 8.76   ? 138 CYS A N   1 
ATOM   856  C  CA  . CYS A 1 115 ? 29.365 90.790  49.103  1.00 8.54   ? 138 CYS A CA  1 
ATOM   857  C  C   . CYS A 1 115 ? 30.444 90.103  49.938  1.00 10.50  ? 138 CYS A C   1 
ATOM   858  O  O   . CYS A 1 115 ? 31.612 90.068  49.543  1.00 8.27   ? 138 CYS A O   1 
ATOM   859  C  CB  . CYS A 1 115 ? 28.426 89.777  48.434  1.00 8.40   ? 138 CYS A CB  1 
ATOM   860  S  SG  . CYS A 1 115 ? 29.291 88.646  47.319  1.00 13.42  ? 138 CYS A SG  1 
ATOM   861  N  N   . VAL A 1 116 ? 30.057 89.592  51.101  1.00 7.75   ? 139 VAL A N   1 
ATOM   862  C  CA  . VAL A 1 116 ? 31.028 89.081  52.052  1.00 8.06   ? 139 VAL A CA  1 
ATOM   863  C  C   . VAL A 1 116 ? 30.698 87.643  52.418  1.00 8.20   ? 139 VAL A C   1 
ATOM   864  O  O   . VAL A 1 116 ? 29.556 87.325  52.753  1.00 8.14   ? 139 VAL A O   1 
ATOM   865  C  CB  . VAL A 1 116 ? 31.055 89.939  53.339  1.00 9.70   ? 139 VAL A CB  1 
ATOM   866  C  CG1 . VAL A 1 116 ? 32.050 89.361  54.362  1.00 7.97   ? 139 VAL A CG1 1 
ATOM   867  C  CG2 . VAL A 1 116 ? 31.434 91.364  52.992  1.00 6.79   ? 139 VAL A CG2 1 
ATOM   868  N  N   . VAL A 1 117 ? 31.698 86.777  52.311  1.00 6.86   ? 140 VAL A N   1 
ATOM   869  C  CA  . VAL A 1 117 ? 31.575 85.427  52.850  1.00 7.24   ? 140 VAL A CA  1 
ATOM   870  C  C   . VAL A 1 117 ? 32.473 85.372  54.069  1.00 6.07   ? 140 VAL A C   1 
ATOM   871  O  O   . VAL A 1 117 ? 33.679 85.554  53.955  1.00 6.06   ? 140 VAL A O   1 
ATOM   872  C  CB  . VAL A 1 117 ? 31.961 84.349  51.826  1.00 7.78   ? 140 VAL A CB  1 
ATOM   873  C  CG1 . VAL A 1 117 ? 31.902 82.959  52.475  1.00 5.96   ? 140 VAL A CG1 1 
ATOM   874  C  CG2 . VAL A 1 117 ? 31.010 84.417  50.610  1.00 5.25   ? 140 VAL A CG2 1 
ATOM   875  N  N   . TRP A 1 118 ? 31.861 85.185  55.231  1.00 7.04   ? 141 TRP A N   1 
ATOM   876  C  CA  . TRP A 1 118 ? 32.556 85.285  56.514  1.00 8.55   ? 141 TRP A CA  1 
ATOM   877  C  C   . TRP A 1 118 ? 32.674 83.890  57.114  1.00 5.63   ? 141 TRP A C   1 
ATOM   878  O  O   . TRP A 1 118 ? 31.689 83.330  57.564  1.00 6.60   ? 141 TRP A O   1 
ATOM   879  C  CB  . TRP A 1 118 ? 31.781 86.205  57.466  1.00 7.35   ? 141 TRP A CB  1 
ATOM   880  C  CG  . TRP A 1 118 ? 32.572 86.655  58.671  1.00 7.97   ? 141 TRP A CG  1 
ATOM   881  C  CD1 . TRP A 1 118 ? 32.844 85.918  59.804  1.00 7.71   ? 141 TRP A CD1 1 
ATOM   882  C  CD2 . TRP A 1 118 ? 33.182 87.948  58.876  1.00 7.37   ? 141 TRP A CD2 1 
ATOM   883  N  NE1 . TRP A 1 118 ? 33.582 86.679  60.691  1.00 6.87   ? 141 TRP A NE1 1 
ATOM   884  C  CE2 . TRP A 1 118 ? 33.804 87.917  60.147  1.00 8.58   ? 141 TRP A CE2 1 
ATOM   885  C  CE3 . TRP A 1 118 ? 33.251 89.123  58.110  1.00 6.26   ? 141 TRP A CE3 1 
ATOM   886  C  CZ2 . TRP A 1 118 ? 34.500 89.029  60.665  1.00 7.62   ? 141 TRP A CZ2 1 
ATOM   887  C  CZ3 . TRP A 1 118 ? 33.944 90.215  58.623  1.00 7.35   ? 141 TRP A CZ3 1 
ATOM   888  C  CH2 . TRP A 1 118 ? 34.552 90.164  59.889  1.00 6.50   ? 141 TRP A CH2 1 
ATOM   889  N  N   . VAL A 1 119 ? 33.878 83.335  57.080  1.00 6.95   ? 142 VAL A N   1 
ATOM   890  C  CA  . VAL A 1 119 ? 34.123 81.968  57.523  1.00 7.86   ? 142 VAL A CA  1 
ATOM   891  C  C   . VAL A 1 119 ? 34.805 81.981  58.884  1.00 5.09   ? 142 VAL A C   1 
ATOM   892  O  O   . VAL A 1 119 ? 35.933 82.453  58.999  1.00 5.11   ? 142 VAL A O   1 
ATOM   893  C  CB  . VAL A 1 119 ? 34.982 81.222  56.493  1.00 6.02   ? 142 VAL A CB  1 
ATOM   894  C  CG1 . VAL A 1 119 ? 35.172 79.744  56.911  1.00 9.35   ? 142 VAL A CG1 1 
ATOM   895  C  CG2 . VAL A 1 119 ? 34.307 81.295  55.129  1.00 6.44   ? 142 VAL A CG2 1 
ATOM   896  N  N   . ASP A 1 120 ? 34.110 81.470  59.901  1.00 6.95   ? 143 ASP A N   1 
ATOM   897  C  CA  . ASP A 1 120 ? 34.463 81.786  61.288  1.00 8.23   ? 143 ASP A CA  1 
ATOM   898  C  C   . ASP A 1 120 ? 33.687 80.889  62.236  1.00 7.39   ? 143 ASP A C   1 
ATOM   899  O  O   . ASP A 1 120 ? 32.545 80.531  61.953  1.00 6.53   ? 143 ASP A O   1 
ATOM   900  C  CB  . ASP A 1 120 ? 34.103 83.263  61.558  1.00 6.01   ? 143 ASP A CB  1 
ATOM   901  C  CG  . ASP A 1 120 ? 34.939 83.905  62.676  1.00 10.95  ? 143 ASP A CG  1 
ATOM   902  O  OD1 . ASP A 1 120 ? 35.211 83.256  63.708  1.00 6.26   ? 143 ASP A OD1 1 
ATOM   903  O  OD2 . ASP A 1 120 ? 35.325 85.081  62.508  1.00 8.53   ? 143 ASP A OD2 1 
ATOM   904  N  N   . ALA A 1 121 ? 34.289 80.548  63.378  1.00 6.57   ? 144 ALA A N   1 
ATOM   905  C  CA  . ALA A 1 121 ? 33.547 79.896  64.462  1.00 8.53   ? 144 ALA A CA  1 
ATOM   906  C  C   . ALA A 1 121 ? 32.581 80.897  65.090  1.00 10.33  ? 144 ALA A C   1 
ATOM   907  O  O   . ALA A 1 121 ? 31.577 80.526  65.726  1.00 9.56   ? 144 ALA A O   1 
ATOM   908  C  CB  . ALA A 1 121 ? 34.522 79.349  65.531  1.00 7.89   ? 144 ALA A CB  1 
ATOM   909  N  N   . HIS A 1 122 ? 32.888 82.178  64.899  1.00 7.80   ? 145 HIS A N   1 
ATOM   910  C  CA  . HIS A 1 122 ? 32.180 83.267  65.578  1.00 6.43   ? 145 HIS A CA  1 
ATOM   911  C  C   . HIS A 1 122 ? 31.553 84.243  64.600  1.00 8.55   ? 145 HIS A C   1 
ATOM   912  O  O   . HIS A 1 122 ? 32.012 84.378  63.472  1.00 9.09   ? 145 HIS A O   1 
ATOM   913  C  CB  . HIS A 1 122 ? 33.170 84.055  66.425  1.00 7.69   ? 145 HIS A CB  1 
ATOM   914  C  CG  . HIS A 1 122 ? 33.996 83.191  67.325  1.00 8.03   ? 145 HIS A CG  1 
ATOM   915  N  ND1 . HIS A 1 122 ? 35.269 82.776  66.981  1.00 8.38   ? 145 HIS A ND1 1 
ATOM   916  C  CD2 . HIS A 1 122 ? 33.743 82.687  68.549  1.00 8.83   ? 145 HIS A CD2 1 
ATOM   917  C  CE1 . HIS A 1 122 ? 35.750 82.027  67.951  1.00 8.87   ? 145 HIS A CE1 1 
ATOM   918  N  NE2 . HIS A 1 122 ? 34.855 81.948  68.916  1.00 7.23   ? 145 HIS A NE2 1 
ATOM   919  N  N   . ALA A 1 123 ? 30.529 84.952  65.050  1.00 5.77   ? 146 ALA A N   1 
ATOM   920  C  CA  . ALA A 1 123 ? 29.815 85.900  64.185  1.00 8.15   ? 146 ALA A CA  1 
ATOM   921  C  C   . ALA A 1 123 ? 30.458 87.284  64.154  1.00 10.80  ? 146 ALA A C   1 
ATOM   922  O  O   . ALA A 1 123 ? 30.201 88.070  63.237  1.00 9.55   ? 146 ALA A O   1 
ATOM   923  C  CB  . ALA A 1 123 ? 28.339 85.999  64.601  1.00 10.54  ? 146 ALA A CB  1 
ATOM   924  N  N   . ASP A 1 124 ? 31.287 87.589  65.151  1.00 7.43   ? 147 ASP A N   1 
ATOM   925  C  CA  . ASP A 1 124 ? 32.016 88.856  65.158  1.00 7.96   ? 147 ASP A CA  1 
ATOM   926  C  C   . ASP A 1 124 ? 31.106 90.061  64.951  1.00 8.29   ? 147 ASP A C   1 
ATOM   927  O  O   . ASP A 1 124 ? 31.485 91.034  64.295  1.00 9.53   ? 147 ASP A O   1 
ATOM   928  C  CB  . ASP A 1 124 ? 33.134 88.831  64.103  1.00 8.23   ? 147 ASP A CB  1 
ATOM   929  C  CG  . ASP A 1 124 ? 34.191 87.805  64.421  1.00 8.71   ? 147 ASP A CG  1 
ATOM   930  O  OD1 . ASP A 1 124 ? 34.044 87.156  65.472  1.00 7.06   ? 147 ASP A OD1 1 
ATOM   931  O  OD2 . ASP A 1 124 ? 35.167 87.659  63.653  1.00 8.27   ? 147 ASP A OD2 1 
ATOM   932  N  N   . ILE A 1 125 ? 29.900 89.987  65.505  1.00 8.55   ? 148 ILE A N   1 
ATOM   933  C  CA  . ILE A 1 125 ? 28.889 91.000  65.217  1.00 9.26   ? 148 ILE A CA  1 
ATOM   934  C  C   . ILE A 1 125 ? 28.358 91.656  66.499  1.00 11.86  ? 148 ILE A C   1 
ATOM   935  O  O   . ILE A 1 125 ? 27.345 92.365  66.489  1.00 9.32   ? 148 ILE A O   1 
ATOM   936  C  CB  . ILE A 1 125 ? 27.747 90.404  64.347  1.00 7.27   ? 148 ILE A CB  1 
ATOM   937  C  CG1 . ILE A 1 125 ? 26.930 91.502  63.661  1.00 9.67   ? 148 ILE A CG1 1 
ATOM   938  C  CG2 . ILE A 1 125 ? 26.840 89.501  65.179  1.00 9.60   ? 148 ILE A CG2 1 
ATOM   939  C  CD1 . ILE A 1 125 ? 25.963 90.941  62.608  1.00 10.92  ? 148 ILE A CD1 1 
ATOM   940  N  N   . ASN A 1 126 ? 29.062 91.451  67.608  1.00 11.71  ? 149 ASN A N   1 
ATOM   941  C  CA  . ASN A 1 126 ? 28.766 92.248  68.793  1.00 10.00  ? 149 ASN A CA  1 
ATOM   942  C  C   . ASN A 1 126 ? 28.959 93.714  68.472  1.00 9.07   ? 149 ASN A C   1 
ATOM   943  O  O   . ASN A 1 126 ? 29.745 94.069  67.591  1.00 10.25  ? 149 ASN A O   1 
ATOM   944  C  CB  . ASN A 1 126 ? 29.670 91.864  69.972  1.00 11.69  ? 149 ASN A CB  1 
ATOM   945  C  CG  . ASN A 1 126 ? 29.167 90.653  70.716  1.00 12.86  ? 149 ASN A CG  1 
ATOM   946  O  OD1 . ASN A 1 126 ? 28.059 90.668  71.255  1.00 13.26  ? 149 ASN A OD1 1 
ATOM   947  N  ND2 . ASN A 1 126 ? 29.984 89.603  70.773  1.00 10.79  ? 149 ASN A ND2 1 
ATOM   948  N  N   . THR A 1 127 ? 28.208 94.565  69.159  1.00 10.25  ? 150 THR A N   1 
ATOM   949  C  CA  . THR A 1 127 ? 28.419 96.001  69.066  1.00 10.04  ? 150 THR A CA  1 
ATOM   950  C  C   . THR A 1 127 ? 29.102 96.446  70.356  1.00 9.95   ? 150 THR A C   1 
ATOM   951  O  O   . THR A 1 127 ? 29.224 95.655  71.294  1.00 11.42  ? 150 THR A O   1 
ATOM   952  C  CB  . THR A 1 127 ? 27.087 96.745  68.915  1.00 10.42  ? 150 THR A CB  1 
ATOM   953  O  OG1 . THR A 1 127 ? 26.451 96.800  70.193  1.00 13.33  ? 150 THR A OG1 1 
ATOM   954  C  CG2 . THR A 1 127 ? 26.184 96.022  67.916  1.00 12.36  ? 150 THR A CG2 1 
ATOM   955  N  N   . PRO A 1 128 ? 29.558 97.707  70.414  1.00 9.48   ? 151 PRO A N   1 
ATOM   956  C  CA  . PRO A 1 128 ? 30.121 98.200  71.679  1.00 11.64  ? 151 PRO A CA  1 
ATOM   957  C  C   . PRO A 1 128 ? 29.150 98.121  72.856  1.00 14.60  ? 151 PRO A C   1 
ATOM   958  O  O   . PRO A 1 128 ? 29.581 98.175  74.018  1.00 12.68  ? 151 PRO A O   1 
ATOM   959  C  CB  . PRO A 1 128 ? 30.460 99.661  71.359  1.00 14.34  ? 151 PRO A CB  1 
ATOM   960  C  CG  . PRO A 1 128 ? 30.772 99.650  69.885  1.00 12.89  ? 151 PRO A CG  1 
ATOM   961  C  CD  . PRO A 1 128 ? 29.800 98.644  69.294  1.00 9.40   ? 151 PRO A CD  1 
ATOM   962  N  N   . LEU A 1 129 ? 27.859 97.989  72.565  1.00 9.73   ? 152 LEU A N   1 
ATOM   963  C  CA  . LEU A 1 129 ? 26.850 97.900  73.621  1.00 11.19  ? 152 LEU A CA  1 
ATOM   964  C  C   . LEU A 1 129 ? 26.518 96.468  73.995  1.00 13.03  ? 152 LEU A C   1 
ATOM   965  O  O   . LEU A 1 129 ? 25.836 96.227  74.984  1.00 12.59  ? 152 LEU A O   1 
ATOM   966  C  CB  . LEU A 1 129 ? 25.563 98.640  73.218  1.00 13.89  ? 152 LEU A CB  1 
ATOM   967  C  CG  . LEU A 1 129 ? 25.688 100.130 72.904  1.00 18.17  ? 152 LEU A CG  1 
ATOM   968  C  CD1 . LEU A 1 129 ? 24.316 100.699 72.543  1.00 24.11  ? 152 LEU A CD1 1 
ATOM   969  C  CD2 . LEU A 1 129 ? 26.268 100.854 74.101  1.00 20.76  ? 152 LEU A CD2 1 
ATOM   970  N  N   . THR A 1 130 ? 26.967 95.502  73.200  1.00 11.02  ? 153 THR A N   1 
ATOM   971  C  CA  . THR A 1 130 ? 26.662 94.110  73.520  1.00 11.72  ? 153 THR A CA  1 
ATOM   972  C  C   . THR A 1 130 ? 27.903 93.267  73.835  1.00 9.93   ? 153 THR A C   1 
ATOM   973  O  O   . THR A 1 130 ? 27.781 92.189  74.395  1.00 10.06  ? 153 THR A O   1 
ATOM   974  C  CB  . THR A 1 130 ? 25.841 93.401  72.410  1.00 12.68  ? 153 THR A CB  1 
ATOM   975  O  OG1 . THR A 1 130 ? 26.689 93.111  71.294  1.00 11.16  ? 153 THR A OG1 1 
ATOM   976  C  CG2 . THR A 1 130 ? 24.621 94.261  71.968  1.00 11.39  ? 153 THR A CG2 1 
ATOM   977  N  N   . THR A 1 131 ? 29.086 93.740  73.459  1.00 9.32   ? 154 THR A N   1 
ATOM   978  C  CA  . THR A 1 131 ? 30.295 92.955  73.716  1.00 9.00   ? 154 THR A CA  1 
ATOM   979  C  C   . THR A 1 131 ? 30.472 92.684  75.208  1.00 14.74  ? 154 THR A C   1 
ATOM   980  O  O   . THR A 1 131 ? 30.278 93.576  76.038  1.00 10.95  ? 154 THR A O   1 
ATOM   981  C  CB  . THR A 1 131 ? 31.568 93.618  73.182  1.00 8.78   ? 154 THR A CB  1 
ATOM   982  O  OG1 . THR A 1 131 ? 32.705 92.819  73.543  1.00 11.09  ? 154 THR A OG1 1 
ATOM   983  C  CG2 . THR A 1 131 ? 31.753 95.013  73.763  1.00 9.60   ? 154 THR A CG2 1 
ATOM   984  N  N   . SER A 1 132 ? 30.829 91.452  75.548  1.00 13.39  ? 155 SER A N   1 
ATOM   985  C  CA  . SER A 1 132 ? 31.103 91.132  76.940  1.00 13.15  ? 155 SER A CA  1 
ATOM   986  C  C   . SER A 1 132 ? 32.607 91.157  77.218  1.00 14.39  ? 155 SER A C   1 
ATOM   987  O  O   . SER A 1 132 ? 33.029 91.096  78.362  1.00 14.38  ? 155 SER A O   1 
ATOM   988  C  CB  . SER A 1 132 ? 30.505 89.772  77.312  1.00 13.55  ? 155 SER A CB  1 
ATOM   989  O  OG  . SER A 1 132 ? 31.066 88.721  76.556  1.00 16.09  ? 155 SER A OG  1 
ATOM   990  N  N   . SER A 1 133 ? 33.412 91.268  76.166  1.00 11.11  ? 156 SER A N   1 
ATOM   991  C  CA  . SER A 1 133 ? 34.861 91.175  76.298  1.00 10.71  ? 156 SER A CA  1 
ATOM   992  C  C   . SER A 1 133 ? 35.532 92.526  76.107  1.00 14.97  ? 156 SER A C   1 
ATOM   993  O  O   . SER A 1 133 ? 36.622 92.754  76.618  1.00 12.47  ? 156 SER A O   1 
ATOM   994  C  CB  . SER A 1 133 ? 35.419 90.197  75.266  1.00 14.31  ? 156 SER A CB  1 
ATOM   995  O  OG  . SER A 1 133 ? 35.284 90.738  73.964  1.00 12.72  ? 156 SER A OG  1 
ATOM   996  N  N   . GLY A 1 134 ? 34.907 93.396  75.317  1.00 11.92  ? 157 GLY A N   1 
ATOM   997  C  CA  . GLY A 1 134 ? 35.499 94.677  74.974  1.00 10.69  ? 157 GLY A CA  1 
ATOM   998  C  C   . GLY A 1 134 ? 36.501 94.591  73.841  1.00 12.65  ? 157 GLY A C   1 
ATOM   999  O  O   . GLY A 1 134 ? 37.111 95.591  73.456  1.00 12.39  ? 157 GLY A O   1 
ATOM   1000 N  N   . ASN A 1 135 ? 36.665 93.391  73.289  1.00 8.11   ? 158 ASN A N   1 
ATOM   1001 C  CA  . ASN A 1 135 ? 37.655 93.160  72.244  1.00 8.23   ? 158 ASN A CA  1 
ATOM   1002 C  C   . ASN A 1 135 ? 37.082 93.426  70.865  1.00 9.52   ? 158 ASN A C   1 
ATOM   1003 O  O   . ASN A 1 135 ? 36.100 92.803  70.468  1.00 8.46   ? 158 ASN A O   1 
ATOM   1004 C  CB  . ASN A 1 135 ? 38.191 91.731  72.330  1.00 12.55  ? 158 ASN A CB  1 
ATOM   1005 C  CG  . ASN A 1 135 ? 38.883 91.451  73.649  1.00 18.77  ? 158 ASN A CG  1 
ATOM   1006 O  OD1 . ASN A 1 135 ? 39.468 92.352  74.249  1.00 14.03  ? 158 ASN A OD1 1 
ATOM   1007 N  ND2 . ASN A 1 135 ? 38.821 90.200  74.108  1.00 13.18  ? 158 ASN A ND2 1 
ATOM   1008 N  N   . LEU A 1 136 ? 37.698 94.348  70.138  1.00 7.78   ? 159 LEU A N   1 
ATOM   1009 C  CA  . LEU A 1 136 ? 37.153 94.758  68.848  1.00 8.42   ? 159 LEU A CA  1 
ATOM   1010 C  C   . LEU A 1 136 ? 37.153 93.671  67.769  1.00 10.79  ? 159 LEU A C   1 
ATOM   1011 O  O   . LEU A 1 136 ? 36.372 93.766  66.816  1.00 9.22   ? 159 LEU A O   1 
ATOM   1012 C  CB  . LEU A 1 136 ? 37.845 96.042  68.367  1.00 9.93   ? 159 LEU A CB  1 
ATOM   1013 C  CG  . LEU A 1 136 ? 37.350 97.250  69.161  1.00 9.44   ? 159 LEU A CG  1 
ATOM   1014 C  CD1 . LEU A 1 136 ? 38.327 98.426  69.005  1.00 10.37  ? 159 LEU A CD1 1 
ATOM   1015 C  CD2 . LEU A 1 136 ? 35.954 97.657  68.676  1.00 7.74   ? 159 LEU A CD2 1 
ATOM   1016 N  N   . HIS A 1 137 ? 37.940 92.716  67.913  1.00 10.82  ? 160 HIS A N   1 
ATOM   1017 C  CA  . HIS A 1 137 ? 37.906 91.612  66.945  1.00 9.95   ? 160 HIS A CA  1 
ATOM   1018 C  C   . HIS A 1 137 ? 36.634 90.756  67.006  1.00 11.95  ? 160 HIS A C   1 
ATOM   1019 O  O   . HIS A 1 137 ? 36.454 89.883  66.161  1.00 11.26  ? 160 HIS A O   1 
ATOM   1020 C  CB  . HIS A 1 137 ? 39.132 90.694  67.059  1.00 11.47  ? 160 HIS A CB  1 
ATOM   1021 C  CG  . HIS A 1 137 ? 39.091 89.764  68.234  1.00 11.98  ? 160 HIS A CG  1 
ATOM   1022 N  ND1 . HIS A 1 137 ? 39.794 88.580  68.250  1.00 13.06  ? 160 HIS A ND1 1 
ATOM   1023 C  CD2 . HIS A 1 137 ? 38.442 89.835  69.420  1.00 12.64  ? 160 HIS A CD2 1 
ATOM   1024 C  CE1 . HIS A 1 137 ? 39.578 87.956  69.395  1.00 12.65  ? 160 HIS A CE1 1 
ATOM   1025 N  NE2 . HIS A 1 137 ? 38.768 88.698  70.128  1.00 13.05  ? 160 HIS A NE2 1 
ATOM   1026 N  N   . GLY A 1 138 ? 35.843 90.946  67.975  1.00 8.01   ? 161 GLY A N   1 
ATOM   1027 C  CA  . GLY A 1 138 ? 34.557 90.292  68.078  1.00 7.83   ? 161 GLY A CA  1 
ATOM   1028 C  C   . GLY A 1 138 ? 33.416 91.220  67.717  1.00 8.67   ? 161 GLY A C   1 
ATOM   1029 O  O   . GLY A 1 138 ? 32.254 90.875  67.895  1.00 9.63   ? 161 GLY A O   1 
ATOM   1030 N  N   . GLN A 1 139 ? 33.756 92.400  67.216  1.00 7.41   ? 162 GLN A N   1 
ATOM   1031 C  CA  . GLN A 1 139 ? 32.758 93.384  66.815  1.00 8.52   ? 162 GLN A CA  1 
ATOM   1032 C  C   . GLN A 1 139 ? 32.797 93.897  65.362  1.00 10.06  ? 162 GLN A C   1 
ATOM   1033 O  O   . GLN A 1 139 ? 31.953 94.730  65.014  1.00 11.20  ? 162 GLN A O   1 
ATOM   1034 C  CB  . GLN A 1 139 ? 32.859 94.611  67.736  1.00 10.67  ? 162 GLN A CB  1 
ATOM   1035 C  CG  . GLN A 1 139 ? 32.673 94.306  69.211  1.00 8.47   ? 162 GLN A CG  1 
ATOM   1036 C  CD  . GLN A 1 139 ? 33.073 95.484  70.083  1.00 12.16  ? 162 GLN A CD  1 
ATOM   1037 O  OE1 . GLN A 1 139 ? 32.485 96.567  69.993  1.00 9.86   ? 162 GLN A OE1 1 
ATOM   1038 N  NE2 . GLN A 1 139 ? 34.088 95.285  70.918  1.00 7.14   ? 162 GLN A NE2 1 
ATOM   1039 N  N   . PRO A 1 140 ? 33.753 93.432  64.519  1.00 9.72   ? 163 PRO A N   1 
ATOM   1040 C  CA  . PRO A 1 140 ? 33.944 94.237  63.305  1.00 9.09   ? 163 PRO A CA  1 
ATOM   1041 C  C   . PRO A 1 140 ? 32.715 94.348  62.418  1.00 10.80  ? 163 PRO A C   1 
ATOM   1042 O  O   . PRO A 1 140 ? 32.515 95.408  61.818  1.00 9.85   ? 163 PRO A O   1 
ATOM   1043 C  CB  . PRO A 1 140 ? 35.077 93.508  62.560  1.00 7.31   ? 163 PRO A CB  1 
ATOM   1044 C  CG  . PRO A 1 140 ? 34.980 92.071  63.055  1.00 7.69   ? 163 PRO A CG  1 
ATOM   1045 C  CD  . PRO A 1 140 ? 34.597 92.217  64.502  1.00 8.19   ? 163 PRO A CD  1 
ATOM   1046 N  N   . VAL A 1 141 ? 31.900 93.303  62.348  1.00 9.01   ? 164 VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 141 ? 30.750 93.335  61.452  1.00 7.11   ? 164 VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 141 ? 29.733 94.399  61.878  1.00 11.81  ? 164 VAL A C   1 
ATOM   1049 O  O   . VAL A 1 141 ? 29.032 94.971  61.042  1.00 14.12  ? 164 VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 141 ? 30.104 91.939  61.303  1.00 9.32   ? 164 VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 141 ? 28.868 91.990  60.393  1.00 6.60   ? 164 VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 141 ? 31.135 90.941  60.732  1.00 8.62   ? 164 VAL A CG2 1 
ATOM   1053 N  N   . SER A 1 142 ? 29.653 94.686  63.176  1.00 9.76   ? 165 SER A N   1 
ATOM   1054 C  CA  . SER A 1 142 ? 28.694 95.698  63.629  1.00 9.52   ? 165 SER A CA  1 
ATOM   1055 C  C   . SER A 1 142 ? 28.983 97.089  63.051  1.00 9.77   ? 165 SER A C   1 
ATOM   1056 O  O   . SER A 1 142 ? 28.063 97.880  62.840  1.00 14.05  ? 165 SER A O   1 
ATOM   1057 C  CB  . SER A 1 142 ? 28.612 95.758  65.156  1.00 8.95   ? 165 SER A CB  1 
ATOM   1058 O  OG  . SER A 1 142 ? 29.745 96.423  65.682  1.00 12.05  ? 165 SER A OG  1 
ATOM   1059 N  N   . PHE A 1 143 ? 30.246 97.398  62.787  1.00 11.16  ? 166 PHE A N   1 
ATOM   1060 C  CA  . PHE A 1 143 ? 30.572 98.711  62.245  1.00 13.61  ? 166 PHE A CA  1 
ATOM   1061 C  C   . PHE A 1 143 ? 30.346 98.797  60.740  1.00 12.88  ? 166 PHE A C   1 
ATOM   1062 O  O   . PHE A 1 143 ? 30.300 99.892  60.181  1.00 14.84  ? 166 PHE A O   1 
ATOM   1063 C  CB  . PHE A 1 143 ? 32.016 99.073  62.568  1.00 13.02  ? 166 PHE A CB  1 
ATOM   1064 C  CG  . PHE A 1 143 ? 32.315 99.023  64.033  1.00 14.54  ? 166 PHE A CG  1 
ATOM   1065 C  CD1 . PHE A 1 143 ? 31.881 100.039 64.876  1.00 12.67  ? 166 PHE A CD1 1 
ATOM   1066 C  CD2 . PHE A 1 143 ? 33.000 97.939  64.573  1.00 12.79  ? 166 PHE A CD2 1 
ATOM   1067 C  CE1 . PHE A 1 143 ? 32.135 99.985  66.238  1.00 19.62  ? 166 PHE A CE1 1 
ATOM   1068 C  CE2 . PHE A 1 143 ? 33.265 97.875  65.932  1.00 16.29  ? 166 PHE A CE2 1 
ATOM   1069 C  CZ  . PHE A 1 143 ? 32.828 98.906  66.769  1.00 13.86  ? 166 PHE A CZ  1 
ATOM   1070 N  N   . LEU A 1 144 ? 30.188 97.644  60.100  1.00 11.52  ? 167 LEU A N   1 
ATOM   1071 C  CA  . LEU A 1 144 ? 30.113 97.568  58.643  1.00 11.17  ? 167 LEU A CA  1 
ATOM   1072 C  C   . LEU A 1 144 ? 28.683 97.418  58.121  1.00 15.16  ? 167 LEU A C   1 
ATOM   1073 O  O   . LEU A 1 144 ? 28.410 97.737  56.959  1.00 12.47  ? 167 LEU A O   1 
ATOM   1074 C  CB  . LEU A 1 144 ? 30.959 96.395  58.133  1.00 10.58  ? 167 LEU A CB  1 
ATOM   1075 C  CG  . LEU A 1 144 ? 32.440 96.452  58.499  1.00 16.80  ? 167 LEU A CG  1 
ATOM   1076 C  CD1 . LEU A 1 144 ? 33.110 95.129  58.182  1.00 12.20  ? 167 LEU A CD1 1 
ATOM   1077 C  CD2 . LEU A 1 144 ? 33.122 97.599  57.763  1.00 14.22  ? 167 LEU A CD2 1 
ATOM   1078 N  N   . LEU A 1 145 ? 27.787 96.896  58.953  1.00 12.78  ? 168 LEU A N   1 
ATOM   1079 C  CA  . LEU A 1 145 ? 26.434 96.583  58.492  1.00 14.24  ? 168 LEU A CA  1 
ATOM   1080 C  C   . LEU A 1 145 ? 25.553 97.791  58.529  1.00 17.07  ? 168 LEU A C   1 
ATOM   1081 O  O   . LEU A 1 145 ? 25.388 98.360  59.586  1.00 12.81  ? 168 LEU A O   1 
ATOM   1082 C  CB  . LEU A 1 145 ? 25.751 95.521  59.357  1.00 22.66  ? 168 LEU A CB  1 
ATOM   1083 C  CG  . LEU A 1 145 ? 25.850 94.021  59.120  1.00 36.56  ? 168 LEU A CG  1 
ATOM   1084 C  CD1 . LEU A 1 145 ? 24.726 93.402  59.912  1.00 35.44  ? 168 LEU A CD1 1 
ATOM   1085 C  CD2 . LEU A 1 145 ? 25.693 93.699  57.652  1.00 27.16  ? 168 LEU A CD2 1 
ATOM   1086 N  N   . ARG A 1 146 ? 24.964 98.148  57.394  1.00 13.64  ? 169 ARG A N   1 
ATOM   1087 C  CA  . ARG A 1 146 ? 24.098 99.318  57.304  1.00 20.60  ? 169 ARG A CA  1 
ATOM   1088 C  C   . ARG A 1 146 ? 22.916 99.290  58.275  1.00 18.41  ? 169 ARG A C   1 
ATOM   1089 O  O   . ARG A 1 146 ? 22.611 100.300 58.909  1.00 17.65  ? 169 ARG A O   1 
ATOM   1090 C  CB  . ARG A 1 146 ? 23.589 99.494  55.870  1.00 21.20  ? 169 ARG A CB  1 
ATOM   1091 C  CG  . ARG A 1 146 ? 24.595 100.137 54.929  1.00 39.77  ? 169 ARG A CG  1 
ATOM   1092 C  CD  . ARG A 1 146 ? 23.973 100.429 53.573  1.00 57.81  ? 169 ARG A CD  1 
ATOM   1093 N  NE  . ARG A 1 146 ? 24.348 99.433  52.574  1.00 69.65  ? 169 ARG A NE  1 
ATOM   1094 C  CZ  . ARG A 1 146 ? 25.267 99.627  51.633  1.00 67.34  ? 169 ARG A CZ  1 
ATOM   1095 N  NH1 . ARG A 1 146 ? 25.910 100.784 51.560  1.00 63.37  ? 169 ARG A NH1 1 
ATOM   1096 N  NH2 . ARG A 1 146 ? 25.543 98.663  50.765  1.00 64.46  ? 169 ARG A NH2 1 
ATOM   1097 N  N   . GLU A 1 147 ? 22.245 98.146  58.386  1.00 14.13  ? 170 GLU A N   1 
ATOM   1098 C  CA  . GLU A 1 147 ? 21.032 98.072  59.199  1.00 18.75  ? 170 GLU A CA  1 
ATOM   1099 C  C   . GLU A 1 147 ? 21.250 98.266  60.704  1.00 21.59  ? 170 GLU A C   1 
ATOM   1100 O  O   . GLU A 1 147 ? 20.311 98.551  61.436  1.00 20.17  ? 170 GLU A O   1 
ATOM   1101 C  CB  . GLU A 1 147 ? 20.301 96.755  58.929  1.00 20.77  ? 170 GLU A CB  1 
ATOM   1102 C  CG  . GLU A 1 147 ? 19.639 96.681  57.547  1.00 23.41  ? 170 GLU A CG  1 
ATOM   1103 C  CD  . GLU A 1 147 ? 20.603 96.262  56.448  1.00 29.62  ? 170 GLU A CD  1 
ATOM   1104 O  OE1 . GLU A 1 147 ? 21.814 96.148  56.727  1.00 22.96  ? 170 GLU A OE1 1 
ATOM   1105 O  OE2 . GLU A 1 147 ? 20.151 96.042  55.302  1.00 29.09  ? 170 GLU A OE2 1 
ATOM   1106 N  N   . LEU A 1 148 ? 22.482 98.112  61.170  1.00 18.81  ? 171 LEU A N   1 
ATOM   1107 C  CA  . LEU A 1 148 ? 22.758 98.191  62.604  1.00 20.52  ? 171 LEU A CA  1 
ATOM   1108 C  C   . LEU A 1 148 ? 23.216 99.568  63.116  1.00 22.65  ? 171 LEU A C   1 
ATOM   1109 O  O   . LEU A 1 148 ? 23.421 99.707  64.318  1.00 22.99  ? 171 LEU A O   1 
ATOM   1110 C  CB  . LEU A 1 148 ? 23.858 97.176  62.960  1.00 22.20  ? 171 LEU A CB  1 
ATOM   1111 C  CG  . LEU A 1 148 ? 23.560 95.775  63.483  1.00 27.21  ? 171 LEU A CG  1 
ATOM   1112 C  CD1 . LEU A 1 148 ? 22.671 95.051  62.503  1.00 44.75  ? 171 LEU A CD1 1 
ATOM   1113 C  CD2 . LEU A 1 148 ? 24.871 95.002  63.664  1.00 18.16  ? 171 LEU A CD2 1 
ATOM   1114 N  N   . GLN A 1 149 ? 23.345 100.549 62.231  1.00 17.05  ? 172 GLN A N   1 
ATOM   1115 C  CA  A GLN A 1 149 ? 23.831 101.898 62.480  0.36 24.90  ? 172 GLN A CA  1 
ATOM   1116 C  CA  B GLN A 1 149 ? 24.104 101.705 62.697  0.64 24.88  ? 172 GLN A CA  1 
ATOM   1117 C  C   . GLN A 1 149 ? 23.392 102.553 63.754  1.00 28.52  ? 172 GLN A C   1 
ATOM   1118 O  O   . GLN A 1 149 ? 24.079 103.179 64.556  1.00 25.59  ? 172 GLN A O   1 
ATOM   1119 C  CB  A GLN A 1 149 ? 23.318 102.853 61.400  0.36 28.11  ? 172 GLN A CB  1 
ATOM   1120 C  CB  B GLN A 1 149 ? 24.515 102.585 61.512  0.64 28.10  ? 172 GLN A CB  1 
ATOM   1121 C  CG  A GLN A 1 149 ? 24.399 103.716 60.770  0.36 30.17  ? 172 GLN A CG  1 
ATOM   1122 C  CG  B GLN A 1 149 ? 25.610 101.974 60.652  0.64 27.23  ? 172 GLN A CG  1 
ATOM   1123 C  CD  A GLN A 1 149 ? 24.087 104.084 59.332  0.36 33.34  ? 172 GLN A CD  1 
ATOM   1124 C  CD  B GLN A 1 149 ? 26.690 101.308 61.483  0.64 31.60  ? 172 GLN A CD  1 
ATOM   1125 O  OE1 A GLN A 1 149 ? 24.741 104.945 58.744  0.36 34.50  ? 172 GLN A OE1 1 
ATOM   1126 O  OE1 B GLN A 1 149 ? 27.520 101.980 62.091  0.64 19.04  ? 172 GLN A OE1 1 
ATOM   1127 N  NE2 A GLN A 1 149 ? 23.083 103.431 58.759  0.36 17.54  ? 172 GLN A NE2 1 
ATOM   1128 N  NE2 B GLN A 1 149 ? 26.680 99.979  61.516  0.64 15.03  ? 172 GLN A NE2 1 
ATOM   1129 N  N   . ASP A 1 150 ? 22.071 102.453 63.861  1.00 25.89  ? 173 ASP A N   1 
ATOM   1130 C  CA  . ASP A 1 150 ? 21.339 103.184 64.892  1.00 33.27  ? 173 ASP A CA  1 
ATOM   1131 C  C   . ASP A 1 150 ? 21.572 102.558 66.264  1.00 34.21  ? 173 ASP A C   1 
ATOM   1132 O  O   . ASP A 1 150 ? 21.235 103.145 67.291  1.00 33.62  ? 173 ASP A O   1 
ATOM   1133 C  CB  . ASP A 1 150 ? 19.840 103.295 64.569  1.00 38.05  ? 173 ASP A CB  1 
ATOM   1134 C  CG  . ASP A 1 150 ? 19.162 101.939 64.439  1.00 49.07  ? 173 ASP A CG  1 
ATOM   1135 O  OD1 . ASP A 1 150 ? 19.877 100.929 64.246  1.00 50.96  ? 173 ASP A OD1 1 
ATOM   1136 O  OD2 . ASP A 1 150 ? 17.916 101.878 64.551  1.00 57.64  ? 173 ASP A OD2 1 
ATOM   1137 N  N   . LYS A 1 151 ? 22.177 101.371 66.276  1.00 23.27  ? 174 LYS A N   1 
ATOM   1138 C  CA  . LYS A 1 151 ? 22.463 100.685 67.528  1.00 20.40  ? 174 LYS A CA  1 
ATOM   1139 C  C   . LYS A 1 151 ? 23.950 100.691 67.859  1.00 23.68  ? 174 LYS A C   1 
ATOM   1140 O  O   . LYS A 1 151 ? 24.364 100.153 68.887  1.00 25.29  ? 174 LYS A O   1 
ATOM   1141 C  CB  . LYS A 1 151 ? 21.921 99.250  67.486  1.00 25.94  ? 174 LYS A CB  1 
ATOM   1142 C  CG  . LYS A 1 151 ? 20.416 99.188  67.259  1.00 30.17  ? 174 LYS A CG  1 
ATOM   1143 C  CD  . LYS A 1 151 ? 19.654 99.400  68.556  1.00 37.23  ? 174 LYS A CD  1 
ATOM   1144 C  CE  . LYS A 1 151 ? 18.148 99.318  68.346  1.00 38.28  ? 174 LYS A CE  1 
ATOM   1145 N  NZ  . LYS A 1 151 ? 17.796 99.321  66.903  1.00 42.61  ? 174 LYS A NZ  1 
ATOM   1146 N  N   . VAL A 1 152 ? 24.751 101.299 66.991  1.00 19.87  ? 175 VAL A N   1 
ATOM   1147 C  CA  . VAL A 1 152 ? 26.199 101.295 67.179  1.00 18.65  ? 175 VAL A CA  1 
ATOM   1148 C  C   . VAL A 1 152 ? 26.709 102.688 67.518  1.00 21.24  ? 175 VAL A C   1 
ATOM   1149 O  O   . VAL A 1 152 ? 26.710 103.571 66.671  1.00 20.83  ? 175 VAL A O   1 
ATOM   1150 C  CB  . VAL A 1 152 ? 26.913 100.772 65.909  1.00 17.76  ? 175 VAL A CB  1 
ATOM   1151 C  CG1 . VAL A 1 152 ? 28.429 100.876 66.043  1.00 19.18  ? 175 VAL A CG1 1 
ATOM   1152 C  CG2 . VAL A 1 152 ? 26.477 99.341  65.614  1.00 18.10  ? 175 VAL A CG2 1 
ATOM   1153 N  N   . PRO A 1 153 ? 27.175 102.875 68.764  1.00 20.70  ? 176 PRO A N   1 
ATOM   1154 C  CA  . PRO A 1 153 ? 27.692 104.187 69.167  1.00 18.16  ? 176 PRO A CA  1 
ATOM   1155 C  C   . PRO A 1 153 ? 28.974 104.523 68.431  1.00 20.68  ? 176 PRO A C   1 
ATOM   1156 O  O   . PRO A 1 153 ? 29.647 103.629 67.898  1.00 17.22  ? 176 PRO A O   1 
ATOM   1157 C  CB  . PRO A 1 153 ? 27.962 104.030 70.675  1.00 24.17  ? 176 PRO A CB  1 
ATOM   1158 C  CG  . PRO A 1 153 ? 28.050 102.561 70.918  1.00 21.30  ? 176 PRO A CG  1 
ATOM   1159 C  CD  . PRO A 1 153 ? 27.274 101.865 69.836  1.00 19.43  ? 176 PRO A CD  1 
ATOM   1160 N  N   . GLN A 1 154 ? 29.307 105.807 68.395  1.00 19.33  ? 177 GLN A N   1 
ATOM   1161 C  CA  . GLN A 1 154 ? 30.480 106.248 67.671  1.00 21.36  ? 177 GLN A CA  1 
ATOM   1162 C  C   . GLN A 1 154 ? 31.676 106.138 68.603  1.00 24.50  ? 177 GLN A C   1 
ATOM   1163 O  O   . GLN A 1 154 ? 31.697 106.763 69.664  1.00 22.56  ? 177 GLN A O   1 
ATOM   1164 C  CB  . GLN A 1 154 ? 30.330 107.691 67.190  1.00 25.93  ? 177 GLN A CB  1 
ATOM   1165 C  CG  . GLN A 1 154 ? 31.311 108.035 66.069  1.00 36.74  ? 177 GLN A CG  1 
ATOM   1166 C  CD  . GLN A 1 154 ? 30.875 107.421 64.743  1.00 54.85  ? 177 GLN A CD  1 
ATOM   1167 O  OE1 . GLN A 1 154 ? 31.530 106.523 64.209  1.00 60.87  ? 177 GLN A OE1 1 
ATOM   1168 N  NE2 . GLN A 1 154 ? 29.767 107.920 64.199  1.00 58.83  ? 177 GLN A NE2 1 
ATOM   1169 N  N   . LEU A 1 155 ? 32.652 105.324 68.218  1.00 12.98  ? 178 LEU A N   1 
ATOM   1170 C  CA  . LEU A 1 155 ? 33.877 105.152 69.004  1.00 16.17  ? 178 LEU A CA  1 
ATOM   1171 C  C   . LEU A 1 155 ? 34.928 106.165 68.571  1.00 14.55  ? 178 LEU A C   1 
ATOM   1172 O  O   . LEU A 1 155 ? 34.958 106.575 67.405  1.00 13.87  ? 178 LEU A O   1 
ATOM   1173 C  CB  . LEU A 1 155 ? 34.439 103.734 68.812  1.00 17.41  ? 178 LEU A CB  1 
ATOM   1174 C  CG  . LEU A 1 155 ? 33.970 102.631 69.772  1.00 21.51  ? 178 LEU A CG  1 
ATOM   1175 C  CD1 . LEU A 1 155 ? 32.493 102.698 70.028  1.00 30.49  ? 178 LEU A CD1 1 
ATOM   1176 C  CD2 . LEU A 1 155 ? 34.347 101.274 69.176  1.00 18.45  ? 178 LEU A CD2 1 
ATOM   1177 N  N   . PRO A 1 156 ? 35.808 106.565 69.502  1.00 14.03  ? 179 PRO A N   1 
ATOM   1178 C  CA  . PRO A 1 156 ? 36.925 107.433 69.114  1.00 19.78  ? 179 PRO A CA  1 
ATOM   1179 C  C   . PRO A 1 156 ? 37.835 106.712 68.119  1.00 19.27  ? 179 PRO A C   1 
ATOM   1180 O  O   . PRO A 1 156 ? 38.184 105.556 68.352  1.00 15.94  ? 179 PRO A O   1 
ATOM   1181 C  CB  . PRO A 1 156 ? 37.660 107.693 70.440  1.00 16.16  ? 179 PRO A CB  1 
ATOM   1182 C  CG  . PRO A 1 156 ? 37.260 106.578 71.339  1.00 15.12  ? 179 PRO A CG  1 
ATOM   1183 C  CD  . PRO A 1 156 ? 35.852 106.198 70.928  1.00 15.14  ? 179 PRO A CD  1 
ATOM   1184 N  N   . GLY A 1 157 ? 38.178 107.378 67.020  1.00 13.03  ? 180 GLY A N   1 
ATOM   1185 C  CA  . GLY A 1 157 ? 38.987 106.781 65.972  1.00 14.91  ? 180 GLY A CA  1 
ATOM   1186 C  C   . GLY A 1 157 ? 38.185 106.070 64.889  1.00 16.03  ? 180 GLY A C   1 
ATOM   1187 O  O   . GLY A 1 157 ? 38.750 105.610 63.889  1.00 15.22  ? 180 GLY A O   1 
ATOM   1188 N  N   . PHE A 1 158 ? 36.870 106.007 65.072  1.00 14.25  ? 181 PHE A N   1 
ATOM   1189 C  CA  . PHE A 1 158 ? 36.002 105.285 64.155  1.00 16.83  ? 181 PHE A CA  1 
ATOM   1190 C  C   . PHE A 1 158 ? 35.147 106.195 63.272  1.00 19.63  ? 181 PHE A C   1 
ATOM   1191 O  O   . PHE A 1 158 ? 34.380 105.702 62.453  1.00 17.96  ? 181 PHE A O   1 
ATOM   1192 C  CB  . PHE A 1 158 ? 35.081 104.332 64.943  1.00 15.57  ? 181 PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1 158 ? 35.714 103.009 65.290  1.00 15.45  ? 181 PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1 158 ? 36.900 102.949 66.019  1.00 16.19  ? 181 PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1 158 ? 35.094 101.819 64.921  1.00 17.70  ? 181 PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1 158 ? 37.486 101.715 66.336  1.00 14.78  ? 181 PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1 158 ? 35.660 100.578 65.236  1.00 18.03  ? 181 PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1 158 ? 36.865 100.529 65.946  1.00 13.95  ? 181 PHE A CZ  1 
ATOM   1199 N  N   . SER A 1 159 ? 35.293 107.513 63.392  1.00 17.94  ? 182 SER A N   1 
ATOM   1200 C  CA  . SER A 1 159 ? 34.369 108.399 62.676  1.00 27.59  ? 182 SER A CA  1 
ATOM   1201 C  C   . SER A 1 159 ? 34.488 108.304 61.151  1.00 18.85  ? 182 SER A C   1 
ATOM   1202 O  O   . SER A 1 159 ? 33.529 108.590 60.445  1.00 19.82  ? 182 SER A O   1 
ATOM   1203 C  CB  . SER A 1 159 ? 34.501 109.859 63.139  1.00 25.02  ? 182 SER A CB  1 
ATOM   1204 O  OG  . SER A 1 159 ? 35.707 110.424 62.666  1.00 26.65  ? 182 SER A OG  1 
ATOM   1205 N  N   . TRP A 1 160 ? 35.648 107.883 60.647  1.00 18.11  ? 183 TRP A N   1 
ATOM   1206 C  CA  . TRP A 1 160 ? 35.865 107.748 59.200  1.00 13.30  ? 183 TRP A CA  1 
ATOM   1207 C  C   . TRP A 1 160 ? 35.060 106.611 58.567  1.00 16.85  ? 183 TRP A C   1 
ATOM   1208 O  O   . TRP A 1 160 ? 34.935 106.537 57.344  1.00 16.09  ? 183 TRP A O   1 
ATOM   1209 C  CB  . TRP A 1 160 ? 37.350 107.514 58.904  1.00 18.81  ? 183 TRP A CB  1 
ATOM   1210 C  CG  . TRP A 1 160 ? 37.843 106.212 59.482  1.00 19.60  ? 183 TRP A CG  1 
ATOM   1211 C  CD1 . TRP A 1 160 ? 38.291 105.997 60.755  1.00 17.77  ? 183 TRP A CD1 1 
ATOM   1212 C  CD2 . TRP A 1 160 ? 37.912 104.945 58.808  1.00 14.71  ? 183 TRP A CD2 1 
ATOM   1213 N  NE1 . TRP A 1 160 ? 38.642 104.672 60.914  1.00 15.20  ? 183 TRP A NE1 1 
ATOM   1214 C  CE2 . TRP A 1 160 ? 38.419 104.006 59.737  1.00 19.88  ? 183 TRP A CE2 1 
ATOM   1215 C  CE3 . TRP A 1 160 ? 37.599 104.512 57.516  1.00 15.95  ? 183 TRP A CE3 1 
ATOM   1216 C  CZ2 . TRP A 1 160 ? 38.615 102.655 59.406  1.00 14.13  ? 183 TRP A CZ2 1 
ATOM   1217 C  CZ3 . TRP A 1 160 ? 37.803 103.171 57.185  1.00 16.43  ? 183 TRP A CZ3 1 
ATOM   1218 C  CH2 . TRP A 1 160 ? 38.302 102.260 58.128  1.00 11.78  ? 183 TRP A CH2 1 
ATOM   1219 N  N   . ILE A 1 161 ? 34.554 105.698 59.387  1.00 14.24  ? 184 ILE A N   1 
ATOM   1220 C  CA  . ILE A 1 161 ? 33.893 104.504 58.853  1.00 20.20  ? 184 ILE A CA  1 
ATOM   1221 C  C   . ILE A 1 161 ? 32.492 104.813 58.344  1.00 24.49  ? 184 ILE A C   1 
ATOM   1222 O  O   . ILE A 1 161 ? 31.685 105.413 59.055  1.00 31.49  ? 184 ILE A O   1 
ATOM   1223 C  CB  . ILE A 1 161 ? 33.786 103.393 59.918  1.00 22.96  ? 184 ILE A CB  1 
ATOM   1224 C  CG1 . ILE A 1 161 ? 35.177 102.954 60.361  1.00 21.34  ? 184 ILE A CG1 1 
ATOM   1225 C  CG2 . ILE A 1 161 ? 33.008 102.199 59.380  1.00 25.07  ? 184 ILE A CG2 1 
ATOM   1226 C  CD1 . ILE A 1 161 ? 35.159 102.036 61.552  1.00 27.91  ? 184 ILE A CD1 1 
ATOM   1227 N  N   . LYS A 1 162 ? 32.205 104.409 57.111  1.00 21.61  ? 185 LYS A N   1 
ATOM   1228 C  CA  . LYS A 1 162 ? 30.824 104.403 56.647  1.00 27.08  ? 185 LYS A CA  1 
ATOM   1229 C  C   . LYS A 1 162 ? 30.428 102.967 56.390  1.00 23.67  ? 185 LYS A C   1 
ATOM   1230 O  O   . LYS A 1 162 ? 31.057 102.280 55.582  1.00 27.23  ? 185 LYS A O   1 
ATOM   1231 C  CB  . LYS A 1 162 ? 30.639 105.246 55.379  1.00 31.17  ? 185 LYS A CB  1 
ATOM   1232 C  CG  . LYS A 1 162 ? 31.758 105.109 54.362  1.00 38.64  ? 185 LYS A CG  1 
ATOM   1233 C  CD  . LYS A 1 162 ? 31.966 106.405 53.582  1.00 47.08  ? 185 LYS A CD  1 
ATOM   1234 C  CE  . LYS A 1 162 ? 32.002 107.609 54.502  1.00 51.34  ? 185 LYS A CE  1 
ATOM   1235 N  NZ  . LYS A 1 162 ? 32.340 108.859 53.769  1.00 49.59  ? 185 LYS A NZ  1 
ATOM   1236 N  N   . PRO A 1 163 ? 29.378 102.510 57.077  1.00 19.03  ? 186 PRO A N   1 
ATOM   1237 C  CA  . PRO A 1 163 ? 28.837 101.159 56.890  1.00 21.86  ? 186 PRO A CA  1 
ATOM   1238 C  C   . PRO A 1 163 ? 28.600 100.878 55.407  1.00 26.66  ? 186 PRO A C   1 
ATOM   1239 O  O   . PRO A 1 163 ? 28.019 101.703 54.713  1.00 21.23  ? 186 PRO A O   1 
ATOM   1240 C  CB  . PRO A 1 163 ? 27.514 101.204 57.662  1.00 26.51  ? 186 PRO A CB  1 
ATOM   1241 C  CG  . PRO A 1 163 ? 27.261 102.678 57.922  1.00 35.05  ? 186 PRO A CG  1 
ATOM   1242 C  CD  . PRO A 1 163 ? 28.602 103.276 58.060  1.00 22.17  ? 186 PRO A CD  1 
ATOM   1243 N  N   . CYS A 1 164 ? 29.083 99.743  54.913  1.00 21.74  ? 187 CYS A N   1 
ATOM   1244 C  CA  . CYS A 1 164 ? 29.124 99.529  53.466  1.00 25.48  ? 187 CYS A CA  1 
ATOM   1245 C  C   . CYS A 1 164 ? 28.519 98.201  53.035  1.00 25.13  ? 187 CYS A C   1 
ATOM   1246 O  O   . CYS A 1 164 ? 28.585 97.820  51.866  1.00 35.75  ? 187 CYS A O   1 
ATOM   1247 C  CB  . CYS A 1 164 ? 30.559 99.663  52.968  1.00 22.60  ? 187 CYS A CB  1 
ATOM   1248 S  SG  . CYS A 1 164 ? 31.719 98.776  54.025  1.00 24.48  ? 187 CYS A SG  1 
ATOM   1249 N  N   . ILE A 1 165 ? 27.930 97.491  53.988  1.00 19.64  ? 188 ILE A N   1 
ATOM   1250 C  CA  . ILE A 1 165 ? 27.423 96.173  53.781  1.00 21.34  ? 188 ILE A CA  1 
ATOM   1251 C  C   . ILE A 1 165 ? 25.963 96.113  54.228  1.00 21.45  ? 188 ILE A C   1 
ATOM   1252 O  O   . ILE A 1 165 ? 25.670 96.497  55.311  1.00 23.00  ? 188 ILE A O   1 
ATOM   1253 C  CB  . ILE A 1 165 ? 28.287 95.127  54.555  1.00 21.91  ? 188 ILE A CB  1 
ATOM   1254 C  CG1 . ILE A 1 165 ? 29.676 95.046  53.971  1.00 31.17  ? 188 ILE A CG1 1 
ATOM   1255 C  CG2 . ILE A 1 165 ? 27.661 93.765  54.555  1.00 27.55  ? 188 ILE A CG2 1 
ATOM   1256 C  CD1 . ILE A 1 165 ? 29.729 95.335  52.498  1.00 42.05  ? 188 ILE A CD1 1 
ATOM   1257 N  N   . SER A 1 166 ? 25.136 95.595  53.376  1.00 17.45  ? 189 SER A N   1 
ATOM   1258 C  CA  . SER A 1 166 ? 23.846 95.362  53.872  1.00 21.77  ? 189 SER A CA  1 
ATOM   1259 C  C   . SER A 1 166 ? 23.628 93.977  54.459  1.00 19.53  ? 189 SER A C   1 
ATOM   1260 O  O   . SER A 1 166 ? 24.369 93.137  54.112  1.00 15.52  ? 189 SER A O   1 
ATOM   1261 C  CB  . SER A 1 166 ? 22.891 95.594  52.768  1.00 22.40  ? 189 SER A CB  1 
ATOM   1262 O  OG  . SER A 1 166 ? 21.758 94.852  52.944  1.00 28.91  ? 189 SER A OG  1 
ATOM   1263 N  N   . SER A 1 167 ? 22.632 93.765  55.279  1.00 17.26  ? 190 SER A N   1 
ATOM   1264 C  CA  . SER A 1 167 ? 22.490 92.500  55.980  1.00 17.42  ? 190 SER A CA  1 
ATOM   1265 C  C   . SER A 1 167 ? 22.255 91.353  55.004  1.00 24.70  ? 190 SER A C   1 
ATOM   1266 O  O   . SER A 1 167 ? 22.532 90.203  55.330  1.00 16.31  ? 190 SER A O   1 
ATOM   1267 C  CB  . SER A 1 167 ? 21.348 92.578  56.998  1.00 23.73  ? 190 SER A CB  1 
ATOM   1268 O  OG  . SER A 1 167 ? 20.122 92.862  56.352  1.00 31.24  ? 190 SER A OG  1 
ATOM   1269 N  N   . ALA A 1 168 ? 21.755 91.661  53.806  1.00 14.72  ? 191 ALA A N   1 
ATOM   1270 C  CA  . ALA A 1 168 ? 21.510 90.620  52.803  1.00 17.06  ? 191 ALA A CA  1 
ATOM   1271 C  C   . ALA A 1 168 ? 22.773 90.261  52.042  1.00 13.22  ? 191 ALA A C   1 
ATOM   1272 O  O   . ALA A 1 168 ? 22.772 89.330  51.227  1.00 15.07  ? 191 ALA A O   1 
ATOM   1273 C  CB  . ALA A 1 168 ? 20.416 91.066  51.814  1.00 19.30  ? 191 ALA A CB  1 
ATOM   1274 N  N   . SER A 1 169 ? 23.853 90.987  52.308  1.00 7.82   ? 192 SER A N   1 
ATOM   1275 C  CA  . SER A 1 169 ? 25.075 90.846  51.520  1.00 11.25  ? 192 SER A CA  1 
ATOM   1276 C  C   . SER A 1 169 ? 26.235 90.154  52.233  1.00 9.81   ? 192 SER A C   1 
ATOM   1277 O  O   . SER A 1 169 ? 27.363 90.180  51.750  1.00 9.95   ? 192 SER A O   1 
ATOM   1278 C  CB  . SER A 1 169 ? 25.542 92.214  51.023  1.00 12.21  ? 192 SER A CB  1 
ATOM   1279 O  OG  . SER A 1 169 ? 24.644 92.708  50.046  1.00 17.24  ? 192 SER A OG  1 
ATOM   1280 N  N   . ILE A 1 170 ? 25.960 89.573  53.389  1.00 10.22  ? 193 ILE A N   1 
ATOM   1281 C  CA  . ILE A 1 170 ? 26.965 88.794  54.100  1.00 8.37   ? 193 ILE A CA  1 
ATOM   1282 C  C   . ILE A 1 170 ? 26.367 87.443  54.465  1.00 7.27   ? 193 ILE A C   1 
ATOM   1283 O  O   . ILE A 1 170 ? 25.205 87.355  54.878  1.00 9.55   ? 193 ILE A O   1 
ATOM   1284 C  CB  . ILE A 1 170 ? 27.501 89.538  55.354  1.00 10.05  ? 193 ILE A CB  1 
ATOM   1285 C  CG1 . ILE A 1 170 ? 28.510 88.661  56.116  1.00 9.64   ? 193 ILE A CG1 1 
ATOM   1286 C  CG2 . ILE A 1 170 ? 26.360 89.929  56.284  1.00 11.41  ? 193 ILE A CG2 1 
ATOM   1287 C  CD1 . ILE A 1 170 ? 29.239 89.411  57.237  1.00 9.96   ? 193 ILE A CD1 1 
ATOM   1288 N  N   . VAL A 1 171 ? 27.151 86.385  54.256  1.00 6.67   ? 194 VAL A N   1 
ATOM   1289 C  CA  . VAL A 1 171 ? 26.776 85.046  54.700  1.00 8.27   ? 194 VAL A CA  1 
ATOM   1290 C  C   . VAL A 1 171 ? 27.901 84.470  55.556  1.00 7.09   ? 194 VAL A C   1 
ATOM   1291 O  O   . VAL A 1 171 ? 29.067 84.550  55.187  1.00 7.76   ? 194 VAL A O   1 
ATOM   1292 C  CB  . VAL A 1 171 ? 26.535 84.099  53.501  1.00 10.67  ? 194 VAL A CB  1 
ATOM   1293 C  CG1 . VAL A 1 171 ? 26.261 82.680  53.996  1.00 11.07  ? 194 VAL A CG1 1 
ATOM   1294 C  CG2 . VAL A 1 171 ? 25.388 84.599  52.660  1.00 11.74  ? 194 VAL A CG2 1 
ATOM   1295 N  N   . TYR A 1 172 ? 27.544 83.937  56.714  1.00 7.19   ? 195 TYR A N   1 
ATOM   1296 C  CA  . TYR A 1 172 ? 28.499 83.277  57.582  1.00 9.10   ? 195 TYR A CA  1 
ATOM   1297 C  C   . TYR A 1 172 ? 28.517 81.796  57.330  1.00 9.33   ? 195 TYR A C   1 
ATOM   1298 O  O   . TYR A 1 172 ? 27.466 81.204  57.100  1.00 7.86   ? 195 TYR A O   1 
ATOM   1299 C  CB  . TYR A 1 172 ? 28.085 83.449  59.022  1.00 5.35   ? 195 TYR A CB  1 
ATOM   1300 C  CG  . TYR A 1 172 ? 28.207 84.840  59.566  1.00 7.17   ? 195 TYR A CG  1 
ATOM   1301 C  CD1 . TYR A 1 172 ? 29.404 85.279  60.119  1.00 8.46   ? 195 TYR A CD1 1 
ATOM   1302 C  CD2 . TYR A 1 172 ? 27.120 85.702  59.568  1.00 9.14   ? 195 TYR A CD2 1 
ATOM   1303 C  CE1 . TYR A 1 172 ? 29.521 86.544  60.656  1.00 6.32   ? 195 TYR A CE1 1 
ATOM   1304 C  CE2 . TYR A 1 172 ? 27.230 86.984  60.094  1.00 9.86   ? 195 TYR A CE2 1 
ATOM   1305 C  CZ  . TYR A 1 172 ? 28.431 87.388  60.640  1.00 10.39  ? 195 TYR A CZ  1 
ATOM   1306 O  OH  . TYR A 1 172 ? 28.552 88.645  61.189  1.00 11.55  ? 195 TYR A OH  1 
ATOM   1307 N  N   . ILE A 1 173 ? 29.703 81.197  57.435  1.00 7.47   ? 196 ILE A N   1 
ATOM   1308 C  CA  . ILE A 1 173 ? 29.845 79.744  57.372  1.00 7.11   ? 196 ILE A CA  1 
ATOM   1309 C  C   . ILE A 1 173 ? 30.746 79.284  58.501  1.00 9.13   ? 196 ILE A C   1 
ATOM   1310 O  O   . ILE A 1 173 ? 31.848 79.804  58.656  1.00 8.17   ? 196 ILE A O   1 
ATOM   1311 C  CB  . ILE A 1 173 ? 30.482 79.276  56.052  1.00 11.15  ? 196 ILE A CB  1 
ATOM   1312 C  CG1 . ILE A 1 173 ? 29.674 79.780  54.842  1.00 7.71   ? 196 ILE A CG1 1 
ATOM   1313 C  CG2 . ILE A 1 173 ? 30.608 77.745  56.044  1.00 9.55   ? 196 ILE A CG2 1 
ATOM   1314 C  CD1 . ILE A 1 173 ? 30.348 79.536  53.511  1.00 6.72   ? 196 ILE A CD1 1 
ATOM   1315 N  N   . GLY A 1 174 ? 30.297 78.343  59.294  1.00 6.63   ? 197 GLY A N   1 
ATOM   1316 C  CA  . GLY A 1 174 ? 31.166 77.777  60.308  1.00 9.77   ? 197 GLY A CA  1 
ATOM   1317 C  C   . GLY A 1 174 ? 30.774 78.010  61.741  1.00 9.64   ? 197 GLY A C   1 
ATOM   1318 O  O   . GLY A 1 174 ? 31.398 77.506  62.628  1.00 10.16  ? 197 GLY A O   1 
ATOM   1319 N  N   . LEU A 1 175 ? 29.731 78.793  61.929  1.00 7.60   ? 198 LEU A N   1 
ATOM   1320 C  CA  . LEU A 1 175 ? 29.412 79.315  63.260  1.00 8.52   ? 198 LEU A CA  1 
ATOM   1321 C  C   . LEU A 1 175 ? 29.094 78.283  64.323  1.00 9.77   ? 198 LEU A C   1 
ATOM   1322 O  O   . LEU A 1 175 ? 28.190 77.460  64.152  1.00 8.23   ? 198 LEU A O   1 
ATOM   1323 C  CB  . LEU A 1 175 ? 28.172 80.203  63.222  1.00 10.22  ? 198 LEU A CB  1 
ATOM   1324 C  CG  . LEU A 1 175 ? 28.252 81.449  62.353  1.00 10.43  ? 198 LEU A CG  1 
ATOM   1325 C  CD1 . LEU A 1 175 ? 26.991 82.285  62.543  1.00 10.57  ? 198 LEU A CD1 1 
ATOM   1326 C  CD2 . LEU A 1 175 ? 29.469 82.244  62.768  1.00 9.28   ? 198 LEU A CD2 1 
ATOM   1327 N  N   . ARG A 1 176 ? 29.799 78.362  65.444  1.00 9.45   ? 199 ARG A N   1 
ATOM   1328 C  CA  . ARG A 1 176 ? 29.503 77.471  66.561  1.00 9.64   ? 199 ARG A CA  1 
ATOM   1329 C  C   . ARG A 1 176 ? 29.675 78.080  67.945  1.00 11.16  ? 199 ARG A C   1 
ATOM   1330 O  O   . ARG A 1 176 ? 29.493 77.405  68.956  1.00 16.35  ? 199 ARG A O   1 
ATOM   1331 C  CB  . ARG A 1 176 ? 30.366 76.232  66.390  1.00 7.64   ? 199 ARG A CB  1 
ATOM   1332 C  CG  . ARG A 1 176 ? 31.863 76.517  66.325  1.00 8.28   ? 199 ARG A CG  1 
ATOM   1333 C  CD  . ARG A 1 176 ? 32.578 75.213  65.987  1.00 9.86   ? 199 ARG A CD  1 
ATOM   1334 N  NE  . ARG A 1 176 ? 34.035 75.315  65.980  1.00 7.71   ? 199 ARG A NE  1 
ATOM   1335 C  CZ  . ARG A 1 176 ? 34.743 75.803  64.976  1.00 7.53   ? 199 ARG A CZ  1 
ATOM   1336 N  NH1 . ARG A 1 176 ? 36.068 75.826  65.051  1.00 6.38   ? 199 ARG A NH1 1 
ATOM   1337 N  NH2 . ARG A 1 176 ? 34.124 76.259  63.894  1.00 6.43   ? 199 ARG A NH2 1 
ATOM   1338 N  N   . ASP A 1 177 ? 30.009 79.363  67.993  1.00 13.36  ? 200 ASP A N   1 
ATOM   1339 C  CA  . ASP A 1 177 ? 30.180 80.039  69.273  1.00 12.00  ? 200 ASP A CA  1 
ATOM   1340 C  C   . ASP A 1 177 ? 29.639 81.458  69.160  1.00 15.95  ? 200 ASP A C   1 
ATOM   1341 O  O   . ASP A 1 177 ? 30.374 82.411  68.899  1.00 17.36  ? 200 ASP A O   1 
ATOM   1342 C  CB  . ASP A 1 177 ? 31.656 80.032  69.663  1.00 9.51   ? 200 ASP A CB  1 
ATOM   1343 C  CG  . ASP A 1 177 ? 31.892 80.576  71.064  1.00 34.86  ? 200 ASP A CG  1 
ATOM   1344 O  OD1 . ASP A 1 177 ? 30.932 80.663  71.854  1.00 26.93  ? 200 ASP A OD1 1 
ATOM   1345 O  OD2 . ASP A 1 177 ? 33.045 80.922  71.373  1.00 27.33  ? 200 ASP A OD2 1 
ATOM   1346 N  N   . VAL A 1 178 ? 28.333 81.582  69.346  1.00 12.16  ? 201 VAL A N   1 
ATOM   1347 C  CA  . VAL A 1 178 ? 27.629 82.833  69.113  1.00 15.58  ? 201 VAL A CA  1 
ATOM   1348 C  C   . VAL A 1 178 ? 27.058 83.336  70.426  1.00 18.17  ? 201 VAL A C   1 
ATOM   1349 O  O   . VAL A 1 178 ? 26.344 82.592  71.110  1.00 13.95  ? 201 VAL A O   1 
ATOM   1350 C  CB  . VAL A 1 178 ? 26.485 82.603  68.096  1.00 17.19  ? 201 VAL A CB  1 
ATOM   1351 C  CG1 . VAL A 1 178 ? 25.731 83.890  67.813  1.00 17.90  ? 201 VAL A CG1 1 
ATOM   1352 C  CG2 . VAL A 1 178 ? 27.059 82.046  66.805  1.00 15.00  ? 201 VAL A CG2 1 
ATOM   1353 N  N   . ASP A 1 179 ? 27.365 84.586  70.782  1.00 14.25  ? 202 ASP A N   1 
ATOM   1354 C  CA  . ASP A 1 179 ? 26.866 85.177  72.031  1.00 12.72  ? 202 ASP A CA  1 
ATOM   1355 C  C   . ASP A 1 179 ? 25.374 85.447  71.900  1.00 13.98  ? 202 ASP A C   1 
ATOM   1356 O  O   . ASP A 1 179 ? 24.893 85.685  70.797  1.00 14.38  ? 202 ASP A O   1 
ATOM   1357 C  CB  . ASP A 1 179 ? 27.595 86.500  72.348  1.00 15.71  ? 202 ASP A CB  1 
ATOM   1358 C  CG  . ASP A 1 179 ? 29.091 86.325  72.530  1.00 22.81  ? 202 ASP A CG  1 
ATOM   1359 O  OD1 . ASP A 1 179 ? 29.511 85.218  72.921  1.00 22.54  ? 202 ASP A OD1 1 
ATOM   1360 O  OD2 . ASP A 1 179 ? 29.850 87.290  72.271  1.00 16.76  ? 202 ASP A OD2 1 
ATOM   1361 N  N   . PRO A 1 180 ? 24.632 85.421  73.020  1.00 17.08  ? 203 PRO A N   1 
ATOM   1362 C  CA  . PRO A 1 180 ? 23.185 85.675  72.917  1.00 13.49  ? 203 PRO A CA  1 
ATOM   1363 C  C   . PRO A 1 180 ? 22.794 86.986  72.208  1.00 17.14  ? 203 PRO A C   1 
ATOM   1364 O  O   . PRO A 1 180 ? 21.851 86.942  71.414  1.00 16.33  ? 203 PRO A O   1 
ATOM   1365 C  CB  . PRO A 1 180 ? 22.711 85.647  74.376  1.00 19.77  ? 203 PRO A CB  1 
ATOM   1366 C  CG  . PRO A 1 180 ? 23.711 84.734  75.070  1.00 18.97  ? 203 PRO A CG  1 
ATOM   1367 C  CD  . PRO A 1 180 ? 25.032 85.015  74.386  1.00 19.15  ? 203 PRO A CD  1 
ATOM   1368 N  N   . PRO A 1 181 ? 23.477 88.123  72.482  1.00 14.89  ? 204 PRO A N   1 
ATOM   1369 C  CA  . PRO A 1 181 ? 23.083 89.294  71.681  1.00 14.32  ? 204 PRO A CA  1 
ATOM   1370 C  C   . PRO A 1 181 ? 23.379 89.142  70.187  1.00 17.30  ? 204 PRO A C   1 
ATOM   1371 O  O   . PRO A 1 181 ? 22.680 89.733  69.358  1.00 15.52  ? 204 PRO A O   1 
ATOM   1372 C  CB  . PRO A 1 181 ? 23.925 90.436  72.260  1.00 17.47  ? 204 PRO A CB  1 
ATOM   1373 C  CG  . PRO A 1 181 ? 24.933 89.812  73.156  1.00 17.15  ? 204 PRO A CG  1 
ATOM   1374 C  CD  . PRO A 1 181 ? 24.449 88.466  73.542  1.00 17.80  ? 204 PRO A CD  1 
ATOM   1375 N  N   . GLU A 1 182 ? 24.426 88.397  69.843  1.00 14.54  ? 205 GLU A N   1 
ATOM   1376 C  CA  . GLU A 1 182 ? 24.729 88.147  68.440  1.00 16.22  ? 205 GLU A CA  1 
ATOM   1377 C  C   . GLU A 1 182 ? 23.636 87.316  67.792  1.00 15.63  ? 205 GLU A C   1 
ATOM   1378 O  O   . GLU A 1 182 ? 23.266 87.560  66.650  1.00 12.78  ? 205 GLU A O   1 
ATOM   1379 C  CB  . GLU A 1 182 ? 26.057 87.419  68.279  1.00 9.10   ? 205 GLU A CB  1 
ATOM   1380 C  CG  . GLU A 1 182 ? 27.277 88.237  68.637  1.00 9.42   ? 205 GLU A CG  1 
ATOM   1381 C  CD  . GLU A 1 182 ? 28.547 87.439  68.452  1.00 14.21  ? 205 GLU A CD  1 
ATOM   1382 O  OE1 . GLU A 1 182 ? 28.702 86.410  69.149  1.00 11.86  ? 205 GLU A OE1 1 
ATOM   1383 O  OE2 . GLU A 1 182 ? 29.370 87.829  67.603  1.00 9.66   ? 205 GLU A OE2 1 
ATOM   1384 N  N   . HIS A 1 183 ? 23.151 86.310  68.510  1.00 13.45  ? 206 HIS A N   1 
ATOM   1385 C  CA  A HIS A 1 183 ? 22.066 85.494  67.987  0.79 14.44  ? 206 HIS A CA  1 
ATOM   1386 C  CA  B HIS A 1 183 ? 22.166 85.494  67.987  0.21 14.44  ? 206 HIS A CA  1 
ATOM   1387 C  C   . HIS A 1 183 ? 20.853 86.362  67.715  1.00 15.05  ? 206 HIS A C   1 
ATOM   1388 O  O   . HIS A 1 183 ? 20.212 86.236  66.673  1.00 14.65  ? 206 HIS A O   1 
ATOM   1389 C  CB  A HIS A 1 183 ? 21.694 84.373  68.957  0.79 16.46  ? 206 HIS A CB  1 
ATOM   1390 C  CB  B HIS A 1 183 ? 21.794 84.373  68.957  0.21 16.46  ? 206 HIS A CB  1 
ATOM   1391 C  CG  A HIS A 1 183 ? 20.539 83.533  68.482  0.79 22.62  ? 206 HIS A CG  1 
ATOM   1392 C  CG  B HIS A 1 183 ? 20.757 83.430  68.408  0.21 22.62  ? 206 HIS A CG  1 
ATOM   1393 N  ND1 A HIS A 1 183 ? 20.696 82.477  67.624  0.79 31.88  ? 206 HIS A ND1 1 
ATOM   1394 N  ND1 B HIS A 1 183 ? 20.967 82.670  67.289  0.21 31.88  ? 206 HIS A ND1 1 
ATOM   1395 C  CD2 A HIS A 1 183 ? 19.215 83.633  68.744  0.79 22.04  ? 206 HIS A CD2 1 
ATOM   1396 C  CD2 B HIS A 1 183 ? 19.500 83.164  68.834  0.21 22.04  ? 206 HIS A CD2 1 
ATOM   1397 C  CE1 A HIS A 1 183 ? 19.503 81.933  67.382  0.79 31.52  ? 206 HIS A CE1 1 
ATOM   1398 C  CE1 B HIS A 1 183 ? 19.876 81.943  67.046  0.21 31.52  ? 206 HIS A CE1 1 
ATOM   1399 N  NE2 A HIS A 1 183 ? 18.598 82.618  68.042  0.79 30.56  ? 206 HIS A NE2 1 
ATOM   1400 N  NE2 B HIS A 1 183 ? 18.980 82.231  67.961  0.21 30.56  ? 206 HIS A NE2 1 
ATOM   1401 N  N   . PHE A 1 184 ? 20.558 87.260  68.642  1.00 14.71  ? 207 PHE A N   1 
ATOM   1402 C  CA  . PHE A 1 184 ? 19.454 88.193  68.461  1.00 16.45  ? 207 PHE A CA  1 
ATOM   1403 C  C   . PHE A 1 184 ? 19.655 89.018  67.198  1.00 17.83  ? 207 PHE A C   1 
ATOM   1404 O  O   . PHE A 1 184 ? 18.729 89.206  66.409  1.00 16.19  ? 207 PHE A O   1 
ATOM   1405 C  CB  . PHE A 1 184 ? 19.321 89.126  69.668  1.00 17.45  ? 207 PHE A CB  1 
ATOM   1406 C  CG  . PHE A 1 184 ? 18.274 90.190  69.479  1.00 23.22  ? 207 PHE A CG  1 
ATOM   1407 C  CD1 . PHE A 1 184 ? 16.936 89.919  69.747  1.00 29.30  ? 207 PHE A CD1 1 
ATOM   1408 C  CD2 . PHE A 1 184 ? 18.621 91.448  68.996  1.00 25.24  ? 207 PHE A CD2 1 
ATOM   1409 C  CE1 . PHE A 1 184 ? 15.960 90.893  69.556  1.00 34.91  ? 207 PHE A CE1 1 
ATOM   1410 C  CE2 . PHE A 1 184 ? 17.653 92.429  68.801  1.00 36.16  ? 207 PHE A CE2 1 
ATOM   1411 C  CZ  . PHE A 1 184 ? 16.317 92.145  69.081  1.00 32.33  ? 207 PHE A CZ  1 
ATOM   1412 N  N   . ILE A 1 185 ? 20.866 89.531  67.017  1.00 14.57  ? 208 ILE A N   1 
ATOM   1413 C  CA  . ILE A 1 185 ? 21.159 90.367  65.858  1.00 12.13  ? 208 ILE A CA  1 
ATOM   1414 C  C   . ILE A 1 185 ? 20.975 89.588  64.559  1.00 16.56  ? 208 ILE A C   1 
ATOM   1415 O  O   . ILE A 1 185 ? 20.292 90.046  63.633  1.00 17.47  ? 208 ILE A O   1 
ATOM   1416 C  CB  . ILE A 1 185 ? 22.586 90.955  65.941  1.00 14.31  ? 208 ILE A CB  1 
ATOM   1417 C  CG1 . ILE A 1 185 ? 22.642 92.030  67.031  1.00 15.32  ? 208 ILE A CG1 1 
ATOM   1418 C  CG2 . ILE A 1 185 ? 23.015 91.539  64.601  1.00 12.32  ? 208 ILE A CG2 1 
ATOM   1419 C  CD1 . ILE A 1 185 ? 24.058 92.453  67.398  1.00 14.71  ? 208 ILE A CD1 1 
ATOM   1420 N  N   . LEU A 1 186 ? 21.554 88.394  64.502  1.00 15.64  ? 209 LEU A N   1 
ATOM   1421 C  CA  . LEU A 1 186 ? 21.450 87.573  63.303  1.00 15.52  ? 209 LEU A CA  1 
ATOM   1422 C  C   . LEU A 1 186 ? 19.990 87.284  62.955  1.00 15.68  ? 209 LEU A C   1 
ATOM   1423 O  O   . LEU A 1 186 ? 19.591 87.384  61.792  1.00 18.32  ? 209 LEU A O   1 
ATOM   1424 C  CB  . LEU A 1 186 ? 22.207 86.257  63.486  1.00 10.41  ? 209 LEU A CB  1 
ATOM   1425 C  CG  . LEU A 1 186 ? 23.722 86.348  63.663  1.00 13.70  ? 209 LEU A CG  1 
ATOM   1426 C  CD1 . LEU A 1 186 ? 24.277 84.976  64.000  1.00 12.30  ? 209 LEU A CD1 1 
ATOM   1427 C  CD2 . LEU A 1 186 ? 24.379 86.905  62.392  1.00 12.38  ? 209 LEU A CD2 1 
ATOM   1428 N  N   . LYS A 1 187 ? 19.192 86.935  63.959  1.00 14.34  ? 210 LYS A N   1 
ATOM   1429 C  CA  . LYS A 1 187 ? 17.775 86.654  63.713  1.00 18.76  ? 210 LYS A CA  1 
ATOM   1430 C  C   . LYS A 1 187 ? 16.981 87.903  63.384  1.00 20.37  ? 210 LYS A C   1 
ATOM   1431 O  O   . LYS A 1 187 ? 16.203 87.921  62.426  1.00 19.58  ? 210 LYS A O   1 
ATOM   1432 C  CB  . LYS A 1 187 ? 17.139 85.937  64.908  1.00 22.72  ? 210 LYS A CB  1 
ATOM   1433 C  CG  . LYS A 1 187 ? 17.643 84.517  65.077  1.00 26.49  ? 210 LYS A CG  1 
ATOM   1434 C  CD  . LYS A 1 187 ? 17.503 83.752  63.763  1.00 33.68  ? 210 LYS A CD  1 
ATOM   1435 C  CE  . LYS A 1 187 ? 17.891 82.289  63.908  1.00 42.55  ? 210 LYS A CE  1 
ATOM   1436 N  NZ  . LYS A 1 187 ? 17.831 81.586  62.595  1.00 50.11  ? 210 LYS A NZ  1 
ATOM   1437 N  N   . ASN A 1 188 ? 17.166 88.946  64.181  1.00 16.78  ? 211 ASN A N   1 
ATOM   1438 C  CA  . ASN A 1 188 ? 16.390 90.176  64.006  1.00 20.79  ? 211 ASN A CA  1 
ATOM   1439 C  C   . ASN A 1 188 ? 16.648 90.877  62.677  1.00 21.36  ? 211 ASN A C   1 
ATOM   1440 O  O   . ASN A 1 188 ? 15.755 91.536  62.135  1.00 16.46  ? 211 ASN A O   1 
ATOM   1441 C  CB  . ASN A 1 188 ? 16.648 91.152  65.154  1.00 24.04  ? 211 ASN A CB  1 
ATOM   1442 C  CG  . ASN A 1 188 ? 15.784 92.404  65.060  1.00 46.18  ? 211 ASN A CG  1 
ATOM   1443 O  OD1 . ASN A 1 188 ? 14.569 92.351  65.273  1.00 47.71  ? 211 ASN A OD1 1 
ATOM   1444 N  ND2 . ASN A 1 188 ? 16.410 93.539  64.745  1.00 40.93  ? 211 ASN A ND2 1 
ATOM   1445 N  N   . TYR A 1 189 ? 17.870 90.777  62.166  1.00 15.70  ? 212 TYR A N   1 
ATOM   1446 C  CA  . TYR A 1 189 ? 18.203 91.424  60.896  1.00 15.31  ? 212 TYR A CA  1 
ATOM   1447 C  C   . TYR A 1 189 ? 18.202 90.467  59.707  1.00 15.21  ? 212 TYR A C   1 
ATOM   1448 O  O   . TYR A 1 189 ? 18.569 90.848  58.595  1.00 18.20  ? 212 TYR A O   1 
ATOM   1449 C  CB  . TYR A 1 189 ? 19.526 92.186  60.999  1.00 22.04  ? 212 TYR A CB  1 
ATOM   1450 C  CG  . TYR A 1 189 ? 19.442 93.339  61.966  1.00 21.46  ? 212 TYR A CG  1 
ATOM   1451 C  CD1 . TYR A 1 189 ? 18.927 94.568  61.565  1.00 26.35  ? 212 TYR A CD1 1 
ATOM   1452 C  CD2 . TYR A 1 189 ? 19.842 93.192  63.287  1.00 27.95  ? 212 TYR A CD2 1 
ATOM   1453 C  CE1 . TYR A 1 189 ? 18.835 95.627  62.454  1.00 20.93  ? 212 TYR A CE1 1 
ATOM   1454 C  CE2 . TYR A 1 189 ? 19.752 94.243  64.184  1.00 32.80  ? 212 TYR A CE2 1 
ATOM   1455 C  CZ  . TYR A 1 189 ? 19.251 95.458  63.759  1.00 31.07  ? 212 TYR A CZ  1 
ATOM   1456 O  OH  . TYR A 1 189 ? 19.163 96.502  64.654  1.00 31.07  ? 212 TYR A OH  1 
ATOM   1457 N  N   . ASP A 1 190 ? 17.760 89.239  59.955  1.00 13.19  ? 213 ASP A N   1 
ATOM   1458 C  CA  . ASP A 1 190 ? 17.636 88.214  58.921  1.00 21.55  ? 213 ASP A CA  1 
ATOM   1459 C  C   . ASP A 1 190 ? 18.963 88.001  58.190  1.00 24.40  ? 213 ASP A C   1 
ATOM   1460 O  O   . ASP A 1 190 ? 19.014 87.902  56.962  1.00 18.35  ? 213 ASP A O   1 
ATOM   1461 C  CB  . ASP A 1 190 ? 16.497 88.551  57.948  1.00 24.54  ? 213 ASP A CB  1 
ATOM   1462 C  CG  . ASP A 1 190 ? 15.902 87.313  57.291  1.00 51.52  ? 213 ASP A CG  1 
ATOM   1463 O  OD1 . ASP A 1 190 ? 15.837 86.252  57.955  1.00 52.12  ? 213 ASP A OD1 1 
ATOM   1464 O  OD2 . ASP A 1 190 ? 15.494 87.404  56.111  1.00 49.86  ? 213 ASP A OD2 1 
ATOM   1465 N  N   . ILE A 1 191 ? 20.044 87.952  58.958  1.00 17.47  ? 214 ILE A N   1 
ATOM   1466 C  CA  . ILE A 1 191 ? 21.358 87.665  58.390  1.00 12.64  ? 214 ILE A CA  1 
ATOM   1467 C  C   . ILE A 1 191 ? 21.498 86.165  58.224  1.00 16.73  ? 214 ILE A C   1 
ATOM   1468 O  O   . ILE A 1 191 ? 21.228 85.404  59.154  1.00 18.09  ? 214 ILE A O   1 
ATOM   1469 C  CB  . ILE A 1 191 ? 22.474 88.214  59.280  1.00 15.66  ? 214 ILE A CB  1 
ATOM   1470 C  CG1 . ILE A 1 191 ? 22.335 89.737  59.362  1.00 18.50  ? 214 ILE A CG1 1 
ATOM   1471 C  CG2 . ILE A 1 191 ? 23.838 87.813  58.726  1.00 12.99  ? 214 ILE A CG2 1 
ATOM   1472 C  CD1 . ILE A 1 191 ? 23.119 90.374  60.479  1.00 15.33  ? 214 ILE A CD1 1 
ATOM   1473 N  N   . GLN A 1 192 ? 21.886 85.736  57.029  1.00 12.57  ? 215 GLN A N   1 
ATOM   1474 C  CA  . GLN A 1 192 ? 21.939 84.306  56.736  1.00 13.38  ? 215 GLN A CA  1 
ATOM   1475 C  C   . GLN A 1 192 ? 23.249 83.691  57.206  1.00 14.91  ? 215 GLN A C   1 
ATOM   1476 O  O   . GLN A 1 192 ? 24.314 84.275  57.049  1.00 9.35   ? 215 GLN A O   1 
ATOM   1477 C  CB  . GLN A 1 192 ? 21.728 84.062  55.244  1.00 15.51  ? 215 GLN A CB  1 
ATOM   1478 C  CG  . GLN A 1 192 ? 20.384 84.604  54.755  1.00 14.86  ? 215 GLN A CG  1 
ATOM   1479 C  CD  . GLN A 1 192 ? 19.213 83.982  55.483  1.00 24.36  ? 215 GLN A CD  1 
ATOM   1480 O  OE1 . GLN A 1 192 ? 19.008 82.772  55.418  1.00 25.71  ? 215 GLN A OE1 1 
ATOM   1481 N  NE2 . GLN A 1 192 ? 18.446 84.803  56.195  1.00 26.61  ? 215 GLN A NE2 1 
ATOM   1482 N  N   . TYR A 1 193 ? 23.161 82.516  57.805  1.00 9.36   ? 216 TYR A N   1 
ATOM   1483 C  CA  . TYR A 1 193 ? 24.363 81.830  58.253  1.00 11.40  ? 216 TYR A CA  1 
ATOM   1484 C  C   . TYR A 1 193 ? 24.200 80.330  58.152  1.00 16.00  ? 216 TYR A C   1 
ATOM   1485 O  O   . TYR A 1 193 ? 23.090 79.808  58.221  1.00 12.00  ? 216 TYR A O   1 
ATOM   1486 C  CB  . TYR A 1 193 ? 24.717 82.250  59.683  1.00 8.96   ? 216 TYR A CB  1 
ATOM   1487 C  CG  . TYR A 1 193 ? 23.663 81.925  60.717  1.00 13.90  ? 216 TYR A CG  1 
ATOM   1488 C  CD1 . TYR A 1 193 ? 22.626 82.821  60.990  1.00 14.86  ? 216 TYR A CD1 1 
ATOM   1489 C  CD2 . TYR A 1 193 ? 23.707 80.738  61.431  1.00 14.75  ? 216 TYR A CD2 1 
ATOM   1490 C  CE1 . TYR A 1 193 ? 21.661 82.531  61.940  1.00 20.56  ? 216 TYR A CE1 1 
ATOM   1491 C  CE2 . TYR A 1 193 ? 22.746 80.438  62.384  1.00 21.61  ? 216 TYR A CE2 1 
ATOM   1492 C  CZ  . TYR A 1 193 ? 21.731 81.336  62.631  1.00 27.57  ? 216 TYR A CZ  1 
ATOM   1493 O  OH  . TYR A 1 193 ? 20.783 81.032  63.576  1.00 31.58  ? 216 TYR A OH  1 
ATOM   1494 N  N   . PHE A 1 194 ? 25.325 79.647  57.985  1.00 12.42  ? 217 PHE A N   1 
ATOM   1495 C  CA  . PHE A 1 194 ? 25.363 78.201  58.030  1.00 9.93   ? 217 PHE A CA  1 
ATOM   1496 C  C   . PHE A 1 194 ? 26.259 77.811  59.187  1.00 7.47   ? 217 PHE A C   1 
ATOM   1497 O  O   . PHE A 1 194 ? 27.477 77.893  59.078  1.00 10.93  ? 217 PHE A O   1 
ATOM   1498 C  CB  . PHE A 1 194 ? 25.877 77.649  56.694  1.00 10.00  ? 217 PHE A CB  1 
ATOM   1499 C  CG  . PHE A 1 194 ? 24.981 78.003  55.536  1.00 11.15  ? 217 PHE A CG  1 
ATOM   1500 C  CD1 . PHE A 1 194 ? 25.199 79.163  54.794  1.00 8.76   ? 217 PHE A CD1 1 
ATOM   1501 C  CD2 . PHE A 1 194 ? 23.876 77.206  55.238  1.00 13.29  ? 217 PHE A CD2 1 
ATOM   1502 C  CE1 . PHE A 1 194 ? 24.339 79.509  53.741  1.00 12.45  ? 217 PHE A CE1 1 
ATOM   1503 C  CE2 . PHE A 1 194 ? 23.023 77.539  54.197  1.00 15.62  ? 217 PHE A CE2 1 
ATOM   1504 C  CZ  . PHE A 1 194 ? 23.254 78.695  53.446  1.00 10.84  ? 217 PHE A CZ  1 
ATOM   1505 N  N   . SER A 1 195 ? 25.645 77.428  60.299  1.00 7.74   ? 218 SER A N   1 
ATOM   1506 C  CA  . SER A 1 195 ? 26.396 77.014  61.478  1.00 9.04   ? 218 SER A CA  1 
ATOM   1507 C  C   . SER A 1 195 ? 26.980 75.642  61.195  1.00 10.49  ? 218 SER A C   1 
ATOM   1508 O  O   . SER A 1 195 ? 26.695 75.049  60.147  1.00 12.20  ? 218 SER A O   1 
ATOM   1509 C  CB  . SER A 1 195 ? 25.484 76.948  62.684  1.00 10.07  ? 218 SER A CB  1 
ATOM   1510 O  OG  . SER A 1 195 ? 24.615 75.836  62.596  1.00 13.76  ? 218 SER A OG  1 
ATOM   1511 N  N   . MET A 1 196 ? 27.808 75.133  62.103  1.00 10.26  ? 219 MET A N   1 
ATOM   1512 C  CA  . MET A 1 196 ? 28.341 73.779  61.943  1.00 9.18   ? 219 MET A CA  1 
ATOM   1513 C  C   . MET A 1 196 ? 27.220 72.754  61.855  1.00 7.34   ? 219 MET A C   1 
ATOM   1514 O  O   . MET A 1 196 ? 27.329 71.751  61.140  1.00 9.20   ? 219 MET A O   1 
ATOM   1515 C  CB  . MET A 1 196 ? 29.303 73.427  63.090  1.00 9.53   ? 219 MET A CB  1 
ATOM   1516 C  CG  . MET A 1 196 ? 30.596 74.286  63.117  1.00 6.01   ? 219 MET A CG  1 
ATOM   1517 S  SD  . MET A 1 196 ? 31.528 74.273  61.588  1.00 11.07  ? 219 MET A SD  1 
ATOM   1518 C  CE  . MET A 1 196 ? 31.645 72.498  61.308  1.00 7.51   ? 219 MET A CE  1 
ATOM   1519 N  N   . ARG A 1 197 ? 26.142 73.012  62.589  1.00 10.27  ? 220 ARG A N   1 
ATOM   1520 C  CA  . ARG A 1 197 ? 24.954 72.169  62.537  1.00 10.10  ? 220 ARG A CA  1 
ATOM   1521 C  C   . ARG A 1 197 ? 24.352 72.146  61.128  1.00 13.23  ? 220 ARG A C   1 
ATOM   1522 O  O   . ARG A 1 197 ? 23.964 71.083  60.632  1.00 10.01  ? 220 ARG A O   1 
ATOM   1523 C  CB  . ARG A 1 197 ? 23.922 72.628  63.574  1.00 12.18  ? 220 ARG A CB  1 
ATOM   1524 C  CG  . ARG A 1 197 ? 22.618 71.847  63.520  1.00 14.24  ? 220 ARG A CG  1 
ATOM   1525 C  CD  . ARG A 1 197 ? 21.598 72.303  64.563  1.00 18.00  ? 220 ARG A CD  1 
ATOM   1526 N  NE  . ARG A 1 197 ? 20.260 71.879  64.143  1.00 17.54  ? 220 ARG A NE  1 
ATOM   1527 C  CZ  . ARG A 1 197 ? 19.723 70.704  64.450  1.00 24.60  ? 220 ARG A CZ  1 
ATOM   1528 N  NH1 . ARG A 1 197 ? 20.397 69.846  65.214  1.00 15.25  ? 220 ARG A NH1 1 
ATOM   1529 N  NH2 . ARG A 1 197 ? 18.511 70.394  64.003  1.00 17.27  ? 220 ARG A NH2 1 
ATOM   1530 N  N   . ASP A 1 198 ? 24.258 73.311  60.487  1.00 11.05  ? 221 ASP A N   1 
ATOM   1531 C  CA  . ASP A 1 198 ? 23.766 73.355  59.109  1.00 9.86   ? 221 ASP A CA  1 
ATOM   1532 C  C   . ASP A 1 198 ? 24.676 72.577  58.177  1.00 6.21   ? 221 ASP A C   1 
ATOM   1533 O  O   . ASP A 1 198 ? 24.209 71.910  57.253  1.00 8.95   ? 221 ASP A O   1 
ATOM   1534 C  CB  . ASP A 1 198 ? 23.626 74.805  58.610  1.00 9.30   ? 221 ASP A CB  1 
ATOM   1535 C  CG  . ASP A 1 198 ? 22.559 75.577  59.351  1.00 13.73  ? 221 ASP A CG  1 
ATOM   1536 O  OD1 . ASP A 1 198 ? 21.441 75.034  59.528  1.00 14.01  ? 221 ASP A OD1 1 
ATOM   1537 O  OD2 . ASP A 1 198 ? 22.842 76.724  59.772  1.00 15.23  ? 221 ASP A OD2 1 
ATOM   1538 N  N   . ILE A 1 199 ? 25.982 72.674  58.391  1.00 6.90   ? 222 ILE A N   1 
ATOM   1539 C  CA  . ILE A 1 199 ? 26.910 71.912  57.561  1.00 8.92   ? 222 ILE A CA  1 
ATOM   1540 C  C   . ILE A 1 199 ? 26.738 70.408  57.798  1.00 9.67   ? 222 ILE A C   1 
ATOM   1541 O  O   . ILE A 1 199 ? 26.775 69.617  56.849  1.00 10.46  ? 222 ILE A O   1 
ATOM   1542 C  CB  . ILE A 1 199 ? 28.361 72.341  57.781  1.00 6.33   ? 222 ILE A CB  1 
ATOM   1543 C  CG1 . ILE A 1 199 ? 28.525 73.821  57.432  1.00 9.71   ? 222 ILE A CG1 1 
ATOM   1544 C  CG2 . ILE A 1 199 ? 29.325 71.493  56.946  1.00 8.78   ? 222 ILE A CG2 1 
ATOM   1545 C  CD1 . ILE A 1 199 ? 29.882 74.392  57.859  1.00 10.24  ? 222 ILE A CD1 1 
ATOM   1546 N  N   . ASP A 1 200 ? 26.559 70.014  59.055  1.00 8.89   ? 223 ASP A N   1 
ATOM   1547 C  CA  . ASP A 1 200 ? 26.283 68.608  59.376  1.00 10.37  ? 223 ASP A CA  1 
ATOM   1548 C  C   . ASP A 1 200 ? 25.066 68.071  58.615  1.00 16.35  ? 223 ASP A C   1 
ATOM   1549 O  O   . ASP A 1 200 ? 25.034 66.905  58.213  1.00 14.91  ? 223 ASP A O   1 
ATOM   1550 C  CB  . ASP A 1 200 ? 26.021 68.436  60.871  1.00 12.79  ? 223 ASP A CB  1 
ATOM   1551 C  CG  . ASP A 1 200 ? 27.259 68.641  61.715  1.00 11.79  ? 223 ASP A CG  1 
ATOM   1552 O  OD1 . ASP A 1 200 ? 28.379 68.481  61.180  1.00 11.10  ? 223 ASP A OD1 1 
ATOM   1553 O  OD2 . ASP A 1 200 ? 27.098 68.933  62.925  1.00 11.24  ? 223 ASP A OD2 1 
ATOM   1554 N  N   . ARG A 1 201 ? 24.063 68.929  58.443  1.00 12.32  ? 224 ARG A N   1 
ATOM   1555 C  CA  . ARG A 1 201 ? 22.802 68.550  57.799  1.00 14.34  ? 224 ARG A CA  1 
ATOM   1556 C  C   . ARG A 1 201 ? 22.901 68.595  56.281  1.00 16.66  ? 224 ARG A C   1 
ATOM   1557 O  O   . ARG A 1 201 ? 22.553 67.641  55.592  1.00 15.51  ? 224 ARG A O   1 
ATOM   1558 C  CB  . ARG A 1 201 ? 21.681 69.493  58.254  1.00 14.30  ? 224 ARG A CB  1 
ATOM   1559 C  CG  . ARG A 1 201 ? 21.281 69.324  59.700  1.00 16.69  ? 224 ARG A CG  1 
ATOM   1560 C  CD  . ARG A 1 201 ? 20.384 70.471  60.154  1.00 22.25  ? 224 ARG A CD  1 
ATOM   1561 N  NE  . ARG A 1 201 ? 19.250 70.669  59.254  1.00 22.69  ? 224 ARG A NE  1 
ATOM   1562 C  CZ  . ARG A 1 201 ? 18.095 70.020  59.354  1.00 34.83  ? 224 ARG A CZ  1 
ATOM   1563 N  NH1 . ARG A 1 201 ? 17.917 69.138  60.327  1.00 33.56  ? 224 ARG A NH1 1 
ATOM   1564 N  NH2 . ARG A 1 201 ? 17.112 70.261  58.495  1.00 25.73  ? 224 ARG A NH2 1 
ATOM   1565 N  N   . LEU A 1 202 ? 23.391 69.710  55.762  1.00 10.69  ? 225 LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 202 ? 23.381 69.944  54.321  1.00 10.75  ? 225 LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 202 ? 24.579 69.364  53.605  1.00 12.55  ? 225 LEU A C   1 
ATOM   1568 O  O   . LEU A 1 202 ? 24.489 68.984  52.435  1.00 14.12  ? 225 LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 202 ? 23.325 71.453  54.034  1.00 9.30   ? 225 LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 202 ? 22.031 72.152  54.429  1.00 18.67  ? 225 LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 202 ? 22.187 73.667  54.298  1.00 17.67  ? 225 LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 202 ? 20.918 71.650  53.523  1.00 25.32  ? 225 LEU A CD2 1 
ATOM   1573 N  N   . GLY A 1 203 ? 25.712 69.311  54.295  1.00 10.32  ? 226 GLY A N   1 
ATOM   1574 C  CA  . GLY A 1 203 ? 26.962 69.029  53.622  1.00 10.69  ? 226 GLY A CA  1 
ATOM   1575 C  C   . GLY A 1 203 ? 27.506 70.314  53.024  1.00 12.05  ? 226 GLY A C   1 
ATOM   1576 O  O   . GLY A 1 203 ? 26.745 71.226  52.668  1.00 10.87  ? 226 GLY A O   1 
ATOM   1577 N  N   . ILE A 1 204 ? 28.827 70.398  52.920  1.00 11.29  ? 227 ILE A N   1 
ATOM   1578 C  CA  . ILE A 1 204 ? 29.474 71.630  52.470  1.00 11.01  ? 227 ILE A CA  1 
ATOM   1579 C  C   . ILE A 1 204 ? 29.150 71.993  51.007  1.00 11.78  ? 227 ILE A C   1 
ATOM   1580 O  O   . ILE A 1 204 ? 29.113 73.174  50.661  1.00 11.95  ? 227 ILE A O   1 
ATOM   1581 C  CB  . ILE A 1 204 ? 31.006 71.590  52.731  1.00 11.36  ? 227 ILE A CB  1 
ATOM   1582 C  CG1 . ILE A 1 204 ? 31.615 72.999  52.698  1.00 12.18  ? 227 ILE A CG1 1 
ATOM   1583 C  CG2 . ILE A 1 204 ? 31.695 70.634  51.757  1.00 9.30   ? 227 ILE A CG2 1 
ATOM   1584 C  CD1 . ILE A 1 204 ? 31.186 73.869  53.893  1.00 14.18  ? 227 ILE A CD1 1 
ATOM   1585 N  N   . GLN A 1 205 ? 28.887 71.008  50.147  1.00 9.33   ? 228 GLN A N   1 
ATOM   1586 C  CA  . GLN A 1 205 ? 28.504 71.355  48.762  1.00 10.43  ? 228 GLN A CA  1 
ATOM   1587 C  C   . GLN A 1 205 ? 27.225 72.187  48.728  1.00 10.89  ? 228 GLN A C   1 
ATOM   1588 O  O   . GLN A 1 205 ? 27.195 73.265  48.120  1.00 13.01  ? 228 GLN A O   1 
ATOM   1589 C  CB  . GLN A 1 205 ? 28.333 70.124  47.855  1.00 13.15  ? 228 GLN A CB  1 
ATOM   1590 C  CG  . GLN A 1 205 ? 27.675 70.491  46.487  1.00 14.32  ? 228 GLN A CG  1 
ATOM   1591 C  CD  . GLN A 1 205 ? 27.360 69.296  45.602  1.00 28.39  ? 228 GLN A CD  1 
ATOM   1592 O  OE1 . GLN A 1 205 ? 27.755 68.166  45.894  1.00 24.26  ? 228 GLN A OE1 1 
ATOM   1593 N  NE2 . GLN A 1 205 ? 26.646 69.543  44.503  1.00 25.71  ? 228 GLN A NE2 1 
ATOM   1594 N  N   . LYS A 1 206 ? 26.176 71.713  49.393  1.00 8.66   ? 229 LYS A N   1 
ATOM   1595 C  CA  . LYS A 1 206 ? 24.919 72.458  49.415  1.00 9.04   ? 229 LYS A CA  1 
ATOM   1596 C  C   . LYS A 1 206 ? 25.060 73.798  50.142  1.00 12.63  ? 229 LYS A C   1 
ATOM   1597 O  O   . LYS A 1 206 ? 24.434 74.793  49.754  1.00 11.58  ? 229 LYS A O   1 
ATOM   1598 C  CB  . LYS A 1 206 ? 23.786 71.625  50.020  1.00 13.34  ? 229 LYS A CB  1 
ATOM   1599 C  CG  . LYS A 1 206 ? 23.273 70.500  49.107  1.00 22.83  ? 229 LYS A CG  1 
ATOM   1600 C  CD  . LYS A 1 206 ? 21.867 70.049  49.530  1.00 38.82  ? 229 LYS A CD  1 
ATOM   1601 C  CE  . LYS A 1 206 ? 21.352 68.908  48.656  1.00 45.75  ? 229 LYS A CE  1 
ATOM   1602 N  NZ  . LYS A 1 206 ? 22.035 67.633  49.002  1.00 46.71  ? 229 LYS A NZ  1 
ATOM   1603 N  N   . VAL A 1 207 ? 25.875 73.831  51.192  1.00 10.70  ? 230 VAL A N   1 
ATOM   1604 C  CA  . VAL A 1 207 ? 26.139 75.097  51.884  1.00 9.58   ? 230 VAL A CA  1 
ATOM   1605 C  C   . VAL A 1 207 ? 26.716 76.143  50.924  1.00 9.05   ? 230 VAL A C   1 
ATOM   1606 O  O   . VAL A 1 207 ? 26.262 77.296  50.904  1.00 9.85   ? 230 VAL A O   1 
ATOM   1607 C  CB  . VAL A 1 207 ? 27.074 74.900  53.104  1.00 9.48   ? 230 VAL A CB  1 
ATOM   1608 C  CG1 . VAL A 1 207 ? 27.640 76.257  53.600  1.00 7.78   ? 230 VAL A CG1 1 
ATOM   1609 C  CG2 . VAL A 1 207 ? 26.328 74.187  54.214  1.00 10.35  ? 230 VAL A CG2 1 
ATOM   1610 N  N   . MET A 1 208 ? 27.694 75.746  50.114  1.00 8.21   ? 231 MET A N   1 
ATOM   1611 C  CA  . MET A 1 208 ? 28.312 76.692  49.186  1.00 9.35   ? 231 MET A CA  1 
ATOM   1612 C  C   . MET A 1 208 ? 27.340 77.092  48.077  1.00 10.01  ? 231 MET A C   1 
ATOM   1613 O  O   . MET A 1 208 ? 27.320 78.252  47.652  1.00 9.75   ? 231 MET A O   1 
ATOM   1614 C  CB  . MET A 1 208 ? 29.623 76.145  48.593  1.00 7.75   ? 231 MET A CB  1 
ATOM   1615 C  CG  . MET A 1 208 ? 30.734 75.919  49.645  1.00 7.52   ? 231 MET A CG  1 
ATOM   1616 S  SD  . MET A 1 208 ? 30.864 77.316  50.783  1.00 10.86  ? 231 MET A SD  1 
ATOM   1617 C  CE  . MET A 1 208 ? 31.400 78.629  49.694  1.00 8.55   ? 231 MET A CE  1 
ATOM   1618 N  N   . GLU A 1 209 ? 26.563 76.126  47.589  1.00 8.60   ? 232 GLU A N   1 
ATOM   1619 C  CA  . GLU A 1 209 ? 25.530 76.417  46.591  1.00 9.10   ? 232 GLU A CA  1 
ATOM   1620 C  C   . GLU A 1 209 ? 24.541 77.449  47.110  1.00 11.53  ? 232 GLU A C   1 
ATOM   1621 O  O   . GLU A 1 209 ? 24.196 78.401  46.406  1.00 11.72  ? 232 GLU A O   1 
ATOM   1622 C  CB  . GLU A 1 209 ? 24.779 75.146  46.192  1.00 11.98  ? 232 GLU A CB  1 
ATOM   1623 C  CG  . GLU A 1 209 ? 25.552 74.261  45.237  1.00 12.73  ? 232 GLU A CG  1 
ATOM   1624 C  CD  . GLU A 1 209 ? 24.868 72.920  44.994  1.00 22.28  ? 232 GLU A CD  1 
ATOM   1625 O  OE1 . GLU A 1 209 ? 25.406 72.136  44.191  1.00 28.63  ? 232 GLU A OE1 1 
ATOM   1626 O  OE2 . GLU A 1 209 ? 23.805 72.654  45.601  1.00 27.53  ? 232 GLU A OE2 1 
ATOM   1627 N  N   . ARG A 1 210 ? 24.072 77.252  48.338  1.00 8.36   ? 233 ARG A N   1 
ATOM   1628 C  CA  . ARG A 1 210 ? 23.087 78.154  48.912  1.00 11.30  ? 233 ARG A CA  1 
ATOM   1629 C  C   . ARG A 1 210 ? 23.691 79.515  49.222  1.00 12.02  ? 233 ARG A C   1 
ATOM   1630 O  O   . ARG A 1 210 ? 23.036 80.544  49.078  1.00 11.96  ? 233 ARG A O   1 
ATOM   1631 C  CB  . ARG A 1 210 ? 22.446 77.540  50.161  1.00 10.46  ? 233 ARG A CB  1 
ATOM   1632 C  CG  . ARG A 1 210 ? 21.634 76.283  49.838  1.00 16.33  ? 233 ARG A CG  1 
ATOM   1633 C  CD  . ARG A 1 210 ? 20.850 75.772  51.036  1.00 23.93  ? 233 ARG A CD  1 
ATOM   1634 N  NE  . ARG A 1 210 ? 20.093 74.573  50.678  1.00 33.35  ? 233 ARG A NE  1 
ATOM   1635 C  CZ  . ARG A 1 210 ? 19.128 74.033  51.415  1.00 37.71  ? 233 ARG A CZ  1 
ATOM   1636 N  NH1 . ARG A 1 210 ? 18.789 74.577  52.573  1.00 31.75  ? 233 ARG A NH1 1 
ATOM   1637 N  NH2 . ARG A 1 210 ? 18.508 72.940  50.989  1.00 35.66  ? 233 ARG A NH2 1 
ATOM   1638 N  N   . THR A 1 211 ? 24.943 79.518  49.646  1.00 9.33   ? 234 THR A N   1 
ATOM   1639 C  CA  . THR A 1 211 ? 25.631 80.771  49.923  1.00 7.83   ? 234 THR A CA  1 
ATOM   1640 C  C   . THR A 1 211 ? 25.688 81.655  48.674  1.00 8.79   ? 234 THR A C   1 
ATOM   1641 O  O   . THR A 1 211 ? 25.347 82.840  48.719  1.00 10.70  ? 234 THR A O   1 
ATOM   1642 C  CB  . THR A 1 211 ? 27.045 80.491  50.440  1.00 10.19  ? 234 THR A CB  1 
ATOM   1643 O  OG1 . THR A 1 211 ? 26.944 79.900  51.741  1.00 10.44  ? 234 THR A OG1 1 
ATOM   1644 C  CG2 . THR A 1 211 ? 27.871 81.786  50.517  1.00 9.85   ? 234 THR A CG2 1 
ATOM   1645 N  N   . PHE A 1 212 ? 26.104 81.075  47.561  1.00 8.59   ? 235 PHE A N   1 
ATOM   1646 C  CA  . PHE A 1 212 ? 26.231 81.850  46.333  1.00 12.57  ? 235 PHE A CA  1 
ATOM   1647 C  C   . PHE A 1 212 ? 24.883 82.263  45.760  1.00 15.54  ? 235 PHE A C   1 
ATOM   1648 O  O   . PHE A 1 212 ? 24.749 83.357  45.198  1.00 14.89  ? 235 PHE A O   1 
ATOM   1649 C  CB  . PHE A 1 212 ? 27.083 81.106  45.315  1.00 10.68  ? 235 PHE A CB  1 
ATOM   1650 C  CG  . PHE A 1 212 ? 28.509 80.944  45.755  1.00 15.35  ? 235 PHE A CG  1 
ATOM   1651 C  CD1 . PHE A 1 212 ? 29.149 81.974  46.434  1.00 14.85  ? 235 PHE A CD1 1 
ATOM   1652 C  CD2 . PHE A 1 212 ? 29.190 79.758  45.540  1.00 17.22  ? 235 PHE A CD2 1 
ATOM   1653 C  CE1 . PHE A 1 212 ? 30.466 81.834  46.868  1.00 20.14  ? 235 PHE A CE1 1 
ATOM   1654 C  CE2 . PHE A 1 212 ? 30.500 79.604  45.972  1.00 14.77  ? 235 PHE A CE2 1 
ATOM   1655 C  CZ  . PHE A 1 212 ? 31.139 80.643  46.641  1.00 12.92  ? 235 PHE A CZ  1 
ATOM   1656 N  N   . ASP A 1 213 ? 23.876 81.414  45.920  1.00 12.16  ? 236 ASP A N   1 
ATOM   1657 C  CA  A ASP A 1 213 ? 22.530 81.776  45.486  0.70 16.47  ? 236 ASP A CA  1 
ATOM   1658 C  CA  B ASP A 1 213 ? 22.533 81.780  45.483  0.00 16.49  ? 236 ASP A CA  1 
ATOM   1659 C  CA  C ASP A 1 213 ? 22.630 81.776  45.486  0.30 16.47  ? 236 ASP A CA  1 
ATOM   1660 C  C   . ASP A 1 213 ? 22.043 83.011  46.237  1.00 17.44  ? 236 ASP A C   1 
ATOM   1661 O  O   . ASP A 1 213 ? 21.442 83.909  45.651  1.00 15.99  ? 236 ASP A O   1 
ATOM   1662 C  CB  A ASP A 1 213 ? 21.556 80.618  45.688  0.70 16.71  ? 236 ASP A CB  1 
ATOM   1663 C  CB  B ASP A 1 213 ? 21.554 80.622  45.666  0.00 16.88  ? 236 ASP A CB  1 
ATOM   1664 C  CB  C ASP A 1 213 ? 21.656 80.618  45.688  0.30 16.71  ? 236 ASP A CB  1 
ATOM   1665 C  CG  A ASP A 1 213 ? 20.172 80.925  45.135  0.70 27.01  ? 236 ASP A CG  1 
ATOM   1666 C  CG  B ASP A 1 213 ? 20.167 80.950  45.145  0.00 26.79  ? 236 ASP A CG  1 
ATOM   1667 C  CG  C ASP A 1 213 ? 21.917 79.470  44.724  0.30 27.01  ? 236 ASP A CG  1 
ATOM   1668 O  OD1 A ASP A 1 213 ? 20.055 81.147  43.904  0.70 28.63  ? 236 ASP A OD1 1 
ATOM   1669 O  OD1 B ASP A 1 213 ? 19.221 81.012  45.958  0.00 32.09  ? 236 ASP A OD1 1 
ATOM   1670 O  OD1 C ASP A 1 213 ? 22.651 79.680  43.727  0.30 28.63  ? 236 ASP A OD1 1 
ATOM   1671 O  OD2 A ASP A 1 213 ? 19.204 80.938  45.925  0.70 32.47  ? 236 ASP A OD2 1 
ATOM   1672 O  OD2 B ASP A 1 213 ? 20.027 81.156  43.920  0.00 28.42  ? 236 ASP A OD2 1 
ATOM   1673 O  OD2 C ASP A 1 213 ? 21.397 78.359  44.966  0.30 32.47  ? 236 ASP A OD2 1 
ATOM   1674 N  N   . LEU A 1 214 ? 22.319 83.060  47.537  1.00 8.80   ? 237 LEU A N   1 
ATOM   1675 C  CA  . LEU A 1 214 ? 21.965 84.232  48.340  1.00 13.38  ? 237 LEU A CA  1 
ATOM   1676 C  C   . LEU A 1 214 ? 22.725 85.481  47.916  1.00 16.38  ? 237 LEU A C   1 
ATOM   1677 O  O   . LEU A 1 214 ? 22.154 86.566  47.856  1.00 16.61  ? 237 LEU A O   1 
ATOM   1678 C  CB  . LEU A 1 214 ? 22.227 83.968  49.830  1.00 12.72  ? 237 LEU A CB  1 
ATOM   1679 C  CG  . LEU A 1 214 ? 21.291 82.968  50.500  1.00 15.84  ? 237 LEU A CG  1 
ATOM   1680 C  CD1 . LEU A 1 214 ? 21.904 82.482  51.814  1.00 16.52  ? 237 LEU A CD1 1 
ATOM   1681 C  CD2 . LEU A 1 214 ? 19.923 83.594  50.734  1.00 15.03  ? 237 LEU A CD2 1 
ATOM   1682 N  N   . LEU A 1 215 ? 24.010 85.337  47.608  1.00 10.41  ? 238 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 215 ? 24.849 86.513  47.383  1.00 10.07  ? 238 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 215 ? 24.924 86.914  45.916  1.00 14.72  ? 238 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 215 ? 24.834 88.101  45.584  1.00 14.23  ? 238 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 215 ? 26.264 86.289  47.935  1.00 10.46  ? 238 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 215 ? 26.358 86.140  49.461  1.00 11.46  ? 238 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 215 ? 27.793 85.972  49.877  1.00 11.01  ? 238 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 215 ? 25.763 87.377  50.151  1.00 10.15  ? 238 LEU A CD2 1 
ATOM   1690 N  N   . ILE A 1 216 ? 25.102 85.939  45.033  1.00 10.28  ? 239 ILE A N   1 
ATOM   1691 C  CA  . ILE A 1 216 ? 25.288 86.260  43.620  1.00 8.34   ? 239 ILE A CA  1 
ATOM   1692 C  C   . ILE A 1 216 ? 24.307 85.520  42.721  1.00 9.25   ? 239 ILE A C   1 
ATOM   1693 O  O   . ILE A 1 216 ? 24.564 85.329  41.534  1.00 13.22  ? 239 ILE A O   1 
ATOM   1694 C  CB  . ILE A 1 216 ? 26.729 85.972  43.148  1.00 12.51  ? 239 ILE A CB  1 
ATOM   1695 C  CG1 . ILE A 1 216 ? 27.115 84.526  43.454  1.00 11.98  ? 239 ILE A CG1 1 
ATOM   1696 C  CG2 . ILE A 1 216 ? 27.718 86.893  43.838  1.00 10.53  ? 239 ILE A CG2 1 
ATOM   1697 C  CD1 . ILE A 1 216 ? 28.470 84.150  42.880  1.00 11.61  ? 239 ILE A CD1 1 
ATOM   1698 N  N   . GLY A 1 217 ? 23.186 85.119  43.296  1.00 11.18  ? 240 GLY A N   1 
ATOM   1699 C  CA  . GLY A 1 217 ? 22.155 84.425  42.548  1.00 16.67  ? 240 GLY A CA  1 
ATOM   1700 C  C   . GLY A 1 217 ? 21.480 85.329  41.531  1.00 25.57  ? 240 GLY A C   1 
ATOM   1701 O  O   . GLY A 1 217 ? 21.007 84.856  40.496  1.00 16.43  ? 240 GLY A O   1 
ATOM   1702 N  N   . LYS A 1 218 ? 21.475 86.636  41.787  1.00 15.23  ? 241 LYS A N   1 
ATOM   1703 C  CA  . LYS A 1 218 ? 20.756 87.562  40.898  1.00 16.38  ? 241 LYS A CA  1 
ATOM   1704 C  C   . LYS A 1 218 ? 21.678 88.357  39.984  1.00 15.09  ? 241 LYS A C   1 
ATOM   1705 O  O   . LYS A 1 218 ? 21.318 88.702  38.855  1.00 14.52  ? 241 LYS A O   1 
ATOM   1706 C  CB  . LYS A 1 218 ? 19.913 88.529  41.722  1.00 16.23  ? 241 LYS A CB  1 
ATOM   1707 C  CG  . LYS A 1 218 ? 18.692 87.926  42.383  1.00 26.79  ? 241 LYS A CG  1 
ATOM   1708 C  CD  . LYS A 1 218 ? 18.083 88.979  43.289  1.00 37.14  ? 241 LYS A CD  1 
ATOM   1709 C  CE  . LYS A 1 218 ? 16.837 88.491  43.992  1.00 60.43  ? 241 LYS A CE  1 
ATOM   1710 N  NZ  . LYS A 1 218 ? 16.302 89.540  44.912  1.00 52.67  ? 241 LYS A NZ  1 
ATOM   1711 N  N   . ARG A 1 219 ? 22.883 88.624  40.465  1.00 10.66  ? 242 ARG A N   1 
ATOM   1712 C  CA  . ARG A 1 219 ? 23.865 89.355  39.684  1.00 9.88   ? 242 ARG A CA  1 
ATOM   1713 C  C   . ARG A 1 219 ? 25.267 89.024  40.150  1.00 11.90  ? 242 ARG A C   1 
ATOM   1714 O  O   . ARG A 1 219 ? 25.472 88.661  41.316  1.00 10.90  ? 242 ARG A O   1 
ATOM   1715 C  CB  . ARG A 1 219 ? 23.612 90.866  39.809  1.00 11.80  ? 242 ARG A CB  1 
ATOM   1716 C  CG  . ARG A 1 219 ? 23.859 91.415  41.215  1.00 12.60  ? 242 ARG A CG  1 
ATOM   1717 C  CD  . ARG A 1 219 ? 23.526 92.902  41.321  1.00 14.01  ? 242 ARG A CD  1 
ATOM   1718 N  NE  . ARG A 1 219 ? 23.833 93.434  42.648  1.00 9.94   ? 242 ARG A NE  1 
ATOM   1719 C  CZ  . ARG A 1 219 ? 23.032 93.324  43.705  1.00 11.93  ? 242 ARG A CZ  1 
ATOM   1720 N  NH1 . ARG A 1 219 ? 21.861 92.693  43.606  1.00 11.57  ? 242 ARG A NH1 1 
ATOM   1721 N  NH2 . ARG A 1 219 ? 23.404 93.838  44.871  1.00 14.19  ? 242 ARG A NH2 1 
ATOM   1722 N  N   . GLN A 1 220 ? 26.234 89.171  39.253  1.00 9.17   ? 243 GLN A N   1 
ATOM   1723 C  CA  . GLN A 1 220 ? 27.631 88.995  39.625  1.00 12.63  ? 243 GLN A CA  1 
ATOM   1724 C  C   . GLN A 1 220 ? 28.066 90.136  40.533  1.00 18.85  ? 243 GLN A C   1 
ATOM   1725 O  O   . GLN A 1 220 ? 27.724 91.296  40.292  1.00 11.74  ? 243 GLN A O   1 
ATOM   1726 C  CB  . GLN A 1 220 ? 28.503 88.967  38.377  1.00 13.34  ? 243 GLN A CB  1 
ATOM   1727 C  CG  . GLN A 1 220 ? 28.114 87.877  37.388  1.00 18.70  ? 243 GLN A CG  1 
ATOM   1728 C  CD  . GLN A 1 220 ? 28.814 86.555  37.650  1.00 41.50  ? 243 GLN A CD  1 
ATOM   1729 O  OE1 . GLN A 1 220 ? 29.926 86.327  37.166  1.00 34.73  ? 243 GLN A OE1 1 
ATOM   1730 N  NE2 . GLN A 1 220 ? 28.159 85.666  38.400  1.00 32.60  ? 243 GLN A NE2 1 
ATOM   1731 N  N   . ARG A 1 221 ? 28.794 89.797  41.596  1.00 11.43  ? 244 ARG A N   1 
ATOM   1732 C  CA  . ARG A 1 221 ? 29.316 90.790  42.536  1.00 9.69   ? 244 ARG A CA  1 
ATOM   1733 C  C   . ARG A 1 221 ? 30.711 90.384  42.951  1.00 10.23  ? 244 ARG A C   1 
ATOM   1734 O  O   . ARG A 1 221 ? 31.007 89.196  43.023  1.00 11.29  ? 244 ARG A O   1 
ATOM   1735 C  CB  . ARG A 1 221 ? 28.433 90.884  43.784  1.00 6.72   ? 244 ARG A CB  1 
ATOM   1736 C  CG  . ARG A 1 221 ? 26.966 91.119  43.510  1.00 10.50  ? 244 ARG A CG  1 
ATOM   1737 C  CD  . ARG A 1 221 ? 26.164 90.892  44.762  1.00 13.52  ? 244 ARG A CD  1 
ATOM   1738 N  NE  . ARG A 1 221 ? 26.294 91.994  45.717  1.00 10.78  ? 244 ARG A NE  1 
ATOM   1739 C  CZ  . ARG A 1 221 ? 25.605 92.062  46.851  1.00 13.28  ? 244 ARG A CZ  1 
ATOM   1740 N  NH1 . ARG A 1 221 ? 24.746 91.093  47.154  1.00 13.53  ? 244 ARG A NH1 1 
ATOM   1741 N  NH2 . ARG A 1 221 ? 25.762 93.096  47.667  1.00 14.18  ? 244 ARG A NH2 1 
ATOM   1742 N  N   . PRO A 1 222 ? 31.575 91.371  43.217  1.00 10.81  ? 245 PRO A N   1 
ATOM   1743 C  CA  . PRO A 1 222 ? 32.893 91.012  43.748  1.00 10.30  ? 245 PRO A CA  1 
ATOM   1744 C  C   . PRO A 1 222 ? 32.715 90.403  45.136  1.00 9.64   ? 245 PRO A C   1 
ATOM   1745 O  O   . PRO A 1 222 ? 31.878 90.852  45.933  1.00 9.91   ? 245 PRO A O   1 
ATOM   1746 C  CB  . PRO A 1 222 ? 33.650 92.350  43.792  1.00 11.21  ? 245 PRO A CB  1 
ATOM   1747 C  CG  . PRO A 1 222 ? 32.578 93.421  43.751  1.00 15.64  ? 245 PRO A CG  1 
ATOM   1748 C  CD  . PRO A 1 222 ? 31.395 92.823  43.033  1.00 13.43  ? 245 PRO A CD  1 
ATOM   1749 N  N   . ILE A 1 223 ? 33.481 89.359  45.407  1.00 9.15   ? 246 ILE A N   1 
ATOM   1750 C  CA  . ILE A 1 223 ? 33.362 88.652  46.672  1.00 6.00   ? 246 ILE A CA  1 
ATOM   1751 C  C   . ILE A 1 223 ? 34.536 88.989  47.575  1.00 6.10   ? 246 ILE A C   1 
ATOM   1752 O  O   . ILE A 1 223 ? 35.692 88.993  47.146  1.00 8.08   ? 246 ILE A O   1 
ATOM   1753 C  CB  . ILE A 1 223 ? 33.309 87.135  46.452  1.00 7.80   ? 246 ILE A CB  1 
ATOM   1754 C  CG1 . ILE A 1 223 ? 32.017 86.759  45.713  1.00 9.45   ? 246 ILE A CG1 1 
ATOM   1755 C  CG2 . ILE A 1 223 ? 33.374 86.399  47.800  1.00 8.43   ? 246 ILE A CG2 1 
ATOM   1756 C  CD1 . ILE A 1 223 ? 31.981 85.285  45.252  1.00 11.84  ? 246 ILE A CD1 1 
ATOM   1757 N  N   . HIS A 1 224 ? 34.205 89.289  48.826  1.00 8.98   ? 247 HIS A N   1 
ATOM   1758 C  CA  . HIS A 1 224 ? 35.178 89.463  49.885  1.00 7.98   ? 247 HIS A CA  1 
ATOM   1759 C  C   . HIS A 1 224 ? 35.082 88.252  50.805  1.00 4.85   ? 247 HIS A C   1 
ATOM   1760 O  O   . HIS A 1 224 ? 34.058 88.050  51.453  1.00 7.42   ? 247 HIS A O   1 
ATOM   1761 C  CB  . HIS A 1 224 ? 34.889 90.735  50.686  1.00 7.05   ? 247 HIS A CB  1 
ATOM   1762 C  CG  . HIS A 1 224 ? 35.962 91.075  51.667  1.00 10.92  ? 247 HIS A CG  1 
ATOM   1763 N  ND1 . HIS A 1 224 ? 36.824 92.135  51.493  1.00 9.03   ? 247 HIS A ND1 1 
ATOM   1764 C  CD2 . HIS A 1 224 ? 36.324 90.477  52.833  1.00 9.45   ? 247 HIS A CD2 1 
ATOM   1765 C  CE1 . HIS A 1 224 ? 37.672 92.181  52.510  1.00 13.33  ? 247 HIS A CE1 1 
ATOM   1766 N  NE2 . HIS A 1 224 ? 37.390 91.185  53.333  1.00 9.53   ? 247 HIS A NE2 1 
ATOM   1767 N  N   . LEU A 1 225 ? 36.139 87.445  50.833  1.00 7.46   ? 248 LEU A N   1 
ATOM   1768 C  CA  . LEU A 1 225 ? 36.192 86.271  51.708  1.00 6.41   ? 248 LEU A CA  1 
ATOM   1769 C  C   . LEU A 1 225 ? 36.954 86.648  52.967  1.00 6.28   ? 248 LEU A C   1 
ATOM   1770 O  O   . LEU A 1 225 ? 38.155 86.916  52.907  1.00 9.09   ? 248 LEU A O   1 
ATOM   1771 C  CB  . LEU A 1 225 ? 36.898 85.104  51.015  1.00 6.63   ? 248 LEU A CB  1 
ATOM   1772 C  CG  . LEU A 1 225 ? 37.081 83.870  51.917  1.00 8.53   ? 248 LEU A CG  1 
ATOM   1773 C  CD1 . LEU A 1 225 ? 35.716 83.263  52.273  1.00 9.08   ? 248 LEU A CD1 1 
ATOM   1774 C  CD2 . LEU A 1 225 ? 37.981 82.843  51.229  1.00 6.18   ? 248 LEU A CD2 1 
ATOM   1775 N  N   . SER A 1 226 ? 36.268 86.709  54.103  1.00 5.95   ? 249 SER A N   1 
ATOM   1776 C  CA  . SER A 1 226 ? 36.970 87.006  55.356  1.00 7.10   ? 249 SER A CA  1 
ATOM   1777 C  C   . SER A 1 226 ? 37.087 85.712  56.125  1.00 8.71   ? 249 SER A C   1 
ATOM   1778 O  O   . SER A 1 226 ? 36.092 85.222  56.649  1.00 7.39   ? 249 SER A O   1 
ATOM   1779 C  CB  . SER A 1 226 ? 36.238 88.063  56.183  1.00 7.75   ? 249 SER A CB  1 
ATOM   1780 O  OG  . SER A 1 226 ? 37.113 88.649  57.142  1.00 10.86  ? 249 SER A OG  1 
ATOM   1781 N  N   . PHE A 1 227 ? 38.295 85.154  56.179  1.00 8.56   ? 250 PHE A N   1 
ATOM   1782 C  CA  . PHE A 1 227 ? 38.480 83.801  56.705  1.00 8.06   ? 250 PHE A CA  1 
ATOM   1783 C  C   . PHE A 1 227 ? 39.260 83.820  58.020  1.00 9.79   ? 250 PHE A C   1 
ATOM   1784 O  O   . PHE A 1 227 ? 40.445 84.144  58.042  1.00 10.00  ? 250 PHE A O   1 
ATOM   1785 C  CB  . PHE A 1 227 ? 39.210 82.948  55.663  1.00 5.36   ? 250 PHE A CB  1 
ATOM   1786 C  CG  . PHE A 1 227 ? 38.975 81.461  55.811  1.00 11.16  ? 250 PHE A CG  1 
ATOM   1787 C  CD1 . PHE A 1 227 ? 39.412 80.781  56.943  1.00 10.37  ? 250 PHE A CD1 1 
ATOM   1788 C  CD2 . PHE A 1 227 ? 38.359 80.744  54.796  1.00 8.63   ? 250 PHE A CD2 1 
ATOM   1789 C  CE1 . PHE A 1 227 ? 39.204 79.409  57.080  1.00 11.79  ? 250 PHE A CE1 1 
ATOM   1790 C  CE2 . PHE A 1 227 ? 38.154 79.373  54.914  1.00 12.98  ? 250 PHE A CE2 1 
ATOM   1791 C  CZ  . PHE A 1 227 ? 38.580 78.704  56.057  1.00 10.54  ? 250 PHE A CZ  1 
ATOM   1792 N  N   . ASP A 1 228 ? 38.564 83.494  59.105  1.00 7.65   ? 251 ASP A N   1 
ATOM   1793 C  CA  . ASP A 1 228 ? 39.156 83.374  60.428  1.00 4.77   ? 251 ASP A CA  1 
ATOM   1794 C  C   . ASP A 1 228 ? 39.648 81.939  60.546  1.00 7.49   ? 251 ASP A C   1 
ATOM   1795 O  O   . ASP A 1 228 ? 38.850 81.022  60.450  1.00 8.24   ? 251 ASP A O   1 
ATOM   1796 C  CB  . ASP A 1 228 ? 38.075 83.647  61.488  1.00 6.15   ? 251 ASP A CB  1 
ATOM   1797 C  CG  . ASP A 1 228 ? 38.625 83.705  62.913  1.00 12.11  ? 251 ASP A CG  1 
ATOM   1798 O  OD1 . ASP A 1 228 ? 39.674 83.072  63.181  1.00 5.28   ? 251 ASP A OD1 1 
ATOM   1799 O  OD2 . ASP A 1 228 ? 37.983 84.358  63.785  1.00 7.25   ? 251 ASP A OD2 1 
ATOM   1800 N  N   . ILE A 1 229 ? 40.948 81.751  60.756  1.00 9.66   ? 252 ILE A N   1 
ATOM   1801 C  CA  . ILE A 1 229 ? 41.503 80.406  60.856  1.00 7.47   ? 252 ILE A CA  1 
ATOM   1802 C  C   . ILE A 1 229 ? 40.797 79.545  61.916  1.00 8.62   ? 252 ILE A C   1 
ATOM   1803 O  O   . ILE A 1 229 ? 40.780 78.305  61.799  1.00 9.50   ? 252 ILE A O   1 
ATOM   1804 C  CB  . ILE A 1 229 ? 43.034 80.439  61.101  1.00 7.01   ? 252 ILE A CB  1 
ATOM   1805 C  CG1 . ILE A 1 229 ? 43.683 79.132  60.622  1.00 7.28   ? 252 ILE A CG1 1 
ATOM   1806 C  CG2 . ILE A 1 229 ? 43.340 80.717  62.578  1.00 7.81   ? 252 ILE A CG2 1 
ATOM   1807 C  CD1 . ILE A 1 229 ? 43.702 78.970  59.084  1.00 11.23  ? 252 ILE A CD1 1 
ATOM   1808 N  N   . ASP A 1 230 ? 40.194 80.175  62.931  1.00 7.76   ? 253 ASP A N   1 
ATOM   1809 C  CA  . ASP A 1 230 ? 39.490 79.403  63.960  1.00 10.31  ? 253 ASP A CA  1 
ATOM   1810 C  C   . ASP A 1 230 ? 38.189 78.753  63.469  1.00 8.84   ? 253 ASP A C   1 
ATOM   1811 O  O   . ASP A 1 230 ? 37.510 78.049  64.216  1.00 7.05   ? 253 ASP A O   1 
ATOM   1812 C  CB  . ASP A 1 230 ? 39.313 80.185  65.286  1.00 8.86   ? 253 ASP A CB  1 
ATOM   1813 C  CG  . ASP A 1 230 ? 38.245 81.280  65.219  1.00 11.88  ? 253 ASP A CG  1 
ATOM   1814 O  OD1 . ASP A 1 230 ? 37.353 81.246  64.353  1.00 7.43   ? 253 ASP A OD1 1 
ATOM   1815 O  OD2 . ASP A 1 230 ? 38.286 82.192  66.075  1.00 10.07  ? 253 ASP A OD2 1 
ATOM   1816 N  N   . ALA A 1 231 ? 37.823 78.996  62.211  1.00 8.10   ? 254 ALA A N   1 
ATOM   1817 C  CA  . ALA A 1 231 ? 36.722 78.235  61.624  1.00 8.32   ? 254 ALA A CA  1 
ATOM   1818 C  C   . ALA A 1 231 ? 37.071 76.737  61.582  1.00 7.52   ? 254 ALA A C   1 
ATOM   1819 O  O   . ALA A 1 231 ? 36.202 75.870  61.761  1.00 9.39   ? 254 ALA A O   1 
ATOM   1820 C  CB  . ALA A 1 231 ? 36.395 78.732  60.219  1.00 6.89   ? 254 ALA A CB  1 
ATOM   1821 N  N   . PHE A 1 232 ? 38.346 76.443  61.371  1.00 5.82   ? 255 PHE A N   1 
ATOM   1822 C  CA  . PHE A 1 232 ? 38.800 75.054  61.349  1.00 7.62   ? 255 PHE A CA  1 
ATOM   1823 C  C   . PHE A 1 232 ? 38.765 74.455  62.746  1.00 11.75  ? 255 PHE A C   1 
ATOM   1824 O  O   . PHE A 1 232 ? 38.918 75.170  63.740  1.00 7.98   ? 255 PHE A O   1 
ATOM   1825 C  CB  . PHE A 1 232 ? 40.234 74.971  60.830  1.00 5.98   ? 255 PHE A CB  1 
ATOM   1826 C  CG  . PHE A 1 232 ? 40.343 75.105  59.345  1.00 8.81   ? 255 PHE A CG  1 
ATOM   1827 C  CD1 . PHE A 1 232 ? 39.893 74.080  58.518  1.00 8.83   ? 255 PHE A CD1 1 
ATOM   1828 C  CD2 . PHE A 1 232 ? 40.903 76.244  58.770  1.00 7.98   ? 255 PHE A CD2 1 
ATOM   1829 C  CE1 . PHE A 1 232 ? 40.006 74.177  57.132  1.00 9.61   ? 255 PHE A CE1 1 
ATOM   1830 C  CE2 . PHE A 1 232 ? 41.013 76.358  57.382  1.00 6.53   ? 255 PHE A CE2 1 
ATOM   1831 C  CZ  . PHE A 1 232 ? 40.559 75.310  56.558  1.00 9.39   ? 255 PHE A CZ  1 
ATOM   1832 N  N   . ASP A 1 233 ? 38.578 73.140  62.824  1.00 9.91   ? 256 ASP A N   1 
ATOM   1833 C  CA  . ASP A 1 233 ? 38.709 72.452  64.107  1.00 10.73  ? 256 ASP A CA  1 
ATOM   1834 C  C   . ASP A 1 233 ? 40.058 72.758  64.764  1.00 8.87   ? 256 ASP A C   1 
ATOM   1835 O  O   . ASP A 1 233 ? 41.079 72.846  64.085  1.00 11.02  ? 256 ASP A O   1 
ATOM   1836 C  CB  . ASP A 1 233 ? 38.562 70.942  63.946  1.00 14.81  ? 256 ASP A CB  1 
ATOM   1837 C  CG  . ASP A 1 233 ? 38.289 70.264  65.261  1.00 15.96  ? 256 ASP A CG  1 
ATOM   1838 O  OD1 . ASP A 1 233 ? 37.130 70.321  65.716  1.00 12.67  ? 256 ASP A OD1 1 
ATOM   1839 O  OD2 . ASP A 1 233 ? 39.237 69.704  65.851  1.00 15.91  ? 256 ASP A OD2 1 
ATOM   1840 N  N   . PRO A 1 234 ? 40.057 72.952  66.092  1.00 8.90   ? 257 PRO A N   1 
ATOM   1841 C  CA  . PRO A 1 234 ? 41.306 73.226  66.813  1.00 9.10   ? 257 PRO A CA  1 
ATOM   1842 C  C   . PRO A 1 234 ? 42.377 72.158  66.609  1.00 10.73  ? 257 PRO A C   1 
ATOM   1843 O  O   . PRO A 1 234 ? 43.562 72.470  66.734  1.00 10.66  ? 257 PRO A O   1 
ATOM   1844 C  CB  . PRO A 1 234 ? 40.866 73.260  68.285  1.00 13.58  ? 257 PRO A CB  1 
ATOM   1845 C  CG  . PRO A 1 234 ? 39.444 73.684  68.237  1.00 15.30  ? 257 PRO A CG  1 
ATOM   1846 C  CD  . PRO A 1 234 ? 38.881 73.041  66.980  1.00 11.33  ? 257 PRO A CD  1 
ATOM   1847 N  N   . THR A 1 235 ? 41.985 70.930  66.284  1.00 13.28  ? 258 THR A N   1 
ATOM   1848 C  CA  . THR A 1 235 ? 42.981 69.902  65.978  1.00 15.19  ? 258 THR A CA  1 
ATOM   1849 C  C   . THR A 1 235 ? 43.793 70.246  64.727  1.00 16.97  ? 258 THR A C   1 
ATOM   1850 O  O   . THR A 1 235 ? 44.954 69.853  64.602  1.00 16.49  ? 258 THR A O   1 
ATOM   1851 C  CB  . THR A 1 235 ? 42.324 68.521  65.813  1.00 16.29  ? 258 THR A CB  1 
ATOM   1852 O  OG1 . THR A 1 235 ? 41.345 68.582  64.767  1.00 15.79  ? 258 THR A OG1 1 
ATOM   1853 C  CG2 . THR A 1 235 ? 41.645 68.117  67.098  1.00 12.91  ? 258 THR A CG2 1 
ATOM   1854 N  N   . LEU A 1 236 ? 43.194 71.006  63.814  1.00 11.88  ? 259 LEU A N   1 
ATOM   1855 C  CA  . LEU A 1 236 ? 43.867 71.413  62.575  1.00 9.12   ? 259 LEU A CA  1 
ATOM   1856 C  C   . LEU A 1 236 ? 44.519 72.796  62.653  1.00 11.86  ? 259 LEU A C   1 
ATOM   1857 O  O   . LEU A 1 236 ? 45.534 73.052  62.008  1.00 11.41  ? 259 LEU A O   1 
ATOM   1858 C  CB  . LEU A 1 236 ? 42.852 71.446  61.434  1.00 13.21  ? 259 LEU A CB  1 
ATOM   1859 C  CG  . LEU A 1 236 ? 42.116 70.148  61.146  1.00 22.42  ? 259 LEU A CG  1 
ATOM   1860 C  CD1 . LEU A 1 236 ? 40.957 70.418  60.204  1.00 21.24  ? 259 LEU A CD1 1 
ATOM   1861 C  CD2 . LEU A 1 236 ? 43.088 69.152  60.531  1.00 19.27  ? 259 LEU A CD2 1 
ATOM   1862 N  N   . ALA A 1 237 ? 43.902 73.700  63.406  1.00 9.79   ? 260 ALA A N   1 
ATOM   1863 C  CA  . ALA A 1 237 ? 44.415 75.061  63.550  1.00 11.93  ? 260 ALA A CA  1 
ATOM   1864 C  C   . ALA A 1 237 ? 44.518 75.424  65.023  1.00 10.21  ? 260 ALA A C   1 
ATOM   1865 O  O   . ALA A 1 237 ? 43.749 76.237  65.528  1.00 8.40   ? 260 ALA A O   1 
ATOM   1866 C  CB  . ALA A 1 237 ? 43.517 76.048  62.804  1.00 8.86   ? 260 ALA A CB  1 
ATOM   1867 N  N   . PRO A 1 238 ? 45.462 74.795  65.735  1.00 8.28   ? 261 PRO A N   1 
ATOM   1868 C  CA  . PRO A 1 238 ? 45.539 75.061  67.176  1.00 14.55  ? 261 PRO A CA  1 
ATOM   1869 C  C   . PRO A 1 238 ? 46.090 76.453  67.504  1.00 9.62   ? 261 PRO A C   1 
ATOM   1870 O  O   . PRO A 1 238 ? 45.786 76.977  68.582  1.00 9.85   ? 261 PRO A O   1 
ATOM   1871 C  CB  . PRO A 1 238 ? 46.502 73.970  67.685  1.00 13.90  ? 261 PRO A CB  1 
ATOM   1872 C  CG  . PRO A 1 238 ? 47.360 73.626  66.486  1.00 11.26  ? 261 PRO A CG  1 
ATOM   1873 C  CD  . PRO A 1 238 ? 46.448 73.790  65.284  1.00 10.75  ? 261 PRO A CD  1 
ATOM   1874 N  N   . ALA A 1 239 ? 46.900 77.028  66.614  1.00 10.50  ? 262 ALA A N   1 
ATOM   1875 C  CA  . ALA A 1 239 ? 47.572 78.295  66.926  1.00 10.69  ? 262 ALA A CA  1 
ATOM   1876 C  C   . ALA A 1 239 ? 46.662 79.488  66.645  1.00 9.70   ? 262 ALA A C   1 
ATOM   1877 O  O   . ALA A 1 239 ? 46.835 80.185  65.652  1.00 10.79  ? 262 ALA A O   1 
ATOM   1878 C  CB  . ALA A 1 239 ? 48.871 78.417  66.151  1.00 8.37   ? 262 ALA A CB  1 
ATOM   1879 N  N   . THR A 1 240 ? 45.698 79.702  67.530  1.00 9.89   ? 263 THR A N   1 
ATOM   1880 C  CA  . THR A 1 240 ? 44.731 80.778  67.376  1.00 12.29  ? 263 THR A CA  1 
ATOM   1881 C  C   . THR A 1 240 ? 44.150 81.097  68.738  1.00 10.37  ? 263 THR A C   1 
ATOM   1882 O  O   . THR A 1 240 ? 44.136 80.234  69.637  1.00 11.91  ? 263 THR A O   1 
ATOM   1883 C  CB  . THR A 1 240 ? 43.626 80.396  66.349  1.00 9.68   ? 263 THR A CB  1 
ATOM   1884 O  OG1 . THR A 1 240 ? 42.910 81.573  65.941  1.00 10.15  ? 263 THR A OG1 1 
ATOM   1885 C  CG2 . THR A 1 240 ? 42.659 79.376  66.951  1.00 7.78   ? 263 THR A CG2 1 
ATOM   1886 N  N   . GLY A 1 241 ? 43.678 82.331  68.896  1.00 12.33  ? 264 GLY A N   1 
ATOM   1887 C  CA  . GLY A 1 241 ? 43.307 82.855  70.197  1.00 12.48  ? 264 GLY A CA  1 
ATOM   1888 C  C   . GLY A 1 241 ? 42.023 82.341  70.806  1.00 18.69  ? 264 GLY A C   1 
ATOM   1889 O  O   . GLY A 1 241 ? 41.908 82.236  72.027  1.00 12.01  ? 264 GLY A O   1 
ATOM   1890 N  N   . THR A 1 242 ? 41.039 82.027  69.974  1.00 11.05  ? 265 THR A N   1 
ATOM   1891 C  CA  A THR A 1 242 ? 39.751 81.587  70.481  0.75 10.14  ? 265 THR A CA  1 
ATOM   1892 C  CA  B THR A 1 242 ? 39.746 81.576  70.479  0.25 10.34  ? 265 THR A CA  1 
ATOM   1893 C  C   . THR A 1 242 ? 39.280 80.297  69.795  1.00 16.01  ? 265 THR A C   1 
ATOM   1894 O  O   . THR A 1 242 ? 38.287 80.307  69.059  1.00 12.23  ? 265 THR A O   1 
ATOM   1895 C  CB  A THR A 1 242 ? 38.687 82.695  70.297  0.75 16.31  ? 265 THR A CB  1 
ATOM   1896 C  CB  B THR A 1 242 ? 38.666 82.660  70.294  0.25 16.16  ? 265 THR A CB  1 
ATOM   1897 O  OG1 A THR A 1 242 ? 39.242 83.969  70.656  0.75 14.54  ? 265 THR A OG1 1 
ATOM   1898 O  OG1 B THR A 1 242 ? 38.495 82.932  68.897  0.25 12.60  ? 265 THR A OG1 1 
ATOM   1899 C  CG2 A THR A 1 242 ? 37.495 82.424  71.163  0.75 14.45  ? 265 THR A CG2 1 
ATOM   1900 C  CG2 B THR A 1 242 ? 39.069 83.933  71.009  0.25 14.27  ? 265 THR A CG2 1 
ATOM   1901 N  N   . PRO A 1 243 ? 39.990 79.179  70.042  1.00 12.45  ? 266 PRO A N   1 
ATOM   1902 C  CA  . PRO A 1 243 ? 39.657 77.896  69.412  1.00 12.57  ? 266 PRO A CA  1 
ATOM   1903 C  C   . PRO A 1 243 ? 38.338 77.368  69.958  1.00 16.43  ? 266 PRO A C   1 
ATOM   1904 O  O   . PRO A 1 243 ? 38.042 77.557  71.143  1.00 13.33  ? 266 PRO A O   1 
ATOM   1905 C  CB  . PRO A 1 243 ? 40.808 76.983  69.842  1.00 13.51  ? 266 PRO A CB  1 
ATOM   1906 C  CG  . PRO A 1 243 ? 41.276 77.570  71.171  1.00 17.62  ? 266 PRO A CG  1 
ATOM   1907 C  CD  . PRO A 1 243 ? 41.095 79.060  71.020  1.00 15.60  ? 266 PRO A CD  1 
ATOM   1908 N  N   . VAL A 1 244 ? 37.541 76.733  69.102  1.00 7.22   ? 267 VAL A N   1 
ATOM   1909 C  CA  . VAL A 1 244 ? 36.275 76.150  69.534  1.00 11.25  ? 267 VAL A CA  1 
ATOM   1910 C  C   . VAL A 1 244 ? 36.159 74.764  68.925  1.00 13.28  ? 267 VAL A C   1 
ATOM   1911 O  O   . VAL A 1 244 ? 36.291 74.621  67.712  1.00 10.82  ? 267 VAL A O   1 
ATOM   1912 C  CB  . VAL A 1 244 ? 35.069 76.983  69.054  1.00 9.59   ? 267 VAL A CB  1 
ATOM   1913 C  CG1 . VAL A 1 244 ? 33.777 76.352  69.556  1.00 8.80   ? 267 VAL A CG1 1 
ATOM   1914 C  CG2 . VAL A 1 244 ? 35.172 78.455  69.540  1.00 10.15  ? 267 VAL A CG2 1 
ATOM   1915 N  N   . VAL A 1 245 ? 35.932 73.749  69.763  1.00 10.41  ? 268 VAL A N   1 
ATOM   1916 C  CA  . VAL A 1 245 ? 35.849 72.372  69.281  1.00 12.23  ? 268 VAL A CA  1 
ATOM   1917 C  C   . VAL A 1 245 ? 34.735 72.198  68.255  1.00 9.50   ? 268 VAL A C   1 
ATOM   1918 O  O   . VAL A 1 245 ? 33.731 72.903  68.300  1.00 12.60  ? 268 VAL A O   1 
ATOM   1919 C  CB  . VAL A 1 245 ? 35.609 71.365  70.424  1.00 12.81  ? 268 VAL A CB  1 
ATOM   1920 C  CG1 . VAL A 1 245 ? 36.802 71.355  71.378  1.00 21.39  ? 268 VAL A CG1 1 
ATOM   1921 C  CG2 . VAL A 1 245 ? 34.310 71.695  71.170  1.00 13.12  ? 268 VAL A CG2 1 
ATOM   1922 N  N   . GLY A 1 246 ? 34.912 71.242  67.353  1.00 10.09  ? 269 GLY A N   1 
ATOM   1923 C  CA  . GLY A 1 246 ? 33.865 70.854  66.425  1.00 11.00  ? 269 GLY A CA  1 
ATOM   1924 C  C   . GLY A 1 246 ? 33.769 71.730  65.190  1.00 10.27  ? 269 GLY A C   1 
ATOM   1925 O  O   . GLY A 1 246 ? 32.670 72.038  64.745  1.00 9.47   ? 269 GLY A O   1 
ATOM   1926 N  N   . GLY A 1 247 ? 34.923 72.087  64.633  1.00 9.22   ? 270 GLY A N   1 
ATOM   1927 C  CA  . GLY A 1 247 ? 35.009 73.001  63.499  1.00 8.21   ? 270 GLY A CA  1 
ATOM   1928 C  C   . GLY A 1 247 ? 35.086 72.323  62.144  1.00 11.61  ? 270 GLY A C   1 
ATOM   1929 O  O   . GLY A 1 247 ? 34.874 71.113  62.016  1.00 6.25   ? 270 GLY A O   1 
ATOM   1930 N  N   . LEU A 1 248 ? 35.385 73.118  61.122  1.00 6.37   ? 271 LEU A N   1 
ATOM   1931 C  CA  . LEU A 1 248 ? 35.524 72.611  59.763  1.00 9.65   ? 271 LEU A CA  1 
ATOM   1932 C  C   . LEU A 1 248 ? 36.634 71.578  59.701  1.00 10.15  ? 271 LEU A C   1 
ATOM   1933 O  O   . LEU A 1 248 ? 37.661 71.739  60.351  1.00 6.01   ? 271 LEU A O   1 
ATOM   1934 C  CB  . LEU A 1 248 ? 35.901 73.749  58.808  1.00 4.53   ? 271 LEU A CB  1 
ATOM   1935 C  CG  . LEU A 1 248 ? 34.898 74.896  58.698  1.00 9.00   ? 271 LEU A CG  1 
ATOM   1936 C  CD1 . LEU A 1 248 ? 35.484 75.985  57.807  1.00 9.88   ? 271 LEU A CD1 1 
ATOM   1937 C  CD2 . LEU A 1 248 ? 33.610 74.356  58.104  1.00 6.82   ? 271 LEU A CD2 1 
ATOM   1938 N  N   . THR A 1 249 ? 36.446 70.552  58.871  1.00 7.32   ? 272 THR A N   1 
ATOM   1939 C  CA  . THR A 1 249 ? 37.529 69.638  58.545  1.00 9.50   ? 272 THR A CA  1 
ATOM   1940 C  C   . THR A 1 249 ? 38.429 70.289  57.505  1.00 11.86  ? 272 THR A C   1 
ATOM   1941 O  O   . THR A 1 249 ? 38.062 71.307  56.904  1.00 8.23   ? 272 THR A O   1 
ATOM   1942 C  CB  . THR A 1 249 ? 37.007 68.322  57.963  1.00 10.57  ? 272 THR A CB  1 
ATOM   1943 O  OG1 . THR A 1 249 ? 36.336 68.581  56.718  1.00 7.22   ? 272 THR A OG1 1 
ATOM   1944 C  CG2 . THR A 1 249 ? 36.045 67.658  58.941  1.00 7.80   ? 272 THR A CG2 1 
ATOM   1945 N  N   . TYR A 1 250 ? 39.615 69.717  57.303  1.00 7.80   ? 273 TYR A N   1 
ATOM   1946 C  CA  . TYR A 1 250 ? 40.517 70.204  56.264  1.00 9.48   ? 273 TYR A CA  1 
ATOM   1947 C  C   . TYR A 1 250 ? 39.810 70.236  54.914  1.00 11.51  ? 273 TYR A C   1 
ATOM   1948 O  O   . TYR A 1 250 ? 39.877 71.230  54.175  1.00 8.51   ? 273 TYR A O   1 
ATOM   1949 C  CB  . TYR A 1 250 ? 41.768 69.320  56.166  1.00 7.93   ? 273 TYR A CB  1 
ATOM   1950 C  CG  . TYR A 1 250 ? 42.723 69.771  55.083  1.00 10.22  ? 273 TYR A CG  1 
ATOM   1951 C  CD1 . TYR A 1 250 ? 43.687 70.733  55.342  1.00 11.35  ? 273 TYR A CD1 1 
ATOM   1952 C  CD2 . TYR A 1 250 ? 42.652 69.245  53.798  1.00 10.72  ? 273 TYR A CD2 1 
ATOM   1953 C  CE1 . TYR A 1 250 ? 44.563 71.153  54.359  1.00 9.94   ? 273 TYR A CE1 1 
ATOM   1954 C  CE2 . TYR A 1 250 ? 43.519 69.668  52.806  1.00 13.27  ? 273 TYR A CE2 1 
ATOM   1955 C  CZ  . TYR A 1 250 ? 44.467 70.618  53.093  1.00 11.02  ? 273 TYR A CZ  1 
ATOM   1956 O  OH  . TYR A 1 250 ? 45.330 71.039  52.119  1.00 15.71  ? 273 TYR A OH  1 
ATOM   1957 N  N   . ARG A 1 251 ? 39.155 69.128  54.582  1.00 8.58   ? 274 ARG A N   1 
ATOM   1958 C  CA  . ARG A 1 251 ? 38.468 68.999  53.305  1.00 8.49   ? 274 ARG A CA  1 
ATOM   1959 C  C   . ARG A 1 251 ? 37.352 70.019  53.146  1.00 8.76   ? 274 ARG A C   1 
ATOM   1960 O  O   . ARG A 1 251 ? 37.170 70.584  52.062  1.00 9.07   ? 274 ARG A O   1 
ATOM   1961 C  CB  . ARG A 1 251 ? 37.944 67.569  53.138  1.00 7.94   ? 274 ARG A CB  1 
ATOM   1962 C  CG  . ARG A 1 251 ? 39.082 66.580  52.837  1.00 8.59   ? 274 ARG A CG  1 
ATOM   1963 C  CD  . ARG A 1 251 ? 38.704 65.164  53.245  1.00 9.85   ? 274 ARG A CD  1 
ATOM   1964 N  NE  . ARG A 1 251 ? 37.461 64.718  52.622  1.00 10.31  ? 274 ARG A NE  1 
ATOM   1965 C  CZ  . ARG A 1 251 ? 36.916 63.519  52.812  1.00 11.68  ? 274 ARG A CZ  1 
ATOM   1966 N  NH1 . ARG A 1 251 ? 37.524 62.627  53.585  1.00 7.47   ? 274 ARG A NH1 1 
ATOM   1967 N  NH2 . ARG A 1 251 ? 35.779 63.208  52.210  1.00 8.29   ? 274 ARG A NH2 1 
ATOM   1968 N  N   . GLU A 1 252 ? 36.604 70.270  54.213  1.00 7.22   ? 275 GLU A N   1 
ATOM   1969 C  CA  . GLU A 1 252 ? 35.544 71.275  54.117  1.00 8.14   ? 275 GLU A CA  1 
ATOM   1970 C  C   . GLU A 1 252 ? 36.102 72.664  53.830  1.00 9.67   ? 275 GLU A C   1 
ATOM   1971 O  O   . GLU A 1 252 ? 35.556 73.408  53.011  1.00 7.90   ? 275 GLU A O   1 
ATOM   1972 C  CB  . GLU A 1 252 ? 34.690 71.279  55.382  1.00 8.62   ? 275 GLU A CB  1 
ATOM   1973 C  CG  . GLU A 1 252 ? 33.722 70.088  55.453  1.00 10.52  ? 275 GLU A CG  1 
ATOM   1974 C  CD  . GLU A 1 252 ? 33.065 69.952  56.810  1.00 10.60  ? 275 GLU A CD  1 
ATOM   1975 O  OE1 . GLU A 1 252 ? 33.660 70.421  57.798  1.00 11.66  ? 275 GLU A OE1 1 
ATOM   1976 O  OE2 . GLU A 1 252 ? 31.955 69.372  56.894  1.00 9.48   ? 275 GLU A OE2 1 
ATOM   1977 N  N   . GLY A 1 253 ? 37.173 73.024  54.533  1.00 9.91   ? 276 GLY A N   1 
ATOM   1978 C  CA  . GLY A 1 253 ? 37.826 74.304  54.304  1.00 7.47   ? 276 GLY A CA  1 
ATOM   1979 C  C   . GLY A 1 253 ? 38.309 74.455  52.874  1.00 11.36  ? 276 GLY A C   1 
ATOM   1980 O  O   . GLY A 1 253 ? 38.082 75.487  52.231  1.00 9.92   ? 276 GLY A O   1 
ATOM   1981 N  N   . MET A 1 254 ? 38.982 73.432  52.358  1.00 5.69   ? 277 MET A N   1 
ATOM   1982 C  CA  . MET A 1 254 ? 39.435 73.482  50.975  1.00 8.61   ? 277 MET A CA  1 
ATOM   1983 C  C   . MET A 1 254 ? 38.263 73.621  50.019  1.00 7.78   ? 277 MET A C   1 
ATOM   1984 O  O   . MET A 1 254 ? 38.331 74.368  49.035  1.00 9.95   ? 277 MET A O   1 
ATOM   1985 C  CB  . MET A 1 254 ? 40.267 72.241  50.611  1.00 8.52   ? 277 MET A CB  1 
ATOM   1986 C  CG  . MET A 1 254 ? 41.581 72.124  51.373  1.00 16.28  ? 277 MET A CG  1 
ATOM   1987 S  SD  . MET A 1 254 ? 42.616 73.608  51.304  1.00 14.30  ? 277 MET A SD  1 
ATOM   1988 C  CE  . MET A 1 254 ? 42.239 74.363  52.890  1.00 12.30  ? 277 MET A CE  1 
ATOM   1989 N  N   . TYR A 1 255 ? 37.182 72.916  50.309  1.00 9.84   ? 278 TYR A N   1 
ATOM   1990 C  CA  . TYR A 1 255 ? 36.017 72.985  49.437  1.00 8.98   ? 278 TYR A CA  1 
ATOM   1991 C  C   . TYR A 1 255 ? 35.426 74.399  49.391  1.00 12.00  ? 278 TYR A C   1 
ATOM   1992 O  O   . TYR A 1 255 ? 35.034 74.892  48.322  1.00 7.72   ? 278 TYR A O   1 
ATOM   1993 C  CB  . TYR A 1 255 ? 34.956 71.948  49.841  1.00 8.15   ? 278 TYR A CB  1 
ATOM   1994 C  CG  . TYR A 1 255 ? 33.866 71.842  48.796  1.00 14.68  ? 278 TYR A CG  1 
ATOM   1995 C  CD1 . TYR A 1 255 ? 33.993 70.995  47.697  1.00 19.80  ? 278 TYR A CD1 1 
ATOM   1996 C  CD2 . TYR A 1 255 ? 32.728 72.625  48.890  1.00 12.72  ? 278 TYR A CD2 1 
ATOM   1997 C  CE1 . TYR A 1 255 ? 32.985 70.931  46.719  1.00 16.36  ? 278 TYR A CE1 1 
ATOM   1998 C  CE2 . TYR A 1 255 ? 31.744 72.568  47.944  1.00 8.64   ? 278 TYR A CE2 1 
ATOM   1999 C  CZ  . TYR A 1 255 ? 31.868 71.731  46.857  1.00 16.67  ? 278 TYR A CZ  1 
ATOM   2000 O  OH  . TYR A 1 255 ? 30.847 71.707  45.923  1.00 24.26  ? 278 TYR A OH  1 
ATOM   2001 N  N   . ILE A 1 256 ? 35.327 75.042  50.550  1.00 7.86   ? 279 ILE A N   1 
ATOM   2002 C  CA  . ILE A 1 256 ? 34.862 76.431  50.591  1.00 6.28   ? 279 ILE A CA  1 
ATOM   2003 C  C   . ILE A 1 256 ? 35.718 77.287  49.670  1.00 6.92   ? 279 ILE A C   1 
ATOM   2004 O  O   . ILE A 1 256 ? 35.211 78.020  48.812  1.00 9.27   ? 279 ILE A O   1 
ATOM   2005 C  CB  . ILE A 1 256 ? 34.937 76.992  52.024  1.00 8.67   ? 279 ILE A CB  1 
ATOM   2006 C  CG1 . ILE A 1 256 ? 33.946 76.256  52.924  1.00 10.71  ? 279 ILE A CG1 1 
ATOM   2007 C  CG2 . ILE A 1 256 ? 34.674 78.512  52.017  1.00 6.75   ? 279 ILE A CG2 1 
ATOM   2008 C  CD1 . ILE A 1 256 ? 34.120 76.570  54.428  1.00 10.32  ? 279 ILE A CD1 1 
ATOM   2009 N  N   . ALA A 1 257 ? 37.029 77.178  49.834  1.00 9.30   ? 280 ALA A N   1 
ATOM   2010 C  CA  . ALA A 1 257 ? 37.958 77.991  49.057  1.00 9.33   ? 280 ALA A CA  1 
ATOM   2011 C  C   . ALA A 1 257 ? 37.868 77.682  47.568  1.00 10.95  ? 280 ALA A C   1 
ATOM   2012 O  O   . ALA A 1 257 ? 37.904 78.596  46.726  1.00 8.38   ? 280 ALA A O   1 
ATOM   2013 C  CB  . ALA A 1 257 ? 39.377 77.779  49.562  1.00 9.49   ? 280 ALA A CB  1 
ATOM   2014 N  N   . GLU A 1 258 ? 37.763 76.396  47.234  1.00 6.68   ? 281 GLU A N   1 
ATOM   2015 C  CA  . GLU A 1 258 ? 37.602 75.988  45.833  1.00 8.04   ? 281 GLU A CA  1 
ATOM   2016 C  C   . GLU A 1 258 ? 36.364 76.608  45.207  1.00 7.20   ? 281 GLU A C   1 
ATOM   2017 O  O   . GLU A 1 258 ? 36.415 77.100  44.073  1.00 9.83   ? 281 GLU A O   1 
ATOM   2018 C  CB  . GLU A 1 258 ? 37.526 74.456  45.721  1.00 10.35  ? 281 GLU A CB  1 
ATOM   2019 C  CG  . GLU A 1 258 ? 38.871 73.789  45.866  1.00 11.99  ? 281 GLU A CG  1 
ATOM   2020 C  CD  . GLU A 1 258 ? 38.771 72.295  46.147  1.00 15.05  ? 281 GLU A CD  1 
ATOM   2021 O  OE1 . GLU A 1 258 ? 37.642 71.763  46.266  1.00 11.68  ? 281 GLU A OE1 1 
ATOM   2022 O  OE2 . GLU A 1 258 ? 39.835 71.659  46.256  1.00 11.90  ? 281 GLU A OE2 1 
ATOM   2023 N  N   . GLU A 1 259 ? 35.253 76.579  45.934  1.00 9.00   ? 282 GLU A N   1 
ATOM   2024 C  CA  . GLU A 1 259 ? 34.011 77.129  45.410  1.00 9.51   ? 282 GLU A CA  1 
ATOM   2025 C  C   . GLU A 1 259 ? 34.105 78.651  45.276  1.00 12.37  ? 282 GLU A C   1 
ATOM   2026 O  O   . GLU A 1 259 ? 33.577 79.233  44.322  1.00 11.05  ? 282 GLU A O   1 
ATOM   2027 C  CB  . GLU A 1 259 ? 32.815 76.712  46.253  1.00 11.16  ? 282 GLU A CB  1 
ATOM   2028 C  CG  . GLU A 1 259 ? 32.432 75.258  46.034  1.00 11.50  ? 282 GLU A CG  1 
ATOM   2029 C  CD  . GLU A 1 259 ? 32.306 74.933  44.561  1.00 17.73  ? 282 GLU A CD  1 
ATOM   2030 O  OE1 . GLU A 1 259 ? 31.376 75.467  43.918  1.00 18.84  ? 282 GLU A OE1 1 
ATOM   2031 O  OE2 . GLU A 1 259 ? 33.144 74.163  44.046  1.00 21.33  ? 282 GLU A OE2 1 
ATOM   2032 N  N   . ILE A 1 260 ? 34.780 79.288  46.227  1.00 8.45   ? 283 ILE A N   1 
ATOM   2033 C  CA  . ILE A 1 260 ? 35.103 80.715  46.092  1.00 7.68   ? 283 ILE A CA  1 
ATOM   2034 C  C   . ILE A 1 260 ? 35.882 80.958  44.798  1.00 14.70  ? 283 ILE A C   1 
ATOM   2035 O  O   . ILE A 1 260 ? 35.507 81.825  43.985  1.00 10.17  ? 283 ILE A O   1 
ATOM   2036 C  CB  . ILE A 1 260 ? 35.922 81.215  47.298  1.00 9.78   ? 283 ILE A CB  1 
ATOM   2037 C  CG1 . ILE A 1 260 ? 35.046 81.237  48.552  1.00 12.80  ? 283 ILE A CG1 1 
ATOM   2038 C  CG2 . ILE A 1 260 ? 36.503 82.614  47.027  1.00 9.37   ? 283 ILE A CG2 1 
ATOM   2039 C  CD1 . ILE A 1 260 ? 33.976 82.326  48.531  1.00 13.95  ? 283 ILE A CD1 1 
ATOM   2040 N  N   . HIS A 1 261 ? 36.950 80.189  44.575  1.00 5.88   ? 284 HIS A N   1 
ATOM   2041 C  CA  . HIS A 1 261 ? 37.686 80.350  43.329  1.00 9.87   ? 284 HIS A CA  1 
ATOM   2042 C  C   . HIS A 1 261 ? 36.803 80.129  42.099  1.00 13.36  ? 284 HIS A C   1 
ATOM   2043 O  O   . HIS A 1 261 ? 36.890 80.882  41.120  1.00 10.17  ? 284 HIS A O   1 
ATOM   2044 C  CB  . HIS A 1 261 ? 38.870 79.385  43.229  1.00 9.80   ? 284 HIS A CB  1 
ATOM   2045 C  CG  . HIS A 1 261 ? 39.545 79.435  41.887  1.00 15.14  ? 284 HIS A CG  1 
ATOM   2046 N  ND1 . HIS A 1 261 ? 40.294 80.508  41.478  1.00 12.63  ? 284 HIS A ND1 1 
ATOM   2047 C  CD2 . HIS A 1 261 ? 39.534 78.552  40.856  1.00 12.67  ? 284 HIS A CD2 1 
ATOM   2048 C  CE1 . HIS A 1 261 ? 40.738 80.289  40.243  1.00 15.06  ? 284 HIS A CE1 1 
ATOM   2049 N  NE2 . HIS A 1 261 ? 40.295 79.115  39.852  1.00 17.83  ? 284 HIS A NE2 1 
ATOM   2050 N  N   . ASN A 1 262 ? 35.954 79.103  42.145  1.00 9.83   ? 285 ASN A N   1 
ATOM   2051 C  CA  . ASN A 1 262 ? 35.156 78.731  40.986  1.00 14.51  ? 285 ASN A CA  1 
ATOM   2052 C  C   . ASN A 1 262 ? 34.146 79.798  40.575  1.00 14.01  ? 285 ASN A C   1 
ATOM   2053 O  O   . ASN A 1 262 ? 33.668 79.782  39.450  1.00 11.25  ? 285 ASN A O   1 
ATOM   2054 C  CB  . ASN A 1 262 ? 34.447 77.379  41.189  1.00 15.09  ? 285 ASN A CB  1 
ATOM   2055 C  CG  . ASN A 1 262 ? 35.399 76.195  41.108  1.00 18.28  ? 285 ASN A CG  1 
ATOM   2056 O  OD1 . ASN A 1 262 ? 36.509 76.310  40.587  1.00 16.63  ? 285 ASN A OD1 1 
ATOM   2057 N  ND2 . ASN A 1 262 ? 34.971 75.050  41.645  1.00 15.46  ? 285 ASN A ND2 1 
ATOM   2058 N  N   . THR A 1 263 ? 33.821 80.728  41.465  1.00 10.24  ? 286 THR A N   1 
ATOM   2059 C  CA  . THR A 1 263 ? 32.923 81.833  41.072  1.00 10.06  ? 286 THR A CA  1 
ATOM   2060 C  C   . THR A 1 263 ? 33.587 82.769  40.074  1.00 11.09  ? 286 THR A C   1 
ATOM   2061 O  O   . THR A 1 263 ? 32.900 83.471  39.328  1.00 15.75  ? 286 THR A O   1 
ATOM   2062 C  CB  . THR A 1 263 ? 32.482 82.709  42.260  1.00 9.13   ? 286 THR A CB  1 
ATOM   2063 O  OG1 . THR A 1 263 ? 33.615 83.423  42.776  1.00 8.81   ? 286 THR A OG1 1 
ATOM   2064 C  CG2 . THR A 1 263 ? 31.835 81.897  43.338  1.00 11.02  ? 286 THR A CG2 1 
ATOM   2065 N  N   . GLY A 1 264 ? 34.919 82.815  40.094  1.00 12.88  ? 287 GLY A N   1 
ATOM   2066 C  CA  . GLY A 1 264 ? 35.669 83.774  39.297  1.00 13.86  ? 287 GLY A CA  1 
ATOM   2067 C  C   . GLY A 1 264 ? 35.507 85.205  39.796  1.00 15.53  ? 287 GLY A C   1 
ATOM   2068 O  O   . GLY A 1 264 ? 35.896 86.161  39.129  1.00 12.81  ? 287 GLY A O   1 
ATOM   2069 N  N   . LEU A 1 265 ? 34.912 85.360  40.971  1.00 8.52   ? 288 LEU A N   1 
ATOM   2070 C  CA  . LEU A 1 265 ? 34.574 86.691  41.487  1.00 9.26   ? 288 LEU A CA  1 
ATOM   2071 C  C   . LEU A 1 265 ? 35.353 87.128  42.726  1.00 14.36  ? 288 LEU A C   1 
ATOM   2072 O  O   . LEU A 1 265 ? 35.094 88.203  43.264  1.00 9.84   ? 288 LEU A O   1 
ATOM   2073 C  CB  . LEU A 1 265 ? 33.079 86.783  41.784  1.00 10.32  ? 288 LEU A CB  1 
ATOM   2074 C  CG  . LEU A 1 265 ? 32.176 86.661  40.555  1.00 15.06  ? 288 LEU A CG  1 
ATOM   2075 C  CD1 . LEU A 1 265 ? 30.741 86.466  41.001  1.00 13.59  ? 288 LEU A CD1 1 
ATOM   2076 C  CD2 . LEU A 1 265 ? 32.330 87.911  39.700  1.00 14.04  ? 288 LEU A CD2 1 
ATOM   2077 N  N   . LEU A 1 266 ? 36.294 86.315  43.198  1.00 13.09  ? 289 LEU A N   1 
ATOM   2078 C  CA  . LEU A 1 266 ? 37.042 86.704  44.393  1.00 10.45  ? 289 LEU A CA  1 
ATOM   2079 C  C   . LEU A 1 266 ? 37.816 87.994  44.165  1.00 15.32  ? 289 LEU A C   1 
ATOM   2080 O  O   . LEU A 1 266 ? 38.638 88.096  43.247  1.00 9.44   ? 289 LEU A O   1 
ATOM   2081 C  CB  . LEU A 1 266 ? 38.004 85.604  44.842  1.00 9.84   ? 289 LEU A CB  1 
ATOM   2082 C  CG  . LEU A 1 266 ? 38.809 85.933  46.106  1.00 11.94  ? 289 LEU A CG  1 
ATOM   2083 C  CD1 . LEU A 1 266 ? 37.897 86.157  47.333  1.00 11.50  ? 289 LEU A CD1 1 
ATOM   2084 C  CD2 . LEU A 1 266 ? 39.788 84.802  46.365  1.00 11.71  ? 289 LEU A CD2 1 
ATOM   2085 N  N   . SER A 1 267 ? 37.571 88.976  45.023  1.00 11.11  ? 290 SER A N   1 
ATOM   2086 C  CA  . SER A 1 267 ? 38.177 90.291  44.845  1.00 9.10   ? 290 SER A CA  1 
ATOM   2087 C  C   . SER A 1 267 ? 39.091 90.667  46.009  1.00 10.95  ? 290 SER A C   1 
ATOM   2088 O  O   . SER A 1 267 ? 40.046 91.413  45.831  1.00 11.81  ? 290 SER A O   1 
ATOM   2089 C  CB  . SER A 1 267 ? 37.071 91.344  44.631  1.00 13.59  ? 290 SER A CB  1 
ATOM   2090 O  OG  . SER A 1 267 ? 37.616 92.640  44.433  1.00 12.73  ? 290 SER A OG  1 
ATOM   2091 N  N   . ALA A 1 268 ? 38.792 90.157  47.204  1.00 8.18   ? 291 ALA A N   1 
ATOM   2092 C  CA  . ALA A 1 268 ? 39.677 90.351  48.346  1.00 11.33  ? 291 ALA A CA  1 
ATOM   2093 C  C   . ALA A 1 268 ? 39.496 89.223  49.334  1.00 8.07   ? 291 ALA A C   1 
ATOM   2094 O  O   . ALA A 1 268 ? 38.413 88.647  49.449  1.00 7.83   ? 291 ALA A O   1 
ATOM   2095 C  CB  . ALA A 1 268 ? 39.419 91.704  49.035  1.00 9.20   ? 291 ALA A CB  1 
ATOM   2096 N  N   . LEU A 1 269 ? 40.554 88.941  50.080  1.00 9.03   ? 292 LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 269 ? 40.528 87.840  51.036  1.00 8.72   ? 292 LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 269 ? 41.279 88.251  52.292  1.00 7.56   ? 292 LEU A C   1 
ATOM   2099 O  O   . LEU A 1 269 ? 42.371 88.812  52.204  1.00 9.25   ? 292 LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 269 ? 41.158 86.597  50.395  1.00 7.79   ? 292 LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 269 ? 41.298 85.295  51.195  1.00 12.25  ? 292 LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 269 ? 41.409 84.146  50.221  1.00 13.25  ? 292 LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 269 ? 42.555 85.320  52.071  1.00 12.69  ? 292 LEU A CD2 1 
ATOM   2104 N  N   . ASP A 1 270 ? 40.678 87.986  53.452  1.00 6.21   ? 293 ASP A N   1 
ATOM   2105 C  CA  . ASP A 1 270 ? 41.376 88.133  54.731  1.00 8.03   ? 293 ASP A CA  1 
ATOM   2106 C  C   . ASP A 1 270 ? 41.695 86.751  55.286  1.00 6.70   ? 293 ASP A C   1 
ATOM   2107 O  O   . ASP A 1 270 ? 40.827 85.893  55.310  1.00 9.07   ? 293 ASP A O   1 
ATOM   2108 C  CB  . ASP A 1 270 ? 40.497 88.849  55.763  1.00 6.98   ? 293 ASP A CB  1 
ATOM   2109 C  CG  . ASP A 1 270 ? 39.833 90.096  55.216  1.00 9.05   ? 293 ASP A CG  1 
ATOM   2110 O  OD1 . ASP A 1 270 ? 40.513 90.887  54.532  1.00 10.89  ? 293 ASP A OD1 1 
ATOM   2111 O  OD2 . ASP A 1 270 ? 38.621 90.274  55.482  1.00 10.13  ? 293 ASP A OD2 1 
ATOM   2112 N  N   . LEU A 1 271 ? 42.892 86.564  55.815  1.00 8.09   ? 294 LEU A N   1 
ATOM   2113 C  CA  . LEU A 1 271 ? 43.189 85.330  56.520  1.00 9.48   ? 294 LEU A CA  1 
ATOM   2114 C  C   . LEU A 1 271 ? 43.717 85.719  57.846  1.00 5.77   ? 294 LEU A C   1 
ATOM   2115 O  O   . LEU A 1 271 ? 44.816 86.138  57.929  1.00 9.88   ? 294 LEU A O   1 
ATOM   2116 C  CB  . LEU A 1 271 ? 44.251 84.549  55.819  1.00 10.26  ? 294 LEU A CB  1 
ATOM   2117 C  CG  . LEU A 1 271 ? 44.314 83.088  56.155  1.00 11.58  ? 294 LEU A CG  1 
ATOM   2118 C  CD1 . LEU A 1 271 ? 44.658 82.851  57.620  1.00 7.54   ? 294 LEU A CD1 1 
ATOM   2119 C  CD2 . LEU A 1 271 ? 43.100 82.326  55.675  1.00 10.99  ? 294 LEU A CD2 1 
ATOM   2120 N  N   . VAL A 1 272 ? 42.870 85.627  58.839  1.00 6.57   ? 295 VAL A N   1 
ATOM   2121 C  CA  . VAL A 1 272 ? 43.130 86.256  60.124  1.00 7.33   ? 295 VAL A CA  1 
ATOM   2122 C  C   . VAL A 1 272 ? 43.231 85.261  61.271  1.00 9.18   ? 295 VAL A C   1 
ATOM   2123 O  O   . VAL A 1 272 ? 42.829 84.098  61.146  1.00 6.48   ? 295 VAL A O   1 
ATOM   2124 C  CB  . VAL A 1 272 ? 42.034 87.310  60.481  1.00 8.24   ? 295 VAL A CB  1 
ATOM   2125 C  CG1 . VAL A 1 272 ? 41.936 88.373  59.388  1.00 8.95   ? 295 VAL A CG1 1 
ATOM   2126 C  CG2 . VAL A 1 272 ? 40.689 86.622  60.697  1.00 6.47   ? 295 VAL A CG2 1 
ATOM   2127 N  N   . GLU A 1 273 ? 43.810 85.747  62.367  1.00 7.90   ? 296 GLU A N   1 
ATOM   2128 C  CA  . GLU A 1 273 ? 43.821 85.078  63.673  1.00 8.54   ? 296 GLU A CA  1 
ATOM   2129 C  C   . GLU A 1 273 ? 44.801 83.918  63.842  1.00 9.02   ? 296 GLU A C   1 
ATOM   2130 O  O   . GLU A 1 273 ? 44.725 83.188  64.834  1.00 11.08  ? 296 GLU A O   1 
ATOM   2131 C  CB  . GLU A 1 273 ? 42.403 84.682  64.127  1.00 7.70   ? 296 GLU A CB  1 
ATOM   2132 C  CG  . GLU A 1 273 ? 41.435 85.886  64.292  1.00 8.14   ? 296 GLU A CG  1 
ATOM   2133 C  CD  . GLU A 1 273 ? 41.644 86.677  65.577  1.00 11.85  ? 296 GLU A CD  1 
ATOM   2134 O  OE1 . GLU A 1 273 ? 42.495 86.282  66.408  1.00 13.98  ? 296 GLU A OE1 1 
ATOM   2135 O  OE2 . GLU A 1 273 ? 40.942 87.698  65.768  1.00 11.52  ? 296 GLU A OE2 1 
ATOM   2136 N  N   . VAL A 1 274 ? 45.726 83.757  62.903  1.00 7.58   ? 297 VAL A N   1 
ATOM   2137 C  CA  . VAL A 1 274 ? 46.850 82.838  63.133  1.00 7.50   ? 297 VAL A CA  1 
ATOM   2138 C  C   . VAL A 1 274 ? 47.773 83.462  64.184  1.00 13.77  ? 297 VAL A C   1 
ATOM   2139 O  O   . VAL A 1 274 ? 48.322 84.535  63.968  1.00 11.72  ? 297 VAL A O   1 
ATOM   2140 C  CB  . VAL A 1 274 ? 47.627 82.534  61.841  1.00 11.14  ? 297 VAL A CB  1 
ATOM   2141 C  CG1 . VAL A 1 274 ? 48.883 81.688  62.140  1.00 11.51  ? 297 VAL A CG1 1 
ATOM   2142 C  CG2 . VAL A 1 274 ? 46.715 81.812  60.828  1.00 10.85  ? 297 VAL A CG2 1 
ATOM   2143 N  N   . ASN A 1 275 ? 47.916 82.803  65.329  1.00 9.68   ? 298 ASN A N   1 
ATOM   2144 C  CA  . ASN A 1 275 ? 48.802 83.295  66.385  1.00 12.03  ? 298 ASN A CA  1 
ATOM   2145 C  C   . ASN A 1 275 ? 49.813 82.221  66.723  1.00 12.30  ? 298 ASN A C   1 
ATOM   2146 O  O   . ASN A 1 275 ? 49.517 81.322  67.507  1.00 13.17  ? 298 ASN A O   1 
ATOM   2147 C  CB  . ASN A 1 275 ? 48.023 83.692  67.646  1.00 7.58   ? 298 ASN A CB  1 
ATOM   2148 C  CG  . ASN A 1 275 ? 48.931 84.284  68.729  1.00 10.45  ? 298 ASN A CG  1 
ATOM   2149 O  OD1 . ASN A 1 275 ? 50.152 84.109  68.689  1.00 11.13  ? 298 ASN A OD1 1 
ATOM   2150 N  ND2 . ASN A 1 275 ? 48.336 84.972  69.702  1.00 11.89  ? 298 ASN A ND2 1 
ATOM   2151 N  N   . PRO A 1 276 ? 51.001 82.306  66.119  1.00 10.45  ? 299 PRO A N   1 
ATOM   2152 C  CA  . PRO A 1 276 ? 51.990 81.237  66.294  1.00 13.65  ? 299 PRO A CA  1 
ATOM   2153 C  C   . PRO A 1 276 ? 52.461 81.077  67.741  1.00 17.39  ? 299 PRO A C   1 
ATOM   2154 O  O   . PRO A 1 276 ? 52.900 79.983  68.090  1.00 20.61  ? 299 PRO A O   1 
ATOM   2155 C  CB  . PRO A 1 276 ? 53.143 81.643  65.367  1.00 15.68  ? 299 PRO A CB  1 
ATOM   2156 C  CG  . PRO A 1 276 ? 52.860 83.033  64.905  1.00 19.28  ? 299 PRO A CG  1 
ATOM   2157 C  CD  . PRO A 1 276 ? 51.430 83.353  65.173  1.00 14.78  ? 299 PRO A CD  1 
ATOM   2158 N  N   . GLN A 1 277 ? 52.357 82.121  68.560  1.00 16.68  ? 300 GLN A N   1 
ATOM   2159 C  CA  . GLN A 1 277 ? 52.776 82.034  69.959  1.00 17.63  ? 300 GLN A CA  1 
ATOM   2160 C  C   . GLN A 1 277 ? 51.878 81.151  70.812  1.00 24.37  ? 300 GLN A C   1 
ATOM   2161 O  O   . GLN A 1 277 ? 52.273 80.724  71.893  1.00 20.93  ? 300 GLN A O   1 
ATOM   2162 C  CB  . GLN A 1 277 ? 52.860 83.422  70.604  1.00 22.06  ? 300 GLN A CB  1 
ATOM   2163 C  CG  . GLN A 1 277 ? 53.968 84.303  70.074  1.00 26.20  ? 300 GLN A CG  1 
ATOM   2164 C  CD  . GLN A 1 277 ? 54.150 85.553  70.924  1.00 36.09  ? 300 GLN A CD  1 
ATOM   2165 O  OE1 . GLN A 1 277 ? 53.711 85.606  72.078  1.00 43.48  ? 300 GLN A OE1 1 
ATOM   2166 N  NE2 . GLN A 1 277 ? 54.807 86.558  70.363  1.00 41.26  ? 300 GLN A NE2 1 
ATOM   2167 N  N   . LEU A 1 278 ? 50.670 80.868  70.341  1.00 13.67  ? 301 LEU A N   1 
ATOM   2168 C  CA  . LEU A 1 278 ? 49.742 80.070  71.138  1.00 16.84  ? 301 LEU A CA  1 
ATOM   2169 C  C   . LEU A 1 278 ? 49.901 78.588  70.846  1.00 22.01  ? 301 LEU A C   1 
ATOM   2170 O  O   . LEU A 1 278 ? 49.260 77.749  71.466  1.00 22.37  ? 301 LEU A O   1 
ATOM   2171 C  CB  . LEU A 1 278 ? 48.304 80.518  70.901  1.00 14.86  ? 301 LEU A CB  1 
ATOM   2172 C  CG  . LEU A 1 278 ? 48.079 81.955  71.359  1.00 18.03  ? 301 LEU A CG  1 
ATOM   2173 C  CD1 . LEU A 1 278 ? 46.647 82.366  71.134  1.00 13.64  ? 301 LEU A CD1 1 
ATOM   2174 C  CD2 . LEU A 1 278 ? 48.441 82.111  72.833  1.00 24.58  ? 301 LEU A CD2 1 
ATOM   2175 N  N   . ALA A 1 279 ? 50.757 78.274  69.887  1.00 18.05  ? 302 ALA A N   1 
ATOM   2176 C  CA  . ALA A 1 279 ? 51.080 76.887  69.613  1.00 24.48  ? 302 ALA A CA  1 
ATOM   2177 C  C   . ALA A 1 279 ? 51.890 76.343  70.783  1.00 24.02  ? 302 ALA A C   1 
ATOM   2178 O  O   . ALA A 1 279 ? 52.729 77.054  71.338  1.00 22.79  ? 302 ALA A O   1 
ATOM   2179 C  CB  . ALA A 1 279 ? 51.874 76.793  68.344  1.00 19.01  ? 302 ALA A CB  1 
ATOM   2180 N  N   . THR A 1 280 ? 51.642 75.089  71.152  1.00 22.51  ? 303 THR A N   1 
ATOM   2181 C  CA  . THR A 1 280 ? 52.416 74.437  72.213  1.00 28.98  ? 303 THR A CA  1 
ATOM   2182 C  C   . THR A 1 280 ? 53.719 73.843  71.678  1.00 30.94  ? 303 THR A C   1 
ATOM   2183 O  O   . THR A 1 280 ? 54.601 73.469  72.448  1.00 31.26  ? 303 THR A O   1 
ATOM   2184 C  CB  . THR A 1 280 ? 51.594 73.346  72.930  1.00 32.33  ? 303 THR A CB  1 
ATOM   2185 O  OG1 . THR A 1 280 ? 51.315 72.276  72.016  1.00 35.86  ? 303 THR A OG1 1 
ATOM   2186 C  CG2 . THR A 1 280 ? 50.276 73.918  73.433  1.00 39.33  ? 303 THR A CG2 1 
ATOM   2187 N  N   . SER A 1 281 ? 53.830 73.756  70.355  1.00 21.48  ? 304 SER A N   1 
ATOM   2188 C  CA  . SER A 1 281 ? 55.035 73.254  69.714  1.00 22.30  ? 304 SER A CA  1 
ATOM   2189 C  C   . SER A 1 281 ? 55.241 73.955  68.379  1.00 32.42  ? 304 SER A C   1 
ATOM   2190 O  O   . SER A 1 281 ? 54.303 74.538  67.822  1.00 26.10  ? 304 SER A O   1 
ATOM   2191 C  CB  . SER A 1 281 ? 54.922 71.749  69.478  1.00 33.51  ? 304 SER A CB  1 
ATOM   2192 O  OG  . SER A 1 281 ? 53.919 71.465  68.517  1.00 28.74  ? 304 SER A OG  1 
ATOM   2193 N  N   . GLU A 1 282 ? 56.460 73.882  67.855  1.00 27.74  ? 305 GLU A N   1 
ATOM   2194 C  CA  . GLU A 1 282 ? 56.751 74.474  66.557  1.00 34.30  ? 305 GLU A CA  1 
ATOM   2195 C  C   . GLU A 1 282 ? 55.931 73.781  65.469  1.00 32.43  ? 305 GLU A C   1 
ATOM   2196 O  O   . GLU A 1 282 ? 55.524 74.409  64.494  1.00 29.37  ? 305 GLU A O   1 
ATOM   2197 C  CB  . GLU A 1 282 ? 58.251 74.408  66.254  1.00 41.64  ? 305 GLU A CB  1 
ATOM   2198 C  CG  . GLU A 1 282 ? 59.037 75.611  66.772  1.00 72.63  ? 305 GLU A CG  1 
ATOM   2199 C  CD  . GLU A 1 282 ? 60.541 75.474  66.579  1.00 95.21  ? 305 GLU A CD  1 
ATOM   2200 O  OE1 . GLU A 1 282 ? 61.190 76.486  66.234  1.00 92.15  ? 305 GLU A OE1 1 
ATOM   2201 O  OE2 . GLU A 1 282 ? 61.075 74.359  66.771  1.00 89.07  ? 305 GLU A OE2 1 
ATOM   2202 N  N   . GLU A 1 283 ? 55.674 72.490  65.655  1.00 29.17  ? 306 GLU A N   1 
ATOM   2203 C  CA  . GLU A 1 283 ? 54.815 71.743  64.744  1.00 32.65  ? 306 GLU A CA  1 
ATOM   2204 C  C   . GLU A 1 283 ? 53.394 72.308  64.699  1.00 26.57  ? 306 GLU A C   1 
ATOM   2205 O  O   . GLU A 1 283 ? 52.821 72.451  63.614  1.00 19.67  ? 306 GLU A O   1 
ATOM   2206 C  CB  . GLU A 1 283 ? 54.769 70.268  65.137  1.00 34.25  ? 306 GLU A CB  1 
ATOM   2207 C  CG  . GLU A 1 283 ? 53.943 69.404  64.190  1.00 45.18  ? 306 GLU A CG  1 
ATOM   2208 C  CD  . GLU A 1 283 ? 54.191 67.914  64.375  1.00 75.37  ? 306 GLU A CD  1 
ATOM   2209 O  OE1 . GLU A 1 283 ? 53.463 67.107  63.755  1.00 77.17  ? 306 GLU A OE1 1 
ATOM   2210 O  OE2 . GLU A 1 283 ? 55.112 67.552  65.140  1.00 84.13  ? 306 GLU A OE2 1 
ATOM   2211 N  N   . GLU A 1 284 ? 52.819 72.607  65.864  1.00 19.48  ? 307 GLU A N   1 
ATOM   2212 C  CA  . GLU A 1 284 ? 51.469 73.186  65.918  1.00 21.35  ? 307 GLU A CA  1 
ATOM   2213 C  C   . GLU A 1 284 ? 51.416 74.549  65.226  1.00 20.00  ? 307 GLU A C   1 
ATOM   2214 O  O   . GLU A 1 284 ? 50.418 74.894  64.591  1.00 15.96  ? 307 GLU A O   1 
ATOM   2215 C  CB  . GLU A 1 284 ? 50.970 73.338  67.364  1.00 19.51  ? 307 GLU A CB  1 
ATOM   2216 C  CG  . GLU A 1 284 ? 50.441 72.063  68.030  1.00 25.67  ? 307 GLU A CG  1 
ATOM   2217 C  CD  . GLU A 1 284 ? 49.692 72.344  69.330  1.00 29.54  ? 307 GLU A CD  1 
ATOM   2218 O  OE1 . GLU A 1 284 ? 49.729 73.499  69.820  1.00 32.43  ? 307 GLU A OE1 1 
ATOM   2219 O  OE2 . GLU A 1 284 ? 49.048 71.412  69.857  1.00 38.42  ? 307 GLU A OE2 1 
ATOM   2220 N  N   . ALA A 1 285 ? 52.477 75.333  65.378  1.00 18.00  ? 308 ALA A N   1 
ATOM   2221 C  CA  . ALA A 1 285 ? 52.532 76.650  64.746  1.00 21.47  ? 308 ALA A CA  1 
ATOM   2222 C  C   . ALA A 1 285 ? 52.628 76.516  63.233  1.00 25.17  ? 308 ALA A C   1 
ATOM   2223 O  O   . ALA A 1 285 ? 51.898 77.173  62.486  1.00 14.70  ? 308 ALA A O   1 
ATOM   2224 C  CB  . ALA A 1 285 ? 53.712 77.459  65.289  1.00 17.82  ? 308 ALA A CB  1 
ATOM   2225 N  N   . LYS A 1 286 ? 53.530 75.655  62.778  1.00 14.74  ? 309 LYS A N   1 
ATOM   2226 C  CA  . LYS A 1 286 ? 53.738 75.486  61.347  1.00 16.79  ? 309 LYS A CA  1 
ATOM   2227 C  C   . LYS A 1 286 ? 52.523 74.892  60.636  1.00 18.27  ? 309 LYS A C   1 
ATOM   2228 O  O   . LYS A 1 286 ? 52.199 75.301  59.517  1.00 17.09  ? 309 LYS A O   1 
ATOM   2229 C  CB  . LYS A 1 286 ? 54.989 74.652  61.062  1.00 17.37  ? 309 LYS A CB  1 
ATOM   2230 C  CG  . LYS A 1 286 ? 56.288 75.395  61.340  1.00 35.00  ? 309 LYS A CG  1 
ATOM   2231 C  CD  . LYS A 1 286 ? 57.485 74.642  60.774  1.00 39.67  ? 309 LYS A CD  1 
ATOM   2232 C  CE  . LYS A 1 286 ? 58.747 75.490  60.850  1.00 55.29  ? 309 LYS A CE  1 
ATOM   2233 N  NZ  . LYS A 1 286 ? 59.936 74.808  60.261  1.00 70.34  ? 309 LYS A NZ  1 
ATOM   2234 N  N   . THR A 1 287 ? 51.846 73.931  61.255  1.00 13.84  ? 310 THR A N   1 
ATOM   2235 C  CA  A THR A 1 287 ? 50.681 73.332  60.613  0.55 17.41  ? 310 THR A CA  1 
ATOM   2236 C  CA  B THR A 1 287 ? 50.679 73.345  60.595  0.45 17.40  ? 310 THR A CA  1 
ATOM   2237 C  C   . THR A 1 287 ? 49.559 74.365  60.477  1.00 13.47  ? 310 THR A C   1 
ATOM   2238 O  O   . THR A 1 287 ? 48.827 74.368  59.494  1.00 10.87  ? 310 THR A O   1 
ATOM   2239 C  CB  A THR A 1 287 ? 50.200 72.041  61.338  0.55 17.27  ? 310 THR A CB  1 
ATOM   2240 C  CB  B THR A 1 287 ? 50.147 72.064  61.278  0.45 17.27  ? 310 THR A CB  1 
ATOM   2241 O  OG1 A THR A 1 287 ? 49.318 71.304  60.482  0.55 13.94  ? 310 THR A OG1 1 
ATOM   2242 O  OG1 B THR A 1 287 ? 49.542 72.394  62.533  0.45 21.78  ? 310 THR A OG1 1 
ATOM   2243 C  CG2 A THR A 1 287 ? 49.490 72.362  62.641  0.55 21.71  ? 310 THR A CG2 1 
ATOM   2244 C  CG2 B THR A 1 287 ? 51.258 71.055  61.477  0.45 17.10  ? 310 THR A CG2 1 
ATOM   2245 N  N   . THR A 1 288 ? 49.432 75.246  61.468  1.00 10.14  ? 311 THR A N   1 
ATOM   2246 C  CA  . THR A 1 288 ? 48.405 76.286  61.380  1.00 12.99  ? 311 THR A CA  1 
ATOM   2247 C  C   . THR A 1 288 ? 48.732 77.216  60.225  1.00 13.25  ? 311 THR A C   1 
ATOM   2248 O  O   . THR A 1 288 ? 47.860 77.573  59.437  1.00 8.86   ? 311 THR A O   1 
ATOM   2249 C  CB  . THR A 1 288 ? 48.249 77.074  62.686  1.00 13.46  ? 311 THR A CB  1 
ATOM   2250 O  OG1 . THR A 1 288 ? 47.986 76.158  63.751  1.00 10.64  ? 311 THR A OG1 1 
ATOM   2251 C  CG2 . THR A 1 288 ? 47.071 78.061  62.582  1.00 9.97   ? 311 THR A CG2 1 
ATOM   2252 N  N   . ALA A 1 289 ? 49.999 77.598  60.120  1.00 9.49   ? 312 ALA A N   1 
ATOM   2253 C  CA  . ALA A 1 289 ? 50.436 78.468  59.031  1.00 10.68  ? 312 ALA A CA  1 
ATOM   2254 C  C   . ALA A 1 289 ? 50.307 77.779  57.671  1.00 17.47  ? 312 ALA A C   1 
ATOM   2255 O  O   . ALA A 1 289 ? 49.936 78.416  56.679  1.00 10.03  ? 312 ALA A O   1 
ATOM   2256 C  CB  . ALA A 1 289 ? 51.865 78.938  59.267  1.00 14.23  ? 312 ALA A CB  1 
ATOM   2257 N  N   . ASN A 1 290 ? 50.649 76.493  57.606  1.00 11.00  ? 313 ASN A N   1 
ATOM   2258 C  CA  . ASN A 1 290 ? 50.504 75.745  56.355  1.00 8.71   ? 313 ASN A CA  1 
ATOM   2259 C  C   . ASN A 1 290 ? 49.053 75.682  55.912  1.00 9.66   ? 313 ASN A C   1 
ATOM   2260 O  O   . ASN A 1 290 ? 48.751 75.747  54.714  1.00 11.60  ? 313 ASN A O   1 
ATOM   2261 C  CB  . ASN A 1 290 ? 51.037 74.312  56.503  1.00 12.17  ? 313 ASN A CB  1 
ATOM   2262 C  CG  . ASN A 1 290 ? 52.541 74.259  56.626  1.00 17.66  ? 313 ASN A CG  1 
ATOM   2263 O  OD1 . ASN A 1 290 ? 53.232 75.188  56.229  1.00 21.28  ? 313 ASN A OD1 1 
ATOM   2264 N  ND2 . ASN A 1 290 ? 53.058 73.156  57.167  1.00 20.45  ? 313 ASN A ND2 1 
ATOM   2265 N  N   . LEU A 1 291 ? 48.164 75.525  56.882  1.00 10.61  ? 314 LEU A N   1 
ATOM   2266 C  CA  . LEU A 1 291 ? 46.731 75.478  56.615  1.00 10.87  ? 314 LEU A CA  1 
ATOM   2267 C  C   . LEU A 1 291 ? 46.251 76.805  56.041  1.00 12.63  ? 314 LEU A C   1 
ATOM   2268 O  O   . LEU A 1 291 ? 45.449 76.834  55.100  1.00 10.06  ? 314 LEU A O   1 
ATOM   2269 C  CB  . LEU A 1 291 ? 45.973 75.162  57.904  1.00 9.49   ? 314 LEU A CB  1 
ATOM   2270 C  CG  . LEU A 1 291 ? 44.445 75.033  57.839  1.00 9.28   ? 314 LEU A CG  1 
ATOM   2271 C  CD1 . LEU A 1 291 ? 44.000 73.974  56.836  1.00 12.28  ? 314 LEU A CD1 1 
ATOM   2272 C  CD2 . LEU A 1 291 ? 43.890 74.688  59.209  1.00 11.15  ? 314 LEU A CD2 1 
ATOM   2273 N  N   . ALA A 1 292 ? 46.740 77.903  56.613  1.00 8.85   ? 315 ALA A N   1 
ATOM   2274 C  CA  . ALA A 1 292 ? 46.395 79.230  56.111  1.00 11.10  ? 315 ALA A CA  1 
ATOM   2275 C  C   . ALA A 1 292 ? 46.803 79.364  54.651  1.00 11.12  ? 315 ALA A C   1 
ATOM   2276 O  O   . ALA A 1 292 ? 46.026 79.842  53.825  1.00 8.02   ? 315 ALA A O   1 
ATOM   2277 C  CB  . ALA A 1 292 ? 47.075 80.329  56.965  1.00 6.51   ? 315 ALA A CB  1 
ATOM   2278 N  N   . VAL A 1 293 ? 48.015 78.925  54.327  1.00 7.68   ? 316 VAL A N   1 
ATOM   2279 C  CA  . VAL A 1 293 ? 48.482 78.987  52.951  1.00 7.73   ? 316 VAL A CA  1 
ATOM   2280 C  C   . VAL A 1 293 ? 47.594 78.149  52.049  1.00 9.23   ? 316 VAL A C   1 
ATOM   2281 O  O   . VAL A 1 293 ? 47.245 78.573  50.947  1.00 8.75   ? 316 VAL A O   1 
ATOM   2282 C  CB  . VAL A 1 293 ? 49.964 78.563  52.822  1.00 10.32  ? 316 VAL A CB  1 
ATOM   2283 C  CG1 . VAL A 1 293 ? 50.350 78.348  51.363  1.00 9.61   ? 316 VAL A CG1 1 
ATOM   2284 C  CG2 . VAL A 1 293 ? 50.862 79.622  53.458  1.00 11.96  ? 316 VAL A CG2 1 
ATOM   2285 N  N   . ASP A 1 294 ? 47.215 76.965  52.518  1.00 9.26   ? 317 ASP A N   1 
ATOM   2286 C  CA  . ASP A 1 294 ? 46.316 76.113  51.740  1.00 10.05  ? 317 ASP A CA  1 
ATOM   2287 C  C   . ASP A 1 294 ? 44.985 76.797  51.417  1.00 11.00  ? 317 ASP A C   1 
ATOM   2288 O  O   . ASP A 1 294 ? 44.472 76.677  50.300  1.00 9.11   ? 317 ASP A O   1 
ATOM   2289 C  CB  . ASP A 1 294 ? 46.046 74.793  52.462  1.00 10.73  ? 317 ASP A CB  1 
ATOM   2290 C  CG  . ASP A 1 294 ? 47.196 73.797  52.347  1.00 19.28  ? 317 ASP A CG  1 
ATOM   2291 O  OD1 . ASP A 1 294 ? 48.176 74.037  51.608  1.00 16.91  ? 317 ASP A OD1 1 
ATOM   2292 O  OD2 . ASP A 1 294 ? 47.089 72.741  53.003  1.00 15.74  ? 317 ASP A OD2 1 
ATOM   2293 N  N   . VAL A 1 295 ? 44.410 77.487  52.397  1.00 8.51   ? 318 VAL A N   1 
ATOM   2294 C  CA  . VAL A 1 295 ? 43.151 78.207  52.163  1.00 9.71   ? 318 VAL A CA  1 
ATOM   2295 C  C   . VAL A 1 295 ? 43.324 79.271  51.099  1.00 11.59  ? 318 VAL A C   1 
ATOM   2296 O  O   . VAL A 1 295 ? 42.514 79.397  50.177  1.00 10.48  ? 318 VAL A O   1 
ATOM   2297 C  CB  . VAL A 1 295 ? 42.641 78.907  53.439  1.00 11.88  ? 318 VAL A CB  1 
ATOM   2298 C  CG1 . VAL A 1 295 ? 41.452 79.812  53.099  1.00 7.99   ? 318 VAL A CG1 1 
ATOM   2299 C  CG2 . VAL A 1 295 ? 42.239 77.879  54.473  1.00 11.99  ? 318 VAL A CG2 1 
ATOM   2300 N  N   . ILE A 1 296 ? 44.377 80.062  51.243  1.00 8.87   ? 319 ILE A N   1 
ATOM   2301 C  CA  . ILE A 1 296 ? 44.603 81.149  50.295  1.00 11.56  ? 319 ILE A CA  1 
ATOM   2302 C  C   . ILE A 1 296 ? 44.870 80.614  48.898  1.00 8.34   ? 319 ILE A C   1 
ATOM   2303 O  O   . ILE A 1 296 ? 44.299 81.098  47.917  1.00 10.42  ? 319 ILE A O   1 
ATOM   2304 C  CB  . ILE A 1 296 ? 45.750 82.052  50.774  1.00 9.27   ? 319 ILE A CB  1 
ATOM   2305 C  CG1 . ILE A 1 296 ? 45.401 82.624  52.150  1.00 8.28   ? 319 ILE A CG1 1 
ATOM   2306 C  CG2 . ILE A 1 296 ? 45.998 83.173  49.788  1.00 9.44   ? 319 ILE A CG2 1 
ATOM   2307 C  CD1 . ILE A 1 296 ? 46.600 83.321  52.810  1.00 9.60   ? 319 ILE A CD1 1 
ATOM   2308 N  N   . ALA A 1 297 ? 45.726 79.602  48.797  1.00 8.12   ? 320 ALA A N   1 
ATOM   2309 C  CA  . ALA A 1 297 ? 46.043 79.032  47.487  1.00 9.07   ? 320 ALA A CA  1 
ATOM   2310 C  C   . ALA A 1 297 ? 44.808 78.433  46.818  1.00 9.13   ? 320 ALA A C   1 
ATOM   2311 O  O   . ALA A 1 297 ? 44.617 78.582  45.608  1.00 10.31  ? 320 ALA A O   1 
ATOM   2312 C  CB  . ALA A 1 297 ? 47.159 77.980  47.594  1.00 8.03   ? 320 ALA A CB  1 
ATOM   2313 N  N   . SER A 1 298 ? 43.980 77.743  47.590  1.00 8.00   ? 321 SER A N   1 
ATOM   2314 C  CA  A SER A 1 298 ? 42.779 77.127  47.036  0.42 10.07  ? 321 SER A CA  1 
ATOM   2315 C  CA  B SER A 1 298 ? 42.785 77.127  47.025  0.58 10.07  ? 321 SER A CA  1 
ATOM   2316 C  C   . SER A 1 298 ? 41.810 78.203  46.562  1.00 9.36   ? 321 SER A C   1 
ATOM   2317 O  O   . SER A 1 298 ? 41.136 78.043  45.551  1.00 9.71   ? 321 SER A O   1 
ATOM   2318 C  CB  A SER A 1 298 ? 42.117 76.221  48.072  0.42 11.47  ? 321 SER A CB  1 
ATOM   2319 C  CB  B SER A 1 298 ? 42.117 76.178  48.023  0.58 11.46  ? 321 SER A CB  1 
ATOM   2320 O  OG  A SER A 1 298 ? 41.084 75.457  47.490  0.42 10.31  ? 321 SER A OG  1 
ATOM   2321 O  OG  B SER A 1 298 ? 42.867 74.988  48.184  0.58 8.33   ? 321 SER A OG  1 
ATOM   2322 N  N   . SER A 1 299 ? 41.765 79.310  47.292  1.00 8.86   ? 322 SER A N   1 
ATOM   2323 C  CA  . SER A 1 299 ? 40.886 80.425  46.934  1.00 12.68  ? 322 SER A CA  1 
ATOM   2324 C  C   . SER A 1 299 ? 41.302 81.061  45.612  1.00 11.52  ? 322 SER A C   1 
ATOM   2325 O  O   . SER A 1 299 ? 40.495 81.709  44.939  1.00 10.87  ? 322 SER A O   1 
ATOM   2326 C  CB  . SER A 1 299 ? 40.900 81.485  48.034  1.00 8.90   ? 322 SER A CB  1 
ATOM   2327 O  OG  . SER A 1 299 ? 40.417 80.947  49.250  1.00 8.85   ? 322 SER A OG  1 
ATOM   2328 N  N   . PHE A 1 300 ? 42.564 80.873  45.241  1.00 9.12   ? 323 PHE A N   1 
ATOM   2329 C  CA  . PHE A 1 300 ? 43.075 81.420  43.986  1.00 10.73  ? 323 PHE A CA  1 
ATOM   2330 C  C   . PHE A 1 300 ? 43.374 80.374  42.928  1.00 17.63  ? 323 PHE A C   1 
ATOM   2331 O  O   . PHE A 1 300 ? 44.049 80.646  41.929  1.00 13.32  ? 323 PHE A O   1 
ATOM   2332 C  CB  . PHE A 1 300 ? 44.294 82.308  44.246  1.00 11.20  ? 323 PHE A CB  1 
ATOM   2333 C  CG  . PHE A 1 300 ? 43.927 83.631  44.855  1.00 12.47  ? 323 PHE A CG  1 
ATOM   2334 C  CD1 . PHE A 1 300 ? 43.486 84.670  44.041  1.00 19.01  ? 323 PHE A CD1 1 
ATOM   2335 C  CD2 . PHE A 1 300 ? 43.984 83.827  46.224  1.00 12.00  ? 323 PHE A CD2 1 
ATOM   2336 C  CE1 . PHE A 1 300 ? 43.117 85.893  44.588  1.00 16.48  ? 323 PHE A CE1 1 
ATOM   2337 C  CE2 . PHE A 1 300 ? 43.618 85.042  46.784  1.00 17.93  ? 323 PHE A CE2 1 
ATOM   2338 C  CZ  . PHE A 1 300 ? 43.186 86.083  45.960  1.00 15.12  ? 323 PHE A CZ  1 
ATOM   2339 N  N   . GLY A 1 301 ? 42.860 79.172  43.140  1.00 9.60   ? 324 GLY A N   1 
ATOM   2340 C  CA  . GLY A 1 301 ? 42.834 78.199  42.060  1.00 11.83  ? 324 GLY A CA  1 
ATOM   2341 C  C   . GLY A 1 301 ? 43.534 76.881  42.293  1.00 15.75  ? 324 GLY A C   1 
ATOM   2342 O  O   . GLY A 1 301 ? 43.466 75.998  41.437  1.00 13.11  ? 324 GLY A O   1 
ATOM   2343 N  N   . GLN A 1 302 ? 44.179 76.694  43.440  1.00 10.68  ? 325 GLN A N   1 
ATOM   2344 C  CA  . GLN A 1 302 ? 44.771 75.383  43.658  1.00 14.54  ? 325 GLN A CA  1 
ATOM   2345 C  C   . GLN A 1 302 ? 43.665 74.330  43.747  1.00 14.81  ? 325 GLN A C   1 
ATOM   2346 O  O   . GLN A 1 302 ? 42.691 74.502  44.481  1.00 13.28  ? 325 GLN A O   1 
ATOM   2347 C  CB  . GLN A 1 302 ? 45.679 75.349  44.887  1.00 14.09  ? 325 GLN A CB  1 
ATOM   2348 C  CG  . GLN A 1 302 ? 46.444 74.023  44.971  1.00 24.03  ? 325 GLN A CG  1 
ATOM   2349 C  CD  . GLN A 1 302 ? 47.668 74.098  45.852  1.00 33.33  ? 325 GLN A CD  1 
ATOM   2350 O  OE1 . GLN A 1 302 ? 48.239 75.173  46.055  1.00 27.95  ? 325 GLN A OE1 1 
ATOM   2351 N  NE2 . GLN A 1 302 ? 48.077 72.952  46.394  1.00 27.37  ? 325 GLN A NE2 1 
ATOM   2352 N  N   . THR A 1 303 ? 43.803 73.258  42.968  1.00 16.55  ? 326 THR A N   1 
ATOM   2353 C  CA  . THR A 1 303 ? 42.802 72.193  42.970  1.00 19.01  ? 326 THR A CA  1 
ATOM   2354 C  C   . THR A 1 303 ? 43.380 70.919  43.586  1.00 15.12  ? 326 THR A C   1 
ATOM   2355 O  O   . THR A 1 303 ? 44.595 70.787  43.759  1.00 20.83  ? 326 THR A O   1 
ATOM   2356 C  CB  . THR A 1 303 ? 42.314 71.849  41.551  1.00 19.23  ? 326 THR A CB  1 
ATOM   2357 O  OG1 . THR A 1 303 ? 43.298 71.043  40.897  1.00 28.95  ? 326 THR A OG1 1 
ATOM   2358 C  CG2 . THR A 1 303 ? 42.055 73.117  40.729  1.00 26.31  ? 326 THR A CG2 1 
ATOM   2359 N  N   . ARG A 1 304 ? 42.508 69.981  43.909  1.00 20.86  ? 327 ARG A N   1 
ATOM   2360 C  CA  . ARG A 1 304 ? 42.967 68.681  44.382  1.00 20.69  ? 327 ARG A CA  1 
ATOM   2361 C  C   . ARG A 1 304 ? 42.933 67.633  43.270  1.00 25.37  ? 327 ARG A C   1 
ATOM   2362 O  O   . ARG A 1 304 ? 42.958 66.441  43.537  1.00 41.20  ? 327 ARG A O   1 
ATOM   2363 C  CB  . ARG A 1 304 ? 42.121 68.244  45.561  1.00 18.15  ? 327 ARG A CB  1 
ATOM   2364 C  CG  . ARG A 1 304 ? 42.323 69.148  46.766  1.00 26.74  ? 327 ARG A CG  1 
ATOM   2365 C  CD  . ARG A 1 304 ? 41.381 68.794  47.875  1.00 12.71  ? 327 ARG A CD  1 
ATOM   2366 N  NE  . ARG A 1 304 ? 40.038 69.348  47.683  1.00 9.44   ? 327 ARG A NE  1 
ATOM   2367 C  CZ  . ARG A 1 304 ? 39.001 68.998  48.434  1.00 13.99  ? 327 ARG A CZ  1 
ATOM   2368 N  NH1 . ARG A 1 304 ? 39.178 68.107  49.397  1.00 11.10  ? 327 ARG A NH1 1 
ATOM   2369 N  NH2 . ARG A 1 304 ? 37.793 69.507  48.225  1.00 11.04  ? 327 ARG A NH2 1 
ATOM   2370 N  N   . GLU A 1 305 ? 42.852 68.069  42.021  1.00 29.54  ? 328 GLU A N   1 
ATOM   2371 C  CA  . GLU A 1 305 ? 42.865 67.102  40.925  1.00 28.79  ? 328 GLU A CA  1 
ATOM   2372 C  C   . GLU A 1 305 ? 43.769 67.480  39.750  1.00 29.77  ? 328 GLU A C   1 
ATOM   2373 O  O   . GLU A 1 305 ? 43.703 66.874  38.673  1.00 28.81  ? 328 GLU A O   1 
ATOM   2374 C  CB  . GLU A 1 305 ? 41.436 66.742  40.505  1.00 27.09  ? 328 GLU A CB  1 
ATOM   2375 C  CG  . GLU A 1 305 ? 40.613 67.854  39.893  1.00 35.81  ? 328 GLU A CG  1 
ATOM   2376 C  CD  . GLU A 1 305 ? 39.157 67.431  39.695  1.00 46.43  ? 328 GLU A CD  1 
ATOM   2377 O  OE1 . GLU A 1 305 ? 38.469 67.153  40.721  1.00 35.02  ? 328 GLU A OE1 1 
ATOM   2378 O  OE2 . GLU A 1 305 ? 38.715 67.358  38.527  1.00 41.61  ? 328 GLU A OE2 1 
ATOM   2379 N  N   . GLY A 1 306 ? 44.617 68.481  39.962  1.00 29.28  ? 329 GLY A N   1 
ATOM   2380 C  CA  . GLY A 1 306 ? 45.642 68.810  38.986  1.00 37.51  ? 329 GLY A CA  1 
ATOM   2381 C  C   . GLY A 1 306 ? 45.124 69.700  37.879  1.00 35.04  ? 329 GLY A C   1 
ATOM   2382 O  O   . GLY A 1 306 ? 43.974 70.152  37.926  1.00 35.41  ? 329 GLY A O   1 
ATOM   2383 O  OXT . GLY A 1 306 ? 45.849 69.975  36.917  1.00 33.71  ? 329 GLY A OXT 1 
ATOM   2384 N  N   . HIS B 1 1   ? 36.216 29.422  49.908  1.00 49.38  ? 24  HIS B N   1 
ATOM   2385 C  CA  . HIS B 1 1   ? 36.801 30.720  49.572  1.00 53.92  ? 24  HIS B CA  1 
ATOM   2386 C  C   . HIS B 1 1   ? 38.292 30.744  49.890  1.00 43.13  ? 24  HIS B C   1 
ATOM   2387 O  O   . HIS B 1 1   ? 38.696 30.750  51.056  1.00 34.15  ? 24  HIS B O   1 
ATOM   2388 C  CB  . HIS B 1 1   ? 36.066 31.860  50.278  1.00 52.77  ? 24  HIS B CB  1 
ATOM   2389 C  CG  . HIS B 1 1   ? 35.021 32.519  49.424  1.00 68.00  ? 24  HIS B CG  1 
ATOM   2390 N  ND1 . HIS B 1 1   ? 35.325 33.478  48.491  1.00 73.02  ? 24  HIS B ND1 1 
ATOM   2391 C  CD2 . HIS B 1 1   ? 33.680 32.337  49.371  1.00 73.72  ? 24  HIS B CD2 1 
ATOM   2392 C  CE1 . HIS B 1 1   ? 34.207 33.870  47.889  1.00 76.07  ? 24  HIS B CE1 1 
ATOM   2393 N  NE2 . HIS B 1 1   ? 33.203 33.196  48.404  1.00 77.39  ? 24  HIS B NE2 1 
ATOM   2394 N  N   . SER B 1 2   ? 39.101 30.779  48.839  1.00 28.49  ? 25  SER B N   1 
ATOM   2395 C  CA  . SER B 1 2   ? 40.545 30.688  48.968  1.00 25.23  ? 25  SER B CA  1 
ATOM   2396 C  C   . SER B 1 2   ? 41.244 32.013  48.690  1.00 23.58  ? 25  SER B C   1 
ATOM   2397 O  O   . SER B 1 2   ? 40.922 32.708  47.726  1.00 14.00  ? 25  SER B O   1 
ATOM   2398 C  CB  . SER B 1 2   ? 41.086 29.595  48.039  1.00 35.98  ? 25  SER B CB  1 
ATOM   2399 O  OG  . SER B 1 2   ? 40.591 28.316  48.399  1.00 45.19  ? 25  SER B OG  1 
ATOM   2400 N  N   . VAL B 1 3   ? 42.168 32.374  49.573  1.00 16.48  ? 26  VAL B N   1 
ATOM   2401 C  CA  . VAL B 1 3   ? 42.921 33.611  49.429  1.00 14.71  ? 26  VAL B CA  1 
ATOM   2402 C  C   . VAL B 1 3   ? 44.402 33.279  49.433  1.00 13.33  ? 26  VAL B C   1 
ATOM   2403 O  O   . VAL B 1 3   ? 44.892 32.616  50.344  1.00 16.13  ? 26  VAL B O   1 
ATOM   2404 C  CB  . VAL B 1 3   ? 42.627 34.596  50.595  1.00 15.85  ? 26  VAL B CB  1 
ATOM   2405 C  CG1 . VAL B 1 3   ? 43.484 35.858  50.462  1.00 13.02  ? 26  VAL B CG1 1 
ATOM   2406 C  CG2 . VAL B 1 3   ? 41.171 34.961  50.628  1.00 14.09  ? 26  VAL B CG2 1 
ATOM   2407 N  N   . ALA B 1 4   ? 45.124 33.744  48.421  1.00 11.30  ? 27  ALA B N   1 
ATOM   2408 C  CA  . ALA B 1 4   ? 46.571 33.639  48.425  1.00 12.08  ? 27  ALA B CA  1 
ATOM   2409 C  C   . ALA B 1 4   ? 47.146 34.940  48.943  1.00 16.75  ? 27  ALA B C   1 
ATOM   2410 O  O   . ALA B 1 4   ? 46.647 36.019  48.617  1.00 12.08  ? 27  ALA B O   1 
ATOM   2411 C  CB  . ALA B 1 4   ? 47.114 33.355  47.028  1.00 11.16  ? 27  ALA B CB  1 
ATOM   2412 N  N   . VAL B 1 5   ? 48.190 34.835  49.758  1.00 8.38   ? 28  VAL B N   1 
ATOM   2413 C  CA  . VAL B 1 5   ? 48.874 36.023  50.239  1.00 10.80  ? 28  VAL B CA  1 
ATOM   2414 C  C   . VAL B 1 5   ? 50.299 35.997  49.741  1.00 13.45  ? 28  VAL B C   1 
ATOM   2415 O  O   . VAL B 1 5   ? 51.036 35.034  49.962  1.00 18.75  ? 28  VAL B O   1 
ATOM   2416 C  CB  . VAL B 1 5   ? 48.819 36.130  51.783  1.00 17.93  ? 28  VAL B CB  1 
ATOM   2417 C  CG1 . VAL B 1 5   ? 49.616 37.342  52.265  1.00 13.33  ? 28  VAL B CG1 1 
ATOM   2418 C  CG2 . VAL B 1 5   ? 47.370 36.198  52.251  1.00 9.31   ? 28  VAL B CG2 1 
ATOM   2419 N  N   . ILE B 1 6   ? 50.686 37.065  49.056  1.00 10.56  ? 29  ILE B N   1 
ATOM   2420 C  CA  . ILE B 1 6   ? 52.013 37.159  48.485  1.00 8.77   ? 29  ILE B CA  1 
ATOM   2421 C  C   . ILE B 1 6   ? 52.698 38.386  49.032  1.00 11.81  ? 29  ILE B C   1 
ATOM   2422 O  O   . ILE B 1 6   ? 52.165 39.488  48.924  1.00 13.08  ? 29  ILE B O   1 
ATOM   2423 C  CB  . ILE B 1 6   ? 51.956 37.316  46.962  1.00 7.04   ? 29  ILE B CB  1 
ATOM   2424 C  CG1 . ILE B 1 6   ? 51.221 36.139  46.342  1.00 12.26  ? 29  ILE B CG1 1 
ATOM   2425 C  CG2 . ILE B 1 6   ? 53.350 37.425  46.370  1.00 10.60  ? 29  ILE B CG2 1 
ATOM   2426 C  CD1 . ILE B 1 6   ? 50.995 36.315  44.857  1.00 14.08  ? 29  ILE B CD1 1 
ATOM   2427 N  N   . GLY B 1 7   ? 53.868 38.198  49.641  1.00 11.85  ? 30  GLY B N   1 
ATOM   2428 C  CA  . GLY B 1 7   ? 54.666 39.333  50.078  1.00 11.50  ? 30  GLY B CA  1 
ATOM   2429 C  C   . GLY B 1 7   ? 55.530 39.795  48.919  1.00 15.61  ? 30  GLY B C   1 
ATOM   2430 O  O   . GLY B 1 7   ? 56.297 38.997  48.369  1.00 12.76  ? 30  GLY B O   1 
ATOM   2431 N  N   . ALA B 1 8   ? 55.408 41.066  48.537  1.00 12.93  ? 31  ALA B N   1 
ATOM   2432 C  CA  . ALA B 1 8   ? 56.209 41.617  47.438  1.00 8.72   ? 31  ALA B CA  1 
ATOM   2433 C  C   . ALA B 1 8   ? 57.005 42.820  47.919  1.00 15.98  ? 31  ALA B C   1 
ATOM   2434 O  O   . ALA B 1 8   ? 56.572 43.953  47.757  1.00 13.99  ? 31  ALA B O   1 
ATOM   2435 C  CB  . ALA B 1 8   ? 55.321 42.010  46.256  1.00 10.86  ? 31  ALA B CB  1 
ATOM   2436 N  N   . PRO B 1 9   ? 58.169 42.571  48.530  1.00 14.54  ? 32  PRO B N   1 
ATOM   2437 C  CA  . PRO B 1 9   ? 58.897 43.686  49.150  1.00 19.38  ? 32  PRO B CA  1 
ATOM   2438 C  C   . PRO B 1 9   ? 59.638 44.596  48.148  1.00 14.62  ? 32  PRO B C   1 
ATOM   2439 O  O   . PRO B 1 9   ? 60.848 44.771  48.248  1.00 26.58  ? 32  PRO B O   1 
ATOM   2440 C  CB  . PRO B 1 9   ? 59.853 42.988  50.124  1.00 19.70  ? 32  PRO B CB  1 
ATOM   2441 C  CG  . PRO B 1 9   ? 59.980 41.565  49.618  1.00 24.50  ? 32  PRO B CG  1 
ATOM   2442 C  CD  . PRO B 1 9   ? 58.722 41.245  48.878  1.00 13.31  ? 32  PRO B CD  1 
ATOM   2443 N  N   . PHE B 1 10  ? 58.901 45.156  47.189  1.00 17.95  ? 33  PHE B N   1 
ATOM   2444 C  CA  A PHE B 1 10  ? 59.447 46.082  46.195  0.61 12.04  ? 33  PHE B CA  1 
ATOM   2445 C  C   . PHE B 1 10  ? 59.870 47.370  46.876  1.00 10.50  ? 33  PHE B C   1 
ATOM   2446 O  O   . PHE B 1 10  ? 59.067 47.944  47.597  1.00 13.10  ? 33  PHE B O   1 
ATOM   2447 C  CB  A PHE B 1 10  ? 58.338 46.487  45.219  0.61 10.83  ? 33  PHE B CB  1 
ATOM   2448 C  CG  A PHE B 1 10  ? 58.203 45.602  44.011  0.61 11.75  ? 33  PHE B CG  1 
ATOM   2449 C  CD1 A PHE B 1 10  ? 57.880 44.262  44.142  0.61 15.69  ? 33  PHE B CD1 1 
ATOM   2450 C  CD2 A PHE B 1 10  ? 58.336 46.136  42.735  0.61 14.53  ? 33  PHE B CD2 1 
ATOM   2451 C  CE1 A PHE B 1 10  ? 57.722 43.459  43.021  0.61 16.30  ? 33  PHE B CE1 1 
ATOM   2452 C  CE2 A PHE B 1 10  ? 58.184 45.340  41.606  0.61 12.36  ? 33  PHE B CE2 1 
ATOM   2453 C  CZ  A PHE B 1 10  ? 57.875 43.998  41.754  0.61 10.87  ? 33  PHE B CZ  1 
ATOM   2454 N  N   . SER B 1 11  ? 61.088 47.864  46.631  1.00 12.58  ? 34  SER B N   1 
ATOM   2455 C  CA  . SER B 1 11  ? 61.415 49.235  47.057  1.00 15.98  ? 34  SER B CA  1 
ATOM   2456 C  C   . SER B 1 11  ? 61.982 50.067  45.905  1.00 13.44  ? 34  SER B C   1 
ATOM   2457 O  O   . SER B 1 11  ? 62.073 51.293  45.991  1.00 14.70  ? 34  SER B O   1 
ATOM   2458 C  CB  . SER B 1 11  ? 62.409 49.243  48.231  1.00 13.78  ? 34  SER B CB  1 
ATOM   2459 O  OG  . SER B 1 11  ? 63.675 48.781  47.812  1.00 16.78  ? 34  SER B OG  1 
ATOM   2460 N  N   . GLN B 1 12  ? 62.360 49.398  44.821  1.00 11.37  ? 35  GLN B N   1 
ATOM   2461 C  CA  . GLN B 1 12  ? 63.098 50.058  43.751  1.00 10.77  ? 35  GLN B CA  1 
ATOM   2462 C  C   . GLN B 1 12  ? 62.243 50.870  42.778  1.00 11.87  ? 35  GLN B C   1 
ATOM   2463 O  O   . GLN B 1 12  ? 62.772 51.527  41.873  1.00 13.03  ? 35  GLN B O   1 
ATOM   2464 C  CB  . GLN B 1 12  ? 63.987 49.044  43.037  1.00 13.80  ? 35  GLN B CB  1 
ATOM   2465 C  CG  . GLN B 1 12  ? 65.111 48.577  43.973  1.00 17.21  ? 35  GLN B CG  1 
ATOM   2466 C  CD  . GLN B 1 12  ? 65.966 47.485  43.385  1.00 27.43  ? 35  GLN B CD  1 
ATOM   2467 O  OE1 . GLN B 1 12  ? 66.240 46.479  44.036  1.00 40.36  ? 35  GLN B OE1 1 
ATOM   2468 N  NE2 . GLN B 1 12  ? 66.399 47.679  42.156  1.00 21.11  ? 35  GLN B NE2 1 
ATOM   2469 N  N   . GLY B 1 13  ? 60.930 50.859  42.997  1.00 11.12  ? 36  GLY B N   1 
ATOM   2470 C  CA  . GLY B 1 13  ? 60.022 51.740  42.270  1.00 10.46  ? 36  GLY B CA  1 
ATOM   2471 C  C   . GLY B 1 13  ? 60.075 53.164  42.807  1.00 12.14  ? 36  GLY B C   1 
ATOM   2472 O  O   . GLY B 1 13  ? 59.449 54.076  42.269  1.00 11.78  ? 36  GLY B O   1 
ATOM   2473 N  N   . GLN B 1 14  ? 60.827 53.360  43.884  1.00 11.53  ? 37  GLN B N   1 
ATOM   2474 C  CA  . GLN B 1 14  ? 60.942 54.691  44.470  1.00 15.27  ? 37  GLN B CA  1 
ATOM   2475 C  C   . GLN B 1 14  ? 62.266 54.811  45.223  1.00 17.93  ? 37  GLN B C   1 
ATOM   2476 O  O   . GLN B 1 14  ? 63.101 53.909  45.139  1.00 14.27  ? 37  GLN B O   1 
ATOM   2477 C  CB  . GLN B 1 14  ? 59.703 55.034  45.319  1.00 13.78  ? 37  GLN B CB  1 
ATOM   2478 C  CG  . GLN B 1 14  ? 59.289 53.972  46.334  1.00 17.20  ? 37  GLN B CG  1 
ATOM   2479 C  CD  . GLN B 1 14  ? 60.091 54.065  47.614  1.00 20.10  ? 37  GLN B CD  1 
ATOM   2480 O  OE1 . GLN B 1 14  ? 59.923 55.002  48.387  1.00 17.59  ? 37  GLN B OE1 1 
ATOM   2481 N  NE2 . GLN B 1 14  ? 60.994 53.104  47.831  1.00 16.36  ? 37  GLN B NE2 1 
ATOM   2482 N  N   . LYS B 1 15  ? 62.481 55.920  45.927  1.00 15.51  ? 38  LYS B N   1 
ATOM   2483 C  CA  . LYS B 1 15  ? 63.818 56.208  46.457  1.00 16.76  ? 38  LYS B CA  1 
ATOM   2484 C  C   . LYS B 1 15  ? 63.946 56.148  47.986  1.00 19.90  ? 38  LYS B C   1 
ATOM   2485 O  O   . LYS B 1 15  ? 65.046 56.275  48.517  1.00 19.31  ? 38  LYS B O   1 
ATOM   2486 C  CB  . LYS B 1 15  ? 64.340 57.564  45.929  1.00 22.02  ? 38  LYS B CB  1 
ATOM   2487 C  CG  . LYS B 1 15  ? 64.589 57.633  44.405  1.00 19.72  ? 38  LYS B CG  1 
ATOM   2488 C  CD  . LYS B 1 15  ? 65.265 58.966  44.017  1.00 22.17  ? 38  LYS B CD  1 
ATOM   2489 C  CE  . LYS B 1 15  ? 65.549 59.075  42.516  1.00 22.99  ? 38  LYS B CE  1 
ATOM   2490 N  NZ  . LYS B 1 15  ? 64.318 59.465  41.767  1.00 19.55  ? 38  LYS B NZ  1 
ATOM   2491 N  N   . ARG B 1 16  ? 62.835 55.965  48.695  1.00 14.34  ? 39  ARG B N   1 
ATOM   2492 C  CA  . ARG B 1 16  ? 62.869 55.976  50.161  1.00 19.69  ? 39  ARG B CA  1 
ATOM   2493 C  C   . ARG B 1 16  ? 63.059 54.558  50.705  1.00 23.46  ? 39  ARG B C   1 
ATOM   2494 O  O   . ARG B 1 16  ? 62.335 53.634  50.333  1.00 19.99  ? 39  ARG B O   1 
ATOM   2495 C  CB  . ARG B 1 16  ? 61.599 56.636  50.726  1.00 21.32  ? 39  ARG B CB  1 
ATOM   2496 C  CG  . ARG B 1 16  ? 61.321 58.011  50.111  1.00 21.98  ? 39  ARG B CG  1 
ATOM   2497 C  CD  . ARG B 1 16  ? 60.321 58.857  50.904  1.00 25.87  ? 39  ARG B CD  1 
ATOM   2498 N  NE  . ARG B 1 16  ? 60.848 59.426  52.144  1.00 28.30  ? 39  ARG B NE  1 
ATOM   2499 C  CZ  . ARG B 1 16  ? 60.154 60.253  52.924  1.00 38.63  ? 39  ARG B CZ  1 
ATOM   2500 N  NH1 . ARG B 1 16  ? 58.917 60.602  52.585  1.00 24.81  ? 39  ARG B NH1 1 
ATOM   2501 N  NH2 . ARG B 1 16  ? 60.690 60.735  54.037  1.00 33.58  ? 39  ARG B NH2 1 
ATOM   2502 N  N   . LYS B 1 17  ? 64.037 54.389  51.585  1.00 19.54  ? 40  LYS B N   1 
ATOM   2503 C  CA  . LYS B 1 17  ? 64.315 53.072  52.148  1.00 23.81  ? 40  LYS B CA  1 
ATOM   2504 C  C   . LYS B 1 17  ? 63.202 52.665  53.108  1.00 19.30  ? 40  LYS B C   1 
ATOM   2505 O  O   . LYS B 1 17  ? 62.680 53.510  53.842  1.00 16.61  ? 40  LYS B O   1 
ATOM   2506 C  CB  . LYS B 1 17  ? 65.654 53.095  52.896  1.00 27.06  ? 40  LYS B CB  1 
ATOM   2507 C  CG  . LYS B 1 17  ? 66.829 53.590  52.053  1.00 36.90  ? 40  LYS B CG  1 
ATOM   2508 C  CD  . LYS B 1 17  ? 68.110 53.694  52.883  1.00 46.29  ? 40  LYS B CD  1 
ATOM   2509 C  CE  . LYS B 1 17  ? 69.205 54.459  52.139  1.00 42.82  ? 40  LYS B CE  1 
ATOM   2510 N  NZ  . LYS B 1 17  ? 69.602 53.789  50.869  1.00 50.47  ? 40  LYS B NZ  1 
ATOM   2511 N  N   . GLY B 1 18  ? 62.836 51.383  53.105  1.00 13.01  ? 41  GLY B N   1 
ATOM   2512 C  CA  . GLY B 1 18  ? 62.000 50.839  54.166  1.00 13.62  ? 41  GLY B CA  1 
ATOM   2513 C  C   . GLY B 1 18  ? 60.683 50.220  53.741  1.00 15.70  ? 41  GLY B C   1 
ATOM   2514 O  O   . GLY B 1 18  ? 60.135 49.376  54.443  1.00 13.00  ? 41  GLY B O   1 
ATOM   2515 N  N   . VAL B 1 19  ? 60.179 50.623  52.582  1.00 12.07  ? 42  VAL B N   1 
ATOM   2516 C  CA  . VAL B 1 19  ? 58.891 50.106  52.102  1.00 12.22  ? 42  VAL B CA  1 
ATOM   2517 C  C   . VAL B 1 19  ? 58.977 48.600  51.828  1.00 10.31  ? 42  VAL B C   1 
ATOM   2518 O  O   . VAL B 1 19  ? 57.958 47.894  51.772  1.00 12.53  ? 42  VAL B O   1 
ATOM   2519 C  CB  . VAL B 1 19  ? 58.400 50.898  50.865  1.00 8.98   ? 42  VAL B CB  1 
ATOM   2520 C  CG1 . VAL B 1 19  ? 59.283 50.599  49.661  1.00 11.53  ? 42  VAL B CG1 1 
ATOM   2521 C  CG2 . VAL B 1 19  ? 56.923 50.610  50.561  1.00 9.10   ? 42  VAL B CG2 1 
ATOM   2522 N  N   . GLU B 1 20  ? 60.197 48.092  51.674  1.00 10.88  ? 43  GLU B N   1 
ATOM   2523 C  CA  . GLU B 1 20  ? 60.377 46.648  51.524  1.00 16.12  ? 43  GLU B CA  1 
ATOM   2524 C  C   . GLU B 1 20  ? 59.986 45.884  52.797  1.00 13.60  ? 43  GLU B C   1 
ATOM   2525 O  O   . GLU B 1 20  ? 59.793 44.672  52.764  1.00 12.57  ? 43  GLU B O   1 
ATOM   2526 C  CB  . GLU B 1 20  ? 61.808 46.300  51.096  1.00 14.86  ? 43  GLU B CB  1 
ATOM   2527 C  CG  . GLU B 1 20  ? 62.852 46.524  52.174  1.00 19.73  ? 43  GLU B CG  1 
ATOM   2528 C  CD  . GLU B 1 20  ? 63.426 47.942  52.184  1.00 27.12  ? 43  GLU B CD  1 
ATOM   2529 O  OE1 . GLU B 1 20  ? 62.725 48.905  51.777  1.00 15.58  ? 43  GLU B OE1 1 
ATOM   2530 O  OE2 . GLU B 1 20  ? 64.596 48.085  52.602  1.00 28.07  ? 43  GLU B OE2 1 
ATOM   2531 N  N   . HIS B 1 21  ? 59.864 46.596  53.914  1.00 11.14  ? 44  HIS B N   1 
ATOM   2532 C  CA  . HIS B 1 21  ? 59.438 45.993  55.174  1.00 13.01  ? 44  HIS B CA  1 
ATOM   2533 C  C   . HIS B 1 21  ? 57.935 46.062  55.389  1.00 8.94   ? 44  HIS B C   1 
ATOM   2534 O  O   . HIS B 1 21  ? 57.425 45.588  56.399  1.00 10.76  ? 44  HIS B O   1 
ATOM   2535 C  CB  . HIS B 1 21  ? 60.170 46.629  56.364  1.00 13.66  ? 44  HIS B CB  1 
ATOM   2536 C  CG  . HIS B 1 21  ? 61.661 46.478  56.290  1.00 25.28  ? 44  HIS B CG  1 
ATOM   2537 N  ND1 . HIS B 1 21  ? 62.272 45.255  56.208  1.00 22.87  ? 44  HIS B ND1 1 
ATOM   2538 C  CD2 . HIS B 1 21  ? 62.646 47.411  56.255  1.00 22.86  ? 44  HIS B CD2 1 
ATOM   2539 C  CE1 . HIS B 1 21  ? 63.589 45.429  56.139  1.00 28.00  ? 44  HIS B CE1 1 
ATOM   2540 N  NE2 . HIS B 1 21  ? 63.835 46.717  56.164  1.00 25.61  ? 44  HIS B NE2 1 
ATOM   2541 N  N   . GLY B 1 22  ? 57.224 46.641  54.431  1.00 11.66  ? 45  GLY B N   1 
ATOM   2542 C  CA  . GLY B 1 22  ? 55.777 46.680  54.489  1.00 9.38   ? 45  GLY B CA  1 
ATOM   2543 C  C   . GLY B 1 22  ? 55.102 45.335  54.683  1.00 9.09   ? 45  GLY B C   1 
ATOM   2544 O  O   . GLY B 1 22  ? 54.230 45.208  55.541  1.00 9.83   ? 45  GLY B O   1 
ATOM   2545 N  N   . PRO B 1 23  ? 55.476 44.326  53.877  1.00 10.65  ? 46  PRO B N   1 
ATOM   2546 C  CA  . PRO B 1 23  ? 54.775 43.043  54.052  1.00 9.43   ? 46  PRO B CA  1 
ATOM   2547 C  C   . PRO B 1 23  ? 54.942 42.464  55.448  1.00 11.61  ? 46  PRO B C   1 
ATOM   2548 O  O   . PRO B 1 23  ? 53.969 41.998  56.035  1.00 11.11  ? 46  PRO B O   1 
ATOM   2549 C  CB  . PRO B 1 23  ? 55.437 42.135  53.014  1.00 11.45  ? 46  PRO B CB  1 
ATOM   2550 C  CG  . PRO B 1 23  ? 55.924 43.105  51.924  1.00 10.64  ? 46  PRO B CG  1 
ATOM   2551 C  CD  . PRO B 1 23  ? 56.363 44.326  52.696  1.00 10.72  ? 46  PRO B CD  1 
ATOM   2552 N  N   . ALA B 1 24  ? 56.155 42.512  55.983  1.00 13.83  ? 47  ALA B N   1 
ATOM   2553 C  CA  . ALA B 1 24  ? 56.376 41.987  57.327  1.00 13.05  ? 47  ALA B CA  1 
ATOM   2554 C  C   . ALA B 1 24  ? 55.546 42.772  58.345  1.00 11.72  ? 47  ALA B C   1 
ATOM   2555 O  O   . ALA B 1 24  ? 54.973 42.187  59.265  1.00 13.49  ? 47  ALA B O   1 
ATOM   2556 C  CB  . ALA B 1 24  ? 57.859 42.032  57.680  1.00 18.02  ? 47  ALA B CB  1 
ATOM   2557 N  N   . ALA B 1 25  ? 55.466 44.091  58.185  1.00 14.12  ? 48  ALA B N   1 
ATOM   2558 C  CA  . ALA B 1 25  ? 54.682 44.905  59.117  1.00 13.46  ? 48  ALA B CA  1 
ATOM   2559 C  C   . ALA B 1 25  ? 53.211 44.523  59.114  1.00 13.42  ? 48  ALA B C   1 
ATOM   2560 O  O   . ALA B 1 25  ? 52.561 44.456  60.160  1.00 10.68  ? 48  ALA B O   1 
ATOM   2561 C  CB  . ALA B 1 25  ? 54.835 46.387  58.798  1.00 11.93  ? 48  ALA B CB  1 
ATOM   2562 N  N   . ILE B 1 26  ? 52.677 44.270  57.929  1.00 10.93  ? 49  ILE B N   1 
ATOM   2563 C  CA  . ILE B 1 26  ? 51.270 43.922  57.811  1.00 9.27   ? 49  ILE B CA  1 
ATOM   2564 C  C   . ILE B 1 26  ? 50.998 42.544  58.401  1.00 10.58  ? 49  ILE B C   1 
ATOM   2565 O  O   . ILE B 1 26  ? 50.010 42.337  59.109  1.00 8.88   ? 49  ILE B O   1 
ATOM   2566 C  CB  . ILE B 1 26  ? 50.800 44.044  56.329  1.00 8.86   ? 49  ILE B CB  1 
ATOM   2567 C  CG1 . ILE B 1 26  ? 50.990 45.494  55.864  1.00 8.57   ? 49  ILE B CG1 1 
ATOM   2568 C  CG2 . ILE B 1 26  ? 49.345 43.584  56.163  1.00 10.68  ? 49  ILE B CG2 1 
ATOM   2569 C  CD1 . ILE B 1 26  ? 50.771 45.719  54.355  1.00 12.47  ? 49  ILE B CD1 1 
ATOM   2570 N  N   . ARG B 1 27  ? 51.886 41.600  58.123  1.00 12.04  ? 50  ARG B N   1 
ATOM   2571 C  CA  . ARG B 1 27  ? 51.761 40.276  58.717  1.00 14.95  ? 50  ARG B CA  1 
ATOM   2572 C  C   . ARG B 1 27  ? 51.818 40.374  60.239  1.00 11.14  ? 50  ARG B C   1 
ATOM   2573 O  O   . ARG B 1 27  ? 51.040 39.734  60.934  1.00 14.38  ? 50  ARG B O   1 
ATOM   2574 C  CB  . ARG B 1 27  ? 52.897 39.374  58.243  1.00 13.21  ? 50  ARG B CB  1 
ATOM   2575 C  CG  . ARG B 1 27  ? 52.784 38.913  56.797  1.00 17.89  ? 50  ARG B CG  1 
ATOM   2576 C  CD  . ARG B 1 27  ? 54.052 38.188  56.394  1.00 21.06  ? 50  ARG B CD  1 
ATOM   2577 N  NE  . ARG B 1 27  ? 54.072 37.880  54.967  1.00 27.66  ? 50  ARG B NE  1 
ATOM   2578 C  CZ  . ARG B 1 27  ? 53.449 36.828  54.447  1.00 28.46  ? 50  ARG B CZ  1 
ATOM   2579 N  NH1 . ARG B 1 27  ? 52.767 36.011  55.243  1.00 27.86  ? 50  ARG B NH1 1 
ATOM   2580 N  NH2 . ARG B 1 27  ? 53.499 36.594  53.140  1.00 29.36  ? 50  ARG B NH2 1 
ATOM   2581 N  N   . GLU B 1 28  ? 52.749 41.176  60.749  1.00 12.87  ? 51  GLU B N   1 
ATOM   2582 C  CA  . GLU B 1 28  ? 52.906 41.309  62.200  1.00 15.60  ? 51  GLU B CA  1 
ATOM   2583 C  C   . GLU B 1 28  ? 51.657 41.911  62.841  1.00 18.97  ? 51  GLU B C   1 
ATOM   2584 O  O   . GLU B 1 28  ? 51.373 41.671  64.017  1.00 16.36  ? 51  GLU B O   1 
ATOM   2585 C  CB  . GLU B 1 28  ? 54.159 42.126  62.535  1.00 15.44  ? 51  GLU B CB  1 
ATOM   2586 C  CG  . GLU B 1 28  ? 55.447 41.367  62.225  1.00 24.93  ? 51  GLU B CG  1 
ATOM   2587 C  CD  . GLU B 1 28  ? 56.699 42.231  62.324  1.00 45.01  ? 51  GLU B CD  1 
ATOM   2588 O  OE1 . GLU B 1 28  ? 56.590 43.415  62.720  1.00 42.63  ? 51  GLU B OE1 1 
ATOM   2589 O  OE2 . GLU B 1 28  ? 57.790 41.723  61.981  1.00 36.74  ? 51  GLU B OE2 1 
ATOM   2590 N  N   . ALA B 1 29  ? 50.910 42.693  62.063  1.00 13.08  ? 52  ALA B N   1 
ATOM   2591 C  CA  . ALA B 1 29  ? 49.665 43.302  62.542  1.00 11.02  ? 52  ALA B CA  1 
ATOM   2592 C  C   . ALA B 1 29  ? 48.494 42.321  62.586  1.00 13.38  ? 52  ALA B C   1 
ATOM   2593 O  O   . ALA B 1 29  ? 47.367 42.707  62.888  1.00 15.93  ? 52  ALA B O   1 
ATOM   2594 C  CB  . ALA B 1 29  ? 49.302 44.530  61.692  1.00 13.22  ? 52  ALA B CB  1 
ATOM   2595 N  N   . GLY B 1 30  ? 48.759 41.062  62.255  1.00 12.67  ? 53  GLY B N   1 
ATOM   2596 C  CA  . GLY B 1 30  ? 47.783 39.998  62.436  1.00 16.62  ? 53  GLY B CA  1 
ATOM   2597 C  C   . GLY B 1 30  ? 46.948 39.653  61.215  1.00 12.70  ? 53  GLY B C   1 
ATOM   2598 O  O   . GLY B 1 30  ? 45.857 39.107  61.354  1.00 12.37  ? 53  GLY B O   1 
ATOM   2599 N  N   . LEU B 1 31  ? 47.462 39.941  60.022  1.00 10.27  ? 54  LEU B N   1 
ATOM   2600 C  CA  . LEU B 1 31  ? 46.690 39.706  58.797  1.00 10.73  ? 54  LEU B CA  1 
ATOM   2601 C  C   . LEU B 1 31  ? 46.166 38.283  58.670  1.00 12.40  ? 54  LEU B C   1 
ATOM   2602 O  O   . LEU B 1 31  ? 44.972 38.077  58.430  1.00 11.62  ? 54  LEU B O   1 
ATOM   2603 C  CB  . LEU B 1 31  ? 47.517 40.040  57.560  1.00 12.86  ? 54  LEU B CB  1 
ATOM   2604 C  CG  . LEU B 1 31  ? 46.811 39.797  56.216  1.00 13.36  ? 54  LEU B CG  1 
ATOM   2605 C  CD1 . LEU B 1 31  ? 45.568 40.681  56.058  1.00 14.21  ? 54  LEU B CD1 1 
ATOM   2606 C  CD2 . LEU B 1 31  ? 47.784 40.035  55.083  1.00 13.16  ? 54  LEU B CD2 1 
ATOM   2607 N  N   . MET B 1 32  ? 47.044 37.297  58.832  1.00 12.76  ? 55  MET B N   1 
ATOM   2608 C  CA  . MET B 1 32  ? 46.638 35.921  58.546  1.00 12.22  ? 55  MET B CA  1 
ATOM   2609 C  C   . MET B 1 32  ? 45.538 35.444  59.486  1.00 13.99  ? 55  MET B C   1 
ATOM   2610 O  O   . MET B 1 32  ? 44.570 34.842  59.036  1.00 14.08  ? 55  MET B O   1 
ATOM   2611 C  CB  . MET B 1 32  ? 47.841 34.963  58.518  1.00 14.40  ? 55  MET B CB  1 
ATOM   2612 C  CG  . MET B 1 32  ? 48.920 35.333  57.501  1.00 20.41  ? 55  MET B CG  1 
ATOM   2613 S  SD  . MET B 1 32  ? 48.340 35.558  55.788  1.00 25.60  ? 55  MET B SD  1 
ATOM   2614 C  CE  . MET B 1 32  ? 48.399 33.852  55.223  1.00 20.13  ? 55  MET B CE  1 
ATOM   2615 N  N   . LYS B 1 33  ? 45.662 35.727  60.782  1.00 14.86  ? 56  LYS B N   1 
ATOM   2616 C  CA  . LYS B 1 33  ? 44.592 35.380  61.721  1.00 16.16  ? 56  LYS B CA  1 
ATOM   2617 C  C   . LYS B 1 33  ? 43.275 36.056  61.366  1.00 14.24  ? 56  LYS B C   1 
ATOM   2618 O  O   . LYS B 1 33  ? 42.210 35.440  61.440  1.00 15.16  ? 56  LYS B O   1 
ATOM   2619 C  CB  . LYS B 1 33  ? 44.963 35.751  63.159  1.00 18.90  ? 56  LYS B CB  1 
ATOM   2620 C  CG  . LYS B 1 33  ? 46.080 34.910  63.768  1.00 37.29  ? 56  LYS B CG  1 
ATOM   2621 C  CD  . LYS B 1 33  ? 46.447 35.427  65.167  1.00 44.96  ? 56  LYS B CD  1 
ATOM   2622 C  CE  . LYS B 1 33  ? 47.339 34.447  65.925  1.00 45.37  ? 56  LYS B CE  1 
ATOM   2623 N  NZ  . LYS B 1 33  ? 48.751 34.936  66.019  1.00 52.82  ? 56  LYS B NZ  1 
ATOM   2624 N  N   . ARG B 1 34  ? 43.342 37.332  61.002  1.00 17.14  ? 57  ARG B N   1 
ATOM   2625 C  CA  . ARG B 1 34  ? 42.132 38.068  60.652  1.00 14.84  ? 57  ARG B CA  1 
ATOM   2626 C  C   . ARG B 1 34  ? 41.411 37.428  59.467  1.00 10.96  ? 57  ARG B C   1 
ATOM   2627 O  O   . ARG B 1 34  ? 40.182 37.274  59.477  1.00 14.41  ? 57  ARG B O   1 
ATOM   2628 C  CB  . ARG B 1 34  ? 42.465 39.544  60.355  1.00 15.00  ? 57  ARG B CB  1 
ATOM   2629 C  CG  . ARG B 1 34  ? 42.886 40.336  61.582  1.00 24.02  ? 57  ARG B CG  1 
ATOM   2630 C  CD  . ARG B 1 34  ? 41.668 40.736  62.398  1.00 19.01  ? 57  ARG B CD  1 
ATOM   2631 N  NE  . ARG B 1 34  ? 40.887 41.746  61.699  1.00 24.54  ? 57  ARG B NE  1 
ATOM   2632 C  CZ  . ARG B 1 34  ? 41.201 43.040  61.669  1.00 20.15  ? 57  ARG B CZ  1 
ATOM   2633 N  NH1 . ARG B 1 34  ? 42.259 43.481  62.332  1.00 19.20  ? 57  ARG B NH1 1 
ATOM   2634 N  NH2 . ARG B 1 34  ? 40.445 43.895  60.995  1.00 24.34  ? 57  ARG B NH2 1 
ATOM   2635 N  N   . LEU B 1 35  ? 42.172 37.056  58.442  1.00 9.57   ? 58  LEU B N   1 
ATOM   2636 C  CA  . LEU B 1 35  ? 41.557 36.427  57.264  1.00 11.46  ? 58  LEU B CA  1 
ATOM   2637 C  C   . LEU B 1 35  ? 40.998 35.031  57.581  1.00 14.02  ? 58  LEU B C   1 
ATOM   2638 O  O   . LEU B 1 35  ? 39.896 34.688  57.136  1.00 12.39  ? 58  LEU B O   1 
ATOM   2639 C  CB  . LEU B 1 35  ? 42.546 36.384  56.099  1.00 10.71  ? 58  LEU B CB  1 
ATOM   2640 C  CG  . LEU B 1 35  ? 42.893 37.752  55.503  1.00 12.01  ? 58  LEU B CG  1 
ATOM   2641 C  CD1 . LEU B 1 35  ? 43.928 37.610  54.401  1.00 16.17  ? 58  LEU B CD1 1 
ATOM   2642 C  CD2 . LEU B 1 35  ? 41.635 38.449  54.987  1.00 13.59  ? 58  LEU B CD2 1 
ATOM   2643 N  N   . SER B 1 36  ? 41.733 34.228  58.354  1.00 15.11  ? 59  SER B N   1 
ATOM   2644 C  CA  A SER B 1 36  ? 41.234 32.909  58.765  0.60 15.54  ? 59  SER B CA  1 
ATOM   2645 C  CA  B SER B 1 36  ? 41.238 32.911  58.766  0.40 15.57  ? 59  SER B CA  1 
ATOM   2646 C  C   . SER B 1 36  ? 39.911 33.025  59.491  1.00 14.58  ? 59  SER B C   1 
ATOM   2647 O  O   . SER B 1 36  ? 38.977 32.266  59.224  1.00 18.07  ? 59  SER B O   1 
ATOM   2648 C  CB  A SER B 1 36  ? 42.229 32.194  59.683  0.60 18.36  ? 59  SER B CB  1 
ATOM   2649 C  CB  B SER B 1 36  ? 42.241 32.205  59.681  0.40 18.39  ? 59  SER B CB  1 
ATOM   2650 O  OG  A SER B 1 36  ? 43.424 31.890  59.007  0.60 23.24  ? 59  SER B OG  1 
ATOM   2651 O  OG  B SER B 1 36  ? 43.423 31.875  58.991  0.40 23.19  ? 59  SER B OG  1 
ATOM   2652 N  N   . SER B 1 37  ? 39.833 33.985  60.410  1.00 15.22  ? 60  SER B N   1 
ATOM   2653 C  CA  . SER B 1 37  ? 38.631 34.190  61.215  1.00 15.70  ? 60  SER B CA  1 
ATOM   2654 C  C   . SER B 1 37  ? 37.409 34.513  60.386  1.00 19.01  ? 60  SER B C   1 
ATOM   2655 O  O   . SER B 1 37  ? 36.285 34.251  60.815  1.00 17.89  ? 60  SER B O   1 
ATOM   2656 C  CB  . SER B 1 37  ? 38.846 35.300  62.249  1.00 23.12  ? 60  SER B CB  1 
ATOM   2657 O  OG  . SER B 1 37  ? 39.758 34.875  63.229  1.00 28.83  ? 60  SER B OG  1 
ATOM   2658 N  N   . LEU B 1 38  ? 37.628 35.078  59.202  1.00 17.29  ? 61  LEU B N   1 
ATOM   2659 C  CA  . LEU B 1 38  ? 36.534 35.371  58.281  1.00 21.15  ? 61  LEU B CA  1 
ATOM   2660 C  C   . LEU B 1 38  ? 36.143 34.143  57.477  1.00 24.81  ? 61  LEU B C   1 
ATOM   2661 O  O   . LEU B 1 38  ? 35.160 34.166  56.735  1.00 20.31  ? 61  LEU B O   1 
ATOM   2662 C  CB  . LEU B 1 38  ? 36.928 36.496  57.308  1.00 14.95  ? 61  LEU B CB  1 
ATOM   2663 C  CG  . LEU B 1 38  ? 37.159 37.858  57.957  1.00 18.27  ? 61  LEU B CG  1 
ATOM   2664 C  CD1 . LEU B 1 38  ? 37.788 38.830  56.969  1.00 24.30  ? 61  LEU B CD1 1 
ATOM   2665 C  CD2 . LEU B 1 38  ? 35.825 38.383  58.470  1.00 18.34  ? 61  LEU B CD2 1 
ATOM   2666 N  N   . GLY B 1 39  ? 36.910 33.067  57.622  1.00 16.49  ? 62  GLY B N   1 
ATOM   2667 C  CA  . GLY B 1 39  ? 36.609 31.843  56.899  1.00 20.55  ? 62  GLY B CA  1 
ATOM   2668 C  C   . GLY B 1 39  ? 37.415 31.663  55.629  1.00 24.79  ? 62  GLY B C   1 
ATOM   2669 O  O   . GLY B 1 39  ? 37.107 30.790  54.812  1.00 21.50  ? 62  GLY B O   1 
ATOM   2670 N  N   A CYS B 1 40  ? 38.443 32.488  55.441  0.93 13.98  ? 63  CYS B N   1 
ATOM   2671 C  CA  A CYS B 1 40  ? 39.308 32.327  54.280  0.93 14.93  ? 63  CYS B CA  1 
ATOM   2672 C  C   A CYS B 1 40  ? 40.245 31.146  54.416  0.93 16.80  ? 63  CYS B C   1 
ATOM   2673 O  O   A CYS B 1 40  ? 40.969 31.021  55.404  0.93 15.01  ? 63  CYS B O   1 
ATOM   2674 C  CB  A CYS B 1 40  ? 40.140 33.581  54.035  0.93 16.15  ? 63  CYS B CB  1 
ATOM   2675 S  SG  A CYS B 1 40  ? 39.147 35.048  53.884  0.93 17.85  ? 63  CYS B SG  1 
ATOM   2676 N  N   . HIS B 1 41  ? 40.235 30.284  53.410  1.00 17.33  ? 64  HIS B N   1 
ATOM   2677 C  CA  . HIS B 1 41  ? 41.251 29.252  53.297  1.00 22.06  ? 64  HIS B CA  1 
ATOM   2678 C  C   . HIS B 1 41  ? 42.480 29.919  52.705  1.00 20.56  ? 64  HIS B C   1 
ATOM   2679 O  O   . HIS B 1 41  ? 42.412 30.501  51.624  1.00 22.33  ? 64  HIS B O   1 
ATOM   2680 C  CB  . HIS B 1 41  ? 40.762 28.121  52.389  1.00 22.18  ? 64  HIS B CB  1 
ATOM   2681 C  CG  . HIS B 1 41  ? 39.599 27.368  52.949  1.00 37.87  ? 64  HIS B CG  1 
ATOM   2682 N  ND1 . HIS B 1 41  ? 38.393 27.972  53.246  1.00 40.17  ? 64  HIS B ND1 1 
ATOM   2683 C  CD2 . HIS B 1 41  ? 39.454 26.061  53.277  1.00 34.73  ? 64  HIS B CD2 1 
ATOM   2684 C  CE1 . HIS B 1 41  ? 37.559 27.069  53.731  1.00 37.98  ? 64  HIS B CE1 1 
ATOM   2685 N  NE2 . HIS B 1 41  ? 38.175 25.904  53.757  1.00 39.89  ? 64  HIS B NE2 1 
ATOM   2686 N  N   . LEU B 1 42  ? 43.606 29.822  53.398  1.00 16.19  ? 65  LEU B N   1 
ATOM   2687 C  CA  . LEU B 1 42  ? 44.773 30.625  53.050  1.00 15.25  ? 65  LEU B CA  1 
ATOM   2688 C  C   . LEU B 1 42  ? 45.921 29.848  52.440  1.00 26.46  ? 65  LEU B C   1 
ATOM   2689 O  O   . LEU B 1 42  ? 46.258 28.752  52.880  1.00 22.91  ? 65  LEU B O   1 
ATOM   2690 C  CB  . LEU B 1 42  ? 45.288 31.352  54.289  1.00 16.28  ? 65  LEU B CB  1 
ATOM   2691 C  CG  . LEU B 1 42  ? 44.345 32.362  54.929  1.00 17.95  ? 65  LEU B CG  1 
ATOM   2692 C  CD1 . LEU B 1 42  ? 44.905 32.847  56.249  1.00 22.77  ? 65  LEU B CD1 1 
ATOM   2693 C  CD2 . LEU B 1 42  ? 44.204 33.535  53.976  1.00 19.99  ? 65  LEU B CD2 1 
ATOM   2694 N  N   . LYS B 1 43  ? 46.520 30.427  51.407  1.00 14.28  ? 66  LYS B N   1 
ATOM   2695 C  CA  . LYS B 1 43  ? 47.819 29.966  50.937  1.00 16.76  ? 66  LYS B CA  1 
ATOM   2696 C  C   . LYS B 1 43  ? 48.825 31.094  51.075  1.00 24.13  ? 66  LYS B C   1 
ATOM   2697 O  O   . LYS B 1 43  ? 48.693 32.138  50.430  1.00 19.16  ? 66  LYS B O   1 
ATOM   2698 C  CB  . LYS B 1 43  ? 47.766 29.509  49.482  1.00 18.92  ? 66  LYS B CB  1 
ATOM   2699 C  CG  . LYS B 1 43  ? 49.129 29.010  49.010  1.00 25.88  ? 66  LYS B CG  1 
ATOM   2700 C  CD  . LYS B 1 43  ? 49.098 28.457  47.597  1.00 28.76  ? 66  LYS B CD  1 
ATOM   2701 C  CE  . LYS B 1 43  ? 50.407 27.744  47.283  1.00 37.21  ? 66  LYS B CE  1 
ATOM   2702 N  NZ  . LYS B 1 43  ? 50.488 27.337  45.848  1.00 37.65  ? 66  LYS B NZ  1 
ATOM   2703 N  N   . ASP B 1 44  ? 49.823 30.906  51.924  1.00 17.84  ? 67  ASP B N   1 
ATOM   2704 C  CA  . ASP B 1 44  ? 50.825 31.948  52.085  1.00 18.06  ? 67  ASP B CA  1 
ATOM   2705 C  C   . ASP B 1 44  ? 52.047 31.629  51.234  1.00 26.60  ? 67  ASP B C   1 
ATOM   2706 O  O   . ASP B 1 44  ? 52.709 30.613  51.441  1.00 19.84  ? 67  ASP B O   1 
ATOM   2707 C  CB  . ASP B 1 44  ? 51.213 32.093  53.554  1.00 23.92  ? 67  ASP B CB  1 
ATOM   2708 C  CG  . ASP B 1 44  ? 52.071 33.316  53.814  1.00 26.36  ? 67  ASP B CG  1 
ATOM   2709 O  OD1 . ASP B 1 44  ? 52.505 33.978  52.842  1.00 26.94  ? 67  ASP B OD1 1 
ATOM   2710 O  OD2 . ASP B 1 44  ? 52.306 33.624  55.001  1.00 33.88  ? 67  ASP B OD2 1 
ATOM   2711 N  N   . PHE B 1 45  ? 52.335 32.498  50.266  1.00 17.61  ? 68  PHE B N   1 
ATOM   2712 C  CA  . PHE B 1 45  ? 53.515 32.327  49.427  1.00 22.98  ? 68  PHE B CA  1 
ATOM   2713 C  C   . PHE B 1 45  ? 54.753 32.906  50.107  1.00 21.24  ? 68  PHE B C   1 
ATOM   2714 O  O   . PHE B 1 45  ? 55.853 32.830  49.575  1.00 27.65  ? 68  PHE B O   1 
ATOM   2715 C  CB  . PHE B 1 45  ? 53.316 32.999  48.063  1.00 19.96  ? 68  PHE B CB  1 
ATOM   2716 C  CG  . PHE B 1 45  ? 52.390 32.261  47.151  1.00 21.16  ? 68  PHE B CG  1 
ATOM   2717 C  CD1 . PHE B 1 45  ? 51.016 32.354  47.316  1.00 18.50  ? 68  PHE B CD1 1 
ATOM   2718 C  CD2 . PHE B 1 45  ? 52.889 31.477  46.126  1.00 26.29  ? 68  PHE B CD2 1 
ATOM   2719 C  CE1 . PHE B 1 45  ? 50.155 31.681  46.482  1.00 22.36  ? 68  PHE B CE1 1 
ATOM   2720 C  CE2 . PHE B 1 45  ? 52.034 30.793  45.282  1.00 28.85  ? 68  PHE B CE2 1 
ATOM   2721 C  CZ  . PHE B 1 45  ? 50.659 30.901  45.457  1.00 28.34  ? 68  PHE B CZ  1 
ATOM   2722 N  N   . GLY B 1 46  ? 54.566 33.500  51.278  1.00 23.27  ? 69  GLY B N   1 
ATOM   2723 C  CA  . GLY B 1 46  ? 55.645 34.183  51.965  1.00 24.90  ? 69  GLY B CA  1 
ATOM   2724 C  C   . GLY B 1 46  ? 56.060 35.460  51.257  1.00 28.32  ? 69  GLY B C   1 
ATOM   2725 O  O   . GLY B 1 46  ? 55.315 35.996  50.425  1.00 19.48  ? 69  GLY B O   1 
ATOM   2726 N  N   . ASP B 1 47  ? 57.247 35.953  51.598  1.00 20.19  ? 70  ASP B N   1 
ATOM   2727 C  CA  . ASP B 1 47  ? 57.820 37.120  50.943  1.00 14.14  ? 70  ASP B CA  1 
ATOM   2728 C  C   . ASP B 1 47  ? 58.724 36.676  49.814  1.00 22.47  ? 70  ASP B C   1 
ATOM   2729 O  O   . ASP B 1 47  ? 59.697 35.962  50.042  1.00 19.16  ? 70  ASP B O   1 
ATOM   2730 C  CB  . ASP B 1 47  ? 58.621 37.951  51.946  1.00 24.97  ? 70  ASP B CB  1 
ATOM   2731 C  CG  . ASP B 1 47  ? 57.733 38.744  52.889  1.00 39.16  ? 70  ASP B CG  1 
ATOM   2732 O  OD1 . ASP B 1 47  ? 56.512 38.459  52.943  1.00 29.85  ? 70  ASP B OD1 1 
ATOM   2733 O  OD2 . ASP B 1 47  ? 58.271 39.638  53.584  1.00 44.29  ? 70  ASP B OD2 1 
ATOM   2734 N  N   . LEU B 1 48  ? 58.412 37.105  48.596  1.00 12.45  ? 71  LEU B N   1 
ATOM   2735 C  CA  . LEU B 1 48  ? 59.215 36.729  47.439  1.00 16.27  ? 71  LEU B CA  1 
ATOM   2736 C  C   . LEU B 1 48  ? 60.576 37.394  47.489  1.00 17.00  ? 71  LEU B C   1 
ATOM   2737 O  O   . LEU B 1 48  ? 60.717 38.484  48.042  1.00 15.13  ? 71  LEU B O   1 
ATOM   2738 C  CB  . LEU B 1 48  ? 58.504 37.097  46.135  1.00 14.08  ? 71  LEU B CB  1 
ATOM   2739 C  CG  . LEU B 1 48  ? 57.086 36.559  45.949  1.00 14.36  ? 71  LEU B CG  1 
ATOM   2740 C  CD1 . LEU B 1 48  ? 56.580 36.911  44.564  1.00 18.06  ? 71  LEU B CD1 1 
ATOM   2741 C  CD2 . LEU B 1 48  ? 57.068 35.049  46.148  1.00 18.75  ? 71  LEU B CD2 1 
ATOM   2742 N  N   . SER B 1 49  ? 61.571 36.714  46.931  1.00 17.13  ? 72  SER B N   1 
ATOM   2743 C  CA  . SER B 1 49  ? 62.888 37.288  46.704  1.00 20.11  ? 72  SER B CA  1 
ATOM   2744 C  C   . SER B 1 49  ? 63.016 37.477  45.205  1.00 18.59  ? 72  SER B C   1 
ATOM   2745 O  O   . SER B 1 49  ? 62.975 36.502  44.450  1.00 24.83  ? 72  SER B O   1 
ATOM   2746 C  CB  . SER B 1 49  ? 63.987 36.333  47.179  1.00 26.61  ? 72  SER B CB  1 
ATOM   2747 O  OG  . SER B 1 49  ? 63.939 36.160  48.574  1.00 32.81  ? 72  SER B OG  1 
ATOM   2748 N  N   . PHE B 1 50  ? 63.163 38.719  44.762  1.00 17.48  ? 73  PHE B N   1 
ATOM   2749 C  CA  . PHE B 1 50  ? 63.230 38.986  43.329  1.00 17.52  ? 73  PHE B CA  1 
ATOM   2750 C  C   . PHE B 1 50  ? 64.660 38.951  42.813  1.00 15.68  ? 73  PHE B C   1 
ATOM   2751 O  O   . PHE B 1 50  ? 65.601 39.301  43.528  1.00 17.18  ? 73  PHE B O   1 
ATOM   2752 C  CB  . PHE B 1 50  ? 62.527 40.307  42.996  1.00 16.75  ? 73  PHE B CB  1 
ATOM   2753 C  CG  . PHE B 1 50  ? 61.084 40.321  43.402  1.00 13.76  ? 73  PHE B CG  1 
ATOM   2754 C  CD1 . PHE B 1 50  ? 60.155 39.564  42.699  1.00 13.28  ? 73  PHE B CD1 1 
ATOM   2755 C  CD2 . PHE B 1 50  ? 60.660 41.045  44.510  1.00 12.02  ? 73  PHE B CD2 1 
ATOM   2756 C  CE1 . PHE B 1 50  ? 58.817 39.544  43.074  1.00 14.09  ? 73  PHE B CE1 1 
ATOM   2757 C  CE2 . PHE B 1 50  ? 59.312 41.037  44.896  1.00 17.31  ? 73  PHE B CE2 1 
ATOM   2758 C  CZ  . PHE B 1 50  ? 58.391 40.282  44.175  1.00 17.02  ? 73  PHE B CZ  1 
ATOM   2759 N  N   . THR B 1 51  ? 64.824 38.500  41.575  1.00 17.70  ? 74  THR B N   1 
ATOM   2760 C  CA  . THR B 1 51  ? 66.149 38.405  40.983  1.00 17.93  ? 74  THR B CA  1 
ATOM   2761 C  C   . THR B 1 51  ? 66.690 39.798  40.688  1.00 18.32  ? 74  THR B C   1 
ATOM   2762 O  O   . THR B 1 51  ? 66.053 40.575  39.983  1.00 17.32  ? 74  THR B O   1 
ATOM   2763 C  CB  . THR B 1 51  ? 66.122 37.598  39.686  1.00 22.96  ? 74  THR B CB  1 
ATOM   2764 O  OG1 . THR B 1 51  ? 65.466 36.348  39.926  1.00 17.66  ? 74  THR B OG1 1 
ATOM   2765 C  CG2 . THR B 1 51  ? 67.539 37.349  39.178  1.00 18.43  ? 74  THR B CG2 1 
ATOM   2766 N  N   . PRO B 1 52  ? 67.865 40.117  41.240  1.00 15.04  ? 75  PRO B N   1 
ATOM   2767 C  CA  . PRO B 1 52  ? 68.514 41.405  40.977  1.00 14.68  ? 75  PRO B CA  1 
ATOM   2768 C  C   . PRO B 1 52  ? 69.056 41.478  39.552  1.00 23.89  ? 75  PRO B C   1 
ATOM   2769 O  O   . PRO B 1 52  ? 69.217 40.455  38.884  1.00 18.87  ? 75  PRO B O   1 
ATOM   2770 C  CB  . PRO B 1 52  ? 69.664 41.437  41.993  1.00 20.13  ? 75  PRO B CB  1 
ATOM   2771 C  CG  . PRO B 1 52  ? 69.967 40.004  42.283  1.00 21.77  ? 75  PRO B CG  1 
ATOM   2772 C  CD  . PRO B 1 52  ? 68.655 39.259  42.144  1.00 18.07  ? 75  PRO B CD  1 
ATOM   2773 N  N   . VAL B 1 53  ? 69.308 42.695  39.087  1.00 14.02  ? 76  VAL B N   1 
ATOM   2774 C  CA  . VAL B 1 53  ? 69.873 42.921  37.766  1.00 12.47  ? 76  VAL B CA  1 
ATOM   2775 C  C   . VAL B 1 53  ? 71.172 43.691  37.921  1.00 15.05  ? 76  VAL B C   1 
ATOM   2776 O  O   . VAL B 1 53  ? 71.189 44.764  38.508  1.00 19.43  ? 76  VAL B O   1 
ATOM   2777 C  CB  . VAL B 1 53  ? 68.906 43.724  36.874  1.00 21.19  ? 76  VAL B CB  1 
ATOM   2778 C  CG1 . VAL B 1 53  ? 69.578 44.080  35.538  1.00 19.12  ? 76  VAL B CG1 1 
ATOM   2779 C  CG2 . VAL B 1 53  ? 67.601 42.947  36.662  1.00 17.26  ? 76  VAL B CG2 1 
ATOM   2780 N  N   . PRO B 1 54  ? 72.278 43.124  37.426  1.00 16.00  ? 77  PRO B N   1 
ATOM   2781 C  CA  . PRO B 1 54  ? 73.532 43.872  37.555  1.00 16.83  ? 77  PRO B CA  1 
ATOM   2782 C  C   . PRO B 1 54  ? 73.477 45.120  36.672  1.00 22.39  ? 77  PRO B C   1 
ATOM   2783 O  O   . PRO B 1 54  ? 72.885 45.074  35.594  1.00 34.13  ? 77  PRO B O   1 
ATOM   2784 C  CB  . PRO B 1 54  ? 74.587 42.902  37.013  1.00 20.49  ? 77  PRO B CB  1 
ATOM   2785 C  CG  . PRO B 1 54  ? 73.902 41.560  36.899  1.00 28.53  ? 77  PRO B CG  1 
ATOM   2786 C  CD  . PRO B 1 54  ? 72.451 41.853  36.699  1.00 20.87  ? 77  PRO B CD  1 
ATOM   2787 N  N   . LYS B 1 55  ? 74.048 46.221  37.148  1.00 21.95  ? 78  LYS B N   1 
ATOM   2788 C  CA  . LYS B 1 55  ? 74.244 47.421  36.339  1.00 29.95  ? 78  LYS B CA  1 
ATOM   2789 C  C   . LYS B 1 55  ? 72.923 47.928  35.781  1.00 37.83  ? 78  LYS B C   1 
ATOM   2790 O  O   . LYS B 1 55  ? 72.796 48.191  34.580  1.00 32.45  ? 78  LYS B O   1 
ATOM   2791 C  CB  . LYS B 1 55  ? 75.229 47.138  35.193  1.00 28.51  ? 78  LYS B CB  1 
ATOM   2792 C  CG  . LYS B 1 55  ? 75.990 48.356  34.659  1.00 31.80  ? 78  LYS B CG  1 
ATOM   2793 C  CD  . LYS B 1 55  ? 77.195 48.673  35.531  1.00 34.64  ? 78  LYS B CD  1 
ATOM   2794 C  CE  . LYS B 1 55  ? 78.141 49.658  34.847  1.00 51.81  ? 78  LYS B CE  1 
ATOM   2795 N  NZ  . LYS B 1 55  ? 77.566 51.028  34.742  1.00 51.88  ? 78  LYS B NZ  1 
ATOM   2796 N  N   . ASP B 1 56  ? 71.934 48.064  36.653  1.00 25.08  ? 79  ASP B N   1 
ATOM   2797 C  CA  . ASP B 1 56  ? 70.639 48.545  36.208  1.00 31.40  ? 79  ASP B CA  1 
ATOM   2798 C  C   . ASP B 1 56  ? 70.668 50.069  36.182  1.00 23.90  ? 79  ASP B C   1 
ATOM   2799 O  O   . ASP B 1 56  ? 69.979 50.720  36.961  1.00 22.97  ? 79  ASP B O   1 
ATOM   2800 C  CB  . ASP B 1 56  ? 69.534 48.032  37.126  1.00 23.57  ? 79  ASP B CB  1 
ATOM   2801 C  CG  . ASP B 1 56  ? 68.135 48.392  36.633  1.00 14.97  ? 79  ASP B CG  1 
ATOM   2802 O  OD1 . ASP B 1 56  ? 67.967 48.891  35.489  1.00 12.30  ? 79  ASP B OD1 1 
ATOM   2803 O  OD2 . ASP B 1 56  ? 67.201 48.147  37.408  1.00 14.24  ? 79  ASP B OD2 1 
ATOM   2804 N  N   . ASP B 1 57  ? 71.466 50.611  35.260  1.00 30.21  ? 80  ASP B N   1 
ATOM   2805 C  CA  . ASP B 1 57  ? 71.626 52.052  35.070  1.00 30.85  ? 80  ASP B CA  1 
ATOM   2806 C  C   . ASP B 1 57  ? 70.301 52.762  34.840  1.00 35.65  ? 80  ASP B C   1 
ATOM   2807 O  O   . ASP B 1 57  ? 69.313 52.138  34.446  1.00 34.30  ? 80  ASP B O   1 
ATOM   2808 C  CB  . ASP B 1 57  ? 72.512 52.334  33.849  1.00 38.06  ? 80  ASP B CB  1 
ATOM   2809 C  CG  . ASP B 1 57  ? 73.937 51.859  34.033  1.00 47.53  ? 80  ASP B CG  1 
ATOM   2810 O  OD1 . ASP B 1 57  ? 74.421 51.860  35.186  1.00 47.02  ? 80  ASP B OD1 1 
ATOM   2811 O  OD2 . ASP B 1 57  ? 74.574 51.487  33.022  1.00 46.01  ? 80  ASP B OD2 1 
ATOM   2812 N  N   . LEU B 1 58  ? 70.285 54.069  35.093  1.00 22.07  ? 81  LEU B N   1 
ATOM   2813 C  CA  . LEU B 1 58  ? 69.142 54.873  34.725  1.00 25.32  ? 81  LEU B CA  1 
ATOM   2814 C  C   . LEU B 1 58  ? 68.784 54.640  33.276  1.00 24.47  ? 81  LEU B C   1 
ATOM   2815 O  O   . LEU B 1 58  ? 69.646 54.436  32.414  1.00 33.02  ? 81  LEU B O   1 
ATOM   2816 C  CB  . LEU B 1 58  ? 69.437 56.372  34.880  1.00 28.85  ? 81  LEU B CB  1 
ATOM   2817 C  CG  . LEU B 1 58  ? 69.459 56.887  36.303  1.00 36.38  ? 81  LEU B CG  1 
ATOM   2818 C  CD1 . LEU B 1 58  ? 69.262 58.401  36.351  1.00 19.21  ? 81  LEU B CD1 1 
ATOM   2819 C  CD2 . LEU B 1 58  ? 68.358 56.179  37.019  1.00 31.36  ? 81  LEU B CD2 1 
ATOM   2820 N  N   . TYR B 1 59  ? 67.503 54.701  33.002  1.00 14.63  ? 82  TYR B N   1 
ATOM   2821 C  CA  . TYR B 1 59  ? 67.077 54.821  31.628  1.00 17.55  ? 82  TYR B CA  1 
ATOM   2822 C  C   . TYR B 1 59  ? 66.892 56.300  31.340  1.00 21.75  ? 82  TYR B C   1 
ATOM   2823 O  O   . TYR B 1 59  ? 66.278 57.019  32.137  1.00 15.88  ? 82  TYR B O   1 
ATOM   2824 C  CB  . TYR B 1 59  ? 65.787 54.042  31.400  1.00 20.99  ? 82  TYR B CB  1 
ATOM   2825 C  CG  . TYR B 1 59  ? 65.110 54.362  30.099  1.00 21.77  ? 82  TYR B CG  1 
ATOM   2826 C  CD1 . TYR B 1 59  ? 65.520 53.761  28.918  1.00 24.37  ? 82  TYR B CD1 1 
ATOM   2827 C  CD2 . TYR B 1 59  ? 64.034 55.242  30.058  1.00 17.02  ? 82  TYR B CD2 1 
ATOM   2828 C  CE1 . TYR B 1 59  ? 64.891 54.043  27.722  1.00 24.69  ? 82  TYR B CE1 1 
ATOM   2829 C  CE2 . TYR B 1 59  ? 63.394 55.529  28.870  1.00 27.65  ? 82  TYR B CE2 1 
ATOM   2830 C  CZ  . TYR B 1 59  ? 63.826 54.922  27.706  1.00 25.23  ? 82  TYR B CZ  1 
ATOM   2831 O  OH  . TYR B 1 59  ? 63.193 55.210  26.519  1.00 33.54  ? 82  TYR B OH  1 
ATOM   2832 N  N   . ASN B 1 60  ? 67.413 56.747  30.215  1.00 15.97  ? 83  ASN B N   1 
ATOM   2833 C  CA  . ASN B 1 60  ? 67.277 58.132  29.823  1.00 13.90  ? 83  ASN B CA  1 
ATOM   2834 C  C   . ASN B 1 60  ? 67.714 59.143  30.911  1.00 14.79  ? 83  ASN B C   1 
ATOM   2835 O  O   . ASN B 1 60  ? 67.143 60.165  31.051  1.00 15.48  ? 83  ASN B O   1 
ATOM   2836 C  CB  . ASN B 1 60  ? 65.853 58.402  29.399  1.00 17.19  ? 83  ASN B CB  1 
ATOM   2837 C  CG  . ASN B 1 60  ? 65.757 59.384  28.266  1.00 25.71  ? 83  ASN B CG  1 
ATOM   2838 O  OD1 . ASN B 1 60  ? 66.736 59.873  27.777  1.00 24.28  ? 83  ASN B OD1 1 
ATOM   2839 N  ND2 . ASN B 1 60  ? 64.551 59.693  27.889  1.00 28.93  ? 83  ASN B ND2 1 
ATOM   2840 N  N   . ASN B 1 61  ? 68.733 58.788  31.654  1.00 13.12  ? 84  ASN B N   1 
ATOM   2841 C  CA  . ASN B 1 61  ? 69.232 59.619  32.749  1.00 18.77  ? 84  ASN B CA  1 
ATOM   2842 C  C   . ASN B 1 61  ? 68.221 60.010  33.812  1.00 14.81  ? 84  ASN B C   1 
ATOM   2843 O  O   . ASN B 1 61  ? 68.486 60.898  34.621  1.00 13.76  ? 84  ASN B O   1 
ATOM   2844 C  CB  . ASN B 1 61  ? 70.065 60.796  32.221  1.00 14.51  ? 84  ASN B CB  1 
ATOM   2845 C  CG  . ASN B 1 61  ? 71.424 60.360  31.722  1.00 18.30  ? 84  ASN B CG  1 
ATOM   2846 O  OD1 . ASN B 1 61  ? 72.163 59.659  32.417  1.00 22.75  ? 84  ASN B OD1 1 
ATOM   2847 N  ND2 . ASN B 1 61  ? 71.754 60.756  30.506  1.00 21.64  ? 84  ASN B ND2 1 
ATOM   2848 N  N   . LEU B 1 62  ? 67.057 59.364  33.806  1.00 11.23  ? 85  LEU B N   1 
ATOM   2849 C  CA  . LEU B 1 62  ? 66.003 59.719  34.751  1.00 8.76   ? 85  LEU B CA  1 
ATOM   2850 C  C   . LEU B 1 62  ? 65.262 58.580  35.456  1.00 15.22  ? 85  LEU B C   1 
ATOM   2851 O  O   . LEU B 1 62  ? 65.025 58.648  36.662  1.00 13.69  ? 85  LEU B O   1 
ATOM   2852 C  CB  . LEU B 1 62  ? 64.996 60.542  33.936  1.00 10.83  ? 85  LEU B CB  1 
ATOM   2853 C  CG  . LEU B 1 62  ? 63.765 61.010  34.723  1.00 15.19  ? 85  LEU B CG  1 
ATOM   2854 C  CD1 . LEU B 1 62  ? 64.154 61.911  35.906  1.00 14.80  ? 85  LEU B CD1 1 
ATOM   2855 C  CD2 . LEU B 1 62  ? 62.791 61.738  33.810  1.00 15.70  ? 85  LEU B CD2 1 
ATOM   2856 N  N   . ILE B 1 63  ? 64.875 57.555  34.697  1.00 12.96  ? 86  ILE B N   1 
ATOM   2857 C  CA  . ILE B 1 63  ? 64.035 56.490  35.241  1.00 13.85  ? 86  ILE B CA  1 
ATOM   2858 C  C   . ILE B 1 63  ? 64.906 55.539  36.041  1.00 11.99  ? 86  ILE B C   1 
ATOM   2859 O  O   . ILE B 1 63  ? 65.842 54.948  35.496  1.00 13.03  ? 86  ILE B O   1 
ATOM   2860 C  CB  . ILE B 1 63  ? 63.344 55.673  34.129  1.00 15.01  ? 86  ILE B CB  1 
ATOM   2861 C  CG1 . ILE B 1 63  ? 62.702 56.596  33.093  1.00 23.25  ? 86  ILE B CG1 1 
ATOM   2862 C  CG2 . ILE B 1 63  ? 62.328 54.687  34.744  1.00 15.33  ? 86  ILE B CG2 1 
ATOM   2863 C  CD1 . ILE B 1 63  ? 61.575 57.413  33.630  1.00 17.71  ? 86  ILE B CD1 1 
ATOM   2864 N  N   . VAL B 1 64  ? 64.617 55.368  37.326  1.00 12.00  ? 87  VAL B N   1 
ATOM   2865 C  CA  . VAL B 1 64  ? 65.530 54.560  38.142  1.00 14.17  ? 87  VAL B CA  1 
ATOM   2866 C  C   . VAL B 1 64  ? 65.097 53.096  38.212  1.00 10.72  ? 87  VAL B C   1 
ATOM   2867 O  O   . VAL B 1 64  ? 63.899 52.789  38.211  1.00 11.50  ? 87  VAL B O   1 
ATOM   2868 C  CB  . VAL B 1 64  ? 65.762 55.145  39.556  1.00 25.09  ? 87  VAL B CB  1 
ATOM   2869 C  CG1 . VAL B 1 64  ? 65.897 56.662  39.501  1.00 29.23  ? 87  VAL B CG1 1 
ATOM   2870 C  CG2 . VAL B 1 64  ? 64.634 54.774  40.445  1.00 28.29  ? 87  VAL B CG2 1 
ATOM   2871 N  N   . ASN B 1 65  ? 66.089 52.211  38.254  1.00 11.07  ? 88  ASN B N   1 
ATOM   2872 C  CA  . ASN B 1 65  ? 65.864 50.776  38.378  1.00 13.16  ? 88  ASN B CA  1 
ATOM   2873 C  C   . ASN B 1 65  ? 64.871 50.152  37.392  1.00 13.50  ? 88  ASN B C   1 
ATOM   2874 O  O   . ASN B 1 65  ? 64.055 49.335  37.805  1.00 11.82  ? 88  ASN B O   1 
ATOM   2875 C  CB  . ASN B 1 65  ? 65.416 50.434  39.813  1.00 8.90   ? 88  ASN B CB  1 
ATOM   2876 C  CG  . ASN B 1 65  ? 66.334 51.041  40.880  1.00 18.06  ? 88  ASN B CG  1 
ATOM   2877 O  OD1 . ASN B 1 65  ? 65.876 51.700  41.819  1.00 24.68  ? 88  ASN B OD1 1 
ATOM   2878 N  ND2 . ASN B 1 65  ? 67.624 50.829  40.726  1.00 12.58  ? 88  ASN B ND2 1 
ATOM   2879 N  N   . PRO B 1 66  ? 64.923 50.525  36.093  1.00 12.59  ? 89  PRO B N   1 
ATOM   2880 C  CA  . PRO B 1 66  ? 63.875 49.947  35.240  1.00 12.02  ? 89  PRO B CA  1 
ATOM   2881 C  C   . PRO B 1 66  ? 63.999 48.438  35.050  1.00 9.69   ? 89  PRO B C   1 
ATOM   2882 O  O   . PRO B 1 66  ? 62.978 47.742  35.008  1.00 11.25  ? 89  PRO B O   1 
ATOM   2883 C  CB  . PRO B 1 66  ? 64.073 50.662  33.898  1.00 14.34  ? 89  PRO B CB  1 
ATOM   2884 C  CG  . PRO B 1 66  ? 65.509 51.081  33.898  1.00 11.42  ? 89  PRO B CG  1 
ATOM   2885 C  CD  . PRO B 1 66  ? 65.803 51.436  35.338  1.00 14.19  ? 89  PRO B CD  1 
ATOM   2886 N  N   . ARG B 1 67  ? 65.220 47.945  34.904  1.00 9.77   ? 90  ARG B N   1 
ATOM   2887 C  CA  . ARG B 1 67  ? 65.397 46.516  34.666  1.00 14.57  ? 90  ARG B CA  1 
ATOM   2888 C  C   . ARG B 1 67  ? 65.002 45.718  35.889  1.00 15.18  ? 90  ARG B C   1 
ATOM   2889 O  O   . ARG B 1 67  ? 64.389 44.656  35.777  1.00 13.45  ? 90  ARG B O   1 
ATOM   2890 C  CB  . ARG B 1 67  ? 66.837 46.195  34.250  1.00 12.51  ? 90  ARG B CB  1 
ATOM   2891 C  CG  . ARG B 1 67  ? 67.276 46.905  32.969  1.00 12.33  ? 90  ARG B CG  1 
ATOM   2892 C  CD  . ARG B 1 67  ? 68.805 46.910  32.827  1.00 17.87  ? 90  ARG B CD  1 
ATOM   2893 N  NE  . ARG B 1 67  ? 69.230 47.788  31.734  1.00 21.23  ? 90  ARG B NE  1 
ATOM   2894 C  CZ  . ARG B 1 67  ? 69.315 49.112  31.831  1.00 27.99  ? 90  ARG B CZ  1 
ATOM   2895 N  NH1 . ARG B 1 67  ? 69.000 49.712  32.971  1.00 17.80  ? 90  ARG B NH1 1 
ATOM   2896 N  NH2 . ARG B 1 67  ? 69.702 49.839  30.787  1.00 20.86  ? 90  ARG B NH2 1 
ATOM   2897 N  N   . SER B 1 68  ? 65.342 46.244  37.062  1.00 10.06  ? 91  SER B N   1 
ATOM   2898 C  CA  . SER B 1 68  ? 65.064 45.551  38.314  1.00 11.74  ? 91  SER B CA  1 
ATOM   2899 C  C   . SER B 1 68  ? 63.568 45.501  38.563  1.00 15.75  ? 91  SER B C   1 
ATOM   2900 O  O   . SER B 1 68  ? 63.017 44.466  38.970  1.00 15.65  ? 91  SER B O   1 
ATOM   2901 C  CB  . SER B 1 68  ? 65.760 46.258  39.478  1.00 16.03  ? 91  SER B CB  1 
ATOM   2902 O  OG  . SER B 1 68  ? 67.158 46.350  39.253  1.00 19.61  ? 91  SER B OG  1 
ATOM   2903 N  N   . VAL B 1 69  ? 62.919 46.641  38.355  1.00 11.55  ? 92  VAL B N   1 
ATOM   2904 C  CA  . VAL B 1 69  ? 61.474 46.728  38.529  1.00 9.39   ? 92  VAL B CA  1 
ATOM   2905 C  C   . VAL B 1 69  ? 60.780 45.894  37.463  1.00 9.38   ? 92  VAL B C   1 
ATOM   2906 O  O   . VAL B 1 69  ? 59.772 45.243  37.737  1.00 12.25  ? 92  VAL B O   1 
ATOM   2907 C  CB  . VAL B 1 69  ? 60.975 48.202  38.514  1.00 14.86  ? 92  VAL B CB  1 
ATOM   2908 C  CG1 . VAL B 1 69  ? 59.455 48.274  38.394  1.00 14.77  ? 92  VAL B CG1 1 
ATOM   2909 C  CG2 . VAL B 1 69  ? 61.450 48.922  39.770  1.00 12.14  ? 92  VAL B CG2 1 
ATOM   2910 N  N   . GLY B 1 70  ? 61.321 45.911  36.252  1.00 11.33  ? 93  GLY B N   1 
ATOM   2911 C  CA  . GLY B 1 70  ? 60.747 45.119  35.171  1.00 14.05  ? 93  GLY B CA  1 
ATOM   2912 C  C   . GLY B 1 70  ? 60.806 43.630  35.478  1.00 10.22  ? 93  GLY B C   1 
ATOM   2913 O  O   . GLY B 1 70  ? 59.816 42.904  35.343  1.00 11.85  ? 93  GLY B O   1 
ATOM   2914 N  N   . LEU B 1 71  ? 61.974 43.166  35.904  1.00 14.17  ? 94  LEU B N   1 
ATOM   2915 C  CA  . LEU B 1 71  ? 62.157 41.739  36.163  1.00 12.85  ? 94  LEU B CA  1 
ATOM   2916 C  C   . LEU B 1 71  ? 61.408 41.271  37.402  1.00 13.62  ? 94  LEU B C   1 
ATOM   2917 O  O   . LEU B 1 71  ? 60.777 40.207  37.386  1.00 11.28  ? 94  LEU B O   1 
ATOM   2918 C  CB  . LEU B 1 71  ? 63.644 41.395  36.274  1.00 13.61  ? 94  LEU B CB  1 
ATOM   2919 C  CG  . LEU B 1 71  ? 63.965 39.918  36.534  1.00 15.38  ? 94  LEU B CG  1 
ATOM   2920 C  CD1 . LEU B 1 71  ? 63.351 39.002  35.483  1.00 15.05  ? 94  LEU B CD1 1 
ATOM   2921 C  CD2 . LEU B 1 71  ? 65.490 39.706  36.600  1.00 14.76  ? 94  LEU B CD2 1 
ATOM   2922 N  N   . ALA B 1 72  ? 61.465 42.055  38.475  1.00 11.54  ? 95  ALA B N   1 
ATOM   2923 C  CA  . ALA B 1 72  ? 60.706 41.717  39.676  1.00 11.95  ? 95  ALA B CA  1 
ATOM   2924 C  C   . ALA B 1 72  ? 59.233 41.610  39.326  1.00 10.64  ? 95  ALA B C   1 
ATOM   2925 O  O   . ALA B 1 72  ? 58.543 40.700  39.783  1.00 12.55  ? 95  ALA B O   1 
ATOM   2926 C  CB  . ALA B 1 72  ? 60.921 42.748  40.780  1.00 13.39  ? 95  ALA B CB  1 
ATOM   2927 N  N   . ASN B 1 73  ? 58.743 42.534  38.508  1.00 9.38   ? 96  ASN B N   1 
ATOM   2928 C  CA  . ASN B 1 73  ? 57.335 42.467  38.104  1.00 7.96   ? 96  ASN B CA  1 
ATOM   2929 C  C   . ASN B 1 73  ? 57.016 41.268  37.216  1.00 10.16  ? 96  ASN B C   1 
ATOM   2930 O  O   . ASN B 1 73  ? 55.926 40.693  37.304  1.00 10.23  ? 96  ASN B O   1 
ATOM   2931 C  CB  . ASN B 1 73  ? 56.888 43.763  37.450  1.00 8.59   ? 96  ASN B CB  1 
ATOM   2932 C  CG  . ASN B 1 73  ? 56.431 44.789  38.475  1.00 10.71  ? 96  ASN B CG  1 
ATOM   2933 O  OD1 . ASN B 1 73  ? 55.555 44.508  39.291  1.00 11.78  ? 96  ASN B OD1 1 
ATOM   2934 N  ND2 . ASN B 1 73  ? 57.044 45.965  38.458  1.00 14.21  ? 96  ASN B ND2 1 
ATOM   2935 N  N   . GLN B 1 74  ? 57.963 40.898  36.359  1.00 12.50  ? 97  GLN B N   1 
ATOM   2936 C  CA  . GLN B 1 74  ? 57.779 39.703  35.533  1.00 14.68  ? 97  GLN B CA  1 
ATOM   2937 C  C   . GLN B 1 74  ? 57.634 38.477  36.436  1.00 14.44  ? 97  GLN B C   1 
ATOM   2938 O  O   . GLN B 1 74  ? 56.764 37.632  36.228  1.00 14.12  ? 97  GLN B O   1 
ATOM   2939 C  CB  . GLN B 1 74  ? 58.938 39.529  34.544  1.00 10.02  ? 97  GLN B CB  1 
ATOM   2940 C  CG  . GLN B 1 74  ? 58.667 38.422  33.498  1.00 12.13  ? 97  GLN B CG  1 
ATOM   2941 C  CD  . GLN B 1 74  ? 59.737 38.341  32.421  1.00 26.04  ? 97  GLN B CD  1 
ATOM   2942 O  OE1 . GLN B 1 74  ? 60.848 38.840  32.591  1.00 26.41  ? 97  GLN B OE1 1 
ATOM   2943 N  NE2 . GLN B 1 74  ? 59.401 37.705  31.301  1.00 20.14  ? 97  GLN B NE2 1 
ATOM   2944 N  N   . GLU B 1 75  ? 58.492 38.395  37.446  1.00 11.06  ? 98  GLU B N   1 
ATOM   2945 C  CA  . GLU B 1 75  ? 58.460 37.290  38.395  1.00 14.27  ? 98  GLU B CA  1 
ATOM   2946 C  C   . GLU B 1 75  ? 57.190 37.284  39.240  1.00 14.63  ? 98  GLU B C   1 
ATOM   2947 O  O   . GLU B 1 75  ? 56.577 36.234  39.465  1.00 11.45  ? 98  GLU B O   1 
ATOM   2948 C  CB  . GLU B 1 75  ? 59.717 37.331  39.271  1.00 15.27  ? 98  GLU B CB  1 
ATOM   2949 C  CG  . GLU B 1 75  ? 60.990 37.109  38.459  1.00 17.74  ? 98  GLU B CG  1 
ATOM   2950 C  CD  . GLU B 1 75  ? 62.255 37.096  39.300  1.00 19.36  ? 98  GLU B CD  1 
ATOM   2951 O  OE1 . GLU B 1 75  ? 63.234 36.440  38.882  1.00 20.09  ? 98  GLU B OE1 1 
ATOM   2952 O  OE2 . GLU B 1 75  ? 62.282 37.757  40.359  1.00 16.69  ? 98  GLU B OE2 1 
ATOM   2953 N  N   . LEU B 1 76  ? 56.784 38.461  39.707  1.00 9.94   ? 99  LEU B N   1 
ATOM   2954 C  CA  . LEU B 1 76  ? 55.561 38.577  40.489  1.00 10.22  ? 99  LEU B CA  1 
ATOM   2955 C  C   . LEU B 1 76  ? 54.349 38.172  39.663  1.00 10.20  ? 99  LEU B C   1 
ATOM   2956 O  O   . LEU B 1 76  ? 53.460 37.472  40.158  1.00 13.19  ? 99  LEU B O   1 
ATOM   2957 C  CB  . LEU B 1 76  ? 55.388 40.012  41.008  1.00 9.97   ? 99  LEU B CB  1 
ATOM   2958 C  CG  . LEU B 1 76  ? 54.141 40.359  41.833  1.00 13.10  ? 99  LEU B CG  1 
ATOM   2959 C  CD1 . LEU B 1 76  ? 53.928 39.419  43.043  1.00 9.64   ? 99  LEU B CD1 1 
ATOM   2960 C  CD2 . LEU B 1 76  ? 54.230 41.811  42.298  1.00 9.35   ? 99  LEU B CD2 1 
ATOM   2961 N  N   . ALA B 1 77  ? 54.310 38.623  38.413  1.00 8.25   ? 100 ALA B N   1 
ATOM   2962 C  CA  . ALA B 1 77  ? 53.178 38.320  37.535  1.00 11.13  ? 100 ALA B CA  1 
ATOM   2963 C  C   . ALA B 1 77  ? 52.982 36.818  37.397  1.00 12.94  ? 100 ALA B C   1 
ATOM   2964 O  O   . ALA B 1 77  ? 51.861 36.329  37.331  1.00 11.69  ? 100 ALA B O   1 
ATOM   2965 C  CB  . ALA B 1 77  ? 53.394 38.940  36.163  1.00 13.86  ? 100 ALA B CB  1 
ATOM   2966 N  N   . GLU B 1 78  ? 54.088 36.093  37.333  1.00 13.93  ? 101 GLU B N   1 
ATOM   2967 C  CA  . GLU B 1 78  ? 54.023 34.641  37.232  1.00 14.47  ? 101 GLU B CA  1 
ATOM   2968 C  C   . GLU B 1 78  ? 53.387 34.017  38.462  1.00 15.18  ? 101 GLU B C   1 
ATOM   2969 O  O   . GLU B 1 78  ? 52.565 33.095  38.360  1.00 13.54  ? 101 GLU B O   1 
ATOM   2970 C  CB  . GLU B 1 78  ? 55.422 34.071  37.024  1.00 19.76  ? 101 GLU B CB  1 
ATOM   2971 C  CG  . GLU B 1 78  ? 55.369 32.632  36.616  1.00 37.45  ? 101 GLU B CG  1 
ATOM   2972 C  CD  . GLU B 1 78  ? 54.905 32.495  35.185  1.00 44.13  ? 101 GLU B CD  1 
ATOM   2973 O  OE1 . GLU B 1 78  ? 54.394 31.413  34.822  1.00 58.07  ? 101 GLU B OE1 1 
ATOM   2974 O  OE2 . GLU B 1 78  ? 55.045 33.483  34.430  1.00 49.32  ? 101 GLU B OE2 1 
ATOM   2975 N  N   . VAL B 1 79  ? 53.768 34.512  39.635  1.00 10.69  ? 102 VAL B N   1 
ATOM   2976 C  CA  . VAL B 1 79  ? 53.197 33.999  40.870  1.00 10.34  ? 102 VAL B CA  1 
ATOM   2977 C  C   . VAL B 1 79  ? 51.721 34.333  40.968  1.00 13.82  ? 102 VAL B C   1 
ATOM   2978 O  O   . VAL B 1 79  ? 50.910 33.486  41.342  1.00 10.31  ? 102 VAL B O   1 
ATOM   2979 C  CB  . VAL B 1 79  ? 53.956 34.522  42.122  1.00 13.83  ? 102 VAL B CB  1 
ATOM   2980 C  CG1 . VAL B 1 79  ? 53.346 33.941  43.399  1.00 17.32  ? 102 VAL B CG1 1 
ATOM   2981 C  CG2 . VAL B 1 79  ? 55.428 34.144  42.029  1.00 16.24  ? 102 VAL B CG2 1 
ATOM   2982 N  N   . VAL B 1 80  ? 51.366 35.573  40.635  1.00 13.15  ? 103 VAL B N   1 
ATOM   2983 C  CA  . VAL B 1 80  ? 49.971 35.990  40.692  1.00 8.19   ? 103 VAL B CA  1 
ATOM   2984 C  C   . VAL B 1 80  ? 49.138 35.185  39.701  1.00 8.61   ? 103 VAL B C   1 
ATOM   2985 O  O   . VAL B 1 80  ? 48.059 34.695  40.032  1.00 9.43   ? 103 VAL B O   1 
ATOM   2986 C  CB  . VAL B 1 80  ? 49.813 37.508  40.407  1.00 7.62   ? 103 VAL B CB  1 
ATOM   2987 C  CG1 . VAL B 1 80  ? 48.361 37.851  40.197  1.00 7.39   ? 103 VAL B CG1 1 
ATOM   2988 C  CG2 . VAL B 1 80  ? 50.413 38.344  41.580  1.00 7.99   ? 103 VAL B CG2 1 
ATOM   2989 N  N   . SER B 1 81  ? 49.653 35.038  38.489  1.00 9.64   ? 104 SER B N   1 
ATOM   2990 C  CA  . SER B 1 81  ? 48.970 34.242  37.474  1.00 14.97  ? 104 SER B CA  1 
ATOM   2991 C  C   . SER B 1 81  ? 48.683 32.822  37.977  1.00 12.86  ? 104 SER B C   1 
ATOM   2992 O  O   . SER B 1 81  ? 47.571 32.305  37.827  1.00 14.42  ? 104 SER B O   1 
ATOM   2993 C  CB  . SER B 1 81  ? 49.820 34.187  36.202  1.00 15.81  ? 104 SER B CB  1 
ATOM   2994 O  OG  . SER B 1 81  ? 49.120 33.525  35.159  1.00 29.44  ? 104 SER B OG  1 
ATOM   2995 N  N   . ARG B 1 82  ? 49.674 32.198  38.592  1.00 17.01  ? 105 ARG B N   1 
ATOM   2996 C  CA  . ARG B 1 82  ? 49.478 30.831  39.065  1.00 19.44  ? 105 ARG B CA  1 
ATOM   2997 C  C   . ARG B 1 82  ? 48.434 30.788  40.170  1.00 17.93  ? 105 ARG B C   1 
ATOM   2998 O  O   . ARG B 1 82  ? 47.574 29.907  40.177  1.00 18.79  ? 105 ARG B O   1 
ATOM   2999 C  CB  . ARG B 1 82  ? 50.797 30.197  39.518  1.00 26.86  ? 105 ARG B CB  1 
ATOM   3000 C  CG  . ARG B 1 82  ? 50.642 28.702  39.777  1.00 39.38  ? 105 ARG B CG  1 
ATOM   3001 C  CD  . ARG B 1 82  ? 50.120 28.057  38.487  1.00 48.56  ? 105 ARG B CD  1 
ATOM   3002 N  NE  . ARG B 1 82  ? 49.575 26.710  38.659  1.00 72.82  ? 105 ARG B NE  1 
ATOM   3003 C  CZ  . ARG B 1 82  ? 49.804 25.692  37.831  1.00 78.59  ? 105 ARG B CZ  1 
ATOM   3004 N  NH1 . ARG B 1 82  ? 50.555 25.866  36.748  1.00 71.06  ? 105 ARG B NH1 1 
ATOM   3005 N  NH2 . ARG B 1 82  ? 49.260 24.505  38.073  1.00 71.40  ? 105 ARG B NH2 1 
ATOM   3006 N  N   . ALA B 1 83  ? 48.486 31.751  41.091  1.00 11.55  ? 106 ALA B N   1 
ATOM   3007 C  CA  . ALA B 1 83  ? 47.526 31.798  42.191  1.00 13.64  ? 106 ALA B CA  1 
ATOM   3008 C  C   . ALA B 1 83  ? 46.104 31.957  41.685  1.00 10.20  ? 106 ALA B C   1 
ATOM   3009 O  O   . ALA B 1 83  ? 45.173 31.278  42.149  1.00 11.61  ? 106 ALA B O   1 
ATOM   3010 C  CB  . ALA B 1 83  ? 47.865 32.943  43.160  1.00 15.08  ? 106 ALA B CB  1 
ATOM   3011 N  N   . VAL B 1 84  ? 45.921 32.884  40.754  1.00 9.33   ? 107 VAL B N   1 
ATOM   3012 C  CA  . VAL B 1 84  ? 44.589 33.123  40.218  1.00 8.50   ? 107 VAL B CA  1 
ATOM   3013 C  C   . VAL B 1 84  ? 44.105 31.905  39.435  1.00 6.58   ? 107 VAL B C   1 
ATOM   3014 O  O   . VAL B 1 84  ? 42.946 31.508  39.539  1.00 11.25  ? 107 VAL B O   1 
ATOM   3015 C  CB  . VAL B 1 84  ? 44.570 34.407  39.355  1.00 14.07  ? 107 VAL B CB  1 
ATOM   3016 C  CG1 . VAL B 1 84  ? 43.315 34.485  38.524  1.00 16.03  ? 107 VAL B CG1 1 
ATOM   3017 C  CG2 . VAL B 1 84  ? 44.703 35.623  40.263  1.00 11.48  ? 107 VAL B CG2 1 
ATOM   3018 N  N   . SER B 1 85  ? 45.004 31.289  38.683  1.00 10.02  ? 108 SER B N   1 
ATOM   3019 C  CA  . SER B 1 85  ? 44.627 30.114  37.899  1.00 13.87  ? 108 SER B CA  1 
ATOM   3020 C  C   . SER B 1 85  ? 44.229 28.945  38.806  1.00 17.50  ? 108 SER B C   1 
ATOM   3021 O  O   . SER B 1 85  ? 43.382 28.124  38.433  1.00 12.61  ? 108 SER B O   1 
ATOM   3022 C  CB  . SER B 1 85  ? 45.744 29.722  36.927  1.00 17.26  ? 108 SER B CB  1 
ATOM   3023 O  OG  . SER B 1 85  ? 46.857 29.209  37.618  1.00 24.45  ? 108 SER B OG  1 
ATOM   3024 N  N   . ASP B 1 86  ? 44.816 28.885  40.002  1.00 13.32  ? 109 ASP B N   1 
ATOM   3025 C  CA  . ASP B 1 86  ? 44.447 27.872  41.000  1.00 14.53  ? 109 ASP B CA  1 
ATOM   3026 C  C   . ASP B 1 86  ? 43.226 28.244  41.806  1.00 11.24  ? 109 ASP B C   1 
ATOM   3027 O  O   . ASP B 1 86  ? 42.869 27.532  42.737  1.00 16.81  ? 109 ASP B O   1 
ATOM   3028 C  CB  . ASP B 1 86  ? 45.609 27.588  41.963  1.00 19.96  ? 109 ASP B CB  1 
ATOM   3029 C  CG  . ASP B 1 86  ? 46.742 26.835  41.302  1.00 32.79  ? 109 ASP B CG  1 
ATOM   3030 O  OD1 . ASP B 1 86  ? 46.473 26.108  40.321  1.00 31.26  ? 109 ASP B OD1 1 
ATOM   3031 O  OD2 . ASP B 1 86  ? 47.900 26.984  41.752  1.00 28.16  ? 109 ASP B OD2 1 
ATOM   3032 N  N   . GLY B 1 87  ? 42.601 29.374  41.480  1.00 10.76  ? 110 GLY B N   1 
ATOM   3033 C  CA  . GLY B 1 87  ? 41.312 29.720  42.063  1.00 10.98  ? 110 GLY B CA  1 
ATOM   3034 C  C   . GLY B 1 87  ? 41.362 30.573  43.321  1.00 13.78  ? 110 GLY B C   1 
ATOM   3035 O  O   . GLY B 1 87  ? 40.357 30.724  44.024  1.00 11.76  ? 110 GLY B O   1 
ATOM   3036 N  N   . TYR B 1 88  ? 42.529 31.132  43.610  1.00 10.74  ? 111 TYR B N   1 
ATOM   3037 C  CA  . TYR B 1 88  ? 42.685 32.008  44.773  1.00 14.33  ? 111 TYR B CA  1 
ATOM   3038 C  C   . TYR B 1 88  ? 42.391 33.456  44.442  1.00 10.65  ? 111 TYR B C   1 
ATOM   3039 O  O   . TYR B 1 88  ? 42.813 33.944  43.389  1.00 11.19  ? 111 TYR B O   1 
ATOM   3040 C  CB  . TYR B 1 88  ? 44.119 31.952  45.298  1.00 10.93  ? 111 TYR B CB  1 
ATOM   3041 C  CG  . TYR B 1 88  ? 44.511 30.637  45.894  1.00 15.09  ? 111 TYR B CG  1 
ATOM   3042 C  CD1 . TYR B 1 88  ? 44.232 30.355  47.221  1.00 21.65  ? 111 TYR B CD1 1 
ATOM   3043 C  CD2 . TYR B 1 88  ? 45.187 29.684  45.142  1.00 19.38  ? 111 TYR B CD2 1 
ATOM   3044 C  CE1 . TYR B 1 88  ? 44.588 29.145  47.782  1.00 19.85  ? 111 TYR B CE1 1 
ATOM   3045 C  CE2 . TYR B 1 88  ? 45.553 28.470  45.693  1.00 25.53  ? 111 TYR B CE2 1 
ATOM   3046 C  CZ  . TYR B 1 88  ? 45.251 28.206  47.013  1.00 31.62  ? 111 TYR B CZ  1 
ATOM   3047 O  OH  . TYR B 1 88  ? 45.614 26.999  47.575  1.00 36.67  ? 111 TYR B OH  1 
ATOM   3048 N  N   . SER B 1 89  ? 41.705 34.147  45.348  1.00 10.12  ? 112 SER B N   1 
ATOM   3049 C  CA  . SER B 1 89  ? 41.726 35.610  45.337  1.00 13.03  ? 112 SER B CA  1 
ATOM   3050 C  C   . SER B 1 89  ? 43.123 35.989  45.813  1.00 14.58  ? 112 SER B C   1 
ATOM   3051 O  O   . SER B 1 89  ? 43.606 35.479  46.827  1.00 15.59  ? 112 SER B O   1 
ATOM   3052 C  CB  . SER B 1 89  ? 40.667 36.168  46.279  1.00 15.07  ? 112 SER B CB  1 
ATOM   3053 O  OG  . SER B 1 89  ? 39.375 35.872  45.796  1.00 21.37  ? 112 SER B OG  1 
ATOM   3054 N  N   . CYS B 1 90  ? 43.785 36.875  45.085  1.00 7.52   ? 113 CYS B N   1 
ATOM   3055 C  CA  A CYS B 1 90  ? 45.205 37.099  45.303  0.47 8.50   ? 113 CYS B CA  1 
ATOM   3056 C  CA  B CYS B 1 90  ? 45.205 37.099  45.304  0.35 8.54   ? 113 CYS B CA  1 
ATOM   3057 C  CA  C CYS B 1 90  ? 45.305 37.099  45.303  0.17 8.50   ? 113 CYS B CA  1 
ATOM   3058 C  C   . CYS B 1 90  ? 45.486 38.413  46.027  1.00 17.47  ? 113 CYS B C   1 
ATOM   3059 O  O   . CYS B 1 90  ? 45.242 39.490  45.491  1.00 15.30  ? 113 CYS B O   1 
ATOM   3060 C  CB  A CYS B 1 90  ? 45.941 37.063  43.967  0.47 16.03  ? 113 CYS B CB  1 
ATOM   3061 C  CB  B CYS B 1 90  ? 45.944 37.061  43.969  0.35 15.99  ? 113 CYS B CB  1 
ATOM   3062 C  CB  C CYS B 1 90  ? 46.041 37.063  43.967  0.17 16.03  ? 113 CYS B CB  1 
ATOM   3063 S  SG  A CYS B 1 90  ? 47.709 36.845  44.119  0.47 22.24  ? 113 CYS B SG  1 
ATOM   3064 S  SG  B CYS B 1 90  ? 47.716 36.863  44.126  0.35 22.15  ? 113 CYS B SG  1 
ATOM   3065 S  SG  C CYS B 1 90  ? 45.987 35.473  43.152  0.17 22.24  ? 113 CYS B SG  1 
ATOM   3066 N  N   . VAL B 1 91  ? 46.002 38.313  47.248  1.00 11.06  ? 114 VAL B N   1 
ATOM   3067 C  CA  . VAL B 1 91  ? 46.407 39.491  48.023  1.00 8.38   ? 114 VAL B CA  1 
ATOM   3068 C  C   . VAL B 1 91  ? 47.912 39.692  47.935  1.00 14.44  ? 114 VAL B C   1 
ATOM   3069 O  O   . VAL B 1 91  ? 48.687 38.821  48.343  1.00 14.77  ? 114 VAL B O   1 
ATOM   3070 C  CB  . VAL B 1 91  ? 46.026 39.330  49.521  1.00 9.79   ? 114 VAL B CB  1 
ATOM   3071 C  CG1 . VAL B 1 91  ? 46.621 40.452  50.368  1.00 11.97  ? 114 VAL B CG1 1 
ATOM   3072 C  CG2 . VAL B 1 91  ? 44.517 39.278  49.685  1.00 10.74  ? 114 VAL B CG2 1 
ATOM   3073 N  N   . THR B 1 92  ? 48.338 40.836  47.399  1.00 9.71   ? 115 THR B N   1 
ATOM   3074 C  CA  . THR B 1 92  ? 49.758 41.138  47.359  1.00 8.80   ? 115 THR B CA  1 
ATOM   3075 C  C   . THR B 1 92  ? 50.093 42.274  48.314  1.00 10.36  ? 115 THR B C   1 
ATOM   3076 O  O   . THR B 1 92  ? 49.491 43.347  48.252  1.00 9.92   ? 115 THR B O   1 
ATOM   3077 C  CB  . THR B 1 92  ? 50.241 41.482  45.947  1.00 12.08  ? 115 THR B CB  1 
ATOM   3078 O  OG1 . THR B 1 92  ? 49.969 40.380  45.075  1.00 13.48  ? 115 THR B OG1 1 
ATOM   3079 C  CG2 . THR B 1 92  ? 51.745 41.727  45.952  1.00 10.57  ? 115 THR B CG2 1 
ATOM   3080 N  N   . LEU B 1 93  ? 51.051 42.025  49.200  1.00 9.76   ? 116 LEU B N   1 
ATOM   3081 C  CA  . LEU B 1 93  ? 51.489 43.030  50.162  1.00 12.72  ? 116 LEU B CA  1 
ATOM   3082 C  C   . LEU B 1 93  ? 52.743 43.721  49.650  1.00 7.90   ? 116 LEU B C   1 
ATOM   3083 O  O   . LEU B 1 93  ? 53.728 43.060  49.314  1.00 8.62   ? 116 LEU B O   1 
ATOM   3084 C  CB  . LEU B 1 93  ? 51.767 42.386  51.527  1.00 9.60   ? 116 LEU B CB  1 
ATOM   3085 C  CG  . LEU B 1 93  ? 50.665 41.481  52.076  1.00 11.36  ? 116 LEU B CG  1 
ATOM   3086 C  CD1 . LEU B 1 93  ? 51.084 40.875  53.434  1.00 11.62  ? 116 LEU B CD1 1 
ATOM   3087 C  CD2 . LEU B 1 93  ? 49.359 42.251  52.213  1.00 9.15   ? 116 LEU B CD2 1 
ATOM   3088 N  N   . GLY B 1 94  ? 52.698 45.052  49.567  1.00 8.50   ? 117 GLY B N   1 
ATOM   3089 C  CA  . GLY B 1 94  ? 53.852 45.831  49.141  1.00 7.12   ? 117 GLY B CA  1 
ATOM   3090 C  C   . GLY B 1 94  ? 54.595 46.385  50.345  1.00 8.25   ? 117 GLY B C   1 
ATOM   3091 O  O   . GLY B 1 94  ? 54.111 46.267  51.467  1.00 10.00  ? 117 GLY B O   1 
ATOM   3092 N  N   . GLY B 1 95  ? 55.741 47.023  50.117  1.00 7.82   ? 118 GLY B N   1 
ATOM   3093 C  CA  . GLY B 1 95  ? 56.264 47.237  48.779  1.00 7.47   ? 118 GLY B CA  1 
ATOM   3094 C  C   . GLY B 1 95  ? 55.664 48.460  48.090  1.00 9.56   ? 118 GLY B C   1 
ATOM   3095 O  O   . GLY B 1 95  ? 54.531 48.861  48.387  1.00 9.82   ? 118 GLY B O   1 
ATOM   3096 N  N   . ASP B 1 96  ? 56.418 49.054  47.174  1.00 7.88   ? 119 ASP B N   1 
ATOM   3097 C  CA  . ASP B 1 96  ? 55.944 50.239  46.470  1.00 8.69   ? 119 ASP B CA  1 
ATOM   3098 C  C   . ASP B 1 96  ? 54.970 49.893  45.345  1.00 10.42  ? 119 ASP B C   1 
ATOM   3099 O  O   . ASP B 1 96  ? 54.891 48.740  44.912  1.00 9.76   ? 119 ASP B O   1 
ATOM   3100 C  CB  . ASP B 1 96  ? 57.117 51.103  45.962  1.00 9.23   ? 119 ASP B CB  1 
ATOM   3101 C  CG  . ASP B 1 96  ? 57.869 50.474  44.801  1.00 11.90  ? 119 ASP B CG  1 
ATOM   3102 O  OD1 . ASP B 1 96  ? 57.330 50.434  43.677  1.00 14.16  ? 119 ASP B OD1 1 
ATOM   3103 O  OD2 . ASP B 1 96  ? 59.025 50.050  45.000  1.00 12.03  ? 119 ASP B OD2 1 
ATOM   3104 N  N   . HIS B 1 97  ? 54.244 50.897  44.856  1.00 8.89   ? 120 HIS B N   1 
ATOM   3105 C  CA  . HIS B 1 97  ? 53.144 50.658  43.921  1.00 6.31   ? 120 HIS B CA  1 
ATOM   3106 C  C   . HIS B 1 97  ? 53.581 50.222  42.519  1.00 7.90   ? 120 HIS B C   1 
ATOM   3107 O  O   . HIS B 1 97  ? 52.734 49.877  41.692  1.00 9.27   ? 120 HIS B O   1 
ATOM   3108 C  CB  . HIS B 1 97  ? 52.232 51.889  43.820  1.00 8.82   ? 120 HIS B CB  1 
ATOM   3109 C  CG  . HIS B 1 97  ? 50.767 51.553  43.738  1.00 8.61   ? 120 HIS B CG  1 
ATOM   3110 N  ND1 . HIS B 1 97  ? 49.786 52.426  44.120  1.00 5.52   ? 120 HIS B ND1 1 
ATOM   3111 C  CD2 . HIS B 1 97  ? 50.147 50.413  43.338  1.00 6.26   ? 120 HIS B CD2 1 
ATOM   3112 C  CE1 . HIS B 1 97  ? 48.599 51.845  43.961  1.00 9.60   ? 120 HIS B CE1 1 
ATOM   3113 N  NE2 . HIS B 1 97  ? 48.787 50.639  43.488  1.00 8.42   ? 120 HIS B NE2 1 
ATOM   3114 N  N   . SER B 1 98  ? 54.878 50.224  42.230  1.00 6.36   ? 121 SER B N   1 
ATOM   3115 C  CA  . SER B 1 98  ? 55.298 49.693  40.929  1.00 7.27   ? 121 SER B CA  1 
ATOM   3116 C  C   . SER B 1 98  ? 54.957 48.195  40.794  1.00 8.91   ? 121 SER B C   1 
ATOM   3117 O  O   . SER B 1 98  ? 54.926 47.661  39.689  1.00 11.78  ? 121 SER B O   1 
ATOM   3118 C  CB  . SER B 1 98  ? 56.785 49.931  40.664  1.00 11.58  ? 121 SER B CB  1 
ATOM   3119 O  OG  . SER B 1 98  ? 57.590 49.113  41.480  1.00 11.35  ? 121 SER B OG  1 
ATOM   3120 N  N   A LEU B 1 99  ? 54.689 47.528  41.914  0.91 7.59   ? 122 LEU B N   1 
ATOM   3121 C  CA  A LEU B 1 99  ? 54.360 46.107  41.883  0.91 7.86   ? 122 LEU B CA  1 
ATOM   3122 C  C   A LEU B 1 99  ? 53.014 45.842  41.209  0.91 10.63  ? 122 LEU B C   1 
ATOM   3123 O  O   A LEU B 1 99  ? 52.722 44.707  40.815  0.91 8.76   ? 122 LEU B O   1 
ATOM   3124 C  CB  A LEU B 1 99  ? 54.393 45.514  43.293  0.91 9.54   ? 122 LEU B CB  1 
ATOM   3125 C  CG  A LEU B 1 99  ? 53.375 45.953  44.344  0.91 17.07  ? 122 LEU B CG  1 
ATOM   3126 C  CD1 A LEU B 1 99  ? 52.051 45.194  44.238  0.91 17.74  ? 122 LEU B CD1 1 
ATOM   3127 C  CD2 A LEU B 1 99  ? 53.976 45.788  45.751  0.91 10.51  ? 122 LEU B CD2 1 
ATOM   3128 N  N   . ALA B 1 100 ? 52.184 46.879  41.087  1.00 9.83   ? 123 ALA B N   1 
ATOM   3129 C  CA  . ALA B 1 100 ? 50.899 46.724  40.401  1.00 10.39  ? 123 ALA B CA  1 
ATOM   3130 C  C   . ALA B 1 100 ? 51.082 46.367  38.936  1.00 8.75   ? 123 ALA B C   1 
ATOM   3131 O  O   . ALA B 1 100 ? 50.173 45.816  38.311  1.00 9.08   ? 123 ALA B O   1 
ATOM   3132 C  CB  . ALA B 1 100 ? 50.051 47.984  40.527  1.00 8.58   ? 123 ALA B CB  1 
ATOM   3133 N  N   . ILE B 1 101 ? 52.232 46.713  38.366  1.00 7.15   ? 124 ILE B N   1 
ATOM   3134 C  CA  . ILE B 1 101 ? 52.521 46.290  36.998  1.00 7.73   ? 124 ILE B CA  1 
ATOM   3135 C  C   . ILE B 1 101 ? 52.478 44.772  36.940  1.00 14.04  ? 124 ILE B C   1 
ATOM   3136 O  O   . ILE B 1 101 ? 51.786 44.181  36.102  1.00 11.43  ? 124 ILE B O   1 
ATOM   3137 C  CB  . ILE B 1 101 ? 53.889 46.790  36.539  1.00 12.28  ? 124 ILE B CB  1 
ATOM   3138 C  CG1 . ILE B 1 101 ? 53.878 48.320  36.443  1.00 12.39  ? 124 ILE B CG1 1 
ATOM   3139 C  CG2 . ILE B 1 101 ? 54.231 46.201  35.176  1.00 16.35  ? 124 ILE B CG2 1 
ATOM   3140 C  CD1 . ILE B 1 101 ? 55.263 48.929  36.239  1.00 11.84  ? 124 ILE B CD1 1 
ATOM   3141 N  N   . GLY B 1 102 ? 53.164 44.138  37.881  1.00 9.95   ? 125 GLY B N   1 
ATOM   3142 C  CA  . GLY B 1 102 ? 53.181 42.688  37.930  1.00 10.90  ? 125 GLY B CA  1 
ATOM   3143 C  C   . GLY B 1 102 ? 51.874 42.046  38.370  1.00 11.24  ? 125 GLY B C   1 
ATOM   3144 O  O   . GLY B 1 102 ? 51.425 41.066  37.766  1.00 12.47  ? 125 GLY B O   1 
ATOM   3145 N  N   . THR B 1 103 ? 51.239 42.574  39.408  1.00 8.37   ? 126 THR B N   1 
ATOM   3146 C  CA  . THR B 1 103 ? 50.016 41.926  39.877  1.00 7.07   ? 126 THR B CA  1 
ATOM   3147 C  C   . THR B 1 103 ? 48.897 42.030  38.851  1.00 9.34   ? 126 THR B C   1 
ATOM   3148 O  O   . THR B 1 103 ? 48.152 41.076  38.633  1.00 9.68   ? 126 THR B O   1 
ATOM   3149 C  CB  . THR B 1 103 ? 49.539 42.425  41.250  1.00 7.44   ? 126 THR B CB  1 
ATOM   3150 O  OG1 . THR B 1 103 ? 49.136 43.801  41.163  1.00 10.16  ? 126 THR B OG1 1 
ATOM   3151 C  CG2 . THR B 1 103 ? 50.650 42.261  42.288  1.00 9.72   ? 126 THR B CG2 1 
ATOM   3152 N  N   . ILE B 1 104 ? 48.765 43.185  38.221  1.00 9.64   ? 127 ILE B N   1 
ATOM   3153 C  CA  . ILE B 1 104 ? 47.693 43.341  37.254  1.00 9.91   ? 127 ILE B CA  1 
ATOM   3154 C  C   . ILE B 1 104 ? 47.976 42.534  35.974  1.00 9.40   ? 127 ILE B C   1 
ATOM   3155 O  O   . ILE B 1 104 ? 47.077 41.881  35.423  1.00 10.96  ? 127 ILE B O   1 
ATOM   3156 C  CB  . ILE B 1 104 ? 47.419 44.831  36.965  1.00 8.38   ? 127 ILE B CB  1 
ATOM   3157 C  CG1 . ILE B 1 104 ? 46.839 45.489  38.221  1.00 10.54  ? 127 ILE B CG1 1 
ATOM   3158 C  CG2 . ILE B 1 104 ? 46.440 44.962  35.838  1.00 9.43   ? 127 ILE B CG2 1 
ATOM   3159 C  CD1 . ILE B 1 104 ? 46.682 47.022  38.136  1.00 11.02  ? 127 ILE B CD1 1 
ATOM   3160 N  N   . SER B 1 105 ? 49.227 42.549  35.533  1.00 8.81   ? 128 SER B N   1 
ATOM   3161 C  CA  . SER B 1 105 ? 49.620 41.761  34.366  1.00 14.26  ? 128 SER B CA  1 
ATOM   3162 C  C   . SER B 1 105 ? 49.345 40.283  34.591  1.00 17.47  ? 128 SER B C   1 
ATOM   3163 O  O   . SER B 1 105 ? 48.747 39.615  33.743  1.00 13.81  ? 128 SER B O   1 
ATOM   3164 C  CB  . SER B 1 105 ? 51.092 41.982  34.027  1.00 11.93  ? 128 SER B CB  1 
ATOM   3165 O  OG  . SER B 1 105 ? 51.284 43.290  33.530  1.00 14.37  ? 128 SER B OG  1 
ATOM   3166 N  N   . GLY B 1 106 ? 49.774 39.781  35.745  1.00 13.36  ? 129 GLY B N   1 
ATOM   3167 C  CA  . GLY B 1 106 ? 49.552 38.389  36.093  1.00 11.61  ? 129 GLY B CA  1 
ATOM   3168 C  C   . GLY B 1 106 ? 48.080 38.046  36.230  1.00 15.38  ? 129 GLY B C   1 
ATOM   3169 O  O   . GLY B 1 106 ? 47.630 36.994  35.764  1.00 14.50  ? 129 GLY B O   1 
ATOM   3170 N  N   . HIS B 1 107 ? 47.324 38.941  36.864  1.00 10.00  ? 130 HIS B N   1 
ATOM   3171 C  CA  . HIS B 1 107 ? 45.889 38.773  37.056  1.00 9.85   ? 130 HIS B CA  1 
ATOM   3172 C  C   . HIS B 1 107 ? 45.185 38.709  35.707  1.00 9.53   ? 130 HIS B C   1 
ATOM   3173 O  O   . HIS B 1 107 ? 44.298 37.880  35.485  1.00 14.52  ? 130 HIS B O   1 
ATOM   3174 C  CB  . HIS B 1 107 ? 45.348 39.961  37.863  1.00 12.99  ? 130 HIS B CB  1 
ATOM   3175 C  CG  . HIS B 1 107 ? 43.954 39.777  38.376  1.00 10.92  ? 130 HIS B CG  1 
ATOM   3176 N  ND1 . HIS B 1 107 ? 43.289 40.771  39.073  1.00 11.86  ? 130 HIS B ND1 1 
ATOM   3177 C  CD2 . HIS B 1 107 ? 43.102 38.729  38.312  1.00 12.39  ? 130 HIS B CD2 1 
ATOM   3178 C  CE1 . HIS B 1 107 ? 42.089 40.340  39.406  1.00 14.67  ? 130 HIS B CE1 1 
ATOM   3179 N  NE2 . HIS B 1 107 ? 41.942 39.104  38.961  1.00 13.80  ? 130 HIS B NE2 1 
ATOM   3180 N  N   . ALA B 1 108 ? 45.582 39.596  34.805  1.00 9.30   ? 131 ALA B N   1 
ATOM   3181 C  CA  . ALA B 1 108 ? 44.936 39.705  33.498  1.00 13.00  ? 131 ALA B CA  1 
ATOM   3182 C  C   . ALA B 1 108 ? 45.157 38.473  32.622  1.00 17.58  ? 131 ALA B C   1 
ATOM   3183 O  O   . ALA B 1 108 ? 44.418 38.257  31.659  1.00 14.94  ? 131 ALA B O   1 
ATOM   3184 C  CB  . ALA B 1 108 ? 45.427 40.961  32.767  1.00 12.80  ? 131 ALA B CB  1 
ATOM   3185 N  N   . ARG B 1 109 ? 46.182 37.677  32.923  1.00 17.63  ? 132 ARG B N   1 
ATOM   3186 C  CA  . ARG B 1 109 ? 46.444 36.498  32.090  1.00 15.40  ? 132 ARG B CA  1 
ATOM   3187 C  C   . ARG B 1 109 ? 45.293 35.506  32.058  1.00 22.74  ? 132 ARG B C   1 
ATOM   3188 O  O   . ARG B 1 109 ? 44.997 34.931  31.012  1.00 22.95  ? 132 ARG B O   1 
ATOM   3189 C  CB  . ARG B 1 109 ? 47.727 35.803  32.525  1.00 19.80  ? 132 ARG B CB  1 
ATOM   3190 C  CG  . ARG B 1 109 ? 48.947 36.507  31.988  1.00 23.10  ? 132 ARG B CG  1 
ATOM   3191 C  CD  . ARG B 1 109 ? 50.222 35.974  32.575  1.00 27.57  ? 132 ARG B CD  1 
ATOM   3192 N  NE  . ARG B 1 109 ? 51.303 36.907  32.293  1.00 28.04  ? 132 ARG B NE  1 
ATOM   3193 C  CZ  . ARG B 1 109 ? 52.507 36.854  32.843  1.00 28.93  ? 132 ARG B CZ  1 
ATOM   3194 N  NH1 . ARG B 1 109 ? 53.415 37.758  32.513  1.00 27.55  ? 132 ARG B NH1 1 
ATOM   3195 N  NH2 . ARG B 1 109 ? 52.803 35.904  33.719  1.00 26.67  ? 132 ARG B NH2 1 
ATOM   3196 N  N   . HIS B 1 110 ? 44.649 35.305  33.198  1.00 15.73  ? 133 HIS B N   1 
ATOM   3197 C  CA  . HIS B 1 110 ? 43.514 34.390  33.281  1.00 25.17  ? 133 HIS B CA  1 
ATOM   3198 C  C   . HIS B 1 110 ? 42.188 35.130  33.369  1.00 22.70  ? 133 HIS B C   1 
ATOM   3199 O  O   . HIS B 1 110 ? 41.120 34.539  33.197  1.00 19.50  ? 133 HIS B O   1 
ATOM   3200 C  CB  . HIS B 1 110 ? 43.702 33.408  34.438  1.00 19.27  ? 133 HIS B CB  1 
ATOM   3201 C  CG  . HIS B 1 110 ? 44.940 32.578  34.300  1.00 24.41  ? 133 HIS B CG  1 
ATOM   3202 N  ND1 . HIS B 1 110 ? 45.027 31.521  33.422  1.00 32.20  ? 133 HIS B ND1 1 
ATOM   3203 C  CD2 . HIS B 1 110 ? 46.158 32.689  34.884  1.00 27.27  ? 133 HIS B CD2 1 
ATOM   3204 C  CE1 . HIS B 1 110 ? 46.242 30.998  33.488  1.00 37.14  ? 133 HIS B CE1 1 
ATOM   3205 N  NE2 . HIS B 1 110 ? 46.945 31.690  34.361  1.00 23.63  ? 133 HIS B NE2 1 
ATOM   3206 N  N   A CYS B 1 111 ? 42.260 36.421  33.679  1.00 13.46  ? 134 CYS B N   1 
ATOM   3207 C  CA  A CYS B 1 111 ? 41.047 37.224  33.810  1.00 15.75  ? 134 CYS B CA  1 
ATOM   3208 C  C   A CYS B 1 111 ? 41.167 38.449  32.928  1.00 18.67  ? 134 CYS B C   1 
ATOM   3209 O  O   A CYS B 1 111 ? 41.287 39.567  33.431  1.00 13.88  ? 134 CYS B O   1 
ATOM   3210 C  CB  A CYS B 1 111 ? 40.836 37.648  35.264  1.00 16.51  ? 134 CYS B CB  1 
ATOM   3211 S  SG  A CYS B 1 111 ? 40.879 36.319  36.474  1.00 26.42  ? 134 CYS B SG  1 
ATOM   3212 N  N   . PRO B 1 112 ? 41.110 38.250  31.604  1.00 17.16  ? 135 PRO B N   1 
ATOM   3213 C  CA  . PRO B 1 112 ? 41.411 39.379  30.713  1.00 16.80  ? 135 PRO B CA  1 
ATOM   3214 C  C   . PRO B 1 112 ? 40.390 40.521  30.766  1.00 12.96  ? 135 PRO B C   1 
ATOM   3215 O  O   . PRO B 1 112 ? 40.725 41.646  30.387  1.00 16.78  ? 135 PRO B O   1 
ATOM   3216 C  CB  . PRO B 1 112 ? 41.473 38.726  29.317  1.00 22.93  ? 135 PRO B CB  1 
ATOM   3217 C  CG  . PRO B 1 112 ? 40.672 37.471  29.448  1.00 26.82  ? 135 PRO B CG  1 
ATOM   3218 C  CD  . PRO B 1 112 ? 40.851 37.000  30.863  1.00 16.40  ? 135 PRO B CD  1 
ATOM   3219 N  N   . ASP B 1 113 ? 39.179 40.257  31.239  1.00 8.63   ? 136 ASP B N   1 
ATOM   3220 C  CA  . ASP B 1 113 ? 38.173 41.314  31.330  1.00 12.08  ? 136 ASP B CA  1 
ATOM   3221 C  C   . ASP B 1 113 ? 38.124 41.926  32.737  1.00 12.40  ? 136 ASP B C   1 
ATOM   3222 O  O   . ASP B 1 113 ? 37.093 42.456  33.149  1.00 8.36   ? 136 ASP B O   1 
ATOM   3223 C  CB  . ASP B 1 113 ? 36.789 40.810  30.917  1.00 12.49  ? 136 ASP B CB  1 
ATOM   3224 C  CG  . ASP B 1 113 ? 35.813 41.947  30.622  1.00 17.17  ? 136 ASP B CG  1 
ATOM   3225 O  OD1 . ASP B 1 113 ? 36.260 43.051  30.227  1.00 14.99  ? 136 ASP B OD1 1 
ATOM   3226 O  OD2 . ASP B 1 113 ? 34.597 41.747  30.806  1.00 14.23  ? 136 ASP B OD2 1 
ATOM   3227 N  N   . LEU B 1 114 ? 39.221 41.817  33.488  1.00 11.43  ? 137 LEU B N   1 
ATOM   3228 C  CA  . LEU B 1 114 ? 39.252 42.400  34.835  1.00 9.63   ? 137 LEU B CA  1 
ATOM   3229 C  C   . LEU B 1 114 ? 39.077 43.925  34.775  1.00 13.38  ? 137 LEU B C   1 
ATOM   3230 O  O   . LEU B 1 114 ? 39.399 44.568  33.772  1.00 11.79  ? 137 LEU B O   1 
ATOM   3231 C  CB  . LEU B 1 114 ? 40.543 42.022  35.600  1.00 7.37   ? 137 LEU B CB  1 
ATOM   3232 C  CG  . LEU B 1 114 ? 41.885 42.666  35.205  1.00 14.96  ? 137 LEU B CG  1 
ATOM   3233 C  CD1 . LEU B 1 114 ? 42.054 44.104  35.692  1.00 20.16  ? 137 LEU B CD1 1 
ATOM   3234 C  CD2 . LEU B 1 114 ? 43.053 41.859  35.731  1.00 16.12  ? 137 LEU B CD2 1 
ATOM   3235 N  N   . CYS B 1 115 ? 38.594 44.495  35.868  1.00 9.85   ? 138 CYS B N   1 
ATOM   3236 C  CA  . CYS B 1 115 ? 38.561 45.944  36.005  1.00 9.23   ? 138 CYS B CA  1 
ATOM   3237 C  C   . CYS B 1 115 ? 39.360 46.316  37.235  1.00 12.31  ? 138 CYS B C   1 
ATOM   3238 O  O   . CYS B 1 115 ? 39.650 45.456  38.072  1.00 9.85   ? 138 CYS B O   1 
ATOM   3239 C  CB  . CYS B 1 115 ? 37.128 46.454  36.105  1.00 8.74   ? 138 CYS B CB  1 
ATOM   3240 S  SG  . CYS B 1 115 ? 36.179 45.822  37.498  1.00 12.44  ? 138 CYS B SG  1 
ATOM   3241 N  N   . VAL B 1 116 ? 39.728 47.592  37.333  1.00 8.26   ? 139 VAL B N   1 
ATOM   3242 C  CA  . VAL B 1 116 ? 40.634 48.029  38.382  1.00 7.24   ? 139 VAL B CA  1 
ATOM   3243 C  C   . VAL B 1 116 ? 40.009 49.168  39.164  1.00 8.90   ? 139 VAL B C   1 
ATOM   3244 O  O   . VAL B 1 116 ? 39.542 50.140  38.575  1.00 9.97   ? 139 VAL B O   1 
ATOM   3245 C  CB  . VAL B 1 116 ? 41.985 48.498  37.797  1.00 8.20   ? 139 VAL B CB  1 
ATOM   3246 C  CG1 . VAL B 1 116 ? 42.896 49.020  38.911  1.00 8.94   ? 139 VAL B CG1 1 
ATOM   3247 C  CG2 . VAL B 1 116 ? 42.667 47.349  37.050  1.00 8.33   ? 139 VAL B CG2 1 
ATOM   3248 N  N   . VAL B 1 117 ? 39.980 49.030  40.488  1.00 5.87   ? 140 VAL B N   1 
ATOM   3249 C  CA  . VAL B 1 117 ? 39.624 50.137  41.361  1.00 8.10   ? 140 VAL B CA  1 
ATOM   3250 C  C   . VAL B 1 117 ? 40.932 50.553  42.022  1.00 10.77  ? 140 VAL B C   1 
ATOM   3251 O  O   . VAL B 1 117 ? 41.566 49.764  42.716  1.00 7.70   ? 140 VAL B O   1 
ATOM   3252 C  CB  . VAL B 1 117 ? 38.536 49.753  42.397  1.00 13.42  ? 140 VAL B CB  1 
ATOM   3253 C  CG1 . VAL B 1 117 ? 38.253 50.906  43.363  1.00 9.07   ? 140 VAL B CG1 1 
ATOM   3254 C  CG2 . VAL B 1 117 ? 37.243 49.343  41.686  1.00 10.88  ? 140 VAL B CG2 1 
ATOM   3255 N  N   . TRP B 1 118 ? 41.367 51.776  41.731  1.00 8.12   ? 141 TRP B N   1 
ATOM   3256 C  CA  . TRP B 1 118 ? 42.682 52.261  42.144  1.00 7.15   ? 141 TRP B CA  1 
ATOM   3257 C  C   . TRP B 1 118 ? 42.484 53.314  43.235  1.00 9.67   ? 141 TRP B C   1 
ATOM   3258 O  O   . TRP B 1 118 ? 42.058 54.434  42.947  1.00 9.47   ? 141 TRP B O   1 
ATOM   3259 C  CB  . TRP B 1 118 ? 43.419 52.852  40.933  1.00 6.17   ? 141 TRP B CB  1 
ATOM   3260 C  CG  . TRP B 1 118 ? 44.885 53.059  41.155  1.00 6.20   ? 141 TRP B CG  1 
ATOM   3261 C  CD1 . TRP B 1 118 ? 45.471 54.088  41.850  1.00 5.95   ? 141 TRP B CD1 1 
ATOM   3262 C  CD2 . TRP B 1 118 ? 45.958 52.235  40.674  1.00 8.86   ? 141 TRP B CD2 1 
ATOM   3263 N  NE1 . TRP B 1 118 ? 46.836 53.948  41.828  1.00 6.89   ? 141 TRP B NE1 1 
ATOM   3264 C  CE2 . TRP B 1 118 ? 47.160 52.816  41.133  1.00 8.06   ? 141 TRP B CE2 1 
ATOM   3265 C  CE3 . TRP B 1 118 ? 46.016 51.066  39.910  1.00 8.17   ? 141 TRP B CE3 1 
ATOM   3266 C  CZ2 . TRP B 1 118 ? 48.413 52.268  40.827  1.00 10.32  ? 141 TRP B CZ2 1 
ATOM   3267 C  CZ3 . TRP B 1 118 ? 47.260 50.517  39.626  1.00 6.49   ? 141 TRP B CZ3 1 
ATOM   3268 C  CH2 . TRP B 1 118 ? 48.441 51.115  40.083  1.00 10.45  ? 141 TRP B CH2 1 
ATOM   3269 N  N   . VAL B 1 119 ? 42.763 52.943  44.483  1.00 9.11   ? 142 VAL B N   1 
ATOM   3270 C  CA  . VAL B 1 119 ? 42.481 53.811  45.636  1.00 5.61   ? 142 VAL B CA  1 
ATOM   3271 C  C   . VAL B 1 119 ? 43.786 54.419  46.105  1.00 9.00   ? 142 VAL B C   1 
ATOM   3272 O  O   . VAL B 1 119 ? 44.687 53.707  46.528  1.00 7.97   ? 142 VAL B O   1 
ATOM   3273 C  CB  . VAL B 1 119 ? 41.800 53.036  46.781  1.00 8.77   ? 142 VAL B CB  1 
ATOM   3274 C  CG1 . VAL B 1 119 ? 41.473 53.976  47.944  1.00 8.69   ? 142 VAL B CG1 1 
ATOM   3275 C  CG2 . VAL B 1 119 ? 40.523 52.363  46.278  1.00 9.61   ? 142 VAL B CG2 1 
ATOM   3276 N  N   . ASP B 1 120 ? 43.911 55.736  45.983  1.00 8.25   ? 143 ASP B N   1 
ATOM   3277 C  CA  . ASP B 1 120 ? 45.238 56.348  46.018  1.00 6.52   ? 143 ASP B CA  1 
ATOM   3278 C  C   . ASP B 1 120 ? 45.082 57.849  46.108  1.00 6.61   ? 143 ASP B C   1 
ATOM   3279 O  O   . ASP B 1 120 ? 44.109 58.386  45.586  1.00 5.43   ? 143 ASP B O   1 
ATOM   3280 C  CB  . ASP B 1 120 ? 46.001 55.962  44.724  1.00 9.22   ? 143 ASP B CB  1 
ATOM   3281 C  CG  . ASP B 1 120 ? 47.521 56.018  44.865  1.00 11.13  ? 143 ASP B CG  1 
ATOM   3282 O  OD1 . ASP B 1 120 ? 48.064 56.952  45.518  1.00 8.75   ? 143 ASP B OD1 1 
ATOM   3283 O  OD2 . ASP B 1 120 ? 48.206 55.111  44.304  1.00 7.75   ? 143 ASP B OD2 1 
ATOM   3284 N  N   . ALA B 1 121 ? 46.036 58.524  46.749  1.00 8.11   ? 144 ALA B N   1 
ATOM   3285 C  CA  . ALA B 1 121 ? 46.126 59.988  46.685  1.00 11.20  ? 144 ALA B CA  1 
ATOM   3286 C  C   . ALA B 1 121 ? 46.573 60.448  45.291  1.00 13.17  ? 144 ALA B C   1 
ATOM   3287 O  O   . ALA B 1 121 ? 46.316 61.586  44.870  1.00 8.79   ? 144 ALA B O   1 
ATOM   3288 C  CB  . ALA B 1 121 ? 47.125 60.507  47.752  1.00 7.31   ? 144 ALA B CB  1 
ATOM   3289 N  N   . HIS B 1 122 ? 47.231 59.542  44.573  1.00 9.59   ? 145 HIS B N   1 
ATOM   3290 C  CA  . HIS B 1 122 ? 47.910 59.853  43.314  1.00 8.82   ? 145 HIS B CA  1 
ATOM   3291 C  C   . HIS B 1 122 ? 47.363 59.000  42.188  1.00 11.68  ? 145 HIS B C   1 
ATOM   3292 O  O   . HIS B 1 122 ? 46.823 57.926  42.435  1.00 9.64   ? 145 HIS B O   1 
ATOM   3293 C  CB  . HIS B 1 122 ? 49.393 59.541  43.440  1.00 7.85   ? 145 HIS B CB  1 
ATOM   3294 C  CG  . HIS B 1 122 ? 50.021 60.147  44.651  1.00 11.85  ? 145 HIS B CG  1 
ATOM   3295 N  ND1 . HIS B 1 122 ? 50.176 59.443  45.825  1.00 9.72   ? 145 HIS B ND1 1 
ATOM   3296 C  CD2 . HIS B 1 122 ? 50.534 61.380  44.870  1.00 10.48  ? 145 HIS B CD2 1 
ATOM   3297 C  CE1 . HIS B 1 122 ? 50.750 60.222  46.726  1.00 10.56  ? 145 HIS B CE1 1 
ATOM   3298 N  NE2 . HIS B 1 122 ? 50.981 61.400  46.176  1.00 8.28   ? 145 HIS B NE2 1 
ATOM   3299 N  N   . ALA B 1 123 ? 47.522 59.468  40.954  1.00 7.38   ? 146 ALA B N   1 
ATOM   3300 C  CA  . ALA B 1 123 ? 47.001 58.741  39.802  1.00 9.59   ? 146 ALA B CA  1 
ATOM   3301 C  C   . ALA B 1 123 ? 47.976 57.689  39.267  1.00 11.31  ? 146 ALA B C   1 
ATOM   3302 O  O   . ALA B 1 123 ? 47.567 56.777  38.538  1.00 10.83  ? 146 ALA B O   1 
ATOM   3303 C  CB  . ALA B 1 123 ? 46.585 59.712  38.695  1.00 10.59  ? 146 ALA B CB  1 
ATOM   3304 N  N   . ASP B 1 124 ? 49.254 57.816  39.619  1.00 7.71   ? 147 ASP B N   1 
ATOM   3305 C  CA  . ASP B 1 124 ? 50.278 56.837  39.239  1.00 9.42   ? 147 ASP B CA  1 
ATOM   3306 C  C   . ASP B 1 124 ? 50.260 56.551  37.737  1.00 14.92  ? 147 ASP B C   1 
ATOM   3307 O  O   . ASP B 1 124 ? 50.465 55.418  37.307  1.00 8.90   ? 147 ASP B O   1 
ATOM   3308 C  CB  . ASP B 1 124 ? 50.108 55.535  40.035  1.00 9.39   ? 147 ASP B CB  1 
ATOM   3309 C  CG  . ASP B 1 124 ? 50.301 55.728  41.522  1.00 12.14  ? 147 ASP B CG  1 
ATOM   3310 O  OD1 . ASP B 1 124 ? 50.613 56.866  41.916  1.00 9.34   ? 147 ASP B OD1 1 
ATOM   3311 O  OD2 . ASP B 1 124 ? 50.127 54.745  42.293  1.00 10.76  ? 147 ASP B OD2 1 
ATOM   3312 N  N   . ILE B 1 125 ? 49.996 57.578  36.942  1.00 11.30  ? 148 ILE B N   1 
ATOM   3313 C  CA  . ILE B 1 125 ? 49.780 57.374  35.514  1.00 9.55   ? 148 ILE B CA  1 
ATOM   3314 C  C   . ILE B 1 125 ? 50.731 58.212  34.663  1.00 12.30  ? 148 ILE B C   1 
ATOM   3315 O  O   . ILE B 1 125 ? 50.517 58.390  33.471  1.00 13.22  ? 148 ILE B O   1 
ATOM   3316 C  CB  . ILE B 1 125 ? 48.291 57.619  35.136  1.00 10.83  ? 148 ILE B CB  1 
ATOM   3317 C  CG1 . ILE B 1 125 ? 47.945 56.957  33.789  1.00 10.20  ? 148 ILE B CG1 1 
ATOM   3318 C  CG2 . ILE B 1 125 ? 47.976 59.118  35.151  1.00 10.21  ? 148 ILE B CG2 1 
ATOM   3319 C  CD1 . ILE B 1 125 ? 46.444 56.941  33.480  1.00 10.51  ? 148 ILE B CD1 1 
ATOM   3320 N  N   . ASN B 1 126 ? 51.792 58.730  35.279  1.00 12.68  ? 149 ASN B N   1 
ATOM   3321 C  CA  . ASN B 1 126 ? 52.868 59.307  34.492  1.00 9.61   ? 149 ASN B CA  1 
ATOM   3322 C  C   . ASN B 1 126 ? 53.466 58.254  33.571  1.00 14.61  ? 149 ASN B C   1 
ATOM   3323 O  O   . ASN B 1 126 ? 53.444 57.062  33.883  1.00 9.83   ? 149 ASN B O   1 
ATOM   3324 C  CB  . ASN B 1 126 ? 53.962 59.874  35.384  1.00 11.81  ? 149 ASN B CB  1 
ATOM   3325 C  CG  . ASN B 1 126 ? 53.640 61.260  35.874  1.00 14.57  ? 149 ASN B CG  1 
ATOM   3326 O  OD1 . ASN B 1 126 ? 53.489 62.186  35.075  1.00 14.89  ? 149 ASN B OD1 1 
ATOM   3327 N  ND2 . ASN B 1 126 ? 53.551 61.420  37.187  1.00 12.25  ? 149 ASN B ND2 1 
ATOM   3328 N  N   . THR B 1 127 ? 53.991 58.695  32.435  1.00 12.09  ? 150 THR B N   1 
ATOM   3329 C  CA  . THR B 1 127 ? 54.720 57.810  31.541  1.00 12.25  ? 150 THR B CA  1 
ATOM   3330 C  C   . THR B 1 127 ? 56.190 58.124  31.717  1.00 10.46  ? 150 THR B C   1 
ATOM   3331 O  O   . THR B 1 127 ? 56.534 59.106  32.374  1.00 15.94  ? 150 THR B O   1 
ATOM   3332 C  CB  . THR B 1 127 ? 54.331 58.062  30.069  1.00 17.24  ? 150 THR B CB  1 
ATOM   3333 O  OG1 . THR B 1 127 ? 55.024 59.221  29.600  1.00 15.31  ? 150 THR B OG1 1 
ATOM   3334 C  CG2 . THR B 1 127 ? 52.825 58.249  29.934  1.00 16.12  ? 150 THR B CG2 1 
ATOM   3335 N  N   . PRO B 1 128 ? 57.074 57.301  31.137  1.00 11.89  ? 151 PRO B N   1 
ATOM   3336 C  CA  . PRO B 1 128 ? 58.499 57.639  31.174  1.00 10.43  ? 151 PRO B CA  1 
ATOM   3337 C  C   . PRO B 1 128 ? 58.814 58.999  30.544  1.00 12.08  ? 151 PRO B C   1 
ATOM   3338 O  O   . PRO B 1 128 ? 59.876 59.562  30.817  1.00 13.27  ? 151 PRO B O   1 
ATOM   3339 C  CB  . PRO B 1 128 ? 59.141 56.517  30.354  1.00 11.22  ? 151 PRO B CB  1 
ATOM   3340 C  CG  . PRO B 1 128 ? 58.227 55.351  30.564  1.00 17.03  ? 151 PRO B CG  1 
ATOM   3341 C  CD  . PRO B 1 128 ? 56.845 55.936  30.619  1.00 15.92  ? 151 PRO B CD  1 
ATOM   3342 N  N   . LEU B 1 129 ? 57.897 59.519  29.733  1.00 10.66  ? 152 LEU B N   1 
ATOM   3343 C  CA  . LEU B 1 129 ? 58.095 60.814  29.082  1.00 13.73  ? 152 LEU B CA  1 
ATOM   3344 C  C   . LEU B 1 129 ? 57.473 61.970  29.868  1.00 17.79  ? 152 LEU B C   1 
ATOM   3345 O  O   . LEU B 1 129 ? 57.707 63.137  29.541  1.00 12.56  ? 152 LEU B O   1 
ATOM   3346 C  CB  . LEU B 1 129 ? 57.548 60.785  27.654  1.00 15.10  ? 152 LEU B CB  1 
ATOM   3347 C  CG  . LEU B 1 129 ? 58.186 59.738  26.736  1.00 16.43  ? 152 LEU B CG  1 
ATOM   3348 C  CD1 . LEU B 1 129 ? 57.571 59.791  25.348  1.00 19.44  ? 152 LEU B CD1 1 
ATOM   3349 C  CD2 . LEU B 1 129 ? 59.681 59.971  26.655  1.00 20.46  ? 152 LEU B CD2 1 
ATOM   3350 N  N   . THR B 1 130 ? 56.665 61.660  30.880  1.00 12.54  ? 153 THR B N   1 
ATOM   3351 C  CA  . THR B 1 130 ? 56.037 62.720  31.690  1.00 10.61  ? 153 THR B CA  1 
ATOM   3352 C  C   . THR B 1 130 ? 56.490 62.753  33.149  1.00 16.23  ? 153 THR B C   1 
ATOM   3353 O  O   . THR B 1 130 ? 56.297 63.756  33.836  1.00 13.09  ? 153 THR B O   1 
ATOM   3354 C  CB  . THR B 1 130 ? 54.469 62.670  31.666  1.00 11.20  ? 153 THR B CB  1 
ATOM   3355 O  OG1 . THR B 1 130 ? 53.974 61.564  32.449  1.00 13.12  ? 153 THR B OG1 1 
ATOM   3356 C  CG2 . THR B 1 130 ? 53.945 62.581  30.240  1.00 11.66  ? 153 THR B CG2 1 
ATOM   3357 N  N   . THR B 1 131 ? 57.072 61.665  33.640  1.00 13.39  ? 154 THR B N   1 
ATOM   3358 C  CA  . THR B 1 131 ? 57.469 61.643  35.048  1.00 12.19  ? 154 THR B CA  1 
ATOM   3359 C  C   . THR B 1 131 ? 58.492 62.725  35.356  1.00 10.88  ? 154 THR B C   1 
ATOM   3360 O  O   . THR B 1 131 ? 59.426 62.935  34.581  1.00 10.61  ? 154 THR B O   1 
ATOM   3361 C  CB  . THR B 1 131 ? 58.025 60.280  35.498  1.00 13.80  ? 154 THR B CB  1 
ATOM   3362 O  OG1 . THR B 1 131 ? 58.439 60.360  36.874  1.00 15.74  ? 154 THR B OG1 1 
ATOM   3363 C  CG2 . THR B 1 131 ? 59.207 59.873  34.652  1.00 8.56   ? 154 THR B CG2 1 
ATOM   3364 N  N   . SER B 1 132 ? 58.312 63.412  36.482  1.00 10.18  ? 155 SER B N   1 
ATOM   3365 C  CA  . SER B 1 132 ? 59.275 64.421  36.907  1.00 15.23  ? 155 SER B CA  1 
ATOM   3366 C  C   . SER B 1 132 ? 60.219 63.852  37.953  1.00 17.63  ? 155 SER B C   1 
ATOM   3367 O  O   . SER B 1 132 ? 61.202 64.488  38.313  1.00 13.22  ? 155 SER B O   1 
ATOM   3368 C  CB  . SER B 1 132 ? 58.563 65.663  37.456  1.00 13.42  ? 155 SER B CB  1 
ATOM   3369 O  OG  . SER B 1 132 ? 57.796 65.360  38.601  1.00 17.28  ? 155 SER B OG  1 
ATOM   3370 N  N   . SER B 1 133 ? 59.915 62.647  38.430  1.00 13.90  ? 156 SER B N   1 
ATOM   3371 C  CA  . SER B 1 133 ? 60.685 62.030  39.504  1.00 11.86  ? 156 SER B CA  1 
ATOM   3372 C  C   . SER B 1 133 ? 61.554 60.876  39.007  1.00 16.75  ? 156 SER B C   1 
ATOM   3373 O  O   . SER B 1 133 ? 62.599 60.586  39.584  1.00 14.27  ? 156 SER B O   1 
ATOM   3374 C  CB  . SER B 1 133 ? 59.738 61.515  40.587  1.00 16.16  ? 156 SER B CB  1 
ATOM   3375 O  OG  . SER B 1 133 ? 58.978 60.426  40.091  1.00 12.29  ? 156 SER B OG  1 
ATOM   3376 N  N   . GLY B 1 134 ? 61.109 60.200  37.951  1.00 12.82  ? 157 GLY B N   1 
ATOM   3377 C  CA  . GLY B 1 134 ? 61.796 59.015  37.465  1.00 13.85  ? 157 GLY B CA  1 
ATOM   3378 C  C   . GLY B 1 134 ? 61.416 57.772  38.260  1.00 16.47  ? 157 GLY B C   1 
ATOM   3379 O  O   . GLY B 1 134 ? 61.920 56.678  38.000  1.00 14.29  ? 157 GLY B O   1 
ATOM   3380 N  N   . ASN B 1 135 ? 60.512 57.927  39.223  1.00 11.08  ? 158 ASN B N   1 
ATOM   3381 C  CA  . ASN B 1 135 ? 60.149 56.804  40.098  1.00 9.92   ? 158 ASN B CA  1 
ATOM   3382 C  C   . ASN B 1 135 ? 59.023 55.986  39.502  1.00 11.67  ? 158 ASN B C   1 
ATOM   3383 O  O   . ASN B 1 135 ? 57.923 56.507  39.258  1.00 8.82   ? 158 ASN B O   1 
ATOM   3384 C  CB  . ASN B 1 135 ? 59.770 57.303  41.504  1.00 8.83   ? 158 ASN B CB  1 
ATOM   3385 C  CG  . ASN B 1 135 ? 60.917 58.040  42.182  1.00 15.97  ? 158 ASN B CG  1 
ATOM   3386 O  OD1 . ASN B 1 135 ? 62.075 57.742  41.925  1.00 11.50  ? 158 ASN B OD1 1 
ATOM   3387 N  ND2 . ASN B 1 135 ? 60.601 59.002  43.050  1.00 14.20  ? 158 ASN B ND2 1 
ATOM   3388 N  N   . LEU B 1 136 ? 59.289 54.705  39.266  1.00 11.12  ? 159 LEU B N   1 
ATOM   3389 C  CA  . LEU B 1 136 ? 58.315 53.860  38.578  1.00 8.38   ? 159 LEU B CA  1 
ATOM   3390 C  C   . LEU B 1 136 ? 57.026 53.640  39.364  1.00 8.38   ? 159 LEU B C   1 
ATOM   3391 O  O   . LEU B 1 136 ? 55.998 53.305  38.769  1.00 9.72   ? 159 LEU B O   1 
ATOM   3392 C  CB  . LEU B 1 136 ? 58.952 52.527  38.139  1.00 11.09  ? 159 LEU B CB  1 
ATOM   3393 C  CG  . LEU B 1 136 ? 59.873 52.704  36.929  1.00 13.53  ? 159 LEU B CG  1 
ATOM   3394 C  CD1 . LEU B 1 136 ? 60.840 51.515  36.745  1.00 12.05  ? 159 LEU B CD1 1 
ATOM   3395 C  CD2 . LEU B 1 136 ? 59.036 52.928  35.663  1.00 11.45  ? 159 LEU B CD2 1 
ATOM   3396 N  N   . HIS B 1 137 ? 57.078 53.853  40.659  1.00 7.01   ? 160 HIS B N   1 
ATOM   3397 C  CA  . HIS B 1 137 ? 55.859 53.728  41.431  1.00 7.09   ? 160 HIS B CA  1 
ATOM   3398 C  C   . HIS B 1 137 ? 54.790 54.768  41.112  1.00 6.51   ? 160 HIS B C   1 
ATOM   3399 O  O   . HIS B 1 137 ? 53.668 54.659  41.527  1.00 8.13   ? 160 HIS B O   1 
ATOM   3400 C  CB  . HIS B 1 137 ? 56.082 53.611  42.926  1.00 7.64   ? 160 HIS B CB  1 
ATOM   3401 C  CG  . HIS B 1 137 ? 56.415 54.910  43.603  1.00 8.67   ? 160 HIS B CG  1 
ATOM   3402 N  ND1 . HIS B 1 137 ? 56.146 55.158  44.881  1.00 10.71  ? 160 HIS B ND1 1 
ATOM   3403 C  CD2 . HIS B 1 137 ? 56.983 56.041  43.107  1.00 9.89   ? 160 HIS B CD2 1 
ATOM   3404 C  CE1 . HIS B 1 137 ? 56.556 56.390  45.176  1.00 14.51  ? 160 HIS B CE1 1 
ATOM   3405 N  NE2 . HIS B 1 137 ? 57.050 56.926  44.102  1.00 13.01  ? 160 HIS B NE2 1 
ATOM   3406 N  N   . GLY B 1 138 ? 55.184 55.787  40.396  1.00 10.08  ? 161 GLY B N   1 
ATOM   3407 C  CA  . GLY B 1 138 ? 54.281 56.835  39.952  1.00 9.05   ? 161 GLY B CA  1 
ATOM   3408 C  C   . GLY B 1 138 ? 53.929 56.714  38.482  1.00 9.77   ? 161 GLY B C   1 
ATOM   3409 O  O   . GLY B 1 138 ? 53.287 57.593  37.907  1.00 11.93  ? 161 GLY B O   1 
ATOM   3410 N  N   . GLN B 1 139 ? 54.351 55.609  37.877  1.00 7.49   ? 162 GLN B N   1 
ATOM   3411 C  CA  . GLN B 1 139 ? 54.066 55.326  36.474  1.00 9.01   ? 162 GLN B CA  1 
ATOM   3412 C  C   . GLN B 1 139 ? 53.308 54.021  36.141  1.00 9.64   ? 162 GLN B C   1 
ATOM   3413 O  O   . GLN B 1 139 ? 53.084 53.768  34.961  1.00 9.09   ? 162 GLN B O   1 
ATOM   3414 C  CB  . GLN B 1 139 ? 55.376 55.303  35.682  1.00 9.98   ? 162 GLN B CB  1 
ATOM   3415 C  CG  . GLN B 1 139 ? 56.183 56.585  35.773  1.00 12.13  ? 162 GLN B CG  1 
ATOM   3416 C  CD  . GLN B 1 139 ? 57.565 56.413  35.229  1.00 11.45  ? 162 GLN B CD  1 
ATOM   3417 O  OE1 . GLN B 1 139 ? 57.742 56.135  34.036  1.00 13.00  ? 162 GLN B OE1 1 
ATOM   3418 N  NE2 . GLN B 1 139 ? 58.574 56.564  36.099  1.00 10.69  ? 162 GLN B NE2 1 
ATOM   3419 N  N   . PRO B 1 140 ? 52.924 53.192  37.143  1.00 11.43  ? 163 PRO B N   1 
ATOM   3420 C  CA  . PRO B 1 140 ? 52.528 51.835  36.718  1.00 11.54  ? 163 PRO B CA  1 
ATOM   3421 C  C   . PRO B 1 140 ? 51.330 51.752  35.777  1.00 12.25  ? 163 PRO B C   1 
ATOM   3422 O  O   . PRO B 1 140 ? 51.302 50.888  34.888  1.00 11.32  ? 163 PRO B O   1 
ATOM   3423 C  CB  . PRO B 1 140 ? 52.196 51.129  38.040  1.00 10.10  ? 163 PRO B CB  1 
ATOM   3424 C  CG  . PRO B 1 140 ? 51.805 52.254  38.984  1.00 9.11   ? 163 PRO B CG  1 
ATOM   3425 C  CD  . PRO B 1 140 ? 52.733 53.382  38.598  1.00 9.37   ? 163 PRO B CD  1 
ATOM   3426 N  N   . VAL B 1 141 ? 50.352 52.628  35.952  1.00 7.89   ? 164 VAL B N   1 
ATOM   3427 C  CA  . VAL B 1 141 ? 49.155 52.556  35.124  1.00 7.71   ? 164 VAL B CA  1 
ATOM   3428 C  C   . VAL B 1 141 ? 49.472 52.840  33.652  1.00 14.34  ? 164 VAL B C   1 
ATOM   3429 O  O   . VAL B 1 141 ? 48.806 52.323  32.753  1.00 12.70  ? 164 VAL B O   1 
ATOM   3430 C  CB  . VAL B 1 141 ? 48.040 53.474  35.664  1.00 10.35  ? 164 VAL B CB  1 
ATOM   3431 C  CG1 . VAL B 1 141 ? 46.809 53.468  34.751  1.00 11.48  ? 164 VAL B CG1 1 
ATOM   3432 C  CG2 . VAL B 1 141 ? 47.668 53.043  37.069  1.00 12.42  ? 164 VAL B CG2 1 
ATOM   3433 N  N   . SER B 1 142 ? 50.505 53.642  33.400  1.00 9.71   ? 165 SER B N   1 
ATOM   3434 C  CA  . SER B 1 142 ? 50.856 53.962  32.013  1.00 12.02  ? 165 SER B CA  1 
ATOM   3435 C  C   . SER B 1 142 ? 51.278 52.721  31.231  1.00 12.96  ? 165 SER B C   1 
ATOM   3436 O  O   . SER B 1 142 ? 51.075 52.650  30.016  1.00 16.47  ? 165 SER B O   1 
ATOM   3437 C  CB  . SER B 1 142 ? 51.938 55.040  31.921  1.00 8.64   ? 165 SER B CB  1 
ATOM   3438 O  OG  . SER B 1 142 ? 53.233 54.530  32.174  1.00 13.74  ? 165 SER B OG  1 
ATOM   3439 N  N   . PHE B 1 143 ? 51.853 51.736  31.909  1.00 13.45  ? 166 PHE B N   1 
ATOM   3440 C  CA  . PHE B 1 143 ? 52.298 50.536  31.209  1.00 11.73  ? 166 PHE B CA  1 
ATOM   3441 C  C   . PHE B 1 143 ? 51.172 49.549  30.949  1.00 14.65  ? 166 PHE B C   1 
ATOM   3442 O  O   . PHE B 1 143 ? 51.304 48.652  30.114  1.00 16.47  ? 166 PHE B O   1 
ATOM   3443 C  CB  . PHE B 1 143 ? 53.411 49.856  31.989  1.00 13.70  ? 166 PHE B CB  1 
ATOM   3444 C  CG  . PHE B 1 143 ? 54.594 50.742  32.215  1.00 17.65  ? 166 PHE B CG  1 
ATOM   3445 C  CD1 . PHE B 1 143 ? 55.505 50.976  31.195  1.00 14.07  ? 166 PHE B CD1 1 
ATOM   3446 C  CD2 . PHE B 1 143 ? 54.770 51.378  33.434  1.00 15.62  ? 166 PHE B CD2 1 
ATOM   3447 C  CE1 . PHE B 1 143 ? 56.595 51.815  31.398  1.00 16.41  ? 166 PHE B CE1 1 
ATOM   3448 C  CE2 . PHE B 1 143 ? 55.846 52.214  33.645  1.00 12.62  ? 166 PHE B CE2 1 
ATOM   3449 C  CZ  . PHE B 1 143 ? 56.761 52.437  32.627  1.00 13.49  ? 166 PHE B CZ  1 
ATOM   3450 N  N   . LEU B 1 144 ? 50.052 49.742  31.628  1.00 11.15  ? 167 LEU B N   1 
ATOM   3451 C  CA  . LEU B 1 144 ? 48.966 48.768  31.604  1.00 11.64  ? 167 LEU B CA  1 
ATOM   3452 C  C   . LEU B 1 144 ? 47.814 49.154  30.678  1.00 13.94  ? 167 LEU B C   1 
ATOM   3453 O  O   . LEU B 1 144 ? 47.036 48.294  30.257  1.00 13.18  ? 167 LEU B O   1 
ATOM   3454 C  CB  . LEU B 1 144 ? 48.418 48.575  33.017  1.00 8.78   ? 167 LEU B CB  1 
ATOM   3455 C  CG  . LEU B 1 144 ? 49.417 48.107  34.065  1.00 14.39  ? 167 LEU B CG  1 
ATOM   3456 C  CD1 . LEU B 1 144 ? 48.825 48.253  35.465  1.00 13.76  ? 167 LEU B CD1 1 
ATOM   3457 C  CD2 . LEU B 1 144 ? 49.792 46.664  33.774  1.00 11.63  ? 167 LEU B CD2 1 
ATOM   3458 N  N   . LEU B 1 145 ? 47.680 50.447  30.405  1.00 12.35  ? 168 LEU B N   1 
ATOM   3459 C  CA  . LEU B 1 145 ? 46.528 50.975  29.659  1.00 16.61  ? 168 LEU B CA  1 
ATOM   3460 C  C   . LEU B 1 145 ? 46.741 50.879  28.145  1.00 17.63  ? 168 LEU B C   1 
ATOM   3461 O  O   . LEU B 1 145 ? 47.718 51.411  27.603  1.00 16.39  ? 168 LEU B O   1 
ATOM   3462 C  CB  . LEU B 1 145 ? 46.282 52.445  30.030  1.00 14.23  ? 168 LEU B CB  1 
ATOM   3463 C  CG  . LEU B 1 145 ? 45.541 52.753  31.336  1.00 23.38  ? 168 LEU B CG  1 
ATOM   3464 C  CD1 . LEU B 1 145 ? 45.073 54.190  31.343  1.00 26.56  ? 168 LEU B CD1 1 
ATOM   3465 C  CD2 . LEU B 1 145 ? 44.368 51.819  31.539  1.00 28.68  ? 168 LEU B CD2 1 
ATOM   3466 N  N   . ARG B 1 146 ? 45.838 50.219  27.470  1.00 15.51  ? 169 ARG B N   1 
ATOM   3467 C  CA  . ARG B 1 146 ? 45.948 50.055  26.046  1.00 18.67  ? 169 ARG B CA  1 
ATOM   3468 C  C   . ARG B 1 146 ? 46.018 51.356  25.282  1.00 15.11  ? 169 ARG B C   1 
ATOM   3469 O  O   . ARG B 1 146 ? 46.805 51.471  24.430  1.00 14.62  ? 169 ARG B O   1 
ATOM   3470 C  CB  . ARG B 1 146 ? 44.769 49.265  25.524  1.00 22.43  ? 169 ARG B CB  1 
ATOM   3471 C  CG  . ARG B 1 146 ? 44.768 47.840  25.973  1.00 52.06  ? 169 ARG B CG  1 
ATOM   3472 C  CD  . ARG B 1 146 ? 43.795 47.016  25.166  1.00 55.93  ? 169 ARG B CD  1 
ATOM   3473 N  NE  . ARG B 1 146 ? 43.803 45.658  25.624  1.00 47.64  ? 169 ARG B NE  1 
ATOM   3474 C  CZ  . ARG B 1 146 ? 42.922 45.187  26.473  1.00 45.08  ? 169 ARG B CZ  1 
ATOM   3475 N  NH1 . ARG B 1 146 ? 41.935 45.959  26.886  1.00 41.80  ? 169 ARG B NH1 1 
ATOM   3476 N  NH2 . ARG B 1 146 ? 42.994 43.931  26.870  1.00 47.85  ? 169 ARG B NH2 1 
ATOM   3477 N  N   . GLU B 1 147 ? 45.146 52.299  25.609  1.00 15.91  ? 170 GLU B N   1 
ATOM   3478 C  CA  . GLU B 1 147 ? 45.057 53.542  24.859  1.00 18.67  ? 170 GLU B CA  1 
ATOM   3479 C  C   . GLU B 1 147 ? 46.328 54.390  24.910  1.00 23.46  ? 170 GLU B C   1 
ATOM   3480 O  O   . GLU B 1 147 ? 46.531 55.249  24.056  1.00 18.66  ? 170 GLU B O   1 
ATOM   3481 C  CB  . GLU B 1 147 ? 43.842 54.350  25.319  1.00 17.67  ? 170 GLU B CB  1 
ATOM   3482 C  CG  . GLU B 1 147 ? 42.503 53.746  24.900  1.00 22.71  ? 170 GLU B CG  1 
ATOM   3483 C  CD  . GLU B 1 147 ? 42.008 52.671  25.852  1.00 29.66  ? 170 GLU B CD  1 
ATOM   3484 O  OE1 . GLU B 1 147 ? 42.758 52.287  26.783  1.00 24.35  ? 170 GLU B OE1 1 
ATOM   3485 O  OE2 . GLU B 1 147 ? 40.859 52.212  25.676  1.00 26.15  ? 170 GLU B OE2 1 
ATOM   3486 N  N   . LEU B 1 148 ? 47.169 54.142  25.908  1.00 17.56  ? 171 LEU B N   1 
ATOM   3487 C  CA  A LEU B 1 148 ? 48.413 54.921  26.070  0.58 17.41  ? 171 LEU B CA  1 
ATOM   3488 C  CA  B LEU B 1 148 ? 48.339 54.985  26.120  0.42 17.41  ? 171 LEU B CA  1 
ATOM   3489 C  C   . LEU B 1 148 ? 49.588 54.364  25.503  1.00 20.40  ? 171 LEU B C   1 
ATOM   3490 O  O   . LEU B 1 148 ? 50.628 54.927  25.848  1.00 24.69  ? 171 LEU B O   1 
ATOM   3491 C  CB  A LEU B 1 148 ? 48.780 54.962  27.535  0.58 17.11  ? 171 LEU B CB  1 
ATOM   3492 C  CB  B LEU B 1 148 ? 48.558 55.233  27.613  0.42 17.11  ? 171 LEU B CB  1 
ATOM   3493 C  CG  A LEU B 1 148 ? 48.397 56.189  28.296  0.58 23.34  ? 171 LEU B CG  1 
ATOM   3494 C  CG  B LEU B 1 148 ? 47.909 56.491  28.194  0.42 23.34  ? 171 LEU B CG  1 
ATOM   3495 C  CD1 A LEU B 1 148 ? 46.918 56.144  28.158  0.58 36.88  ? 171 LEU B CD1 1 
ATOM   3496 C  CD1 B LEU B 1 148 ? 47.813 56.396  29.709  0.42 36.88  ? 171 LEU B CD1 1 
ATOM   3497 C  CD2 A LEU B 1 148 ? 48.769 56.112  29.753  0.58 20.93  ? 171 LEU B CD2 1 
ATOM   3498 C  CD2 B LEU B 1 148 ? 48.681 57.734  27.779  0.42 20.93  ? 171 LEU B CD2 1 
ATOM   3499 N  N   . GLN B 1 149 ? 49.573 53.274  24.743  1.00 19.23  ? 172 GLN B N   1 
ATOM   3500 C  CA  A GLN B 1 149 ? 50.787 52.554  24.327  0.40 23.38  ? 172 GLN B CA  1 
ATOM   3501 C  CA  B GLN B 1 149 ? 50.805 52.596  24.361  0.60 23.38  ? 172 GLN B CA  1 
ATOM   3502 C  C   . GLN B 1 149 ? 51.689 53.246  23.292  1.00 25.64  ? 172 GLN B C   1 
ATOM   3503 O  O   . GLN B 1 149 ? 52.901 53.044  23.296  1.00 27.53  ? 172 GLN B O   1 
ATOM   3504 C  CB  A GLN B 1 149 ? 50.486 51.095  23.932  0.40 23.94  ? 172 GLN B CB  1 
ATOM   3505 C  CB  B GLN B 1 149 ? 50.525 51.131  24.087  0.60 24.04  ? 172 GLN B CB  1 
ATOM   3506 C  CG  A GLN B 1 149 ? 49.524 50.888  22.773  0.40 22.59  ? 172 GLN B CG  1 
ATOM   3507 C  CG  B GLN B 1 149 ? 50.045 50.479  25.359  0.60 25.30  ? 172 GLN B CG  1 
ATOM   3508 C  CD  A GLN B 1 149 ? 49.099 49.432  22.640  0.40 25.91  ? 172 GLN B CD  1 
ATOM   3509 C  CD  B GLN B 1 149 ? 50.951 50.787  26.553  0.60 20.51  ? 172 GLN B CD  1 
ATOM   3510 O  OE1 A GLN B 1 149 ? 49.938 48.534  22.558  0.40 23.98  ? 172 GLN B OE1 1 
ATOM   3511 O  OE1 B GLN B 1 149 ? 52.146 50.471  26.543  0.60 20.40  ? 172 GLN B OE1 1 
ATOM   3512 N  NE2 A GLN B 1 149 ? 47.791 49.192  22.648  0.40 20.88  ? 172 GLN B NE2 1 
ATOM   3513 N  NE2 B GLN B 1 149 ? 50.382 51.408  27.585  0.60 5.92   ? 172 GLN B NE2 1 
ATOM   3514 N  N   . ASP B 1 150 ? 51.124 54.057  22.399  1.00 25.37  ? 173 ASP B N   1 
ATOM   3515 C  CA  . ASP B 1 150 ? 51.915 54.851  21.451  1.00 29.56  ? 173 ASP B CA  1 
ATOM   3516 C  C   . ASP B 1 150 ? 52.633 56.001  22.142  1.00 31.16  ? 173 ASP B C   1 
ATOM   3517 O  O   . ASP B 1 150 ? 53.448 56.688  21.537  1.00 33.16  ? 173 ASP B O   1 
ATOM   3518 C  CB  . ASP B 1 150 ? 51.023 55.457  20.368  1.00 33.79  ? 173 ASP B CB  1 
ATOM   3519 C  CG  . ASP B 1 150 ? 50.334 54.414  19.516  1.00 38.01  ? 173 ASP B CG  1 
ATOM   3520 O  OD1 . ASP B 1 150 ? 50.736 53.232  19.557  1.00 37.03  ? 173 ASP B OD1 1 
ATOM   3521 O  OD2 . ASP B 1 150 ? 49.388 54.791  18.793  1.00 48.03  ? 173 ASP B OD2 1 
ATOM   3522 N  N   . LYS B 1 151 ? 52.275 56.248  23.398  1.00 20.12  ? 174 LYS B N   1 
ATOM   3523 C  CA  . LYS B 1 151 ? 52.869 57.352  24.144  1.00 21.56  ? 174 LYS B CA  1 
ATOM   3524 C  C   . LYS B 1 151 ? 53.853 56.860  25.201  1.00 25.93  ? 174 LYS B C   1 
ATOM   3525 O  O   . LYS B 1 151 ? 54.464 57.655  25.918  1.00 26.78  ? 174 LYS B O   1 
ATOM   3526 C  CB  . LYS B 1 151 ? 51.780 58.228  24.764  1.00 28.31  ? 174 LYS B CB  1 
ATOM   3527 C  CG  . LYS B 1 151 ? 50.862 58.850  23.715  1.00 35.02  ? 174 LYS B CG  1 
ATOM   3528 C  CD  . LYS B 1 151 ? 51.520 60.072  23.082  1.00 36.71  ? 174 LYS B CD  1 
ATOM   3529 C  CE  . LYS B 1 151 ? 50.600 60.749  22.076  1.00 41.78  ? 174 LYS B CE  1 
ATOM   3530 N  NZ  . LYS B 1 151 ? 50.157 59.799  21.020  1.00 49.19  ? 174 LYS B NZ  1 
ATOM   3531 N  N   . VAL B 1 152 ? 54.014 55.543  25.280  1.00 24.30  ? 175 VAL B N   1 
ATOM   3532 C  CA  . VAL B 1 152 ? 54.891 54.939  26.271  1.00 21.66  ? 175 VAL B CA  1 
ATOM   3533 C  C   . VAL B 1 152 ? 56.071 54.253  25.596  1.00 25.81  ? 175 VAL B C   1 
ATOM   3534 O  O   . VAL B 1 152 ? 55.901 53.243  24.916  1.00 23.95  ? 175 VAL B O   1 
ATOM   3535 C  CB  . VAL B 1 152 ? 54.116 53.918  27.143  1.00 20.43  ? 175 VAL B CB  1 
ATOM   3536 C  CG1 . VAL B 1 152 ? 55.047 53.224  28.130  1.00 15.40  ? 175 VAL B CG1 1 
ATOM   3537 C  CG2 . VAL B 1 152 ? 52.976 54.607  27.871  1.00 16.10  ? 175 VAL B CG2 1 
ATOM   3538 N  N   . PRO B 1 153 ? 57.279 54.800  25.790  1.00 18.52  ? 176 PRO B N   1 
ATOM   3539 C  CA  . PRO B 1 153 ? 58.488 54.194  25.221  1.00 20.95  ? 176 PRO B CA  1 
ATOM   3540 C  C   . PRO B 1 153 ? 58.803 52.859  25.882  1.00 19.34  ? 176 PRO B C   1 
ATOM   3541 O  O   . PRO B 1 153 ? 58.328 52.589  26.990  1.00 19.40  ? 176 PRO B O   1 
ATOM   3542 C  CB  . PRO B 1 153 ? 59.587 55.215  25.533  1.00 23.46  ? 176 PRO B CB  1 
ATOM   3543 C  CG  . PRO B 1 153 ? 59.057 56.048  26.653  1.00 26.96  ? 176 PRO B CG  1 
ATOM   3544 C  CD  . PRO B 1 153 ? 57.564 56.004  26.595  1.00 26.80  ? 176 PRO B CD  1 
ATOM   3545 N  N   . GLN B 1 154 ? 59.602 52.040  25.207  1.00 19.86  ? 177 GLN B N   1 
ATOM   3546 C  CA  . GLN B 1 154 ? 59.954 50.715  25.707  1.00 22.13  ? 177 GLN B CA  1 
ATOM   3547 C  C   . GLN B 1 154 ? 61.144 50.794  26.659  1.00 21.33  ? 177 GLN B C   1 
ATOM   3548 O  O   . GLN B 1 154 ? 62.244 51.152  26.250  1.00 25.50  ? 177 GLN B O   1 
ATOM   3549 C  CB  . GLN B 1 154 ? 60.283 49.782  24.531  1.00 29.20  ? 177 GLN B CB  1 
ATOM   3550 C  CG  . GLN B 1 154 ? 60.470 48.309  24.909  1.00 38.30  ? 177 GLN B CG  1 
ATOM   3551 C  CD  . GLN B 1 154 ? 59.168 47.609  25.259  1.00 53.34  ? 177 GLN B CD  1 
ATOM   3552 O  OE1 . GLN B 1 154 ? 58.962 47.192  26.403  1.00 55.05  ? 177 GLN B OE1 1 
ATOM   3553 N  NE2 . GLN B 1 154 ? 58.286 47.463  24.272  1.00 55.64  ? 177 GLN B NE2 1 
ATOM   3554 N  N   . LEU B 1 155 ? 60.918 50.436  27.923  1.00 15.97  ? 178 LEU B N   1 
ATOM   3555 C  CA  . LEU B 1 155 ? 61.976 50.446  28.929  1.00 18.35  ? 178 LEU B CA  1 
ATOM   3556 C  C   . LEU B 1 155 ? 62.691 49.106  28.919  1.00 14.87  ? 178 LEU B C   1 
ATOM   3557 O  O   . LEU B 1 155 ? 62.063 48.070  28.681  1.00 17.18  ? 178 LEU B O   1 
ATOM   3558 C  CB  . LEU B 1 155 ? 61.379 50.684  30.327  1.00 13.17  ? 178 LEU B CB  1 
ATOM   3559 C  CG  . LEU B 1 155 ? 60.699 52.017  30.646  1.00 26.98  ? 178 LEU B CG  1 
ATOM   3560 C  CD1 . LEU B 1 155 ? 60.066 51.978  32.005  1.00 27.93  ? 178 LEU B CD1 1 
ATOM   3561 C  CD2 . LEU B 1 155 ? 61.735 53.147  30.575  1.00 18.76  ? 178 LEU B CD2 1 
ATOM   3562 N  N   . PRO B 1 156 ? 64.002 49.119  29.209  1.00 16.29  ? 179 PRO B N   1 
ATOM   3563 C  CA  . PRO B 1 156 ? 64.733 47.863  29.381  1.00 20.65  ? 179 PRO B CA  1 
ATOM   3564 C  C   . PRO B 1 156 ? 64.150 47.084  30.550  1.00 21.10  ? 179 PRO B C   1 
ATOM   3565 O  O   . PRO B 1 156 ? 63.935 47.656  31.625  1.00 14.35  ? 179 PRO B O   1 
ATOM   3566 C  CB  . PRO B 1 156 ? 66.175 48.322  29.675  1.00 18.49  ? 179 PRO B CB  1 
ATOM   3567 C  CG  . PRO B 1 156 ? 66.065 49.741  30.115  1.00 22.43  ? 179 PRO B CG  1 
ATOM   3568 C  CD  . PRO B 1 156 ? 64.867 50.302  29.392  1.00 17.94  ? 179 PRO B CD  1 
ATOM   3569 N  N   . GLY B 1 157 ? 63.866 45.804  30.322  1.00 16.26  ? 180 GLY B N   1 
ATOM   3570 C  CA  . GLY B 1 157 ? 63.241 44.958  31.326  1.00 17.85  ? 180 GLY B CA  1 
ATOM   3571 C  C   . GLY B 1 157 ? 61.724 44.948  31.251  1.00 13.37  ? 180 GLY B C   1 
ATOM   3572 O  O   . GLY B 1 157 ? 61.068 44.237  32.007  1.00 14.08  ? 180 GLY B O   1 
ATOM   3573 N  N   . PHE B 1 158 ? 61.161 45.739  30.344  1.00 13.84  ? 181 PHE B N   1 
ATOM   3574 C  CA  . PHE B 1 158 ? 59.708 45.863  30.246  1.00 15.36  ? 181 PHE B CA  1 
ATOM   3575 C  C   . PHE B 1 158 ? 59.112 45.203  28.996  1.00 17.42  ? 181 PHE B C   1 
ATOM   3576 O  O   . PHE B 1 158 ? 57.916 45.299  28.774  1.00 16.82  ? 181 PHE B O   1 
ATOM   3577 C  CB  . PHE B 1 158 ? 59.289 47.346  30.287  1.00 16.78  ? 181 PHE B CB  1 
ATOM   3578 C  CG  . PHE B 1 158 ? 59.188 47.922  31.679  1.00 15.48  ? 181 PHE B CG  1 
ATOM   3579 C  CD1 . PHE B 1 158 ? 60.281 47.918  32.539  1.00 15.08  ? 181 PHE B CD1 1 
ATOM   3580 C  CD2 . PHE B 1 158 ? 57.999 48.485  32.114  1.00 18.19  ? 181 PHE B CD2 1 
ATOM   3581 C  CE1 . PHE B 1 158 ? 60.173 48.450  33.834  1.00 12.80  ? 181 PHE B CE1 1 
ATOM   3582 C  CE2 . PHE B 1 158 ? 57.876 49.022  33.393  1.00 18.33  ? 181 PHE B CE2 1 
ATOM   3583 C  CZ  . PHE B 1 158 ? 58.969 49.001  34.257  1.00 11.92  ? 181 PHE B CZ  1 
ATOM   3584 N  N   . SER B 1 159 ? 59.923 44.527  28.190  1.00 17.60  ? 182 SER B N   1 
ATOM   3585 C  CA  . SER B 1 159 ? 59.418 44.029  26.904  1.00 22.74  ? 182 SER B CA  1 
ATOM   3586 C  C   . SER B 1 159 ? 58.327 42.953  27.040  1.00 20.87  ? 182 SER B C   1 
ATOM   3587 O  O   . SER B 1 159 ? 57.461 42.833  26.172  1.00 17.58  ? 182 SER B O   1 
ATOM   3588 C  CB  . SER B 1 159 ? 60.568 43.550  26.006  1.00 24.64  ? 182 SER B CB  1 
ATOM   3589 O  OG  . SER B 1 159 ? 61.126 42.350  26.489  1.00 29.97  ? 182 SER B OG  1 
ATOM   3590 N  N   . TRP B 1 160 ? 58.328 42.226  28.156  1.00 18.48  ? 183 TRP B N   1 
ATOM   3591 C  CA  . TRP B 1 160 ? 57.335 41.177  28.410  1.00 18.82  ? 183 TRP B CA  1 
ATOM   3592 C  C   . TRP B 1 160 ? 55.930 41.736  28.632  1.00 22.01  ? 183 TRP B C   1 
ATOM   3593 O  O   . TRP B 1 160 ? 54.940 41.009  28.553  1.00 21.47  ? 183 TRP B O   1 
ATOM   3594 C  CB  . TRP B 1 160 ? 57.749 40.357  29.638  1.00 16.06  ? 183 TRP B CB  1 
ATOM   3595 C  CG  . TRP B 1 160 ? 57.795 41.196  30.898  1.00 19.12  ? 183 TRP B CG  1 
ATOM   3596 C  CD1 . TRP B 1 160 ? 58.842 41.960  31.333  1.00 15.12  ? 183 TRP B CD1 1 
ATOM   3597 C  CD2 . TRP B 1 160 ? 56.745 41.361  31.865  1.00 15.36  ? 183 TRP B CD2 1 
ATOM   3598 N  NE1 . TRP B 1 160 ? 58.505 42.592  32.515  1.00 15.26  ? 183 TRP B NE1 1 
ATOM   3599 C  CE2 . TRP B 1 160 ? 57.232 42.235  32.864  1.00 11.74  ? 183 TRP B CE2 1 
ATOM   3600 C  CE3 . TRP B 1 160 ? 55.447 40.852  31.986  1.00 18.49  ? 183 TRP B CE3 1 
ATOM   3601 C  CZ2 . TRP B 1 160 ? 56.452 42.620  33.964  1.00 10.40  ? 183 TRP B CZ2 1 
ATOM   3602 C  CZ3 . TRP B 1 160 ? 54.675 41.229  33.091  1.00 17.75  ? 183 TRP B CZ3 1 
ATOM   3603 C  CH2 . TRP B 1 160 ? 55.180 42.101  34.061  1.00 11.70  ? 183 TRP B CH2 1 
ATOM   3604 N  N   . ILE B 1 161 ? 55.842 43.022  28.944  1.00 16.19  ? 184 ILE B N   1 
ATOM   3605 C  CA  . ILE B 1 161 ? 54.561 43.609  29.307  1.00 18.87  ? 184 ILE B CA  1 
ATOM   3606 C  C   . ILE B 1 161 ? 53.701 43.888  28.088  1.00 25.69  ? 184 ILE B C   1 
ATOM   3607 O  O   . ILE B 1 161 ? 54.148 44.523  27.141  1.00 29.60  ? 184 ILE B O   1 
ATOM   3608 C  CB  . ILE B 1 161 ? 54.740 44.926  30.068  1.00 24.12  ? 184 ILE B CB  1 
ATOM   3609 C  CG1 . ILE B 1 161 ? 55.490 44.676  31.366  1.00 20.08  ? 184 ILE B CG1 1 
ATOM   3610 C  CG2 . ILE B 1 161 ? 53.384 45.566  30.361  1.00 27.59  ? 184 ILE B CG2 1 
ATOM   3611 C  CD1 . ILE B 1 161 ? 55.897 45.945  32.062  1.00 26.11  ? 184 ILE B CD1 1 
ATOM   3612 N  N   . LYS B 1 162 ? 52.468 43.400  28.114  1.00 25.56  ? 185 LYS B N   1 
ATOM   3613 C  CA  . LYS B 1 162 ? 51.470 43.834  27.147  1.00 33.45  ? 185 LYS B CA  1 
ATOM   3614 C  C   . LYS B 1 162 ? 50.336 44.538  27.871  1.00 28.12  ? 185 LYS B C   1 
ATOM   3615 O  O   . LYS B 1 162 ? 49.780 44.002  28.831  1.00 32.06  ? 185 LYS B O   1 
ATOM   3616 C  CB  . LYS B 1 162 ? 50.948 42.664  26.305  1.00 35.56  ? 185 LYS B CB  1 
ATOM   3617 C  CG  . LYS B 1 162 ? 51.885 41.463  26.219  1.00 36.38  ? 185 LYS B CG  1 
ATOM   3618 C  CD  . LYS B 1 162 ? 51.222 40.314  25.472  1.00 59.44  ? 185 LYS B CD  1 
ATOM   3619 C  CE  . LYS B 1 162 ? 51.562 40.323  23.984  1.00 67.05  ? 185 LYS B CE  1 
ATOM   3620 N  NZ  . LYS B 1 162 ? 50.996 39.135  23.272  1.00 67.13  ? 185 LYS B NZ  1 
ATOM   3621 N  N   . PRO B 1 163 ? 50.015 45.758  27.428  1.00 22.38  ? 186 PRO B N   1 
ATOM   3622 C  CA  . PRO B 1 163 ? 48.882 46.517  27.970  1.00 24.21  ? 186 PRO B CA  1 
ATOM   3623 C  C   . PRO B 1 163 ? 47.635 45.637  28.020  1.00 25.95  ? 186 PRO B C   1 
ATOM   3624 O  O   . PRO B 1 163 ? 47.340 44.970  27.036  1.00 33.51  ? 186 PRO B O   1 
ATOM   3625 C  CB  . PRO B 1 163 ? 48.702 47.651  26.952  1.00 32.47  ? 186 PRO B CB  1 
ATOM   3626 C  CG  . PRO B 1 163 ? 49.520 47.233  25.742  1.00 37.88  ? 186 PRO B CG  1 
ATOM   3627 C  CD  . PRO B 1 163 ? 50.653 46.458  26.303  1.00 25.97  ? 186 PRO B CD  1 
ATOM   3628 N  N   . CYS B 1 164 ? 46.930 45.613  29.150  1.00 23.40  ? 187 CYS B N   1 
ATOM   3629 C  CA  . CYS B 1 164 ? 45.874 44.615  29.347  1.00 30.20  ? 187 CYS B CA  1 
ATOM   3630 C  C   . CYS B 1 164 ? 44.548 45.211  29.804  1.00 33.82  ? 187 CYS B C   1 
ATOM   3631 O  O   . CYS B 1 164 ? 43.582 44.493  30.047  1.00 38.37  ? 187 CYS B O   1 
ATOM   3632 C  CB  . CYS B 1 164 ? 46.332 43.547  30.337  1.00 24.13  ? 187 CYS B CB  1 
ATOM   3633 S  SG  . CYS B 1 164 ? 47.062 44.229  31.843  1.00 30.82  ? 187 CYS B SG  1 
ATOM   3634 N  N   . ILE B 1 165 ? 44.516 46.528  29.950  1.00 21.54  ? 188 ILE B N   1 
ATOM   3635 C  CA  . ILE B 1 165 ? 43.335 47.216  30.447  1.00 20.80  ? 188 ILE B CA  1 
ATOM   3636 C  C   . ILE B 1 165 ? 43.011 48.439  29.596  1.00 21.41  ? 188 ILE B C   1 
ATOM   3637 O  O   . ILE B 1 165 ? 43.913 49.162  29.182  1.00 20.06  ? 188 ILE B O   1 
ATOM   3638 C  CB  . ILE B 1 165 ? 43.555 47.628  31.905  1.00 21.30  ? 188 ILE B CB  1 
ATOM   3639 C  CG1 . ILE B 1 165 ? 43.458 46.379  32.759  1.00 39.23  ? 188 ILE B CG1 1 
ATOM   3640 C  CG2 . ILE B 1 165 ? 42.478 48.548  32.407  1.00 31.83  ? 188 ILE B CG2 1 
ATOM   3641 C  CD1 . ILE B 1 165 ? 44.114 46.533  34.044  1.00 46.68  ? 188 ILE B CD1 1 
ATOM   3642 N  N   . SER B 1 166 ? 41.726 48.658  29.329  1.00 18.97  ? 189 SER B N   1 
ATOM   3643 C  CA  . SER B 1 166 ? 41.300 49.855  28.620  1.00 21.67  ? 189 SER B CA  1 
ATOM   3644 C  C   . SER B 1 166 ? 41.072 50.992  29.608  1.00 21.20  ? 189 SER B C   1 
ATOM   3645 O  O   . SER B 1 166 ? 40.884 50.767  30.803  1.00 15.92  ? 189 SER B O   1 
ATOM   3646 C  CB  . SER B 1 166 ? 40.020 49.595  27.828  1.00 21.98  ? 189 SER B CB  1 
ATOM   3647 O  OG  . SER B 1 166 ? 38.908 49.462  28.694  1.00 29.14  ? 189 SER B OG  1 
ATOM   3648 N  N   . SER B 1 167 ? 41.081 52.217  29.099  1.00 23.50  ? 190 SER B N   1 
ATOM   3649 C  CA  . SER B 1 167 ? 40.875 53.393  29.926  1.00 18.78  ? 190 SER B CA  1 
ATOM   3650 C  C   . SER B 1 167 ? 39.487 53.429  30.567  1.00 18.02  ? 190 SER B C   1 
ATOM   3651 O  O   . SER B 1 167 ? 39.286 54.091  31.584  1.00 16.42  ? 190 SER B O   1 
ATOM   3652 C  CB  . SER B 1 167 ? 41.137 54.651  29.087  1.00 25.30  ? 190 SER B CB  1 
ATOM   3653 O  OG  . SER B 1 167 ? 40.295 54.676  27.958  1.00 30.29  ? 190 SER B OG  1 
ATOM   3654 N  N   . ALA B 1 168 ? 38.527 52.712  29.989  1.00 9.59   ? 191 ALA B N   1 
ATOM   3655 C  CA  . ALA B 1 168 ? 37.190 52.658  30.570  1.00 11.26  ? 191 ALA B CA  1 
ATOM   3656 C  C   . ALA B 1 168 ? 37.143 51.640  31.710  1.00 10.86  ? 191 ALA B C   1 
ATOM   3657 O  O   . ALA B 1 168 ? 36.118 51.494  32.381  1.00 9.96   ? 191 ALA B O   1 
ATOM   3658 C  CB  . ALA B 1 168 ? 36.157 52.296  29.506  1.00 19.53  ? 191 ALA B CB  1 
ATOM   3659 N  N   . SER B 1 169 ? 38.249 50.939  31.929  1.00 10.75  ? 192 SER B N   1 
ATOM   3660 C  CA  . SER B 1 169 ? 38.250 49.813  32.878  1.00 11.56  ? 192 SER B CA  1 
ATOM   3661 C  C   . SER B 1 169 ? 38.993 50.063  34.189  1.00 17.31  ? 192 SER B C   1 
ATOM   3662 O  O   . SER B 1 169 ? 39.227 49.127  34.972  1.00 12.60  ? 192 SER B O   1 
ATOM   3663 C  CB  . SER B 1 169 ? 38.778 48.550  32.192  1.00 14.82  ? 192 SER B CB  1 
ATOM   3664 O  OG  . SER B 1 169 ? 37.823 48.112  31.238  1.00 18.31  ? 192 SER B OG  1 
ATOM   3665 N  N   . ILE B 1 170 ? 39.352 51.321  34.434  1.00 8.51   ? 193 ILE B N   1 
ATOM   3666 C  CA  . ILE B 1 170 ? 39.963 51.701  35.703  1.00 6.72   ? 193 ILE B CA  1 
ATOM   3667 C  C   . ILE B 1 170 ? 39.215 52.896  36.266  1.00 11.86  ? 193 ILE B C   1 
ATOM   3668 O  O   . ILE B 1 170 ? 38.872 53.822  35.530  1.00 11.51  ? 193 ILE B O   1 
ATOM   3669 C  CB  . ILE B 1 170 ? 41.485 51.997  35.561  1.00 8.00   ? 193 ILE B CB  1 
ATOM   3670 C  CG1 . ILE B 1 170 ? 42.089 52.384  36.922  1.00 9.38   ? 193 ILE B CG1 1 
ATOM   3671 C  CG2 . ILE B 1 170 ? 41.756 53.076  34.490  1.00 10.72  ? 193 ILE B CG2 1 
ATOM   3672 C  CD1 . ILE B 1 170 ? 43.637 52.467  36.916  1.00 9.07   ? 193 ILE B CD1 1 
ATOM   3673 N  N   . VAL B 1 171 ? 38.911 52.855  37.558  1.00 7.28   ? 194 VAL B N   1 
ATOM   3674 C  CA  . VAL B 1 171 ? 38.341 54.023  38.239  1.00 7.94   ? 194 VAL B CA  1 
ATOM   3675 C  C   . VAL B 1 171 ? 39.220 54.345  39.439  1.00 14.97  ? 194 VAL B C   1 
ATOM   3676 O  O   . VAL B 1 171 ? 39.582 53.444  40.211  1.00 9.81   ? 194 VAL B O   1 
ATOM   3677 C  CB  . VAL B 1 171 ? 36.891 53.768  38.729  1.00 8.57   ? 194 VAL B CB  1 
ATOM   3678 C  CG1 . VAL B 1 171 ? 36.385 54.934  39.581  1.00 9.13   ? 194 VAL B CG1 1 
ATOM   3679 C  CG2 . VAL B 1 171 ? 35.942 53.519  37.538  1.00 10.33  ? 194 VAL B CG2 1 
ATOM   3680 N  N   . TYR B 1 172 ? 39.593 55.616  39.572  1.00 8.08   ? 195 TYR B N   1 
ATOM   3681 C  CA  . TYR B 1 172 ? 40.358 56.075  40.726  1.00 7.32   ? 195 TYR B CA  1 
ATOM   3682 C  C   . TYR B 1 172 ? 39.449 56.593  41.809  1.00 8.29   ? 195 TYR B C   1 
ATOM   3683 O  O   . TYR B 1 172 ? 38.420 57.209  41.520  1.00 7.85   ? 195 TYR B O   1 
ATOM   3684 C  CB  . TYR B 1 172 ? 41.264 57.226  40.320  1.00 7.64   ? 195 TYR B CB  1 
ATOM   3685 C  CG  . TYR B 1 172 ? 42.380 56.846  39.406  1.00 7.24   ? 195 TYR B CG  1 
ATOM   3686 C  CD1 . TYR B 1 172 ? 43.587 56.405  39.914  1.00 8.99   ? 195 TYR B CD1 1 
ATOM   3687 C  CD2 . TYR B 1 172 ? 42.241 56.961  38.026  1.00 9.43   ? 195 TYR B CD2 1 
ATOM   3688 C  CE1 . TYR B 1 172 ? 44.626 56.086  39.084  1.00 8.90   ? 195 TYR B CE1 1 
ATOM   3689 C  CE2 . TYR B 1 172 ? 43.279 56.640  37.181  1.00 8.87   ? 195 TYR B CE2 1 
ATOM   3690 C  CZ  . TYR B 1 172 ? 44.469 56.209  37.716  1.00 11.10  ? 195 TYR B CZ  1 
ATOM   3691 O  OH  . TYR B 1 172 ? 45.525 55.893  36.891  1.00 9.99   ? 195 TYR B OH  1 
ATOM   3692 N  N   . ILE B 1 173 ? 39.841 56.361  43.065  1.00 8.92   ? 196 ILE B N   1 
ATOM   3693 C  CA  . ILE B 1 173 ? 39.139 56.934  44.213  1.00 7.40   ? 196 ILE B CA  1 
ATOM   3694 C  C   . ILE B 1 173 ? 40.160 57.499  45.179  1.00 8.37   ? 196 ILE B C   1 
ATOM   3695 O  O   . ILE B 1 173 ? 41.066 56.782  45.596  1.00 7.34   ? 196 ILE B O   1 
ATOM   3696 C  CB  . ILE B 1 173 ? 38.295 55.893  44.983  1.00 8.66   ? 196 ILE B CB  1 
ATOM   3697 C  CG1 . ILE B 1 173 ? 37.264 55.235  44.057  1.00 9.31   ? 196 ILE B CG1 1 
ATOM   3698 C  CG2 . ILE B 1 173 ? 37.590 56.563  46.186  1.00 8.34   ? 196 ILE B CG2 1 
ATOM   3699 C  CD1 . ILE B 1 173 ? 36.545 54.074  44.698  1.00 11.32  ? 196 ILE B CD1 1 
ATOM   3700 N  N   . GLY B 1 174 ? 40.031 58.773  45.514  1.00 5.78   ? 197 GLY B N   1 
ATOM   3701 C  CA  . GLY B 1 174 ? 40.826 59.400  46.535  1.00 5.42   ? 197 GLY B CA  1 
ATOM   3702 C  C   . GLY B 1 174 ? 41.829 60.417  46.061  1.00 9.44   ? 197 GLY B C   1 
ATOM   3703 O  O   . GLY B 1 174 ? 42.542 60.919  46.854  1.00 8.50   ? 197 GLY B O   1 
ATOM   3704 N  N   . LEU B 1 175 ? 41.848 60.690  44.770  1.00 7.55   ? 198 LEU B N   1 
ATOM   3705 C  CA  . LEU B 1 175 ? 42.895 61.523  44.172  1.00 6.46   ? 198 LEU B CA  1 
ATOM   3706 C  C   . LEU B 1 175 ? 42.962 62.931  44.727  1.00 9.67   ? 198 LEU B C   1 
ATOM   3707 O  O   . LEU B 1 175 ? 41.945 63.617  44.792  1.00 8.44   ? 198 LEU B O   1 
ATOM   3708 C  CB  . LEU B 1 175 ? 42.699 61.683  42.658  1.00 9.10   ? 198 LEU B CB  1 
ATOM   3709 C  CG  . LEU B 1 175 ? 42.730 60.410  41.811  1.00 10.69  ? 198 LEU B CG  1 
ATOM   3710 C  CD1 . LEU B 1 175 ? 42.692 60.736  40.292  1.00 10.51  ? 198 LEU B CD1 1 
ATOM   3711 C  CD2 . LEU B 1 175 ? 43.983 59.638  42.132  1.00 8.80   ? 198 LEU B CD2 1 
ATOM   3712 N  N   . ARG B 1 176 ? 44.164 63.351  45.125  1.00 10.72  ? 199 ARG B N   1 
ATOM   3713 C  CA  . ARG B 1 176 ? 44.368 64.724  45.578  1.00 9.00   ? 199 ARG B CA  1 
ATOM   3714 C  C   . ARG B 1 176 ? 45.743 65.299  45.267  1.00 18.53  ? 199 ARG B C   1 
ATOM   3715 O  O   . ARG B 1 176 ? 46.038 66.431  45.631  1.00 17.08  ? 199 ARG B O   1 
ATOM   3716 C  CB  . ARG B 1 176 ? 44.056 64.801  47.077  1.00 10.62  ? 199 ARG B CB  1 
ATOM   3717 C  CG  . ARG B 1 176 ? 44.878 63.863  47.948  1.00 8.12   ? 199 ARG B CG  1 
ATOM   3718 C  CD  . ARG B 1 176 ? 44.354 63.905  49.390  1.00 7.41   ? 199 ARG B CD  1 
ATOM   3719 N  NE  . ARG B 1 176 ? 45.150 63.090  50.311  1.00 7.28   ? 199 ARG B NE  1 
ATOM   3720 C  CZ  . ARG B 1 176 ? 45.016 61.774  50.476  1.00 10.50  ? 199 ARG B CZ  1 
ATOM   3721 N  NH1 . ARG B 1 176 ? 45.786 61.146  51.365  1.00 4.98   ? 199 ARG B NH1 1 
ATOM   3722 N  NH2 . ARG B 1 176 ? 44.114 61.089  49.768  1.00 7.14   ? 199 ARG B NH2 1 
ATOM   3723 N  N   . ASP B 1 177 ? 46.582 64.527  44.581  1.00 11.39  ? 200 ASP B N   1 
ATOM   3724 C  CA  . ASP B 1 177 ? 47.945 64.976  44.275  1.00 13.66  ? 200 ASP B CA  1 
ATOM   3725 C  C   . ASP B 1 177 ? 48.267 64.468  42.873  1.00 21.52  ? 200 ASP B C   1 
ATOM   3726 O  O   . ASP B 1 177 ? 48.897 63.428  42.704  1.00 22.40  ? 200 ASP B O   1 
ATOM   3727 C  CB  . ASP B 1 177 ? 48.919 64.415  45.334  1.00 17.79  ? 200 ASP B CB  1 
ATOM   3728 C  CG  . ASP B 1 177 ? 50.342 64.977  45.218  1.00 34.20  ? 200 ASP B CG  1 
ATOM   3729 O  OD1 . ASP B 1 177 ? 50.526 66.018  44.556  1.00 27.15  ? 200 ASP B OD1 1 
ATOM   3730 O  OD2 . ASP B 1 177 ? 51.280 64.375  45.808  1.00 30.97  ? 200 ASP B OD2 1 
ATOM   3731 N  N   . VAL B 1 178 ? 47.810 65.213  41.871  1.00 16.78  ? 201 VAL B N   1 
ATOM   3732 C  CA  . VAL B 1 178 ? 47.902 64.804  40.476  1.00 16.43  ? 201 VAL B CA  1 
ATOM   3733 C  C   . VAL B 1 178 ? 48.807 65.754  39.689  1.00 21.09  ? 201 VAL B C   1 
ATOM   3734 O  O   . VAL B 1 178 ? 48.618 66.965  39.743  1.00 16.66  ? 201 VAL B O   1 
ATOM   3735 C  CB  . VAL B 1 178 ? 46.486 64.789  39.854  1.00 16.33  ? 201 VAL B CB  1 
ATOM   3736 C  CG1 . VAL B 1 178 ? 46.543 64.443  38.382  1.00 18.14  ? 201 VAL B CG1 1 
ATOM   3737 C  CG2 . VAL B 1 178 ? 45.589 63.811  40.628  1.00 15.22  ? 201 VAL B CG2 1 
ATOM   3738 N  N   . ASP B 1 179 ? 49.805 65.213  38.984  1.00 14.91  ? 202 ASP B N   1 
ATOM   3739 C  CA  . ASP B 1 179 ? 50.722 66.047  38.196  1.00 17.88  ? 202 ASP B CA  1 
ATOM   3740 C  C   . ASP B 1 179 ? 49.998 66.583  36.968  1.00 14.03  ? 202 ASP B C   1 
ATOM   3741 O  O   . ASP B 1 179 ? 49.051 65.965  36.496  1.00 14.87  ? 202 ASP B O   1 
ATOM   3742 C  CB  . ASP B 1 179 ? 51.961 65.254  37.751  1.00 15.03  ? 202 ASP B CB  1 
ATOM   3743 C  CG  . ASP B 1 179 ? 52.757 64.703  38.922  1.00 24.19  ? 202 ASP B CG  1 
ATOM   3744 O  OD1 . ASP B 1 179 ? 52.661 65.276  40.022  1.00 26.24  ? 202 ASP B OD1 1 
ATOM   3745 O  OD2 . ASP B 1 179 ? 53.495 63.707  38.740  1.00 17.73  ? 202 ASP B OD2 1 
ATOM   3746 N  N   . PRO B 1 180 ? 50.424 67.749  36.455  1.00 15.10  ? 203 PRO B N   1 
ATOM   3747 C  CA  . PRO B 1 180 ? 49.744 68.276  35.264  1.00 17.03  ? 203 PRO B CA  1 
ATOM   3748 C  C   . PRO B 1 180 ? 49.679 67.305  34.070  1.00 15.94  ? 203 PRO B C   1 
ATOM   3749 O  O   . PRO B 1 180 ? 48.602 67.187  33.460  1.00 15.05  ? 203 PRO B O   1 
ATOM   3750 C  CB  . PRO B 1 180 ? 50.556 69.541  34.923  1.00 20.34  ? 203 PRO B CB  1 
ATOM   3751 C  CG  . PRO B 1 180 ? 51.115 69.987  36.251  1.00 24.24  ? 203 PRO B CG  1 
ATOM   3752 C  CD  . PRO B 1 180 ? 51.420 68.698  36.995  1.00 18.15  ? 203 PRO B CD  1 
ATOM   3753 N  N   . PRO B 1 181 ? 50.788 66.611  33.740  1.00 12.88  ? 204 PRO B N   1 
ATOM   3754 C  CA  . PRO B 1 181 ? 50.613 65.674  32.622  1.00 14.53  ? 204 PRO B CA  1 
ATOM   3755 C  C   . PRO B 1 181 ? 49.631 64.554  32.930  1.00 13.43  ? 204 PRO B C   1 
ATOM   3756 O  O   . PRO B 1 181 ? 48.973 64.054  32.009  1.00 15.35  ? 204 PRO B O   1 
ATOM   3757 C  CB  . PRO B 1 181 ? 52.017 65.096  32.400  1.00 17.84  ? 204 PRO B CB  1 
ATOM   3758 C  CG  . PRO B 1 181 ? 52.843 65.507  33.552  1.00 21.26  ? 204 PRO B CG  1 
ATOM   3759 C  CD  . PRO B 1 181 ? 52.192 66.698  34.186  1.00 16.50  ? 204 PRO B CD  1 
ATOM   3760 N  N   . GLU B 1 182 ? 49.539 64.149  34.196  1.00 14.18  ? 205 GLU B N   1 
ATOM   3761 C  CA  . GLU B 1 182 ? 48.583 63.115  34.569  1.00 11.19  ? 205 GLU B CA  1 
ATOM   3762 C  C   . GLU B 1 182 ? 47.166 63.614  34.386  1.00 12.60  ? 205 GLU B C   1 
ATOM   3763 O  O   . GLU B 1 182 ? 46.284 62.873  33.948  1.00 13.04  ? 205 GLU B O   1 
ATOM   3764 C  CB  . GLU B 1 182 ? 48.778 62.680  36.021  1.00 10.28  ? 205 GLU B CB  1 
ATOM   3765 C  CG  . GLU B 1 182 ? 50.076 61.958  36.294  1.00 6.19   ? 205 GLU B CG  1 
ATOM   3766 C  CD  . GLU B 1 182 ? 50.183 61.538  37.752  1.00 15.33  ? 205 GLU B CD  1 
ATOM   3767 O  OE1 . GLU B 1 182 ? 50.166 62.431  38.631  1.00 12.95  ? 205 GLU B OE1 1 
ATOM   3768 O  OE2 . GLU B 1 182 ? 50.256 60.318  38.013  1.00 13.27  ? 205 GLU B OE2 1 
ATOM   3769 N  N   . HIS B 1 183 ? 46.930 64.866  34.766  1.00 14.24  ? 206 HIS B N   1 
ATOM   3770 C  CA  . HIS B 1 183 ? 45.603 65.440  34.597  1.00 15.18  ? 206 HIS B CA  1 
ATOM   3771 C  C   . HIS B 1 183 ? 45.224 65.461  33.119  1.00 15.14  ? 206 HIS B C   1 
ATOM   3772 O  O   . HIS B 1 183 ? 44.075 65.181  32.757  1.00 14.77  ? 206 HIS B O   1 
ATOM   3773 C  CB  . HIS B 1 183 ? 45.516 66.855  35.189  1.00 16.83  ? 206 HIS B CB  1 
ATOM   3774 C  CG  . HIS B 1 183 ? 44.166 67.486  35.021  1.00 21.35  ? 206 HIS B CG  1 
ATOM   3775 N  ND1 . HIS B 1 183 ? 43.136 67.286  35.909  1.00 28.94  ? 206 HIS B ND1 1 
ATOM   3776 C  CD2 . HIS B 1 183 ? 43.681 68.293  34.047  1.00 23.69  ? 206 HIS B CD2 1 
ATOM   3777 C  CE1 . HIS B 1 183 ? 42.069 67.955  35.499  1.00 27.93  ? 206 HIS B CE1 1 
ATOM   3778 N  NE2 . HIS B 1 183 ? 42.372 68.569  34.374  1.00 25.60  ? 206 HIS B NE2 1 
ATOM   3779 N  N   . PHE B 1 184 ? 46.187 65.809  32.276  1.00 13.87  ? 207 PHE B N   1 
ATOM   3780 C  CA  . PHE B 1 184 ? 45.966 65.795  30.835  1.00 15.70  ? 207 PHE B CA  1 
ATOM   3781 C  C   . PHE B 1 184 ? 45.558 64.391  30.403  1.00 18.67  ? 207 PHE B C   1 
ATOM   3782 O  O   . PHE B 1 184 ? 44.581 64.207  29.668  1.00 15.00  ? 207 PHE B O   1 
ATOM   3783 C  CB  . PHE B 1 184 ? 47.233 66.238  30.091  1.00 16.15  ? 207 PHE B CB  1 
ATOM   3784 C  CG  . PHE B 1 184 ? 47.107 66.173  28.592  1.00 27.05  ? 207 PHE B CG  1 
ATOM   3785 C  CD1 . PHE B 1 184 ? 46.652 67.273  27.874  1.00 36.02  ? 207 PHE B CD1 1 
ATOM   3786 C  CD2 . PHE B 1 184 ? 47.431 65.009  27.898  1.00 25.32  ? 207 PHE B CD2 1 
ATOM   3787 C  CE1 . PHE B 1 184 ? 46.525 67.213  26.490  1.00 32.62  ? 207 PHE B CE1 1 
ATOM   3788 C  CE2 . PHE B 1 184 ? 47.300 64.941  26.518  1.00 32.69  ? 207 PHE B CE2 1 
ATOM   3789 C  CZ  . PHE B 1 184 ? 46.849 66.047  25.814  1.00 29.75  ? 207 PHE B CZ  1 
ATOM   3790 N  N   . ILE B 1 185 ? 46.302 63.397  30.876  1.00 11.86  ? 208 ILE B N   1 
ATOM   3791 C  CA  . ILE B 1 185 ? 46.043 62.014  30.481  1.00 13.67  ? 208 ILE B CA  1 
ATOM   3792 C  C   . ILE B 1 185 ? 44.652 61.581  30.917  1.00 11.79  ? 208 ILE B C   1 
ATOM   3793 O  O   . ILE B 1 185 ? 43.897 61.015  30.120  1.00 14.41  ? 208 ILE B O   1 
ATOM   3794 C  CB  . ILE B 1 185 ? 47.133 61.058  31.032  1.00 12.38  ? 208 ILE B CB  1 
ATOM   3795 C  CG1 . ILE B 1 185 ? 48.451 61.308  30.292  1.00 15.56  ? 208 ILE B CG1 1 
ATOM   3796 C  CG2 . ILE B 1 185 ? 46.681 59.594  30.899  1.00 14.75  ? 208 ILE B CG2 1 
ATOM   3797 C  CD1 . ILE B 1 185 ? 49.704 60.699  30.944  1.00 14.50  ? 208 ILE B CD1 1 
ATOM   3798 N  N   . LEU B 1 186 ? 44.298 61.862  32.168  1.00 11.62  ? 209 LEU B N   1 
ATOM   3799 C  CA  . LEU B 1 186 ? 42.984 61.472  32.673  1.00 10.09  ? 209 LEU B CA  1 
ATOM   3800 C  C   . LEU B 1 186 ? 41.881 62.107  31.836  1.00 17.13  ? 209 LEU B C   1 
ATOM   3801 O  O   . LEU B 1 186 ? 40.900 61.455  31.487  1.00 17.39  ? 209 LEU B O   1 
ATOM   3802 C  CB  . LEU B 1 186 ? 42.814 61.873  34.140  1.00 12.71  ? 209 LEU B CB  1 
ATOM   3803 C  CG  . LEU B 1 186 ? 43.750 61.189  35.149  1.00 13.60  ? 209 LEU B CG  1 
ATOM   3804 C  CD1 . LEU B 1 186 ? 43.589 61.819  36.514  1.00 13.77  ? 209 LEU B CD1 1 
ATOM   3805 C  CD2 . LEU B 1 186 ? 43.437 59.698  35.224  1.00 12.42  ? 209 LEU B CD2 1 
ATOM   3806 N  N   . LYS B 1 187 ? 42.057 63.385  31.513  1.00 15.40  ? 210 LYS B N   1 
ATOM   3807 C  CA  . LYS B 1 187 ? 41.074 64.105  30.709  1.00 18.42  ? 210 LYS B CA  1 
ATOM   3808 C  C   . LYS B 1 187 ? 41.043 63.643  29.261  1.00 14.76  ? 210 LYS B C   1 
ATOM   3809 O  O   . LYS B 1 187 ? 39.978 63.373  28.711  1.00 20.15  ? 210 LYS B O   1 
ATOM   3810 C  CB  . LYS B 1 187 ? 41.340 65.612  30.768  1.00 21.04  ? 210 LYS B CB  1 
ATOM   3811 C  CG  . LYS B 1 187 ? 41.027 66.222  32.116  1.00 25.57  ? 210 LYS B CG  1 
ATOM   3812 C  CD  . LYS B 1 187 ? 39.603 65.867  32.531  1.00 28.64  ? 210 LYS B CD  1 
ATOM   3813 C  CE  . LYS B 1 187 ? 39.205 66.559  33.817  1.00 40.13  ? 210 LYS B CE  1 
ATOM   3814 N  NZ  . LYS B 1 187 ? 37.839 66.151  34.245  1.00 43.11  ? 210 LYS B NZ  1 
ATOM   3815 N  N   . ASN B 1 188 ? 42.215 63.541  28.650  1.00 15.83  ? 211 ASN B N   1 
ATOM   3816 C  CA  . ASN B 1 188 ? 42.302 63.192  27.234  1.00 19.20  ? 211 ASN B CA  1 
ATOM   3817 C  C   . ASN B 1 188 ? 41.772 61.795  26.922  1.00 26.97  ? 211 ASN B C   1 
ATOM   3818 O  O   . ASN B 1 188 ? 41.168 61.569  25.866  1.00 17.93  ? 211 ASN B O   1 
ATOM   3819 C  CB  . ASN B 1 188 ? 43.750 63.304  26.749  1.00 27.97  ? 211 ASN B CB  1 
ATOM   3820 C  CG  . ASN B 1 188 ? 43.884 63.077  25.256  1.00 40.46  ? 211 ASN B CG  1 
ATOM   3821 O  OD1 . ASN B 1 188 ? 43.489 63.925  24.455  1.00 49.37  ? 211 ASN B OD1 1 
ATOM   3822 N  ND2 . ASN B 1 188 ? 44.438 61.927  24.872  1.00 42.37  ? 211 ASN B ND2 1 
ATOM   3823 N  N   . TYR B 1 189 ? 41.985 60.856  27.840  1.00 18.79  ? 212 TYR B N   1 
ATOM   3824 C  CA  . TYR B 1 189 ? 41.542 59.486  27.610  1.00 14.88  ? 212 TYR B CA  1 
ATOM   3825 C  C   . TYR B 1 189 ? 40.230 59.170  28.335  1.00 19.29  ? 212 TYR B C   1 
ATOM   3826 O  O   . TYR B 1 189 ? 39.771 58.020  28.339  1.00 19.83  ? 212 TYR B O   1 
ATOM   3827 C  CB  . TYR B 1 189 ? 42.661 58.498  27.970  1.00 19.65  ? 212 TYR B CB  1 
ATOM   3828 C  CG  . TYR B 1 189 ? 43.893 58.676  27.107  1.00 21.11  ? 212 TYR B CG  1 
ATOM   3829 C  CD1 . TYR B 1 189 ? 44.910 59.546  27.484  1.00 21.66  ? 212 TYR B CD1 1 
ATOM   3830 C  CD2 . TYR B 1 189 ? 44.027 57.994  25.902  1.00 19.09  ? 212 TYR B CD2 1 
ATOM   3831 C  CE1 . TYR B 1 189 ? 46.035 59.719  26.695  1.00 32.81  ? 212 TYR B CE1 1 
ATOM   3832 C  CE2 . TYR B 1 189 ? 45.151 58.162  25.104  1.00 21.40  ? 212 TYR B CE2 1 
ATOM   3833 C  CZ  . TYR B 1 189 ? 46.149 59.024  25.505  1.00 27.14  ? 212 TYR B CZ  1 
ATOM   3834 O  OH  . TYR B 1 189 ? 47.269 59.201  24.721  1.00 24.67  ? 212 TYR B OH  1 
ATOM   3835 N  N   . ASP B 1 190 ? 39.624 60.206  28.916  1.00 12.22  ? 213 ASP B N   1 
ATOM   3836 C  CA  . ASP B 1 190 ? 38.349 60.091  29.625  1.00 15.73  ? 213 ASP B CA  1 
ATOM   3837 C  C   . ASP B 1 190 ? 38.382 59.008  30.708  1.00 20.37  ? 213 ASP B C   1 
ATOM   3838 O  O   . ASP B 1 190 ? 37.438 58.231  30.866  1.00 19.24  ? 213 ASP B O   1 
ATOM   3839 C  CB  . ASP B 1 190 ? 37.183 59.870  28.652  1.00 23.72  ? 213 ASP B CB  1 
ATOM   3840 C  CG  . ASP B 1 190 ? 35.847 60.340  29.226  1.00 39.02  ? 213 ASP B CG  1 
ATOM   3841 O  OD1 . ASP B 1 190 ? 35.830 61.342  29.980  1.00 39.89  ? 213 ASP B OD1 1 
ATOM   3842 O  OD2 . ASP B 1 190 ? 34.813 59.705  28.925  1.00 50.24  ? 213 ASP B OD2 1 
ATOM   3843 N  N   . ILE B 1 191 ? 39.472 58.967  31.462  1.00 15.44  ? 214 ILE B N   1 
ATOM   3844 C  CA  . ILE B 1 191 ? 39.581 58.011  32.568  1.00 14.29  ? 214 ILE B CA  1 
ATOM   3845 C  C   . ILE B 1 191 ? 38.806 58.574  33.736  1.00 19.67  ? 214 ILE B C   1 
ATOM   3846 O  O   . ILE B 1 191 ? 38.989 59.740  34.104  1.00 15.61  ? 214 ILE B O   1 
ATOM   3847 C  CB  . ILE B 1 191 ? 41.043 57.781  32.949  1.00 14.01  ? 214 ILE B CB  1 
ATOM   3848 C  CG1 . ILE B 1 191 ? 41.775 57.156  31.766  1.00 12.31  ? 214 ILE B CG1 1 
ATOM   3849 C  CG2 . ILE B 1 191 ? 41.157 56.892  34.208  1.00 13.09  ? 214 ILE B CG2 1 
ATOM   3850 C  CD1 . ILE B 1 191 ? 43.293 57.227  31.866  1.00 15.21  ? 214 ILE B CD1 1 
ATOM   3851 N  N   . GLN B 1 192 ? 37.923 57.759  34.303  1.00 12.41  ? 215 GLN B N   1 
ATOM   3852 C  CA  . GLN B 1 192 ? 37.022 58.216  35.347  1.00 12.61  ? 215 GLN B CA  1 
ATOM   3853 C  C   . GLN B 1 192 ? 37.673 58.191  36.722  1.00 17.86  ? 215 GLN B C   1 
ATOM   3854 O  O   . GLN B 1 192 ? 38.331 57.219  37.103  1.00 9.64   ? 215 GLN B O   1 
ATOM   3855 C  CB  . GLN B 1 192 ? 35.756 57.367  35.349  1.00 14.48  ? 215 GLN B CB  1 
ATOM   3856 C  CG  . GLN B 1 192 ? 35.021 57.403  34.010  1.00 21.40  ? 215 GLN B CG  1 
ATOM   3857 C  CD  . GLN B 1 192 ? 34.609 58.810  33.617  1.00 23.56  ? 215 GLN B CD  1 
ATOM   3858 O  OE1 . GLN B 1 192 ? 33.823 59.454  34.315  1.00 22.83  ? 215 GLN B OE1 1 
ATOM   3859 N  NE2 . GLN B 1 192 ? 35.155 59.300  32.509  1.00 22.47  ? 215 GLN B NE2 1 
ATOM   3860 N  N   . TYR B 1 193 ? 37.473 59.257  37.483  1.00 11.39  ? 216 TYR B N   1 
ATOM   3861 C  CA  . TYR B 1 193 ? 38.052 59.308  38.818  1.00 12.16  ? 216 TYR B CA  1 
ATOM   3862 C  C   . TYR B 1 193 ? 37.154 60.052  39.779  1.00 18.14  ? 216 TYR B C   1 
ATOM   3863 O  O   . TYR B 1 193 ? 36.370 60.909  39.377  1.00 12.50  ? 216 TYR B O   1 
ATOM   3864 C  CB  . TYR B 1 193 ? 39.439 59.950  38.796  1.00 11.54  ? 216 TYR B CB  1 
ATOM   3865 C  CG  . TYR B 1 193 ? 39.465 61.388  38.316  1.00 14.16  ? 216 TYR B CG  1 
ATOM   3866 C  CD1 . TYR B 1 193 ? 39.307 62.450  39.204  1.00 15.36  ? 216 TYR B CD1 1 
ATOM   3867 C  CD2 . TYR B 1 193 ? 39.646 61.682  36.968  1.00 16.48  ? 216 TYR B CD2 1 
ATOM   3868 C  CE1 . TYR B 1 193 ? 39.336 63.773  38.756  1.00 23.85  ? 216 TYR B CE1 1 
ATOM   3869 C  CE2 . TYR B 1 193 ? 39.682 62.990  36.517  1.00 18.97  ? 216 TYR B CE2 1 
ATOM   3870 C  CZ  . TYR B 1 193 ? 39.523 64.027  37.413  1.00 28.46  ? 216 TYR B CZ  1 
ATOM   3871 O  OH  . TYR B 1 193 ? 39.555 65.319  36.950  1.00 29.91  ? 216 TYR B OH  1 
ATOM   3872 N  N   . PHE B 1 194 ? 37.261 59.701  41.053  1.00 10.75  ? 217 PHE B N   1 
ATOM   3873 C  CA  . PHE B 1 194 ? 36.581 60.439  42.103  1.00 10.16  ? 217 PHE B CA  1 
ATOM   3874 C  C   . PHE B 1 194 ? 37.652 60.979  43.039  1.00 15.05  ? 217 PHE B C   1 
ATOM   3875 O  O   . PHE B 1 194 ? 38.214 60.237  43.853  1.00 11.07  ? 217 PHE B O   1 
ATOM   3876 C  CB  . PHE B 1 194 ? 35.589 59.529  42.833  1.00 11.96  ? 217 PHE B CB  1 
ATOM   3877 C  CG  . PHE B 1 194 ? 34.501 58.996  41.945  1.00 13.72  ? 217 PHE B CG  1 
ATOM   3878 C  CD1 . PHE B 1 194 ? 34.644 57.772  41.301  1.00 11.41  ? 217 PHE B CD1 1 
ATOM   3879 C  CD2 . PHE B 1 194 ? 33.346 59.740  41.721  1.00 12.39  ? 217 PHE B CD2 1 
ATOM   3880 C  CE1 . PHE B 1 194 ? 33.637 57.290  40.459  1.00 12.46  ? 217 PHE B CE1 1 
ATOM   3881 C  CE2 . PHE B 1 194 ? 32.338 59.264  40.881  1.00 18.70  ? 217 PHE B CE2 1 
ATOM   3882 C  CZ  . PHE B 1 194 ? 32.493 58.037  40.248  1.00 15.66  ? 217 PHE B CZ  1 
ATOM   3883 N  N   . SER B 1 195 ? 37.969 62.265  42.891  1.00 11.77  ? 218 SER B N   1 
ATOM   3884 C  CA  . SER B 1 195 ? 38.983 62.902  43.729  1.00 9.60   ? 218 SER B CA  1 
ATOM   3885 C  C   . SER B 1 195 ? 38.395 63.125  45.109  1.00 6.73   ? 218 SER B C   1 
ATOM   3886 O  O   . SER B 1 195 ? 37.194 62.897  45.329  1.00 8.98   ? 218 SER B O   1 
ATOM   3887 C  CB  . SER B 1 195 ? 39.386 64.254  43.146  1.00 12.07  ? 218 SER B CB  1 
ATOM   3888 O  OG  . SER B 1 195 ? 38.330 65.168  43.361  1.00 10.35  ? 218 SER B OG  1 
ATOM   3889 N  N   . MET B 1 196 ? 39.219 63.591  46.045  1.00 7.68   ? 219 MET B N   1 
ATOM   3890 C  CA  . MET B 1 196 ? 38.694 63.896  47.385  1.00 8.64   ? 219 MET B CA  1 
ATOM   3891 C  C   . MET B 1 196 ? 37.550 64.915  47.320  1.00 6.23   ? 219 MET B C   1 
ATOM   3892 O  O   . MET B 1 196 ? 36.594 64.849  48.102  1.00 8.81   ? 219 MET B O   1 
ATOM   3893 C  CB  . MET B 1 196 ? 39.809 64.394  48.318  1.00 7.51   ? 219 MET B CB  1 
ATOM   3894 C  CG  . MET B 1 196 ? 40.906 63.355  48.625  1.00 7.86   ? 219 MET B CG  1 
ATOM   3895 S  SD  . MET B 1 196 ? 40.242 61.811  49.272  1.00 10.38  ? 219 MET B SD  1 
ATOM   3896 C  CE  . MET B 1 196 ? 39.197 62.355  50.630  1.00 7.53   ? 219 MET B CE  1 
ATOM   3897 N  N   . ARG B 1 197 ? 37.656 65.855  46.384  1.00 12.12  ? 220 ARG B N   1 
ATOM   3898 C  CA  . ARG B 1 197 ? 36.595 66.830  46.128  1.00 9.94   ? 220 ARG B CA  1 
ATOM   3899 C  C   . ARG B 1 197 ? 35.276 66.148  45.716  1.00 8.98   ? 220 ARG B C   1 
ATOM   3900 O  O   . ARG B 1 197 ? 34.199 66.495  46.205  1.00 9.18   ? 220 ARG B O   1 
ATOM   3901 C  CB  . ARG B 1 197 ? 37.064 67.836  45.061  1.00 8.26   ? 220 ARG B CB  1 
ATOM   3902 C  CG  . ARG B 1 197 ? 36.005 68.858  44.667  1.00 17.30  ? 220 ARG B CG  1 
ATOM   3903 C  CD  . ARG B 1 197 ? 36.486 69.858  43.604  1.00 16.98  ? 220 ARG B CD  1 
ATOM   3904 N  NE  . ARG B 1 197 ? 35.312 70.452  42.967  1.00 16.30  ? 220 ARG B NE  1 
ATOM   3905 C  CZ  . ARG B 1 197 ? 34.685 71.538  43.406  1.00 17.53  ? 220 ARG B CZ  1 
ATOM   3906 N  NH1 . ARG B 1 197 ? 35.136 72.193  44.474  1.00 12.97  ? 220 ARG B NH1 1 
ATOM   3907 N  NH2 . ARG B 1 197 ? 33.605 71.971  42.762  1.00 19.34  ? 220 ARG B NH2 1 
ATOM   3908 N  N   . ASP B 1 198 ? 35.352 65.170  44.818  1.00 7.16   ? 221 ASP B N   1 
ATOM   3909 C  CA  . ASP B 1 198 ? 34.156 64.420  44.433  1.00 8.79   ? 221 ASP B CA  1 
ATOM   3910 C  C   . ASP B 1 198 ? 33.558 63.699  45.632  1.00 10.35  ? 221 ASP B C   1 
ATOM   3911 O  O   . ASP B 1 198 ? 32.333 63.599  45.788  1.00 8.78   ? 221 ASP B O   1 
ATOM   3912 C  CB  . ASP B 1 198 ? 34.489 63.423  43.317  1.00 10.86  ? 221 ASP B CB  1 
ATOM   3913 C  CG  . ASP B 1 198 ? 34.879 64.108  42.034  1.00 15.97  ? 221 ASP B CG  1 
ATOM   3914 O  OD1 . ASP B 1 198 ? 34.161 65.055  41.636  1.00 18.05  ? 221 ASP B OD1 1 
ATOM   3915 O  OD2 . ASP B 1 198 ? 35.912 63.727  41.446  1.00 12.30  ? 221 ASP B OD2 1 
ATOM   3916 N  N   . ILE B 1 199 ? 34.425 63.184  46.491  1.00 8.46   ? 222 ILE B N   1 
ATOM   3917 C  CA  . ILE B 1 199 ? 33.934 62.523  47.686  1.00 7.35   ? 222 ILE B CA  1 
ATOM   3918 C  C   . ILE B 1 199 ? 33.252 63.520  48.620  1.00 8.81   ? 222 ILE B C   1 
ATOM   3919 O  O   . ILE B 1 199 ? 32.195 63.235  49.181  1.00 9.69   ? 222 ILE B O   1 
ATOM   3920 C  CB  . ILE B 1 199 ? 35.052 61.740  48.413  1.00 6.93   ? 222 ILE B CB  1 
ATOM   3921 C  CG1 . ILE B 1 199 ? 35.631 60.669  47.484  1.00 9.43   ? 222 ILE B CG1 1 
ATOM   3922 C  CG2 . ILE B 1 199 ? 34.519 61.082  49.692  1.00 8.92   ? 222 ILE B CG2 1 
ATOM   3923 C  CD1 . ILE B 1 199 ? 36.880 59.963  48.049  1.00 6.67   ? 222 ILE B CD1 1 
ATOM   3924 N  N   . ASP B 1 200 ? 33.855 64.692  48.786  1.00 8.62   ? 223 ASP B N   1 
ATOM   3925 C  CA  . ASP B 1 200 ? 33.237 65.739  49.606  1.00 10.25  ? 223 ASP B CA  1 
ATOM   3926 C  C   . ASP B 1 200 ? 31.815 66.070  49.142  1.00 7.18   ? 223 ASP B C   1 
ATOM   3927 O  O   . ASP B 1 200 ? 30.917 66.315  49.962  1.00 10.99  ? 223 ASP B O   1 
ATOM   3928 C  CB  . ASP B 1 200 ? 34.093 67.003  49.549  1.00 12.07  ? 223 ASP B CB  1 
ATOM   3929 C  CG  . ASP B 1 200 ? 35.428 66.838  50.249  1.00 14.59  ? 223 ASP B CG  1 
ATOM   3930 O  OD1 . ASP B 1 200 ? 35.526 65.972  51.157  1.00 10.63  ? 223 ASP B OD1 1 
ATOM   3931 O  OD2 . ASP B 1 200 ? 36.371 67.577  49.891  1.00 10.90  ? 223 ASP B OD2 1 
ATOM   3932 N  N   . ARG B 1 201 ? 31.614 66.046  47.823  1.00 9.57   ? 224 ARG B N   1 
ATOM   3933 C  CA  . ARG B 1 201 ? 30.343 66.419  47.199  1.00 10.26  ? 224 ARG B CA  1 
ATOM   3934 C  C   . ARG B 1 201 ? 29.332 65.285  47.234  1.00 9.35   ? 224 ARG B C   1 
ATOM   3935 O  O   . ARG B 1 201 ? 28.191 65.462  47.669  1.00 12.88  ? 224 ARG B O   1 
ATOM   3936 C  CB  . ARG B 1 201 ? 30.594 66.825  45.736  1.00 8.39   ? 224 ARG B CB  1 
ATOM   3937 C  CG  . ARG B 1 201 ? 31.395 68.107  45.599  1.00 13.47  ? 224 ARG B CG  1 
ATOM   3938 C  CD  . ARG B 1 201 ? 31.846 68.366  44.157  1.00 17.80  ? 224 ARG B CD  1 
ATOM   3939 N  NE  . ARG B 1 201 ? 30.727 68.298  43.215  1.00 19.36  ? 224 ARG B NE  1 
ATOM   3940 C  CZ  . ARG B 1 201 ? 29.904 69.310  42.936  1.00 35.83  ? 224 ARG B CZ  1 
ATOM   3941 N  NH1 . ARG B 1 201 ? 30.051 70.492  43.538  1.00 22.51  ? 224 ARG B NH1 1 
ATOM   3942 N  NH2 . ARG B 1 201 ? 28.921 69.135  42.057  1.00 24.77  ? 224 ARG B NH2 1 
ATOM   3943 N  N   . LEU B 1 202 ? 29.769 64.112  46.787  1.00 7.77   ? 225 LEU B N   1 
ATOM   3944 C  CA  . LEU B 1 202 ? 28.870 62.970  46.589  1.00 8.72   ? 225 LEU B CA  1 
ATOM   3945 C  C   . LEU B 1 202 ? 28.688 62.137  47.837  1.00 11.87  ? 225 LEU B C   1 
ATOM   3946 O  O   . LEU B 1 202 ? 27.628 61.546  48.053  1.00 12.31  ? 225 LEU B O   1 
ATOM   3947 C  CB  . LEU B 1 202 ? 29.413 62.071  45.469  1.00 10.15  ? 225 LEU B CB  1 
ATOM   3948 C  CG  . LEU B 1 202 ? 29.405 62.666  44.060  1.00 14.88  ? 225 LEU B CG  1 
ATOM   3949 C  CD1 . LEU B 1 202 ? 30.177 61.779  43.082  1.00 12.08  ? 225 LEU B CD1 1 
ATOM   3950 C  CD2 . LEU B 1 202 ? 27.973 62.856  43.590  1.00 19.26  ? 225 LEU B CD2 1 
ATOM   3951 N  N   . GLY B 1 203 ? 29.728 62.077  48.662  1.00 10.33  ? 226 GLY B N   1 
ATOM   3952 C  CA  . GLY B 1 203 ? 29.740 61.116  49.750  1.00 9.49   ? 226 GLY B CA  1 
ATOM   3953 C  C   . GLY B 1 203 ? 30.226 59.773  49.249  1.00 11.51  ? 226 GLY B C   1 
ATOM   3954 O  O   . GLY B 1 203 ? 30.050 59.422  48.079  1.00 9.84   ? 226 GLY B O   1 
ATOM   3955 N  N   . ILE B 1 204 ? 30.854 59.005  50.128  1.00 8.13   ? 227 ILE B N   1 
ATOM   3956 C  CA  . ILE B 1 204 ? 31.472 57.754  49.695  1.00 7.41   ? 227 ILE B CA  1 
ATOM   3957 C  C   . ILE B 1 204 ? 30.462 56.702  49.184  1.00 11.19  ? 227 ILE B C   1 
ATOM   3958 O  O   . ILE B 1 204 ? 30.804 55.895  48.315  1.00 11.79  ? 227 ILE B O   1 
ATOM   3959 C  CB  . ILE B 1 204 ? 32.415 57.193  50.803  1.00 7.93   ? 227 ILE B CB  1 
ATOM   3960 C  CG1 . ILE B 1 204 ? 33.366 56.131  50.249  1.00 8.22   ? 227 ILE B CG1 1 
ATOM   3961 C  CG2 . ILE B 1 204 ? 31.605 56.659  51.955  1.00 6.49   ? 227 ILE B CG2 1 
ATOM   3962 C  CD1 . ILE B 1 204 ? 34.404 56.677  49.294  1.00 10.43  ? 227 ILE B CD1 1 
ATOM   3963 N  N   . GLN B 1 205 ? 29.226 56.718  49.685  1.00 7.92   ? 228 GLN B N   1 
ATOM   3964 C  CA  . GLN B 1 205 ? 28.225 55.762  49.187  1.00 12.93  ? 228 GLN B CA  1 
ATOM   3965 C  C   . GLN B 1 205 ? 27.979 55.942  47.695  1.00 14.25  ? 228 GLN B C   1 
ATOM   3966 O  O   . GLN B 1 205 ? 28.068 54.981  46.922  1.00 11.49  ? 228 GLN B O   1 
ATOM   3967 C  CB  . GLN B 1 205 ? 26.886 55.856  49.929  1.00 13.20  ? 228 GLN B CB  1 
ATOM   3968 C  CG  . GLN B 1 205 ? 25.773 55.032  49.208  1.00 17.91  ? 228 GLN B CG  1 
ATOM   3969 C  CD  . GLN B 1 205 ? 24.391 55.197  49.816  1.00 29.25  ? 228 GLN B CD  1 
ATOM   3970 O  OE1 . GLN B 1 205 ? 24.235 55.787  50.881  1.00 24.38  ? 228 GLN B OE1 1 
ATOM   3971 N  NE2 . GLN B 1 205 ? 23.372 54.680  49.128  1.00 26.14  ? 228 GLN B NE2 1 
ATOM   3972 N  N   . LYS B 1 206 ? 27.691 57.172  47.280  1.00 12.62  ? 229 LYS B N   1 
ATOM   3973 C  CA  . LYS B 1 206 ? 27.454 57.439  45.863  1.00 10.01  ? 229 LYS B CA  1 
ATOM   3974 C  C   . LYS B 1 206 ? 28.699 57.207  45.011  1.00 10.91  ? 229 LYS B C   1 
ATOM   3975 O  O   . LYS B 1 206 ? 28.600 56.776  43.862  1.00 12.30  ? 229 LYS B O   1 
ATOM   3976 C  CB  . LYS B 1 206 ? 26.908 58.856  45.648  1.00 12.46  ? 229 LYS B CB  1 
ATOM   3977 C  CG  . LYS B 1 206 ? 25.449 59.025  46.064  1.00 24.55  ? 229 LYS B CG  1 
ATOM   3978 C  CD  . LYS B 1 206 ? 24.819 60.264  45.410  1.00 37.32  ? 229 LYS B CD  1 
ATOM   3979 C  CE  . LYS B 1 206 ? 23.360 60.434  45.836  1.00 35.08  ? 229 LYS B CE  1 
ATOM   3980 N  NZ  . LYS B 1 206 ? 23.249 60.921  47.235  1.00 40.50  ? 229 LYS B NZ  1 
ATOM   3981 N  N   . VAL B 1 207 ? 29.871 57.510  45.560  1.00 9.80   ? 230 VAL B N   1 
ATOM   3982 C  CA  . VAL B 1 207 ? 31.111 57.249  44.849  1.00 8.79   ? 230 VAL B CA  1 
ATOM   3983 C  C   . VAL B 1 207 ? 31.254 55.762  44.492  1.00 8.75   ? 230 VAL B C   1 
ATOM   3984 O  O   . VAL B 1 207 ? 31.606 55.413  43.361  1.00 11.05  ? 230 VAL B O   1 
ATOM   3985 C  CB  . VAL B 1 207 ? 32.343 57.753  45.643  1.00 15.07  ? 230 VAL B CB  1 
ATOM   3986 C  CG1 . VAL B 1 207 ? 33.631 57.123  45.126  1.00 10.09  ? 230 VAL B CG1 1 
ATOM   3987 C  CG2 . VAL B 1 207 ? 32.413 59.287  45.580  1.00 9.79   ? 230 VAL B CG2 1 
ATOM   3988 N  N   . MET B 1 208 ? 30.968 54.893  45.451  1.00 10.02  ? 231 MET B N   1 
ATOM   3989 C  CA  . MET B 1 208 ? 31.076 53.459  45.194  1.00 8.87   ? 231 MET B CA  1 
ATOM   3990 C  C   . MET B 1 208 ? 29.997 52.985  44.211  1.00 10.33  ? 231 MET B C   1 
ATOM   3991 O  O   . MET B 1 208 ? 30.261 52.164  43.322  1.00 8.96   ? 231 MET B O   1 
ATOM   3992 C  CB  . MET B 1 208 ? 31.022 52.675  46.511  1.00 10.62  ? 231 MET B CB  1 
ATOM   3993 C  CG  . MET B 1 208 ? 32.204 52.968  47.468  1.00 8.70   ? 231 MET B CG  1 
ATOM   3994 S  SD  . MET B 1 208 ? 33.804 52.980  46.633  1.00 11.74  ? 231 MET B SD  1 
ATOM   3995 C  CE  . MET B 1 208 ? 33.910 51.282  46.039  1.00 11.34  ? 231 MET B CE  1 
ATOM   3996 N  N   . GLU B 1 209 ? 28.782 53.502  44.374  1.00 10.01  ? 232 GLU B N   1 
ATOM   3997 C  CA  . GLU B 1 209 ? 27.696 53.184  43.446  1.00 11.73  ? 232 GLU B CA  1 
ATOM   3998 C  C   . GLU B 1 209 ? 28.074 53.526  42.020  1.00 12.03  ? 232 GLU B C   1 
ATOM   3999 O  O   . GLU B 1 209 ? 27.874 52.725  41.092  1.00 12.47  ? 232 GLU B O   1 
ATOM   4000 C  CB  . GLU B 1 209 ? 26.429 53.931  43.838  1.00 13.76  ? 232 GLU B CB  1 
ATOM   4001 C  CG  . GLU B 1 209 ? 25.689 53.300  44.998  1.00 21.23  ? 232 GLU B CG  1 
ATOM   4002 C  CD  . GLU B 1 209 ? 24.583 54.192  45.517  1.00 25.81  ? 232 GLU B CD  1 
ATOM   4003 O  OE1 . GLU B 1 209 ? 23.874 53.771  46.450  1.00 34.13  ? 232 GLU B OE1 1 
ATOM   4004 O  OE2 . GLU B 1 209 ? 24.434 55.317  44.996  1.00 28.29  ? 232 GLU B OE2 1 
ATOM   4005 N  N   . ARG B 1 210 ? 28.620 54.724  41.833  1.00 9.82   ? 233 ARG B N   1 
ATOM   4006 C  CA  . ARG B 1 210 ? 28.977 55.171  40.494  1.00 12.65  ? 233 ARG B CA  1 
ATOM   4007 C  C   . ARG B 1 210 ? 30.171 54.423  39.944  1.00 11.00  ? 233 ARG B C   1 
ATOM   4008 O  O   . ARG B 1 210 ? 30.265 54.176  38.738  1.00 11.12  ? 233 ARG B O   1 
ATOM   4009 C  CB  . ARG B 1 210 ? 29.234 56.680  40.468  1.00 14.79  ? 233 ARG B CB  1 
ATOM   4010 C  CG  . ARG B 1 210 ? 28.000 57.494  40.779  1.00 17.88  ? 233 ARG B CG  1 
ATOM   4011 C  CD  . ARG B 1 210 ? 28.272 58.968  40.574  1.00 25.16  ? 233 ARG B CD  1 
ATOM   4012 N  NE  . ARG B 1 210 ? 27.092 59.771  40.876  1.00 26.89  ? 233 ARG B NE  1 
ATOM   4013 C  CZ  . ARG B 1 210 ? 26.954 61.045  40.528  1.00 24.34  ? 233 ARG B CZ  1 
ATOM   4014 N  NH1 . ARG B 1 210 ? 27.925 61.656  39.867  1.00 30.58  ? 233 ARG B NH1 1 
ATOM   4015 N  NH2 . ARG B 1 210 ? 25.849 61.701  40.844  1.00 35.20  ? 233 ARG B NH2 1 
ATOM   4016 N  N   . THR B 1 211 ? 31.096 54.076  40.828  1.00 9.67   ? 234 THR B N   1 
ATOM   4017 C  CA  . THR B 1 211 ? 32.268 53.314  40.421  1.00 7.15   ? 234 THR B CA  1 
ATOM   4018 C  C   . THR B 1 211 ? 31.858 51.972  39.821  1.00 7.46   ? 234 THR B C   1 
ATOM   4019 O  O   . THR B 1 211 ? 32.333 51.575  38.754  1.00 9.15   ? 234 THR B O   1 
ATOM   4020 C  CB  . THR B 1 211 ? 33.212 53.095  41.618  1.00 8.12   ? 234 THR B CB  1 
ATOM   4021 O  OG1 . THR B 1 211 ? 33.761 54.360  42.028  1.00 9.30   ? 234 THR B OG1 1 
ATOM   4022 C  CG2 . THR B 1 211 ? 34.331 52.137  41.235  1.00 8.88   ? 234 THR B CG2 1 
ATOM   4023 N  N   . PHE B 1 212 ? 30.983 51.275  40.532  1.00 7.75   ? 235 PHE B N   1 
ATOM   4024 C  CA  . PHE B 1 212 ? 30.517 49.964  40.087  1.00 11.13  ? 235 PHE B CA  1 
ATOM   4025 C  C   . PHE B 1 212 ? 29.613 50.063  38.869  1.00 12.08  ? 235 PHE B C   1 
ATOM   4026 O  O   . PHE B 1 212 ? 29.674 49.218  37.975  1.00 14.25  ? 235 PHE B O   1 
ATOM   4027 C  CB  . PHE B 1 212 ? 29.850 49.219  41.238  1.00 11.93  ? 235 PHE B CB  1 
ATOM   4028 C  CG  . PHE B 1 212 ? 30.803 48.894  42.339  1.00 9.17   ? 235 PHE B CG  1 
ATOM   4029 C  CD1 . PHE B 1 212 ? 32.114 48.547  42.028  1.00 15.68  ? 235 PHE B CD1 1 
ATOM   4030 C  CD2 . PHE B 1 212 ? 30.416 48.957  43.665  1.00 15.12  ? 235 PHE B CD2 1 
ATOM   4031 C  CE1 . PHE B 1 212 ? 33.032 48.263  43.026  1.00 19.79  ? 235 PHE B CE1 1 
ATOM   4032 C  CE2 . PHE B 1 212 ? 31.334 48.681  44.676  1.00 15.14  ? 235 PHE B CE2 1 
ATOM   4033 C  CZ  . PHE B 1 212 ? 32.640 48.331  44.349  1.00 16.58  ? 235 PHE B CZ  1 
ATOM   4034 N  N   . ASP B 1 213 ? 28.808 51.119  38.795  1.00 13.07  ? 236 ASP B N   1 
ATOM   4035 C  CA  A ASP B 1 213 ? 28.021 51.318  37.576  0.59 12.71  ? 236 ASP B CA  1 
ATOM   4036 C  CA  B ASP B 1 213 ? 28.121 51.318  37.576  0.41 12.71  ? 236 ASP B CA  1 
ATOM   4037 C  C   . ASP B 1 213 ? 28.920 51.473  36.347  1.00 13.99  ? 236 ASP B C   1 
ATOM   4038 O  O   . ASP B 1 213 ? 28.645 50.896  35.295  1.00 12.96  ? 236 ASP B O   1 
ATOM   4039 C  CB  A ASP B 1 213 ? 27.057 52.499  37.705  0.59 19.29  ? 236 ASP B CB  1 
ATOM   4040 C  CB  B ASP B 1 213 ? 27.157 52.499  37.705  0.41 19.29  ? 236 ASP B CB  1 
ATOM   4041 C  CG  A ASP B 1 213 ? 26.029 52.527  36.576  0.59 41.63  ? 236 ASP B CG  1 
ATOM   4042 C  CG  B ASP B 1 213 ? 25.963 52.170  38.598  0.41 41.63  ? 236 ASP B CG  1 
ATOM   4043 O  OD1 A ASP B 1 213 ? 25.449 51.457  36.275  0.59 38.16  ? 236 ASP B OD1 1 
ATOM   4044 O  OD1 B ASP B 1 213 ? 25.741 50.968  38.874  0.41 38.16  ? 236 ASP B OD1 1 
ATOM   4045 O  OD2 A ASP B 1 213 ? 25.814 53.608  35.982  0.59 48.38  ? 236 ASP B OD2 1 
ATOM   4046 O  OD2 B ASP B 1 213 ? 25.241 53.107  39.010  0.41 48.38  ? 236 ASP B OD2 1 
ATOM   4047 N  N   . LEU B 1 214 ? 30.017 52.213  36.486  1.00 8.87   ? 237 LEU B N   1 
ATOM   4048 C  CA  . LEU B 1 214 ? 30.979 52.376  35.400  1.00 9.93   ? 237 LEU B CA  1 
ATOM   4049 C  C   . LEU B 1 214 ? 31.695 51.092  35.013  1.00 16.29  ? 237 LEU B C   1 
ATOM   4050 O  O   . LEU B 1 214 ? 31.951 50.842  33.831  1.00 15.50  ? 237 LEU B O   1 
ATOM   4051 C  CB  . LEU B 1 214 ? 32.042 53.415  35.765  1.00 9.08   ? 237 LEU B CB  1 
ATOM   4052 C  CG  . LEU B 1 214 ? 31.602 54.874  35.840  1.00 17.39  ? 237 LEU B CG  1 
ATOM   4053 C  CD1 . LEU B 1 214 ? 32.680 55.696  36.565  1.00 14.55  ? 237 LEU B CD1 1 
ATOM   4054 C  CD2 . LEU B 1 214 ? 31.346 55.404  34.438  1.00 19.72  ? 237 LEU B CD2 1 
ATOM   4055 N  N   . LEU B 1 215 ? 32.044 50.290  36.011  1.00 10.36  ? 238 LEU B N   1 
ATOM   4056 C  CA  . LEU B 1 215 ? 32.898 49.133  35.766  1.00 11.21  ? 238 LEU B CA  1 
ATOM   4057 C  C   . LEU B 1 215 ? 32.106 47.860  35.502  1.00 10.61  ? 238 LEU B C   1 
ATOM   4058 O  O   . LEU B 1 215 ? 32.429 47.100  34.587  1.00 11.34  ? 238 LEU B O   1 
ATOM   4059 C  CB  . LEU B 1 215 ? 33.846 48.914  36.954  1.00 12.30  ? 238 LEU B CB  1 
ATOM   4060 C  CG  . LEU B 1 215 ? 34.903 49.996  37.191  1.00 9.97   ? 238 LEU B CG  1 
ATOM   4061 C  CD1 . LEU B 1 215 ? 35.824 49.616  38.354  1.00 8.84   ? 238 LEU B CD1 1 
ATOM   4062 C  CD2 . LEU B 1 215 ? 35.708 50.219  35.917  1.00 6.73   ? 238 LEU B CD2 1 
ATOM   4063 N  N   . ILE B 1 216 ? 31.091 47.618  36.320  1.00 8.52   ? 239 ILE B N   1 
ATOM   4064 C  CA  . ILE B 1 216 ? 30.325 46.383  36.233  1.00 11.29  ? 239 ILE B CA  1 
ATOM   4065 C  C   . ILE B 1 216 ? 28.829 46.629  36.126  1.00 9.20   ? 239 ILE B C   1 
ATOM   4066 O  O   . ILE B 1 216 ? 28.033 45.776  36.521  1.00 13.56  ? 239 ILE B O   1 
ATOM   4067 C  CB  . ILE B 1 216 ? 30.590 45.442  37.446  1.00 9.44   ? 239 ILE B CB  1 
ATOM   4068 C  CG1 . ILE B 1 216 ? 30.311 46.166  38.765  1.00 14.50  ? 239 ILE B CG1 1 
ATOM   4069 C  CG2 . ILE B 1 216 ? 32.004 44.930  37.439  1.00 10.89  ? 239 ILE B CG2 1 
ATOM   4070 C  CD1 . ILE B 1 216 ? 30.418 45.261  39.992  1.00 17.34  ? 239 ILE B CD1 1 
ATOM   4071 N  N   . GLY B 1 217 ? 28.438 47.788  35.609  1.00 13.20  ? 240 GLY B N   1 
ATOM   4072 C  CA  . GLY B 1 217 ? 27.017 48.077  35.508  1.00 15.72  ? 240 GLY B CA  1 
ATOM   4073 C  C   . GLY B 1 217 ? 26.330 47.155  34.511  1.00 21.85  ? 240 GLY B C   1 
ATOM   4074 O  O   . GLY B 1 217 ? 25.152 46.832  34.652  1.00 19.24  ? 240 GLY B O   1 
ATOM   4075 N  N   . LYS B 1 218 ? 27.072 46.710  33.505  1.00 11.88  ? 241 LYS B N   1 
ATOM   4076 C  CA  . LYS B 1 218 ? 26.457 45.892  32.458  1.00 25.31  ? 241 LYS B CA  1 
ATOM   4077 C  C   . LYS B 1 218 ? 26.899 44.429  32.365  1.00 22.58  ? 241 LYS B C   1 
ATOM   4078 O  O   . LYS B 1 218 ? 26.233 43.615  31.718  1.00 15.98  ? 241 LYS B O   1 
ATOM   4079 C  CB  . LYS B 1 218 ? 26.537 46.630  31.122  1.00 26.72  ? 241 LYS B CB  1 
ATOM   4080 C  CG  . LYS B 1 218 ? 25.502 47.758  31.136  1.00 38.42  ? 241 LYS B CG  1 
ATOM   4081 C  CD  . LYS B 1 218 ? 25.501 48.661  29.933  1.00 47.44  ? 241 LYS B CD  1 
ATOM   4082 C  CE  . LYS B 1 218 ? 24.386 49.685  30.118  1.00 58.21  ? 241 LYS B CE  1 
ATOM   4083 N  NZ  . LYS B 1 218 ? 24.299 50.681  29.018  1.00 69.77  ? 241 LYS B NZ  1 
ATOM   4084 N  N   . ARG B 1 219 ? 28.035 44.108  32.972  1.00 13.68  ? 242 ARG B N   1 
ATOM   4085 C  CA  . ARG B 1 219 ? 28.515 42.729  33.011  1.00 13.43  ? 242 ARG B CA  1 
ATOM   4086 C  C   . ARG B 1 219 ? 29.347 42.512  34.281  1.00 20.19  ? 242 ARG B C   1 
ATOM   4087 O  O   . ARG B 1 219 ? 29.935 43.460  34.811  1.00 12.04  ? 242 ARG B O   1 
ATOM   4088 C  CB  . ARG B 1 219 ? 29.352 42.410  31.760  1.00 11.23  ? 242 ARG B CB  1 
ATOM   4089 C  CG  . ARG B 1 219 ? 30.691 43.158  31.644  1.00 17.57  ? 242 ARG B CG  1 
ATOM   4090 C  CD  . ARG B 1 219 ? 31.402 42.826  30.328  1.00 16.34  ? 242 ARG B CD  1 
ATOM   4091 N  NE  . ARG B 1 219 ? 32.724 43.451  30.216  1.00 20.79  ? 242 ARG B NE  1 
ATOM   4092 C  CZ  . ARG B 1 219 ? 32.952 44.693  29.785  1.00 17.44  ? 242 ARG B CZ  1 
ATOM   4093 N  NH1 . ARG B 1 219 ? 34.198 45.159  29.725  1.00 17.33  ? 242 ARG B NH1 1 
ATOM   4094 N  NH2 . ARG B 1 219 ? 31.948 45.463  29.390  1.00 21.42  ? 242 ARG B NH2 1 
ATOM   4095 N  N   . GLN B 1 220 ? 29.350 41.281  34.792  1.00 10.71  ? 243 GLN B N   1 
ATOM   4096 C  CA  . GLN B 1 220 ? 30.196 40.926  35.927  1.00 11.28  ? 243 GLN B CA  1 
ATOM   4097 C  C   . GLN B 1 220 ? 31.631 40.794  35.470  1.00 13.38  ? 243 GLN B C   1 
ATOM   4098 O  O   . GLN B 1 220 ? 31.912 40.237  34.404  1.00 12.12  ? 243 GLN B O   1 
ATOM   4099 C  CB  . GLN B 1 220 ? 29.718 39.631  36.593  1.00 11.12  ? 243 GLN B CB  1 
ATOM   4100 C  CG  . GLN B 1 220 ? 28.287 39.717  37.105  1.00 11.31  ? 243 GLN B CG  1 
ATOM   4101 C  CD  . GLN B 1 220 ? 28.194 40.363  38.478  1.00 18.68  ? 243 GLN B CD  1 
ATOM   4102 O  OE1 . GLN B 1 220 ? 28.326 39.699  39.506  1.00 21.17  ? 243 GLN B OE1 1 
ATOM   4103 N  NE2 . GLN B 1 220 ? 27.946 41.666  38.497  1.00 16.49  ? 243 GLN B NE2 1 
ATOM   4104 N  N   . ARG B 1 221 ? 32.546 41.328  36.271  1.00 9.24   ? 244 ARG B N   1 
ATOM   4105 C  CA  . ARG B 1 221 ? 33.969 41.266  35.964  1.00 9.20   ? 244 ARG B CA  1 
ATOM   4106 C  C   . ARG B 1 221 ? 34.753 41.041  37.244  1.00 10.12  ? 244 ARG B C   1 
ATOM   4107 O  O   . ARG B 1 221 ? 34.369 41.550  38.296  1.00 12.23  ? 244 ARG B O   1 
ATOM   4108 C  CB  . ARG B 1 221 ? 34.420 42.582  35.324  1.00 8.72   ? 244 ARG B CB  1 
ATOM   4109 C  CG  . ARG B 1 221 ? 33.592 43.018  34.100  1.00 11.41  ? 244 ARG B CG  1 
ATOM   4110 C  CD  . ARG B 1 221 ? 33.887 44.465  33.716  1.00 13.20  ? 244 ARG B CD  1 
ATOM   4111 N  NE  . ARG B 1 221 ? 35.176 44.606  33.049  1.00 11.50  ? 244 ARG B NE  1 
ATOM   4112 C  CZ  . ARG B 1 221 ? 35.643 45.744  32.555  1.00 10.90  ? 244 ARG B CZ  1 
ATOM   4113 N  NH1 . ARG B 1 221 ? 34.935 46.855  32.692  1.00 11.44  ? 244 ARG B NH1 1 
ATOM   4114 N  NH2 . ARG B 1 221 ? 36.821 45.765  31.941  1.00 9.33   ? 244 ARG B NH2 1 
ATOM   4115 N  N   . PRO B 1 222 ? 35.865 40.303  37.150  1.00 8.56   ? 245 PRO B N   1 
ATOM   4116 C  CA  . PRO B 1 222 ? 36.733 40.190  38.326  1.00 10.91  ? 245 PRO B CA  1 
ATOM   4117 C  C   . PRO B 1 222 ? 37.272 41.569  38.664  1.00 10.71  ? 245 PRO B C   1 
ATOM   4118 O  O   . PRO B 1 222 ? 37.643 42.310  37.756  1.00 9.82   ? 245 PRO B O   1 
ATOM   4119 C  CB  . PRO B 1 222 ? 37.881 39.295  37.847  1.00 8.68   ? 245 PRO B CB  1 
ATOM   4120 C  CG  . PRO B 1 222 ? 37.850 39.355  36.348  1.00 15.22  ? 245 PRO B CG  1 
ATOM   4121 C  CD  . PRO B 1 222 ? 36.418 39.629  35.959  1.00 7.80   ? 245 PRO B CD  1 
ATOM   4122 N  N   . ILE B 1 223 ? 37.309 41.905  39.944  1.00 11.14  ? 246 ILE B N   1 
ATOM   4123 C  CA  . ILE B 1 223 ? 37.779 43.225  40.353  1.00 8.46   ? 246 ILE B CA  1 
ATOM   4124 C  C   . ILE B 1 223 ? 39.192 43.103  40.898  1.00 10.09  ? 246 ILE B C   1 
ATOM   4125 O  O   . ILE B 1 223 ? 39.487 42.193  41.682  1.00 11.04  ? 246 ILE B O   1 
ATOM   4126 C  CB  . ILE B 1 223 ? 36.859 43.825  41.423  1.00 10.96  ? 246 ILE B CB  1 
ATOM   4127 C  CG1 . ILE B 1 223 ? 35.484 44.123  40.814  1.00 6.82   ? 246 ILE B CG1 1 
ATOM   4128 C  CG2 . ILE B 1 223 ? 37.492 45.085  42.051  1.00 8.30   ? 246 ILE B CG2 1 
ATOM   4129 C  CD1 . ILE B 1 223 ? 34.433 44.547  41.844  1.00 11.27  ? 246 ILE B CD1 1 
ATOM   4130 N  N   . HIS B 1 224 ? 40.061 44.004  40.449  1.00 7.16   ? 247 HIS B N   1 
ATOM   4131 C  CA  . HIS B 1 224 ? 41.400 44.153  41.005  1.00 10.03  ? 247 HIS B CA  1 
ATOM   4132 C  C   . HIS B 1 224 ? 41.408 45.436  41.823  1.00 10.18  ? 247 HIS B C   1 
ATOM   4133 O  O   . HIS B 1 224 ? 41.313 46.523  41.261  1.00 9.58   ? 247 HIS B O   1 
ATOM   4134 C  CB  . HIS B 1 224 ? 42.447 44.253  39.893  1.00 7.77   ? 247 HIS B CB  1 
ATOM   4135 C  CG  . HIS B 1 224 ? 43.860 44.204  40.382  1.00 9.74   ? 247 HIS B CG  1 
ATOM   4136 N  ND1 . HIS B 1 224 ? 44.706 43.148  40.120  1.00 11.35  ? 247 HIS B ND1 1 
ATOM   4137 C  CD2 . HIS B 1 224 ? 44.570 45.077  41.149  1.00 9.96   ? 247 HIS B CD2 1 
ATOM   4138 C  CE1 . HIS B 1 224 ? 45.880 43.373  40.689  1.00 11.75  ? 247 HIS B CE1 1 
ATOM   4139 N  NE2 . HIS B 1 224 ? 45.821 44.528  41.321  1.00 10.72  ? 247 HIS B NE2 1 
ATOM   4140 N  N   . LEU B 1 225 ? 41.525 45.310  43.144  1.00 7.76   ? 248 LEU B N   1 
ATOM   4141 C  CA  . LEU B 1 225 ? 41.596 46.486  44.012  1.00 6.33   ? 248 LEU B CA  1 
ATOM   4142 C  C   . LEU B 1 225 ? 43.048 46.821  44.291  1.00 12.18  ? 248 LEU B C   1 
ATOM   4143 O  O   . LEU B 1 225 ? 43.750 46.064  44.969  1.00 10.57  ? 248 LEU B O   1 
ATOM   4144 C  CB  . LEU B 1 225 ? 40.863 46.242  45.331  1.00 6.31   ? 248 LEU B CB  1 
ATOM   4145 C  CG  . LEU B 1 225 ? 40.976 47.355  46.381  1.00 9.98   ? 248 LEU B CG  1 
ATOM   4146 C  CD1 . LEU B 1 225 ? 40.309 48.612  45.859  1.00 8.97   ? 248 LEU B CD1 1 
ATOM   4147 C  CD2 . LEU B 1 225 ? 40.338 46.894  47.701  1.00 6.04   ? 248 LEU B CD2 1 
ATOM   4148 N  N   . SER B 1 226 ? 43.521 47.945  43.753  1.00 7.08   ? 249 SER B N   1 
ATOM   4149 C  CA  . SER B 1 226 ? 44.896 48.356  44.036  1.00 6.49   ? 249 SER B CA  1 
ATOM   4150 C  C   . SER B 1 226 ? 44.838 49.503  45.033  1.00 10.16  ? 249 SER B C   1 
ATOM   4151 O  O   . SER B 1 226 ? 44.456 50.623  44.688  1.00 7.83   ? 249 SER B O   1 
ATOM   4152 C  CB  . SER B 1 226 ? 45.651 48.768  42.771  1.00 7.85   ? 249 SER B CB  1 
ATOM   4153 O  OG  . SER B 1 226 ? 47.058 48.657  42.979  1.00 9.00   ? 249 SER B OG  1 
ATOM   4154 N  N   . PHE B 1 227 ? 45.202 49.207  46.273  1.00 8.61   ? 250 PHE B N   1 
ATOM   4155 C  CA  . PHE B 1 227 ? 44.974 50.141  47.372  1.00 7.87   ? 250 PHE B CA  1 
ATOM   4156 C  C   . PHE B 1 227 ? 46.311 50.641  47.910  1.00 11.34  ? 250 PHE B C   1 
ATOM   4157 O  O   . PHE B 1 227 ? 47.065 49.894  48.529  1.00 7.76   ? 250 PHE B O   1 
ATOM   4158 C  CB  . PHE B 1 227 ? 44.149 49.453  48.466  1.00 8.03   ? 250 PHE B CB  1 
ATOM   4159 C  CG  . PHE B 1 227 ? 43.419 50.401  49.386  1.00 9.99   ? 250 PHE B CG  1 
ATOM   4160 C  CD1 . PHE B 1 227 ? 44.122 51.275  50.202  1.00 10.23  ? 250 PHE B CD1 1 
ATOM   4161 C  CD2 . PHE B 1 227 ? 42.031 50.362  49.482  1.00 8.66   ? 250 PHE B CD2 1 
ATOM   4162 C  CE1 . PHE B 1 227 ? 43.447 52.134  51.066  1.00 10.03  ? 250 PHE B CE1 1 
ATOM   4163 C  CE2 . PHE B 1 227 ? 41.350 51.200  50.346  1.00 10.27  ? 250 PHE B CE2 1 
ATOM   4164 C  CZ  . PHE B 1 227 ? 42.059 52.087  51.147  1.00 9.85   ? 250 PHE B CZ  1 
ATOM   4165 N  N   . ASP B 1 228 ? 46.595 51.911  47.641  1.00 7.57   ? 251 ASP B N   1 
ATOM   4166 C  CA  . ASP B 1 228 ? 47.776 52.591  48.156  1.00 4.53   ? 251 ASP B CA  1 
ATOM   4167 C  C   . ASP B 1 228 ? 47.378 53.156  49.507  1.00 8.62   ? 251 ASP B C   1 
ATOM   4168 O  O   . ASP B 1 228 ? 46.430 53.937  49.598  1.00 7.56   ? 251 ASP B O   1 
ATOM   4169 C  CB  . ASP B 1 228 ? 48.154 53.701  47.164  1.00 7.67   ? 251 ASP B CB  1 
ATOM   4170 C  CG  . ASP B 1 228 ? 49.438 54.411  47.505  1.00 9.70   ? 251 ASP B CG  1 
ATOM   4171 O  OD1 . ASP B 1 228 ? 49.801 54.485  48.703  1.00 8.89   ? 251 ASP B OD1 1 
ATOM   4172 O  OD2 . ASP B 1 228 ? 50.097 54.925  46.558  1.00 7.97   ? 251 ASP B OD2 1 
ATOM   4173 N  N   . ILE B 1 229 ? 48.084 52.752  50.561  1.00 8.29   ? 252 ILE B N   1 
ATOM   4174 C  CA  . ILE B 1 229 ? 47.749 53.205  51.908  1.00 7.04   ? 252 ILE B CA  1 
ATOM   4175 C  C   . ILE B 1 229 ? 47.716 54.741  52.016  1.00 7.36   ? 252 ILE B C   1 
ATOM   4176 O  O   . ILE B 1 229 ? 46.977 55.291  52.846  1.00 8.00   ? 252 ILE B O   1 
ATOM   4177 C  CB  . ILE B 1 229 ? 48.696 52.567  52.974  1.00 7.41   ? 252 ILE B CB  1 
ATOM   4178 C  CG1 . ILE B 1 229 ? 48.066 52.590  54.369  1.00 10.21  ? 252 ILE B CG1 1 
ATOM   4179 C  CG2 . ILE B 1 229 ? 50.028 53.285  53.008  1.00 9.81   ? 252 ILE B CG2 1 
ATOM   4180 C  CD1 . ILE B 1 229 ? 46.866 51.662  54.550  1.00 6.11   ? 252 ILE B CD1 1 
ATOM   4181 N  N   . ASP B 1 230 ? 48.455 55.441  51.157  1.00 4.70   ? 253 ASP B N   1 
ATOM   4182 C  CA  . ASP B 1 230 ? 48.449 56.917  51.201  1.00 8.29   ? 253 ASP B CA  1 
ATOM   4183 C  C   . ASP B 1 230 ? 47.126 57.537  50.742  1.00 8.38   ? 253 ASP B C   1 
ATOM   4184 O  O   . ASP B 1 230 ? 46.946 58.754  50.772  1.00 5.24   ? 253 ASP B O   1 
ATOM   4185 C  CB  . ASP B 1 230 ? 49.695 57.539  50.526  1.00 6.65   ? 253 ASP B CB  1 
ATOM   4186 C  CG  . ASP B 1 230 ? 49.685 57.469  48.986  1.00 10.98  ? 253 ASP B CG  1 
ATOM   4187 O  OD1 . ASP B 1 230 ? 48.627 57.327  48.341  1.00 9.55   ? 253 ASP B OD1 1 
ATOM   4188 O  OD2 . ASP B 1 230 ? 50.788 57.588  48.403  1.00 8.29   ? 253 ASP B OD2 1 
ATOM   4189 N  N   . ALA B 1 231 ? 46.176 56.699  50.336  1.00 7.44   ? 254 ALA B N   1 
ATOM   4190 C  CA  . ALA B 1 231 ? 44.827 57.207  50.087  1.00 7.69   ? 254 ALA B CA  1 
ATOM   4191 C  C   . ALA B 1 231 ? 44.236 57.767  51.380  1.00 6.69   ? 254 ALA B C   1 
ATOM   4192 O  O   . ALA B 1 231 ? 43.438 58.719  51.369  1.00 8.83   ? 254 ALA B O   1 
ATOM   4193 C  CB  . ALA B 1 231 ? 43.921 56.118  49.528  1.00 9.22   ? 254 ALA B CB  1 
ATOM   4194 N  N   . PHE B 1 232 ? 44.614 57.155  52.496  1.00 7.48   ? 255 PHE B N   1 
ATOM   4195 C  CA  . PHE B 1 232 ? 44.137 57.592  53.802  1.00 9.59   ? 255 PHE B CA  1 
ATOM   4196 C  C   . PHE B 1 232 ? 44.812 58.885  54.207  1.00 8.85   ? 255 PHE B C   1 
ATOM   4197 O  O   . PHE B 1 232 ? 45.976 59.138  53.856  1.00 6.43   ? 255 PHE B O   1 
ATOM   4198 C  CB  . PHE B 1 232 ? 44.439 56.534  54.879  1.00 6.73   ? 255 PHE B CB  1 
ATOM   4199 C  CG  . PHE B 1 232 ? 43.489 55.361  54.875  1.00 8.60   ? 255 PHE B CG  1 
ATOM   4200 C  CD1 . PHE B 1 232 ? 42.183 55.508  55.325  1.00 6.17   ? 255 PHE B CD1 1 
ATOM   4201 C  CD2 . PHE B 1 232 ? 43.907 54.111  54.423  1.00 9.53   ? 255 PHE B CD2 1 
ATOM   4202 C  CE1 . PHE B 1 232 ? 41.305 54.430  55.338  1.00 8.68   ? 255 PHE B CE1 1 
ATOM   4203 C  CE2 . PHE B 1 232 ? 43.025 53.022  54.422  1.00 7.28   ? 255 PHE B CE2 1 
ATOM   4204 C  CZ  . PHE B 1 232 ? 41.729 53.186  54.884  1.00 7.24   ? 255 PHE B CZ  1 
ATOM   4205 N  N   . ASP B 1 233 ? 44.103 59.686  54.989  1.00 6.31   ? 256 ASP B N   1 
ATOM   4206 C  CA  . ASP B 1 233 ? 44.732 60.858  55.584  1.00 8.58   ? 256 ASP B CA  1 
ATOM   4207 C  C   . ASP B 1 233 ? 46.007 60.473  56.351  1.00 9.70   ? 256 ASP B C   1 
ATOM   4208 O  O   . ASP B 1 233 ? 46.029 59.457  57.046  1.00 12.10  ? 256 ASP B O   1 
ATOM   4209 C  CB  . ASP B 1 233 ? 43.775 61.560  56.531  1.00 8.27   ? 256 ASP B CB  1 
ATOM   4210 C  CG  . ASP B 1 233 ? 44.243 62.943  56.851  1.00 15.66  ? 256 ASP B CG  1 
ATOM   4211 O  OD1 . ASP B 1 233 ? 44.047 63.825  55.995  1.00 12.01  ? 256 ASP B OD1 1 
ATOM   4212 O  OD2 . ASP B 1 233 ? 44.869 63.120  57.916  1.00 14.09  ? 256 ASP B OD2 1 
ATOM   4213 N  N   . PRO B 1 234 ? 47.069 61.278  56.216  1.00 8.54   ? 257 PRO B N   1 
ATOM   4214 C  CA  . PRO B 1 234 ? 48.335 61.014  56.906  1.00 11.59  ? 257 PRO B CA  1 
ATOM   4215 C  C   . PRO B 1 234 ? 48.191 60.899  58.422  1.00 11.70  ? 257 PRO B C   1 
ATOM   4216 O  O   . PRO B 1 234 ? 49.051 60.278  59.045  1.00 11.56  ? 257 PRO B O   1 
ATOM   4217 C  CB  . PRO B 1 234 ? 49.203 62.224  56.532  1.00 17.17  ? 257 PRO B CB  1 
ATOM   4218 C  CG  . PRO B 1 234 ? 48.676 62.661  55.214  1.00 13.63  ? 257 PRO B CG  1 
ATOM   4219 C  CD  . PRO B 1 234 ? 47.185 62.419  55.283  1.00 10.75  ? 257 PRO B CD  1 
ATOM   4220 N  N   . THR B 1 235 ? 47.151 61.482  59.011  1.00 11.06  ? 258 THR B N   1 
ATOM   4221 C  CA  . THR B 1 235 ? 46.928 61.286  60.441  1.00 16.91  ? 258 THR B CA  1 
ATOM   4222 C  C   . THR B 1 235 ? 46.621 59.826  60.761  1.00 19.81  ? 258 THR B C   1 
ATOM   4223 O  O   . THR B 1 235 ? 46.900 59.359  61.862  1.00 15.03  ? 258 THR B O   1 
ATOM   4224 C  CB  . THR B 1 235 ? 45.804 62.192  60.985  1.00 20.30  ? 258 THR B CB  1 
ATOM   4225 O  OG1 . THR B 1 235 ? 44.590 61.939  60.266  1.00 18.15  ? 258 THR B OG1 1 
ATOM   4226 C  CG2 . THR B 1 235 ? 46.192 63.662  60.811  1.00 11.99  ? 258 THR B CG2 1 
ATOM   4227 N  N   . LEU B 1 236 ? 46.064 59.105  59.791  1.00 13.29  ? 259 LEU B N   1 
ATOM   4228 C  CA  . LEU B 1 236 ? 45.705 57.696  59.971  1.00 14.88  ? 259 LEU B CA  1 
ATOM   4229 C  C   . LEU B 1 236 ? 46.779 56.749  59.449  1.00 12.95  ? 259 LEU B C   1 
ATOM   4230 O  O   . LEU B 1 236 ? 46.977 55.658  59.990  1.00 12.90  ? 259 LEU B O   1 
ATOM   4231 C  CB  . LEU B 1 236 ? 44.395 57.398  59.229  1.00 12.40  ? 259 LEU B CB  1 
ATOM   4232 C  CG  . LEU B 1 236 ? 43.194 58.240  59.663  1.00 19.32  ? 259 LEU B CG  1 
ATOM   4233 C  CD1 . LEU B 1 236 ? 42.043 58.058  58.677  1.00 16.32  ? 259 LEU B CD1 1 
ATOM   4234 C  CD2 . LEU B 1 236 ? 42.749 57.858  61.071  1.00 21.85  ? 259 LEU B CD2 1 
ATOM   4235 N  N   . ALA B 1 237 ? 47.450 57.160  58.381  1.00 11.25  ? 260 ALA B N   1 
ATOM   4236 C  CA  . ALA B 1 237 ? 48.478 56.341  57.741  1.00 12.26  ? 260 ALA B CA  1 
ATOM   4237 C  C   . ALA B 1 237 ? 49.760 57.124  57.574  1.00 9.72   ? 260 ALA B C   1 
ATOM   4238 O  O   . ALA B 1 237 ? 50.160 57.444  56.445  1.00 9.23   ? 260 ALA B O   1 
ATOM   4239 C  CB  . ALA B 1 237 ? 47.989 55.826  56.382  1.00 9.01   ? 260 ALA B CB  1 
ATOM   4240 N  N   . PRO B 1 238 ? 50.434 57.436  58.694  1.00 9.62   ? 261 PRO B N   1 
ATOM   4241 C  CA  . PRO B 1 238 ? 51.625 58.284  58.556  1.00 12.15  ? 261 PRO B CA  1 
ATOM   4242 C  C   . PRO B 1 238 ? 52.811 57.542  57.948  1.00 14.27  ? 261 PRO B C   1 
ATOM   4243 O  O   . PRO B 1 238 ? 53.672 58.166  57.331  1.00 12.65  ? 261 PRO B O   1 
ATOM   4244 C  CB  . PRO B 1 238 ? 51.937 58.691  60.004  1.00 9.11   ? 261 PRO B CB  1 
ATOM   4245 C  CG  . PRO B 1 238 ? 51.356 57.598  60.842  1.00 14.42  ? 261 PRO B CG  1 
ATOM   4246 C  CD  . PRO B 1 238 ? 50.123 57.128  60.104  1.00 10.99  ? 261 PRO B CD  1 
ATOM   4247 N  N   . ALA B 1 239 ? 52.854 56.226  58.117  1.00 10.80  ? 262 ALA B N   1 
ATOM   4248 C  CA  . ALA B 1 239 ? 54.020 55.459  57.696  1.00 10.68  ? 262 ALA B CA  1 
ATOM   4249 C  C   . ALA B 1 239 ? 53.955 55.120  56.215  1.00 9.37   ? 262 ALA B C   1 
ATOM   4250 O  O   . ALA B 1 239 ? 53.678 53.980  55.839  1.00 9.34   ? 262 ALA B O   1 
ATOM   4251 C  CB  . ALA B 1 239 ? 54.164 54.202  58.543  1.00 10.64  ? 262 ALA B CB  1 
ATOM   4252 N  N   . THR B 1 240 ? 54.220 56.124  55.385  1.00 8.85   ? 263 THR B N   1 
ATOM   4253 C  CA  . THR B 1 240 ? 54.174 55.971  53.941  1.00 8.61   ? 263 THR B CA  1 
ATOM   4254 C  C   . THR B 1 240 ? 55.018 57.055  53.286  1.00 12.62  ? 263 THR B C   1 
ATOM   4255 O  O   . THR B 1 240 ? 55.251 58.116  53.880  1.00 8.91   ? 263 THR B O   1 
ATOM   4256 C  CB  . THR B 1 240 ? 52.709 56.003  53.428  1.00 10.36  ? 263 THR B CB  1 
ATOM   4257 O  OG1 . THR B 1 240 ? 52.655 55.520  52.073  1.00 9.70   ? 263 THR B OG1 1 
ATOM   4258 C  CG2 . THR B 1 240 ? 52.131 57.442  53.509  1.00 11.65  ? 263 THR B CG2 1 
ATOM   4259 N  N   . GLY B 1 241 ? 55.481 56.778  52.070  1.00 11.17  ? 264 GLY B N   1 
ATOM   4260 C  CA  . GLY B 1 241 ? 56.480 57.597  51.414  1.00 14.05  ? 264 GLY B CA  1 
ATOM   4261 C  C   . GLY B 1 241 ? 56.040 58.946  50.870  1.00 17.48  ? 264 GLY B C   1 
ATOM   4262 O  O   . GLY B 1 241 ? 56.829 59.887  50.829  1.00 11.33  ? 264 GLY B O   1 
ATOM   4263 N  N   A THR B 1 242 ? 54.791 59.039  50.432  0.30 10.66  ? 265 THR B N   1 
ATOM   4264 N  N   B THR B 1 242 ? 54.787 59.042  50.440  0.70 10.55  ? 265 THR B N   1 
ATOM   4265 C  CA  A THR B 1 242 ? 54.293 60.280  49.849  0.30 11.55  ? 265 THR B CA  1 
ATOM   4266 C  CA  B THR B 1 242 ? 54.290 60.284  49.844  0.70 11.50  ? 265 THR B CA  1 
ATOM   4267 C  C   A THR B 1 242 ? 52.939 60.669  50.428  0.30 13.20  ? 265 THR B C   1 
ATOM   4268 C  C   B THR B 1 242 ? 52.932 60.664  50.429  0.70 13.20  ? 265 THR B C   1 
ATOM   4269 O  O   A THR B 1 242 ? 51.927 60.612  49.730  0.30 12.08  ? 265 THR B O   1 
ATOM   4270 O  O   B THR B 1 242 ? 51.910 60.585  49.743  0.70 12.05  ? 265 THR B O   1 
ATOM   4271 C  CB  A THR B 1 242 ? 54.186 60.164  48.316  0.30 13.32  ? 265 THR B CB  1 
ATOM   4272 C  CB  B THR B 1 242 ? 54.202 60.170  48.305  0.70 13.31  ? 265 THR B CB  1 
ATOM   4273 O  OG1 A THR B 1 242 ? 53.296 59.093  47.974  0.30 13.56  ? 265 THR B OG1 1 
ATOM   4274 O  OG1 B THR B 1 242 ? 55.379 59.525  47.805  0.70 13.37  ? 265 THR B OG1 1 
ATOM   4275 C  CG2 A THR B 1 242 ? 55.545 59.879  47.720  0.30 13.71  ? 265 THR B CG2 1 
ATOM   4276 C  CG2 B THR B 1 242 ? 54.075 61.541  47.662  0.70 17.68  ? 265 THR B CG2 1 
ATOM   4277 N  N   . PRO B 1 243 ? 52.919 61.069  51.712  1.00 11.35  ? 266 PRO B N   1 
ATOM   4278 C  CA  . PRO B 1 243 ? 51.676 61.423  52.400  1.00 10.43  ? 266 PRO B CA  1 
ATOM   4279 C  C   . PRO B 1 243 ? 51.150 62.730  51.835  1.00 16.79  ? 266 PRO B C   1 
ATOM   4280 O  O   . PRO B 1 243 ? 51.944 63.602  51.479  1.00 12.23  ? 266 PRO B O   1 
ATOM   4281 C  CB  . PRO B 1 243 ? 52.123 61.607  53.861  1.00 11.71  ? 266 PRO B CB  1 
ATOM   4282 C  CG  . PRO B 1 243 ? 53.553 62.029  53.763  1.00 19.39  ? 266 PRO B CG  1 
ATOM   4283 C  CD  . PRO B 1 243 ? 54.105 61.283  52.574  1.00 13.20  ? 266 PRO B CD  1 
ATOM   4284 N  N   . VAL B 1 244 ? 49.836 62.853  51.730  1.00 10.29  ? 267 VAL B N   1 
ATOM   4285 C  CA  . VAL B 1 244 ? 49.219 64.076  51.244  1.00 11.84  ? 267 VAL B CA  1 
ATOM   4286 C  C   . VAL B 1 244 ? 48.066 64.407  52.159  1.00 13.54  ? 267 VAL B C   1 
ATOM   4287 O  O   . VAL B 1 244 ? 47.186 63.573  52.393  1.00 10.79  ? 267 VAL B O   1 
ATOM   4288 C  CB  . VAL B 1 244 ? 48.691 63.897  49.805  1.00 10.38  ? 267 VAL B CB  1 
ATOM   4289 C  CG1 . VAL B 1 244 ? 48.056 65.206  49.295  1.00 12.75  ? 267 VAL B CG1 1 
ATOM   4290 C  CG2 . VAL B 1 244 ? 49.818 63.451  48.871  1.00 10.65  ? 267 VAL B CG2 1 
ATOM   4291 N  N   . VAL B 1 245 ? 48.065 65.615  52.710  1.00 10.68  ? 268 VAL B N   1 
ATOM   4292 C  CA  . VAL B 1 245 ? 46.975 65.993  53.609  1.00 10.00  ? 268 VAL B CA  1 
ATOM   4293 C  C   . VAL B 1 245 ? 45.603 65.914  52.935  1.00 8.04   ? 268 VAL B C   1 
ATOM   4294 O  O   . VAL B 1 245 ? 45.477 66.033  51.709  1.00 9.75   ? 268 VAL B O   1 
ATOM   4295 C  CB  . VAL B 1 245 ? 47.164 67.413  54.196  1.00 12.69  ? 268 VAL B CB  1 
ATOM   4296 C  CG1 . VAL B 1 245 ? 48.410 67.449  55.089  1.00 17.90  ? 268 VAL B CG1 1 
ATOM   4297 C  CG2 . VAL B 1 245 ? 47.264 68.439  53.076  1.00 14.69  ? 268 VAL B CG2 1 
ATOM   4298 N  N   . GLY B 1 246 ? 44.585 65.672  53.755  1.00 6.12   ? 269 GLY B N   1 
ATOM   4299 C  CA  . GLY B 1 246 ? 43.193 65.722  53.337  1.00 9.64   ? 269 GLY B CA  1 
ATOM   4300 C  C   . GLY B 1 246 ? 42.694 64.444  52.691  1.00 11.07  ? 269 GLY B C   1 
ATOM   4301 O  O   . GLY B 1 246 ? 41.979 64.493  51.693  1.00 8.40   ? 269 GLY B O   1 
ATOM   4302 N  N   . GLY B 1 247 ? 43.049 63.305  53.279  1.00 7.70   ? 270 GLY B N   1 
ATOM   4303 C  CA  . GLY B 1 247 ? 42.702 62.014  52.696  1.00 7.65   ? 270 GLY B CA  1 
ATOM   4304 C  C   . GLY B 1 247 ? 41.438 61.374  53.216  1.00 11.88  ? 270 GLY B C   1 
ATOM   4305 O  O   . GLY B 1 247 ? 40.664 61.991  53.960  1.00 6.12   ? 270 GLY B O   1 
ATOM   4306 N  N   . LEU B 1 248 ? 41.233 60.115  52.830  1.00 6.59   ? 271 LEU B N   1 
ATOM   4307 C  CA  . LEU B 1 248 ? 40.088 59.340  53.282  1.00 9.42   ? 271 LEU B CA  1 
ATOM   4308 C  C   . LEU B 1 248 ? 40.099 59.242  54.787  1.00 7.23   ? 271 LEU B C   1 
ATOM   4309 O  O   . LEU B 1 248 ? 41.167 59.136  55.393  1.00 8.83   ? 271 LEU B O   1 
ATOM   4310 C  CB  . LEU B 1 248 ? 40.172 57.916  52.724  1.00 6.89   ? 271 LEU B CB  1 
ATOM   4311 C  CG  . LEU B 1 248 ? 40.139 57.811  51.201  1.00 8.25   ? 271 LEU B CG  1 
ATOM   4312 C  CD1 . LEU B 1 248 ? 40.416 56.373  50.770  1.00 10.31  ? 271 LEU B CD1 1 
ATOM   4313 C  CD2 . LEU B 1 248 ? 38.749 58.250  50.727  1.00 7.06   ? 271 LEU B CD2 1 
ATOM   4314 N  N   . THR B 1 249 ? 38.918 59.260  55.388  1.00 8.75   ? 272 THR B N   1 
ATOM   4315 C  CA  . THR B 1 249 ? 38.806 58.930  56.798  1.00 8.40   ? 272 THR B CA  1 
ATOM   4316 C  C   . THR B 1 249 ? 38.836 57.414  56.948  1.00 13.81  ? 272 THR B C   1 
ATOM   4317 O  O   . THR B 1 249 ? 38.699 56.671  55.963  1.00 7.02   ? 272 THR B O   1 
ATOM   4318 C  CB  . THR B 1 249 ? 37.507 59.442  57.394  1.00 10.15  ? 272 THR B CB  1 
ATOM   4319 O  OG1 . THR B 1 249 ? 36.414 58.781  56.753  1.00 8.44   ? 272 THR B OG1 1 
ATOM   4320 C  CG2 . THR B 1 249 ? 37.392 60.948  57.201  1.00 8.64   ? 272 THR B CG2 1 
ATOM   4321 N  N   . TYR B 1 250 ? 39.025 56.958  58.180  1.00 9.35   ? 273 TYR B N   1 
ATOM   4322 C  CA  . TYR B 1 250 ? 38.975 55.540  58.470  1.00 7.08   ? 273 TYR B CA  1 
ATOM   4323 C  C   . TYR B 1 250 ? 37.666 54.933  57.969  1.00 9.04   ? 273 TYR B C   1 
ATOM   4324 O  O   . TYR B 1 250 ? 37.659 53.920  57.258  1.00 8.27   ? 273 TYR B O   1 
ATOM   4325 C  CB  . TYR B 1 250 ? 39.126 55.310  59.983  1.00 8.42   ? 273 TYR B CB  1 
ATOM   4326 C  CG  . TYR B 1 250 ? 39.026 53.852  60.364  1.00 10.68  ? 273 TYR B CG  1 
ATOM   4327 C  CD1 . TYR B 1 250 ? 40.138 53.033  60.291  1.00 14.13  ? 273 TYR B CD1 1 
ATOM   4328 C  CD2 . TYR B 1 250 ? 37.824 53.300  60.802  1.00 9.54   ? 273 TYR B CD2 1 
ATOM   4329 C  CE1 . TYR B 1 250 ? 40.074 51.698  60.624  1.00 11.61  ? 273 TYR B CE1 1 
ATOM   4330 C  CE2 . TYR B 1 250 ? 37.738 51.944  61.145  1.00 11.50  ? 273 TYR B CE2 1 
ATOM   4331 C  CZ  . TYR B 1 250 ? 38.885 51.153  61.043  1.00 14.92  ? 273 TYR B CZ  1 
ATOM   4332 O  OH  . TYR B 1 250 ? 38.876 49.816  61.369  1.00 13.94  ? 273 TYR B OH  1 
ATOM   4333 N  N   . ARG B 1 251 ? 36.560 55.573  58.322  1.00 5.14   ? 274 ARG B N   1 
ATOM   4334 C  CA  . ARG B 1 251 ? 35.243 55.080  57.940  1.00 7.88   ? 274 ARG B CA  1 
ATOM   4335 C  C   . ARG B 1 251 ? 35.052 54.999  56.428  1.00 9.25   ? 274 ARG B C   1 
ATOM   4336 O  O   . ARG B 1 251 ? 34.443 54.040  55.920  1.00 7.22   ? 274 ARG B O   1 
ATOM   4337 C  CB  . ARG B 1 251 ? 34.159 55.934  58.595  1.00 8.05   ? 274 ARG B CB  1 
ATOM   4338 C  CG  . ARG B 1 251 ? 34.023 55.661  60.100  1.00 8.39   ? 274 ARG B CG  1 
ATOM   4339 C  CD  . ARG B 1 251 ? 33.393 56.830  60.844  1.00 10.45  ? 274 ARG B CD  1 
ATOM   4340 N  NE  . ARG B 1 251 ? 32.090 57.203  60.296  1.00 6.65   ? 274 ARG B NE  1 
ATOM   4341 C  CZ  . ARG B 1 251 ? 31.343 58.199  60.764  1.00 12.25  ? 274 ARG B CZ  1 
ATOM   4342 N  NH1 . ARG B 1 251 ? 30.172 58.475  60.200  1.00 9.71   ? 274 ARG B NH1 1 
ATOM   4343 N  NH2 . ARG B 1 251 ? 31.755 58.905  61.816  1.00 6.66   ? 274 ARG B NH2 1 
ATOM   4344 N  N   . GLU B 1 252 ? 35.552 55.997  55.703  1.00 9.39   ? 275 GLU B N   1 
ATOM   4345 C  CA  . GLU B 1 252 ? 35.465 55.968  54.244  1.00 10.57  ? 275 GLU B CA  1 
ATOM   4346 C  C   . GLU B 1 252 ? 36.250 54.797  53.661  1.00 6.93   ? 275 GLU B C   1 
ATOM   4347 O  O   . GLU B 1 252 ? 35.763 54.097  52.775  1.00 9.11   ? 275 GLU B O   1 
ATOM   4348 C  CB  . GLU B 1 252 ? 35.944 57.294  53.639  1.00 6.96   ? 275 GLU B CB  1 
ATOM   4349 C  CG  . GLU B 1 252 ? 34.914 58.424  53.801  1.00 9.41   ? 275 GLU B CG  1 
ATOM   4350 C  CD  . GLU B 1 252 ? 35.472 59.793  53.449  1.00 10.11  ? 275 GLU B CD  1 
ATOM   4351 O  OE1 . GLU B 1 252 ? 36.705 59.977  53.532  1.00 9.54   ? 275 GLU B OE1 1 
ATOM   4352 O  OE2 . GLU B 1 252 ? 34.670 60.684  53.079  1.00 10.80  ? 275 GLU B OE2 1 
ATOM   4353 N  N   . GLY B 1 253 ? 37.466 54.590  54.161  1.00 6.19   ? 276 GLY B N   1 
ATOM   4354 C  CA  . GLY B 1 253 ? 38.287 53.468  53.723  1.00 6.65   ? 276 GLY B CA  1 
ATOM   4355 C  C   . GLY B 1 253 ? 37.600 52.138  53.949  1.00 9.23   ? 276 GLY B C   1 
ATOM   4356 O  O   . GLY B 1 253 ? 37.601 51.247  53.071  1.00 10.84  ? 276 GLY B O   1 
ATOM   4357 N  N   . MET B 1 254 ? 37.026 51.978  55.137  1.00 8.55   ? 277 MET B N   1 
ATOM   4358 C  CA  . MET B 1 254 ? 36.277 50.764  55.442  1.00 10.28  ? 277 MET B CA  1 
ATOM   4359 C  C   . MET B 1 254 ? 35.068 50.623  54.510  1.00 9.57   ? 277 MET B C   1 
ATOM   4360 O  O   . MET B 1 254 ? 34.764 49.530  54.053  1.00 6.79   ? 277 MET B O   1 
ATOM   4361 C  CB  . MET B 1 254 ? 35.826 50.728  56.908  1.00 13.54  ? 277 MET B CB  1 
ATOM   4362 C  CG  . MET B 1 254 ? 36.979 50.661  57.940  1.00 14.37  ? 277 MET B CG  1 
ATOM   4363 S  SD  . MET B 1 254 ? 38.151 49.317  57.647  1.00 13.73  ? 277 MET B SD  1 
ATOM   4364 C  CE  . MET B 1 254 ? 39.486 50.138  56.808  1.00 8.98   ? 277 MET B CE  1 
ATOM   4365 N  N   . TYR B 1 255 ? 34.377 51.724  54.231  1.00 11.03  ? 278 TYR B N   1 
ATOM   4366 C  CA  . TYR B 1 255 ? 33.213 51.656  53.358  1.00 8.54   ? 278 TYR B CA  1 
ATOM   4367 C  C   . TYR B 1 255 ? 33.599 51.199  51.953  1.00 7.77   ? 278 TYR B C   1 
ATOM   4368 O  O   . TYR B 1 255 ? 32.912 50.370  51.348  1.00 9.86   ? 278 TYR B O   1 
ATOM   4369 C  CB  . TYR B 1 255 ? 32.441 52.995  53.311  1.00 9.27   ? 278 TYR B CB  1 
ATOM   4370 C  CG  . TYR B 1 255 ? 31.116 52.835  52.595  1.00 10.28  ? 278 TYR B CG  1 
ATOM   4371 C  CD1 . TYR B 1 255 ? 29.980 52.443  53.281  1.00 13.80  ? 278 TYR B CD1 1 
ATOM   4372 C  CD2 . TYR B 1 255 ? 31.022 53.026  51.221  1.00 13.75  ? 278 TYR B CD2 1 
ATOM   4373 C  CE1 . TYR B 1 255 ? 28.775 52.261  52.622  1.00 14.64  ? 278 TYR B CE1 1 
ATOM   4374 C  CE2 . TYR B 1 255 ? 29.823 52.863  50.558  1.00 11.57  ? 278 TYR B CE2 1 
ATOM   4375 C  CZ  . TYR B 1 255 ? 28.704 52.473  51.264  1.00 15.11  ? 278 TYR B CZ  1 
ATOM   4376 O  OH  . TYR B 1 255 ? 27.508 52.294  50.605  1.00 16.97  ? 278 TYR B OH  1 
ATOM   4377 N  N   . ILE B 1 256 ? 34.682 51.755  51.420  1.00 6.22   ? 279 ILE B N   1 
ATOM   4378 C  CA  . ILE B 1 256 ? 35.192 51.315  50.116  1.00 9.33   ? 279 ILE B CA  1 
ATOM   4379 C  C   . ILE B 1 256 ? 35.415 49.809  50.098  1.00 11.67  ? 279 ILE B C   1 
ATOM   4380 O  O   . ILE B 1 256 ? 34.941 49.092  49.204  1.00 9.06   ? 279 ILE B O   1 
ATOM   4381 C  CB  . ILE B 1 256 ? 36.518 51.999  49.791  1.00 10.71  ? 279 ILE B CB  1 
ATOM   4382 C  CG1 . ILE B 1 256 ? 36.290 53.496  49.553  1.00 11.25  ? 279 ILE B CG1 1 
ATOM   4383 C  CG2 . ILE B 1 256 ? 37.178 51.347  48.571  1.00 7.81   ? 279 ILE B CG2 1 
ATOM   4384 C  CD1 . ILE B 1 256 ? 37.586 54.297  49.439  1.00 9.15   ? 279 ILE B CD1 1 
ATOM   4385 N  N   . ALA B 1 257 ? 36.140 49.329  51.100  1.00 7.08   ? 280 ALA B N   1 
ATOM   4386 C  CA  . ALA B 1 257 ? 36.483 47.914  51.178  1.00 8.75   ? 280 ALA B CA  1 
ATOM   4387 C  C   . ALA B 1 257 ? 35.235 47.050  51.324  1.00 6.30   ? 280 ALA B C   1 
ATOM   4388 O  O   . ALA B 1 257 ? 35.126 45.979  50.705  1.00 10.10  ? 280 ALA B O   1 
ATOM   4389 C  CB  . ALA B 1 257 ? 37.452 47.677  52.352  1.00 8.75   ? 280 ALA B CB  1 
ATOM   4390 N  N   . GLU B 1 258 ? 34.294 47.507  52.147  1.00 7.51   ? 281 GLU B N   1 
ATOM   4391 C  CA  . GLU B 1 258 ? 33.025 46.797  52.323  1.00 11.27  ? 281 GLU B CA  1 
ATOM   4392 C  C   . GLU B 1 258 ? 32.279 46.662  51.007  1.00 13.28  ? 281 GLU B C   1 
ATOM   4393 O  O   . GLU B 1 258 ? 31.768 45.589  50.684  1.00 9.08   ? 281 GLU B O   1 
ATOM   4394 C  CB  . GLU B 1 258 ? 32.146 47.506  53.354  1.00 10.80  ? 281 GLU B CB  1 
ATOM   4395 C  CG  . GLU B 1 258 ? 32.613 47.259  54.792  1.00 10.86  ? 281 GLU B CG  1 
ATOM   4396 C  CD  . GLU B 1 258 ? 32.031 48.255  55.772  1.00 18.30  ? 281 GLU B CD  1 
ATOM   4397 O  OE1 . GLU B 1 258 ? 31.293 49.173  55.338  1.00 12.89  ? 281 GLU B OE1 1 
ATOM   4398 O  OE2 . GLU B 1 258 ? 32.312 48.117  56.982  1.00 15.70  ? 281 GLU B OE2 1 
ATOM   4399 N  N   . GLU B 1 259 ? 32.221 47.748  50.241  1.00 9.70   ? 282 GLU B N   1 
ATOM   4400 C  CA  . GLU B 1 259 ? 31.500 47.710  48.969  1.00 7.21   ? 282 GLU B CA  1 
ATOM   4401 C  C   . GLU B 1 259 ? 32.193 46.799  47.962  1.00 9.84   ? 282 GLU B C   1 
ATOM   4402 O  O   . GLU B 1 259 ? 31.524 46.081  47.208  1.00 13.00  ? 282 GLU B O   1 
ATOM   4403 C  CB  . GLU B 1 259 ? 31.300 49.120  48.409  1.00 10.62  ? 282 GLU B CB  1 
ATOM   4404 C  CG  . GLU B 1 259 ? 30.244 49.884  49.185  1.00 10.88  ? 282 GLU B CG  1 
ATOM   4405 C  CD  . GLU B 1 259 ? 28.969 49.078  49.332  1.00 17.94  ? 282 GLU B CD  1 
ATOM   4406 O  OE1 . GLU B 1 259 ? 28.272 48.879  48.310  1.00 19.80  ? 282 GLU B OE1 1 
ATOM   4407 O  OE2 . GLU B 1 259 ? 28.676 48.614  50.459  1.00 20.21  ? 282 GLU B OE2 1 
ATOM   4408 N  N   . ILE B 1 260 ? 33.524 46.811  47.963  1.00 8.51   ? 283 ILE B N   1 
ATOM   4409 C  CA  . ILE B 1 260 ? 34.292 45.860  47.162  1.00 8.72   ? 283 ILE B CA  1 
ATOM   4410 C  C   . ILE B 1 260 ? 33.883 44.429  47.546  1.00 11.96  ? 283 ILE B C   1 
ATOM   4411 O  O   . ILE B 1 260 ? 33.580 43.598  46.684  1.00 10.80  ? 283 ILE B O   1 
ATOM   4412 C  CB  . ILE B 1 260 ? 35.810 46.025  47.373  1.00 13.67  ? 283 ILE B CB  1 
ATOM   4413 C  CG1 . ILE B 1 260 ? 36.330 47.333  46.754  1.00 11.76  ? 283 ILE B CG1 1 
ATOM   4414 C  CG2 . ILE B 1 260 ? 36.547 44.856  46.744  1.00 10.30  ? 283 ILE B CG2 1 
ATOM   4415 C  CD1 . ILE B 1 260 ? 36.363 47.328  45.217  1.00 13.81  ? 283 ILE B CD1 1 
ATOM   4416 N  N   . HIS B 1 261 ? 33.884 44.132  48.840  1.00 8.39   ? 284 HIS B N   1 
ATOM   4417 C  CA  . HIS B 1 261 ? 33.460 42.803  49.269  1.00 12.45  ? 284 HIS B CA  1 
ATOM   4418 C  C   . HIS B 1 261 ? 32.043 42.490  48.807  1.00 13.30  ? 284 HIS B C   1 
ATOM   4419 O  O   . HIS B 1 261 ? 31.767 41.382  48.342  1.00 13.63  ? 284 HIS B O   1 
ATOM   4420 C  CB  . HIS B 1 261 ? 33.507 42.652  50.784  1.00 9.65   ? 284 HIS B CB  1 
ATOM   4421 C  CG  . HIS B 1 261 ? 32.888 41.377  51.263  1.00 10.50  ? 284 HIS B CG  1 
ATOM   4422 N  ND1 . HIS B 1 261 ? 33.457 40.145  51.025  1.00 11.96  ? 284 HIS B ND1 1 
ATOM   4423 C  CD2 . HIS B 1 261 ? 31.732 41.140  51.930  1.00 11.29  ? 284 HIS B CD2 1 
ATOM   4424 C  CE1 . HIS B 1 261 ? 32.686 39.199  51.541  1.00 15.21  ? 284 HIS B CE1 1 
ATOM   4425 N  NE2 . HIS B 1 261 ? 31.637 39.778  52.096  1.00 15.98  ? 284 HIS B NE2 1 
ATOM   4426 N  N   . ASN B 1 262 ? 31.146 43.467  48.930  1.00 9.64   ? 285 ASN B N   1 
ATOM   4427 C  CA  . ASN B 1 262 ? 29.735 43.220  48.647  1.00 13.93  ? 285 ASN B CA  1 
ATOM   4428 C  C   . ASN B 1 262 ? 29.446 42.924  47.187  1.00 13.83  ? 285 ASN B C   1 
ATOM   4429 O  O   . ASN B 1 262 ? 28.391 42.387  46.869  1.00 14.67  ? 285 ASN B O   1 
ATOM   4430 C  CB  . ASN B 1 262 ? 28.854 44.362  49.150  1.00 11.82  ? 285 ASN B CB  1 
ATOM   4431 C  CG  . ASN B 1 262 ? 28.752 44.393  50.665  1.00 23.41  ? 285 ASN B CG  1 
ATOM   4432 O  OD1 . ASN B 1 262 ? 29.042 43.398  51.335  1.00 16.91  ? 285 ASN B OD1 1 
ATOM   4433 N  ND2 . ASN B 1 262 ? 28.368 45.546  51.216  1.00 17.94  ? 285 ASN B ND2 1 
ATOM   4434 N  N   . THR B 1 263 ? 30.367 43.270  46.294  1.00 8.88   ? 286 THR B N   1 
ATOM   4435 C  CA  . THR B 1 263 ? 30.178 42.918  44.880  1.00 11.82  ? 286 THR B CA  1 
ATOM   4436 C  C   . THR B 1 263 ? 30.282 41.420  44.657  1.00 20.76  ? 286 THR B C   1 
ATOM   4437 O  O   . THR B 1 263 ? 29.760 40.900  43.673  1.00 14.03  ? 286 THR B O   1 
ATOM   4438 C  CB  . THR B 1 263 ? 31.208 43.557  43.967  1.00 10.32  ? 286 THR B CB  1 
ATOM   4439 O  OG1 . THR B 1 263 ? 32.508 42.998  44.238  1.00 12.03  ? 286 THR B OG1 1 
ATOM   4440 C  CG2 . THR B 1 263 ? 31.218 45.071  44.133  1.00 13.49  ? 286 THR B CG2 1 
ATOM   4441 N  N   . GLY B 1 264 ? 30.999 40.741  45.546  1.00 15.40  ? 287 GLY B N   1 
ATOM   4442 C  CA  . GLY B 1 264 ? 31.301 39.331  45.379  1.00 13.66  ? 287 GLY B CA  1 
ATOM   4443 C  C   . GLY B 1 264 ? 32.293 39.047  44.265  1.00 16.91  ? 287 GLY B C   1 
ATOM   4444 O  O   . GLY B 1 264 ? 32.487 37.889  43.895  1.00 14.65  ? 287 GLY B O   1 
ATOM   4445 N  N   . LEU B 1 265 ? 32.927 40.093  43.731  1.00 7.47   ? 288 LEU B N   1 
ATOM   4446 C  CA  . LEU B 1 265 ? 33.807 39.964  42.563  1.00 8.29   ? 288 LEU B CA  1 
ATOM   4447 C  C   . LEU B 1 265 ? 35.292 40.223  42.796  1.00 10.28  ? 288 LEU B C   1 
ATOM   4448 O  O   . LEU B 1 265 ? 36.091 40.189  41.856  1.00 8.01   ? 288 LEU B O   1 
ATOM   4449 C  CB  . LEU B 1 265 ? 33.319 40.892  41.437  1.00 10.85  ? 288 LEU B CB  1 
ATOM   4450 C  CG  . LEU B 1 265 ? 31.926 40.550  40.904  1.00 12.92  ? 288 LEU B CG  1 
ATOM   4451 C  CD1 . LEU B 1 265 ? 31.408 41.681  40.035  1.00 12.36  ? 288 LEU B CD1 1 
ATOM   4452 C  CD2 . LEU B 1 265 ? 31.985 39.261  40.098  1.00 10.86  ? 288 LEU B CD2 1 
ATOM   4453 N  N   . LEU B 1 266 ? 35.678 40.495  44.036  1.00 8.46   ? 289 LEU B N   1 
ATOM   4454 C  CA  . LEU B 1 266 ? 37.081 40.763  44.315  1.00 8.78   ? 289 LEU B CA  1 
ATOM   4455 C  C   . LEU B 1 266 ? 37.932 39.562  43.935  1.00 10.85  ? 289 LEU B C   1 
ATOM   4456 O  O   . LEU B 1 266 ? 37.689 38.457  44.395  1.00 13.78  ? 289 LEU B O   1 
ATOM   4457 C  CB  . LEU B 1 266 ? 37.288 41.107  45.798  1.00 6.55   ? 289 LEU B CB  1 
ATOM   4458 C  CG  . LEU B 1 266 ? 38.747 41.411  46.142  1.00 9.11   ? 289 LEU B CG  1 
ATOM   4459 C  CD1 . LEU B 1 266 ? 39.233 42.624  45.367  1.00 9.03   ? 289 LEU B CD1 1 
ATOM   4460 C  CD2 . LEU B 1 266 ? 38.873 41.638  47.641  1.00 10.83  ? 289 LEU B CD2 1 
ATOM   4461 N  N   . SER B 1 267 ? 38.915 39.779  43.073  1.00 8.38   ? 290 SER B N   1 
ATOM   4462 C  CA  . SER B 1 267 ? 39.737 38.692  42.555  1.00 9.10   ? 290 SER B CA  1 
ATOM   4463 C  C   . SER B 1 267 ? 41.211 38.883  42.912  1.00 12.17  ? 290 SER B C   1 
ATOM   4464 O  O   . SER B 1 267 ? 41.964 37.916  43.068  1.00 11.57  ? 290 SER B O   1 
ATOM   4465 C  CB  . SER B 1 267 ? 39.526 38.581  41.032  1.00 11.11  ? 290 SER B CB  1 
ATOM   4466 O  OG  . SER B 1 267 ? 40.333 37.574  40.448  1.00 11.70  ? 290 SER B OG  1 
ATOM   4467 N  N   . ALA B 1 268 ? 41.630 40.138  43.038  1.00 7.53   ? 291 ALA B N   1 
ATOM   4468 C  CA  . ALA B 1 268 ? 42.985 40.405  43.504  1.00 8.30   ? 291 ALA B CA  1 
ATOM   4469 C  C   . ALA B 1 268 ? 43.024 41.742  44.215  1.00 12.95  ? 291 ALA B C   1 
ATOM   4470 O  O   . ALA B 1 268 ? 42.258 42.657  43.898  1.00 9.00   ? 291 ALA B O   1 
ATOM   4471 C  CB  . ALA B 1 268 ? 43.985 40.379  42.358  1.00 8.84   ? 291 ALA B CB  1 
ATOM   4472 N  N   . LEU B 1 269 ? 43.937 41.857  45.167  1.00 7.66   ? 292 LEU B N   1 
ATOM   4473 C  CA  . LEU B 1 269 ? 44.042 43.076  45.949  1.00 6.87   ? 292 LEU B CA  1 
ATOM   4474 C  C   . LEU B 1 269 ? 45.513 43.369  46.176  1.00 8.30   ? 292 LEU B C   1 
ATOM   4475 O  O   . LEU B 1 269 ? 46.268 42.477  46.548  1.00 10.43  ? 292 LEU B O   1 
ATOM   4476 C  CB  . LEU B 1 269 ? 43.305 42.891  47.279  1.00 10.64  ? 292 LEU B CB  1 
ATOM   4477 C  CG  . LEU B 1 269 ? 43.252 44.032  48.295  1.00 11.29  ? 292 LEU B CG  1 
ATOM   4478 C  CD1 . LEU B 1 269 ? 42.082 43.768  49.205  1.00 12.17  ? 292 LEU B CD1 1 
ATOM   4479 C  CD2 . LEU B 1 269 ? 44.529 44.118  49.121  1.00 11.45  ? 292 LEU B CD2 1 
ATOM   4480 N  N   . ASP B 1 270 ? 45.922 44.615  45.929  1.00 6.70   ? 293 ASP B N   1 
ATOM   4481 C  CA  . ASP B 1 270 ? 47.254 45.066  46.299  1.00 6.88   ? 293 ASP B CA  1 
ATOM   4482 C  C   . ASP B 1 270 ? 47.097 45.964  47.507  1.00 10.20  ? 293 ASP B C   1 
ATOM   4483 O  O   . ASP B 1 270 ? 46.214 46.812  47.513  1.00 8.71   ? 293 ASP B O   1 
ATOM   4484 C  CB  . ASP B 1 270 ? 47.912 45.890  45.189  1.00 6.40   ? 293 ASP B CB  1 
ATOM   4485 C  CG  . ASP B 1 270 ? 47.816 45.241  43.829  1.00 16.22  ? 293 ASP B CG  1 
ATOM   4486 O  OD1 . ASP B 1 270 ? 48.067 44.017  43.728  1.00 10.61  ? 293 ASP B OD1 1 
ATOM   4487 O  OD2 . ASP B 1 270 ? 47.487 45.971  42.859  1.00 11.54  ? 293 ASP B OD2 1 
ATOM   4488 N  N   . LEU B 1 271 ? 47.929 45.821  48.528  1.00 6.61   ? 294 LEU B N   1 
ATOM   4489 C  CA  . LEU B 1 271 ? 47.986 46.783  49.643  1.00 9.04   ? 294 LEU B CA  1 
ATOM   4490 C  C   . LEU B 1 271 ? 49.403 47.306  49.691  1.00 6.29   ? 294 LEU B C   1 
ATOM   4491 O  O   . LEU B 1 271 ? 50.249 46.626  50.157  1.00 8.12   ? 294 LEU B O   1 
ATOM   4492 C  CB  . LEU B 1 271 ? 47.662 46.163  50.957  1.00 8.36   ? 294 LEU B CB  1 
ATOM   4493 C  CG  . LEU B 1 271 ? 47.235 47.118  52.043  1.00 9.02   ? 294 LEU B CG  1 
ATOM   4494 C  CD1 . LEU B 1 271 ? 48.315 48.140  52.337  1.00 7.76   ? 294 LEU B CD1 1 
ATOM   4495 C  CD2 . LEU B 1 271 ? 45.932 47.765  51.692  1.00 9.75   ? 294 LEU B CD2 1 
ATOM   4496 N  N   . VAL B 1 272 ? 49.616 48.484  49.127  1.00 7.15   ? 295 VAL B N   1 
ATOM   4497 C  CA  . VAL B 1 272 ? 50.971 48.959  48.878  1.00 5.18   ? 295 VAL B CA  1 
ATOM   4498 C  C   . VAL B 1 272 ? 51.339 50.222  49.658  1.00 6.55   ? 295 VAL B C   1 
ATOM   4499 O  O   . VAL B 1 272 ? 50.469 50.916  50.211  1.00 6.38   ? 295 VAL B O   1 
ATOM   4500 C  CB  . VAL B 1 272 ? 51.215 49.221  47.373  1.00 8.66   ? 295 VAL B CB  1 
ATOM   4501 C  CG1 . VAL B 1 272 ? 50.896 47.952  46.567  1.00 9.11   ? 295 VAL B CG1 1 
ATOM   4502 C  CG2 . VAL B 1 272 ? 50.363 50.405  46.894  1.00 10.63  ? 295 VAL B CG2 1 
ATOM   4503 N  N   . GLU B 1 273 ? 52.646 50.470  49.702  1.00 8.10   ? 296 GLU B N   1 
ATOM   4504 C  CA  . GLU B 1 273 ? 53.267 51.714  50.189  1.00 11.00  ? 296 GLU B CA  1 
ATOM   4505 C  C   . GLU B 1 273 ? 53.310 51.911  51.711  1.00 11.24  ? 296 GLU B C   1 
ATOM   4506 O  O   . GLU B 1 273 ? 53.641 53.001  52.195  1.00 11.29  ? 296 GLU B O   1 
ATOM   4507 C  CB  . GLU B 1 273 ? 52.712 52.948  49.455  1.00 8.72   ? 296 GLU B CB  1 
ATOM   4508 C  CG  . GLU B 1 273 ? 52.956 52.954  47.918  1.00 6.97   ? 296 GLU B CG  1 
ATOM   4509 C  CD  . GLU B 1 273 ? 54.369 53.352  47.517  1.00 11.75  ? 296 GLU B CD  1 
ATOM   4510 O  OE1 . GLU B 1 273 ? 55.175 53.684  48.418  1.00 13.65  ? 296 GLU B OE1 1 
ATOM   4511 O  OE2 . GLU B 1 273 ? 54.681 53.338  46.294  1.00 13.83  ? 296 GLU B OE2 1 
ATOM   4512 N  N   . VAL B 1 274 ? 53.014 50.861  52.469  1.00 8.66   ? 297 VAL B N   1 
ATOM   4513 C  CA  . VAL B 1 274 ? 53.278 50.901  53.904  1.00 9.68   ? 297 VAL B CA  1 
ATOM   4514 C  C   . VAL B 1 274 ? 54.786 50.847  54.128  1.00 15.14  ? 297 VAL B C   1 
ATOM   4515 O  O   . VAL B 1 274 ? 55.429 49.870  53.756  1.00 10.55  ? 297 VAL B O   1 
ATOM   4516 C  CB  . VAL B 1 274 ? 52.575 49.758  54.667  1.00 9.85   ? 297 VAL B CB  1 
ATOM   4517 C  CG1 . VAL B 1 274 ? 53.039 49.718  56.138  1.00 9.54   ? 297 VAL B CG1 1 
ATOM   4518 C  CG2 . VAL B 1 274 ? 51.076 49.917  54.587  1.00 8.74   ? 297 VAL B CG2 1 
ATOM   4519 N  N   . ASN B 1 275 ? 55.345 51.908  54.711  1.00 10.62  ? 298 ASN B N   1 
ATOM   4520 C  CA  . ASN B 1 275 ? 56.787 51.979  54.977  1.00 8.56   ? 298 ASN B CA  1 
ATOM   4521 C  C   . ASN B 1 275 ? 56.997 52.271  56.448  1.00 14.82  ? 298 ASN B C   1 
ATOM   4522 O  O   . ASN B 1 275 ? 56.970 53.430  56.863  1.00 12.25  ? 298 ASN B O   1 
ATOM   4523 C  CB  . ASN B 1 275 ? 57.464 53.062  54.119  1.00 10.97  ? 298 ASN B CB  1 
ATOM   4524 C  CG  . ASN B 1 275 ? 58.988 53.104  54.306  1.00 13.88  ? 298 ASN B CG  1 
ATOM   4525 O  OD1 . ASN B 1 275 ? 59.522 52.565  55.275  1.00 14.11  ? 298 ASN B OD1 1 
ATOM   4526 N  ND2 . ASN B 1 275 ? 59.685 53.756  53.379  1.00 13.90  ? 298 ASN B ND2 1 
ATOM   4527 N  N   . PRO B 1 276 ? 57.207 51.211  57.241  1.00 12.03  ? 299 PRO B N   1 
ATOM   4528 C  CA  . PRO B 1 276 ? 57.280 51.369  58.695  1.00 16.84  ? 299 PRO B CA  1 
ATOM   4529 C  C   . PRO B 1 276 ? 58.463 52.229  59.121  1.00 15.79  ? 299 PRO B C   1 
ATOM   4530 O  O   . PRO B 1 276 ? 58.399 52.845  60.181  1.00 17.14  ? 299 PRO B O   1 
ATOM   4531 C  CB  . PRO B 1 276 ? 57.417 49.929  59.223  1.00 16.60  ? 299 PRO B CB  1 
ATOM   4532 C  CG  . PRO B 1 276 ? 57.687 49.062  58.052  1.00 19.06  ? 299 PRO B CG  1 
ATOM   4533 C  CD  . PRO B 1 276 ? 57.329 49.807  56.799  1.00 13.36  ? 299 PRO B CD  1 
ATOM   4534 N  N   . GLN B 1 277 ? 59.506 52.296  58.302  1.00 15.78  ? 300 GLN B N   1 
ATOM   4535 C  CA  . GLN B 1 277 ? 60.680 53.091  58.648  1.00 21.90  ? 300 GLN B CA  1 
ATOM   4536 C  C   . GLN B 1 277 ? 60.411 54.597  58.643  1.00 21.12  ? 300 GLN B C   1 
ATOM   4537 O  O   . GLN B 1 277 ? 61.196 55.362  59.194  1.00 22.87  ? 300 GLN B O   1 
ATOM   4538 C  CB  . GLN B 1 277 ? 61.857 52.770  57.713  1.00 20.22  ? 300 GLN B CB  1 
ATOM   4539 C  CG  . GLN B 1 277 ? 62.443 51.367  57.891  1.00 28.61  ? 300 GLN B CG  1 
ATOM   4540 C  CD  . GLN B 1 277 ? 63.738 51.174  57.116  1.00 34.78  ? 300 GLN B CD  1 
ATOM   4541 O  OE1 . GLN B 1 277 ? 64.228 52.097  56.463  1.00 48.81  ? 300 GLN B OE1 1 
ATOM   4542 N  NE2 . GLN B 1 277 ? 64.296 49.971  57.186  1.00 43.70  ? 300 GLN B NE2 1 
ATOM   4543 N  N   . LEU B 1 278 ? 59.320 55.028  58.018  1.00 15.74  ? 301 LEU B N   1 
ATOM   4544 C  CA  . LEU B 1 278 ? 59.049 56.464  57.921  1.00 19.02  ? 301 LEU B CA  1 
ATOM   4545 C  C   . LEU B 1 278 ? 58.186 56.989  59.057  1.00 21.10  ? 301 LEU B C   1 
ATOM   4546 O  O   . LEU B 1 278 ? 57.975 58.193  59.176  1.00 26.70  ? 301 LEU B O   1 
ATOM   4547 C  CB  . LEU B 1 278 ? 58.407 56.807  56.577  1.00 17.53  ? 301 LEU B CB  1 
ATOM   4548 C  CG  . LEU B 1 278 ? 59.296 56.531  55.361  1.00 19.47  ? 301 LEU B CG  1 
ATOM   4549 C  CD1 . LEU B 1 278 ? 58.577 56.947  54.091  1.00 16.21  ? 301 LEU B CD1 1 
ATOM   4550 C  CD2 . LEU B 1 278 ? 60.629 57.260  55.469  1.00 23.90  ? 301 LEU B CD2 1 
ATOM   4551 N  N   . ALA B 1 279 ? 57.700 56.079  59.891  1.00 17.22  ? 302 ALA B N   1 
ATOM   4552 C  CA  . ALA B 1 279 ? 56.957 56.440  61.089  1.00 20.02  ? 302 ALA B CA  1 
ATOM   4553 C  C   . ALA B 1 279 ? 57.920 57.112  62.069  1.00 22.30  ? 302 ALA B C   1 
ATOM   4554 O  O   . ALA B 1 279 ? 59.076 56.713  62.155  1.00 22.65  ? 302 ALA B O   1 
ATOM   4555 C  CB  . ALA B 1 279 ? 56.373 55.198  61.711  1.00 21.49  ? 302 ALA B CB  1 
ATOM   4556 N  N   . THR B 1 280 ? 57.440 58.116  62.805  1.00 25.95  ? 303 THR B N   1 
ATOM   4557 C  CA  . THR B 1 280 ? 58.260 58.816  63.803  1.00 31.31  ? 303 THR B CA  1 
ATOM   4558 C  C   . THR B 1 280 ? 58.277 58.062  65.134  1.00 31.29  ? 303 THR B C   1 
ATOM   4559 O  O   . THR B 1 280 ? 59.129 58.297  65.998  1.00 35.31  ? 303 THR B O   1 
ATOM   4560 C  CB  . THR B 1 280 ? 57.753 60.262  64.047  1.00 31.70  ? 303 THR B CB  1 
ATOM   4561 O  OG1 . THR B 1 280 ? 56.393 60.235  64.500  1.00 43.96  ? 303 THR B OG1 1 
ATOM   4562 C  CG2 . THR B 1 280 ? 57.823 61.086  62.765  1.00 46.90  ? 303 THR B CG2 1 
ATOM   4563 N  N   . SER B 1 281 ? 57.343 57.131  65.281  1.00 20.82  ? 304 SER B N   1 
ATOM   4564 C  CA  . SER B 1 281 ? 57.257 56.316  66.478  1.00 25.06  ? 304 SER B CA  1 
ATOM   4565 C  C   . SER B 1 281 ? 56.800 54.936  66.082  1.00 31.43  ? 304 SER B C   1 
ATOM   4566 O  O   . SER B 1 281 ? 56.213 54.742  65.014  1.00 25.49  ? 304 SER B O   1 
ATOM   4567 C  CB  . SER B 1 281 ? 56.256 56.910  67.465  1.00 27.71  ? 304 SER B CB  1 
ATOM   4568 O  OG  . SER B 1 281 ? 54.932 56.835  66.961  1.00 22.88  ? 304 SER B OG  1 
ATOM   4569 N  N   . GLU B 1 282 ? 57.063 53.963  66.927  1.00 23.83  ? 305 GLU B N   1 
ATOM   4570 C  CA  . GLU B 1 282 ? 56.581 52.657  66.653  1.00 27.41  ? 305 GLU B CA  1 
ATOM   4571 C  C   . GLU B 1 282 ? 55.064 52.588  66.615  1.00 30.01  ? 305 GLU B C   1 
ATOM   4572 O  O   . GLU B 1 282 ? 54.490 51.881  65.858  1.00 26.89  ? 305 GLU B O   1 
ATOM   4573 C  CB  . GLU B 1 282 ? 57.135 51.679  67.645  1.00 41.95  ? 305 GLU B CB  1 
ATOM   4574 C  CG  . GLU B 1 282 ? 58.565 51.262  67.354  1.00 64.09  ? 305 GLU B CG  1 
ATOM   4575 C  CD  . GLU B 1 282 ? 59.018 51.338  65.886  1.00 74.90  ? 305 GLU B CD  1 
ATOM   4576 O  OE1 . GLU B 1 282 ? 58.851 50.348  65.137  1.00 76.14  ? 305 GLU B OE1 1 
ATOM   4577 O  OE2 . GLU B 1 282 ? 59.614 52.364  65.491  1.00 67.65  ? 305 GLU B OE2 1 
ATOM   4578 N  N   . GLU B 1 283 ? 54.435 53.355  67.453  1.00 22.28  ? 306 GLU B N   1 
ATOM   4579 C  CA  . GLU B 1 283 ? 52.978 53.428  67.400  1.00 27.06  ? 306 GLU B CA  1 
ATOM   4580 C  C   . GLU B 1 283 ? 52.495 53.875  66.013  1.00 25.06  ? 306 GLU B C   1 
ATOM   4581 O  O   . GLU B 1 283 ? 51.507 53.351  65.505  1.00 20.22  ? 306 GLU B O   1 
ATOM   4582 C  CB  . GLU B 1 283 ? 52.410 54.389  68.436  1.00 32.81  ? 306 GLU B CB  1 
ATOM   4583 C  CG  . GLU B 1 283 ? 50.889 54.339  68.448  1.00 40.19  ? 306 GLU B CG  1 
ATOM   4584 C  CD  . GLU B 1 283 ? 50.248 55.664  68.788  1.00 67.23  ? 306 GLU B CD  1 
ATOM   4585 O  OE1 . GLU B 1 283 ? 49.380 55.696  69.689  1.00 69.89  ? 306 GLU B OE1 1 
ATOM   4586 O  OE2 . GLU B 1 283 ? 50.595 56.671  68.130  1.00 72.57  ? 306 GLU B OE2 1 
ATOM   4587 N  N   . GLU B 1 284 ? 53.158 54.869  65.426  1.00 18.18  ? 307 GLU B N   1 
ATOM   4588 C  CA  . GLU B 1 284 ? 52.788 55.327  64.081  1.00 22.43  ? 307 GLU B CA  1 
ATOM   4589 C  C   . GLU B 1 284 ? 52.930 54.200  63.063  1.00 21.25  ? 307 GLU B C   1 
ATOM   4590 O  O   . GLU B 1 284 ? 52.122 54.077  62.134  1.00 14.70  ? 307 GLU B O   1 
ATOM   4591 C  CB  . GLU B 1 284 ? 53.649 56.513  63.620  1.00 17.86  ? 307 GLU B CB  1 
ATOM   4592 C  CG  . GLU B 1 284 ? 53.280 57.888  64.183  1.00 23.60  ? 307 GLU B CG  1 
ATOM   4593 C  CD  . GLU B 1 284 ? 53.944 59.035  63.420  1.00 30.00  ? 307 GLU B CD  1 
ATOM   4594 O  OE1 . GLU B 1 284 ? 54.815 58.770  62.559  1.00 27.91  ? 307 GLU B OE1 1 
ATOM   4595 O  OE2 . GLU B 1 284 ? 53.591 60.207  63.677  1.00 36.98  ? 307 GLU B OE2 1 
ATOM   4596 N  N   . ALA B 1 285 ? 53.973 53.390  63.222  1.00 16.27  ? 308 ALA B N   1 
ATOM   4597 C  CA  . ALA B 1 285 ? 54.186 52.269  62.305  1.00 16.00  ? 308 ALA B CA  1 
ATOM   4598 C  C   . ALA B 1 285 ? 53.084 51.249  62.496  1.00 15.13  ? 308 ALA B C   1 
ATOM   4599 O  O   . ALA B 1 285 ? 52.473 50.782  61.528  1.00 13.46  ? 308 ALA B O   1 
ATOM   4600 C  CB  . ALA B 1 285 ? 55.559 51.637  62.520  1.00 20.94  ? 308 ALA B CB  1 
ATOM   4601 N  N   . LYS B 1 286 ? 52.804 50.915  63.749  1.00 14.72  ? 309 LYS B N   1 
ATOM   4602 C  CA  . LYS B 1 286 ? 51.791 49.907  64.020  1.00 20.50  ? 309 LYS B CA  1 
ATOM   4603 C  C   . LYS B 1 286 ? 50.379 50.325  63.621  1.00 13.39  ? 309 LYS B C   1 
ATOM   4604 O  O   . LYS B 1 286 ? 49.614 49.497  63.125  1.00 12.80  ? 309 LYS B O   1 
ATOM   4605 C  CB  . LYS B 1 286 ? 51.841 49.434  65.479  1.00 20.06  ? 309 LYS B CB  1 
ATOM   4606 C  CG  . LYS B 1 286 ? 53.051 48.541  65.747  1.00 23.49  ? 309 LYS B CG  1 
ATOM   4607 C  CD  . LYS B 1 286 ? 52.933 47.783  67.064  1.00 53.80  ? 309 LYS B CD  1 
ATOM   4608 C  CE  . LYS B 1 286 ? 52.896 48.704  68.268  1.00 50.21  ? 309 LYS B CE  1 
ATOM   4609 N  NZ  . LYS B 1 286 ? 52.846 47.919  69.541  1.00 53.27  ? 309 LYS B NZ  1 
ATOM   4610 N  N   . THR B 1 287 ? 50.005 51.584  63.824  1.00 14.44  ? 310 THR B N   1 
ATOM   4611 C  CA  A THR B 1 287 ? 48.662 52.012  63.442  0.54 13.65  ? 310 THR B CA  1 
ATOM   4612 C  CA  B THR B 1 287 ? 48.660 52.005  63.434  0.46 13.66  ? 310 THR B CA  1 
ATOM   4613 C  C   . THR B 1 287 ? 48.505 51.933  61.923  1.00 12.18  ? 310 THR B C   1 
ATOM   4614 O  O   . THR B 1 287 ? 47.437 51.578  61.419  1.00 10.29  ? 310 THR B O   1 
ATOM   4615 C  CB  A THR B 1 287 ? 48.300 53.429  63.996  0.54 18.57  ? 310 THR B CB  1 
ATOM   4616 C  CB  B THR B 1 287 ? 48.292 53.424  63.927  0.46 18.57  ? 310 THR B CB  1 
ATOM   4617 O  OG1 A THR B 1 287 ? 46.907 53.692  63.789  0.54 14.13  ? 310 THR B OG1 1 
ATOM   4618 O  OG1 B THR B 1 287 ? 49.090 54.398  63.247  0.46 24.45  ? 310 THR B OG1 1 
ATOM   4619 C  CG2 A THR B 1 287 ? 49.123 54.516  63.332  0.54 24.37  ? 310 THR B CG2 1 
ATOM   4620 C  CG2 B THR B 1 287 ? 48.493 53.542  65.426  0.46 16.68  ? 310 THR B CG2 1 
ATOM   4621 N  N   . THR B 1 288 ? 49.576 52.247  61.198  1.00 9.28   ? 311 THR B N   1 
ATOM   4622 C  CA  . THR B 1 288 ? 49.533 52.185  59.736  1.00 12.60  ? 311 THR B CA  1 
ATOM   4623 C  C   . THR B 1 288 ? 49.335 50.738  59.284  1.00 12.53  ? 311 THR B C   1 
ATOM   4624 O  O   . THR B 1 288 ? 48.508 50.450  58.413  1.00 10.42  ? 311 THR B O   1 
ATOM   4625 C  CB  . THR B 1 288 ? 50.792 52.791  59.095  1.00 9.22   ? 311 THR B CB  1 
ATOM   4626 O  OG1 . THR B 1 288 ? 50.951 54.137  59.557  1.00 10.88  ? 311 THR B OG1 1 
ATOM   4627 C  CG2 . THR B 1 288 ? 50.663 52.810  57.563  1.00 7.58   ? 311 THR B CG2 1 
ATOM   4628 N  N   . ALA B 1 289 ? 50.089 49.825  59.895  1.00 9.48   ? 312 ALA B N   1 
ATOM   4629 C  CA  . ALA B 1 289 ? 49.974 48.403  59.579  1.00 12.10  ? 312 ALA B CA  1 
ATOM   4630 C  C   . ALA B 1 289 ? 48.616 47.857  59.982  1.00 11.14  ? 312 ALA B C   1 
ATOM   4631 O  O   . ALA B 1 289 ? 48.013 47.087  59.234  1.00 11.71  ? 312 ALA B O   1 
ATOM   4632 C  CB  . ALA B 1 289 ? 51.097 47.604  60.250  1.00 12.87  ? 312 ALA B CB  1 
ATOM   4633 N  N   . ASN B 1 290 ? 48.130 48.252  61.160  1.00 8.50   ? 313 ASN B N   1 
ATOM   4634 C  CA  . ASN B 1 290 ? 46.808 47.846  61.607  1.00 9.29   ? 313 ASN B CA  1 
ATOM   4635 C  C   . ASN B 1 290 ? 45.746 48.316  60.619  1.00 11.09  ? 313 ASN B C   1 
ATOM   4636 O  O   . ASN B 1 290 ? 44.768 47.611  60.355  1.00 10.83  ? 313 ASN B O   1 
ATOM   4637 C  CB  . ASN B 1 290 ? 46.476 48.436  62.984  1.00 14.70  ? 313 ASN B CB  1 
ATOM   4638 C  CG  . ASN B 1 290 ? 47.268 47.807  64.107  1.00 21.73  ? 313 ASN B CG  1 
ATOM   4639 O  OD1 . ASN B 1 290 ? 47.773 46.700  63.973  1.00 20.90  ? 313 ASN B OD1 1 
ATOM   4640 N  ND2 . ASN B 1 290 ? 47.353 48.507  65.241  1.00 17.41  ? 313 ASN B ND2 1 
ATOM   4641 N  N   . LEU B 1 291 ? 45.929 49.518  60.087  1.00 7.82   ? 314 LEU B N   1 
ATOM   4642 C  CA  . LEU B 1 291 ? 44.984 50.063  59.110  1.00 8.78   ? 314 LEU B CA  1 
ATOM   4643 C  C   . LEU B 1 291 ? 44.987 49.227  57.829  1.00 6.92   ? 314 LEU B C   1 
ATOM   4644 O  O   . LEU B 1 291 ? 43.933 48.945  57.251  1.00 9.29   ? 314 LEU B O   1 
ATOM   4645 C  CB  . LEU B 1 291 ? 45.360 51.506  58.785  1.00 10.75  ? 314 LEU B CB  1 
ATOM   4646 C  CG  . LEU B 1 291 ? 44.460 52.261  57.816  1.00 10.94  ? 314 LEU B CG  1 
ATOM   4647 C  CD1 . LEU B 1 291 ? 43.013 52.290  58.337  1.00 10.99  ? 314 LEU B CD1 1 
ATOM   4648 C  CD2 . LEU B 1 291 ? 45.009 53.665  57.644  1.00 11.22  ? 314 LEU B CD2 1 
ATOM   4649 N  N   . ALA B 1 292 ? 46.176 48.842  57.382  1.00 6.81   ? 315 ALA B N   1 
ATOM   4650 C  CA  . ALA B 1 292 ? 46.299 47.992  56.195  1.00 7.25   ? 315 ALA B CA  1 
ATOM   4651 C  C   . ALA B 1 292 ? 45.540 46.680  56.382  1.00 11.00  ? 315 ALA B C   1 
ATOM   4652 O  O   . ALA B 1 292 ? 44.813 46.225  55.486  1.00 8.75   ? 315 ALA B O   1 
ATOM   4653 C  CB  . ALA B 1 292 ? 47.770 47.717  55.896  1.00 8.04   ? 315 ALA B CB  1 
ATOM   4654 N  N   . VAL B 1 293 ? 45.711 46.068  57.549  1.00 10.39  ? 316 VAL B N   1 
ATOM   4655 C  CA  . VAL B 1 293 ? 44.997 44.832  57.852  1.00 8.16   ? 316 VAL B CA  1 
ATOM   4656 C  C   . VAL B 1 293 ? 43.478 45.050  57.864  1.00 8.77   ? 316 VAL B C   1 
ATOM   4657 O  O   . VAL B 1 293 ? 42.736 44.227  57.325  1.00 9.01   ? 316 VAL B O   1 
ATOM   4658 C  CB  . VAL B 1 293 ? 45.480 44.208  59.187  1.00 11.63  ? 316 VAL B CB  1 
ATOM   4659 C  CG1 . VAL B 1 293 ? 44.592 43.036  59.582  1.00 12.61  ? 316 VAL B CG1 1 
ATOM   4660 C  CG2 . VAL B 1 293 ? 46.937 43.735  59.053  1.00 10.58  ? 316 VAL B CG2 1 
ATOM   4661 N  N   . ASP B 1 294 ? 43.011 46.149  58.463  1.00 8.54   ? 317 ASP B N   1 
ATOM   4662 C  CA  . ASP B 1 294 ? 41.578 46.472  58.440  1.00 11.06  ? 317 ASP B CA  1 
ATOM   4663 C  C   . ASP B 1 294 ? 41.015 46.575  57.013  1.00 8.42   ? 317 ASP B C   1 
ATOM   4664 O  O   . ASP B 1 294 ? 39.911 46.100  56.736  1.00 7.89   ? 317 ASP B O   1 
ATOM   4665 C  CB  . ASP B 1 294 ? 41.282 47.774  59.207  1.00 10.15  ? 317 ASP B CB  1 
ATOM   4666 C  CG  . ASP B 1 294 ? 41.251 47.578  60.715  1.00 18.87  ? 317 ASP B CG  1 
ATOM   4667 O  OD1 . ASP B 1 294 ? 41.326 46.424  61.176  1.00 17.31  ? 317 ASP B OD1 1 
ATOM   4668 O  OD2 . ASP B 1 294 ? 41.110 48.581  61.437  1.00 16.13  ? 317 ASP B OD2 1 
ATOM   4669 N  N   . VAL B 1 295 ? 41.764 47.208  56.122  1.00 7.27   ? 318 VAL B N   1 
ATOM   4670 C  CA  . VAL B 1 295 ? 41.348 47.316  54.722  1.00 8.57   ? 318 VAL B CA  1 
ATOM   4671 C  C   . VAL B 1 295 ? 41.230 45.947  54.072  1.00 8.34   ? 318 VAL B C   1 
ATOM   4672 O  O   . VAL B 1 295 ? 40.234 45.640  53.408  1.00 8.46   ? 318 VAL B O   1 
ATOM   4673 C  CB  . VAL B 1 295 ? 42.352 48.158  53.892  1.00 6.46   ? 318 VAL B CB  1 
ATOM   4674 C  CG1 . VAL B 1 295 ? 42.063 48.032  52.383  1.00 10.28  ? 318 VAL B CG1 1 
ATOM   4675 C  CG2 . VAL B 1 295 ? 42.314 49.603  54.319  1.00 8.50   ? 318 VAL B CG2 1 
ATOM   4676 N  N   . ILE B 1 296 ? 42.258 45.126  54.245  1.00 8.60   ? 319 ILE B N   1 
ATOM   4677 C  CA  . ILE B 1 296 ? 42.254 43.806  53.616  1.00 8.03   ? 319 ILE B CA  1 
ATOM   4678 C  C   . ILE B 1 296 ? 41.124 42.954  54.180  1.00 9.24   ? 319 ILE B C   1 
ATOM   4679 O  O   . ILE B 1 296 ? 40.374 42.318  53.424  1.00 9.94   ? 319 ILE B O   1 
ATOM   4680 C  CB  . ILE B 1 296 ? 43.621 43.106  53.774  1.00 10.53  ? 319 ILE B CB  1 
ATOM   4681 C  CG1 . ILE B 1 296 ? 44.722 43.954  53.126  1.00 9.05   ? 319 ILE B CG1 1 
ATOM   4682 C  CG2 . ILE B 1 296 ? 43.601 41.735  53.125  1.00 10.36  ? 319 ILE B CG2 1 
ATOM   4683 C  CD1 . ILE B 1 296 ? 46.156 43.487  53.434  1.00 12.21  ? 319 ILE B CD1 1 
ATOM   4684 N  N   . ALA B 1 297 ? 40.976 42.960  55.507  1.00 6.96   ? 320 ALA B N   1 
ATOM   4685 C  CA  . ALA B 1 297 ? 39.922 42.171  56.154  1.00 11.11  ? 320 ALA B CA  1 
ATOM   4686 C  C   . ALA B 1 297 ? 38.531 42.615  55.716  1.00 10.01  ? 320 ALA B C   1 
ATOM   4687 O  O   . ALA B 1 297 ? 37.637 41.790  55.488  1.00 9.53   ? 320 ALA B O   1 
ATOM   4688 C  CB  . ALA B 1 297 ? 40.042 42.248  57.693  1.00 11.14  ? 320 ALA B CB  1 
ATOM   4689 N  N   . SER B 1 298 ? 38.321 43.919  55.616  1.00 9.60   ? 321 SER B N   1 
ATOM   4690 C  CA  A SER B 1 298 ? 37.014 44.413  55.200  0.42 6.46   ? 321 SER B CA  1 
ATOM   4691 C  CA  B SER B 1 298 ? 37.018 44.417  55.204  0.58 6.43   ? 321 SER B CA  1 
ATOM   4692 C  C   . SER B 1 298 ? 36.747 44.057  53.743  1.00 6.22   ? 321 SER B C   1 
ATOM   4693 O  O   . SER B 1 298 ? 35.602 43.814  53.349  1.00 10.95  ? 321 SER B O   1 
ATOM   4694 C  CB  A SER B 1 298 ? 36.904 45.923  55.397  0.42 12.37  ? 321 SER B CB  1 
ATOM   4695 C  CB  B SER B 1 298 ? 36.919 45.925  55.427  0.58 12.25  ? 321 SER B CB  1 
ATOM   4696 O  OG  A SER B 1 298 ? 35.579 46.348  55.143  0.42 10.35  ? 321 SER B OG  1 
ATOM   4697 O  OG  B SER B 1 298 ? 36.835 46.217  56.807  0.58 6.80   ? 321 SER B OG  1 
ATOM   4698 N  N   . SER B 1 299 ? 37.804 44.024  52.944  1.00 7.64   ? 322 SER B N   1 
ATOM   4699 C  CA  . SER B 1 299 ? 37.682 43.654  51.534  1.00 11.72  ? 322 SER B CA  1 
ATOM   4700 C  C   . SER B 1 299 ? 37.265 42.190  51.377  1.00 15.40  ? 322 SER B C   1 
ATOM   4701 O  O   . SER B 1 299 ? 36.730 41.786  50.332  1.00 11.63  ? 322 SER B O   1 
ATOM   4702 C  CB  . SER B 1 299 ? 38.989 43.919  50.796  1.00 10.89  ? 322 SER B CB  1 
ATOM   4703 O  OG  . SER B 1 299 ? 39.293 45.314  50.803  1.00 10.58  ? 322 SER B OG  1 
ATOM   4704 N  N   . PHE B 1 300 ? 37.509 41.400  52.415  1.00 11.83  ? 323 PHE B N   1 
ATOM   4705 C  CA  . PHE B 1 300 ? 37.128 39.995  52.396  1.00 11.67  ? 323 PHE B CA  1 
ATOM   4706 C  C   . PHE B 1 300 ? 36.020 39.636  53.360  1.00 18.88  ? 323 PHE B C   1 
ATOM   4707 O  O   . PHE B 1 300 ? 35.799 38.461  53.656  1.00 16.37  ? 323 PHE B O   1 
ATOM   4708 C  CB  . PHE B 1 300 ? 38.343 39.100  52.601  1.00 14.56  ? 323 PHE B CB  1 
ATOM   4709 C  CG  . PHE B 1 300 ? 39.239 39.054  51.416  1.00 11.80  ? 323 PHE B CG  1 
ATOM   4710 C  CD1 . PHE B 1 300 ? 38.948 38.217  50.349  1.00 15.83  ? 323 PHE B CD1 1 
ATOM   4711 C  CD2 . PHE B 1 300 ? 40.353 39.868  51.340  1.00 10.28  ? 323 PHE B CD2 1 
ATOM   4712 C  CE1 . PHE B 1 300 ? 39.772 38.183  49.239  1.00 14.03  ? 323 PHE B CE1 1 
ATOM   4713 C  CE2 . PHE B 1 300 ? 41.173 39.846  50.232  1.00 13.44  ? 323 PHE B CE2 1 
ATOM   4714 C  CZ  . PHE B 1 300 ? 40.890 38.993  49.181  1.00 17.01  ? 323 PHE B CZ  1 
ATOM   4715 N  N   . GLY B 1 301 ? 35.315 40.642  53.853  1.00 11.95  ? 324 GLY B N   1 
ATOM   4716 C  CA  . GLY B 1 301 ? 34.055 40.370  54.505  1.00 13.18  ? 324 GLY B CA  1 
ATOM   4717 C  C   . GLY B 1 301 ? 33.909 40.827  55.931  1.00 16.19  ? 324 GLY B C   1 
ATOM   4718 O  O   . GLY B 1 301 ? 32.846 40.638  56.512  1.00 15.83  ? 324 GLY B O   1 
ATOM   4719 N  N   . GLN B 1 302 ? 34.946 41.416  56.515  1.00 13.07  ? 325 GLN B N   1 
ATOM   4720 C  CA  . GLN B 1 302 ? 34.757 41.947  57.863  1.00 10.85  ? 325 GLN B CA  1 
ATOM   4721 C  C   . GLN B 1 302 ? 33.751 43.078  57.782  1.00 17.49  ? 325 GLN B C   1 
ATOM   4722 O  O   . GLN B 1 302 ? 33.897 43.972  56.940  1.00 12.85  ? 325 GLN B O   1 
ATOM   4723 C  CB  . GLN B 1 302 ? 36.048 42.453  58.511  1.00 10.75  ? 325 GLN B CB  1 
ATOM   4724 C  CG  . GLN B 1 302 ? 35.797 42.801  59.997  1.00 18.86  ? 325 GLN B CG  1 
ATOM   4725 C  CD  . GLN B 1 302 ? 37.062 42.997  60.808  1.00 34.81  ? 325 GLN B CD  1 
ATOM   4726 O  OE1 . GLN B 1 302 ? 38.137 42.536  60.426  1.00 28.29  ? 325 GLN B OE1 1 
ATOM   4727 N  NE2 . GLN B 1 302 ? 36.929 43.645  61.963  1.00 24.69  ? 325 GLN B NE2 1 
ATOM   4728 N  N   . THR B 1 303 ? 32.733 43.025  58.643  1.00 16.34  ? 326 THR B N   1 
ATOM   4729 C  CA  . THR B 1 303 ? 31.683 44.044  58.686  1.00 24.24  ? 326 THR B CA  1 
ATOM   4730 C  C   . THR B 1 303 ? 31.790 44.856  59.978  1.00 20.45  ? 326 THR B C   1 
ATOM   4731 O  O   . THR B 1 303 ? 32.488 44.469  60.902  1.00 19.38  ? 326 THR B O   1 
ATOM   4732 C  CB  . THR B 1 303 ? 30.266 43.413  58.630  1.00 23.24  ? 326 THR B CB  1 
ATOM   4733 O  OG1 . THR B 1 303 ? 29.936 42.847  59.907  1.00 29.19  ? 326 THR B OG1 1 
ATOM   4734 C  CG2 . THR B 1 303 ? 30.198 42.323  57.574  1.00 27.98  ? 326 THR B CG2 1 
ATOM   4735 N  N   . ARG B 1 304 ? 31.098 45.984  60.036  1.00 21.57  ? 327 ARG B N   1 
ATOM   4736 C  CA  . ARG B 1 304 ? 31.012 46.748  61.273  1.00 20.99  ? 327 ARG B CA  1 
ATOM   4737 C  C   . ARG B 1 304 ? 29.677 46.502  61.976  1.00 27.62  ? 327 ARG B C   1 
ATOM   4738 O  O   . ARG B 1 304 ? 29.229 47.307  62.780  1.00 32.76  ? 327 ARG B O   1 
ATOM   4739 C  CB  . ARG B 1 304 ? 31.224 48.228  60.990  1.00 20.54  ? 327 ARG B CB  1 
ATOM   4740 C  CG  . ARG B 1 304 ? 32.640 48.527  60.547  1.00 27.15  ? 327 ARG B CG  1 
ATOM   4741 C  CD  . ARG B 1 304 ? 32.767 49.960  60.156  1.00 14.68  ? 327 ARG B CD  1 
ATOM   4742 N  NE  . ARG B 1 304 ? 32.264 50.204  58.797  1.00 12.64  ? 327 ARG B NE  1 
ATOM   4743 C  CZ  . ARG B 1 304 ? 32.047 51.414  58.289  1.00 16.11  ? 327 ARG B CZ  1 
ATOM   4744 N  NH1 . ARG B 1 304 ? 32.251 52.487  59.037  1.00 6.28   ? 327 ARG B NH1 1 
ATOM   4745 N  NH2 . ARG B 1 304 ? 31.589 51.556  57.049  1.00 11.85  ? 327 ARG B NH2 1 
ATOM   4746 N  N   . GLU B 1 305 ? 28.974 45.447  61.584  1.00 34.54  ? 328 GLU B N   1 
ATOM   4747 C  CA  A GLU B 1 305 ? 27.641 45.083  62.101  0.66 29.35  ? 328 GLU B CA  1 
ATOM   4748 C  CA  B GLU B 1 305 ? 27.704 45.076  62.185  0.34 29.35  ? 328 GLU B CA  1 
ATOM   4749 C  C   . GLU B 1 305 ? 27.532 43.618  62.671  1.00 30.22  ? 328 GLU B C   1 
ATOM   4750 O  O   . GLU B 1 305 ? 26.541 43.222  63.219  1.00 27.74  ? 328 GLU B O   1 
ATOM   4751 C  CB  A GLU B 1 305 ? 26.539 45.229  61.046  0.66 33.33  ? 328 GLU B CB  1 
ATOM   4752 C  CB  B GLU B 1 305 ? 26.553 45.500  61.281  0.34 33.33  ? 328 GLU B CB  1 
ATOM   4753 C  CG  A GLU B 1 305 ? 26.784 46.223  59.936  0.66 37.12  ? 328 GLU B CG  1 
ATOM   4754 C  CG  B GLU B 1 305 ? 26.250 44.572  60.155  0.34 37.12  ? 328 GLU B CG  1 
ATOM   4755 C  CD  A GLU B 1 305 ? 25.503 46.732  59.260  0.66 55.60  ? 328 GLU B CD  1 
ATOM   4756 C  CD  B GLU B 1 305 ? 24.796 44.647  59.608  0.34 55.60  ? 328 GLU B CD  1 
ATOM   4757 O  OE1 A GLU B 1 305 ? 25.420 47.936  58.975  0.66 33.42  ? 328 GLU B OE1 1 
ATOM   4758 O  OE1 B GLU B 1 305 ? 24.245 43.607  59.172  0.34 33.42  ? 328 GLU B OE1 1 
ATOM   4759 O  OE2 A GLU B 1 305 ? 24.566 45.896  59.121  0.66 40.28  ? 328 GLU B OE2 1 
ATOM   4760 O  OE2 B GLU B 1 305 ? 24.220 45.719  59.551  0.34 40.28  ? 328 GLU B OE2 1 
ATOM   4761 N  N   . GLY B 1 306 ? 28.636 42.900  62.682  1.00 29.05  ? 329 GLY B N   1 
ATOM   4762 C  CA  . GLY B 1 306 ? 28.624 41.544  63.195  1.00 33.57  ? 329 GLY B CA  1 
ATOM   4763 C  C   . GLY B 1 306 ? 28.135 40.530  62.182  1.00 38.17  ? 329 GLY B C   1 
ATOM   4764 O  O   . GLY B 1 306 ? 27.898 40.865  61.017  1.00 41.33  ? 329 GLY B O   1 
ATOM   4765 O  OXT . GLY B 1 306 ? 27.966 39.350  62.508  1.00 41.04  ? 329 GLY B OXT 1 
ATOM   4766 N  N   . HIS C 1 1   ? 12.716 74.013  83.452  1.00 58.02  ? 24  HIS C N   1 
ATOM   4767 C  CA  . HIS C 1 1   ? 12.665 72.560  83.307  1.00 51.19  ? 24  HIS C CA  1 
ATOM   4768 C  C   . HIS C 1 1   ? 13.372 71.929  84.502  1.00 43.00  ? 24  HIS C C   1 
ATOM   4769 O  O   . HIS C 1 1   ? 14.325 72.503  85.026  1.00 31.82  ? 24  HIS C O   1 
ATOM   4770 C  CB  . HIS C 1 1   ? 13.299 72.126  81.990  1.00 50.75  ? 24  HIS C CB  1 
ATOM   4771 C  CG  . HIS C 1 1   ? 12.356 72.182  80.824  1.00 76.71  ? 24  HIS C CG  1 
ATOM   4772 N  ND1 . HIS C 1 1   ? 11.455 71.185  80.544  1.00 78.93  ? 24  HIS C ND1 1 
ATOM   4773 C  CD2 . HIS C 1 1   ? 12.179 73.141  79.884  1.00 73.51  ? 24  HIS C CD2 1 
ATOM   4774 C  CE1 . HIS C 1 1   ? 10.757 71.521  79.464  1.00 80.81  ? 24  HIS C CE1 1 
ATOM   4775 N  NE2 . HIS C 1 1   ? 11.176 72.697  79.050  1.00 83.99  ? 24  HIS C NE2 1 
ATOM   4776 N  N   . SER C 1 2   ? 12.914 70.765  84.953  1.00 32.59  ? 25  SER C N   1 
ATOM   4777 C  CA  . SER C 1 2   ? 13.532 70.163  86.133  1.00 30.20  ? 25  SER C CA  1 
ATOM   4778 C  C   . SER C 1 2   ? 14.338 68.915  85.784  1.00 28.22  ? 25  SER C C   1 
ATOM   4779 O  O   . SER C 1 2   ? 13.835 67.992  85.147  1.00 26.86  ? 25  SER C O   1 
ATOM   4780 C  CB  . SER C 1 2   ? 12.472 69.850  87.194  1.00 41.60  ? 25  SER C CB  1 
ATOM   4781 O  OG  . SER C 1 2   ? 11.846 71.037  87.656  1.00 47.16  ? 25  SER C OG  1 
ATOM   4782 N  N   . VAL C 1 3   ? 15.590 68.898  86.226  1.00 26.78  ? 26  VAL C N   1 
ATOM   4783 C  CA  . VAL C 1 3   ? 16.504 67.804  85.917  1.00 21.43  ? 26  VAL C CA  1 
ATOM   4784 C  C   . VAL C 1 3   ? 17.064 67.243  87.207  1.00 22.44  ? 26  VAL C C   1 
ATOM   4785 O  O   . VAL C 1 3   ? 17.575 67.995  88.041  1.00 18.93  ? 26  VAL C O   1 
ATOM   4786 C  CB  . VAL C 1 3   ? 17.670 68.290  85.028  1.00 21.10  ? 26  VAL C CB  1 
ATOM   4787 C  CG1 . VAL C 1 3   ? 18.707 67.184  84.833  1.00 17.61  ? 26  VAL C CG1 1 
ATOM   4788 C  CG2 . VAL C 1 3   ? 17.150 68.805  83.690  1.00 20.48  ? 26  VAL C CG2 1 
ATOM   4789 N  N   . ALA C 1 4   ? 16.958 65.929  87.377  1.00 18.91  ? 27  ALA C N   1 
ATOM   4790 C  CA  . ALA C 1 4   ? 17.606 65.260  88.492  1.00 16.90  ? 27  ALA C CA  1 
ATOM   4791 C  C   . ALA C 1 4   ? 18.927 64.668  88.025  1.00 21.70  ? 27  ALA C C   1 
ATOM   4792 O  O   . ALA C 1 4   ? 18.995 64.074  86.950  1.00 17.91  ? 27  ALA C O   1 
ATOM   4793 C  CB  . ALA C 1 4   ? 16.707 64.161  89.059  1.00 18.94  ? 27  ALA C CB  1 
ATOM   4794 N  N   . VAL C 1 5   ? 19.968 64.810  88.838  1.00 17.85  ? 28  VAL C N   1 
ATOM   4795 C  CA  . VAL C 1 5   ? 21.263 64.223  88.509  1.00 18.00  ? 28  VAL C CA  1 
ATOM   4796 C  C   . VAL C 1 5   ? 21.632 63.168  89.542  1.00 21.75  ? 28  VAL C C   1 
ATOM   4797 O  O   . VAL C 1 5   ? 21.665 63.429  90.749  1.00 19.94  ? 28  VAL C O   1 
ATOM   4798 C  CB  . VAL C 1 5   ? 22.376 65.297  88.393  1.00 17.90  ? 28  VAL C CB  1 
ATOM   4799 C  CG1 . VAL C 1 5   ? 23.729 64.644  88.127  1.00 17.33  ? 28  VAL C CG1 1 
ATOM   4800 C  CG2 . VAL C 1 5   ? 22.040 66.293  87.286  1.00 17.25  ? 28  VAL C CG2 1 
ATOM   4801 N  N   . ILE C 1 6   ? 21.892 61.964  89.050  1.00 16.09  ? 29  ILE C N   1 
ATOM   4802 C  CA  . ILE C 1 6   ? 22.203 60.829  89.900  1.00 13.59  ? 29  ILE C CA  1 
ATOM   4803 C  C   . ILE C 1 6   ? 23.532 60.236  89.499  1.00 18.06  ? 29  ILE C C   1 
ATOM   4804 O  O   . ILE C 1 6   ? 23.718 59.819  88.349  1.00 15.97  ? 29  ILE C O   1 
ATOM   4805 C  CB  . ILE C 1 6   ? 21.149 59.723  89.753  1.00 18.03  ? 29  ILE C CB  1 
ATOM   4806 C  CG1 . ILE C 1 6   ? 19.757 60.260  90.075  1.00 21.37  ? 29  ILE C CG1 1 
ATOM   4807 C  CG2 . ILE C 1 6   ? 21.502 58.526  90.639  1.00 16.54  ? 29  ILE C CG2 1 
ATOM   4808 C  CD1 . ILE C 1 6   ? 18.653 59.272  89.780  1.00 21.95  ? 29  ILE C CD1 1 
ATOM   4809 N  N   . GLY C 1 7   ? 24.462 60.200  90.446  1.00 15.91  ? 30  GLY C N   1 
ATOM   4810 C  CA  . GLY C 1 7   ? 25.730 59.537  90.223  1.00 14.15  ? 30  GLY C CA  1 
ATOM   4811 C  C   . GLY C 1 7   ? 25.558 58.073  90.552  1.00 17.16  ? 30  GLY C C   1 
ATOM   4812 O  O   . GLY C 1 7   ? 25.106 57.733  91.647  1.00 17.74  ? 30  GLY C O   1 
ATOM   4813 N  N   . ALA C 1 8   ? 25.878 57.206  89.600  1.00 15.59  ? 31  ALA C N   1 
ATOM   4814 C  CA  . ALA C 1 8   ? 25.767 55.767  89.815  1.00 14.86  ? 31  ALA C CA  1 
ATOM   4815 C  C   . ALA C 1 8   ? 27.119 55.142  89.561  1.00 18.04  ? 31  ALA C C   1 
ATOM   4816 O  O   . ALA C 1 8   ? 27.388 54.640  88.472  1.00 20.15  ? 31  ALA C O   1 
ATOM   4817 C  CB  . ALA C 1 8   ? 24.702 55.163  88.911  1.00 14.95  ? 31  ALA C CB  1 
ATOM   4818 N  N   . PRO C 1 9   ? 27.987 55.175  90.581  1.00 18.71  ? 32  PRO C N   1 
ATOM   4819 C  CA  . PRO C 1 9   ? 29.369 54.740  90.385  1.00 21.73  ? 32  PRO C CA  1 
ATOM   4820 C  C   . PRO C 1 9   ? 29.502 53.224  90.290  1.00 16.55  ? 32  PRO C C   1 
ATOM   4821 O  O   . PRO C 1 9   ? 30.221 52.603  91.063  1.00 29.79  ? 32  PRO C O   1 
ATOM   4822 C  CB  . PRO C 1 9   ? 30.106 55.318  91.601  1.00 23.82  ? 32  PRO C CB  1 
ATOM   4823 C  CG  . PRO C 1 9   ? 29.055 55.567  92.622  1.00 30.67  ? 32  PRO C CG  1 
ATOM   4824 C  CD  . PRO C 1 9   ? 27.768 55.807  91.897  1.00 17.53  ? 32  PRO C CD  1 
ATOM   4825 N  N   . PHE C 1 10  ? 28.793 52.635  89.332  1.00 22.10  ? 33  PHE C N   1 
ATOM   4826 C  CA  A PHE C 1 10  ? 28.799 51.207  89.006  0.52 21.41  ? 33  PHE C CA  1 
ATOM   4827 C  CA  B PHE C 1 10  ? 28.958 51.187  89.330  0.48 21.23  ? 33  PHE C CA  1 
ATOM   4828 C  C   . PHE C 1 10  ? 30.120 50.789  88.427  1.00 15.73  ? 33  PHE C C   1 
ATOM   4829 O  O   . PHE C 1 10  ? 30.439 51.375  87.392  1.00 19.61  ? 33  PHE C O   1 
ATOM   4830 C  CB  A PHE C 1 10  ? 27.770 50.972  87.888  0.52 16.70  ? 33  PHE C CB  1 
ATOM   4831 C  CB  B PHE C 1 10  ? 27.672 50.499  88.869  0.48 22.31  ? 33  PHE C CB  1 
ATOM   4832 C  CG  A PHE C 1 10  ? 26.435 50.454  88.349  0.52 17.39  ? 33  PHE C CG  1 
ATOM   4833 C  CG  B PHE C 1 10  ? 27.410 49.185  89.548  0.48 20.93  ? 33  PHE C CG  1 
ATOM   4834 C  CD1 A PHE C 1 10  ? 25.530 51.284  88.992  0.52 17.63  ? 33  PHE C CD1 1 
ATOM   4835 C  CD1 B PHE C 1 10  ? 27.609 49.043  90.912  0.48 20.24  ? 33  PHE C CD1 1 
ATOM   4836 C  CD2 A PHE C 1 10  ? 26.060 49.149  88.075  0.52 18.56  ? 33  PHE C CD2 1 
ATOM   4837 C  CD2 B PHE C 1 10  ? 26.964 48.092  88.824  0.48 17.98  ? 33  PHE C CD2 1 
ATOM   4838 C  CE1 A PHE C 1 10  ? 24.292 50.806  89.391  0.52 20.81  ? 33  PHE C CE1 1 
ATOM   4839 C  CE1 B PHE C 1 10  ? 27.368 47.836  91.540  0.48 16.26  ? 33  PHE C CE1 1 
ATOM   4840 C  CE2 A PHE C 1 10  ? 24.826 48.663  88.471  0.52 13.53  ? 33  PHE C CE2 1 
ATOM   4841 C  CE2 B PHE C 1 10  ? 26.721 46.882  89.446  0.48 18.75  ? 33  PHE C CE2 1 
ATOM   4842 C  CZ  A PHE C 1 10  ? 23.939 49.492  89.124  0.52 18.07  ? 33  PHE C CZ  1 
ATOM   4843 C  CZ  B PHE C 1 10  ? 26.924 46.754  90.806  0.48 16.53  ? 33  PHE C CZ  1 
ATOM   4844 N  N   . SER C 1 11  ? 30.765 49.720  88.882  1.00 11.97  ? 34  SER C N   1 
ATOM   4845 C  CA  . SER C 1 11  ? 31.916 49.159  88.171  1.00 15.88  ? 34  SER C CA  1 
ATOM   4846 C  C   . SER C 1 11  ? 31.802 47.638  87.997  1.00 13.36  ? 34  SER C C   1 
ATOM   4847 O  O   . SER C 1 11  ? 32.528 47.034  87.205  1.00 13.13  ? 34  SER C O   1 
ATOM   4848 C  CB  . SER C 1 11  ? 33.230 49.527  88.871  1.00 21.71  ? 34  SER C CB  1 
ATOM   4849 O  OG  . SER C 1 11  ? 33.321 48.909  90.139  1.00 19.57  ? 34  SER C OG  1 
ATOM   4850 N  N   . GLN C 1 12  ? 30.878 47.017  88.719  1.00 13.66  ? 35  GLN C N   1 
ATOM   4851 C  CA  . GLN C 1 12  ? 30.854 45.558  88.777  1.00 13.24  ? 35  GLN C CA  1 
ATOM   4852 C  C   . GLN C 1 12  ? 30.173 44.884  87.584  1.00 14.69  ? 35  GLN C C   1 
ATOM   4853 O  O   . GLN C 1 12  ? 30.141 43.658  87.488  1.00 13.76  ? 35  GLN C O   1 
ATOM   4854 C  CB  . GLN C 1 12  ? 30.274 45.094  90.120  1.00 18.54  ? 35  GLN C CB  1 
ATOM   4855 C  CG  . GLN C 1 12  ? 31.196 45.442  91.290  1.00 21.01  ? 35  GLN C CG  1 
ATOM   4856 C  CD  . GLN C 1 12  ? 30.598 45.082  92.633  1.00 30.43  ? 35  GLN C CD  1 
ATOM   4857 O  OE1 . GLN C 1 12  ? 30.821 43.989  93.148  1.00 29.35  ? 35  GLN C OE1 1 
ATOM   4858 N  NE2 . GLN C 1 12  ? 29.825 45.999  93.201  1.00 37.63  ? 35  GLN C NE2 1 
ATOM   4859 N  N   . GLY C 1 13  ? 29.667 45.694  86.658  1.00 13.80  ? 36  GLY C N   1 
ATOM   4860 C  CA  . GLY C 1 13  ? 29.175 45.191  85.388  1.00 12.44  ? 36  GLY C CA  1 
ATOM   4861 C  C   . GLY C 1 13  ? 30.299 44.837  84.437  1.00 9.45   ? 36  GLY C C   1 
ATOM   4862 O  O   . GLY C 1 13  ? 30.062 44.361  83.332  1.00 11.48  ? 36  GLY C O   1 
ATOM   4863 N  N   . GLN C 1 14  ? 31.535 45.100  84.848  1.00 13.04  ? 37  GLN C N   1 
ATOM   4864 C  CA  . GLN C 1 14  ? 32.692 44.794  84.011  1.00 8.31   ? 37  GLN C CA  1 
ATOM   4865 C  C   . GLN C 1 14  ? 33.942 44.595  84.880  1.00 16.60  ? 37  GLN C C   1 
ATOM   4866 O  O   . GLN C 1 14  ? 33.834 44.541  86.099  1.00 17.34  ? 37  GLN C O   1 
ATOM   4867 C  CB  . GLN C 1 14  ? 32.870 45.866  82.922  1.00 11.59  ? 37  GLN C CB  1 
ATOM   4868 C  CG  . GLN C 1 14  ? 32.845 47.307  83.444  1.00 11.51  ? 37  GLN C CG  1 
ATOM   4869 C  CD  . GLN C 1 14  ? 34.193 47.749  83.953  1.00 21.22  ? 37  GLN C CD  1 
ATOM   4870 O  OE1 . GLN C 1 14  ? 35.121 47.955  83.168  1.00 19.63  ? 37  GLN C OE1 1 
ATOM   4871 N  NE2 . GLN C 1 14  ? 34.322 47.878  85.276  1.00 17.02  ? 37  GLN C NE2 1 
ATOM   4872 N  N   . LYS C 1 15  ? 35.116 44.466  84.266  1.00 13.67  ? 38  LYS C N   1 
ATOM   4873 C  CA  . LYS C 1 15  ? 36.300 44.034  85.015  1.00 20.74  ? 38  LYS C CA  1 
ATOM   4874 C  C   . LYS C 1 15  ? 37.393 45.087  85.190  1.00 18.46  ? 38  LYS C C   1 
ATOM   4875 O  O   . LYS C 1 15  ? 38.354 44.866  85.918  1.00 23.16  ? 38  LYS C O   1 
ATOM   4876 C  CB  . LYS C 1 15  ? 36.890 42.754  84.409  1.00 15.67  ? 38  LYS C CB  1 
ATOM   4877 C  CG  . LYS C 1 15  ? 35.992 41.509  84.540  1.00 20.00  ? 38  LYS C CG  1 
ATOM   4878 C  CD  . LYS C 1 15  ? 36.724 40.261  84.026  1.00 19.84  ? 38  LYS C CD  1 
ATOM   4879 C  CE  . LYS C 1 15  ? 35.891 38.981  84.175  1.00 30.65  ? 38  LYS C CE  1 
ATOM   4880 N  NZ  . LYS C 1 15  ? 34.870 38.786  83.103  1.00 21.75  ? 38  LYS C NZ  1 
ATOM   4881 N  N   . ARG C 1 16  ? 37.239 46.234  84.544  1.00 16.94  ? 39  ARG C N   1 
ATOM   4882 C  CA  . ARG C 1 16  ? 38.267 47.265  84.580  1.00 19.98  ? 39  ARG C CA  1 
ATOM   4883 C  C   . ARG C 1 16  ? 38.020 48.245  85.723  1.00 23.02  ? 39  ARG C C   1 
ATOM   4884 O  O   . ARG C 1 16  ? 36.917 48.776  85.881  1.00 20.03  ? 39  ARG C O   1 
ATOM   4885 C  CB  . ARG C 1 16  ? 38.324 47.983  83.230  1.00 21.63  ? 39  ARG C CB  1 
ATOM   4886 C  CG  . ARG C 1 16  ? 38.419 47.007  82.047  1.00 22.30  ? 39  ARG C CG  1 
ATOM   4887 C  CD  . ARG C 1 16  ? 39.008 47.646  80.800  1.00 28.95  ? 39  ARG C CD  1 
ATOM   4888 N  NE  . ARG C 1 16  ? 40.444 47.875  80.898  1.00 33.56  ? 39  ARG C NE  1 
ATOM   4889 C  CZ  . ARG C 1 16  ? 41.184 48.364  79.909  1.00 32.84  ? 39  ARG C CZ  1 
ATOM   4890 N  NH1 . ARG C 1 16  ? 40.614 48.687  78.756  1.00 32.47  ? 39  ARG C NH1 1 
ATOM   4891 N  NH2 . ARG C 1 16  ? 42.489 48.546  80.075  1.00 35.75  ? 39  ARG C NH2 1 
ATOM   4892 N  N   . LYS C 1 17  ? 39.045 48.477  86.533  1.00 18.38  ? 40  LYS C N   1 
ATOM   4893 C  CA  . LYS C 1 17  ? 38.910 49.405  87.649  1.00 21.62  ? 40  LYS C CA  1 
ATOM   4894 C  C   . LYS C 1 17  ? 38.844 50.838  87.140  1.00 17.15  ? 40  LYS C C   1 
ATOM   4895 O  O   . LYS C 1 17  ? 39.532 51.186  86.170  1.00 17.21  ? 40  LYS C O   1 
ATOM   4896 C  CB  . LYS C 1 17  ? 40.097 49.243  88.611  1.00 24.27  ? 40  LYS C CB  1 
ATOM   4897 C  CG  . LYS C 1 17  ? 40.263 47.814  89.114  1.00 36.81  ? 40  LYS C CG  1 
ATOM   4898 C  CD  . LYS C 1 17  ? 41.510 47.630  89.974  1.00 58.24  ? 40  LYS C CD  1 
ATOM   4899 C  CE  . LYS C 1 17  ? 41.799 46.147  90.201  1.00 54.85  ? 40  LYS C CE  1 
ATOM   4900 N  NZ  . LYS C 1 17  ? 40.742 45.290  89.595  1.00 66.68  ? 40  LYS C NZ  1 
ATOM   4901 N  N   . GLY C 1 18  ? 38.008 51.658  87.777  1.00 12.32  ? 41  GLY C N   1 
ATOM   4902 C  CA  . GLY C 1 18  ? 38.048 53.098  87.566  1.00 17.98  ? 41  GLY C CA  1 
ATOM   4903 C  C   . GLY C 1 18  ? 36.777 53.750  87.053  1.00 11.33  ? 41  GLY C C   1 
ATOM   4904 O  O   . GLY C 1 18  ? 36.563 54.945  87.245  1.00 17.34  ? 41  GLY C O   1 
ATOM   4905 N  N   . VAL C 1 19  ? 35.919 52.966  86.412  1.00 13.34  ? 42  VAL C N   1 
ATOM   4906 C  CA  . VAL C 1 19  ? 34.692 53.514  85.836  1.00 9.51   ? 42  VAL C CA  1 
ATOM   4907 C  C   . VAL C 1 19  ? 33.752 54.030  86.936  1.00 12.43  ? 42  VAL C C   1 
ATOM   4908 O  O   . VAL C 1 19  ? 32.863 54.848  86.687  1.00 12.60  ? 42  VAL C O   1 
ATOM   4909 C  CB  . VAL C 1 19  ? 34.017 52.485  84.898  1.00 13.97  ? 42  VAL C CB  1 
ATOM   4910 C  CG1 . VAL C 1 19  ? 33.458 51.305  85.689  1.00 15.48  ? 42  VAL C CG1 1 
ATOM   4911 C  CG2 . VAL C 1 19  ? 32.940 53.136  84.043  1.00 11.26  ? 42  VAL C CG2 1 
ATOM   4912 N  N   . GLU C 1 20  ? 33.966 53.582  88.174  1.00 14.73  ? 43  GLU C N   1 
ATOM   4913 C  CA  . GLU C 1 20  ? 33.190 54.123  89.288  1.00 13.02  ? 43  GLU C CA  1 
ATOM   4914 C  C   . GLU C 1 20  ? 33.511 55.600  89.527  1.00 15.38  ? 43  GLU C C   1 
ATOM   4915 O  O   . GLU C 1 20  ? 32.758 56.309  90.198  1.00 17.83  ? 43  GLU C O   1 
ATOM   4916 C  CB  . GLU C 1 20  ? 33.391 53.294  90.578  1.00 16.50  ? 43  GLU C CB  1 
ATOM   4917 C  CG  . GLU C 1 20  ? 34.779 53.434  91.192  1.00 17.56  ? 43  GLU C CG  1 
ATOM   4918 C  CD  . GLU C 1 20  ? 35.813 52.448  90.635  1.00 28.33  ? 43  GLU C CD  1 
ATOM   4919 O  OE1 . GLU C 1 20  ? 35.692 51.983  89.474  1.00 19.74  ? 43  GLU C OE1 1 
ATOM   4920 O  OE2 . GLU C 1 20  ? 36.780 52.150  91.369  1.00 29.16  ? 43  GLU C OE2 1 
ATOM   4921 N  N   . HIS C 1 21  ? 34.616 56.073  88.960  1.00 13.83  ? 44  HIS C N   1 
ATOM   4922 C  CA  . HIS C 1 21  ? 34.990 57.480  89.110  1.00 15.58  ? 44  HIS C CA  1 
ATOM   4923 C  C   . HIS C 1 21  ? 34.446 58.372  87.986  1.00 15.15  ? 44  HIS C C   1 
ATOM   4924 O  O   . HIS C 1 21  ? 34.652 59.591  87.986  1.00 13.04  ? 44  HIS C O   1 
ATOM   4925 C  CB  . HIS C 1 21  ? 36.513 57.612  89.239  1.00 21.39  ? 44  HIS C CB  1 
ATOM   4926 C  CG  . HIS C 1 21  ? 37.079 56.850  90.399  1.00 25.11  ? 44  HIS C CG  1 
ATOM   4927 N  ND1 . HIS C 1 21  ? 36.669 57.059  91.698  1.00 26.91  ? 44  HIS C ND1 1 
ATOM   4928 C  CD2 . HIS C 1 21  ? 38.011 55.863  90.457  1.00 28.45  ? 44  HIS C CD2 1 
ATOM   4929 C  CE1 . HIS C 1 21  ? 37.328 56.248  92.506  1.00 27.76  ? 44  HIS C CE1 1 
ATOM   4930 N  NE2 . HIS C 1 21  ? 38.149 55.512  91.777  1.00 25.41  ? 44  HIS C NE2 1 
ATOM   4931 N  N   . GLY C 1 22  ? 33.727 57.769  87.048  1.00 13.52  ? 45  GLY C N   1 
ATOM   4932 C  CA  . GLY C 1 22  ? 33.073 58.528  85.988  1.00 11.90  ? 45  GLY C CA  1 
ATOM   4933 C  C   . GLY C 1 22  ? 32.181 59.671  86.437  1.00 13.15  ? 45  GLY C C   1 
ATOM   4934 O  O   . GLY C 1 22  ? 32.275 60.785  85.904  1.00 14.87  ? 45  GLY C O   1 
ATOM   4935 N  N   . PRO C 1 23  ? 31.274 59.408  87.391  1.00 14.98  ? 46  PRO C N   1 
ATOM   4936 C  CA  . PRO C 1 23  ? 30.386 60.502  87.796  1.00 12.41  ? 46  PRO C CA  1 
ATOM   4937 C  C   . PRO C 1 23  ? 31.157 61.698  88.341  1.00 14.05  ? 46  PRO C C   1 
ATOM   4938 O  O   . PRO C 1 23  ? 30.839 62.844  88.019  1.00 14.82  ? 46  PRO C O   1 
ATOM   4939 C  CB  . PRO C 1 23  ? 29.522 59.859  88.893  1.00 15.57  ? 46  PRO C CB  1 
ATOM   4940 C  CG  . PRO C 1 23  ? 29.516 58.396  88.548  1.00 14.28  ? 46  PRO C CG  1 
ATOM   4941 C  CD  . PRO C 1 23  ? 30.906 58.129  88.032  1.00 14.91  ? 46  PRO C CD  1 
ATOM   4942 N  N   . ALA C 1 24  ? 32.175 61.433  89.151  1.00 13.97  ? 47  ALA C N   1 
ATOM   4943 C  CA  . ALA C 1 24  ? 32.980 62.517  89.703  1.00 19.51  ? 47  ALA C CA  1 
ATOM   4944 C  C   . ALA C 1 24  ? 33.712 63.277  88.595  1.00 13.67  ? 47  ALA C C   1 
ATOM   4945 O  O   . ALA C 1 24  ? 33.803 64.506  88.629  1.00 15.56  ? 47  ALA C O   1 
ATOM   4946 C  CB  . ALA C 1 24  ? 33.963 61.980  90.723  1.00 18.04  ? 47  ALA C CB  1 
ATOM   4947 N  N   . ALA C 1 25  ? 34.250 62.549  87.627  1.00 13.58  ? 48  ALA C N   1 
ATOM   4948 C  CA  . ALA C 1 25  ? 34.949 63.194  86.508  1.00 15.93  ? 48  ALA C CA  1 
ATOM   4949 C  C   . ALA C 1 25  ? 34.007 64.095  85.708  1.00 13.74  ? 48  ALA C C   1 
ATOM   4950 O  O   . ALA C 1 25  ? 34.382 65.193  85.282  1.00 14.12  ? 48  ALA C O   1 
ATOM   4951 C  CB  . ALA C 1 25  ? 35.598 62.154  85.607  1.00 13.86  ? 48  ALA C CB  1 
ATOM   4952 N  N   . ILE C 1 26  ? 32.782 63.629  85.496  1.00 11.86  ? 49  ILE C N   1 
ATOM   4953 C  CA  . ILE C 1 26  ? 31.805 64.407  84.757  1.00 12.32  ? 49  ILE C CA  1 
ATOM   4954 C  C   . ILE C 1 26  ? 31.393 65.647  85.546  1.00 13.28  ? 49  ILE C C   1 
ATOM   4955 O  O   . ILE C 1 26  ? 31.275 66.743  84.986  1.00 14.52  ? 49  ILE C O   1 
ATOM   4956 C  CB  . ILE C 1 26  ? 30.589 63.533  84.352  1.00 13.14  ? 49  ILE C CB  1 
ATOM   4957 C  CG1 . ILE C 1 26  ? 31.050 62.440  83.382  1.00 10.05  ? 49  ILE C CG1 1 
ATOM   4958 C  CG2 . ILE C 1 26  ? 29.487 64.381  83.713  1.00 9.76   ? 49  ILE C CG2 1 
ATOM   4959 C  CD1 . ILE C 1 26  ? 29.990 61.366  83.089  1.00 12.08  ? 49  ILE C CD1 1 
ATOM   4960 N  N   . ARG C 1 27  ? 31.195 65.490  86.851  1.00 12.49  ? 50  ARG C N   1 
ATOM   4961 C  CA  . ARG C 1 27  ? 30.891 66.637  87.703  1.00 13.53  ? 50  ARG C CA  1 
ATOM   4962 C  C   . ARG C 1 27  ? 32.026 67.646  87.682  1.00 11.12  ? 50  ARG C C   1 
ATOM   4963 O  O   . ARG C 1 27  ? 31.794 68.847  87.578  1.00 16.33  ? 50  ARG C O   1 
ATOM   4964 C  CB  . ARG C 1 27  ? 30.660 66.179  89.137  1.00 15.70  ? 50  ARG C CB  1 
ATOM   4965 C  CG  . ARG C 1 27  ? 29.352 65.441  89.354  1.00 20.43  ? 50  ARG C CG  1 
ATOM   4966 C  CD  . ARG C 1 27  ? 29.312 64.886  90.770  1.00 24.80  ? 50  ARG C CD  1 
ATOM   4967 N  NE  . ARG C 1 27  ? 28.183 63.986  90.982  1.00 34.67  ? 50  ARG C NE  1 
ATOM   4968 C  CZ  . ARG C 1 27  ? 26.955 64.410  91.253  1.00 35.68  ? 50  ARG C CZ  1 
ATOM   4969 N  NH1 . ARG C 1 27  ? 26.710 65.715  91.329  1.00 29.30  ? 50  ARG C NH1 1 
ATOM   4970 N  NH2 . ARG C 1 27  ? 25.972 63.537  91.444  1.00 40.60  ? 50  ARG C NH2 1 
ATOM   4971 N  N   . GLU C 1 28  ? 33.256 67.145  87.782  1.00 13.04  ? 51  GLU C N   1 
ATOM   4972 C  CA  . GLU C 1 28  ? 34.436 68.008  87.787  1.00 15.97  ? 51  GLU C CA  1 
ATOM   4973 C  C   . GLU C 1 28  ? 34.556 68.778  86.477  1.00 16.12  ? 51  GLU C C   1 
ATOM   4974 O  O   . GLU C 1 28  ? 35.089 69.885  86.447  1.00 17.04  ? 51  GLU C O   1 
ATOM   4975 C  CB  . GLU C 1 28  ? 35.705 67.190  88.039  1.00 22.55  ? 51  GLU C CB  1 
ATOM   4976 C  CG  . GLU C 1 28  ? 35.842 66.673  89.465  1.00 30.43  ? 51  GLU C CG  1 
ATOM   4977 C  CD  . GLU C 1 28  ? 36.935 65.615  89.604  1.00 46.44  ? 51  GLU C CD  1 
ATOM   4978 O  OE1 . GLU C 1 28  ? 37.621 65.326  88.597  1.00 46.72  ? 51  GLU C OE1 1 
ATOM   4979 O  OE2 . GLU C 1 28  ? 37.099 65.061  90.715  1.00 48.46  ? 51  GLU C OE2 1 
ATOM   4980 N  N   . ALA C 1 29  ? 34.034 68.203  85.399  1.00 14.45  ? 52  ALA C N   1 
ATOM   4981 C  CA  . ALA C 1 29  ? 34.073 68.861  84.092  1.00 14.78  ? 52  ALA C CA  1 
ATOM   4982 C  C   . ALA C 1 29  ? 33.033 69.969  83.964  1.00 15.81  ? 52  ALA C C   1 
ATOM   4983 O  O   . ALA C 1 29  ? 32.903 70.597  82.914  1.00 16.81  ? 52  ALA C O   1 
ATOM   4984 C  CB  . ALA C 1 29  ? 33.899 67.828  82.977  1.00 14.79  ? 52  ALA C CB  1 
ATOM   4985 N  N   . GLY C 1 30  ? 32.281 70.201  85.032  1.00 17.20  ? 53  GLY C N   1 
ATOM   4986 C  CA  . GLY C 1 30  ? 31.387 71.342  85.089  1.00 17.21  ? 53  GLY C CA  1 
ATOM   4987 C  C   . GLY C 1 30  ? 29.944 71.070  84.711  1.00 15.57  ? 53  GLY C C   1 
ATOM   4988 O  O   . GLY C 1 30  ? 29.233 71.989  84.323  1.00 15.07  ? 53  GLY C O   1 
ATOM   4989 N  N   . LEU C 1 31  ? 29.495 69.824  84.855  1.00 13.78  ? 54  LEU C N   1 
ATOM   4990 C  CA  . LEU C 1 31  ? 28.128 69.466  84.471  1.00 13.09  ? 54  LEU C CA  1 
ATOM   4991 C  C   . LEU C 1 31  ? 27.047 70.353  85.098  1.00 16.15  ? 54  LEU C C   1 
ATOM   4992 O  O   . LEU C 1 31  ? 26.167 70.849  84.392  1.00 13.21  ? 54  LEU C O   1 
ATOM   4993 C  CB  . LEU C 1 31  ? 27.827 68.006  84.814  1.00 10.45  ? 54  LEU C CB  1 
ATOM   4994 C  CG  . LEU C 1 31  ? 26.398 67.589  84.454  1.00 14.99  ? 54  LEU C CG  1 
ATOM   4995 C  CD1 . LEU C 1 31  ? 26.159 67.663  82.942  1.00 15.88  ? 54  LEU C CD1 1 
ATOM   4996 C  CD2 . LEU C 1 31  ? 26.061 66.204  84.989  1.00 20.61  ? 54  LEU C CD2 1 
ATOM   4997 N  N   . MET C 1 32  ? 27.086 70.553  86.415  1.00 16.41  ? 55  MET C N   1 
ATOM   4998 C  CA  . MET C 1 32  ? 25.972 71.252  87.055  1.00 14.92  ? 55  MET C CA  1 
ATOM   4999 C  C   . MET C 1 32  ? 25.839 72.694  86.586  1.00 15.96  ? 55  MET C C   1 
ATOM   5000 O  O   . MET C 1 32  ? 24.724 73.163  86.324  1.00 13.98  ? 55  MET C O   1 
ATOM   5001 C  CB  . MET C 1 32  ? 26.037 71.170  88.591  1.00 17.23  ? 55  MET C CB  1 
ATOM   5002 C  CG  . MET C 1 32  ? 26.065 69.749  89.137  1.00 17.72  ? 55  MET C CG  1 
ATOM   5003 S  SD  . MET C 1 32  ? 24.714 68.701  88.545  1.00 25.47  ? 55  MET C SD  1 
ATOM   5004 C  CE  . MET C 1 32  ? 23.428 69.040  89.752  1.00 38.55  ? 55  MET C CE  1 
ATOM   5005 N  N   . LYS C 1 33  ? 26.948 73.395  86.461  1.00 12.62  ? 56  LYS C N   1 
ATOM   5006 C  CA  . LYS C 1 33  ? 26.895 74.774  85.994  1.00 14.53  ? 56  LYS C CA  1 
ATOM   5007 C  C   . LYS C 1 33  ? 26.380 74.813  84.561  1.00 15.67  ? 56  LYS C C   1 
ATOM   5008 O  O   . LYS C 1 33  ? 25.593 75.609  84.212  1.00 15.02  ? 56  LYS C O   1 
ATOM   5009 C  CB  . LYS C 1 33  ? 28.235 75.475  86.080  1.00 17.33  ? 56  LYS C CB  1 
ATOM   5010 C  CG  . LYS C 1 33  ? 28.236 76.934  85.631  1.00 13.30  ? 56  LYS C CG  1 
ATOM   5011 C  CD  . LYS C 1 33  ? 27.035 77.814  86.031  1.00 26.28  ? 56  LYS C CD  1 
ATOM   5012 C  CE  . LYS C 1 33  ? 27.260 79.335  85.810  1.00 29.88  ? 56  LYS C CE  1 
ATOM   5013 N  NZ  . LYS C 1 33  ? 26.527 80.234  86.734  1.00 28.83  ? 56  LYS C NZ  1 
ATOM   5014 N  N   . ARG C 1 34  ? 26.842 73.904  83.743  1.00 13.06  ? 57  ARG C N   1 
ATOM   5015 C  CA  . ARG C 1 34  ? 26.366 73.866  82.353  1.00 14.52  ? 57  ARG C CA  1 
ATOM   5016 C  C   . ARG C 1 34  ? 24.851 73.703  82.266  1.00 14.35  ? 57  ARG C C   1 
ATOM   5017 O  O   . ARG C 1 34  ? 24.175 74.403  81.499  1.00 12.22  ? 57  ARG C O   1 
ATOM   5018 C  CB  . ARG C 1 34  ? 27.066 72.750  81.569  1.00 15.39  ? 57  ARG C CB  1 
ATOM   5019 C  CG  . ARG C 1 34  ? 28.530 73.039  81.307  1.00 24.50  ? 57  ARG C CG  1 
ATOM   5020 C  CD  . ARG C 1 34  ? 28.718 73.994  80.120  1.00 20.72  ? 57  ARG C CD  1 
ATOM   5021 N  NE  . ARG C 1 34  ? 28.415 73.335  78.856  1.00 26.14  ? 57  ARG C NE  1 
ATOM   5022 C  CZ  . ARG C 1 34  ? 29.242 72.489  78.246  1.00 16.56  ? 57  ARG C CZ  1 
ATOM   5023 N  NH1 . ARG C 1 34  ? 30.428 72.215  78.776  1.00 23.23  ? 57  ARG C NH1 1 
ATOM   5024 N  NH2 . ARG C 1 34  ? 28.888 71.926  77.102  1.00 23.90  ? 57  ARG C NH2 1 
ATOM   5025 N  N   . LEU C 1 35  ? 24.310 72.796  83.072  1.00 12.67  ? 58  LEU C N   1 
ATOM   5026 C  CA  . LEU C 1 35  ? 22.875 72.566  83.059  1.00 12.33  ? 58  LEU C CA  1 
ATOM   5027 C  C   . LEU C 1 35  ? 22.118 73.773  83.614  1.00 14.73  ? 58  LEU C C   1 
ATOM   5028 O  O   . LEU C 1 35  ? 21.087 74.160  83.066  1.00 14.31  ? 58  LEU C O   1 
ATOM   5029 C  CB  . LEU C 1 35  ? 22.524 71.284  83.815  1.00 11.10  ? 58  LEU C CB  1 
ATOM   5030 C  CG  . LEU C 1 35  ? 23.009 70.017  83.101  1.00 12.92  ? 58  LEU C CG  1 
ATOM   5031 C  CD1 . LEU C 1 35  ? 22.689 68.778  83.915  1.00 17.65  ? 58  LEU C CD1 1 
ATOM   5032 C  CD2 . LEU C 1 35  ? 22.383 69.918  81.718  1.00 14.55  ? 58  LEU C CD2 1 
ATOM   5033 N  N   . SER C 1 36  ? 22.630 74.368  84.691  1.00 14.97  ? 59  SER C N   1 
ATOM   5034 C  CA  A SER C 1 36  ? 22.001 75.559  85.269  0.81 15.12  ? 59  SER C CA  1 
ATOM   5035 C  CA  B SER C 1 36  ? 22.012 75.554  85.274  0.19 15.22  ? 59  SER C CA  1 
ATOM   5036 C  C   . SER C 1 36  ? 21.934 76.678  84.250  1.00 14.51  ? 59  SER C C   1 
ATOM   5037 O  O   . SER C 1 36  ? 20.920 77.355  84.137  1.00 17.73  ? 59  SER C O   1 
ATOM   5038 C  CB  A SER C 1 36  ? 22.766 76.050  86.505  0.81 15.71  ? 59  SER C CB  1 
ATOM   5039 C  CB  B SER C 1 36  ? 22.797 76.020  86.502  0.19 15.81  ? 59  SER C CB  1 
ATOM   5040 O  OG  A SER C 1 36  ? 22.856 75.038  87.482  0.81 18.92  ? 59  SER C OG  1 
ATOM   5041 O  OG  B SER C 1 36  ? 22.836 75.017  87.495  0.19 18.80  ? 59  SER C OG  1 
ATOM   5042 N  N   . SER C 1 37  ? 23.022 76.857  83.503  1.00 15.96  ? 60  SER C N   1 
ATOM   5043 C  CA  . SER C 1 37  ? 23.107 77.903  82.493  1.00 13.67  ? 60  SER C CA  1 
ATOM   5044 C  C   . SER C 1 37  ? 22.071 77.740  81.395  1.00 18.30  ? 60  SER C C   1 
ATOM   5045 O  O   . SER C 1 37  ? 21.707 78.707  80.736  1.00 19.84  ? 60  SER C O   1 
ATOM   5046 C  CB  . SER C 1 37  ? 24.510 77.958  81.888  1.00 19.35  ? 60  SER C CB  1 
ATOM   5047 O  OG  . SER C 1 37  ? 25.440 78.414  82.848  1.00 28.20  ? 60  SER C OG  1 
ATOM   5048 N  N   . LEU C 1 38  ? 21.617 76.509  81.180  1.00 17.76  ? 61  LEU C N   1 
ATOM   5049 C  CA  . LEU C 1 38  ? 20.579 76.255  80.183  1.00 18.74  ? 61  LEU C CA  1 
ATOM   5050 C  C   . LEU C 1 38  ? 19.183 76.492  80.743  1.00 23.85  ? 61  LEU C C   1 
ATOM   5051 O  O   . LEU C 1 38  ? 18.188 76.353  80.030  1.00 25.16  ? 61  LEU C O   1 
ATOM   5052 C  CB  . LEU C 1 38  ? 20.677 74.820  79.653  1.00 18.08  ? 61  LEU C CB  1 
ATOM   5053 C  CG  . LEU C 1 38  ? 21.936 74.481  78.853  1.00 20.66  ? 61  LEU C CG  1 
ATOM   5054 C  CD1 . LEU C 1 38  ? 22.010 72.982  78.599  1.00 19.58  ? 61  LEU C CD1 1 
ATOM   5055 C  CD2 . LEU C 1 38  ? 21.932 75.246  77.540  1.00 16.47  ? 61  LEU C CD2 1 
ATOM   5056 N  N   . GLY C 1 39  ? 19.106 76.815  82.029  1.00 16.83  ? 62  GLY C N   1 
ATOM   5057 C  CA  . GLY C 1 39  ? 17.823 77.064  82.659  1.00 18.26  ? 62  GLY C CA  1 
ATOM   5058 C  C   . GLY C 1 39  ? 17.251 75.864  83.384  1.00 25.56  ? 62  GLY C C   1 
ATOM   5059 O  O   . GLY C 1 39  ? 16.079 75.872  83.766  1.00 19.42  ? 62  GLY C O   1 
ATOM   5060 N  N   A CYS C 1 40  ? 18.065 74.828  83.581  0.88 18.13  ? 63  CYS C N   1 
ATOM   5061 C  CA  A CYS C 1 40  ? 17.609 73.652  84.322  0.88 20.20  ? 63  CYS C CA  1 
ATOM   5062 C  C   A CYS C 1 40  ? 17.582 73.907  85.818  0.88 21.30  ? 63  CYS C C   1 
ATOM   5063 O  O   . CYS C 1 40  ? 18.568 74.372  86.391  1.00 18.31  ? 63  CYS C O   1 
ATOM   5064 C  CB  A CYS C 1 40  ? 18.517 72.451  84.062  0.88 18.90  ? 63  CYS C CB  1 
ATOM   5065 S  SG  A CYS C 1 40  ? 18.727 72.020  82.313  0.88 33.25  ? 63  CYS C SG  1 
ATOM   5066 N  N   . HIS C 1 41  ? 16.450 73.597  86.443  1.00 23.75  ? 64  HIS C N   1 
ATOM   5067 C  CA  . HIS C 1 41  ? 16.359 73.525  87.900  1.00 25.22  ? 64  HIS C CA  1 
ATOM   5068 C  C   . HIS C 1 41  ? 16.861 72.152  88.314  1.00 25.93  ? 64  HIS C C   1 
ATOM   5069 O  O   . HIS C 1 41  ? 16.379 71.142  87.811  1.00 28.89  ? 64  HIS C O   1 
ATOM   5070 C  CB  . HIS C 1 41  ? 14.913 73.722  88.367  1.00 23.38  ? 64  HIS C CB  1 
ATOM   5071 C  CG  . HIS C 1 41  ? 14.386 75.106  88.147  1.00 35.71  ? 64  HIS C CG  1 
ATOM   5072 N  ND1 . HIS C 1 41  ? 14.318 75.694  86.898  1.00 43.03  ? 64  HIS C ND1 1 
ATOM   5073 C  CD2 . HIS C 1 41  ? 13.891 76.017  89.017  1.00 33.56  ? 64  HIS C CD2 1 
ATOM   5074 C  CE1 . HIS C 1 41  ? 13.814 76.910  87.015  1.00 32.44  ? 64  HIS C CE1 1 
ATOM   5075 N  NE2 . HIS C 1 41  ? 13.539 77.130  88.287  1.00 36.97  ? 64  HIS C NE2 1 
ATOM   5076 N  N   . LEU C 1 42  ? 17.833 72.111  89.218  1.00 22.71  ? 65  LEU C N   1 
ATOM   5077 C  CA  . LEU C 1 42  ? 18.553 70.873  89.477  1.00 19.96  ? 65  LEU C CA  1 
ATOM   5078 C  C   . LEU C 1 42  ? 18.276 70.266  90.841  1.00 30.45  ? 65  LEU C C   1 
ATOM   5079 O  O   . LEU C 1 42  ? 18.273 70.955  91.859  1.00 23.96  ? 65  LEU C O   1 
ATOM   5080 C  CB  . LEU C 1 42  ? 20.058 71.109  89.358  1.00 18.79  ? 65  LEU C CB  1 
ATOM   5081 C  CG  . LEU C 1 42  ? 20.568 71.608  88.009  1.00 21.09  ? 65  LEU C CG  1 
ATOM   5082 C  CD1 . LEU C 1 42  ? 22.050 71.928  88.098  1.00 18.90  ? 65  LEU C CD1 1 
ATOM   5083 C  CD2 . LEU C 1 42  ? 20.310 70.569  86.932  1.00 24.12  ? 65  LEU C CD2 1 
ATOM   5084 N  N   . LYS C 1 43  ? 18.077 68.955  90.854  1.00 25.65  ? 66  LYS C N   1 
ATOM   5085 C  CA  . LYS C 1 43  ? 18.089 68.202  92.094  1.00 23.17  ? 66  LYS C CA  1 
ATOM   5086 C  C   . LYS C 1 43  ? 19.248 67.237  91.969  1.00 25.91  ? 66  LYS C C   1 
ATOM   5087 O  O   . LYS C 1 43  ? 19.236 66.349  91.113  1.00 23.12  ? 66  LYS C O   1 
ATOM   5088 C  CB  . LYS C 1 43  ? 16.761 67.464  92.299  1.00 27.97  ? 66  LYS C CB  1 
ATOM   5089 C  CG  . LYS C 1 43  ? 16.638 66.726  93.637  1.00 39.11  ? 66  LYS C CG  1 
ATOM   5090 C  CD  . LYS C 1 43  ? 15.221 66.178  93.821  1.00 37.16  ? 66  LYS C CD  1 
ATOM   5091 C  CE  . LYS C 1 43  ? 14.956 65.718  95.249  1.00 51.98  ? 66  LYS C CE  1 
ATOM   5092 N  NZ  . LYS C 1 43  ? 14.732 64.252  95.348  1.00 42.05  ? 66  LYS C NZ  1 
ATOM   5093 N  N   . ASP C 1 44  ? 20.262 67.439  92.802  1.00 21.95  ? 67  ASP C N   1 
ATOM   5094 C  CA  . ASP C 1 44  ? 21.437 66.592  92.783  1.00 25.50  ? 67  ASP C CA  1 
ATOM   5095 C  C   . ASP C 1 44  ? 21.301 65.519  93.857  1.00 34.59  ? 67  ASP C C   1 
ATOM   5096 O  O   . ASP C 1 44  ? 21.246 65.822  95.048  1.00 27.73  ? 67  ASP C O   1 
ATOM   5097 C  CB  . ASP C 1 44  ? 22.693 67.424  93.030  1.00 24.60  ? 67  ASP C CB  1 
ATOM   5098 C  CG  . ASP C 1 44  ? 23.960 66.648  92.752  1.00 27.88  ? 67  ASP C CG  1 
ATOM   5099 O  OD1 . ASP C 1 44  ? 23.864 65.422  92.516  1.00 29.41  ? 67  ASP C OD1 1 
ATOM   5100 O  OD2 . ASP C 1 44  ? 25.047 67.260  92.760  1.00 37.71  ? 67  ASP C OD2 1 
ATOM   5101 N  N   . PHE C 1 45  ? 21.244 64.264  93.425  1.00 26.76  ? 68  PHE C N   1 
ATOM   5102 C  CA  . PHE C 1 45  ? 21.156 63.143  94.352  1.00 29.54  ? 68  PHE C CA  1 
ATOM   5103 C  C   . PHE C 1 45  ? 22.529 62.730  94.848  1.00 30.10  ? 68  PHE C C   1 
ATOM   5104 O  O   . PHE C 1 45  ? 22.656 61.818  95.662  1.00 33.44  ? 68  PHE C O   1 
ATOM   5105 C  CB  . PHE C 1 45  ? 20.468 61.958  93.682  1.00 25.76  ? 68  PHE C CB  1 
ATOM   5106 C  CG  . PHE C 1 45  ? 18.989 62.119  93.551  1.00 26.67  ? 68  PHE C CG  1 
ATOM   5107 C  CD1 . PHE C 1 45  ? 18.449 62.951  92.583  1.00 18.57  ? 68  PHE C CD1 1 
ATOM   5108 C  CD2 . PHE C 1 45  ? 18.133 61.423  94.389  1.00 34.22  ? 68  PHE C CD2 1 
ATOM   5109 C  CE1 . PHE C 1 45  ? 17.079 63.098  92.461  1.00 32.98  ? 68  PHE C CE1 1 
ATOM   5110 C  CE2 . PHE C 1 45  ? 16.765 61.563  94.273  1.00 30.09  ? 68  PHE C CE2 1 
ATOM   5111 C  CZ  . PHE C 1 45  ? 16.235 62.401  93.304  1.00 29.86  ? 68  PHE C CZ  1 
ATOM   5112 N  N   . GLY C 1 46  ? 23.561 63.388  94.332  1.00 25.27  ? 69  GLY C N   1 
ATOM   5113 C  CA  . GLY C 1 46  ? 24.925 63.018  94.643  1.00 27.61  ? 69  GLY C CA  1 
ATOM   5114 C  C   . GLY C 1 46  ? 25.237 61.664  94.044  1.00 29.07  ? 69  GLY C C   1 
ATOM   5115 O  O   . GLY C 1 46  ? 24.511 61.179  93.175  1.00 24.99  ? 69  GLY C O   1 
ATOM   5116 N  N   . ASP C 1 47  ? 26.310 61.043  94.518  1.00 25.38  ? 70  ASP C N   1 
ATOM   5117 C  CA  . ASP C 1 47  ? 26.668 59.701  94.085  1.00 25.53  ? 70  ASP C CA  1 
ATOM   5118 C  C   . ASP C 1 47  ? 26.100 58.674  95.048  1.00 26.86  ? 70  ASP C C   1 
ATOM   5119 O  O   . ASP C 1 47  ? 26.394 58.698  96.245  1.00 19.76  ? 70  ASP C O   1 
ATOM   5120 C  CB  . ASP C 1 47  ? 28.184 59.557  94.000  1.00 28.25  ? 70  ASP C CB  1 
ATOM   5121 C  CG  . ASP C 1 47  ? 28.768 60.249  92.780  1.00 42.91  ? 70  ASP C CG  1 
ATOM   5122 O  OD1 . ASP C 1 47  ? 28.051 61.062  92.141  1.00 35.90  ? 70  ASP C OD1 1 
ATOM   5123 O  OD2 . ASP C 1 47  ? 29.953 59.982  92.477  1.00 53.07  ? 70  ASP C OD2 1 
ATOM   5124 N  N   . LEU C 1 48  ? 25.292 57.764  94.519  1.00 15.86  ? 71  LEU C N   1 
ATOM   5125 C  CA  . LEU C 1 48  ? 24.674 56.730  95.343  1.00 23.34  ? 71  LEU C CA  1 
ATOM   5126 C  C   . LEU C 1 48  ? 25.703 55.735  95.876  1.00 28.01  ? 71  LEU C C   1 
ATOM   5127 O  O   . LEU C 1 48  ? 26.719 55.458  95.230  1.00 22.12  ? 71  LEU C O   1 
ATOM   5128 C  CB  . LEU C 1 48  ? 23.590 55.990  94.551  1.00 20.95  ? 71  LEU C CB  1 
ATOM   5129 C  CG  . LEU C 1 48  ? 22.482 56.851  93.952  1.00 18.90  ? 71  LEU C CG  1 
ATOM   5130 C  CD1 . LEU C 1 48  ? 21.430 55.991  93.298  1.00 18.50  ? 71  LEU C CD1 1 
ATOM   5131 C  CD2 . LEU C 1 48  ? 21.854 57.700  95.034  1.00 19.42  ? 71  LEU C CD2 1 
ATOM   5132 N  N   . SER C 1 49  ? 25.433 55.207  97.066  1.00 22.88  ? 72  SER C N   1 
ATOM   5133 C  CA  . SER C 1 49  ? 26.228 54.121  97.626  1.00 22.77  ? 72  SER C CA  1 
ATOM   5134 C  C   . SER C 1 49  ? 25.392 52.865  97.554  1.00 21.73  ? 72  SER C C   1 
ATOM   5135 O  O   . SER C 1 49  ? 24.338 52.776  98.184  1.00 25.13  ? 72  SER C O   1 
ATOM   5136 C  CB  . SER C 1 49  ? 26.574 54.400  99.089  1.00 24.96  ? 72  SER C CB  1 
ATOM   5137 O  OG  . SER C 1 49  ? 27.450 55.502  99.204  1.00 36.38  ? 72  SER C OG  1 
ATOM   5138 N  N   . PHE C 1 50  ? 25.849 51.889  96.782  1.00 19.75  ? 73  PHE C N   1 
ATOM   5139 C  CA  . PHE C 1 50  ? 25.064 50.677  96.606  1.00 19.59  ? 73  PHE C CA  1 
ATOM   5140 C  C   . PHE C 1 50  ? 25.414 49.622  97.647  1.00 17.50  ? 73  PHE C C   1 
ATOM   5141 O  O   . PHE C 1 50  ? 26.571 49.485  98.052  1.00 24.62  ? 73  PHE C O   1 
ATOM   5142 C  CB  . PHE C 1 50  ? 25.206 50.148  95.176  1.00 18.28  ? 73  PHE C CB  1 
ATOM   5143 C  CG  . PHE C 1 50  ? 24.765 51.143  94.133  1.00 22.06  ? 73  PHE C CG  1 
ATOM   5144 C  CD1 . PHE C 1 50  ? 23.414 51.445  93.983  1.00 23.02  ? 73  PHE C CD1 1 
ATOM   5145 C  CD2 . PHE C 1 50  ? 25.693 51.806  93.341  1.00 21.34  ? 73  PHE C CD2 1 
ATOM   5146 C  CE1 . PHE C 1 50  ? 22.982 52.380  93.042  1.00 25.16  ? 73  PHE C CE1 1 
ATOM   5147 C  CE2 . PHE C 1 50  ? 25.274 52.743  92.390  1.00 22.85  ? 73  PHE C CE2 1 
ATOM   5148 C  CZ  . PHE C 1 50  ? 23.918 53.029  92.246  1.00 23.42  ? 73  PHE C CZ  1 
ATOM   5149 N  N   . THR C 1 51  ? 24.404 48.864  98.059  1.00 20.21  ? 74  THR C N   1 
ATOM   5150 C  CA  . THR C 1 51  ? 24.595 47.837  99.073  1.00 25.09  ? 74  THR C CA  1 
ATOM   5151 C  C   . THR C 1 51  ? 25.421 46.690  98.512  1.00 18.85  ? 74  THR C C   1 
ATOM   5152 O  O   . THR C 1 51  ? 25.051 46.087  97.505  1.00 20.29  ? 74  THR C O   1 
ATOM   5153 C  CB  . THR C 1 51  ? 23.243 47.307  99.574  1.00 25.92  ? 74  THR C CB  1 
ATOM   5154 O  OG1 . THR C 1 51  ? 22.444 48.409  100.017 1.00 24.73  ? 74  THR C OG1 1 
ATOM   5155 C  CG2 . THR C 1 51  ? 23.442 46.333  100.732 1.00 24.88  ? 74  THR C CG2 1 
ATOM   5156 N  N   . PRO C 1 52  ? 26.559 46.393  99.157  1.00 22.15  ? 75  PRO C N   1 
ATOM   5157 C  CA  . PRO C 1 52  ? 27.364 45.270  98.672  1.00 21.06  ? 75  PRO C CA  1 
ATOM   5158 C  C   . PRO C 1 52  ? 26.693 43.936  98.971  1.00 20.40  ? 75  PRO C C   1 
ATOM   5159 O  O   . PRO C 1 52  ? 25.822 43.847  99.837  1.00 19.10  ? 75  PRO C O   1 
ATOM   5160 C  CB  . PRO C 1 52  ? 28.677 45.411  99.452  1.00 25.30  ? 75  PRO C CB  1 
ATOM   5161 C  CG  . PRO C 1 52  ? 28.315 46.157  100.694 1.00 26.05  ? 75  PRO C CG  1 
ATOM   5162 C  CD  . PRO C 1 52  ? 27.166 47.065  100.322 1.00 22.61  ? 75  PRO C CD  1 
ATOM   5163 N  N   . VAL C 1 53  ? 27.087 42.907  98.232  1.00 18.73  ? 76  VAL C N   1 
ATOM   5164 C  CA  . VAL C 1 53  ? 26.588 41.566  98.462  1.00 18.45  ? 76  VAL C CA  1 
ATOM   5165 C  C   . VAL C 1 53  ? 27.787 40.689  98.746  1.00 15.36  ? 76  VAL C C   1 
ATOM   5166 O  O   . VAL C 1 53  ? 28.646 40.515  97.888  1.00 23.61  ? 76  VAL C O   1 
ATOM   5167 C  CB  . VAL C 1 53  ? 25.846 41.017  97.232  1.00 23.65  ? 76  VAL C CB  1 
ATOM   5168 C  CG1 . VAL C 1 53  ? 25.465 39.555  97.453  1.00 21.33  ? 76  VAL C CG1 1 
ATOM   5169 C  CG2 . VAL C 1 53  ? 24.614 41.874  96.914  1.00 22.86  ? 76  VAL C CG2 1 
ATOM   5170 N  N   . PRO C 1 54  ? 27.842 40.115  99.956  1.00 20.55  ? 77  PRO C N   1 
ATOM   5171 C  CA  . PRO C 1 54  ? 28.980 39.259  100.302 1.00 21.54  ? 77  PRO C CA  1 
ATOM   5172 C  C   . PRO C 1 54  ? 28.974 37.998  99.455  1.00 19.96  ? 77  PRO C C   1 
ATOM   5173 O  O   . PRO C 1 54  ? 27.889 37.505  99.140  1.00 21.36  ? 77  PRO C O   1 
ATOM   5174 C  CB  . PRO C 1 54  ? 28.708 38.881  101.768 1.00 27.27  ? 77  PRO C CB  1 
ATOM   5175 C  CG  . PRO C 1 54  ? 27.607 39.791  102.240 1.00 31.91  ? 77  PRO C CG  1 
ATOM   5176 C  CD  . PRO C 1 54  ? 26.823 40.150  101.019 1.00 21.96  ? 77  PRO C CD  1 
ATOM   5177 N  N   . LYS C 1 55  ? 30.150 37.502  99.081  1.00 15.51  ? 78  LYS C N   1 
ATOM   5178 C  CA  . LYS C 1 55  ? 30.269 36.200  98.428  1.00 28.69  ? 78  LYS C CA  1 
ATOM   5179 C  C   . LYS C 1 55  ? 29.429 36.163  97.161  1.00 33.51  ? 78  LYS C C   1 
ATOM   5180 O  O   . LYS C 1 55  ? 28.684 35.213  96.918  1.00 22.12  ? 78  LYS C O   1 
ATOM   5181 C  CB  . LYS C 1 55  ? 29.824 35.083  99.389  1.00 31.48  ? 78  LYS C CB  1 
ATOM   5182 C  CG  . LYS C 1 55  ? 30.332 33.676  99.068  1.00 38.38  ? 78  LYS C CG  1 
ATOM   5183 C  CD  . LYS C 1 55  ? 31.751 33.431  99.550  1.00 35.79  ? 78  LYS C CD  1 
ATOM   5184 C  CE  . LYS C 1 55  ? 32.079 31.942  99.499  1.00 46.21  ? 78  LYS C CE  1 
ATOM   5185 N  NZ  . LYS C 1 55  ? 32.188 31.420  98.105  1.00 52.28  ? 78  LYS C NZ  1 
ATOM   5186 N  N   . ASP C 1 56  ? 29.561 37.201  96.347  1.00 23.97  ? 79  ASP C N   1 
ATOM   5187 C  CA  . ASP C 1 56  ? 28.793 37.285  95.118  1.00 26.99  ? 79  ASP C CA  1 
ATOM   5188 C  C   . ASP C 1 56  ? 29.540 36.511  94.055  1.00 27.63  ? 79  ASP C C   1 
ATOM   5189 O  O   . ASP C 1 56  ? 30.104 37.090  93.125  1.00 22.69  ? 79  ASP C O   1 
ATOM   5190 C  CB  . ASP C 1 56  ? 28.588 38.745  94.715  1.00 26.42  ? 79  ASP C CB  1 
ATOM   5191 C  CG  . ASP C 1 56  ? 27.669 38.904  93.515  1.00 21.36  ? 79  ASP C CG  1 
ATOM   5192 O  OD1 . ASP C 1 56  ? 27.029 37.916  93.071  1.00 14.45  ? 79  ASP C OD1 1 
ATOM   5193 O  OD2 . ASP C 1 56  ? 27.586 40.044  93.025  1.00 16.57  ? 79  ASP C OD2 1 
ATOM   5194 N  N   . ASP C 1 57  ? 29.564 35.193  94.235  1.00 26.73  ? 80  ASP C N   1 
ATOM   5195 C  CA  . ASP C 1 57  ? 30.236 34.278  93.324  1.00 30.59  ? 80  ASP C CA  1 
ATOM   5196 C  C   . ASP C 1 57  ? 29.704 34.365  91.902  1.00 27.06  ? 80  ASP C C   1 
ATOM   5197 O  O   . ASP C 1 57  ? 28.541 34.716  91.680  1.00 26.75  ? 80  ASP C O   1 
ATOM   5198 C  CB  . ASP C 1 57  ? 30.068 32.841  93.821  1.00 31.91  ? 80  ASP C CB  1 
ATOM   5199 C  CG  . ASP C 1 57  ? 30.734 32.613  95.164  1.00 43.35  ? 80  ASP C CG  1 
ATOM   5200 O  OD1 . ASP C 1 57  ? 31.749 33.292  95.445  1.00 41.85  ? 80  ASP C OD1 1 
ATOM   5201 O  OD2 . ASP C 1 57  ? 30.238 31.763  95.936  1.00 45.47  ? 80  ASP C OD2 1 
ATOM   5202 N  N   . LEU C 1 58  ? 30.553 33.984  90.953  1.00 22.81  ? 81  LEU C N   1 
ATOM   5203 C  CA  . LEU C 1 58  ? 30.170 33.887  89.560  1.00 22.58  ? 81  LEU C CA  1 
ATOM   5204 C  C   . LEU C 1 58  ? 28.887 33.100  89.441  1.00 24.60  ? 81  LEU C C   1 
ATOM   5205 O  O   . LEU C 1 58  ? 28.656 32.134  90.172  1.00 25.11  ? 81  LEU C O   1 
ATOM   5206 C  CB  . LEU C 1 58  ? 31.251 33.149  88.769  1.00 21.83  ? 81  LEU C CB  1 
ATOM   5207 C  CG  . LEU C 1 58  ? 32.564 33.854  88.452  1.00 33.34  ? 81  LEU C CG  1 
ATOM   5208 C  CD1 . LEU C 1 58  ? 33.310 33.072  87.389  1.00 19.94  ? 81  LEU C CD1 1 
ATOM   5209 C  CD2 . LEU C 1 58  ? 32.282 35.251  87.965  1.00 31.01  ? 81  LEU C CD2 1 
ATOM   5210 N  N   . TYR C 1 59  ? 28.065 33.493  88.487  1.00 16.81  ? 82  TYR C N   1 
ATOM   5211 C  CA  . TYR C 1 59  ? 26.937 32.666  88.112  1.00 18.67  ? 82  TYR C CA  1 
ATOM   5212 C  C   . TYR C 1 59  ? 27.386 31.806  86.948  1.00 21.49  ? 82  TYR C C   1 
ATOM   5213 O  O   . TYR C 1 59  ? 27.972 32.309  85.984  1.00 16.62  ? 82  TYR C O   1 
ATOM   5214 C  CB  . TYR C 1 59  ? 25.742 33.540  87.736  1.00 20.82  ? 82  TYR C CB  1 
ATOM   5215 C  CG  . TYR C 1 59  ? 24.619 32.808  87.037  1.00 19.46  ? 82  TYR C CG  1 
ATOM   5216 C  CD1 . TYR C 1 59  ? 23.639 32.140  87.761  1.00 25.24  ? 82  TYR C CD1 1 
ATOM   5217 C  CD2 . TYR C 1 59  ? 24.545 32.786  85.650  1.00 23.51  ? 82  TYR C CD2 1 
ATOM   5218 C  CE1 . TYR C 1 59  ? 22.610 31.476  87.124  1.00 32.53  ? 82  TYR C CE1 1 
ATOM   5219 C  CE2 . TYR C 1 59  ? 23.521 32.123  84.999  1.00 32.84  ? 82  TYR C CE2 1 
ATOM   5220 C  CZ  . TYR C 1 59  ? 22.555 31.474  85.740  1.00 37.29  ? 82  TYR C CZ  1 
ATOM   5221 O  OH  . TYR C 1 59  ? 21.536 30.818  85.085  1.00 37.08  ? 82  TYR C OH  1 
ATOM   5222 N  N   . ASN C 1 60  ? 27.126 30.530  87.061  1.00 18.35  ? 83  ASN C N   1 
ATOM   5223 C  CA  . ASN C 1 60  ? 27.474 29.609  86.029  1.00 20.18  ? 83  ASN C CA  1 
ATOM   5224 C  C   . ASN C 1 60  ? 28.965 29.613  85.655  1.00 14.35  ? 83  ASN C C   1 
ATOM   5225 O  O   . ASN C 1 60  ? 29.322 29.444  84.540  1.00 18.16  ? 83  ASN C O   1 
ATOM   5226 C  CB  . ASN C 1 60  ? 26.638 29.853  84.796  1.00 20.41  ? 83  ASN C CB  1 
ATOM   5227 C  CG  . ASN C 1 60  ? 26.362 28.582  84.040  1.00 36.54  ? 83  ASN C CG  1 
ATOM   5228 O  OD1 . ASN C 1 60  ? 26.586 27.497  84.532  1.00 25.54  ? 83  ASN C OD1 1 
ATOM   5229 N  ND2 . ASN C 1 60  ? 25.852 28.720  82.849  1.00 29.71  ? 83  ASN C ND2 1 
ATOM   5230 N  N   . ASN C 1 61  ? 29.812 29.829  86.620  1.00 11.23  ? 84  ASN C N   1 
ATOM   5231 C  CA  . ASN C 1 61  ? 31.250 29.928  86.376  1.00 18.67  ? 84  ASN C CA  1 
ATOM   5232 C  C   . ASN C 1 61  ? 31.686 31.002  85.373  1.00 14.71  ? 84  ASN C C   1 
ATOM   5233 O  O   . ASN C 1 61  ? 32.836 31.020  84.934  1.00 16.61  ? 84  ASN C O   1 
ATOM   5234 C  CB  . ASN C 1 61  ? 31.868 28.546  86.128  1.00 16.62  ? 84  ASN C CB  1 
ATOM   5235 C  CG  . ASN C 1 61  ? 32.008 27.734  87.407  1.00 20.49  ? 84  ASN C CG  1 
ATOM   5236 O  OD1 . ASN C 1 61  ? 32.516 28.223  88.413  1.00 24.48  ? 84  ASN C OD1 1 
ATOM   5237 N  ND2 . ASN C 1 61  ? 31.567 26.491  87.365  1.00 21.99  ? 84  ASN C ND2 1 
ATOM   5238 N  N   . LEU C 1 62  ? 30.764 31.887  85.015  1.00 13.75  ? 85  LEU C N   1 
ATOM   5239 C  CA  . LEU C 1 62  ? 31.062 32.901  84.010  1.00 17.73  ? 85  LEU C CA  1 
ATOM   5240 C  C   . LEU C 1 62  ? 30.602 34.325  84.283  1.00 16.77  ? 85  LEU C C   1 
ATOM   5241 O  O   . LEU C 1 62  ? 31.376 35.270  84.095  1.00 15.92  ? 85  LEU C O   1 
ATOM   5242 C  CB  . LEU C 1 62  ? 30.406 32.384  82.726  1.00 15.98  ? 85  LEU C CB  1 
ATOM   5243 C  CG  . LEU C 1 62  ? 30.568 33.336  81.531  1.00 14.08  ? 85  LEU C CG  1 
ATOM   5244 C  CD1 . LEU C 1 62  ? 32.030 33.540  81.229  1.00 12.48  ? 85  LEU C CD1 1 
ATOM   5245 C  CD2 . LEU C 1 62  ? 29.850 32.781  80.294  1.00 14.32  ? 85  LEU C CD2 1 
ATOM   5246 N  N   . ILE C 1 63  ? 29.350 34.479  84.716  1.00 13.81  ? 86  ILE C N   1 
ATOM   5247 C  CA  . ILE C 1 63  ? 28.754 35.804  84.875  1.00 15.04  ? 86  ILE C CA  1 
ATOM   5248 C  C   . ILE C 1 63  ? 29.233 36.423  86.169  1.00 18.53  ? 86  ILE C C   1 
ATOM   5249 O  O   . ILE C 1 63  ? 29.025 35.873  87.256  1.00 14.45  ? 86  ILE C O   1 
ATOM   5250 C  CB  . ILE C 1 63  ? 27.204 35.749  84.902  1.00 18.64  ? 86  ILE C CB  1 
ATOM   5251 C  CG1 . ILE C 1 63  ? 26.676 34.918  83.737  1.00 25.57  ? 86  ILE C CG1 1 
ATOM   5252 C  CG2 . ILE C 1 63  ? 26.603 37.170  84.912  1.00 17.05  ? 86  ILE C CG2 1 
ATOM   5253 C  CD1 . ILE C 1 63  ? 26.957 35.512  82.385  1.00 24.01  ? 86  ILE C CD1 1 
ATOM   5254 N  N   . VAL C 1 64  ? 29.868 37.584  86.064  1.00 18.36  ? 87  VAL C N   1 
ATOM   5255 C  CA  . VAL C 1 64  ? 30.517 38.168  87.230  1.00 14.74  ? 87  VAL C CA  1 
ATOM   5256 C  C   . VAL C 1 64  ? 29.615 39.139  87.991  1.00 15.12  ? 87  VAL C C   1 
ATOM   5257 O  O   . VAL C 1 64  ? 28.804 39.859  87.394  1.00 15.22  ? 87  VAL C O   1 
ATOM   5258 C  CB  . VAL C 1 64  ? 31.906 38.777  86.853  1.00 29.60  ? 87  VAL C CB  1 
ATOM   5259 C  CG1 . VAL C 1 64  ? 31.751 39.843  85.819  1.00 26.04  ? 87  VAL C CG1 1 
ATOM   5260 C  CG2 . VAL C 1 64  ? 32.644 39.310  88.078  1.00 32.33  ? 87  VAL C CG2 1 
ATOM   5261 N  N   . ASN C 1 65  ? 29.737 39.104  89.318  1.00 11.83  ? 88  ASN C N   1 
ATOM   5262 C  CA  . ASN C 1 65  ? 29.009 39.985  90.226  1.00 14.24  ? 88  ASN C CA  1 
ATOM   5263 C  C   . ASN C 1 65  ? 27.495 40.102  89.993  1.00 15.01  ? 88  ASN C C   1 
ATOM   5264 O  O   . ASN C 1 65  ? 26.948 41.200  90.082  1.00 14.20  ? 88  ASN C O   1 
ATOM   5265 C  CB  . ASN C 1 65  ? 29.639 41.389  90.230  1.00 14.05  ? 88  ASN C CB  1 
ATOM   5266 C  CG  . ASN C 1 65  ? 31.157 41.357  90.428  1.00 25.89  ? 88  ASN C CG  1 
ATOM   5267 O  OD1 . ASN C 1 65  ? 31.917 41.988  89.685  1.00 30.65  ? 88  ASN C OD1 1 
ATOM   5268 N  ND2 . ASN C 1 65  ? 31.598 40.600  91.404  1.00 21.40  ? 88  ASN C ND2 1 
ATOM   5269 N  N   . PRO C 1 66  ? 26.799 38.976  89.737  1.00 15.02  ? 89  PRO C N   1 
ATOM   5270 C  CA  . PRO C 1 66  ? 25.379 39.138  89.374  1.00 13.47  ? 89  PRO C CA  1 
ATOM   5271 C  C   . PRO C 1 66  ? 24.508 39.707  90.497  1.00 15.10  ? 89  PRO C C   1 
ATOM   5272 O  O   . PRO C 1 66  ? 23.615 40.524  90.245  1.00 14.42  ? 89  PRO C O   1 
ATOM   5273 C  CB  . PRO C 1 66  ? 24.936 37.706  89.037  1.00 15.29  ? 89  PRO C CB  1 
ATOM   5274 C  CG  . PRO C 1 66  ? 25.882 36.815  89.828  1.00 16.83  ? 89  PRO C CG  1 
ATOM   5275 C  CD  . PRO C 1 66  ? 27.203 37.557  89.785  1.00 12.76  ? 89  PRO C CD  1 
ATOM   5276 N  N   . ARG C 1 67  ? 24.739 39.274  91.730  1.00 12.87  ? 90  ARG C N   1 
ATOM   5277 C  CA  . ARG C 1 67  ? 23.930 39.778  92.831  1.00 15.76  ? 90  ARG C CA  1 
ATOM   5278 C  C   . ARG C 1 67  ? 24.198 41.252  93.096  1.00 16.82  ? 90  ARG C C   1 
ATOM   5279 O  O   . ARG C 1 67  ? 23.287 42.006  93.446  1.00 15.46  ? 90  ARG C O   1 
ATOM   5280 C  CB  . ARG C 1 67  ? 24.159 38.943  94.094  1.00 19.90  ? 90  ARG C CB  1 
ATOM   5281 C  CG  . ARG C 1 67  ? 23.838 37.471  93.898  1.00 16.14  ? 90  ARG C CG  1 
ATOM   5282 C  CD  . ARG C 1 67  ? 24.471 36.627  95.000  1.00 19.59  ? 90  ARG C CD  1 
ATOM   5283 N  NE  . ARG C 1 67  ? 24.424 35.203  94.682  1.00 22.20  ? 90  ARG C NE  1 
ATOM   5284 C  CZ  . ARG C 1 67  ? 25.273 34.604  93.855  1.00 29.71  ? 90  ARG C CZ  1 
ATOM   5285 N  NH1 . ARG C 1 67  ? 26.222 35.314  93.257  1.00 17.68  ? 90  ARG C NH1 1 
ATOM   5286 N  NH2 . ARG C 1 67  ? 25.165 33.301  93.611  1.00 22.37  ? 90  ARG C NH2 1 
ATOM   5287 N  N   . SER C 1 68  ? 25.454 41.658  92.942  1.00 14.75  ? 91  SER C N   1 
ATOM   5288 C  CA  . SER C 1 68  ? 25.823 43.038  93.196  1.00 15.60  ? 91  SER C CA  1 
ATOM   5289 C  C   . SER C 1 68  ? 25.176 43.929  92.158  1.00 13.18  ? 91  SER C C   1 
ATOM   5290 O  O   . SER C 1 68  ? 24.603 44.976  92.491  1.00 16.32  ? 91  SER C O   1 
ATOM   5291 C  CB  . SER C 1 68  ? 27.344 43.209  93.166  1.00 17.58  ? 91  SER C CB  1 
ATOM   5292 O  OG  . SER C 1 68  ? 27.972 42.343  94.100  1.00 20.55  ? 91  SER C OG  1 
ATOM   5293 N  N   . VAL C 1 69  ? 25.269 43.506  90.901  1.00 14.06  ? 92  VAL C N   1 
ATOM   5294 C  CA  . VAL C 1 69  ? 24.686 44.256  89.795  1.00 14.54  ? 92  VAL C CA  1 
ATOM   5295 C  C   . VAL C 1 69  ? 23.168 44.269  89.886  1.00 15.84  ? 92  VAL C C   1 
ATOM   5296 O  O   . VAL C 1 69  ? 22.524 45.301  89.658  1.00 16.33  ? 92  VAL C O   1 
ATOM   5297 C  CB  . VAL C 1 69  ? 25.132 43.688  88.426  1.00 14.43  ? 92  VAL C CB  1 
ATOM   5298 C  CG1 . VAL C 1 69  ? 24.375 44.374  87.299  1.00 16.89  ? 92  VAL C CG1 1 
ATOM   5299 C  CG2 . VAL C 1 69  ? 26.643 43.882  88.230  1.00 16.32  ? 92  VAL C CG2 1 
ATOM   5300 N  N   . GLY C 1 70  ? 22.594 43.131  90.260  1.00 17.75  ? 93  GLY C N   1 
ATOM   5301 C  CA  . GLY C 1 70  ? 21.152 43.036  90.398  1.00 15.47  ? 93  GLY C CA  1 
ATOM   5302 C  C   . GLY C 1 70  ? 20.639 43.961  91.478  1.00 14.83  ? 93  GLY C C   1 
ATOM   5303 O  O   . GLY C 1 70  ? 19.660 44.688  91.277  1.00 15.26  ? 93  GLY C O   1 
ATOM   5304 N  N   . LEU C 1 71  ? 21.305 43.936  92.630  1.00 19.12  ? 94  LEU C N   1 
ATOM   5305 C  CA  . LEU C 1 71  ? 20.864 44.728  93.772  1.00 18.90  ? 94  LEU C CA  1 
ATOM   5306 C  C   . LEU C 1 71  ? 21.124 46.213  93.564  1.00 18.45  ? 94  LEU C C   1 
ATOM   5307 O  O   . LEU C 1 71  ? 20.273 47.047  93.881  1.00 16.86  ? 94  LEU C O   1 
ATOM   5308 C  CB  . LEU C 1 71  ? 21.523 44.246  95.072  1.00 16.98  ? 94  LEU C CB  1 
ATOM   5309 C  CG  . LEU C 1 71  ? 21.074 44.987  96.338  1.00 19.96  ? 94  LEU C CG  1 
ATOM   5310 C  CD1 . LEU C 1 71  ? 19.554 44.903  96.524  1.00 21.12  ? 94  LEU C CD1 1 
ATOM   5311 C  CD2 . LEU C 1 71  ? 21.798 44.475  97.586  1.00 23.00  ? 94  LEU C CD2 1 
ATOM   5312 N  N   . ALA C 1 72  ? 22.299 46.556  93.046  1.00 17.14  ? 95  ALA C N   1 
ATOM   5313 C  CA  . ALA C 1 72  ? 22.578 47.965  92.773  1.00 15.17  ? 95  ALA C CA  1 
ATOM   5314 C  C   . ALA C 1 72  ? 21.535 48.525  91.801  1.00 14.07  ? 95  ALA C C   1 
ATOM   5315 O  O   . ALA C 1 72  ? 21.018 49.632  91.989  1.00 15.83  ? 95  ALA C O   1 
ATOM   5316 C  CB  . ALA C 1 72  ? 23.983 48.143  92.226  1.00 15.57  ? 95  ALA C CB  1 
ATOM   5317 N  N   . ASN C 1 73  ? 21.211 47.754  90.771  1.00 13.18  ? 96  ASN C N   1 
ATOM   5318 C  CA  . ASN C 1 73  ? 20.185 48.188  89.816  1.00 14.74  ? 96  ASN C CA  1 
ATOM   5319 C  C   . ASN C 1 73  ? 18.788 48.289  90.410  1.00 15.86  ? 96  ASN C C   1 
ATOM   5320 O  O   . ASN C 1 73  ? 18.009 49.165  90.041  1.00 17.03  ? 96  ASN C O   1 
ATOM   5321 C  CB  . ASN C 1 73  ? 20.173 47.298  88.588  1.00 14.61  ? 96  ASN C CB  1 
ATOM   5322 C  CG  . ASN C 1 73  ? 21.176 47.745  87.562  1.00 16.47  ? 96  ASN C CG  1 
ATOM   5323 O  OD1 . ASN C 1 73  ? 21.171 48.907  87.152  1.00 16.74  ? 96  ASN C OD1 1 
ATOM   5324 N  ND2 . ASN C 1 73  ? 22.055 46.842  87.155  1.00 16.10  ? 96  ASN C ND2 1 
ATOM   5325 N  N   . GLN C 1 74  ? 18.461 47.385  91.322  1.00 19.00  ? 97  GLN C N   1 
ATOM   5326 C  CA  . GLN C 1 74  ? 17.172 47.478  92.003  1.00 13.45  ? 97  GLN C CA  1 
ATOM   5327 C  C   . GLN C 1 74  ? 17.092 48.777  92.783  1.00 15.25  ? 97  GLN C C   1 
ATOM   5328 O  O   . GLN C 1 74  ? 16.066 49.470  92.767  1.00 21.65  ? 97  GLN C O   1 
ATOM   5329 C  CB  . GLN C 1 74  ? 16.953 46.274  92.925  1.00 17.12  ? 97  GLN C CB  1 
ATOM   5330 C  CG  . GLN C 1 74  ? 15.532 46.208  93.496  1.00 16.33  ? 97  GLN C CG  1 
ATOM   5331 C  CD  . GLN C 1 74  ? 15.290 44.942  94.311  1.00 23.52  ? 97  GLN C CD  1 
ATOM   5332 O  OE1 . GLN C 1 74  ? 16.231 44.301  94.773  1.00 32.02  ? 97  GLN C OE1 1 
ATOM   5333 N  NE2 . GLN C 1 74  ? 14.026 44.558  94.450  1.00 19.98  ? 97  GLN C NE2 1 
ATOM   5334 N  N   . GLU C 1 75  ? 18.180 49.102  93.473  1.00 15.02  ? 98  GLU C N   1 
ATOM   5335 C  CA  . GLU C 1 75  ? 18.247 50.324  94.258  1.00 15.26  ? 98  GLU C CA  1 
ATOM   5336 C  C   . GLU C 1 75  ? 18.203 51.556  93.371  1.00 23.00  ? 98  GLU C C   1 
ATOM   5337 O  O   . GLU C 1 75  ? 17.524 52.537  93.683  1.00 18.64  ? 98  GLU C O   1 
ATOM   5338 C  CB  . GLU C 1 75  ? 19.498 50.329  95.140  1.00 18.97  ? 98  GLU C CB  1 
ATOM   5339 C  CG  . GLU C 1 75  ? 19.476 49.211  96.186  1.00 20.74  ? 98  GLU C CG  1 
ATOM   5340 C  CD  . GLU C 1 75  ? 20.668 49.214  97.128  1.00 34.20  ? 98  GLU C CD  1 
ATOM   5341 O  OE1 . GLU C 1 75  ? 21.758 49.672  96.731  1.00 26.16  ? 98  GLU C OE1 1 
ATOM   5342 O  OE2 . GLU C 1 75  ? 20.517 48.739  98.274  1.00 34.21  ? 98  GLU C OE2 1 
ATOM   5343 N  N   . LEU C 1 76  ? 18.938 51.507  92.266  1.00 19.71  ? 99  LEU C N   1 
ATOM   5344 C  CA  . LEU C 1 76  ? 18.950 52.617  91.319  1.00 16.32  ? 99  LEU C CA  1 
ATOM   5345 C  C   . LEU C 1 76  ? 17.558 52.865  90.734  1.00 13.48  ? 99  LEU C C   1 
ATOM   5346 O  O   . LEU C 1 76  ? 17.104 54.004  90.635  1.00 20.08  ? 99  LEU C O   1 
ATOM   5347 C  CB  . LEU C 1 76  ? 19.950 52.329  90.198  1.00 14.49  ? 99  LEU C CB  1 
ATOM   5348 C  CG  . LEU C 1 76  ? 20.062 53.395  89.101  1.00 17.67  ? 99  LEU C CG  1 
ATOM   5349 C  CD1 . LEU C 1 76  ? 20.332 54.753  89.712  1.00 11.51  ? 99  LEU C CD1 1 
ATOM   5350 C  CD2 . LEU C 1 76  ? 21.162 53.023  88.138  1.00 12.54  ? 99  LEU C CD2 1 
ATOM   5351 N  N   . ALA C 1 77  ? 16.877 51.787  90.360  1.00 14.86  ? 100 ALA C N   1 
ATOM   5352 C  CA  . ALA C 1 77  ? 15.549 51.886  89.757  1.00 14.02  ? 100 ALA C CA  1 
ATOM   5353 C  C   . ALA C 1 77  ? 14.586 52.621  90.677  1.00 22.82  ? 100 ALA C C   1 
ATOM   5354 O  O   . ALA C 1 77  ? 13.739 53.394  90.221  1.00 19.59  ? 100 ALA C O   1 
ATOM   5355 C  CB  . ALA C 1 77  ? 15.016 50.490  89.432  1.00 19.52  ? 100 ALA C CB  1 
ATOM   5356 N  N   . GLU C 1 78  ? 14.717 52.373  91.975  1.00 20.06  ? 101 GLU C N   1 
ATOM   5357 C  CA  . GLU C 1 78  ? 13.872 53.035  92.957  1.00 25.04  ? 101 GLU C CA  1 
ATOM   5358 C  C   . GLU C 1 78  ? 14.124 54.539  92.950  1.00 27.57  ? 101 GLU C C   1 
ATOM   5359 O  O   . GLU C 1 78  ? 13.186 55.333  93.008  1.00 20.57  ? 101 GLU C O   1 
ATOM   5360 C  CB  . GLU C 1 78  ? 14.119 52.455  94.350  1.00 24.93  ? 101 GLU C CB  1 
ATOM   5361 C  CG  . GLU C 1 78  ? 13.106 52.895  95.386  1.00 50.13  ? 101 GLU C CG  1 
ATOM   5362 C  CD  . GLU C 1 78  ? 11.768 52.195  95.229  1.00 61.53  ? 101 GLU C CD  1 
ATOM   5363 O  OE1 . GLU C 1 78  ? 11.733 51.099  94.623  1.00 55.56  ? 101 GLU C OE1 1 
ATOM   5364 O  OE2 . GLU C 1 78  ? 10.752 52.746  95.711  1.00 69.53  ? 101 GLU C OE2 1 
ATOM   5365 N  N   . VAL C 1 79  ? 15.394 54.930  92.888  1.00 20.97  ? 102 VAL C N   1 
ATOM   5366 C  CA  . VAL C 1 79  ? 15.729 56.347  92.871  1.00 19.67  ? 102 VAL C CA  1 
ATOM   5367 C  C   . VAL C 1 79  ? 15.228 57.007  91.588  1.00 23.58  ? 102 VAL C C   1 
ATOM   5368 O  O   . VAL C 1 79  ? 14.649 58.099  91.625  1.00 26.08  ? 102 VAL C O   1 
ATOM   5369 C  CB  . VAL C 1 79  ? 17.240 56.578  93.058  1.00 21.72  ? 102 VAL C CB  1 
ATOM   5370 C  CG1 . VAL C 1 79  ? 17.556 58.078  93.079  1.00 21.97  ? 102 VAL C CG1 1 
ATOM   5371 C  CG2 . VAL C 1 79  ? 17.698 55.942  94.356  1.00 21.70  ? 102 VAL C CG2 1 
ATOM   5372 N  N   . VAL C 1 80  ? 15.446 56.340  90.459  1.00 17.75  ? 103 VAL C N   1 
ATOM   5373 C  CA  . VAL C 1 80  ? 15.004 56.852  89.164  1.00 19.47  ? 103 VAL C CA  1 
ATOM   5374 C  C   . VAL C 1 80  ? 13.479 56.955  89.116  1.00 21.17  ? 103 VAL C C   1 
ATOM   5375 O  O   . VAL C 1 80  ? 12.926 57.968  88.684  1.00 18.08  ? 103 VAL C O   1 
ATOM   5376 C  CB  . VAL C 1 80  ? 15.517 55.965  88.007  1.00 20.80  ? 103 VAL C CB  1 
ATOM   5377 C  CG1 . VAL C 1 80  ? 14.865 56.374  86.684  1.00 16.26  ? 103 VAL C CG1 1 
ATOM   5378 C  CG2 . VAL C 1 80  ? 17.043 56.053  87.912  1.00 16.67  ? 103 VAL C CG2 1 
ATOM   5379 N  N   . SER C 1 81  ? 12.806 55.899  89.568  1.00 18.39  ? 104 SER C N   1 
ATOM   5380 C  CA  . SER C 1 81  ? 11.351 55.896  89.640  1.00 19.03  ? 104 SER C CA  1 
ATOM   5381 C  C   . SER C 1 81  ? 10.859 57.076  90.459  1.00 24.49  ? 104 SER C C   1 
ATOM   5382 O  O   . SER C 1 81  ? 9.931  57.771  90.062  1.00 24.77  ? 104 SER C O   1 
ATOM   5383 C  CB  . SER C 1 81  ? 10.837 54.592  90.258  1.00 23.96  ? 104 SER C CB  1 
ATOM   5384 O  OG  . SER C 1 81  ? 9.426  54.539  90.194  1.00 34.96  ? 104 SER C OG  1 
ATOM   5385 N  N   . ARG C 1 82  ? 11.489 57.311  91.601  1.00 25.80  ? 105 ARG C N   1 
ATOM   5386 C  CA  . ARG C 1 82  ? 11.068 58.411  92.458  1.00 25.36  ? 105 ARG C CA  1 
ATOM   5387 C  C   . ARG C 1 82  ? 11.273 59.773  91.785  1.00 30.93  ? 105 ARG C C   1 
ATOM   5388 O  O   . ARG C 1 82  ? 10.377 60.618  91.807  1.00 25.52  ? 105 ARG C O   1 
ATOM   5389 C  CB  . ARG C 1 82  ? 11.797 58.353  93.802  1.00 30.81  ? 105 ARG C CB  1 
ATOM   5390 C  CG  . ARG C 1 82  ? 11.303 59.377  94.805  1.00 39.53  ? 105 ARG C CG  1 
ATOM   5391 C  CD  . ARG C 1 82  ? 9.830  59.154  95.097  1.00 62.13  ? 105 ARG C CD  1 
ATOM   5392 N  NE  . ARG C 1 82  ? 9.211  60.288  95.777  1.00 74.44  ? 105 ARG C NE  1 
ATOM   5393 C  CZ  . ARG C 1 82  ? 8.010  60.243  96.343  1.00 84.29  ? 105 ARG C CZ  1 
ATOM   5394 N  NH1 . ARG C 1 82  ? 7.310  59.116  96.313  1.00 86.52  ? 105 ARG C NH1 1 
ATOM   5395 N  NH2 . ARG C 1 82  ? 7.511  61.317  96.944  1.00 85.43  ? 105 ARG C NH2 1 
ATOM   5396 N  N   . ALA C 1 83  ? 12.432 59.966  91.159  1.00 21.23  ? 106 ALA C N   1 
ATOM   5397 C  CA  . ALA C 1 83  ? 12.754 61.225  90.488  1.00 25.36  ? 106 ALA C CA  1 
ATOM   5398 C  C   . ALA C 1 83  ? 11.795 61.540  89.339  1.00 26.17  ? 106 ALA C C   1 
ATOM   5399 O  O   . ALA C 1 83  ? 11.313 62.670  89.206  1.00 25.06  ? 106 ALA C O   1 
ATOM   5400 C  CB  . ALA C 1 83  ? 14.194 61.196  89.971  1.00 20.94  ? 106 ALA C CB  1 
ATOM   5401 N  N   . VAL C 1 84  ? 11.542 60.541  88.500  1.00 19.93  ? 107 VAL C N   1 
ATOM   5402 C  CA  . VAL C 1 84  ? 10.656 60.709  87.355  1.00 23.19  ? 107 VAL C CA  1 
ATOM   5403 C  C   . VAL C 1 84  ? 9.228  60.990  87.828  1.00 28.33  ? 107 VAL C C   1 
ATOM   5404 O  O   . VAL C 1 84  ? 8.519  61.801  87.236  1.00 24.61  ? 107 VAL C O   1 
ATOM   5405 C  CB  . VAL C 1 84  ? 10.709 59.479  86.421  1.00 21.63  ? 107 VAL C CB  1 
ATOM   5406 C  CG1 . VAL C 1 84  ? 9.578  59.512  85.399  1.00 31.94  ? 107 VAL C CG1 1 
ATOM   5407 C  CG2 . VAL C 1 84  ? 12.051 59.426  85.713  1.00 25.11  ? 107 VAL C CG2 1 
ATOM   5408 N  N   . SER C 1 85  ? 8.810  60.317  88.893  1.00 24.89  ? 108 SER C N   1 
ATOM   5409 C  CA  . SER C 1 85  ? 7.466  60.526  89.431  1.00 32.52  ? 108 SER C CA  1 
ATOM   5410 C  C   . SER C 1 85  ? 7.305  61.913  90.040  1.00 31.63  ? 108 SER C C   1 
ATOM   5411 O  O   . SER C 1 85  ? 6.202  62.462  90.052  1.00 34.11  ? 108 SER C O   1 
ATOM   5412 C  CB  . SER C 1 85  ? 7.089  59.426  90.432  1.00 29.85  ? 108 SER C CB  1 
ATOM   5413 O  OG  . SER C 1 85  ? 7.850  59.531  91.614  1.00 48.72  ? 108 SER C OG  1 
ATOM   5414 N  N   . ASP C 1 86  ? 8.405  62.472  90.542  1.00 29.47  ? 109 ASP C N   1 
ATOM   5415 C  CA  . ASP C 1 86  ? 8.400  63.838  91.069  1.00 25.64  ? 109 ASP C CA  1 
ATOM   5416 C  C   . ASP C 1 86  ? 8.542  64.872  89.950  1.00 28.56  ? 109 ASP C C   1 
ATOM   5417 O  O   . ASP C 1 86  ? 8.635  66.073  90.212  1.00 37.18  ? 109 ASP C O   1 
ATOM   5418 C  CB  . ASP C 1 86  ? 9.514  64.039  92.102  1.00 31.88  ? 109 ASP C CB  1 
ATOM   5419 C  CG  . ASP C 1 86  ? 9.282  63.253  93.381  1.00 42.96  ? 109 ASP C CG  1 
ATOM   5420 O  OD1 . ASP C 1 86  ? 8.111  62.932  93.681  1.00 46.03  ? 109 ASP C OD1 1 
ATOM   5421 O  OD2 . ASP C 1 86  ? 10.274 62.970  94.089  1.00 43.79  ? 109 ASP C OD2 1 
ATOM   5422 N  N   . GLY C 1 87  ? 8.569  64.408  88.703  1.00 24.80  ? 110 GLY C N   1 
ATOM   5423 C  CA  . GLY C 1 87  ? 8.545  65.312  87.564  1.00 25.89  ? 110 GLY C CA  1 
ATOM   5424 C  C   . GLY C 1 87  ? 9.891  65.722  86.991  1.00 27.35  ? 110 GLY C C   1 
ATOM   5425 O  O   . GLY C 1 87  ? 9.971  66.670  86.207  1.00 27.00  ? 110 GLY C O   1 
ATOM   5426 N  N   . TYR C 1 88  ? 10.955 65.022  87.378  1.00 23.26  ? 111 TYR C N   1 
ATOM   5427 C  CA  . TYR C 1 88  ? 12.289 65.322  86.858  1.00 26.27  ? 111 TYR C CA  1 
ATOM   5428 C  C   . TYR C 1 88  ? 12.640 64.539  85.597  1.00 22.14  ? 111 TYR C C   1 
ATOM   5429 O  O   . TYR C 1 88  ? 12.303 63.364  85.475  1.00 20.84  ? 111 TYR C O   1 
ATOM   5430 C  CB  . TYR C 1 88  ? 13.348 65.020  87.915  1.00 23.18  ? 111 TYR C CB  1 
ATOM   5431 C  CG  . TYR C 1 88  ? 13.306 65.928  89.114  1.00 26.35  ? 111 TYR C CG  1 
ATOM   5432 C  CD1 . TYR C 1 88  ? 13.982 67.139  89.112  1.00 30.13  ? 111 TYR C CD1 1 
ATOM   5433 C  CD2 . TYR C 1 88  ? 12.596 65.573  90.253  1.00 30.74  ? 111 TYR C CD2 1 
ATOM   5434 C  CE1 . TYR C 1 88  ? 13.949 67.981  90.216  1.00 31.35  ? 111 TYR C CE1 1 
ATOM   5435 C  CE2 . TYR C 1 88  ? 12.554 66.404  91.358  1.00 34.29  ? 111 TYR C CE2 1 
ATOM   5436 C  CZ  . TYR C 1 88  ? 13.230 67.606  91.334  1.00 38.77  ? 111 TYR C CZ  1 
ATOM   5437 O  OH  . TYR C 1 88  ? 13.193 68.432  92.435  1.00 38.27  ? 111 TYR C OH  1 
ATOM   5438 N  N   . SER C 1 89  ? 13.310 65.205  84.660  1.00 22.98  ? 112 SER C N   1 
ATOM   5439 C  CA  . SER C 1 89  ? 14.057 64.506  83.627  1.00 20.30  ? 112 SER C CA  1 
ATOM   5440 C  C   . SER C 1 89  ? 15.268 63.949  84.353  1.00 21.52  ? 112 SER C C   1 
ATOM   5441 O  O   . SER C 1 89  ? 15.956 64.671  85.074  1.00 19.88  ? 112 SER C O   1 
ATOM   5442 C  CB  . SER C 1 89  ? 14.487 65.464  82.523  1.00 19.52  ? 112 SER C CB  1 
ATOM   5443 O  OG  . SER C 1 89  ? 13.363 65.913  81.796  1.00 27.84  ? 112 SER C OG  1 
ATOM   5444 N  N   . CYS C 1 90  ? 15.539 62.668  84.168  1.00 14.82  ? 113 CYS C N   1 
ATOM   5445 C  CA  A CYS C 1 90  ? 16.504 61.983  85.018  0.35 15.96  ? 113 CYS C CA  1 
ATOM   5446 C  CA  B CYS C 1 90  ? 16.504 61.983  85.018  0.45 15.93  ? 113 CYS C CA  1 
ATOM   5447 C  CA  C CYS C 1 90  ? 16.604 61.983  85.018  0.20 15.96  ? 113 CYS C CA  1 
ATOM   5448 C  C   . CYS C 1 90  ? 17.836 61.702  84.324  1.00 20.43  ? 113 CYS C C   1 
ATOM   5449 O  O   . CYS C 1 90  ? 17.906 60.883  83.411  1.00 22.63  ? 113 CYS C O   1 
ATOM   5450 C  CB  A CYS C 1 90  ? 15.891 60.681  85.531  0.35 23.70  ? 113 CYS C CB  1 
ATOM   5451 C  CB  B CYS C 1 90  ? 15.888 60.681  85.527  0.45 23.73  ? 113 CYS C CB  1 
ATOM   5452 C  CB  C CYS C 1 90  ? 15.991 60.681  85.531  0.20 23.70  ? 113 CYS C CB  1 
ATOM   5453 S  SG  A CYS C 1 90  ? 16.769 59.954  86.910  0.35 30.80  ? 113 CYS C SG  1 
ATOM   5454 S  SG  B CYS C 1 90  ? 16.761 59.956  86.905  0.45 30.91  ? 113 CYS C SG  1 
ATOM   5455 S  SG  C CYS C 1 90  ? 14.609 60.913  86.644  0.20 30.80  ? 113 CYS C SG  1 
ATOM   5456 N  N   . VAL C 1 91  ? 18.895 62.380  84.767  1.00 16.19  ? 114 VAL C N   1 
ATOM   5457 C  CA  . VAL C 1 91  ? 20.245 62.152  84.234  1.00 13.71  ? 114 VAL C CA  1 
ATOM   5458 C  C   . VAL C 1 91  ? 21.031 61.236  85.174  1.00 16.01  ? 114 VAL C C   1 
ATOM   5459 O  O   . VAL C 1 91  ? 21.247 61.565  86.349  1.00 16.84  ? 114 VAL C O   1 
ATOM   5460 C  CB  . VAL C 1 91  ? 21.044 63.463  84.092  1.00 15.61  ? 114 VAL C CB  1 
ATOM   5461 C  CG1 . VAL C 1 91  ? 22.505 63.164  83.725  1.00 13.65  ? 114 VAL C CG1 1 
ATOM   5462 C  CG2 . VAL C 1 91  ? 20.405 64.374  83.062  1.00 20.02  ? 114 VAL C CG2 1 
ATOM   5463 N  N   . THR C 1 92  ? 21.440 60.083  84.666  1.00 16.74  ? 115 THR C N   1 
ATOM   5464 C  CA  . THR C 1 92  ? 22.258 59.177  85.458  1.00 15.89  ? 115 THR C CA  1 
ATOM   5465 C  C   . THR C 1 92  ? 23.668 59.102  84.904  1.00 12.18  ? 115 THR C C   1 
ATOM   5466 O  O   . THR C 1 92  ? 23.876 58.813  83.724  1.00 16.14  ? 115 THR C O   1 
ATOM   5467 C  CB  . THR C 1 92  ? 21.644 57.769  85.542  1.00 18.63  ? 115 THR C CB  1 
ATOM   5468 O  OG1 . THR C 1 92  ? 20.306 57.871  86.052  1.00 20.38  ? 115 THR C OG1 1 
ATOM   5469 C  CG2 . THR C 1 92  ? 22.483 56.868  86.473  1.00 15.23  ? 115 THR C CG2 1 
ATOM   5470 N  N   . LEU C 1 93  ? 24.634 59.376  85.771  1.00 13.98  ? 116 LEU C N   1 
ATOM   5471 C  CA  . LEU C 1 93  ? 26.045 59.331  85.414  1.00 14.02  ? 116 LEU C CA  1 
ATOM   5472 C  C   . LEU C 1 93  ? 26.657 58.009  85.855  1.00 12.87  ? 116 LEU C C   1 
ATOM   5473 O  O   . LEU C 1 93  ? 26.580 57.642  87.030  1.00 12.84  ? 116 LEU C O   1 
ATOM   5474 C  CB  . LEU C 1 93  ? 26.791 60.489  86.077  1.00 9.97   ? 116 LEU C CB  1 
ATOM   5475 C  CG  . LEU C 1 93  ? 26.208 61.883  85.919  1.00 14.79  ? 116 LEU C CG  1 
ATOM   5476 C  CD1 . LEU C 1 93  ? 27.048 62.876  86.701  1.00 13.43  ? 116 LEU C CD1 1 
ATOM   5477 C  CD2 . LEU C 1 93  ? 26.188 62.262  84.432  1.00 9.68   ? 116 LEU C CD2 1 
ATOM   5478 N  N   . GLY C 1 94  ? 27.262 57.292  84.908  1.00 12.67  ? 117 GLY C N   1 
ATOM   5479 C  CA  . GLY C 1 94  ? 27.937 56.040  85.205  1.00 14.55  ? 117 GLY C CA  1 
ATOM   5480 C  C   . GLY C 1 94  ? 29.428 56.254  85.360  1.00 12.62  ? 117 GLY C C   1 
ATOM   5481 O  O   . GLY C 1 94  ? 29.909 57.364  85.133  1.00 10.73  ? 117 GLY C O   1 
ATOM   5482 N  N   . GLY C 1 95  ? 30.160 55.204  85.728  1.00 13.59  ? 118 GLY C N   1 
ATOM   5483 C  CA  . GLY C 1 95  ? 29.586 53.883  85.933  1.00 12.91  ? 118 GLY C CA  1 
ATOM   5484 C  C   . GLY C 1 95  ? 29.436 53.088  84.650  1.00 13.75  ? 118 GLY C C   1 
ATOM   5485 O  O   . GLY C 1 95  ? 29.253 53.663  83.579  1.00 12.92  ? 118 GLY C O   1 
ATOM   5486 N  N   . ASP C 1 96  ? 29.478 51.764  84.747  1.00 11.18  ? 119 ASP C N   1 
ATOM   5487 C  CA  . ASP C 1 96  ? 29.350 50.931  83.561  1.00 10.98  ? 119 ASP C CA  1 
ATOM   5488 C  C   . ASP C 1 96  ? 27.895 50.783  83.099  1.00 9.38   ? 119 ASP C C   1 
ATOM   5489 O  O   . ASP C 1 96  ? 26.945 51.086  83.835  1.00 10.74  ? 119 ASP C O   1 
ATOM   5490 C  CB  . ASP C 1 96  ? 30.020 49.554  83.759  1.00 11.81  ? 119 ASP C CB  1 
ATOM   5491 C  CG  . ASP C 1 96  ? 29.244 48.648  84.699  1.00 16.03  ? 119 ASP C CG  1 
ATOM   5492 O  OD1 . ASP C 1 96  ? 28.186 48.144  84.279  1.00 14.92  ? 119 ASP C OD1 1 
ATOM   5493 O  OD2 . ASP C 1 96  ? 29.689 48.430  85.853  1.00 14.67  ? 119 ASP C OD2 1 
ATOM   5494 N  N   . HIS C 1 97  ? 27.726 50.289  81.885  1.00 10.00  ? 120 HIS C N   1 
ATOM   5495 C  CA  . HIS C 1 97  ? 26.421 50.294  81.239  1.00 10.83  ? 120 HIS C CA  1 
ATOM   5496 C  C   . HIS C 1 97  ? 25.404 49.315  81.832  1.00 13.79  ? 120 HIS C C   1 
ATOM   5497 O  O   . HIS C 1 97  ? 24.232 49.359  81.472  1.00 12.70  ? 120 HIS C O   1 
ATOM   5498 C  CB  . HIS C 1 97  ? 26.573 50.032  79.738  1.00 9.72   ? 120 HIS C CB  1 
ATOM   5499 C  CG  . HIS C 1 97  ? 25.641 50.840  78.889  1.00 11.17  ? 120 HIS C CG  1 
ATOM   5500 N  ND1 . HIS C 1 97  ? 25.888 51.108  77.560  1.00 7.85   ? 120 HIS C ND1 1 
ATOM   5501 C  CD2 . HIS C 1 97  ? 24.484 51.463  79.199  1.00 7.33   ? 120 HIS C CD2 1 
ATOM   5502 C  CE1 . HIS C 1 97  ? 24.917 51.865  77.087  1.00 11.56  ? 120 HIS C CE1 1 
ATOM   5503 N  NE2 . HIS C 1 97  ? 24.051 52.098  78.052  1.00 9.51   ? 120 HIS C NE2 1 
ATOM   5504 N  N   . SER C 1 98  ? 25.825 48.449  82.752  1.00 12.13  ? 121 SER C N   1 
ATOM   5505 C  CA  . SER C 1 98  ? 24.855 47.556  83.389  1.00 11.37  ? 121 SER C CA  1 
ATOM   5506 C  C   . SER C 1 98  ? 23.820 48.360  84.175  1.00 13.71  ? 121 SER C C   1 
ATOM   5507 O  O   . SER C 1 98  ? 22.733 47.867  84.492  1.00 15.24  ? 121 SER C O   1 
ATOM   5508 C  CB  . SER C 1 98  ? 25.541 46.540  84.309  1.00 10.75  ? 121 SER C CB  1 
ATOM   5509 O  OG  . SER C 1 98  ? 26.014 47.174  85.486  1.00 15.81  ? 121 SER C OG  1 
ATOM   5510 N  N   A LEU C 1 99  ? 24.147 49.605  84.490  0.95 13.20  ? 122 LEU C N   1 
ATOM   5511 C  CA  A LEU C 1 99  ? 23.214 50.435  85.236  0.95 13.42  ? 122 LEU C CA  1 
ATOM   5512 C  C   A LEU C 1 99  ? 21.954 50.776  84.434  0.95 12.87  ? 122 LEU C C   1 
ATOM   5513 O  O   A LEU C 1 99  ? 20.963 51.228  85.006  0.95 12.08  ? 122 LEU C O   1 
ATOM   5514 C  CB  A LEU C 1 99  ? 23.890 51.708  85.748  0.95 13.96  ? 122 LEU C CB  1 
ATOM   5515 C  CG  A LEU C 1 99  ? 24.349 52.767  84.748  0.95 24.24  ? 122 LEU C CG  1 
ATOM   5516 C  CD1 A LEU C 1 99  ? 23.217 53.717  84.295  0.95 17.84  ? 122 LEU C CD1 1 
ATOM   5517 C  CD2 A LEU C 1 99  ? 25.484 53.548  85.381  0.95 17.09  ? 122 LEU C CD2 1 
ATOM   5518 N  N   . ALA C 1 100 ? 21.996 50.594  83.115  1.00 14.23  ? 123 ALA C N   1 
ATOM   5519 C  CA  . ALA C 1 100 ? 20.809 50.856  82.303  1.00 14.13  ? 123 ALA C CA  1 
ATOM   5520 C  C   . ALA C 1 100 ? 19.678 49.900  82.661  1.00 19.08  ? 123 ALA C C   1 
ATOM   5521 O  O   . ALA C 1 100 ? 18.516 50.216  82.442  1.00 14.17  ? 123 ALA C O   1 
ATOM   5522 C  CB  . ALA C 1 100 ? 21.122 50.789  80.808  1.00 14.46  ? 123 ALA C CB  1 
ATOM   5523 N  N   . ILE C 1 101 ? 20.008 48.735  83.214  1.00 13.98  ? 124 ILE C N   1 
ATOM   5524 C  CA  . ILE C 1 101 ? 18.949 47.845  83.693  1.00 14.67  ? 124 ILE C CA  1 
ATOM   5525 C  C   . ILE C 1 101 ? 18.097 48.590  84.708  1.00 15.12  ? 124 ILE C C   1 
ATOM   5526 O  O   . ILE C 1 101 ? 16.868 48.611  84.609  1.00 16.65  ? 124 ILE C O   1 
ATOM   5527 C  CB  . ILE C 1 101 ? 19.515 46.590  84.350  1.00 12.89  ? 124 ILE C CB  1 
ATOM   5528 C  CG1 . ILE C 1 101 ? 20.317 45.780  83.327  1.00 12.18  ? 124 ILE C CG1 1 
ATOM   5529 C  CG2 . ILE C 1 101 ? 18.384 45.766  84.941  1.00 17.78  ? 124 ILE C CG2 1 
ATOM   5530 C  CD1 . ILE C 1 101 ? 21.120 44.636  83.921  1.00 14.67  ? 124 ILE C CD1 1 
ATOM   5531 N  N   . GLY C 1 102 ? 18.758 49.241  85.657  1.00 12.12  ? 125 GLY C N   1 
ATOM   5532 C  CA  . GLY C 1 102 ? 18.055 50.001  86.674  1.00 15.11  ? 125 GLY C CA  1 
ATOM   5533 C  C   . GLY C 1 102 ? 17.409 51.288  86.191  1.00 16.49  ? 125 GLY C C   1 
ATOM   5534 O  O   . GLY C 1 102 ? 16.269 51.581  86.569  1.00 14.78  ? 125 GLY C O   1 
ATOM   5535 N  N   . THR C 1 103 ? 18.108 52.080  85.373  1.00 12.54  ? 126 THR C N   1 
ATOM   5536 C  CA  . THR C 1 103 ? 17.503 53.349  84.937  1.00 11.85  ? 126 THR C CA  1 
ATOM   5537 C  C   . THR C 1 103 ? 16.287 53.132  84.038  1.00 13.45  ? 126 THR C C   1 
ATOM   5538 O  O   . THR C 1 103 ? 15.275 53.822  84.172  1.00 15.28  ? 126 THR C O   1 
ATOM   5539 C  CB  . THR C 1 103 ? 18.512 54.318  84.258  1.00 12.94  ? 126 THR C CB  1 
ATOM   5540 O  OG1 . THR C 1 103 ? 18.991 53.752  83.029  1.00 14.81  ? 126 THR C OG1 1 
ATOM   5541 C  CG2 . THR C 1 103 ? 19.679 54.595  85.195  1.00 13.36  ? 126 THR C CG2 1 
ATOM   5542 N  N   . ILE C 1 104 ? 16.378 52.179  83.123  1.00 13.60  ? 127 ILE C N   1 
ATOM   5543 C  CA  . ILE C 1 104 ? 15.264 51.945  82.217  1.00 14.15  ? 127 ILE C CA  1 
ATOM   5544 C  C   . ILE C 1 104 ? 14.087 51.305  82.973  1.00 17.86  ? 127 ILE C C   1 
ATOM   5545 O  O   . ILE C 1 104 ? 12.942 51.686  82.758  1.00 17.45  ? 127 ILE C O   1 
ATOM   5546 C  CB  . ILE C 1 104 ? 15.703 51.152  80.964  1.00 14.39  ? 127 ILE C CB  1 
ATOM   5547 C  CG1 . ILE C 1 104 ? 16.700 51.985  80.143  1.00 14.26  ? 127 ILE C CG1 1 
ATOM   5548 C  CG2 . ILE C 1 104 ? 14.503 50.773  80.088  1.00 17.60  ? 127 ILE C CG2 1 
ATOM   5549 C  CD1 . ILE C 1 104 ? 17.319 51.234  78.960  1.00 13.77  ? 127 ILE C CD1 1 
ATOM   5550 N  N   . SER C 1 105 ? 14.372 50.376  83.887  1.00 16.46  ? 128 SER C N   1 
ATOM   5551 C  CA  . SER C 1 105 ? 13.325 49.784  84.734  1.00 22.79  ? 128 SER C CA  1 
ATOM   5552 C  C   . SER C 1 105 ? 12.606 50.828  85.585  1.00 20.57  ? 128 SER C C   1 
ATOM   5553 O  O   . SER C 1 105 ? 11.375 50.862  85.651  1.00 21.38  ? 128 SER C O   1 
ATOM   5554 C  CB  . SER C 1 105 ? 13.908 48.697  85.642  1.00 16.79  ? 128 SER C CB  1 
ATOM   5555 O  OG  . SER C 1 105 ? 14.325 47.590  84.877  1.00 19.05  ? 128 SER C OG  1 
ATOM   5556 N  N   . GLY C 1 106 ? 13.383 51.672  86.249  1.00 16.33  ? 129 GLY C N   1 
ATOM   5557 C  CA  . GLY C 1 106 ? 12.819 52.711  87.089  1.00 20.22  ? 129 GLY C CA  1 
ATOM   5558 C  C   . GLY C 1 106 ? 12.012 53.698  86.273  1.00 23.12  ? 129 GLY C C   1 
ATOM   5559 O  O   . GLY C 1 106 ? 10.940 54.132  86.702  1.00 19.03  ? 129 GLY C O   1 
ATOM   5560 N  N   . HIS C 1 107 ? 12.542 54.063  85.104  1.00 16.43  ? 130 HIS C N   1 
ATOM   5561 C  CA  . HIS C 1 107 ? 11.874 54.976  84.176  1.00 17.08  ? 130 HIS C CA  1 
ATOM   5562 C  C   . HIS C 1 107 ? 10.555 54.377  83.670  1.00 20.37  ? 130 HIS C C   1 
ATOM   5563 O  O   . HIS C 1 107 ? 9.527  55.063  83.607  1.00 20.70  ? 130 HIS C O   1 
ATOM   5564 C  CB  . HIS C 1 107 ? 12.803 55.244  82.980  1.00 15.93  ? 130 HIS C CB  1 
ATOM   5565 C  CG  . HIS C 1 107 ? 12.387 56.395  82.111  1.00 21.79  ? 130 HIS C CG  1 
ATOM   5566 N  ND1 . HIS C 1 107 ? 13.068 56.739  80.958  1.00 18.58  ? 130 HIS C ND1 1 
ATOM   5567 C  CD2 . HIS C 1 107 ? 11.379 57.293  82.234  1.00 19.14  ? 130 HIS C CD2 1 
ATOM   5568 C  CE1 . HIS C 1 107 ? 12.484 57.783  80.401  1.00 16.02  ? 130 HIS C CE1 1 
ATOM   5569 N  NE2 . HIS C 1 107 ? 11.462 58.144  81.152  1.00 23.52  ? 130 HIS C NE2 1 
ATOM   5570 N  N   . ALA C 1 108 ? 10.587 53.101  83.301  1.00 18.04  ? 131 ALA C N   1 
ATOM   5571 C  CA  . ALA C 1 108 ? 9.419  52.445  82.716  1.00 21.48  ? 131 ALA C CA  1 
ATOM   5572 C  C   . ALA C 1 108 ? 8.278  52.285  83.718  1.00 25.09  ? 131 ALA C C   1 
ATOM   5573 O  O   . ALA C 1 108 ? 7.119  52.149  83.333  1.00 21.05  ? 131 ALA C O   1 
ATOM   5574 C  CB  . ALA C 1 108 ? 9.809  51.091  82.145  1.00 17.21  ? 131 ALA C CB  1 
ATOM   5575 N  N   . ARG C 1 109 ? 8.618  52.306  85.000  1.00 21.90  ? 132 ARG C N   1 
ATOM   5576 C  CA  . ARG C 1 109 ? 7.632  52.144  86.059  1.00 25.67  ? 132 ARG C CA  1 
ATOM   5577 C  C   . ARG C 1 109 ? 6.555  53.222  86.051  1.00 28.97  ? 132 ARG C C   1 
ATOM   5578 O  O   . ARG C 1 109 ? 5.385  52.934  86.281  1.00 36.62  ? 132 ARG C O   1 
ATOM   5579 C  CB  . ARG C 1 109 ? 8.328  52.108  87.413  1.00 26.45  ? 132 ARG C CB  1 
ATOM   5580 C  CG  . ARG C 1 109 ? 8.158  50.808  88.150  1.00 35.36  ? 132 ARG C CG  1 
ATOM   5581 C  CD  . ARG C 1 109 ? 9.073  50.759  89.351  1.00 36.73  ? 132 ARG C CD  1 
ATOM   5582 N  NE  . ARG C 1 109 ? 10.022 49.656  89.239  1.00 30.22  ? 132 ARG C NE  1 
ATOM   5583 C  CZ  . ARG C 1 109 ? 11.073 49.494  90.031  1.00 31.69  ? 132 ARG C CZ  1 
ATOM   5584 N  NH1 . ARG C 1 109 ? 11.319 50.367  90.997  1.00 31.99  ? 132 ARG C NH1 1 
ATOM   5585 N  NH2 . ARG C 1 109 ? 11.878 48.460  89.851  1.00 31.96  ? 132 ARG C NH2 1 
ATOM   5586 N  N   . HIS C 1 110 ? 6.946  54.460  85.779  1.00 28.22  ? 133 HIS C N   1 
ATOM   5587 C  CA  . HIS C 1 110 ? 6.032  55.585  85.697  1.00 33.82  ? 133 HIS C CA  1 
ATOM   5588 C  C   . HIS C 1 110 ? 5.775  56.099  84.310  1.00 33.77  ? 133 HIS C C   1 
ATOM   5589 O  O   . HIS C 1 110 ? 4.738  56.652  83.993  1.00 31.71  ? 133 HIS C O   1 
ATOM   5590 C  CB  . HIS C 1 110 ? 6.501  56.731  86.576  1.00 31.49  ? 133 HIS C CB  1 
ATOM   5591 C  CG  . HIS C 1 110 ? 6.466  56.399  88.047  1.00 56.09  ? 133 HIS C CG  1 
ATOM   5592 N  ND1 . HIS C 1 110 ? 5.311  56.236  88.734  1.00 71.69  ? 133 HIS C ND1 1 
ATOM   5593 C  CD2 . HIS C 1 110 ? 7.483  56.151  88.940  1.00 61.57  ? 133 HIS C CD2 1 
ATOM   5594 C  CE1 . HIS C 1 110 ? 5.594  55.926  90.002  1.00 66.77  ? 133 HIS C CE1 1 
ATOM   5595 N  NE2 . HIS C 1 110 ? 6.928  55.880  90.127  1.00 67.98  ? 133 HIS C NE2 1 
ATOM   5596 N  N   A CYS C 1 111 ? 6.304  55.297  83.433  0.83 21.88  ? 134 CYS C N   1 
ATOM   5597 C  CA  A CYS C 1 111 ? 6.518  55.702  82.049  0.83 22.95  ? 134 CYS C CA  1 
ATOM   5598 C  C   A CYS C 1 111 ? 6.544  54.495  81.118  0.83 24.21  ? 134 CYS C C   1 
ATOM   5599 O  O   A CYS C 1 111 ? 7.510  54.285  80.384  0.83 18.49  ? 134 CYS C O   1 
ATOM   5600 C  CB  A CYS C 1 111 ? 7.820  56.495  81.918  0.83 37.23  ? 134 CYS C CB  1 
ATOM   5601 S  SG  A CYS C 1 111 ? 7.667  58.253  82.311  0.83 33.65  ? 134 CYS C SG  1 
ATOM   5602 N  N   . PRO C 1 112 ? 5.451  53.738  81.109  1.00 30.35  ? 135 PRO C N   1 
ATOM   5603 C  CA  . PRO C 1 112 ? 5.519  52.435  80.433  1.00 21.51  ? 135 PRO C CA  1 
ATOM   5604 C  C   . PRO C 1 112 ? 5.622  52.522  78.913  1.00 19.37  ? 135 PRO C C   1 
ATOM   5605 O  O   . PRO C 1 112 ? 6.076  51.572  78.271  1.00 20.21  ? 135 PRO C O   1 
ATOM   5606 C  CB  . PRO C 1 112 ? 4.207  51.747  80.851  1.00 28.29  ? 135 PRO C CB  1 
ATOM   5607 C  CG  . PRO C 1 112 ? 3.279  52.872  81.205  1.00 27.14  ? 135 PRO C CG  1 
ATOM   5608 C  CD  . PRO C 1 112 ? 4.157  53.956  81.782  1.00 27.28  ? 135 PRO C CD  1 
ATOM   5609 N  N   . ASP C 1 113 ? 5.219  53.649  78.334  1.00 20.12  ? 136 ASP C N   1 
ATOM   5610 C  CA  . ASP C 1 113 ? 5.284  53.784  76.887  1.00 20.52  ? 136 ASP C CA  1 
ATOM   5611 C  C   . ASP C 1 113 ? 6.583  54.456  76.438  1.00 19.32  ? 136 ASP C C   1 
ATOM   5612 O  O   . ASP C 1 113 ? 6.656  54.994  75.342  1.00 18.51  ? 136 ASP C O   1 
ATOM   5613 C  CB  . ASP C 1 113 ? 4.069  54.549  76.346  1.00 21.51  ? 136 ASP C CB  1 
ATOM   5614 C  CG  . ASP C 1 113 ? 3.890  54.371  74.846  1.00 22.08  ? 136 ASP C CG  1 
ATOM   5615 O  OD1 . ASP C 1 113 ? 4.311  53.315  74.325  1.00 24.50  ? 136 ASP C OD1 1 
ATOM   5616 O  OD2 . ASP C 1 113 ? 3.358  55.297  74.187  1.00 30.30  ? 136 ASP C OD2 1 
ATOM   5617 N  N   . LEU C 1 114 ? 7.611  54.417  77.282  1.00 18.88  ? 137 LEU C N   1 
ATOM   5618 C  CA  . LEU C 1 114 ? 8.894  55.028  76.916  1.00 22.55  ? 137 LEU C CA  1 
ATOM   5619 C  C   . LEU C 1 114 ? 9.523  54.335  75.703  1.00 18.69  ? 137 LEU C C   1 
ATOM   5620 O  O   . LEU C 1 114 ? 9.248  53.164  75.443  1.00 18.09  ? 137 LEU C O   1 
ATOM   5621 C  CB  . LEU C 1 114 ? 9.855  55.050  78.121  1.00 18.03  ? 137 LEU C CB  1 
ATOM   5622 C  CG  . LEU C 1 114 ? 10.521 53.762  78.617  1.00 21.65  ? 137 LEU C CG  1 
ATOM   5623 C  CD1 . LEU C 1 114 ? 11.681 53.355  77.744  1.00 30.85  ? 137 LEU C CD1 1 
ATOM   5624 C  CD2 . LEU C 1 114 ? 11.028 53.946  80.023  1.00 22.30  ? 137 LEU C CD2 1 
ATOM   5625 N  N   . CYS C 1 115 ? 10.370 55.053  74.968  1.00 14.77  ? 138 CYS C N   1 
ATOM   5626 C  CA  . CYS C 1 115 ? 11.182 54.423  73.935  1.00 13.19  ? 138 CYS C CA  1 
ATOM   5627 C  C   . CYS C 1 115 ? 12.648 54.695  74.260  1.00 18.53  ? 138 CYS C C   1 
ATOM   5628 O  O   . CYS C 1 115 ? 12.958 55.569  75.076  1.00 15.31  ? 138 CYS C O   1 
ATOM   5629 C  CB  . CYS C 1 115 ? 10.821 54.940  72.536  1.00 14.51  ? 138 CYS C CB  1 
ATOM   5630 S  SG  . CYS C 1 115 ? 11.047 56.713  72.313  1.00 19.96  ? 138 CYS C SG  1 
ATOM   5631 N  N   . VAL C 1 116 ? 13.541 53.934  73.640  1.00 13.35  ? 139 VAL C N   1 
ATOM   5632 C  CA  . VAL C 1 116 ? 14.954 53.998  73.986  1.00 14.29  ? 139 VAL C CA  1 
ATOM   5633 C  C   . VAL C 1 116 ? 15.815 54.260  72.761  1.00 12.29  ? 139 VAL C C   1 
ATOM   5634 O  O   . VAL C 1 116 ? 15.703 53.560  71.748  1.00 11.60  ? 139 VAL C O   1 
ATOM   5635 C  CB  . VAL C 1 116 ? 15.423 52.681  74.664  1.00 10.42  ? 139 VAL C CB  1 
ATOM   5636 C  CG1 . VAL C 1 116 ? 16.920 52.748  74.981  1.00 13.02  ? 139 VAL C CG1 1 
ATOM   5637 C  CG2 . VAL C 1 116 ? 14.623 52.438  75.939  1.00 12.39  ? 139 VAL C CG2 1 
ATOM   5638 N  N   . VAL C 1 117 ? 16.661 55.281  72.859  1.00 12.57  ? 140 VAL C N   1 
ATOM   5639 C  CA  . VAL C 1 117 ? 17.701 55.502  71.870  1.00 9.73   ? 140 VAL C CA  1 
ATOM   5640 C  C   . VAL C 1 117 ? 19.022 55.110  72.527  1.00 10.54  ? 140 VAL C C   1 
ATOM   5641 O  O   . VAL C 1 117 ? 19.437 55.715  73.512  1.00 10.65  ? 140 VAL C O   1 
ATOM   5642 C  CB  . VAL C 1 117 ? 17.736 56.963  71.391  1.00 13.18  ? 140 VAL C CB  1 
ATOM   5643 C  CG1 . VAL C 1 117 ? 18.883 57.184  70.408  1.00 9.73   ? 140 VAL C CG1 1 
ATOM   5644 C  CG2 . VAL C 1 117 ? 16.388 57.329  70.738  1.00 9.36   ? 140 VAL C CG2 1 
ATOM   5645 N  N   . TRP C 1 118 ? 19.649 54.074  71.986  1.00 12.09  ? 141 TRP C N   1 
ATOM   5646 C  CA  . TRP C 1 118 ? 20.836 53.471  72.577  1.00 11.56  ? 141 TRP C CA  1 
ATOM   5647 C  C   . TRP C 1 118 ? 22.024 53.827  71.695  1.00 9.80   ? 141 TRP C C   1 
ATOM   5648 O  O   . TRP C 1 118 ? 22.159 53.307  70.589  1.00 10.11  ? 141 TRP C O   1 
ATOM   5649 C  CB  . TRP C 1 118 ? 20.662 51.948  72.666  1.00 8.92   ? 141 TRP C CB  1 
ATOM   5650 C  CG  . TRP C 1 118 ? 21.635 51.257  73.583  1.00 9.92   ? 141 TRP C CG  1 
ATOM   5651 C  CD1 . TRP C 1 118 ? 22.940 50.960  73.313  1.00 10.69  ? 141 TRP C CD1 1 
ATOM   5652 C  CD2 . TRP C 1 118 ? 21.374 50.767  74.903  1.00 9.26   ? 141 TRP C CD2 1 
ATOM   5653 N  NE1 . TRP C 1 118 ? 23.512 50.326  74.387  1.00 9.66   ? 141 TRP C NE1 1 
ATOM   5654 C  CE2 . TRP C 1 118 ? 22.576 50.189  75.374  1.00 13.20  ? 141 TRP C CE2 1 
ATOM   5655 C  CE3 . TRP C 1 118 ? 20.246 50.750  75.728  1.00 9.68   ? 141 TRP C CE3 1 
ATOM   5656 C  CZ2 . TRP C 1 118 ? 22.674 49.596  76.646  1.00 9.93   ? 141 TRP C CZ2 1 
ATOM   5657 C  CZ3 . TRP C 1 118 ? 20.350 50.170  76.994  1.00 9.10   ? 141 TRP C CZ3 1 
ATOM   5658 C  CH2 . TRP C 1 118 ? 21.554 49.606  77.438  1.00 10.29  ? 141 TRP C CH2 1 
ATOM   5659 N  N   . VAL C 1 119 ? 22.861 54.746  72.172  1.00 7.09   ? 142 VAL C N   1 
ATOM   5660 C  CA  . VAL C 1 119 ? 23.987 55.252  71.384  1.00 6.90   ? 142 VAL C CA  1 
ATOM   5661 C  C   . VAL C 1 119 ? 25.275 54.627  71.890  1.00 9.01   ? 142 VAL C C   1 
ATOM   5662 O  O   . VAL C 1 119 ? 25.667 54.864  73.027  1.00 10.47  ? 142 VAL C O   1 
ATOM   5663 C  CB  . VAL C 1 119 ? 24.078 56.780  71.469  1.00 8.72   ? 142 VAL C CB  1 
ATOM   5664 C  CG1 . VAL C 1 119 ? 25.178 57.304  70.548  1.00 7.73   ? 142 VAL C CG1 1 
ATOM   5665 C  CG2 . VAL C 1 119 ? 22.733 57.403  71.083  1.00 7.50   ? 142 VAL C CG2 1 
ATOM   5666 N  N   . ASP C 1 120 ? 25.924 53.821  71.057  1.00 7.28   ? 143 ASP C N   1 
ATOM   5667 C  CA  . ASP C 1 120 ? 26.922 52.879  71.568  1.00 8.42   ? 143 ASP C CA  1 
ATOM   5668 C  C   . ASP C 1 120 ? 27.664 52.274  70.404  1.00 12.06  ? 143 ASP C C   1 
ATOM   5669 O  O   . ASP C 1 120 ? 27.085 52.090  69.333  1.00 9.29   ? 143 ASP C O   1 
ATOM   5670 C  CB  . ASP C 1 120 ? 26.187 51.775  72.360  1.00 8.77   ? 143 ASP C CB  1 
ATOM   5671 C  CG  . ASP C 1 120 ? 27.062 51.078  73.404  1.00 9.29   ? 143 ASP C CG  1 
ATOM   5672 O  OD1 . ASP C 1 120 ? 28.257 50.803  73.144  1.00 6.87   ? 143 ASP C OD1 1 
ATOM   5673 O  OD2 . ASP C 1 120 ? 26.531 50.796  74.500  1.00 11.02  ? 143 ASP C OD2 1 
ATOM   5674 N  N   . ALA C 1 121 ? 28.937 51.947  70.600  1.00 8.93   ? 144 ALA C N   1 
ATOM   5675 C  CA  . ALA C 1 121 ? 29.661 51.144  69.626  1.00 8.85   ? 144 ALA C CA  1 
ATOM   5676 C  C   . ALA C 1 121 ? 29.148 49.698  69.636  1.00 9.64   ? 144 ALA C C   1 
ATOM   5677 O  O   . ALA C 1 121 ? 29.304 48.954  68.660  1.00 11.02  ? 144 ALA C O   1 
ATOM   5678 C  CB  . ALA C 1 121 ? 31.156 51.169  69.923  1.00 11.46  ? 144 ALA C CB  1 
ATOM   5679 N  N   . HIS C 1 122 ? 28.529 49.315  70.747  1.00 10.45  ? 145 HIS C N   1 
ATOM   5680 C  CA  . HIS C 1 122 ? 28.157 47.921  71.018  1.00 9.94   ? 145 HIS C CA  1 
ATOM   5681 C  C   . HIS C 1 122 ? 26.658 47.811  71.219  1.00 8.58   ? 145 HIS C C   1 
ATOM   5682 O  O   . HIS C 1 122 ? 26.017 48.789  71.585  1.00 10.18  ? 145 HIS C O   1 
ATOM   5683 C  CB  . HIS C 1 122 ? 28.829 47.445  72.313  1.00 10.19  ? 145 HIS C CB  1 
ATOM   5684 C  CG  . HIS C 1 122 ? 30.311 47.694  72.350  1.00 6.44   ? 145 HIS C CG  1 
ATOM   5685 N  ND1 . HIS C 1 122 ? 30.854 48.779  73.002  1.00 7.72   ? 145 HIS C ND1 1 
ATOM   5686 C  CD2 . HIS C 1 122 ? 31.339 46.997  71.821  1.00 10.79  ? 145 HIS C CD2 1 
ATOM   5687 C  CE1 . HIS C 1 122 ? 32.169 48.743  72.864  1.00 12.81  ? 145 HIS C CE1 1 
ATOM   5688 N  NE2 . HIS C 1 122 ? 32.495 47.686  72.150  1.00 10.16  ? 145 HIS C NE2 1 
ATOM   5689 N  N   . ALA C 1 123 ? 26.094 46.624  70.998  1.00 9.35   ? 146 ALA C N   1 
ATOM   5690 C  CA  . ALA C 1 123 ? 24.649 46.431  71.150  1.00 9.73   ? 146 ALA C CA  1 
ATOM   5691 C  C   . ALA C 1 123 ? 24.208 46.091  72.584  1.00 15.36  ? 146 ALA C C   1 
ATOM   5692 O  O   . ALA C 1 123 ? 23.041 46.277  72.926  1.00 13.32  ? 146 ALA C O   1 
ATOM   5693 C  CB  . ALA C 1 123 ? 24.145 45.359  70.167  1.00 13.00  ? 146 ALA C CB  1 
ATOM   5694 N  N   . ASP C 1 124 ? 25.136 45.615  73.417  1.00 9.49   ? 147 ASP C N   1 
ATOM   5695 C  CA  . ASP C 1 124 ? 24.843 45.336  74.829  1.00 9.05   ? 147 ASP C CA  1 
ATOM   5696 C  C   . ASP C 1 124 ? 23.626 44.431  74.986  1.00 10.72  ? 147 ASP C C   1 
ATOM   5697 O  O   . ASP C 1 124 ? 22.830 44.582  75.908  1.00 11.11  ? 147 ASP C O   1 
ATOM   5698 C  CB  . ASP C 1 124 ? 24.647 46.637  75.613  1.00 12.11  ? 147 ASP C CB  1 
ATOM   5699 C  CG  . ASP C 1 124 ? 25.906 47.484  75.657  1.00 8.90   ? 147 ASP C CG  1 
ATOM   5700 O  OD1 . ASP C 1 124 ? 26.938 47.037  75.101  1.00 10.41  ? 147 ASP C OD1 1 
ATOM   5701 O  OD2 . ASP C 1 124 ? 25.860 48.580  76.261  1.00 13.28  ? 147 ASP C OD2 1 
ATOM   5702 N  N   . ILE C 1 125 ? 23.490 43.490  74.067  1.00 9.62   ? 148 ILE C N   1 
ATOM   5703 C  CA  . ILE C 1 125 ? 22.290 42.665  74.035  1.00 11.67  ? 148 ILE C CA  1 
ATOM   5704 C  C   . ILE C 1 125 ? 22.626 41.166  74.117  1.00 14.00  ? 148 ILE C C   1 
ATOM   5705 O  O   . ILE C 1 125 ? 21.783 40.306  73.855  1.00 16.36  ? 148 ILE C O   1 
ATOM   5706 C  CB  . ILE C 1 125 ? 21.418 43.025  72.796  1.00 13.11  ? 148 ILE C CB  1 
ATOM   5707 C  CG1 . ILE C 1 125 ? 19.963 42.581  72.991  1.00 12.20  ? 148 ILE C CG1 1 
ATOM   5708 C  CG2 . ILE C 1 125 ? 22.032 42.476  71.516  1.00 10.52  ? 148 ILE C CG2 1 
ATOM   5709 C  CD1 . ILE C 1 125 ? 19.043 43.102  71.914  1.00 13.77  ? 148 ILE C CD1 1 
ATOM   5710 N  N   . ASN C 1 126 ? 23.858 40.840  74.507  1.00 15.05  ? 149 ASN C N   1 
ATOM   5711 C  CA  . ASN C 1 126 ? 24.134 39.448  74.854  1.00 9.44   ? 149 ASN C CA  1 
ATOM   5712 C  C   . ASN C 1 126 ? 23.244 39.009  76.005  1.00 10.17  ? 149 ASN C C   1 
ATOM   5713 O  O   . ASN C 1 126 ? 22.833 39.830  76.828  1.00 13.47  ? 149 ASN C O   1 
ATOM   5714 C  CB  . ASN C 1 126 ? 25.605 39.252  75.230  1.00 13.51  ? 149 ASN C CB  1 
ATOM   5715 C  CG  . ASN C 1 126 ? 26.481 39.071  74.026  1.00 14.45  ? 149 ASN C CG  1 
ATOM   5716 O  OD1 . ASN C 1 126 ? 26.293 38.126  73.258  1.00 16.42  ? 149 ASN C OD1 1 
ATOM   5717 N  ND2 . ASN C 1 126 ? 27.458 39.960  73.852  1.00 12.06  ? 149 ASN C ND2 1 
ATOM   5718 N  N   . THR C 1 127 ? 22.924 37.719  76.063  1.00 13.36  ? 150 THR C N   1 
ATOM   5719 C  CA  . THR C 1 127 ? 22.200 37.183  77.210  1.00 14.13  ? 150 THR C CA  1 
ATOM   5720 C  C   . THR C 1 127 ? 23.206 36.441  78.082  1.00 11.85  ? 150 THR C C   1 
ATOM   5721 O  O   . THR C 1 127 ? 24.354 36.248  77.678  1.00 12.92  ? 150 THR C O   1 
ATOM   5722 C  CB  . THR C 1 127 ? 21.098 36.193  76.771  1.00 16.26  ? 150 THR C CB  1 
ATOM   5723 O  OG1 . THR C 1 127 ? 21.704 34.942  76.441  1.00 12.66  ? 150 THR C OG1 1 
ATOM   5724 C  CG2 . THR C 1 127 ? 20.328 36.729  75.551  1.00 16.63  ? 150 THR C CG2 1 
ATOM   5725 N  N   . PRO C 1 128 ? 22.792 36.023  79.291  1.00 12.73  ? 151 PRO C N   1 
ATOM   5726 C  CA  . PRO C 1 128 ? 23.703 35.179  80.080  1.00 13.72  ? 151 PRO C CA  1 
ATOM   5727 C  C   . PRO C 1 128 ? 24.130 33.902  79.360  1.00 15.89  ? 151 PRO C C   1 
ATOM   5728 O  O   . PRO C 1 128 ? 25.127 33.294  79.758  1.00 14.77  ? 151 PRO C O   1 
ATOM   5729 C  CB  . PRO C 1 128 ? 22.875 34.847  81.324  1.00 15.26  ? 151 PRO C CB  1 
ATOM   5730 C  CG  . PRO C 1 128 ? 21.987 36.060  81.487  1.00 16.36  ? 151 PRO C CG  1 
ATOM   5731 C  CD  . PRO C 1 128 ? 21.647 36.496  80.088  1.00 13.47  ? 151 PRO C CD  1 
ATOM   5732 N  N   . LEU C 1 129 ? 23.395 33.503  78.325  1.00 14.63  ? 152 LEU C N   1 
ATOM   5733 C  CA  . LEU C 1 129 ? 23.736 32.305  77.560  1.00 17.00  ? 152 LEU C CA  1 
ATOM   5734 C  C   . LEU C 1 129 ? 24.596 32.596  76.331  1.00 14.98  ? 152 LEU C C   1 
ATOM   5735 O  O   . LEU C 1 129 ? 25.143 31.684  75.723  1.00 13.13  ? 152 LEU C O   1 
ATOM   5736 C  CB  . LEU C 1 129 ? 22.464 31.561  77.123  1.00 20.40  ? 152 LEU C CB  1 
ATOM   5737 C  CG  . LEU C 1 129 ? 21.542 31.105  78.254  1.00 22.51  ? 152 LEU C CG  1 
ATOM   5738 C  CD1 . LEU C 1 129 ? 20.326 30.368  77.708  1.00 26.85  ? 152 LEU C CD1 1 
ATOM   5739 C  CD2 . LEU C 1 129 ? 22.310 30.222  79.216  1.00 21.54  ? 152 LEU C CD2 1 
ATOM   5740 N  N   . THR C 1 130 ? 24.719 33.859  75.943  1.00 14.89  ? 153 THR C N   1 
ATOM   5741 C  CA  . THR C 1 130 ? 25.497 34.153  74.742  1.00 11.47  ? 153 THR C CA  1 
ATOM   5742 C  C   . THR C 1 130 ? 26.770 34.951  75.012  1.00 14.16  ? 153 THR C C   1 
ATOM   5743 O  O   . THR C 1 130 ? 27.664 34.994  74.165  1.00 11.78  ? 153 THR C O   1 
ATOM   5744 C  CB  . THR C 1 130 ? 24.676 34.889  73.660  1.00 16.86  ? 153 THR C CB  1 
ATOM   5745 O  OG1 . THR C 1 130 ? 24.415 36.230  74.086  1.00 13.27  ? 153 THR C OG1 1 
ATOM   5746 C  CG2 . THR C 1 130 ? 23.342 34.161  73.372  1.00 15.01  ? 153 THR C CG2 1 
ATOM   5747 N  N   . THR C 1 131 ? 26.849 35.592  76.173  1.00 13.39  ? 154 THR C N   1 
ATOM   5748 C  CA  . THR C 1 131 ? 28.038 36.394  76.499  1.00 13.94  ? 154 THR C CA  1 
ATOM   5749 C  C   . THR C 1 131 ? 29.298 35.547  76.496  1.00 18.68  ? 154 THR C C   1 
ATOM   5750 O  O   . THR C 1 131 ? 29.291 34.416  76.983  1.00 13.40  ? 154 THR C O   1 
ATOM   5751 C  CB  . THR C 1 131 ? 27.913 37.126  77.856  1.00 14.36  ? 154 THR C CB  1 
ATOM   5752 O  OG1 . THR C 1 131 ? 29.144 37.812  78.150  1.00 14.54  ? 154 THR C OG1 1 
ATOM   5753 C  CG2 . THR C 1 131 ? 27.621 36.136  78.984  1.00 13.43  ? 154 THR C CG2 1 
ATOM   5754 N  N   . SER C 1 132 ? 30.368 36.072  75.907  1.00 11.18  ? 155 SER C N   1 
ATOM   5755 C  CA  . SER C 1 132 ? 31.649 35.382  75.942  1.00 17.22  ? 155 SER C CA  1 
ATOM   5756 C  C   . SER C 1 132 ? 32.552 35.975  77.024  1.00 15.91  ? 155 SER C C   1 
ATOM   5757 O  O   . SER C 1 132 ? 33.626 35.446  77.305  1.00 20.82  ? 155 SER C O   1 
ATOM   5758 C  CB  . SER C 1 132 ? 32.350 35.442  74.582  1.00 20.83  ? 155 SER C CB  1 
ATOM   5759 O  OG  . SER C 1 132 ? 32.650 36.773  74.225  1.00 17.26  ? 155 SER C OG  1 
ATOM   5760 N  N   . SER C 1 133 ? 32.121 37.078  77.625  1.00 16.08  ? 156 SER C N   1 
ATOM   5761 C  CA  . SER C 1 133 ? 32.953 37.774  78.597  1.00 14.63  ? 156 SER C CA  1 
ATOM   5762 C  C   . SER C 1 133 ? 32.442 37.541  80.008  1.00 18.30  ? 156 SER C C   1 
ATOM   5763 O  O   . SER C 1 133 ? 33.216 37.544  80.960  1.00 18.04  ? 156 SER C O   1 
ATOM   5764 C  CB  . SER C 1 133 ? 32.960 39.271  78.307  1.00 13.89  ? 156 SER C CB  1 
ATOM   5765 O  OG  . SER C 1 133 ? 31.682 39.812  78.559  1.00 12.02  ? 156 SER C OG  1 
ATOM   5766 N  N   . GLY C 1 134 ? 31.133 37.361  80.144  1.00 14.68  ? 157 GLY C N   1 
ATOM   5767 C  CA  . GLY C 1 134 ? 30.524 37.236  81.459  1.00 12.89  ? 157 GLY C CA  1 
ATOM   5768 C  C   . GLY C 1 134 ? 30.267 38.577  82.115  1.00 15.50  ? 157 GLY C C   1 
ATOM   5769 O  O   . GLY C 1 134 ? 29.804 38.632  83.258  1.00 15.06  ? 157 GLY C O   1 
ATOM   5770 N  N   . ASN C 1 135 ? 30.567 39.663  81.396  1.00 13.11  ? 158 ASN C N   1 
ATOM   5771 C  CA  . ASN C 1 135 ? 30.399 41.019  81.934  1.00 12.12  ? 158 ASN C CA  1 
ATOM   5772 C  C   . ASN C 1 135 ? 28.989 41.548  81.689  1.00 11.82  ? 158 ASN C C   1 
ATOM   5773 O  O   . ASN C 1 135 ? 28.548 41.643  80.537  1.00 12.08  ? 158 ASN C O   1 
ATOM   5774 C  CB  . ASN C 1 135 ? 31.448 41.974  81.334  1.00 9.27   ? 158 ASN C CB  1 
ATOM   5775 C  CG  . ASN C 1 135 ? 32.862 41.557  81.671  1.00 20.04  ? 158 ASN C CG  1 
ATOM   5776 O  OD1 . ASN C 1 135 ? 33.099 40.998  82.738  1.00 16.17  ? 158 ASN C OD1 1 
ATOM   5777 N  ND2 . ASN C 1 135 ? 33.808 41.790  80.753  1.00 13.71  ? 158 ASN C ND2 1 
ATOM   5778 N  N   . LEU C 1 136 ? 28.288 41.899  82.762  1.00 11.25  ? 159 LEU C N   1 
ATOM   5779 C  CA  . LEU C 1 136 ? 26.897 42.315  82.644  1.00 8.47   ? 159 LEU C CA  1 
ATOM   5780 C  C   . LEU C 1 136 ? 26.694 43.625  81.867  1.00 13.80  ? 159 LEU C C   1 
ATOM   5781 O  O   . LEU C 1 136 ? 25.606 43.857  81.357  1.00 10.45  ? 159 LEU C O   1 
ATOM   5782 C  CB  . LEU C 1 136 ? 26.206 42.350  84.019  1.00 8.90   ? 159 LEU C CB  1 
ATOM   5783 C  CG  . LEU C 1 136 ? 25.891 40.928  84.531  1.00 11.49  ? 159 LEU C CG  1 
ATOM   5784 C  CD1 . LEU C 1 136 ? 25.585 40.923  86.031  1.00 13.43  ? 159 LEU C CD1 1 
ATOM   5785 C  CD2 . LEU C 1 136 ? 24.728 40.309  83.760  1.00 11.42  ? 159 LEU C CD2 1 
ATOM   5786 N  N   . HIS C 1 137 ? 27.731 44.418  81.713  1.00 10.69  ? 160 HIS C N   1 
ATOM   5787 C  CA  . HIS C 1 137 ? 27.609 45.643  80.948  1.00 12.58  ? 160 HIS C CA  1 
ATOM   5788 C  C   . HIS C 1 137 ? 27.360 45.411  79.484  1.00 10.98  ? 160 HIS C C   1 
ATOM   5789 O  O   . HIS C 1 137 ? 27.004 46.323  78.792  1.00 11.86  ? 160 HIS C O   1 
ATOM   5790 C  CB  . HIS C 1 137 ? 28.743 46.657  81.225  1.00 8.72   ? 160 HIS C CB  1 
ATOM   5791 C  CG  . HIS C 1 137 ? 30.034 46.336  80.554  1.00 8.99   ? 160 HIS C CG  1 
ATOM   5792 N  ND1 . HIS C 1 137 ? 30.959 47.248  80.268  1.00 11.81  ? 160 HIS C ND1 1 
ATOM   5793 C  CD2 . HIS C 1 137 ? 30.529 45.160  80.138  1.00 8.65   ? 160 HIS C CD2 1 
ATOM   5794 C  CE1 . HIS C 1 137 ? 31.962 46.660  79.653  1.00 14.22  ? 160 HIS C CE1 1 
ATOM   5795 N  NE2 . HIS C 1 137 ? 31.709 45.397  79.581  1.00 11.05  ? 160 HIS C NE2 1 
ATOM   5796 N  N   . GLY C 1 138 ? 27.582 44.191  79.023  1.00 9.71   ? 161 GLY C N   1 
ATOM   5797 C  CA  . GLY C 1 138 ? 27.380 43.814  77.633  1.00 11.23  ? 161 GLY C CA  1 
ATOM   5798 C  C   . GLY C 1 138 ? 26.096 43.033  77.442  1.00 10.94  ? 161 GLY C C   1 
ATOM   5799 O  O   . GLY C 1 138 ? 25.840 42.503  76.361  1.00 10.10  ? 161 GLY C O   1 
ATOM   5800 N  N   . GLN C 1 139 ? 25.300 42.962  78.506  1.00 11.09  ? 162 GLN C N   1 
ATOM   5801 C  CA  . GLN C 1 139 ? 24.016 42.262  78.500  1.00 12.69  ? 162 GLN C CA  1 
ATOM   5802 C  C   . GLN C 1 139 ? 22.749 43.068  78.877  1.00 11.44  ? 162 GLN C C   1 
ATOM   5803 O  O   . GLN C 1 139 ? 21.667 42.475  78.914  1.00 14.29  ? 162 GLN C O   1 
ATOM   5804 C  CB  . GLN C 1 139 ? 24.092 41.063  79.461  1.00 9.19   ? 162 GLN C CB  1 
ATOM   5805 C  CG  . GLN C 1 139 ? 25.173 40.059  79.136  1.00 11.86  ? 162 GLN C CG  1 
ATOM   5806 C  CD  . GLN C 1 139 ? 25.435 39.118  80.288  1.00 13.96  ? 162 GLN C CD  1 
ATOM   5807 O  OE1 . GLN C 1 139 ? 26.524 39.128  80.879  1.00 16.86  ? 162 GLN C OE1 1 
ATOM   5808 N  NE2 . GLN C 1 139 ? 24.439 38.311  80.631  1.00 13.65  ? 162 GLN C NE2 1 
ATOM   5809 N  N   . PRO C 1 140 ? 22.862 44.377  79.197  1.00 12.06  ? 163 PRO C N   1 
ATOM   5810 C  CA  . PRO C 1 140 ? 21.684 44.955  79.866  1.00 10.38  ? 163 PRO C CA  1 
ATOM   5811 C  C   . PRO C 1 140 ? 20.387 44.912  79.072  1.00 14.78  ? 163 PRO C C   1 
ATOM   5812 O  O   . PRO C 1 140 ? 19.319 44.766  79.667  1.00 17.34  ? 163 PRO C O   1 
ATOM   5813 C  CB  . PRO C 1 140 ? 22.091 46.412  80.109  1.00 12.22  ? 163 PRO C CB  1 
ATOM   5814 C  CG  . PRO C 1 140 ? 23.129 46.692  79.070  1.00 9.97   ? 163 PRO C CG  1 
ATOM   5815 C  CD  . PRO C 1 140 ? 23.889 45.409  78.943  1.00 9.29   ? 163 PRO C CD  1 
ATOM   5816 N  N   . VAL C 1 141 ? 20.474 45.051  77.758  1.00 11.62  ? 164 VAL C N   1 
ATOM   5817 C  CA  . VAL C 1 141 ? 19.272 45.093  76.939  1.00 14.50  ? 164 VAL C CA  1 
ATOM   5818 C  C   . VAL C 1 141 ? 18.521 43.761  76.970  1.00 23.16  ? 164 VAL C C   1 
ATOM   5819 O  O   . VAL C 1 141 ? 17.283 43.736  76.904  1.00 15.85  ? 164 VAL C O   1 
ATOM   5820 C  CB  . VAL C 1 141 ? 19.601 45.524  75.490  1.00 15.31  ? 164 VAL C CB  1 
ATOM   5821 C  CG1 . VAL C 1 141 ? 18.330 45.559  74.621  1.00 13.62  ? 164 VAL C CG1 1 
ATOM   5822 C  CG2 . VAL C 1 141 ? 20.268 46.899  75.505  1.00 14.03  ? 164 VAL C CG2 1 
ATOM   5823 N  N   . SER C 1 142 ? 19.260 42.659  77.116  1.00 16.93  ? 165 SER C N   1 
ATOM   5824 C  CA  . SER C 1 142 ? 18.630 41.334  77.125  1.00 15.46  ? 165 SER C CA  1 
ATOM   5825 C  C   . SER C 1 142 ? 17.645 41.181  78.281  1.00 19.28  ? 165 SER C C   1 
ATOM   5826 O  O   . SER C 1 142 ? 16.660 40.457  78.163  1.00 21.82  ? 165 SER C O   1 
ATOM   5827 C  CB  . SER C 1 142 ? 19.666 40.196  77.138  1.00 16.88  ? 165 SER C CB  1 
ATOM   5828 O  OG  . SER C 1 142 ? 20.217 40.011  78.426  1.00 17.15  ? 165 SER C OG  1 
ATOM   5829 N  N   . PHE C 1 143 ? 17.896 41.866  79.390  1.00 15.92  ? 166 PHE C N   1 
ATOM   5830 C  CA  . PHE C 1 143 ? 17.007 41.769  80.541  1.00 19.49  ? 166 PHE C CA  1 
ATOM   5831 C  C   . PHE C 1 143 ? 15.786 42.662  80.412  1.00 19.73  ? 166 PHE C C   1 
ATOM   5832 O  O   . PHE C 1 143 ? 14.820 42.498  81.154  1.00 20.39  ? 166 PHE C O   1 
ATOM   5833 C  CB  . PHE C 1 143 ? 17.759 42.121  81.825  1.00 20.58  ? 166 PHE C CB  1 
ATOM   5834 C  CG  . PHE C 1 143 ? 18.958 41.263  82.059  1.00 23.20  ? 166 PHE C CG  1 
ATOM   5835 C  CD1 . PHE C 1 143 ? 18.820 39.973  82.552  1.00 24.93  ? 166 PHE C CD1 1 
ATOM   5836 C  CD2 . PHE C 1 143 ? 20.225 41.731  81.751  1.00 15.88  ? 166 PHE C CD2 1 
ATOM   5837 C  CE1 . PHE C 1 143 ? 19.931 39.169  82.745  1.00 19.18  ? 166 PHE C CE1 1 
ATOM   5838 C  CE2 . PHE C 1 143 ? 21.343 40.936  81.940  1.00 16.88  ? 166 PHE C CE2 1 
ATOM   5839 C  CZ  . PHE C 1 143 ? 21.200 39.652  82.436  1.00 19.12  ? 166 PHE C CZ  1 
ATOM   5840 N  N   . LEU C 1 144 ? 15.830 43.601  79.468  1.00 15.99  ? 167 LEU C N   1 
ATOM   5841 C  CA  . LEU C 1 144 ? 14.791 44.622  79.359  1.00 15.19  ? 167 LEU C CA  1 
ATOM   5842 C  C   . LEU C 1 144 ? 13.778 44.339  78.249  1.00 20.49  ? 167 LEU C C   1 
ATOM   5843 O  O   . LEU C 1 144 ? 12.644 44.817  78.317  1.00 19.33  ? 167 LEU C O   1 
ATOM   5844 C  CB  . LEU C 1 144 ? 15.419 46.006  79.135  1.00 17.73  ? 167 LEU C CB  1 
ATOM   5845 C  CG  . LEU C 1 144 ? 16.381 46.473  80.230  1.00 18.52  ? 167 LEU C CG  1 
ATOM   5846 C  CD1 . LEU C 1 144 ? 17.127 47.713  79.784  1.00 13.58  ? 167 LEU C CD1 1 
ATOM   5847 C  CD2 . LEU C 1 144 ? 15.639 46.735  81.538  1.00 16.93  ? 167 LEU C CD2 1 
ATOM   5848 N  N   . LEU C 1 145 ? 14.193 43.568  77.242  1.00 17.93  ? 168 LEU C N   1 
ATOM   5849 C  CA  . LEU C 1 145 ? 13.375 43.309  76.047  1.00 18.85  ? 168 LEU C CA  1 
ATOM   5850 C  C   . LEU C 1 145 ? 12.367 42.199  76.276  1.00 23.81  ? 168 LEU C C   1 
ATOM   5851 O  O   . LEU C 1 145 ? 12.740 41.070  76.589  1.00 18.11  ? 168 LEU C O   1 
ATOM   5852 C  CB  . LEU C 1 145 ? 14.246 42.903  74.861  1.00 19.56  ? 168 LEU C CB  1 
ATOM   5853 C  CG  . LEU C 1 145 ? 14.911 43.926  73.952  1.00 38.00  ? 168 LEU C CG  1 
ATOM   5854 C  CD1 . LEU C 1 145 ? 15.360 43.215  72.698  1.00 40.49  ? 168 LEU C CD1 1 
ATOM   5855 C  CD2 . LEU C 1 145 ? 13.939 45.017  73.599  1.00 33.49  ? 168 LEU C CD2 1 
ATOM   5856 N  N   . ARG C 1 146 ? 11.094 42.513  76.076  1.00 19.79  ? 169 ARG C N   1 
ATOM   5857 C  CA  A ARG C 1 146 ? 10.029 41.538  76.285  0.42 26.65  ? 169 ARG C CA  1 
ATOM   5858 C  CA  B ARG C 1 146 ? 10.028 41.537  76.285  0.58 26.68  ? 169 ARG C CA  1 
ATOM   5859 C  C   . ARG C 1 146 ? 10.229 40.292  75.433  1.00 20.89  ? 169 ARG C C   1 
ATOM   5860 O  O   . ARG C 1 146 ? 10.122 39.169  75.927  1.00 22.80  ? 169 ARG C O   1 
ATOM   5861 C  CB  A ARG C 1 146 ? 8.663  42.159  75.986  0.42 26.49  ? 169 ARG C CB  1 
ATOM   5862 C  CB  B ARG C 1 146 ? 8.662  42.159  75.983  0.58 26.45  ? 169 ARG C CB  1 
ATOM   5863 C  CG  A ARG C 1 146 ? 8.280  43.288  76.924  0.42 30.28  ? 169 ARG C CG  1 
ATOM   5864 C  CG  B ARG C 1 146 ? 8.279  43.288  76.920  0.58 30.27  ? 169 ARG C CG  1 
ATOM   5865 C  CD  A ARG C 1 146 ? 6.841  43.739  76.716  0.42 33.74  ? 169 ARG C CD  1 
ATOM   5866 C  CD  B ARG C 1 146 ? 6.838  43.737  76.713  0.58 33.72  ? 169 ARG C CD  1 
ATOM   5867 N  NE  A ARG C 1 146 ? 6.444  44.709  77.732  0.42 38.69  ? 169 ARG C NE  1 
ATOM   5868 N  NE  B ARG C 1 146 ? 6.443  44.708  77.730  0.58 38.68  ? 169 ARG C NE  1 
ATOM   5869 C  CZ  A ARG C 1 146 ? 6.426  46.025  77.545  0.42 41.49  ? 169 ARG C CZ  1 
ATOM   5870 C  CZ  B ARG C 1 146 ? 6.427  46.023  77.543  0.58 41.54  ? 169 ARG C CZ  1 
ATOM   5871 N  NH1 A ARG C 1 146 ? 6.767  46.534  76.370  0.42 40.61  ? 169 ARG C NH1 1 
ATOM   5872 N  NH1 B ARG C 1 146 ? 6.769  46.531  76.367  0.58 40.65  ? 169 ARG C NH1 1 
ATOM   5873 N  NH2 A ARG C 1 146 ? 6.057  46.832  78.532  0.42 43.26  ? 169 ARG C NH2 1 
ATOM   5874 N  NH2 B ARG C 1 146 ? 6.061  46.832  78.530  0.58 43.31  ? 169 ARG C NH2 1 
ATOM   5875 N  N   . GLU C 1 147 ? 10.539 40.496  74.156  1.00 20.82  ? 170 GLU C N   1 
ATOM   5876 C  CA  . GLU C 1 147 ? 10.615 39.385  73.209  1.00 24.68  ? 170 GLU C CA  1 
ATOM   5877 C  C   . GLU C 1 147 ? 11.703 38.360  73.509  1.00 31.70  ? 170 GLU C C   1 
ATOM   5878 O  O   . GLU C 1 147 ? 11.634 37.232  73.028  1.00 24.01  ? 170 GLU C O   1 
ATOM   5879 C  CB  . GLU C 1 147 ? 10.761 39.907  71.768  1.00 26.98  ? 170 GLU C CB  1 
ATOM   5880 C  CG  . GLU C 1 147 ? 9.488  40.533  71.197  1.00 32.50  ? 170 GLU C CG  1 
ATOM   5881 C  CD  . GLU C 1 147 ? 9.296  41.987  71.608  1.00 36.29  ? 170 GLU C CD  1 
ATOM   5882 O  OE1 . GLU C 1 147 ? 10.091 42.489  72.431  1.00 32.32  ? 170 GLU C OE1 1 
ATOM   5883 O  OE2 . GLU C 1 147 ? 8.337  42.626  71.124  1.00 32.55  ? 170 GLU C OE2 1 
ATOM   5884 N  N   . LEU C 1 148 ? 12.690 38.747  74.292  1.00 22.85  ? 171 LEU C N   1 
ATOM   5885 C  CA  A LEU C 1 148 ? 13.824 37.845  74.566  0.26 23.20  ? 171 LEU C CA  1 
ATOM   5886 C  CA  B LEU C 1 148 ? 13.782 37.868  74.638  0.74 23.20  ? 171 LEU C CA  1 
ATOM   5887 C  C   . LEU C 1 148 ? 13.591 36.922  75.819  1.00 23.96  ? 171 LEU C C   1 
ATOM   5888 O  O   . LEU C 1 148 ? 14.495 36.251  76.225  1.00 30.33  ? 171 LEU C O   1 
ATOM   5889 C  CB  A LEU C 1 148 ? 15.117 38.662  74.696  0.26 21.38  ? 171 LEU C CB  1 
ATOM   5890 C  CB  B LEU C 1 148 ? 15.071 38.658  74.819  0.74 21.38  ? 171 LEU C CB  1 
ATOM   5891 C  CG  A LEU C 1 148 ? 16.039 38.880  73.497  0.26 27.88  ? 171 LEU C CG  1 
ATOM   5892 C  CG  B LEU C 1 148 ? 15.959 38.936  73.615  0.74 27.88  ? 171 LEU C CG  1 
ATOM   5893 C  CD1 A LEU C 1 148 ? 15.268 39.513  72.363  0.26 39.57  ? 171 LEU C CD1 1 
ATOM   5894 C  CD1 B LEU C 1 148 ? 17.086 39.878  73.965  0.74 20.33  ? 171 LEU C CD1 1 
ATOM   5895 C  CD2 A LEU C 1 148 ? 17.184 39.800  73.902  0.26 20.33  ? 171 LEU C CD2 1 
ATOM   5896 C  CD2 B LEU C 1 148 ? 16.525 37.649  73.103  0.74 39.57  ? 171 LEU C CD2 1 
ATOM   5897 N  N   . GLN C 1 149 ? 12.587 37.257  76.579  1.00 20.94  ? 172 GLN C N   1 
ATOM   5898 C  CA  A GLN C 1 149 ? 12.517 36.747  77.948  0.51 26.95  ? 172 GLN C CA  1 
ATOM   5899 C  CA  B GLN C 1 149 ? 12.497 36.726  77.933  0.49 26.95  ? 172 GLN C CA  1 
ATOM   5900 C  C   . GLN C 1 149 ? 12.530 35.221  78.085  1.00 26.18  ? 172 GLN C C   1 
ATOM   5901 O  O   . GLN C 1 149 ? 13.029 34.711  79.080  1.00 28.86  ? 172 GLN C O   1 
ATOM   5902 C  CB  A GLN C 1 149 ? 11.375 37.398  78.751  0.51 26.60  ? 172 GLN C CB  1 
ATOM   5903 C  CB  B GLN C 1 149 ? 11.307 37.320  78.656  0.49 26.64  ? 172 GLN C CB  1 
ATOM   5904 C  CG  A GLN C 1 149 ? 10.000 36.774  78.598  0.51 32.97  ? 172 GLN C CG  1 
ATOM   5905 C  CG  B GLN C 1 149 ? 11.618 38.718  79.036  0.49 28.09  ? 172 GLN C CG  1 
ATOM   5906 C  CD  A GLN C 1 149 ? 8.902  37.697  79.102  0.51 30.49  ? 172 GLN C CD  1 
ATOM   5907 C  CD  B GLN C 1 149 ? 13.063 38.877  79.499  0.49 31.33  ? 172 GLN C CD  1 
ATOM   5908 O  OE1 A GLN C 1 149 ? 8.137  38.254  78.313  0.51 33.61  ? 172 GLN C OE1 1 
ATOM   5909 O  OE1 B GLN C 1 149 ? 13.477 38.294  80.504  0.49 22.38  ? 172 GLN C OE1 1 
ATOM   5910 N  NE2 A GLN C 1 149 ? 8.833  37.878  80.417  0.51 25.37  ? 172 GLN C NE2 1 
ATOM   5911 N  NE2 B GLN C 1 149 ? 13.839 39.654  78.753  0.49 12.28  ? 172 GLN C NE2 1 
ATOM   5912 N  N   . ASP C 1 150 ? 12.010 34.498  77.098  1.00 28.86  ? 173 ASP C N   1 
ATOM   5913 C  CA  . ASP C 1 150 ? 12.080 33.037  77.196  1.00 36.42  ? 173 ASP C CA  1 
ATOM   5914 C  C   . ASP C 1 150 ? 13.496 32.527  76.891  1.00 38.07  ? 173 ASP C C   1 
ATOM   5915 O  O   . ASP C 1 150 ? 13.795 31.349  77.085  1.00 36.30  ? 173 ASP C O   1 
ATOM   5916 C  CB  . ASP C 1 150 ? 10.991 32.326  76.366  1.00 38.65  ? 173 ASP C CB  1 
ATOM   5917 C  CG  . ASP C 1 150 ? 11.072 32.627  74.885  1.00 58.79  ? 173 ASP C CG  1 
ATOM   5918 O  OD1 . ASP C 1 150 ? 11.752 33.603  74.501  1.00 60.89  ? 173 ASP C OD1 1 
ATOM   5919 O  OD2 . ASP C 1 150 ? 10.435 31.886  74.100  1.00 65.05  ? 173 ASP C OD2 1 
ATOM   5920 N  N   . LYS C 1 151 ? 14.373 33.427  76.443  1.00 25.66  ? 174 LYS C N   1 
ATOM   5921 C  CA  . LYS C 1 151 ? 15.763 33.067  76.149  1.00 27.05  ? 174 LYS C CA  1 
ATOM   5922 C  C   . LYS C 1 151 ? 16.766 33.565  77.194  1.00 25.57  ? 174 LYS C C   1 
ATOM   5923 O  O   . LYS C 1 151 ? 17.971 33.354  77.056  1.00 32.48  ? 174 LYS C O   1 
ATOM   5924 C  CB  . LYS C 1 151 ? 16.163 33.550  74.753  1.00 29.98  ? 174 LYS C CB  1 
ATOM   5925 C  CG  . LYS C 1 151 ? 15.360 32.892  73.638  1.00 39.73  ? 174 LYS C CG  1 
ATOM   5926 C  CD  . LYS C 1 151 ? 15.934 31.520  73.321  1.00 37.39  ? 174 LYS C CD  1 
ATOM   5927 C  CE  . LYS C 1 151 ? 15.176 30.839  72.196  1.00 48.96  ? 174 LYS C CE  1 
ATOM   5928 N  NZ  . LYS C 1 151 ? 14.956 31.744  71.044  1.00 49.88  ? 174 LYS C NZ  1 
ATOM   5929 N  N   . VAL C 1 152 ? 16.269 34.228  78.231  1.00 22.89  ? 175 VAL C N   1 
ATOM   5930 C  CA  . VAL C 1 152 ? 17.133 34.786  79.273  1.00 20.18  ? 175 VAL C CA  1 
ATOM   5931 C  C   . VAL C 1 152 ? 16.902 34.081  80.606  1.00 24.18  ? 175 VAL C C   1 
ATOM   5932 O  O   . VAL C 1 152 ? 15.830 34.194  81.193  1.00 23.21  ? 175 VAL C O   1 
ATOM   5933 C  CB  . VAL C 1 152 ? 16.890 36.301  79.444  1.00 24.33  ? 175 VAL C CB  1 
ATOM   5934 C  CG1 . VAL C 1 152 ? 17.712 36.856  80.606  1.00 23.42  ? 175 VAL C CG1 1 
ATOM   5935 C  CG2 . VAL C 1 152 ? 17.210 37.034  78.148  1.00 19.89  ? 175 VAL C CG2 1 
ATOM   5936 N  N   . PRO C 1 153 ? 17.912 33.342  81.089  1.00 23.31  ? 176 PRO C N   1 
ATOM   5937 C  CA  . PRO C 1 153 ? 17.771 32.663  82.384  1.00 23.69  ? 176 PRO C CA  1 
ATOM   5938 C  C   . PRO C 1 153 ? 17.705 33.624  83.572  1.00 28.57  ? 176 PRO C C   1 
ATOM   5939 O  O   . PRO C 1 153 ? 18.124 34.784  83.499  1.00 22.86  ? 176 PRO C O   1 
ATOM   5940 C  CB  . PRO C 1 153 ? 19.035 31.791  82.480  1.00 28.01  ? 176 PRO C CB  1 
ATOM   5941 C  CG  . PRO C 1 153 ? 20.005 32.360  81.498  1.00 31.08  ? 176 PRO C CG  1 
ATOM   5942 C  CD  . PRO C 1 153 ? 19.210 33.079  80.437  1.00 24.16  ? 176 PRO C CD  1 
ATOM   5943 N  N   . GLN C 1 154 ? 17.182 33.123  84.683  1.00 21.61  ? 177 GLN C N   1 
ATOM   5944 C  CA  . GLN C 1 154 ? 17.019 33.931  85.882  1.00 24.70  ? 177 GLN C CA  1 
ATOM   5945 C  C   . GLN C 1 154 ? 18.316 33.973  86.702  1.00 29.69  ? 177 GLN C C   1 
ATOM   5946 O  O   . GLN C 1 154 ? 18.804 32.951  87.187  1.00 24.82  ? 177 GLN C O   1 
ATOM   5947 C  CB  . GLN C 1 154 ? 15.846 33.376  86.697  1.00 39.70  ? 177 GLN C CB  1 
ATOM   5948 C  CG  . GLN C 1 154 ? 15.469 34.195  87.906  1.00 48.60  ? 177 GLN C CG  1 
ATOM   5949 C  CD  . GLN C 1 154 ? 14.931 35.559  87.540  1.00 52.32  ? 177 GLN C CD  1 
ATOM   5950 O  OE1 . GLN C 1 154 ? 15.522 36.576  87.904  1.00 53.69  ? 177 GLN C OE1 1 
ATOM   5951 N  NE2 . GLN C 1 154 ? 13.841 35.594  86.779  1.00 45.64  ? 177 GLN C NE2 1 
ATOM   5952 N  N   . LEU C 1 155 ? 18.885 35.167  86.829  1.00 20.47  ? 178 LEU C N   1 
ATOM   5953 C  CA  . LEU C 1 155 ? 20.117 35.344  87.591  1.00 22.51  ? 178 LEU C CA  1 
ATOM   5954 C  C   . LEU C 1 155 ? 19.817 35.658  89.048  1.00 19.89  ? 178 LEU C C   1 
ATOM   5955 O  O   . LEU C 1 155 ? 18.795 36.281  89.364  1.00 21.13  ? 178 LEU C O   1 
ATOM   5956 C  CB  . LEU C 1 155 ? 20.960 36.481  86.997  1.00 13.71  ? 178 LEU C CB  1 
ATOM   5957 C  CG  . LEU C 1 155 ? 22.018 36.165  85.937  1.00 23.44  ? 178 LEU C CG  1 
ATOM   5958 C  CD1 . LEU C 1 155 ? 21.497 35.204  84.898  1.00 29.94  ? 178 LEU C CD1 1 
ATOM   5959 C  CD2 . LEU C 1 155 ? 22.485 37.468  85.286  1.00 21.96  ? 178 LEU C CD2 1 
ATOM   5960 N  N   . PRO C 1 156 ? 20.722 35.240  89.947  1.00 20.67  ? 179 PRO C N   1 
ATOM   5961 C  CA  . PRO C 1 156 ? 20.590 35.666  91.342  1.00 19.40  ? 179 PRO C CA  1 
ATOM   5962 C  C   . PRO C 1 156 ? 20.715 37.183  91.438  1.00 25.03  ? 179 PRO C C   1 
ATOM   5963 O  O   . PRO C 1 156 ? 21.636 37.772  90.857  1.00 17.94  ? 179 PRO C O   1 
ATOM   5964 C  CB  . PRO C 1 156 ? 21.759 34.962  92.048  1.00 25.66  ? 179 PRO C CB  1 
ATOM   5965 C  CG  . PRO C 1 156 ? 22.733 34.601  90.955  1.00 25.14  ? 179 PRO C CG  1 
ATOM   5966 C  CD  . PRO C 1 156 ? 21.886 34.363  89.730  1.00 19.28  ? 179 PRO C CD  1 
ATOM   5967 N  N   . GLY C 1 157 ? 19.778 37.800  92.148  1.00 18.06  ? 180 GLY C N   1 
ATOM   5968 C  CA  . GLY C 1 157 ? 19.729 39.242  92.294  1.00 24.98  ? 180 GLY C CA  1 
ATOM   5969 C  C   . GLY C 1 157 ? 18.890 39.939  91.236  1.00 17.36  ? 180 GLY C C   1 
ATOM   5970 O  O   . GLY C 1 157 ? 18.689 41.149  91.304  1.00 21.15  ? 180 GLY C O   1 
ATOM   5971 N  N   . PHE C 1 158 ? 18.380 39.176  90.273  1.00 16.52  ? 181 PHE C N   1 
ATOM   5972 C  CA  . PHE C 1 158 ? 17.633 39.750  89.150  1.00 20.88  ? 181 PHE C CA  1 
ATOM   5973 C  C   . PHE C 1 158 ? 16.121 39.477  89.162  1.00 27.18  ? 181 PHE C C   1 
ATOM   5974 O  O   . PHE C 1 158 ? 15.441 39.821  88.199  1.00 24.61  ? 181 PHE C O   1 
ATOM   5975 C  CB  . PHE C 1 158 ? 18.213 39.241  87.823  1.00 19.24  ? 181 PHE C CB  1 
ATOM   5976 C  CG  . PHE C 1 158 ? 19.440 39.977  87.364  1.00 19.44  ? 181 PHE C CG  1 
ATOM   5977 C  CD1 . PHE C 1 158 ? 20.578 40.035  88.161  1.00 20.66  ? 181 PHE C CD1 1 
ATOM   5978 C  CD2 . PHE C 1 158 ? 19.467 40.580  86.113  1.00 24.71  ? 181 PHE C CD2 1 
ATOM   5979 C  CE1 . PHE C 1 158 ? 21.719 40.714  87.728  1.00 16.72  ? 181 PHE C CE1 1 
ATOM   5980 C  CE2 . PHE C 1 158 ? 20.591 41.264  85.668  1.00 24.26  ? 181 PHE C CE2 1 
ATOM   5981 C  CZ  . PHE C 1 158 ? 21.724 41.332  86.476  1.00 20.84  ? 181 PHE C CZ  1 
ATOM   5982 N  N   . SER C 1 159 ? 15.594 38.846  90.213  1.00 25.91  ? 182 SER C N   1 
ATOM   5983 C  CA  . SER C 1 159 ? 14.181 38.423  90.197  1.00 25.72  ? 182 SER C CA  1 
ATOM   5984 C  C   . SER C 1 159 ? 13.181 39.582  90.168  1.00 29.37  ? 182 SER C C   1 
ATOM   5985 O  O   . SER C 1 159 ? 12.066 39.421  89.675  1.00 24.27  ? 182 SER C O   1 
ATOM   5986 C  CB  . SER C 1 159 ? 13.857 37.465  91.352  1.00 25.23  ? 182 SER C CB  1 
ATOM   5987 O  OG  . SER C 1 159 ? 13.842 38.149  92.583  1.00 32.47  ? 182 SER C OG  1 
ATOM   5988 N  N   . TRP C 1 160 ? 13.593 40.743  90.672  1.00 22.73  ? 183 TRP C N   1 
ATOM   5989 C  CA  . TRP C 1 160 ? 12.753 41.938  90.671  1.00 19.23  ? 183 TRP C CA  1 
ATOM   5990 C  C   . TRP C 1 160 ? 12.529 42.484  89.262  1.00 24.78  ? 183 TRP C C   1 
ATOM   5991 O  O   . TRP C 1 160 ? 11.604 43.262  89.031  1.00 23.65  ? 183 TRP C O   1 
ATOM   5992 C  CB  . TRP C 1 160 ? 13.398 43.032  91.524  1.00 24.94  ? 183 TRP C CB  1 
ATOM   5993 C  CG  . TRP C 1 160 ? 14.727 43.495  90.978  1.00 25.39  ? 183 TRP C CG  1 
ATOM   5994 C  CD1 . TRP C 1 160 ? 15.952 42.928  91.208  1.00 24.67  ? 183 TRP C CD1 1 
ATOM   5995 C  CD2 . TRP C 1 160 ? 14.958 44.609  90.100  1.00 20.75  ? 183 TRP C CD2 1 
ATOM   5996 N  NE1 . TRP C 1 160 ? 16.934 43.628  90.532  1.00 19.83  ? 183 TRP C NE1 1 
ATOM   5997 C  CE2 . TRP C 1 160 ? 16.350 44.660  89.846  1.00 21.03  ? 183 TRP C CE2 1 
ATOM   5998 C  CE3 . TRP C 1 160 ? 14.128 45.566  89.506  1.00 21.14  ? 183 TRP C CE3 1 
ATOM   5999 C  CZ2 . TRP C 1 160 ? 16.925 45.636  89.018  1.00 17.78  ? 183 TRP C CZ2 1 
ATOM   6000 C  CZ3 . TRP C 1 160 ? 14.703 46.538  88.686  1.00 19.24  ? 183 TRP C CZ3 1 
ATOM   6001 C  CH2 . TRP C 1 160 ? 16.086 46.565  88.454  1.00 23.26  ? 183 TRP C CH2 1 
ATOM   6002 N  N   . ILE C 1 161 ? 13.375 42.093  88.316  1.00 22.59  ? 184 ILE C N   1 
ATOM   6003 C  CA  . ILE C 1 161 ? 13.303 42.701  86.985  1.00 22.62  ? 184 ILE C CA  1 
ATOM   6004 C  C   . ILE C 1 161 ? 12.158 42.158  86.151  1.00 28.44  ? 184 ILE C C   1 
ATOM   6005 O  O   . ILE C 1 161 ? 12.031 40.948  85.951  1.00 32.30  ? 184 ILE C O   1 
ATOM   6006 C  CB  . ILE C 1 161 ? 14.599 42.494  86.196  1.00 24.53  ? 184 ILE C CB  1 
ATOM   6007 C  CG1 . ILE C 1 161 ? 15.752 43.180  86.911  1.00 25.74  ? 184 ILE C CG1 1 
ATOM   6008 C  CG2 . ILE C 1 161 ? 14.468 43.067  84.782  1.00 26.34  ? 184 ILE C CG2 1 
ATOM   6009 C  CD1 . ILE C 1 161 ? 17.083 42.855  86.321  1.00 30.47  ? 184 ILE C CD1 1 
ATOM   6010 N  N   . LYS C 1 162 ? 11.329 43.063  85.652  1.00 27.43  ? 185 LYS C N   1 
ATOM   6011 C  CA  . LYS C 1 162 ? 10.363 42.695  84.631  1.00 32.88  ? 185 LYS C CA  1 
ATOM   6012 C  C   . LYS C 1 162 ? 10.655 43.484  83.366  1.00 28.03  ? 185 LYS C C   1 
ATOM   6013 O  O   . LYS C 1 162 ? 10.711 44.714  83.394  1.00 35.02  ? 185 LYS C O   1 
ATOM   6014 C  CB  . LYS C 1 162 ? 8.925  42.915  85.121  1.00 40.85  ? 185 LYS C CB  1 
ATOM   6015 C  CG  . LYS C 1 162 ? 8.547  42.035  86.329  1.00 49.63  ? 185 LYS C CG  1 
ATOM   6016 C  CD  . LYS C 1 162 ? 8.955  40.569  86.103  1.00 56.94  ? 185 LYS C CD  1 
ATOM   6017 C  CE  . LYS C 1 162 ? 9.346  39.863  87.408  1.00 59.42  ? 185 LYS C CE  1 
ATOM   6018 N  NZ  . LYS C 1 162 ? 9.663  38.412  87.208  1.00 58.05  ? 185 LYS C NZ  1 
ATOM   6019 N  N   . PRO C 1 163 ? 10.854 42.764  82.254  1.00 26.85  ? 186 PRO C N   1 
ATOM   6020 C  CA  . PRO C 1 163 ? 11.082 43.295  80.905  1.00 25.25  ? 186 PRO C CA  1 
ATOM   6021 C  C   . PRO C 1 163 ? 10.035 44.338  80.545  1.00 34.69  ? 186 PRO C C   1 
ATOM   6022 O  O   . PRO C 1 163 ? 8.842  44.092  80.713  1.00 35.24  ? 186 PRO C O   1 
ATOM   6023 C  CB  . PRO C 1 163 ? 10.935 42.058  80.012  1.00 31.53  ? 186 PRO C CB  1 
ATOM   6024 C  CG  . PRO C 1 163 ? 10.290 41.008  80.902  1.00 32.48  ? 186 PRO C CG  1 
ATOM   6025 C  CD  . PRO C 1 163 ? 10.796 41.296  82.256  1.00 29.57  ? 186 PRO C CD  1 
ATOM   6026 N  N   . CYS C 1 164 ? 10.485 45.493  80.067  1.00 24.92  ? 187 CYS C N   1 
ATOM   6027 C  CA  . CYS C 1 164 ? 9.607  46.650  79.916  1.00 33.32  ? 187 CYS C CA  1 
ATOM   6028 C  C   . CYS C 1 164 ? 9.702  47.311  78.543  1.00 33.50  ? 187 CYS C C   1 
ATOM   6029 O  O   . CYS C 1 164 ? 9.070  48.339  78.294  1.00 41.31  ? 187 CYS C O   1 
ATOM   6030 C  CB  . CYS C 1 164 ? 9.906  47.666  81.021  1.00 36.52  ? 187 CYS C CB  1 
ATOM   6031 S  SG  . CYS C 1 164 ? 11.687 47.975  81.255  1.00 36.06  ? 187 CYS C SG  1 
ATOM   6032 N  N   . ILE C 1 165 ? 10.480 46.709  77.653  1.00 29.20  ? 188 ILE C N   1 
ATOM   6033 C  CA  . ILE C 1 165 ? 10.728 47.296  76.348  1.00 36.28  ? 188 ILE C CA  1 
ATOM   6034 C  C   . ILE C 1 165 ? 10.452 46.240  75.299  1.00 29.27  ? 188 ILE C C   1 
ATOM   6035 O  O   . ILE C 1 165 ? 10.886 45.101  75.434  1.00 28.50  ? 188 ILE C O   1 
ATOM   6036 C  CB  . ILE C 1 165 ? 12.212 47.745  76.194  1.00 32.21  ? 188 ILE C CB  1 
ATOM   6037 C  CG1 . ILE C 1 165 ? 12.573 48.788  77.239  1.00 42.50  ? 188 ILE C CG1 1 
ATOM   6038 C  CG2 . ILE C 1 165 ? 12.491 48.263  74.787  1.00 37.16  ? 188 ILE C CG2 1 
ATOM   6039 C  CD1 . ILE C 1 165 ? 11.630 49.949  77.239  1.00 43.52  ? 188 ILE C CD1 1 
ATOM   6040 N  N   . SER C 1 166 ? 9.723  46.611  74.254  1.00 28.65  ? 189 SER C N   1 
ATOM   6041 C  CA  A SER C 1 166 ? 9.547  45.720  73.117  0.55 31.63  ? 189 SER C CA  1 
ATOM   6042 C  CA  B SER C 1 166 ? 9.546  45.721  73.116  0.45 31.61  ? 189 SER C CA  1 
ATOM   6043 C  C   . SER C 1 166 ? 10.608 46.063  72.084  1.00 27.96  ? 189 SER C C   1 
ATOM   6044 O  O   . SER C 1 166 ? 11.124 47.184  72.060  1.00 23.01  ? 189 SER C O   1 
ATOM   6045 C  CB  A SER C 1 166 ? 8.152  45.858  72.510  0.55 32.20  ? 189 SER C CB  1 
ATOM   6046 C  CB  B SER C 1 166 ? 8.151  45.862  72.509  0.45 32.20  ? 189 SER C CB  1 
ATOM   6047 O  OG  A SER C 1 166 ? 8.060  47.022  71.715  0.55 38.28  ? 189 SER C OG  1 
ATOM   6048 O  OG  B SER C 1 166 ? 8.061  47.024  71.712  0.45 38.21  ? 189 SER C OG  1 
ATOM   6049 N  N   . SER C 1 167 ? 10.916 45.101  71.229  1.00 23.31  ? 190 SER C N   1 
ATOM   6050 C  CA  . SER C 1 167 ? 11.993 45.229  70.268  1.00 25.93  ? 190 SER C CA  1 
ATOM   6051 C  C   . SER C 1 167 ? 11.775 46.365  69.273  1.00 31.45  ? 190 SER C C   1 
ATOM   6052 O  O   . SER C 1 167 ? 12.726 46.846  68.657  1.00 22.42  ? 190 SER C O   1 
ATOM   6053 C  CB  . SER C 1 167 ? 12.176 43.898  69.548  1.00 28.79  ? 190 SER C CB  1 
ATOM   6054 O  OG  . SER C 1 167 ? 10.968 43.523  68.923  1.00 32.85  ? 190 SER C OG  1 
ATOM   6055 N  N   . ALA C 1 168 ? 10.524 46.791  69.116  1.00 19.85  ? 191 ALA C N   1 
ATOM   6056 C  CA  . ALA C 1 168 ? 10.209 47.893  68.216  1.00 18.52  ? 191 ALA C CA  1 
ATOM   6057 C  C   . ALA C 1 168 ? 10.438 49.249  68.883  1.00 18.99  ? 191 ALA C C   1 
ATOM   6058 O  O   . ALA C 1 168 ? 10.339 50.296  68.233  1.00 21.72  ? 191 ALA C O   1 
ATOM   6059 C  CB  . ALA C 1 168 ? 8.764  47.775  67.754  1.00 26.64  ? 191 ALA C CB  1 
ATOM   6060 N  N   . SER C 1 169 ? 10.742 49.232  70.180  1.00 17.16  ? 192 SER C N   1 
ATOM   6061 C  CA  . SER C 1 169 ? 10.817 50.477  70.958  1.00 19.06  ? 192 SER C CA  1 
ATOM   6062 C  C   . SER C 1 169 ? 12.237 50.894  71.350  1.00 14.39  ? 192 SER C C   1 
ATOM   6063 O  O   . SER C 1 169 ? 12.427 51.791  72.182  1.00 16.74  ? 192 SER C O   1 
ATOM   6064 C  CB  . SER C 1 169 ? 9.920  50.405  72.197  1.00 18.74  ? 192 SER C CB  1 
ATOM   6065 O  OG  . SER C 1 169 ? 8.553  50.457  71.829  1.00 27.17  ? 192 SER C OG  1 
ATOM   6066 N  N   . ILE C 1 170 ? 13.223 50.241  70.755  1.00 15.67  ? 193 ILE C N   1 
ATOM   6067 C  CA  . ILE C 1 170 ? 14.620 50.630  70.942  1.00 14.52  ? 193 ILE C CA  1 
ATOM   6068 C  C   . ILE C 1 170 ? 15.308 50.753  69.583  1.00 12.10  ? 193 ILE C C   1 
ATOM   6069 O  O   . ILE C 1 170 ? 15.141 49.905  68.713  1.00 14.13  ? 193 ILE C O   1 
ATOM   6070 C  CB  . ILE C 1 170 ? 15.372 49.638  71.884  1.00 15.46  ? 193 ILE C CB  1 
ATOM   6071 C  CG1 . ILE C 1 170 ? 16.857 50.013  72.004  1.00 14.17  ? 193 ILE C CG1 1 
ATOM   6072 C  CG2 . ILE C 1 170 ? 15.237 48.208  71.375  1.00 16.75  ? 193 ILE C CG2 1 
ATOM   6073 C  CD1 . ILE C 1 170 ? 17.628 49.201  73.069  1.00 10.12  ? 193 ILE C CD1 1 
ATOM   6074 N  N   . VAL C 1 171 ? 16.055 51.836  69.395  1.00 10.88  ? 194 VAL C N   1 
ATOM   6075 C  CA  . VAL C 1 171 ? 16.854 52.025  68.191  1.00 12.46  ? 194 VAL C CA  1 
ATOM   6076 C  C   . VAL C 1 171 ? 18.290 52.266  68.597  1.00 9.93   ? 194 VAL C C   1 
ATOM   6077 O  O   . VAL C 1 171 ? 18.548 53.078  69.473  1.00 9.92   ? 194 VAL C O   1 
ATOM   6078 C  CB  . VAL C 1 171 ? 16.361 53.252  67.367  1.00 11.89  ? 194 VAL C CB  1 
ATOM   6079 C  CG1 . VAL C 1 171 ? 17.320 53.551  66.215  1.00 9.65   ? 194 VAL C CG1 1 
ATOM   6080 C  CG2 . VAL C 1 171 ? 14.934 53.019  66.848  1.00 15.27  ? 194 VAL C CG2 1 
ATOM   6081 N  N   . TYR C 1 172 ? 19.215 51.543  67.984  1.00 11.69  ? 195 TYR C N   1 
ATOM   6082 C  CA  . TYR C 1 172 ? 20.634 51.749  68.248  1.00 10.79  ? 195 TYR C CA  1 
ATOM   6083 C  C   . TYR C 1 172 ? 21.217 52.706  67.240  1.00 11.91  ? 195 TYR C C   1 
ATOM   6084 O  O   . TYR C 1 172 ? 20.837 52.689  66.076  1.00 12.70  ? 195 TYR C O   1 
ATOM   6085 C  CB  . TYR C 1 172 ? 21.408 50.453  68.102  1.00 8.01   ? 195 TYR C CB  1 
ATOM   6086 C  CG  . TYR C 1 172 ? 21.138 49.424  69.160  1.00 11.71  ? 195 TYR C CG  1 
ATOM   6087 C  CD1 . TYR C 1 172 ? 21.853 49.425  70.354  1.00 9.36   ? 195 TYR C CD1 1 
ATOM   6088 C  CD2 . TYR C 1 172 ? 20.197 48.424  68.950  1.00 16.78  ? 195 TYR C CD2 1 
ATOM   6089 C  CE1 . TYR C 1 172 ? 21.619 48.457  71.328  1.00 8.25   ? 195 TYR C CE1 1 
ATOM   6090 C  CE2 . TYR C 1 172 ? 19.953 47.458  69.909  1.00 12.86  ? 195 TYR C CE2 1 
ATOM   6091 C  CZ  . TYR C 1 172 ? 20.672 47.476  71.090  1.00 16.62  ? 195 TYR C CZ  1 
ATOM   6092 O  OH  . TYR C 1 172 ? 20.437 46.504  72.033  1.00 13.71  ? 195 TYR C OH  1 
ATOM   6093 N  N   . ILE C 1 173 ? 22.171 53.513  67.690  1.00 9.96   ? 196 ILE C N   1 
ATOM   6094 C  CA  . ILE C 1 173 ? 22.946 54.357  66.802  1.00 5.60   ? 196 ILE C CA  1 
ATOM   6095 C  C   . ILE C 1 173 ? 24.417 54.250  67.154  1.00 9.41   ? 196 ILE C C   1 
ATOM   6096 O  O   . ILE C 1 173 ? 24.796 54.466  68.311  1.00 8.71   ? 196 ILE C O   1 
ATOM   6097 C  CB  . ILE C 1 173 ? 22.530 55.841  66.927  1.00 12.64  ? 196 ILE C CB  1 
ATOM   6098 C  CG1 . ILE C 1 173 ? 21.034 56.008  66.625  1.00 10.06  ? 196 ILE C CG1 1 
ATOM   6099 C  CG2 . ILE C 1 173 ? 23.403 56.735  66.024  1.00 8.99   ? 196 ILE C CG2 1 
ATOM   6100 C  CD1 . ILE C 1 173 ? 20.502 57.412  66.923  1.00 11.66  ? 196 ILE C CD1 1 
ATOM   6101 N  N   . GLY C 1 174 ? 25.243 53.904  66.188  1.00 8.95   ? 197 GLY C N   1 
ATOM   6102 C  CA  . GLY C 1 174 ? 26.655 53.925  66.387  1.00 10.18  ? 197 GLY C CA  1 
ATOM   6103 C  C   . GLY C 1 174 ? 27.358 52.596  66.332  1.00 8.57   ? 197 GLY C C   1 
ATOM   6104 O  O   . GLY C 1 174 ? 28.507 52.543  66.449  1.00 10.61  ? 197 GLY C O   1 
ATOM   6105 N  N   . LEU C 1 175 ? 26.596 51.540  66.138  1.00 10.02  ? 198 LEU C N   1 
ATOM   6106 C  CA  . LEU C 1 175 ? 27.132 50.180  66.273  1.00 8.98   ? 198 LEU C CA  1 
ATOM   6107 C  C   . LEU C 1 175 ? 28.255 49.782  65.321  1.00 12.74  ? 198 LEU C C   1 
ATOM   6108 O  O   . LEU C 1 175 ? 28.141 49.927  64.093  1.00 10.55  ? 198 LEU C O   1 
ATOM   6109 C  CB  . LEU C 1 175 ? 26.040 49.138  66.023  1.00 12.72  ? 198 LEU C CB  1 
ATOM   6110 C  CG  . LEU C 1 175 ? 24.792 49.149  66.900  1.00 11.06  ? 198 LEU C CG  1 
ATOM   6111 C  CD1 . LEU C 1 175 ? 23.948 47.903  66.593  1.00 11.49  ? 198 LEU C CD1 1 
ATOM   6112 C  CD2 . LEU C 1 175 ? 25.169 49.182  68.377  1.00 11.37  ? 198 LEU C CD2 1 
ATOM   6113 N  N   . ARG C 1 176 ? 29.349 49.284  65.894  1.00 9.26   ? 199 ARG C N   1 
ATOM   6114 C  CA  . ARG C 1 176 ? 30.470 48.807  65.087  1.00 10.85  ? 199 ARG C CA  1 
ATOM   6115 C  C   . ARG C 1 176 ? 31.251 47.619  65.648  1.00 10.63  ? 199 ARG C C   1 
ATOM   6116 O  O   . ARG C 1 176 ? 32.230 47.186  65.057  1.00 17.10  ? 199 ARG C O   1 
ATOM   6117 C  CB  . ARG C 1 176 ? 31.410 49.994  64.834  1.00 7.72   ? 199 ARG C CB  1 
ATOM   6118 C  CG  . ARG C 1 176 ? 31.957 50.677  66.106  1.00 10.15  ? 199 ARG C CG  1 
ATOM   6119 C  CD  . ARG C 1 176 ? 32.716 51.945  65.714  1.00 10.29  ? 199 ARG C CD  1 
ATOM   6120 N  NE  . ARG C 1 176 ? 33.357 52.632  66.842  1.00 8.98   ? 199 ARG C NE  1 
ATOM   6121 C  CZ  . ARG C 1 176 ? 32.744 53.452  67.688  1.00 9.44   ? 199 ARG C CZ  1 
ATOM   6122 N  NH1 . ARG C 1 176 ? 33.446 54.038  68.662  1.00 7.37   ? 199 ARG C NH1 1 
ATOM   6123 N  NH2 . ARG C 1 176 ? 31.443 53.703  67.566  1.00 8.48   ? 199 ARG C NH2 1 
ATOM   6124 N  N   . ASP C 1 177 ? 30.814 47.100  66.789  1.00 11.95  ? 200 ASP C N   1 
ATOM   6125 C  CA  . ASP C 1 177 ? 31.510 45.998  67.453  1.00 13.77  ? 200 ASP C CA  1 
ATOM   6126 C  C   . ASP C 1 177 ? 30.426 45.117  68.034  1.00 16.65  ? 200 ASP C C   1 
ATOM   6127 O  O   . ASP C 1 177 ? 30.075 45.229  69.205  1.00 17.41  ? 200 ASP C O   1 
ATOM   6128 C  CB  . ASP C 1 177 ? 32.434 46.554  68.550  1.00 16.11  ? 200 ASP C CB  1 
ATOM   6129 C  CG  . ASP C 1 177 ? 33.312 45.489  69.200  1.00 27.42  ? 200 ASP C CG  1 
ATOM   6130 O  OD1 . ASP C 1 177 ? 33.473 44.395  68.617  1.00 25.49  ? 200 ASP C OD1 1 
ATOM   6131 O  OD2 . ASP C 1 177 ? 33.845 45.761  70.307  1.00 27.25  ? 200 ASP C OD2 1 
ATOM   6132 N  N   . VAL C 1 178 ? 29.879 44.256  67.185  1.00 13.77  ? 201 VAL C N   1 
ATOM   6133 C  CA  . VAL C 1 178 ? 28.718 43.450  67.527  1.00 14.99  ? 201 VAL C CA  1 
ATOM   6134 C  C   . VAL C 1 178 ? 29.107 41.977  67.513  1.00 15.38  ? 201 VAL C C   1 
ATOM   6135 O  O   . VAL C 1 178 ? 29.685 41.517  66.533  1.00 16.18  ? 201 VAL C O   1 
ATOM   6136 C  CB  . VAL C 1 178 ? 27.595 43.704  66.503  1.00 16.93  ? 201 VAL C CB  1 
ATOM   6137 C  CG1 . VAL C 1 178 ? 26.387 42.825  66.788  1.00 19.47  ? 201 VAL C CG1 1 
ATOM   6138 C  CG2 . VAL C 1 178 ? 27.227 45.189  66.502  1.00 17.19  ? 201 VAL C CG2 1 
ATOM   6139 N  N   . ASP C 1 179 ? 28.828 41.250  68.599  1.00 15.71  ? 202 ASP C N   1 
ATOM   6140 C  CA  . ASP C 1 179 ? 29.156 39.819  68.657  1.00 17.03  ? 202 ASP C CA  1 
ATOM   6141 C  C   . ASP C 1 179 ? 28.195 39.052  67.768  1.00 16.23  ? 202 ASP C C   1 
ATOM   6142 O  O   . ASP C 1 179 ? 27.059 39.478  67.600  1.00 12.43  ? 202 ASP C O   1 
ATOM   6143 C  CB  . ASP C 1 179 ? 29.036 39.272  70.082  1.00 13.75  ? 202 ASP C CB  1 
ATOM   6144 C  CG  . ASP C 1 179 ? 29.904 40.017  71.072  1.00 25.22  ? 202 ASP C CG  1 
ATOM   6145 O  OD1 . ASP C 1 179 ? 30.891 40.625  70.638  1.00 24.36  ? 202 ASP C OD1 1 
ATOM   6146 O  OD2 . ASP C 1 179 ? 29.608 39.979  72.286  1.00 20.26  ? 202 ASP C OD2 1 
ATOM   6147 N  N   . PRO C 1 180 ? 28.633 37.902  67.220  1.00 20.07  ? 203 PRO C N   1 
ATOM   6148 C  CA  . PRO C 1 180 ? 27.717 37.151  66.350  1.00 20.84  ? 203 PRO C CA  1 
ATOM   6149 C  C   . PRO C 1 180 ? 26.353 36.811  66.976  1.00 15.27  ? 203 PRO C C   1 
ATOM   6150 O  O   . PRO C 1 180 ? 25.345 37.011  66.290  1.00 20.29  ? 203 PRO C O   1 
ATOM   6151 C  CB  . PRO C 1 180 ? 28.516 35.884  65.999  1.00 18.30  ? 203 PRO C CB  1 
ATOM   6152 C  CG  . PRO C 1 180 ? 29.951 36.327  66.086  1.00 27.43  ? 203 PRO C CG  1 
ATOM   6153 C  CD  . PRO C 1 180 ? 29.990 37.318  67.229  1.00 22.79  ? 203 PRO C CD  1 
ATOM   6154 N  N   . PRO C 1 181 ? 26.303 36.341  68.239  1.00 15.99  ? 204 PRO C N   1 
ATOM   6155 C  CA  . PRO C 1 181 ? 24.952 36.101  68.770  1.00 18.91  ? 204 PRO C CA  1 
ATOM   6156 C  C   . PRO C 1 181 ? 24.098 37.366  68.875  1.00 22.49  ? 204 PRO C C   1 
ATOM   6157 O  O   . PRO C 1 181 ? 22.867 37.296  68.806  1.00 12.61  ? 204 PRO C O   1 
ATOM   6158 C  CB  . PRO C 1 181 ? 25.202 35.518  70.166  1.00 19.84  ? 204 PRO C CB  1 
ATOM   6159 C  CG  . PRO C 1 181 ? 26.649 35.702  70.457  1.00 25.06  ? 204 PRO C CG  1 
ATOM   6160 C  CD  . PRO C 1 181 ? 27.363 35.881  69.163  1.00 16.83  ? 204 PRO C CD  1 
ATOM   6161 N  N   . GLU C 1 182 ? 24.737 38.510  69.082  1.00 12.56  ? 205 GLU C N   1 
ATOM   6162 C  CA  . GLU C 1 182 ? 24.010 39.766  69.100  1.00 12.15  ? 205 GLU C CA  1 
ATOM   6163 C  C   . GLU C 1 182 ? 23.449 40.092  67.719  1.00 15.09  ? 205 GLU C C   1 
ATOM   6164 O  O   . GLU C 1 182 ? 22.319 40.554  67.600  1.00 17.40  ? 205 GLU C O   1 
ATOM   6165 C  CB  . GLU C 1 182 ? 24.919 40.907  69.555  1.00 15.11  ? 205 GLU C CB  1 
ATOM   6166 C  CG  . GLU C 1 182 ? 25.365 40.811  71.001  1.00 13.72  ? 205 GLU C CG  1 
ATOM   6167 C  CD  . GLU C 1 182 ? 26.221 41.994  71.384  1.00 12.88  ? 205 GLU C CD  1 
ATOM   6168 O  OE1 . GLU C 1 182 ? 27.298 42.158  70.775  1.00 15.08  ? 205 GLU C OE1 1 
ATOM   6169 O  OE2 . GLU C 1 182 ? 25.796 42.770  72.261  1.00 10.17  ? 205 GLU C OE2 1 
ATOM   6170 N  N   . HIS C 1 183 ? 24.253 39.875  66.681  1.00 13.27  ? 206 HIS C N   1 
ATOM   6171 C  CA  . HIS C 1 183 ? 23.779 40.130  65.324  1.00 17.69  ? 206 HIS C CA  1 
ATOM   6172 C  C   . HIS C 1 183 ? 22.574 39.243  65.023  1.00 21.36  ? 206 HIS C C   1 
ATOM   6173 O  O   . HIS C 1 183 ? 21.607 39.680  64.400  1.00 18.99  ? 206 HIS C O   1 
ATOM   6174 C  CB  . HIS C 1 183 ? 24.871 39.896  64.291  1.00 18.62  ? 206 HIS C CB  1 
ATOM   6175 C  CG  . HIS C 1 183 ? 24.426 40.167  62.882  1.00 30.08  ? 206 HIS C CG  1 
ATOM   6176 N  ND1 . HIS C 1 183 ? 23.934 39.183  62.057  1.00 32.52  ? 206 HIS C ND1 1 
ATOM   6177 C  CD2 . HIS C 1 183 ? 24.398 41.318  62.170  1.00 31.06  ? 206 HIS C CD2 1 
ATOM   6178 C  CE1 . HIS C 1 183 ? 23.625 39.717  60.882  1.00 32.76  ? 206 HIS C CE1 1 
ATOM   6179 N  NE2 . HIS C 1 183 ? 23.897 41.001  60.925  1.00 34.52  ? 206 HIS C NE2 1 
ATOM   6180 N  N   . PHE C 1 184 ? 22.645 37.993  65.463  1.00 18.80  ? 207 PHE C N   1 
ATOM   6181 C  CA  . PHE C 1 184 ? 21.522 37.084  65.313  1.00 20.00  ? 207 PHE C CA  1 
ATOM   6182 C  C   . PHE C 1 184 ? 20.296 37.649  65.998  1.00 22.40  ? 207 PHE C C   1 
ATOM   6183 O  O   . PHE C 1 184 ? 19.201 37.646  65.439  1.00 19.65  ? 207 PHE C O   1 
ATOM   6184 C  CB  . PHE C 1 184 ? 21.840 35.712  65.895  1.00 21.59  ? 207 PHE C CB  1 
ATOM   6185 C  CG  . PHE C 1 184 ? 20.665 34.772  65.874  1.00 29.20  ? 207 PHE C CG  1 
ATOM   6186 C  CD1 . PHE C 1 184 ? 20.412 33.980  64.764  1.00 39.31  ? 207 PHE C CD1 1 
ATOM   6187 C  CD2 . PHE C 1 184 ? 19.805 34.689  66.965  1.00 23.32  ? 207 PHE C CD2 1 
ATOM   6188 C  CE1 . PHE C 1 184 ? 19.321 33.114  64.740  1.00 36.22  ? 207 PHE C CE1 1 
ATOM   6189 C  CE2 . PHE C 1 184 ? 18.711 33.832  66.950  1.00 41.40  ? 207 PHE C CE2 1 
ATOM   6190 C  CZ  . PHE C 1 184 ? 18.470 33.045  65.834  1.00 35.72  ? 207 PHE C CZ  1 
ATOM   6191 N  N   . ILE C 1 185 ? 20.481 38.121  67.224  1.00 16.03  ? 208 ILE C N   1 
ATOM   6192 C  CA  . ILE C 1 185 ? 19.370 38.660  67.989  1.00 15.11  ? 208 ILE C CA  1 
ATOM   6193 C  C   . ILE C 1 185 ? 18.783 39.874  67.277  1.00 22.72  ? 208 ILE C C   1 
ATOM   6194 O  O   . ILE C 1 185 ? 17.561 39.994  67.134  1.00 19.18  ? 208 ILE C O   1 
ATOM   6195 C  CB  . ILE C 1 185 ? 19.797 39.009  69.438  1.00 17.47  ? 208 ILE C CB  1 
ATOM   6196 C  CG1 . ILE C 1 185 ? 20.013 37.724  70.248  1.00 20.14  ? 208 ILE C CG1 1 
ATOM   6197 C  CG2 . ILE C 1 185 ? 18.755 39.888  70.123  1.00 15.07  ? 208 ILE C CG2 1 
ATOM   6198 C  CD1 . ILE C 1 185 ? 20.707 37.949  71.580  1.00 16.21  ? 208 ILE C CD1 1 
ATOM   6199 N  N   . LEU C 1 186 ? 19.655 40.772  66.825  1.00 15.35  ? 209 LEU C N   1 
ATOM   6200 C  CA  . LEU C 1 186 ? 19.196 41.975  66.146  1.00 18.36  ? 209 LEU C CA  1 
ATOM   6201 C  C   . LEU C 1 186 ? 18.383 41.643  64.899  1.00 21.57  ? 209 LEU C C   1 
ATOM   6202 O  O   . LEU C 1 186 ? 17.319 42.221  64.687  1.00 22.49  ? 209 LEU C O   1 
ATOM   6203 C  CB  . LEU C 1 186 ? 20.369 42.872  65.782  1.00 18.05  ? 209 LEU C CB  1 
ATOM   6204 C  CG  . LEU C 1 186 ? 21.124 43.439  66.985  1.00 16.48  ? 209 LEU C CG  1 
ATOM   6205 C  CD1 . LEU C 1 186 ? 22.353 44.205  66.513  1.00 15.97  ? 209 LEU C CD1 1 
ATOM   6206 C  CD2 . LEU C 1 186 ? 20.202 44.327  67.808  1.00 17.42  ? 209 LEU C CD2 1 
ATOM   6207 N  N   . LYS C 1 187 ? 18.858 40.700  64.096  1.00 18.34  ? 210 LYS C N   1 
ATOM   6208 C  CA  . LYS C 1 187 ? 18.130 40.320  62.888  1.00 22.33  ? 210 LYS C CA  1 
ATOM   6209 C  C   . LYS C 1 187 ? 16.861 39.538  63.210  1.00 29.57  ? 210 LYS C C   1 
ATOM   6210 O  O   . LYS C 1 187 ? 15.787 39.854  62.702  1.00 29.53  ? 210 LYS C O   1 
ATOM   6211 C  CB  . LYS C 1 187 ? 19.027 39.522  61.938  1.00 23.63  ? 210 LYS C CB  1 
ATOM   6212 C  CG  . LYS C 1 187 ? 20.123 40.355  61.292  1.00 35.66  ? 210 LYS C CG  1 
ATOM   6213 C  CD  . LYS C 1 187 ? 19.535 41.594  60.622  1.00 36.57  ? 210 LYS C CD  1 
ATOM   6214 C  CE  . LYS C 1 187 ? 20.593 42.397  59.868  1.00 45.99  ? 210 LYS C CE  1 
ATOM   6215 N  NZ  . LYS C 1 187 ? 20.024 43.645  59.271  1.00 50.47  ? 210 LYS C NZ  1 
ATOM   6216 N  N   . ASN C 1 188 ? 16.986 38.544  64.085  1.00 21.53  ? 211 ASN C N   1 
ATOM   6217 C  CA  . ASN C 1 188 ? 15.876 37.650  64.406  1.00 28.49  ? 211 ASN C CA  1 
ATOM   6218 C  C   . ASN C 1 188 ? 14.680 38.354  65.040  1.00 31.15  ? 211 ASN C C   1 
ATOM   6219 O  O   . ASN C 1 188 ? 13.536 37.962  64.817  1.00 24.35  ? 211 ASN C O   1 
ATOM   6220 C  CB  . ASN C 1 188 ? 16.352 36.532  65.343  1.00 27.07  ? 211 ASN C CB  1 
ATOM   6221 C  CG  . ASN C 1 188 ? 15.269 35.503  65.629  1.00 45.05  ? 211 ASN C CG  1 
ATOM   6222 O  OD1 . ASN C 1 188 ? 14.927 34.692  64.768  1.00 51.49  ? 211 ASN C OD1 1 
ATOM   6223 N  ND2 . ASN C 1 188 ? 14.715 35.543  66.837  1.00 44.38  ? 211 ASN C ND2 1 
ATOM   6224 N  N   . TYR C 1 189 ? 14.938 39.376  65.849  1.00 21.85  ? 212 TYR C N   1 
ATOM   6225 C  CA  . TYR C 1 189 ? 13.852 40.086  66.519  1.00 17.16  ? 212 TYR C CA  1 
ATOM   6226 C  C   . TYR C 1 189 ? 13.520 41.420  65.836  1.00 15.94  ? 212 TYR C C   1 
ATOM   6227 O  O   . TYR C 1 189 ? 12.723 42.211  66.344  1.00 23.76  ? 212 TYR C O   1 
ATOM   6228 C  CB  . TYR C 1 189 ? 14.174 40.278  68.008  1.00 22.64  ? 212 TYR C CB  1 
ATOM   6229 C  CG  . TYR C 1 189 ? 14.295 38.973  68.768  1.00 20.76  ? 212 TYR C CG  1 
ATOM   6230 C  CD1 . TYR C 1 189 ? 15.486 38.247  68.759  1.00 27.85  ? 212 TYR C CD1 1 
ATOM   6231 C  CD2 . TYR C 1 189 ? 13.213 38.454  69.473  1.00 26.54  ? 212 TYR C CD2 1 
ATOM   6232 C  CE1 . TYR C 1 189 ? 15.601 37.045  69.447  1.00 28.85  ? 212 TYR C CE1 1 
ATOM   6233 C  CE2 . TYR C 1 189 ? 13.316 37.250  70.163  1.00 26.85  ? 212 TYR C CE2 1 
ATOM   6234 C  CZ  . TYR C 1 189 ? 14.510 36.553  70.147  1.00 32.13  ? 212 TYR C CZ  1 
ATOM   6235 O  OH  . TYR C 1 189 ? 14.614 35.362  70.828  1.00 31.47  ? 212 TYR C OH  1 
ATOM   6236 N  N   . ASP C 1 190 ? 14.164 41.652  64.694  1.00 17.47  ? 213 ASP C N   1 
ATOM   6237 C  CA  . ASP C 1 190 ? 13.962 42.851  63.871  1.00 26.49  ? 213 ASP C CA  1 
ATOM   6238 C  C   . ASP C 1 190 ? 14.139 44.150  64.670  1.00 31.62  ? 213 ASP C C   1 
ATOM   6239 O  O   . ASP C 1 190 ? 13.354 45.093  64.556  1.00 22.17  ? 213 ASP C O   1 
ATOM   6240 C  CB  . ASP C 1 190 ? 12.614 42.806  63.134  1.00 28.04  ? 213 ASP C CB  1 
ATOM   6241 C  CG  . ASP C 1 190 ? 12.625 43.629  61.842  1.00 45.08  ? 213 ASP C CG  1 
ATOM   6242 O  OD1 . ASP C 1 190 ? 13.689 43.713  61.184  1.00 45.39  ? 213 ASP C OD1 1 
ATOM   6243 O  OD2 . ASP C 1 190 ? 11.563 44.175  61.471  1.00 60.13  ? 213 ASP C OD2 1 
ATOM   6244 N  N   . ILE C 1 191 ? 15.190 44.193  65.478  1.00 22.81  ? 214 ILE C N   1 
ATOM   6245 C  CA  . ILE C 1 191 ? 15.526 45.403  66.220  1.00 16.05  ? 214 ILE C CA  1 
ATOM   6246 C  C   . ILE C 1 191 ? 16.222 46.354  65.261  1.00 13.89  ? 214 ILE C C   1 
ATOM   6247 O  O   . ILE C 1 191 ? 17.124 45.954  64.528  1.00 18.70  ? 214 ILE C O   1 
ATOM   6248 C  CB  . ILE C 1 191 ? 16.424 45.077  67.433  1.00 20.23  ? 214 ILE C CB  1 
ATOM   6249 C  CG1 . ILE C 1 191 ? 15.651 44.186  68.407  1.00 22.88  ? 214 ILE C CG1 1 
ATOM   6250 C  CG2 . ILE C 1 191 ? 16.886 46.356  68.153  1.00 15.17  ? 214 ILE C CG2 1 
ATOM   6251 C  CD1 . ILE C 1 191 ? 16.520 43.467  69.402  1.00 25.32  ? 214 ILE C CD1 1 
ATOM   6252 N  N   . GLN C 1 192 ? 15.765 47.599  65.226  1.00 14.50  ? 215 GLN C N   1 
ATOM   6253 C  CA  . GLN C 1 192 ? 16.298 48.575  64.281  1.00 17.12  ? 215 GLN C CA  1 
ATOM   6254 C  C   . GLN C 1 192 ? 17.569 49.233  64.807  1.00 19.53  ? 215 GLN C C   1 
ATOM   6255 O  O   . GLN C 1 192 ? 17.646 49.646  65.972  1.00 13.81  ? 215 GLN C O   1 
ATOM   6256 C  CB  . GLN C 1 192 ? 15.242 49.634  63.961  1.00 18.90  ? 215 GLN C CB  1 
ATOM   6257 C  CG  . GLN C 1 192 ? 13.967 49.053  63.353  1.00 22.50  ? 215 GLN C CG  1 
ATOM   6258 C  CD  . GLN C 1 192 ? 14.242 48.303  62.063  1.00 27.57  ? 215 GLN C CD  1 
ATOM   6259 O  OE1 . GLN C 1 192 ? 14.692 48.885  61.077  1.00 27.31  ? 215 GLN C OE1 1 
ATOM   6260 N  NE2 . GLN C 1 192 ? 14.007 46.996  62.078  1.00 33.26  ? 215 GLN C NE2 1 
ATOM   6261 N  N   . TYR C 1 193 ? 18.559 49.343  63.937  1.00 16.12  ? 216 TYR C N   1 
ATOM   6262 C  CA  . TYR C 1 193 ? 19.816 49.963  64.318  1.00 18.66  ? 216 TYR C CA  1 
ATOM   6263 C  C   . TYR C 1 193 ? 20.430 50.714  63.158  1.00 16.81  ? 216 TYR C C   1 
ATOM   6264 O  O   . TYR C 1 193 ? 20.188 50.391  62.005  1.00 15.85  ? 216 TYR C O   1 
ATOM   6265 C  CB  . TYR C 1 193 ? 20.803 48.918  64.854  1.00 13.17  ? 216 TYR C CB  1 
ATOM   6266 C  CG  . TYR C 1 193 ? 21.213 47.848  63.864  1.00 17.54  ? 216 TYR C CG  1 
ATOM   6267 C  CD1 . TYR C 1 193 ? 22.332 48.011  63.052  1.00 15.71  ? 216 TYR C CD1 1 
ATOM   6268 C  CD2 . TYR C 1 193 ? 20.486 46.671  63.749  1.00 18.92  ? 216 TYR C CD2 1 
ATOM   6269 C  CE1 . TYR C 1 193 ? 22.716 47.037  62.157  1.00 25.07  ? 216 TYR C CE1 1 
ATOM   6270 C  CE2 . TYR C 1 193 ? 20.861 45.687  62.853  1.00 18.25  ? 216 TYR C CE2 1 
ATOM   6271 C  CZ  . TYR C 1 193 ? 21.977 45.878  62.060  1.00 31.43  ? 216 TYR C CZ  1 
ATOM   6272 O  OH  . TYR C 1 193 ? 22.364 44.909  61.165  1.00 33.05  ? 216 TYR C OH  1 
ATOM   6273 N  N   . PHE C 1 194 ? 21.214 51.732  63.482  1.00 11.99  ? 217 PHE C N   1 
ATOM   6274 C  CA  . PHE C 1 194 ? 21.994 52.451  62.496  1.00 10.46  ? 217 PHE C CA  1 
ATOM   6275 C  C   . PHE C 1 194 ? 23.440 52.317  62.884  1.00 16.79  ? 217 PHE C C   1 
ATOM   6276 O  O   . PHE C 1 194 ? 23.915 52.998  63.791  1.00 12.66  ? 217 PHE C O   1 
ATOM   6277 C  CB  . PHE C 1 194 ? 21.555 53.914  62.448  1.00 13.89  ? 217 PHE C CB  1 
ATOM   6278 C  CG  . PHE C 1 194 ? 20.125 54.083  62.024  1.00 12.68  ? 217 PHE C CG  1 
ATOM   6279 C  CD1 . PHE C 1 194 ? 19.103 54.103  62.966  1.00 12.81  ? 217 PHE C CD1 1 
ATOM   6280 C  CD2 . PHE C 1 194 ? 19.798 54.150  60.674  1.00 16.60  ? 217 PHE C CD2 1 
ATOM   6281 C  CE1 . PHE C 1 194 ? 17.771 54.227  62.569  1.00 15.83  ? 217 PHE C CE1 1 
ATOM   6282 C  CE2 . PHE C 1 194 ? 18.472 54.281  60.269  1.00 18.60  ? 217 PHE C CE2 1 
ATOM   6283 C  CZ  . PHE C 1 194 ? 17.458 54.323  61.222  1.00 18.80  ? 217 PHE C CZ  1 
ATOM   6284 N  N   . SER C 1 195 ? 24.130 51.405  62.214  1.00 10.44  ? 218 SER C N   1 
ATOM   6285 C  CA  . SER C 1 195 ? 25.533 51.167  62.494  1.00 11.38  ? 218 SER C CA  1 
ATOM   6286 C  C   . SER C 1 195 ? 26.337 52.325  61.937  1.00 10.34  ? 218 SER C C   1 
ATOM   6287 O  O   . SER C 1 195 ? 25.788 53.185  61.236  1.00 11.24  ? 218 SER C O   1 
ATOM   6288 C  CB  . SER C 1 195 ? 25.981 49.883  61.812  1.00 14.57  ? 218 SER C CB  1 
ATOM   6289 O  OG  . SER C 1 195 ? 26.089 50.101  60.420  1.00 12.65  ? 218 SER C OG  1 
ATOM   6290 N  N   . MET C 1 196 ? 27.635 52.349  62.223  1.00 9.47   ? 219 MET C N   1 
ATOM   6291 C  CA  . MET C 1 196 ? 28.508 53.372  61.646  1.00 9.25   ? 219 MET C CA  1 
ATOM   6292 C  C   . MET C 1 196 ? 28.450 53.357  60.116  1.00 11.24  ? 219 MET C C   1 
ATOM   6293 O  O   . MET C 1 196 ? 28.540 54.403  59.468  1.00 9.99   ? 219 MET C O   1 
ATOM   6294 C  CB  . MET C 1 196 ? 29.952 53.192  62.118  1.00 8.78   ? 219 MET C CB  1 
ATOM   6295 C  CG  . MET C 1 196 ? 30.151 53.383  63.627  1.00 5.31   ? 219 MET C CG  1 
ATOM   6296 S  SD  . MET C 1 196 ? 29.548 54.953  64.254  1.00 10.60  ? 219 MET C SD  1 
ATOM   6297 C  CE  . MET C 1 196 ? 30.396 56.061  63.126  1.00 9.29   ? 219 MET C CE  1 
ATOM   6298 N  N   . ARG C 1 197 ? 28.314 52.163  59.544  1.00 10.85  ? 220 ARG C N   1 
ATOM   6299 C  CA  . ARG C 1 197 ? 28.136 52.017  58.103  1.00 10.96  ? 220 ARG C CA  1 
ATOM   6300 C  C   . ARG C 1 197 ? 26.864 52.736  57.626  1.00 8.75   ? 220 ARG C C   1 
ATOM   6301 O  O   . ARG C 1 197 ? 26.879 53.442  56.607  1.00 9.22   ? 220 ARG C O   1 
ATOM   6302 C  CB  . ARG C 1 197 ? 28.134 50.524  57.718  1.00 13.83  ? 220 ARG C CB  1 
ATOM   6303 C  CG  . ARG C 1 197 ? 27.855 50.280  56.242  1.00 16.12  ? 220 ARG C CG  1 
ATOM   6304 C  CD  . ARG C 1 197 ? 27.857 48.806  55.855  1.00 14.22  ? 220 ARG C CD  1 
ATOM   6305 N  NE  . ARG C 1 197 ? 27.109 48.658  54.605  1.00 15.99  ? 220 ARG C NE  1 
ATOM   6306 C  CZ  . ARG C 1 197 ? 27.642 48.745  53.395  1.00 15.87  ? 220 ARG C CZ  1 
ATOM   6307 N  NH1 . ARG C 1 197 ? 28.950 48.914  53.256  1.00 14.69  ? 220 ARG C NH1 1 
ATOM   6308 N  NH2 . ARG C 1 197 ? 26.866 48.629  52.321  1.00 17.20  ? 220 ARG C NH2 1 
ATOM   6309 N  N   . ASP C 1 198 ? 25.762 52.568  58.355  1.00 9.25   ? 221 ASP C N   1 
ATOM   6310 C  CA  . ASP C 1 198 ? 24.528 53.279  58.019  1.00 9.61   ? 221 ASP C CA  1 
ATOM   6311 C  C   . ASP C 1 198 ? 24.699 54.804  58.101  1.00 14.83  ? 221 ASP C C   1 
ATOM   6312 O  O   . ASP C 1 198 ? 24.138 55.561  57.297  1.00 11.33  ? 221 ASP C O   1 
ATOM   6313 C  CB  . ASP C 1 198 ? 23.387 52.823  58.932  1.00 9.01   ? 221 ASP C CB  1 
ATOM   6314 C  CG  . ASP C 1 198 ? 23.014 51.376  58.705  1.00 18.19  ? 221 ASP C CG  1 
ATOM   6315 O  OD1 . ASP C 1 198 ? 22.884 50.991  57.523  1.00 17.84  ? 221 ASP C OD1 1 
ATOM   6316 O  OD2 . ASP C 1 198 ? 22.889 50.625  59.700  1.00 15.87  ? 221 ASP C OD2 1 
ATOM   6317 N  N   . ILE C 1 199 ? 25.455 55.261  59.090  1.00 10.11  ? 222 ILE C N   1 
ATOM   6318 C  CA  . ILE C 1 199 ? 25.727 56.693  59.212  1.00 10.33  ? 222 ILE C CA  1 
ATOM   6319 C  C   . ILE C 1 199 ? 26.571 57.194  58.033  1.00 9.00   ? 222 ILE C C   1 
ATOM   6320 O  O   . ILE C 1 199 ? 26.326 58.287  57.502  1.00 12.63  ? 222 ILE C O   1 
ATOM   6321 C  CB  . ILE C 1 199 ? 26.398 57.032  60.570  1.00 9.71   ? 222 ILE C CB  1 
ATOM   6322 C  CG1 . ILE C 1 199 ? 25.480 56.642  61.731  1.00 9.88   ? 222 ILE C CG1 1 
ATOM   6323 C  CG2 . ILE C 1 199 ? 26.728 58.521  60.650  1.00 8.16   ? 222 ILE C CG2 1 
ATOM   6324 C  CD1 . ILE C 1 199 ? 26.178 56.712  63.124  1.00 9.65   ? 222 ILE C CD1 1 
ATOM   6325 N  N   . ASP C 1 200 ? 27.561 56.404  57.628  1.00 9.07   ? 223 ASP C N   1 
ATOM   6326 C  CA  . ASP C 1 200 ? 28.385 56.729  56.464  1.00 12.02  ? 223 ASP C CA  1 
ATOM   6327 C  C   . ASP C 1 200 ? 27.529 56.921  55.211  1.00 12.56  ? 223 ASP C C   1 
ATOM   6328 O  O   . ASP C 1 200 ? 27.834 57.761  54.355  1.00 12.09  ? 223 ASP C O   1 
ATOM   6329 C  CB  . ASP C 1 200 ? 29.402 55.613  56.186  1.00 12.82  ? 223 ASP C CB  1 
ATOM   6330 C  CG  . ASP C 1 200 ? 30.478 55.508  57.251  1.00 13.82  ? 223 ASP C CG  1 
ATOM   6331 O  OD1 . ASP C 1 200 ? 30.756 56.518  57.935  1.00 11.39  ? 223 ASP C OD1 1 
ATOM   6332 O  OD2 . ASP C 1 200 ? 31.037 54.400  57.403  1.00 11.01  ? 223 ASP C OD2 1 
ATOM   6333 N  N   . ARG C 1 201 ? 26.477 56.114  55.106  1.00 11.81  ? 224 ARG C N   1 
ATOM   6334 C  CA  . ARG C 1 201 ? 25.587 56.114  53.938  1.00 10.47  ? 224 ARG C CA  1 
ATOM   6335 C  C   . ARG C 1 201 ? 24.547 57.223  54.004  1.00 12.85  ? 224 ARG C C   1 
ATOM   6336 O  O   . ARG C 1 201 ? 24.386 58.012  53.064  1.00 17.54  ? 224 ARG C O   1 
ATOM   6337 C  CB  . ARG C 1 201 ? 24.868 54.752  53.834  1.00 12.01  ? 224 ARG C CB  1 
ATOM   6338 C  CG  . ARG C 1 201 ? 25.794 53.597  53.465  1.00 15.76  ? 224 ARG C CG  1 
ATOM   6339 C  CD  . ARG C 1 201 ? 25.110 52.231  53.588  1.00 22.05  ? 224 ARG C CD  1 
ATOM   6340 N  NE  . ARG C 1 201 ? 23.861 52.158  52.828  1.00 22.05  ? 224 ARG C NE  1 
ATOM   6341 C  CZ  . ARG C 1 201 ? 23.779 51.834  51.536  1.00 30.65  ? 224 ARG C CZ  1 
ATOM   6342 N  NH1 . ARG C 1 201 ? 24.875 51.537  50.841  1.00 23.98  ? 224 ARG C NH1 1 
ATOM   6343 N  NH2 . ARG C 1 201 ? 22.593 51.789  50.941  1.00 28.48  ? 224 ARG C NH2 1 
ATOM   6344 N  N   . LEU C 1 202 ? 23.847 57.297  55.128  1.00 10.51  ? 225 LEU C N   1 
ATOM   6345 C  CA  . LEU C 1 202 ? 22.701 58.197  55.248  1.00 10.68  ? 225 LEU C CA  1 
ATOM   6346 C  C   . LEU C 1 202 ? 23.080 59.606  55.692  1.00 16.52  ? 225 LEU C C   1 
ATOM   6347 O  O   . LEU C 1 202 ? 22.406 60.581  55.347  1.00 12.44  ? 225 LEU C O   1 
ATOM   6348 C  CB  . LEU C 1 202 ? 21.695 57.622  56.240  1.00 10.01  ? 225 LEU C CB  1 
ATOM   6349 C  CG  . LEU C 1 202 ? 21.006 56.306  55.857  1.00 15.92  ? 225 LEU C CG  1 
ATOM   6350 C  CD1 . LEU C 1 202 ? 20.240 55.750  57.046  1.00 15.73  ? 225 LEU C CD1 1 
ATOM   6351 C  CD2 . LEU C 1 202 ? 20.064 56.533  54.674  1.00 25.89  ? 225 LEU C CD2 1 
ATOM   6352 N  N   . GLY C 1 203 ? 24.143 59.710  56.481  1.00 9.92   ? 226 GLY C N   1 
ATOM   6353 C  CA  . GLY C 1 203 ? 24.410 60.943  57.203  1.00 9.56   ? 226 GLY C CA  1 
ATOM   6354 C  C   . GLY C 1 203 ? 23.585 60.996  58.480  1.00 10.84  ? 226 GLY C C   1 
ATOM   6355 O  O   . GLY C 1 203 ? 22.469 60.452  58.561  1.00 10.60  ? 226 GLY C O   1 
ATOM   6356 N  N   . ILE C 1 204 ? 24.121 61.659  59.497  1.00 9.01   ? 227 ILE C N   1 
ATOM   6357 C  CA  . ILE C 1 204 ? 23.481 61.652  60.809  1.00 8.55   ? 227 ILE C CA  1 
ATOM   6358 C  C   . ILE C 1 204 ? 22.108 62.348  60.847  1.00 11.55  ? 227 ILE C C   1 
ATOM   6359 O  O   . ILE C 1 204 ? 21.245 61.958  61.637  1.00 10.72  ? 227 ILE C O   1 
ATOM   6360 C  CB  . ILE C 1 204 ? 24.465 62.180  61.908  1.00 12.93  ? 227 ILE C CB  1 
ATOM   6361 C  CG1 . ILE C 1 204 ? 23.991 61.786  63.309  1.00 12.62  ? 227 ILE C CG1 1 
ATOM   6362 C  CG2 . ILE C 1 204 ? 24.689 63.682  61.771  1.00 11.97  ? 227 ILE C CG2 1 
ATOM   6363 C  CD1 . ILE C 1 204 ? 24.088 60.266  63.576  1.00 13.11  ? 227 ILE C CD1 1 
ATOM   6364 N  N   . GLN C 1 205 ? 21.864 63.311  59.968  1.00 12.63  ? 228 GLN C N   1 
ATOM   6365 C  CA  . GLN C 1 205 ? 20.554 63.960  59.927  1.00 14.35  ? 228 GLN C CA  1 
ATOM   6366 C  C   . GLN C 1 205 ? 19.467 62.946  59.586  1.00 10.47  ? 228 GLN C C   1 
ATOM   6367 O  O   . GLN C 1 205 ? 18.499 62.818  60.281  1.00 12.78  ? 228 GLN C O   1 
ATOM   6368 C  CB  . GLN C 1 205 ? 20.445 65.080  58.902  1.00 17.16  ? 228 GLN C CB  1 
ATOM   6369 C  CG  . GLN C 1 205 ? 18.984 65.506  58.622  1.00 15.61  ? 228 GLN C CG  1 
ATOM   6370 C  CD  . GLN C 1 205 ? 18.892 66.549  57.525  1.00 36.30  ? 228 GLN C CD  1 
ATOM   6371 O  OE1 . GLN C 1 205 ? 19.903 67.046  57.054  1.00 29.39  ? 228 GLN C OE1 1 
ATOM   6372 N  NE2 . GLN C 1 205 ? 17.684 66.965  57.205  1.00 37.23  ? 228 GLN C NE2 1 
ATOM   6373 N  N   . LYS C 1 206 ? 19.684 62.208  58.517  1.00 11.90  ? 229 LYS C N   1 
ATOM   6374 C  CA  . LYS C 1 206 ? 18.721 61.186  58.117  1.00 13.91  ? 229 LYS C CA  1 
ATOM   6375 C  C   . LYS C 1 206 ? 18.614 60.061  59.147  1.00 13.30  ? 229 LYS C C   1 
ATOM   6376 O  O   . LYS C 1 206 ? 17.526 59.541  59.396  1.00 13.09  ? 229 LYS C O   1 
ATOM   6377 C  CB  . LYS C 1 206 ? 19.041 60.625  56.730  1.00 14.03  ? 229 LYS C CB  1 
ATOM   6378 C  CG  . LYS C 1 206 ? 18.703 61.580  55.593  1.00 27.29  ? 229 LYS C CG  1 
ATOM   6379 C  CD  . LYS C 1 206 ? 18.544 60.820  54.287  1.00 34.98  ? 229 LYS C CD  1 
ATOM   6380 C  CE  . LYS C 1 206 ? 18.248 61.767  53.135  1.00 50.53  ? 229 LYS C CE  1 
ATOM   6381 N  NZ  . LYS C 1 206 ? 19.471 62.515  52.733  1.00 35.44  ? 229 LYS C NZ  1 
ATOM   6382 N  N   . VAL C 1 207 ? 19.735 59.689  59.760  1.00 12.38  ? 230 VAL C N   1 
ATOM   6383 C  CA  . VAL C 1 207 ? 19.679 58.680  60.820  1.00 10.47  ? 230 VAL C CA  1 
ATOM   6384 C  C   . VAL C 1 207 ? 18.744 59.138  61.938  1.00 9.49   ? 230 VAL C C   1 
ATOM   6385 O  O   . VAL C 1 207 ? 17.893 58.371  62.393  1.00 12.30  ? 230 VAL C O   1 
ATOM   6386 C  CB  . VAL C 1 207 ? 21.096 58.325  61.364  1.00 12.01  ? 230 VAL C CB  1 
ATOM   6387 C  CG1 . VAL C 1 207 ? 21.001 57.580  62.705  1.00 11.54  ? 230 VAL C CG1 1 
ATOM   6388 C  CG2 . VAL C 1 207 ? 21.863 57.499  60.339  1.00 11.26  ? 230 VAL C CG2 1 
ATOM   6389 N  N   . MET C 1 208 ? 18.857 60.393  62.358  1.00 11.15  ? 231 MET C N   1 
ATOM   6390 C  CA  . MET C 1 208 ? 17.982 60.872  63.427  1.00 11.44  ? 231 MET C CA  1 
ATOM   6391 C  C   . MET C 1 208 ? 16.524 60.965  62.967  1.00 13.66  ? 231 MET C C   1 
ATOM   6392 O  O   . MET C 1 208 ? 15.614 60.650  63.732  1.00 11.10  ? 231 MET C O   1 
ATOM   6393 C  CB  . MET C 1 208 ? 18.468 62.217  63.998  1.00 12.29  ? 231 MET C CB  1 
ATOM   6394 C  CG  . MET C 1 208 ? 19.847 62.139  64.681  1.00 12.68  ? 231 MET C CG  1 
ATOM   6395 S  SD  . MET C 1 208 ? 20.019 60.722  65.793  1.00 13.42  ? 231 MET C SD  1 
ATOM   6396 C  CE  . MET C 1 208 ? 18.796 61.091  67.030  1.00 13.65  ? 231 MET C CE  1 
ATOM   6397 N  N   . GLU C 1 209 ? 16.312 61.358  61.726  1.00 14.50  ? 232 GLU C N   1 
ATOM   6398 C  CA  . GLU C 1 209 ? 14.962 61.424  61.188  1.00 17.33  ? 232 GLU C CA  1 
ATOM   6399 C  C   . GLU C 1 209 ? 14.278 60.063  61.206  1.00 18.14  ? 232 GLU C C   1 
ATOM   6400 O  O   . GLU C 1 209 ? 13.166 59.942  61.615  1.00 16.34  ? 232 GLU C O   1 
ATOM   6401 C  CB  . GLU C 1 209 ? 14.981 61.922  59.750  1.00 17.75  ? 232 GLU C CB  1 
ATOM   6402 C  CG  . GLU C 1 209 ? 15.410 63.333  59.584  1.00 25.18  ? 232 GLU C CG  1 
ATOM   6403 C  CD  . GLU C 1 209 ? 15.495 63.796  58.141  1.00 30.24  ? 232 GLU C CD  1 
ATOM   6404 O  OE1 . GLU C 1 209 ? 15.395 62.959  57.281  1.00 34.59  ? 232 GLU C OE1 1 
ATOM   6405 O  OE2 . GLU C 1 209 ? 15.644 64.953  57.875  1.00 29.94  ? 232 GLU C OE2 1 
ATOM   6406 N  N   . ARG C 1 210 ? 14.997 59.058  60.740  1.00 14.39  ? 233 ARG C N   1 
ATOM   6407 C  CA  . ARG C 1 210 ? 14.421 57.716  60.679  1.00 18.85  ? 233 ARG C CA  1 
ATOM   6408 C  C   . ARG C 1 210 ? 14.228 57.129  62.064  1.00 18.11  ? 233 ARG C C   1 
ATOM   6409 O  O   . ARG C 1 210 ? 13.266 56.397  62.318  1.00 18.00  ? 233 ARG C O   1 
ATOM   6410 C  CB  . ARG C 1 210 ? 15.282 56.801  59.810  1.00 15.89  ? 233 ARG C CB  1 
ATOM   6411 C  CG  . ARG C 1 210 ? 15.324 57.266  58.372  1.00 23.06  ? 233 ARG C CG  1 
ATOM   6412 C  CD  . ARG C 1 210 ? 16.058 56.295  57.488  1.00 29.60  ? 233 ARG C CD  1 
ATOM   6413 N  NE  . ARG C 1 210 ? 16.087 56.762  56.105  1.00 33.88  ? 233 ARG C NE  1 
ATOM   6414 C  CZ  . ARG C 1 210 ? 16.436 56.009  55.069  1.00 35.93  ? 233 ARG C CZ  1 
ATOM   6415 N  NH1 . ARG C 1 210 ? 16.795 54.748  55.258  1.00 29.09  ? 233 ARG C NH1 1 
ATOM   6416 N  NH2 . ARG C 1 210 ? 16.433 56.525  53.848  1.00 46.23  ? 233 ARG C NH2 1 
ATOM   6417 N  N   . THR C 1 211 ? 15.149 57.458  62.961  1.00 13.47  ? 234 THR C N   1 
ATOM   6418 C  CA  . THR C 1 211 ? 15.060 56.995  64.332  1.00 11.06  ? 234 THR C CA  1 
ATOM   6419 C  C   . THR C 1 211 ? 13.768 57.473  64.961  1.00 12.53  ? 234 THR C C   1 
ATOM   6420 O  O   . THR C 1 211 ? 13.017 56.693  65.561  1.00 14.73  ? 234 THR C O   1 
ATOM   6421 C  CB  . THR C 1 211 ? 16.265 57.484  65.165  1.00 10.77  ? 234 THR C CB  1 
ATOM   6422 O  OG1 . THR C 1 211 ? 17.464 56.855  64.684  1.00 12.33  ? 234 THR C OG1 1 
ATOM   6423 C  CG2 . THR C 1 211 ? 16.057 57.157  66.642  1.00 9.93   ? 234 THR C CG2 1 
ATOM   6424 N  N   . PHE C 1 212 ? 13.489 58.758  64.812  1.00 11.56  ? 235 PHE C N   1 
ATOM   6425 C  CA  . PHE C 1 212 ? 12.269 59.298  65.392  1.00 15.25  ? 235 PHE C CA  1 
ATOM   6426 C  C   . PHE C 1 212 ? 11.022 58.793  64.677  1.00 15.26  ? 235 PHE C C   1 
ATOM   6427 O  O   . PHE C 1 212 ? 9.984  58.579  65.308  1.00 18.19  ? 235 PHE C O   1 
ATOM   6428 C  CB  . PHE C 1 212 ? 12.328 60.816  65.446  1.00 15.67  ? 235 PHE C CB  1 
ATOM   6429 C  CG  . PHE C 1 212 ? 13.393 61.322  66.368  1.00 23.61  ? 235 PHE C CG  1 
ATOM   6430 C  CD1 . PHE C 1 212 ? 13.647 60.660  67.563  1.00 16.84  ? 235 PHE C CD1 1 
ATOM   6431 C  CD2 . PHE C 1 212 ? 14.163 62.423  66.034  1.00 20.33  ? 235 PHE C CD2 1 
ATOM   6432 C  CE1 . PHE C 1 212 ? 14.643 61.104  68.428  1.00 24.53  ? 235 PHE C CE1 1 
ATOM   6433 C  CE2 . PHE C 1 212 ? 15.159 62.868  66.885  1.00 22.07  ? 235 PHE C CE2 1 
ATOM   6434 C  CZ  . PHE C 1 212 ? 15.398 62.206  68.085  1.00 18.71  ? 235 PHE C CZ  1 
ATOM   6435 N  N   . ASP C 1 213 ? 11.122 58.573  63.373  1.00 18.93  ? 236 ASP C N   1 
ATOM   6436 C  CA  A ASP C 1 213 ? 9.984  58.006  62.658  0.58 20.80  ? 236 ASP C CA  1 
ATOM   6437 C  CA  B ASP C 1 213 ? 10.023 57.978  62.614  0.42 20.80  ? 236 ASP C CA  1 
ATOM   6438 C  C   . ASP C 1 213 ? 9.635  56.629  63.211  1.00 21.02  ? 236 ASP C C   1 
ATOM   6439 O  O   . ASP C 1 213 ? 8.459  56.327  63.412  1.00 20.29  ? 236 ASP C O   1 
ATOM   6440 C  CB  A ASP C 1 213 ? 10.235 57.926  61.158  0.58 21.22  ? 236 ASP C CB  1 
ATOM   6441 C  CB  B ASP C 1 213 ? 10.426 57.789  61.149  0.42 21.05  ? 236 ASP C CB  1 
ATOM   6442 C  CG  A ASP C 1 213 ? 8.966  57.633  60.382  0.58 22.50  ? 236 ASP C CG  1 
ATOM   6443 C  CG  B ASP C 1 213 ? 10.416 59.085  60.366  0.42 22.99  ? 236 ASP C CG  1 
ATOM   6444 O  OD1 A ASP C 1 213 ? 7.936  58.285  60.665  0.58 28.82  ? 236 ASP C OD1 1 
ATOM   6445 O  OD1 B ASP C 1 213 ? 9.913  60.097  60.896  0.42 22.38  ? 236 ASP C OD1 1 
ATOM   6446 O  OD2 A ASP C 1 213 ? 8.997  56.746  59.506  0.58 30.09  ? 236 ASP C OD2 1 
ATOM   6447 O  OD2 B ASP C 1 213 ? 10.901 59.084  59.213  0.42 28.62  ? 236 ASP C OD2 1 
ATOM   6448 N  N   . LEU C 1 214 ? 10.653 55.816  63.488  1.00 21.35  ? 237 LEU C N   1 
ATOM   6449 C  CA  . LEU C 1 214 ? 10.455 54.493  64.072  1.00 22.03  ? 237 LEU C CA  1 
ATOM   6450 C  C   . LEU C 1 214 ? 9.876  54.556  65.477  1.00 22.50  ? 237 LEU C C   1 
ATOM   6451 O  O   . LEU C 1 214 ? 9.047  53.725  65.845  1.00 21.63  ? 237 LEU C O   1 
ATOM   6452 C  CB  . LEU C 1 214 ? 11.775 53.704  64.107  1.00 18.86  ? 237 LEU C CB  1 
ATOM   6453 C  CG  . LEU C 1 214 ? 12.322 53.232  62.760  1.00 20.44  ? 237 LEU C CG  1 
ATOM   6454 C  CD1 . LEU C 1 214 ? 13.798 52.851  62.868  1.00 22.89  ? 237 LEU C CD1 1 
ATOM   6455 C  CD2 . LEU C 1 214 ? 11.512 52.050  62.245  1.00 20.51  ? 237 LEU C CD2 1 
ATOM   6456 N  N   . LEU C 1 215 ? 10.316 55.524  66.273  1.00 14.87  ? 238 LEU C N   1 
ATOM   6457 C  CA  . LEU C 1 215 ? 9.944  55.525  67.686  1.00 16.31  ? 238 LEU C CA  1 
ATOM   6458 C  C   . LEU C 1 215 ? 8.732  56.381  67.996  1.00 22.75  ? 238 LEU C C   1 
ATOM   6459 O  O   . LEU C 1 215 ? 7.859  55.965  68.756  1.00 19.86  ? 238 LEU C O   1 
ATOM   6460 C  CB  . LEU C 1 215 ? 11.128 55.957  68.558  1.00 14.09  ? 238 LEU C CB  1 
ATOM   6461 C  CG  . LEU C 1 215 ? 12.323 55.003  68.540  1.00 16.51  ? 238 LEU C CG  1 
ATOM   6462 C  CD1 . LEU C 1 215 ? 13.391 55.506  69.492  1.00 15.40  ? 238 LEU C CD1 1 
ATOM   6463 C  CD2 . LEU C 1 215 ? 11.892 53.590  68.912  1.00 15.50  ? 238 LEU C CD2 1 
ATOM   6464 N  N   . ILE C 1 216 ? 8.686  57.579  67.425  1.00 19.45  ? 239 ILE C N   1 
ATOM   6465 C  CA  . ILE C 1 216 ? 7.605  58.519  67.718  1.00 20.84  ? 239 ILE C CA  1 
ATOM   6466 C  C   . ILE C 1 216 ? 6.897  59.026  66.462  1.00 17.40  ? 239 ILE C C   1 
ATOM   6467 O  O   . ILE C 1 216 ? 6.299  60.100  66.473  1.00 24.30  ? 239 ILE C O   1 
ATOM   6468 C  CB  . ILE C 1 216 ? 8.104  59.723  68.554  1.00 21.19  ? 239 ILE C CB  1 
ATOM   6469 C  CG1 . ILE C 1 216 ? 9.289  60.397  67.853  1.00 22.87  ? 239 ILE C CG1 1 
ATOM   6470 C  CG2 . ILE C 1 216 ? 8.506  59.273  69.954  1.00 18.78  ? 239 ILE C CG2 1 
ATOM   6471 C  CD1 . ILE C 1 216 ? 9.754  61.685  68.531  1.00 21.03  ? 239 ILE C CD1 1 
ATOM   6472 N  N   . GLY C 1 217 ? 6.954  58.243  65.391  1.00 20.88  ? 240 GLY C N   1 
ATOM   6473 C  CA  . GLY C 1 217 ? 6.313  58.621  64.143  1.00 32.20  ? 240 GLY C CA  1 
ATOM   6474 C  C   . GLY C 1 217 ? 4.796  58.670  64.237  1.00 31.20  ? 240 GLY C C   1 
ATOM   6475 O  O   . GLY C 1 217 ? 4.144  59.401  63.491  1.00 31.78  ? 240 GLY C O   1 
ATOM   6476 N  N   . LYS C 1 218 ? 4.231  57.883  65.148  1.00 28.50  ? 241 LYS C N   1 
ATOM   6477 C  CA  . LYS C 1 218 ? 2.778  57.820  65.295  1.00 32.83  ? 241 LYS C CA  1 
ATOM   6478 C  C   . LYS C 1 218 ? 2.239  58.444  66.580  1.00 38.34  ? 241 LYS C C   1 
ATOM   6479 O  O   . LYS C 1 218 ? 1.077  58.826  66.632  1.00 28.98  ? 241 LYS C O   1 
ATOM   6480 C  CB  . LYS C 1 218 ? 2.279  56.384  65.133  1.00 35.81  ? 241 LYS C CB  1 
ATOM   6481 C  CG  . LYS C 1 218 ? 2.302  55.933  63.688  1.00 51.61  ? 241 LYS C CG  1 
ATOM   6482 C  CD  . LYS C 1 218 ? 1.915  54.480  63.530  1.00 69.98  ? 241 LYS C CD  1 
ATOM   6483 C  CE  . LYS C 1 218 ? 1.920  54.098  62.058  1.00 70.82  ? 241 LYS C CE  1 
ATOM   6484 N  NZ  . LYS C 1 218 ? 1.592  52.665  61.851  1.00 60.16  ? 241 LYS C NZ  1 
ATOM   6485 N  N   . ARG C 1 219 ? 3.062  58.526  67.621  1.00 22.04  ? 242 ARG C N   1 
ATOM   6486 C  CA  . ARG C 1 219 ? 2.618  59.149  68.866  1.00 20.50  ? 242 ARG C CA  1 
ATOM   6487 C  C   . ARG C 1 219 ? 3.809  59.687  69.648  1.00 23.90  ? 242 ARG C C   1 
ATOM   6488 O  O   . ARG C 1 219 ? 4.930  59.216  69.475  1.00 23.46  ? 242 ARG C O   1 
ATOM   6489 C  CB  . ARG C 1 219 ? 1.830  58.154  69.727  1.00 27.56  ? 242 ARG C CB  1 
ATOM   6490 C  CG  . ARG C 1 219 ? 2.659  57.012  70.284  1.00 25.54  ? 242 ARG C CG  1 
ATOM   6491 C  CD  . ARG C 1 219 ? 1.811  56.031  71.081  1.00 28.48  ? 242 ARG C CD  1 
ATOM   6492 N  NE  . ARG C 1 219 ? 2.635  54.978  71.674  1.00 27.59  ? 242 ARG C NE  1 
ATOM   6493 C  CZ  . ARG C 1 219 ? 3.036  53.891  71.020  1.00 25.58  ? 242 ARG C CZ  1 
ATOM   6494 N  NH1 . ARG C 1 219 ? 2.678  53.708  69.757  1.00 28.48  ? 242 ARG C NH1 1 
ATOM   6495 N  NH2 . ARG C 1 219 ? 3.789  52.987  71.631  1.00 31.62  ? 242 ARG C NH2 1 
ATOM   6496 N  N   . GLN C 1 220 ? 3.561  60.691  70.481  1.00 22.03  ? 243 GLN C N   1 
ATOM   6497 C  CA  . GLN C 1 220 ? 4.583  61.232  71.370  1.00 23.57  ? 243 GLN C CA  1 
ATOM   6498 C  C   . GLN C 1 220 ? 4.859  60.235  72.489  1.00 21.72  ? 243 GLN C C   1 
ATOM   6499 O  O   . GLN C 1 220 ? 3.928  59.714  73.102  1.00 21.69  ? 243 GLN C O   1 
ATOM   6500 C  CB  . GLN C 1 220 ? 4.109  62.556  71.972  1.00 24.01  ? 243 GLN C CB  1 
ATOM   6501 C  CG  . GLN C 1 220 ? 3.731  63.600  70.939  1.00 34.36  ? 243 GLN C CG  1 
ATOM   6502 C  CD  . GLN C 1 220 ? 4.908  64.434  70.494  1.00 46.03  ? 243 GLN C CD  1 
ATOM   6503 O  OE1 . GLN C 1 220 ? 5.215  65.464  71.099  1.00 57.96  ? 243 GLN C OE1 1 
ATOM   6504 N  NE2 . GLN C 1 220 ? 5.587  63.989  69.436  1.00 43.20  ? 243 GLN C NE2 1 
ATOM   6505 N  N   . ARG C 1 221 ? 6.137  59.993  72.776  1.00 20.26  ? 244 ARG C N   1 
ATOM   6506 C  CA  . ARG C 1 221 ? 6.532  59.075  73.842  1.00 18.90  ? 244 ARG C CA  1 
ATOM   6507 C  C   . ARG C 1 221 ? 7.710  59.655  74.608  1.00 18.19  ? 244 ARG C C   1 
ATOM   6508 O  O   . ARG C 1 221 ? 8.551  60.327  74.018  1.00 16.54  ? 244 ARG C O   1 
ATOM   6509 C  CB  . ARG C 1 221 ? 6.963  57.723  73.258  1.00 16.77  ? 244 ARG C CB  1 
ATOM   6510 C  CG  . ARG C 1 221 ? 5.975  57.098  72.295  1.00 22.90  ? 244 ARG C CG  1 
ATOM   6511 C  CD  . ARG C 1 221 ? 6.605  55.935  71.551  1.00 22.78  ? 244 ARG C CD  1 
ATOM   6512 N  NE  . ARG C 1 221 ? 6.708  54.741  72.384  1.00 21.08  ? 244 ARG C NE  1 
ATOM   6513 C  CZ  . ARG C 1 221 ? 7.151  53.564  71.952  1.00 18.41  ? 244 ARG C CZ  1 
ATOM   6514 N  NH1 . ARG C 1 221 ? 7.535  53.419  70.693  1.00 18.50  ? 244 ARG C NH1 1 
ATOM   6515 N  NH2 . ARG C 1 221 ? 7.197  52.531  72.779  1.00 15.78  ? 244 ARG C NH2 1 
ATOM   6516 N  N   . PRO C 1 222 ? 7.785  59.376  75.918  1.00 18.58  ? 245 PRO C N   1 
ATOM   6517 C  CA  . PRO C 1 222 ? 8.983  59.783  76.657  1.00 21.51  ? 245 PRO C CA  1 
ATOM   6518 C  C   . PRO C 1 222 ? 10.197 59.042  76.107  1.00 19.15  ? 245 PRO C C   1 
ATOM   6519 O  O   . PRO C 1 222 ? 10.130 57.841  75.830  1.00 18.20  ? 245 PRO C O   1 
ATOM   6520 C  CB  . PRO C 1 222 ? 8.683  59.358  78.100  1.00 20.03  ? 245 PRO C CB  1 
ATOM   6521 C  CG  . PRO C 1 222 ? 7.580  58.351  78.006  1.00 23.73  ? 245 PRO C CG  1 
ATOM   6522 C  CD  . PRO C 1 222 ? 6.801  58.670  76.762  1.00 21.04  ? 245 PRO C CD  1 
ATOM   6523 N  N   . ILE C 1 223 ? 11.295 59.766  75.930  1.00 15.37  ? 246 ILE C N   1 
ATOM   6524 C  CA  . ILE C 1 223 ? 12.487 59.174  75.344  1.00 12.50  ? 246 ILE C CA  1 
ATOM   6525 C  C   . ILE C 1 223 ? 13.513 58.904  76.433  1.00 14.90  ? 246 ILE C C   1 
ATOM   6526 O  O   . ILE C 1 223 ? 13.760 59.753  77.296  1.00 15.39  ? 246 ILE C O   1 
ATOM   6527 C  CB  . ILE C 1 223 ? 13.102 60.098  74.276  1.00 13.85  ? 246 ILE C CB  1 
ATOM   6528 C  CG1 . ILE C 1 223 ? 12.132 60.266  73.101  1.00 14.63  ? 246 ILE C CG1 1 
ATOM   6529 C  CG2 . ILE C 1 223 ? 14.464 59.554  73.795  1.00 13.16  ? 246 ILE C CG2 1 
ATOM   6530 C  CD1 . ILE C 1 223 ? 12.603 61.278  72.064  1.00 16.61  ? 246 ILE C CD1 1 
ATOM   6531 N  N   . HIS C 1 224 ? 14.084 57.705  76.405  1.00 13.72  ? 247 HIS C N   1 
ATOM   6532 C  CA  . HIS C 1 224 ? 15.217 57.371  77.260  1.00 13.20  ? 247 HIS C CA  1 
ATOM   6533 C  C   . HIS C 1 224 ? 16.463 57.299  76.397  1.00 12.11  ? 247 HIS C C   1 
ATOM   6534 O  O   . HIS C 1 224 ? 16.575 56.408  75.548  1.00 12.99  ? 247 HIS C O   1 
ATOM   6535 C  CB  . HIS C 1 224 ? 15.004 56.022  77.954  1.00 14.27  ? 247 HIS C CB  1 
ATOM   6536 C  CG  . HIS C 1 224 ? 16.027 55.717  79.000  1.00 15.89  ? 247 HIS C CG  1 
ATOM   6537 N  ND1 . HIS C 1 224 ? 15.744 55.726  80.347  1.00 13.96  ? 247 HIS C ND1 1 
ATOM   6538 C  CD2 . HIS C 1 224 ? 17.347 55.404  78.891  1.00 15.56  ? 247 HIS C CD2 1 
ATOM   6539 C  CE1 . HIS C 1 224 ? 16.840 55.436  81.028  1.00 16.56  ? 247 HIS C CE1 1 
ATOM   6540 N  NE2 . HIS C 1 224 ? 17.824 55.238  80.167  1.00 16.34  ? 247 HIS C NE2 1 
ATOM   6541 N  N   . LEU C 1 225 ? 17.391 58.232  76.605  1.00 8.70   ? 248 LEU C N   1 
ATOM   6542 C  CA  . LEU C 1 225 ? 18.638 58.229  75.842  1.00 11.13  ? 248 LEU C CA  1 
ATOM   6543 C  C   . LEU C 1 225 ? 19.726 57.552  76.663  1.00 13.47  ? 248 LEU C C   1 
ATOM   6544 O  O   . LEU C 1 225 ? 20.161 58.090  77.689  1.00 11.10  ? 248 LEU C O   1 
ATOM   6545 C  CB  . LEU C 1 225 ? 19.068 59.660  75.487  1.00 14.60  ? 248 LEU C CB  1 
ATOM   6546 C  CG  . LEU C 1 225 ? 20.430 59.796  74.788  1.00 13.24  ? 248 LEU C CG  1 
ATOM   6547 C  CD1 . LEU C 1 225 ? 20.408 59.119  73.414  1.00 12.50  ? 248 LEU C CD1 1 
ATOM   6548 C  CD2 . LEU C 1 225 ? 20.849 61.265  74.659  1.00 8.77   ? 248 LEU C CD2 1 
ATOM   6549 N  N   . SER C 1 226 ? 20.160 56.375  76.220  1.00 8.36   ? 249 SER C N   1 
ATOM   6550 C  CA  . SER C 1 226 ? 21.234 55.671  76.903  1.00 9.48   ? 249 SER C CA  1 
ATOM   6551 C  C   . SER C 1 226 ? 22.498 55.828  76.076  1.00 12.51  ? 249 SER C C   1 
ATOM   6552 O  O   . SER C 1 226 ? 22.640 55.222  75.015  1.00 11.74  ? 249 SER C O   1 
ATOM   6553 C  CB  . SER C 1 226 ? 20.895 54.190  77.112  1.00 10.23  ? 249 SER C CB  1 
ATOM   6554 O  OG  . SER C 1 226 ? 21.695 53.640  78.153  1.00 13.43  ? 249 SER C OG  1 
ATOM   6555 N  N   . PHE C 1 227 ? 23.411 56.665  76.557  1.00 12.12  ? 250 PHE C N   1 
ATOM   6556 C  CA  . PHE C 1 227 ? 24.563 57.067  75.753  1.00 8.66   ? 250 PHE C CA  1 
ATOM   6557 C  C   . PHE C 1 227 ? 25.845 56.530  76.356  1.00 15.06  ? 250 PHE C C   1 
ATOM   6558 O  O   . PHE C 1 227 ? 26.239 56.957  77.443  1.00 10.50  ? 250 PHE C O   1 
ATOM   6559 C  CB  . PHE C 1 227 ? 24.617 58.593  75.660  1.00 9.75   ? 250 PHE C CB  1 
ATOM   6560 C  CG  . PHE C 1 227 ? 25.395 59.110  74.476  1.00 11.89  ? 250 PHE C CG  1 
ATOM   6561 C  CD1 . PHE C 1 227 ? 26.763 58.885  74.372  1.00 11.95  ? 250 PHE C CD1 1 
ATOM   6562 C  CD2 . PHE C 1 227 ? 24.762 59.857  73.489  1.00 11.00  ? 250 PHE C CD2 1 
ATOM   6563 C  CE1 . PHE C 1 227 ? 27.486 59.371  73.281  1.00 10.57  ? 250 PHE C CE1 1 
ATOM   6564 C  CE2 . PHE C 1 227 ? 25.475 60.360  72.399  1.00 10.34  ? 250 PHE C CE2 1 
ATOM   6565 C  CZ  . PHE C 1 227 ? 26.840 60.119  72.296  1.00 12.76  ? 250 PHE C CZ  1 
ATOM   6566 N  N   . ASP C 1 228 ? 26.456 55.570  75.662  1.00 10.78  ? 251 ASP C N   1 
ATOM   6567 C  CA  . ASP C 1 228 ? 27.748 55.000  76.035  1.00 11.84  ? 251 ASP C CA  1 
ATOM   6568 C  C   . ASP C 1 228 ? 28.812 55.878  75.377  1.00 10.02  ? 251 ASP C C   1 
ATOM   6569 O  O   . ASP C 1 228 ? 28.835 56.028  74.151  1.00 11.01  ? 251 ASP C O   1 
ATOM   6570 C  CB  . ASP C 1 228 ? 27.817 53.550  75.519  1.00 9.85   ? 251 ASP C CB  1 
ATOM   6571 C  CG  . ASP C 1 228 ? 29.067 52.791  75.963  1.00 11.79  ? 251 ASP C CG  1 
ATOM   6572 O  OD1 . ASP C 1 228 ? 30.114 53.425  76.239  1.00 8.58   ? 251 ASP C OD1 1 
ATOM   6573 O  OD2 . ASP C 1 228 ? 29.018 51.525  75.959  1.00 9.31   ? 251 ASP C OD2 1 
ATOM   6574 N  N   . ILE C 1 229 ? 29.684 56.467  76.190  1.00 8.90   ? 252 ILE C N   1 
ATOM   6575 C  CA  . ILE C 1 229 ? 30.713 57.361  75.672  1.00 9.44   ? 252 ILE C CA  1 
ATOM   6576 C  C   . ILE C 1 229 ? 31.559 56.689  74.582  1.00 7.10   ? 252 ILE C C   1 
ATOM   6577 O  O   . ILE C 1 229 ? 32.088 57.373  73.700  1.00 8.89   ? 252 ILE C O   1 
ATOM   6578 C  CB  . ILE C 1 229 ? 31.594 57.946  76.818  1.00 7.73   ? 252 ILE C CB  1 
ATOM   6579 C  CG1 . ILE C 1 229 ? 32.241 59.267  76.392  1.00 8.23   ? 252 ILE C CG1 1 
ATOM   6580 C  CG2 . ILE C 1 229 ? 32.666 56.935  77.271  1.00 7.95   ? 252 ILE C CG2 1 
ATOM   6581 C  CD1 . ILE C 1 229 ? 31.256 60.408  76.241  1.00 9.00   ? 252 ILE C CD1 1 
ATOM   6582 N  N   . ASP C 1 230 ? 31.657 55.357  74.599  1.00 6.28   ? 253 ASP C N   1 
ATOM   6583 C  CA  . ASP C 1 230 ? 32.424 54.668  73.568  1.00 7.88   ? 253 ASP C CA  1 
ATOM   6584 C  C   . ASP C 1 230 ? 31.766 54.687  72.188  1.00 8.42   ? 253 ASP C C   1 
ATOM   6585 O  O   . ASP C 1 230 ? 32.327 54.169  71.228  1.00 6.92   ? 253 ASP C O   1 
ATOM   6586 C  CB  . ASP C 1 230 ? 32.877 53.249  73.990  1.00 8.69   ? 253 ASP C CB  1 
ATOM   6587 C  CG  . ASP C 1 230 ? 31.754 52.212  74.006  1.00 13.47  ? 253 ASP C CG  1 
ATOM   6588 O  OD1 . ASP C 1 230 ? 30.713 52.377  73.337  1.00 9.79   ? 253 ASP C OD1 1 
ATOM   6589 O  OD2 . ASP C 1 230 ? 31.947 51.182  74.699  1.00 11.99  ? 253 ASP C OD2 1 
ATOM   6590 N  N   . ALA C 1 231 ? 30.576 55.277  72.081  1.00 5.69   ? 254 ALA C N   1 
ATOM   6591 C  CA  . ALA C 1 231 ? 30.011 55.499  70.745  1.00 8.30   ? 254 ALA C CA  1 
ATOM   6592 C  C   . ALA C 1 231 ? 30.928 56.429  69.948  1.00 7.72   ? 254 ALA C C   1 
ATOM   6593 O  O   . ALA C 1 231 ? 31.043 56.322  68.721  1.00 6.91   ? 254 ALA C O   1 
ATOM   6594 C  CB  . ALA C 1 231 ? 28.600 56.082  70.828  1.00 7.15   ? 254 ALA C CB  1 
ATOM   6595 N  N   . PHE C 1 232 ? 31.574 57.354  70.651  1.00 7.08   ? 255 PHE C N   1 
ATOM   6596 C  CA  . PHE C 1 232 ? 32.488 58.297  70.006  1.00 6.14   ? 255 PHE C CA  1 
ATOM   6597 C  C   . PHE C 1 232 ? 33.783 57.633  69.577  1.00 11.14  ? 255 PHE C C   1 
ATOM   6598 O  O   . PHE C 1 232 ? 34.238 56.660  70.201  1.00 9.29   ? 255 PHE C O   1 
ATOM   6599 C  CB  . PHE C 1 232 ? 32.844 59.436  70.970  1.00 7.07   ? 255 PHE C CB  1 
ATOM   6600 C  CG  . PHE C 1 232 ? 31.786 60.481  71.105  1.00 9.01   ? 255 PHE C CG  1 
ATOM   6601 C  CD1 . PHE C 1 232 ? 31.553 61.381  70.070  1.00 8.54   ? 255 PHE C CD1 1 
ATOM   6602 C  CD2 . PHE C 1 232 ? 31.051 60.597  72.277  1.00 8.54   ? 255 PHE C CD2 1 
ATOM   6603 C  CE1 . PHE C 1 232 ? 30.590 62.367  70.193  1.00 9.30   ? 255 PHE C CE1 1 
ATOM   6604 C  CE2 . PHE C 1 232 ? 30.083 61.584  72.412  1.00 9.19   ? 255 PHE C CE2 1 
ATOM   6605 C  CZ  . PHE C 1 232 ? 29.853 62.472  71.358  1.00 11.23  ? 255 PHE C CZ  1 
ATOM   6606 N  N   . ASP C 1 233 ? 34.414 58.172  68.536  1.00 6.81   ? 256 ASP C N   1 
ATOM   6607 C  CA  . ASP C 1 233 ? 35.735 57.688  68.171  1.00 8.05   ? 256 ASP C CA  1 
ATOM   6608 C  C   . ASP C 1 233 ? 36.694 57.755  69.370  1.00 11.27  ? 256 ASP C C   1 
ATOM   6609 O  O   . ASP C 1 233 ? 36.644 58.702  70.139  1.00 11.47  ? 256 ASP C O   1 
ATOM   6610 C  CB  . ASP C 1 233 ? 36.329 58.484  67.014  1.00 9.16   ? 256 ASP C CB  1 
ATOM   6611 C  CG  . ASP C 1 233 ? 37.459 57.738  66.359  1.00 14.18  ? 256 ASP C CG  1 
ATOM   6612 O  OD1 . ASP C 1 233 ? 37.156 56.809  65.583  1.00 14.08  ? 256 ASP C OD1 1 
ATOM   6613 O  OD2 . ASP C 1 233 ? 38.640 58.032  66.649  1.00 14.29  ? 256 ASP C OD2 1 
ATOM   6614 N  N   . PRO C 1 234 ? 37.547 56.734  69.537  1.00 10.90  ? 257 PRO C N   1 
ATOM   6615 C  CA  . PRO C 1 234 ? 38.517 56.728  70.646  1.00 11.17  ? 257 PRO C CA  1 
ATOM   6616 C  C   . PRO C 1 234 ? 39.450 57.936  70.687  1.00 13.52  ? 257 PRO C C   1 
ATOM   6617 O  O   . PRO C 1 234 ? 39.926 58.271  71.768  1.00 12.95  ? 257 PRO C O   1 
ATOM   6618 C  CB  . PRO C 1 234 ? 39.342 55.462  70.387  1.00 14.93  ? 257 PRO C CB  1 
ATOM   6619 C  CG  . PRO C 1 234 ? 38.419 54.552  69.653  1.00 16.02  ? 257 PRO C CG  1 
ATOM   6620 C  CD  . PRO C 1 234 ? 37.582 55.473  68.769  1.00 10.11  ? 257 PRO C CD  1 
ATOM   6621 N  N   . THR C 1 235 ? 39.717 58.579  69.552  1.00 13.34  ? 258 THR C N   1 
ATOM   6622 C  CA  . THR C 1 235 ? 40.516 59.802  69.575  1.00 12.86  ? 258 THR C CA  1 
ATOM   6623 C  C   . THR C 1 235 ? 39.825 60.906  70.358  1.00 18.00  ? 258 THR C C   1 
ATOM   6624 O  O   . THR C 1 235 ? 40.477 61.790  70.906  1.00 15.20  ? 258 THR C O   1 
ATOM   6625 C  CB  . THR C 1 235 ? 40.827 60.308  68.160  1.00 18.64  ? 258 THR C CB  1 
ATOM   6626 O  OG1 . THR C 1 235 ? 39.593 60.554  67.469  1.00 14.85  ? 258 THR C OG1 1 
ATOM   6627 C  CG2 . THR C 1 235 ? 41.636 59.266  67.403  1.00 17.54  ? 258 THR C CG2 1 
ATOM   6628 N  N   . LEU C 1 236 ? 38.497 60.850  70.410  1.00 11.65  ? 259 LEU C N   1 
ATOM   6629 C  CA  . LEU C 1 236 ? 37.708 61.843  71.122  1.00 10.59  ? 259 LEU C CA  1 
ATOM   6630 C  C   . LEU C 1 236 ? 37.364 61.395  72.528  1.00 15.78  ? 259 LEU C C   1 
ATOM   6631 O  O   . LEU C 1 236 ? 37.230 62.217  73.412  1.00 13.23  ? 259 LEU C O   1 
ATOM   6632 C  CB  . LEU C 1 236 ? 36.384 62.097  70.402  1.00 10.48  ? 259 LEU C CB  1 
ATOM   6633 C  CG  . LEU C 1 236 ? 36.515 62.561  68.959  1.00 20.12  ? 259 LEU C CG  1 
ATOM   6634 C  CD1 . LEU C 1 236 ? 35.139 62.522  68.303  1.00 15.51  ? 259 LEU C CD1 1 
ATOM   6635 C  CD2 . LEU C 1 236 ? 37.091 63.967  68.935  1.00 22.83  ? 259 LEU C CD2 1 
ATOM   6636 N  N   . ALA C 1 237 ? 37.161 60.096  72.717  1.00 10.42  ? 260 ALA C N   1 
ATOM   6637 C  CA  . ALA C 1 237 ? 36.777 59.572  74.030  1.00 10.21  ? 260 ALA C CA  1 
ATOM   6638 C  C   . ALA C 1 237 ? 37.684 58.424  74.411  1.00 12.41  ? 260 ALA C C   1 
ATOM   6639 O  O   . ALA C 1 237 ? 37.249 57.271  74.460  1.00 8.86   ? 260 ALA C O   1 
ATOM   6640 C  CB  . ALA C 1 237 ? 35.320 59.126  74.023  1.00 11.45  ? 260 ALA C CB  1 
ATOM   6641 N  N   . PRO C 1 238 ? 38.961 58.729  74.682  1.00 11.04  ? 261 PRO C N   1 
ATOM   6642 C  CA  . PRO C 1 238 ? 39.894 57.636  74.954  1.00 12.90  ? 261 PRO C CA  1 
ATOM   6643 C  C   . PRO C 1 238 ? 39.676 56.983  76.325  1.00 12.93  ? 261 PRO C C   1 
ATOM   6644 O  O   . PRO C 1 238 ? 39.991 55.801  76.486  1.00 12.64  ? 261 PRO C O   1 
ATOM   6645 C  CB  . PRO C 1 238 ? 41.267 58.328  74.891  1.00 12.98  ? 261 PRO C CB  1 
ATOM   6646 C  CG  . PRO C 1 238 ? 40.999 59.764  75.223  1.00 15.45  ? 261 PRO C CG  1 
ATOM   6647 C  CD  . PRO C 1 238 ? 39.628 60.046  74.645  1.00 11.75  ? 261 PRO C CD  1 
ATOM   6648 N  N   . ALA C 1 239 ? 39.147 57.729  77.290  1.00 9.03   ? 262 ALA C N   1 
ATOM   6649 C  CA  . ALA C 1 239 ? 39.028 57.203  78.657  1.00 10.01  ? 262 ALA C CA  1 
ATOM   6650 C  C   . ALA C 1 239 ? 37.768 56.360  78.805  1.00 8.53   ? 262 ALA C C   1 
ATOM   6651 O  O   . ALA C 1 239 ? 36.778 56.794  79.391  1.00 11.11  ? 262 ALA C O   1 
ATOM   6652 C  CB  . ALA C 1 239 ? 39.056 58.345  79.688  1.00 8.14   ? 262 ALA C CB  1 
ATOM   6653 N  N   . THR C 1 240 ? 37.816 55.146  78.265  1.00 9.94   ? 263 THR C N   1 
ATOM   6654 C  CA  . THR C 1 240 ? 36.676 54.242  78.312  1.00 9.97   ? 263 THR C CA  1 
ATOM   6655 C  C   . THR C 1 240 ? 37.183 52.811  78.159  1.00 8.88   ? 263 THR C C   1 
ATOM   6656 O  O   . THR C 1 240 ? 38.278 52.586  77.626  1.00 9.82   ? 263 THR C O   1 
ATOM   6657 C  CB  . THR C 1 240 ? 35.628 54.590  77.216  1.00 8.52   ? 263 THR C CB  1 
ATOM   6658 O  OG1 . THR C 1 240 ? 34.383 53.961  77.534  1.00 10.71  ? 263 THR C OG1 1 
ATOM   6659 C  CG2 . THR C 1 240 ? 36.127 54.128  75.827  1.00 10.03  ? 263 THR C CG2 1 
ATOM   6660 N  N   . GLY C 1 241 ? 36.409 51.848  78.654  1.00 13.71  ? 264 GLY C N   1 
ATOM   6661 C  CA  . GLY C 1 241 ? 36.872 50.473  78.779  1.00 12.98  ? 264 GLY C CA  1 
ATOM   6662 C  C   . GLY C 1 241 ? 36.978 49.647  77.512  1.00 14.06  ? 264 GLY C C   1 
ATOM   6663 O  O   . GLY C 1 241 ? 37.841 48.779  77.385  1.00 11.43  ? 264 GLY C O   1 
ATOM   6664 N  N   . THR C 1 242 ? 36.103 49.902  76.556  1.00 8.77   ? 265 THR C N   1 
ATOM   6665 C  CA  A THR C 1 242 ? 36.080 49.115  75.332  0.26 8.56   ? 265 THR C CA  1 
ATOM   6666 C  CA  B THR C 1 242 ? 36.083 49.103  75.336  0.74 8.38   ? 265 THR C CA  1 
ATOM   6667 C  C   . THR C 1 242 ? 36.048 50.008  74.100  1.00 11.48  ? 265 THR C C   1 
ATOM   6668 O  O   . THR C 1 242 ? 35.046 50.050  73.395  1.00 11.47  ? 265 THR C O   1 
ATOM   6669 C  CB  A THR C 1 242 ? 34.845 48.209  75.315  0.26 13.42  ? 265 THR C CB  1 
ATOM   6670 C  CB  B THR C 1 242 ? 34.858 48.154  75.333  0.74 13.42  ? 265 THR C CB  1 
ATOM   6671 O  OG1 A THR C 1 242 ? 33.669 49.015  75.444  0.26 10.79  ? 265 THR C OG1 1 
ATOM   6672 O  OG1 B THR C 1 242 ? 34.747 47.513  76.610  0.74 15.84  ? 265 THR C OG1 1 
ATOM   6673 C  CG2 A THR C 1 242 ? 34.898 47.247  76.470  0.26 15.40  ? 265 THR C CG2 1 
ATOM   6674 C  CG2 B THR C 1 242 ? 34.975 47.097  74.237  0.74 14.85  ? 265 THR C CG2 1 
ATOM   6675 N  N   . PRO C 1 243 ? 37.149 50.742  73.839  1.00 11.87  ? 266 PRO C N   1 
ATOM   6676 C  CA  . PRO C 1 243 ? 37.179 51.651  72.686  1.00 9.42   ? 266 PRO C CA  1 
ATOM   6677 C  C   . PRO C 1 243 ? 37.220 50.879  71.374  1.00 15.86  ? 266 PRO C C   1 
ATOM   6678 O  O   . PRO C 1 243 ? 37.861 49.830  71.297  1.00 11.63  ? 266 PRO C O   1 
ATOM   6679 C  CB  . PRO C 1 243 ? 38.500 52.417  72.874  1.00 14.52  ? 266 PRO C CB  1 
ATOM   6680 C  CG  . PRO C 1 243 ? 39.391 51.455  73.633  1.00 17.08  ? 266 PRO C CG  1 
ATOM   6681 C  CD  . PRO C 1 243 ? 38.435 50.723  74.568  1.00 14.92  ? 266 PRO C CD  1 
ATOM   6682 N  N   . VAL C 1 244 ? 36.550 51.391  70.346  1.00 9.38   ? 267 VAL C N   1 
ATOM   6683 C  CA  . VAL C 1 244 ? 36.555 50.742  69.038  1.00 10.80  ? 267 VAL C CA  1 
ATOM   6684 C  C   . VAL C 1 244 ? 36.790 51.813  67.982  1.00 9.60   ? 267 VAL C C   1 
ATOM   6685 O  O   . VAL C 1 244 ? 36.092 52.825  67.971  1.00 9.71   ? 267 VAL C O   1 
ATOM   6686 C  CB  . VAL C 1 244 ? 35.200 50.060  68.760  1.00 8.92   ? 267 VAL C CB  1 
ATOM   6687 C  CG1 . VAL C 1 244 ? 35.227 49.332  67.407  1.00 10.06  ? 267 VAL C CG1 1 
ATOM   6688 C  CG2 . VAL C 1 244 ? 34.843 49.072  69.888  1.00 13.79  ? 267 VAL C CG2 1 
ATOM   6689 N  N   . VAL C 1 245 ? 37.792 51.624  67.125  1.00 11.28  ? 268 VAL C N   1 
ATOM   6690 C  CA  . VAL C 1 245 ? 38.091 52.629  66.104  1.00 12.68  ? 268 VAL C CA  1 
ATOM   6691 C  C   . VAL C 1 245 ? 36.904 52.881  65.164  1.00 9.36   ? 268 VAL C C   1 
ATOM   6692 O  O   . VAL C 1 245 ? 36.052 52.012  64.964  1.00 10.13  ? 268 VAL C O   1 
ATOM   6693 C  CB  . VAL C 1 245 ? 39.325 52.254  65.257  1.00 14.94  ? 268 VAL C CB  1 
ATOM   6694 C  CG1 . VAL C 1 245 ? 40.575 52.240  66.135  1.00 21.20  ? 268 VAL C CG1 1 
ATOM   6695 C  CG2 . VAL C 1 245 ? 39.112 50.912  64.572  1.00 16.28  ? 268 VAL C CG2 1 
ATOM   6696 N  N   . GLY C 1 246 ? 36.852 54.080  64.594  1.00 10.59  ? 269 GLY C N   1 
ATOM   6697 C  CA  . GLY C 1 246 ? 35.865 54.410  63.574  1.00 10.30  ? 269 GLY C CA  1 
ATOM   6698 C  C   . GLY C 1 246 ? 34.515 54.825  64.124  1.00 9.13   ? 269 GLY C C   1 
ATOM   6699 O  O   . GLY C 1 246 ? 33.471 54.433  63.597  1.00 9.80   ? 269 GLY C O   1 
ATOM   6700 N  N   . GLY C 1 247 ? 34.526 55.647  65.170  1.00 8.67   ? 270 GLY C N   1 
ATOM   6701 C  CA  . GLY C 1 247 ? 33.289 56.024  65.830  1.00 7.99   ? 270 GLY C CA  1 
ATOM   6702 C  C   . GLY C 1 247 ? 32.708 57.351  65.386  1.00 10.43  ? 270 GLY C C   1 
ATOM   6703 O  O   . GLY C 1 247 ? 33.179 57.959  64.414  1.00 7.34   ? 270 GLY C O   1 
ATOM   6704 N  N   . LEU C 1 248 ? 31.704 57.808  66.130  1.00 6.67   ? 271 LEU C N   1 
ATOM   6705 C  CA  . LEU C 1 248 ? 31.062 59.101  65.886  1.00 8.15   ? 271 LEU C CA  1 
ATOM   6706 C  C   . LEU C 1 248 ? 32.085 60.214  66.002  1.00 10.06  ? 271 LEU C C   1 
ATOM   6707 O  O   . LEU C 1 248 ? 32.984 60.153  66.850  1.00 8.64   ? 271 LEU C O   1 
ATOM   6708 C  CB  . LEU C 1 248 ? 29.981 59.366  66.932  1.00 6.95   ? 271 LEU C CB  1 
ATOM   6709 C  CG  . LEU C 1 248 ? 28.820 58.393  67.047  1.00 7.97   ? 271 LEU C CG  1 
ATOM   6710 C  CD1 . LEU C 1 248 ? 27.973 58.806  68.247  1.00 5.86   ? 271 LEU C CD1 1 
ATOM   6711 C  CD2 . LEU C 1 248 ? 27.971 58.379  65.757  1.00 7.84   ? 271 LEU C CD2 1 
ATOM   6712 N  N   . THR C 1 249 ? 31.933 61.236  65.169  1.00 8.93   ? 272 THR C N   1 
ATOM   6713 C  CA  . THR C 1 249 ? 32.717 62.453  65.305  1.00 9.17   ? 272 THR C CA  1 
ATOM   6714 C  C   . THR C 1 249 ? 32.081 63.293  66.404  1.00 9.27   ? 272 THR C C   1 
ATOM   6715 O  O   . THR C 1 249 ? 30.953 63.032  66.837  1.00 6.80   ? 272 THR C O   1 
ATOM   6716 C  CB  . THR C 1 249 ? 32.734 63.272  64.004  1.00 8.08   ? 272 THR C CB  1 
ATOM   6717 O  OG1 . THR C 1 249 ? 31.399 63.690  63.690  1.00 7.87   ? 272 THR C OG1 1 
ATOM   6718 C  CG2 . THR C 1 249 ? 33.282 62.441  62.835  1.00 9.12   ? 272 THR C CG2 1 
ATOM   6719 N  N   . TYR C 1 250 ? 32.812 64.290  66.869  1.00 8.21   ? 273 TYR C N   1 
ATOM   6720 C  CA  . TYR C 1 250 ? 32.264 65.229  67.829  1.00 6.68   ? 273 TYR C CA  1 
ATOM   6721 C  C   . TYR C 1 250 ? 30.968 65.826  67.292  1.00 8.39   ? 273 TYR C C   1 
ATOM   6722 O  O   . TYR C 1 250 ? 29.951 65.873  67.984  1.00 8.83   ? 273 TYR C O   1 
ATOM   6723 C  CB  . TYR C 1 250 ? 33.279 66.341  68.120  1.00 6.71   ? 273 TYR C CB  1 
ATOM   6724 C  CG  . TYR C 1 250 ? 32.741 67.373  69.082  1.00 8.14   ? 273 TYR C CG  1 
ATOM   6725 C  CD1 . TYR C 1 250 ? 32.842 67.182  70.452  1.00 13.38  ? 273 TYR C CD1 1 
ATOM   6726 C  CD2 . TYR C 1 250 ? 32.139 68.539  68.622  1.00 11.40  ? 273 TYR C CD2 1 
ATOM   6727 C  CE1 . TYR C 1 250 ? 32.347 68.111  71.345  1.00 12.04  ? 273 TYR C CE1 1 
ATOM   6728 C  CE2 . TYR C 1 250 ? 31.639 69.486  69.513  1.00 12.04  ? 273 TYR C CE2 1 
ATOM   6729 C  CZ  . TYR C 1 250 ? 31.744 69.256  70.873  1.00 12.68  ? 273 TYR C CZ  1 
ATOM   6730 O  OH  . TYR C 1 250 ? 31.264 70.174  71.778  1.00 11.80  ? 273 TYR C OH  1 
ATOM   6731 N  N   . ARG C 1 251 ? 31.006 66.285  66.050  1.00 7.53   ? 274 ARG C N   1 
ATOM   6732 C  CA  . ARG C 1 251 ? 29.826 66.917  65.463  1.00 7.42   ? 274 ARG C CA  1 
ATOM   6733 C  C   . ARG C 1 251 ? 28.624 65.980  65.378  1.00 9.42   ? 274 ARG C C   1 
ATOM   6734 O  O   . ARG C 1 251 ? 27.491 66.395  65.639  1.00 8.37   ? 274 ARG C O   1 
ATOM   6735 C  CB  . ARG C 1 251 ? 30.172 67.504  64.094  1.00 7.26   ? 274 ARG C CB  1 
ATOM   6736 C  CG  . ARG C 1 251 ? 31.042 68.772  64.195  1.00 6.07   ? 274 ARG C CG  1 
ATOM   6737 C  CD  . ARG C 1 251 ? 31.839 69.019  62.929  1.00 10.09  ? 274 ARG C CD  1 
ATOM   6738 N  NE  . ARG C 1 251 ? 30.984 69.085  61.737  1.00 9.67   ? 274 ARG C NE  1 
ATOM   6739 C  CZ  . ARG C 1 251 ? 31.439 69.294  60.501  1.00 10.31  ? 274 ARG C CZ  1 
ATOM   6740 N  NH1 . ARG C 1 251 ? 32.733 69.471  60.292  1.00 6.52   ? 274 ARG C NH1 1 
ATOM   6741 N  NH2 . ARG C 1 251 ? 30.595 69.333  59.472  1.00 9.69   ? 274 ARG C NH2 1 
ATOM   6742 N  N   . GLU C 1 252 ? 28.859 64.716  65.029  1.00 8.27   ? 275 GLU C N   1 
ATOM   6743 C  CA  . GLU C 1 252 ? 27.760 63.753  64.965  1.00 9.17   ? 275 GLU C CA  1 
ATOM   6744 C  C   . GLU C 1 252 ? 27.115 63.536  66.314  1.00 10.40  ? 275 GLU C C   1 
ATOM   6745 O  O   . GLU C 1 252 ? 25.890 63.463  66.421  1.00 8.08   ? 275 GLU C O   1 
ATOM   6746 C  CB  . GLU C 1 252 ? 28.243 62.420  64.385  1.00 6.86   ? 275 GLU C CB  1 
ATOM   6747 C  CG  . GLU C 1 252 ? 28.453 62.485  62.873  1.00 9.84   ? 275 GLU C CG  1 
ATOM   6748 C  CD  . GLU C 1 252 ? 29.197 61.288  62.323  1.00 11.29  ? 275 GLU C CD  1 
ATOM   6749 O  OE1 . GLU C 1 252 ? 29.940 60.632  63.095  1.00 11.17  ? 275 GLU C OE1 1 
ATOM   6750 O  OE2 . GLU C 1 252 ? 29.064 61.017  61.103  1.00 10.45  ? 275 GLU C OE2 1 
ATOM   6751 N  N   . GLY C 1 253 ? 27.955 63.386  67.339  1.00 9.91   ? 276 GLY C N   1 
ATOM   6752 C  CA  . GLY C 1 253 ? 27.470 63.221  68.696  1.00 8.53   ? 276 GLY C CA  1 
ATOM   6753 C  C   . GLY C 1 253 ? 26.625 64.390  69.148  1.00 10.76  ? 276 GLY C C   1 
ATOM   6754 O  O   . GLY C 1 253 ? 25.555 64.211  69.750  1.00 11.30  ? 276 GLY C O   1 
ATOM   6755 N  N   . MET C 1 254 ? 27.110 65.599  68.888  1.00 8.38   ? 277 MET C N   1 
ATOM   6756 C  CA  . MET C 1 254 ? 26.326 66.777  69.225  1.00 8.53   ? 277 MET C CA  1 
ATOM   6757 C  C   . MET C 1 254 ? 25.012 66.790  68.460  1.00 6.95   ? 277 MET C C   1 
ATOM   6758 O  O   . MET C 1 254 ? 23.970 67.166  68.997  1.00 10.42  ? 277 MET C O   1 
ATOM   6759 C  CB  . MET C 1 254 ? 27.104 68.066  68.948  1.00 9.53   ? 277 MET C CB  1 
ATOM   6760 C  CG  . MET C 1 254 ? 28.355 68.240  69.804  1.00 10.23  ? 277 MET C CG  1 
ATOM   6761 S  SD  . MET C 1 254 ? 28.047 68.061  71.573  1.00 14.88  ? 277 MET C SD  1 
ATOM   6762 C  CE  . MET C 1 254 ? 28.608 66.392  71.875  1.00 8.97   ? 277 MET C CE  1 
ATOM   6763 N  N   . TYR C 1 255 ? 25.061 66.375  67.202  1.00 11.57  ? 278 TYR C N   1 
ATOM   6764 C  CA  . TYR C 1 255 ? 23.853 66.394  66.388  1.00 8.92   ? 278 TYR C CA  1 
ATOM   6765 C  C   . TYR C 1 255 ? 22.786 65.458  66.959  1.00 12.41  ? 278 TYR C C   1 
ATOM   6766 O  O   . TYR C 1 255 ? 21.605 65.810  67.053  1.00 13.77  ? 278 TYR C O   1 
ATOM   6767 C  CB  . TYR C 1 255 ? 24.161 66.070  64.917  1.00 10.10  ? 278 TYR C CB  1 
ATOM   6768 C  CG  . TYR C 1 255 ? 22.956 66.345  64.064  1.00 13.40  ? 278 TYR C CG  1 
ATOM   6769 C  CD1 . TYR C 1 255 ? 22.737 67.603  63.515  1.00 15.99  ? 278 TYR C CD1 1 
ATOM   6770 C  CD2 . TYR C 1 255 ? 22.002 65.361  63.860  1.00 15.16  ? 278 TYR C CD2 1 
ATOM   6771 C  CE1 . TYR C 1 255 ? 21.601 67.861  62.760  1.00 15.63  ? 278 TYR C CE1 1 
ATOM   6772 C  CE2 . TYR C 1 255 ? 20.884 65.601  63.113  1.00 16.18  ? 278 TYR C CE2 1 
ATOM   6773 C  CZ  . TYR C 1 255 ? 20.680 66.845  62.573  1.00 16.89  ? 278 TYR C CZ  1 
ATOM   6774 O  OH  . TYR C 1 255 ? 19.545 67.053  61.840  1.00 25.41  ? 278 TYR C OH  1 
ATOM   6775 N  N   . ILE C 1 256 ? 23.202 64.261  67.344  1.00 8.21   ? 279 ILE C N   1 
ATOM   6776 C  CA  . ILE C 1 256 ? 22.286 63.325  67.988  1.00 8.51   ? 279 ILE C CA  1 
ATOM   6777 C  C   . ILE C 1 256 ? 21.619 63.975  69.183  1.00 10.62  ? 279 ILE C C   1 
ATOM   6778 O  O   . ILE C 1 256 ? 20.387 63.963  69.329  1.00 8.46   ? 279 ILE C O   1 
ATOM   6779 C  CB  . ILE C 1 256 ? 23.039 62.072  68.458  1.00 9.63   ? 279 ILE C CB  1 
ATOM   6780 C  CG1 . ILE C 1 256 ? 23.580 61.312  67.246  1.00 7.93   ? 279 ILE C CG1 1 
ATOM   6781 C  CG2 . ILE C 1 256 ? 22.144 61.183  69.325  1.00 8.34   ? 279 ILE C CG2 1 
ATOM   6782 C  CD1 . ILE C 1 256 ? 24.537 60.179  67.609  1.00 11.18  ? 279 ILE C CD1 1 
ATOM   6783 N  N   . ALA C 1 257 ? 22.439 64.554  70.045  1.00 7.95   ? 280 ALA C N   1 
ATOM   6784 C  CA  . ALA C 1 257 ? 21.930 65.128  71.282  1.00 9.82   ? 280 ALA C CA  1 
ATOM   6785 C  C   . ALA C 1 257 ? 20.989 66.302  71.014  1.00 13.23  ? 280 ALA C C   1 
ATOM   6786 O  O   . ALA C 1 257 ? 19.960 66.458  71.694  1.00 12.41  ? 280 ALA C O   1 
ATOM   6787 C  CB  . ALA C 1 257 ? 23.094 65.547  72.167  1.00 9.89   ? 280 ALA C CB  1 
ATOM   6788 N  N   . GLU C 1 258 ? 21.364 67.141  70.047  1.00 12.28  ? 281 GLU C N   1 
ATOM   6789 C  CA  . GLU C 1 258 ? 20.526 68.259  69.612  1.00 13.56  ? 281 GLU C CA  1 
ATOM   6790 C  C   . GLU C 1 258 ? 19.176 67.764  69.131  1.00 14.13  ? 281 GLU C C   1 
ATOM   6791 O  O   . GLU C 1 258 ? 18.145 68.359  69.444  1.00 12.03  ? 281 GLU C O   1 
ATOM   6792 C  CB  . GLU C 1 258 ? 21.216 69.052  68.502  1.00 13.96  ? 281 GLU C CB  1 
ATOM   6793 C  CG  . GLU C 1 258 ? 22.323 69.953  69.008  1.00 10.73  ? 281 GLU C CG  1 
ATOM   6794 C  CD  . GLU C 1 258 ? 23.271 70.430  67.913  1.00 20.00  ? 281 GLU C CD  1 
ATOM   6795 O  OE1 . GLU C 1 258 ? 23.111 70.045  66.728  1.00 17.00  ? 281 GLU C OE1 1 
ATOM   6796 O  OE2 . GLU C 1 258 ? 24.191 71.200  68.254  1.00 14.01  ? 281 GLU C OE2 1 
ATOM   6797 N  N   . GLU C 1 259 ? 19.176 66.690  68.344  1.00 10.98  ? 282 GLU C N   1 
ATOM   6798 C  CA  . GLU C 1 259 ? 17.900 66.171  67.843  1.00 10.22  ? 282 GLU C CA  1 
ATOM   6799 C  C   . GLU C 1 259 ? 17.059 65.581  68.963  1.00 13.08  ? 282 GLU C C   1 
ATOM   6800 O  O   . GLU C 1 259 ? 15.835 65.744  68.982  1.00 13.49  ? 282 GLU C O   1 
ATOM   6801 C  CB  . GLU C 1 259 ? 18.091 65.162  66.702  1.00 10.90  ? 282 GLU C CB  1 
ATOM   6802 C  CG  . GLU C 1 259 ? 18.469 65.841  65.415  1.00 15.04  ? 282 GLU C CG  1 
ATOM   6803 C  CD  . GLU C 1 259 ? 17.560 67.029  65.120  1.00 21.87  ? 282 GLU C CD  1 
ATOM   6804 O  OE1 . GLU C 1 259 ? 16.367 66.822  64.810  1.00 18.07  ? 282 GLU C OE1 1 
ATOM   6805 O  OE2 . GLU C 1 259 ? 18.038 68.176  65.240  1.00 21.76  ? 282 GLU C OE2 1 
ATOM   6806 N  N   . ILE C 1 260 ? 17.711 64.910  69.906  1.00 11.21  ? 283 ILE C N   1 
ATOM   6807 C  CA  . ILE C 1 260 ? 17.014 64.443  71.099  1.00 11.62  ? 283 ILE C CA  1 
ATOM   6808 C  C   . ILE C 1 260 ? 16.342 65.615  71.810  1.00 15.21  ? 283 ILE C C   1 
ATOM   6809 O  O   . ILE C 1 260 ? 15.157 65.555  72.130  1.00 15.08  ? 283 ILE C O   1 
ATOM   6810 C  CB  . ILE C 1 260 ? 17.980 63.725  72.072  1.00 14.22  ? 283 ILE C CB  1 
ATOM   6811 C  CG1 . ILE C 1 260 ? 18.425 62.384  71.471  1.00 13.52  ? 283 ILE C CG1 1 
ATOM   6812 C  CG2 . ILE C 1 260 ? 17.329 63.514  73.439  1.00 15.84  ? 283 ILE C CG2 1 
ATOM   6813 C  CD1 . ILE C 1 260 ? 17.314 61.327  71.397  1.00 19.62  ? 283 ILE C CD1 1 
ATOM   6814 N  N   . HIS C 1 261 ? 17.095 66.682  72.053  1.00 11.17  ? 284 HIS C N   1 
ATOM   6815 C  CA  . HIS C 1 261 ? 16.520 67.851  72.700  1.00 13.08  ? 284 HIS C CA  1 
ATOM   6816 C  C   . HIS C 1 261 ? 15.352 68.430  71.912  1.00 14.98  ? 284 HIS C C   1 
ATOM   6817 O  O   . HIS C 1 261 ? 14.348 68.856  72.493  1.00 14.05  ? 284 HIS C O   1 
ATOM   6818 C  CB  . HIS C 1 261 ? 17.555 68.951  72.889  1.00 10.31  ? 284 HIS C CB  1 
ATOM   6819 C  CG  . HIS C 1 261 ? 16.947 70.237  73.357  1.00 13.44  ? 284 HIS C CG  1 
ATOM   6820 N  ND1 . HIS C 1 261 ? 16.396 70.375  74.605  1.00 16.88  ? 284 HIS C ND1 1 
ATOM   6821 C  CD2 . HIS C 1 261 ? 16.777 71.419  72.719  1.00 16.29  ? 284 HIS C CD2 1 
ATOM   6822 C  CE1 . HIS C 1 261 ? 15.915 71.607  74.733  1.00 19.79  ? 284 HIS C CE1 1 
ATOM   6823 N  NE2 . HIS C 1 261 ? 16.127 72.252  73.608  1.00 19.71  ? 284 HIS C NE2 1 
ATOM   6824 N  N   . ASN C 1 262 ? 15.501 68.477  70.593  1.00 13.33  ? 285 ASN C N   1 
ATOM   6825 C  CA  . ASN C 1 262 ? 14.484 69.108  69.757  1.00 18.83  ? 285 ASN C CA  1 
ATOM   6826 C  C   . ASN C 1 262 ? 13.150 68.382  69.753  1.00 22.28  ? 285 ASN C C   1 
ATOM   6827 O  O   . ASN C 1 262 ? 12.132 68.977  69.405  1.00 18.54  ? 285 ASN C O   1 
ATOM   6828 C  CB  . ASN C 1 262 ? 14.978 69.308  68.323  1.00 15.27  ? 285 ASN C CB  1 
ATOM   6829 C  CG  . ASN C 1 262 ? 16.022 70.396  68.222  1.00 21.78  ? 285 ASN C CG  1 
ATOM   6830 O  OD1 . ASN C 1 262 ? 16.172 71.203  69.136  1.00 21.20  ? 285 ASN C OD1 1 
ATOM   6831 N  ND2 . ASN C 1 262 ? 16.749 70.425  67.109  1.00 20.94  ? 285 ASN C ND2 1 
ATOM   6832 N  N   . THR C 1 263 ? 13.138 67.109  70.145  1.00 12.35  ? 286 THR C N   1 
ATOM   6833 C  CA  . THR C 1 263 ? 11.872 66.383  70.239  1.00 18.41  ? 286 THR C CA  1 
ATOM   6834 C  C   . THR C 1 263 ? 11.022 66.934  71.366  1.00 21.53  ? 286 THR C C   1 
ATOM   6835 O  O   . THR C 1 263 ? 9.801  66.793  71.353  1.00 15.88  ? 286 THR C O   1 
ATOM   6836 C  CB  . THR C 1 263 ? 12.065 64.884  70.532  1.00 15.02  ? 286 THR C CB  1 
ATOM   6837 O  OG1 . THR C 1 263 ? 12.638 64.740  71.837  1.00 14.37  ? 286 THR C OG1 1 
ATOM   6838 C  CG2 . THR C 1 263 ? 12.958 64.239  69.492  1.00 18.22  ? 286 THR C CG2 1 
ATOM   6839 N  N   . GLY C 1 264 ? 11.679 67.527  72.359  1.00 17.66  ? 287 GLY C N   1 
ATOM   6840 C  CA  . GLY C 1 264 ? 10.996 67.978  73.558  1.00 19.40  ? 287 GLY C CA  1 
ATOM   6841 C  C   . GLY C 1 264 ? 10.520 66.829  74.433  1.00 22.66  ? 287 GLY C C   1 
ATOM   6842 O  O   . GLY C 1 264 ? 9.782  67.039  75.397  1.00 21.13  ? 287 GLY C O   1 
ATOM   6843 N  N   . LEU C 1 265 ? 10.960 65.613  74.117  1.00 14.93  ? 288 LEU C N   1 
ATOM   6844 C  CA  . LEU C 1 265 ? 10.452 64.411  74.789  1.00 17.70  ? 288 LEU C CA  1 
ATOM   6845 C  C   . LEU C 1 265 ? 11.476 63.681  75.666  1.00 18.74  ? 288 LEU C C   1 
ATOM   6846 O  O   . LEU C 1 265 ? 11.168 62.628  76.220  1.00 14.70  ? 288 LEU C O   1 
ATOM   6847 C  CB  . LEU C 1 265 ? 9.857  63.437  73.761  1.00 16.60  ? 288 LEU C CB  1 
ATOM   6848 C  CG  . LEU C 1 265 ? 8.629  63.991  73.024  1.00 20.53  ? 288 LEU C CG  1 
ATOM   6849 C  CD1 . LEU C 1 265 ? 8.316  63.161  71.801  1.00 16.55  ? 288 LEU C CD1 1 
ATOM   6850 C  CD2 . LEU C 1 265 ? 7.442  64.009  73.973  1.00 18.70  ? 288 LEU C CD2 1 
ATOM   6851 N  N   . LEU C 1 266 ? 12.687 64.219  75.786  1.00 15.39  ? 289 LEU C N   1 
ATOM   6852 C  CA  . LEU C 1 266 ? 13.711 63.570  76.617  1.00 17.16  ? 289 LEU C CA  1 
ATOM   6853 C  C   . LEU C 1 266 ? 13.257 63.472  78.069  1.00 19.94  ? 289 LEU C C   1 
ATOM   6854 O  O   . LEU C 1 266 ? 12.970 64.483  78.705  1.00 17.12  ? 289 LEU C O   1 
ATOM   6855 C  CB  . LEU C 1 266 ? 15.049 64.315  76.552  1.00 13.97  ? 289 LEU C CB  1 
ATOM   6856 C  CG  . LEU C 1 266 ? 16.152 63.669  77.408  1.00 14.64  ? 289 LEU C CG  1 
ATOM   6857 C  CD1 . LEU C 1 266 ? 16.490 62.258  76.922  1.00 12.97  ? 289 LEU C CD1 1 
ATOM   6858 C  CD2 . LEU C 1 266 ? 17.407 64.558  77.470  1.00 17.12  ? 289 LEU C CD2 1 
ATOM   6859 N  N   . SER C 1 267 ? 13.222 62.254  78.599  1.00 13.80  ? 290 SER C N   1 
ATOM   6860 C  CA  . SER C 1 267 ? 12.692 62.028  79.940  1.00 15.88  ? 290 SER C CA  1 
ATOM   6861 C  C   . SER C 1 267 ? 13.742 61.457  80.902  1.00 16.39  ? 290 SER C C   1 
ATOM   6862 O  O   . SER C 1 267 ? 13.683 61.693  82.109  1.00 17.19  ? 290 SER C O   1 
ATOM   6863 C  CB  . SER C 1 267 ? 11.460 61.120  79.865  1.00 17.80  ? 290 SER C CB  1 
ATOM   6864 O  OG  . SER C 1 267 ? 10.920 60.883  81.151  1.00 21.20  ? 290 SER C OG  1 
ATOM   6865 N  N   . ALA C 1 268 ? 14.696 60.705  80.360  1.00 13.51  ? 291 ALA C N   1 
ATOM   6866 C  CA  . ALA C 1 268 ? 15.840 60.230  81.137  1.00 14.81  ? 291 ALA C CA  1 
ATOM   6867 C  C   . ALA C 1 268 ? 17.024 60.027  80.214  1.00 16.55  ? 291 ALA C C   1 
ATOM   6868 O  O   . ALA C 1 268 ? 16.859 59.684  79.044  1.00 14.89  ? 291 ALA C O   1 
ATOM   6869 C  CB  . ALA C 1 268 ? 15.516 58.926  81.874  1.00 13.66  ? 291 ALA C CB  1 
ATOM   6870 N  N   . LEU C 1 269 ? 18.218 60.205  80.764  1.00 13.02  ? 292 LEU C N   1 
ATOM   6871 C  CA  . LEU C 1 269 ? 19.456 60.071  80.012  1.00 12.15  ? 292 LEU C CA  1 
ATOM   6872 C  C   . LEU C 1 269 ? 20.498 59.369  80.871  1.00 12.32  ? 292 LEU C C   1 
ATOM   6873 O  O   . LEU C 1 269 ? 20.663 59.706  82.045  1.00 13.40  ? 292 LEU C O   1 
ATOM   6874 C  CB  . LEU C 1 269 ? 19.958 61.460  79.596  1.00 12.12  ? 292 LEU C CB  1 
ATOM   6875 C  CG  . LEU C 1 269 ? 21.273 61.645  78.842  1.00 15.84  ? 292 LEU C CG  1 
ATOM   6876 C  CD1 . LEU C 1 269 ? 21.194 62.981  78.136  1.00 12.52  ? 292 LEU C CD1 1 
ATOM   6877 C  CD2 . LEU C 1 269 ? 22.476 61.667  79.775  1.00 12.72  ? 292 LEU C CD2 1 
ATOM   6878 N  N   . ASP C 1 270 ? 21.175 58.384  80.287  1.00 10.52  ? 293 ASP C N   1 
ATOM   6879 C  CA  . ASP C 1 270 ? 22.323 57.753  80.923  1.00 12.36  ? 293 ASP C CA  1 
ATOM   6880 C  C   . ASP C 1 270 ? 23.567 58.208  80.183  1.00 11.00  ? 293 ASP C C   1 
ATOM   6881 O  O   . ASP C 1 270 ? 23.571 58.236  78.953  1.00 10.91  ? 293 ASP C O   1 
ATOM   6882 C  CB  . ASP C 1 270 ? 22.273 56.229  80.813  1.00 9.49   ? 293 ASP C CB  1 
ATOM   6883 C  CG  . ASP C 1 270 ? 20.925 55.644  81.170  1.00 16.57  ? 293 ASP C CG  1 
ATOM   6884 O  OD1 . ASP C 1 270 ? 20.325 56.078  82.177  1.00 16.59  ? 293 ASP C OD1 1 
ATOM   6885 O  OD2 . ASP C 1 270 ? 20.486 54.729  80.436  1.00 14.78  ? 293 ASP C OD2 1 
ATOM   6886 N  N   . LEU C 1 271 ? 24.626 58.525  80.893  1.00 7.72   ? 294 LEU C N   1 
ATOM   6887 C  CA  . LEU C 1 271 ? 25.916 58.785  80.267  1.00 9.25   ? 294 LEU C CA  1 
ATOM   6888 C  C   . LEU C 1 271 ? 26.921 57.899  80.961  1.00 11.94  ? 294 LEU C C   1 
ATOM   6889 O  O   . LEU C 1 271 ? 27.324 58.201  82.043  1.00 13.08  ? 294 LEU C O   1 
ATOM   6890 C  CB  . LEU C 1 271 ? 26.351 60.222  80.413  1.00 9.37   ? 294 LEU C CB  1 
ATOM   6891 C  CG  . LEU C 1 271 ? 27.407 60.734  79.483  1.00 9.57   ? 294 LEU C CG  1 
ATOM   6892 C  CD1 . LEU C 1 271 ? 28.693 59.963  79.623  1.00 10.32  ? 294 LEU C CD1 1 
ATOM   6893 C  CD2 . LEU C 1 271 ? 26.945 60.732  78.054  1.00 13.46  ? 294 LEU C CD2 1 
ATOM   6894 N  N   . VAL C 1 272 ? 27.257 56.817  80.290  1.00 10.29  ? 295 VAL C N   1 
ATOM   6895 C  CA  . VAL C 1 272 ? 27.997 55.740  80.928  1.00 8.80   ? 295 VAL C CA  1 
ATOM   6896 C  C   . VAL C 1 272 ? 29.357 55.478  80.308  1.00 11.21  ? 295 VAL C C   1 
ATOM   6897 O  O   . VAL C 1 272 ? 29.670 55.969  79.218  1.00 9.11   ? 295 VAL C O   1 
ATOM   6898 C  CB  . VAL C 1 272 ? 27.182 54.431  80.924  1.00 12.46  ? 295 VAL C CB  1 
ATOM   6899 C  CG1 . VAL C 1 272 ? 25.825 54.665  81.587  1.00 10.41  ? 295 VAL C CG1 1 
ATOM   6900 C  CG2 . VAL C 1 272 ? 27.007 53.915  79.489  1.00 9.56   ? 295 VAL C CG2 1 
ATOM   6901 N  N   . GLU C 1 273 ? 30.163 54.731  81.056  1.00 9.66   ? 296 GLU C N   1 
ATOM   6902 C  CA  . GLU C 1 273 ? 31.434 54.157  80.611  1.00 10.14  ? 296 GLU C CA  1 
ATOM   6903 C  C   . GLU C 1 273 ? 32.608 55.117  80.521  1.00 9.27   ? 296 GLU C C   1 
ATOM   6904 O  O   . GLU C 1 273 ? 33.652 54.762  79.973  1.00 10.79  ? 296 GLU C O   1 
ATOM   6905 C  CB  . GLU C 1 273 ? 31.276 53.323  79.331  1.00 8.35   ? 296 GLU C CB  1 
ATOM   6906 C  CG  . GLU C 1 273 ? 30.294 52.141  79.503  1.00 9.25   ? 296 GLU C CG  1 
ATOM   6907 C  CD  . GLU C 1 273 ? 30.877 50.931  80.225  1.00 13.25  ? 296 GLU C CD  1 
ATOM   6908 O  OE1 . GLU C 1 273 ? 32.083 50.933  80.566  1.00 19.12  ? 296 GLU C OE1 1 
ATOM   6909 O  OE2 . GLU C 1 273 ? 30.111 49.962  80.446  1.00 14.77  ? 296 GLU C OE2 1 
ATOM   6910 N  N   . VAL C 1 274 ? 32.457 56.316  81.078  1.00 9.15   ? 297 VAL C N   1 
ATOM   6911 C  CA  . VAL C 1 274 ? 33.616 57.182  81.265  1.00 9.03   ? 297 VAL C CA  1 
ATOM   6912 C  C   . VAL C 1 274 ? 34.480 56.607  82.391  1.00 12.24  ? 297 VAL C C   1 
ATOM   6913 O  O   . VAL C 1 274 ? 34.039 56.512  83.530  1.00 12.11  ? 297 VAL C O   1 
ATOM   6914 C  CB  . VAL C 1 274 ? 33.211 58.638  81.578  1.00 11.77  ? 297 VAL C CB  1 
ATOM   6915 C  CG1 . VAL C 1 274 ? 34.444 59.475  81.927  1.00 12.04  ? 297 VAL C CG1 1 
ATOM   6916 C  CG2 . VAL C 1 274 ? 32.465 59.247  80.391  1.00 10.11  ? 297 VAL C CG2 1 
ATOM   6917 N  N   . ASN C 1 275 ? 35.702 56.210  82.058  1.00 13.31  ? 298 ASN C N   1 
ATOM   6918 C  CA  . ASN C 1 275 ? 36.636 55.649  83.039  1.00 15.57  ? 298 ASN C CA  1 
ATOM   6919 C  C   . ASN C 1 275 ? 37.922 56.450  83.008  1.00 11.02  ? 298 ASN C C   1 
ATOM   6920 O  O   . ASN C 1 275 ? 38.794 56.183  82.192  1.00 11.15  ? 298 ASN C O   1 
ATOM   6921 C  CB  . ASN C 1 275 ? 36.919 54.167  82.743  1.00 10.99  ? 298 ASN C CB  1 
ATOM   6922 C  CG  . ASN C 1 275 ? 37.825 53.504  83.804  1.00 17.36  ? 298 ASN C CG  1 
ATOM   6923 O  OD1 . ASN C 1 275 ? 38.523 54.188  84.557  1.00 12.26  ? 298 ASN C OD1 1 
ATOM   6924 N  ND2 . ASN C 1 275 ? 37.808 52.171  83.858  1.00 12.01  ? 298 ASN C ND2 1 
ATOM   6925 N  N   . PRO C 1 276 ? 38.037 57.445  83.899  1.00 11.58  ? 299 PRO C N   1 
ATOM   6926 C  CA  . PRO C 1 276 ? 39.190 58.358  83.857  1.00 13.77  ? 299 PRO C CA  1 
ATOM   6927 C  C   . PRO C 1 276 ? 40.517 57.653  84.115  1.00 16.87  ? 299 PRO C C   1 
ATOM   6928 O  O   . PRO C 1 276 ? 41.553 58.150  83.680  1.00 20.44  ? 299 PRO C O   1 
ATOM   6929 C  CB  . PRO C 1 276 ? 38.895 59.390  84.962  1.00 19.23  ? 299 PRO C CB  1 
ATOM   6930 C  CG  . PRO C 1 276 ? 37.767 58.862  85.752  1.00 19.73  ? 299 PRO C CG  1 
ATOM   6931 C  CD  . PRO C 1 276 ? 37.079 57.775  84.966  1.00 15.53  ? 299 PRO C CD  1 
ATOM   6932 N  N   . GLN C 1 277 ? 40.497 56.518  84.801  1.00 13.43  ? 300 GLN C N   1 
ATOM   6933 C  CA  . GLN C 1 277 ? 41.738 55.789  85.069  1.00 18.47  ? 300 GLN C CA  1 
ATOM   6934 C  C   . GLN C 1 277 ? 42.350 55.150  83.832  1.00 20.87  ? 300 GLN C C   1 
ATOM   6935 O  O   . GLN C 1 277 ? 43.523 54.787  83.839  1.00 22.34  ? 300 GLN C O   1 
ATOM   6936 C  CB  . GLN C 1 277 ? 41.526 54.715  86.141  1.00 19.59  ? 300 GLN C CB  1 
ATOM   6937 C  CG  . GLN C 1 277 ? 41.264 55.263  87.522  1.00 29.51  ? 300 GLN C CG  1 
ATOM   6938 C  CD  . GLN C 1 277 ? 41.257 54.174  88.572  1.00 31.08  ? 300 GLN C CD  1 
ATOM   6939 O  OE1 . GLN C 1 277 ? 40.554 54.273  89.575  1.00 45.23  ? 300 GLN C OE1 1 
ATOM   6940 N  NE2 . GLN C 1 277 ? 42.045 53.127  88.347  1.00 45.05  ? 300 GLN C NE2 1 
ATOM   6941 N  N   . LEU C 1 278 ? 41.571 55.004  82.764  1.00 16.14  ? 301 LEU C N   1 
ATOM   6942 C  CA  . LEU C 1 278 ? 42.098 54.362  81.557  1.00 16.93  ? 301 LEU C CA  1 
ATOM   6943 C  C   . LEU C 1 278 ? 42.732 55.381  80.642  1.00 22.31  ? 301 LEU C C   1 
ATOM   6944 O  O   . LEU C 1 278 ? 43.321 55.037  79.609  1.00 21.85  ? 301 LEU C O   1 
ATOM   6945 C  CB  . LEU C 1 278 ? 41.002 53.590  80.820  1.00 20.53  ? 301 LEU C CB  1 
ATOM   6946 C  CG  . LEU C 1 278 ? 40.453 52.423  81.635  1.00 18.66  ? 301 LEU C CG  1 
ATOM   6947 C  CD1 . LEU C 1 278 ? 39.384 51.670  80.861  1.00 13.39  ? 301 LEU C CD1 1 
ATOM   6948 C  CD2 . LEU C 1 278 ? 41.596 51.486  82.025  1.00 21.54  ? 301 LEU C CD2 1 
ATOM   6949 N  N   . ALA C 1 279 ? 42.617 56.640  81.036  1.00 17.82  ? 302 ALA C N   1 
ATOM   6950 C  CA  . ALA C 1 279 ? 43.249 57.710  80.301  1.00 21.82  ? 302 ALA C CA  1 
ATOM   6951 C  C   . ALA C 1 279 ? 44.749 57.551  80.454  1.00 27.51  ? 302 ALA C C   1 
ATOM   6952 O  O   . ALA C 1 279 ? 45.255 57.248  81.534  1.00 25.84  ? 302 ALA C O   1 
ATOM   6953 C  CB  . ALA C 1 279 ? 42.809 59.031  80.841  1.00 20.88  ? 302 ALA C CB  1 
ATOM   6954 N  N   . THR C 1 280 ? 45.539 57.723  79.425  1.00 23.19  ? 303 THR C N   1 
ATOM   6955 C  CA  . THR C 1 280 ? 46.988 57.624  79.649  1.00 31.36  ? 303 THR C CA  1 
ATOM   6956 C  C   . THR C 1 280 ? 47.556 58.975  80.124  1.00 33.08  ? 303 THR C C   1 
ATOM   6957 O  O   . THR C 1 280 ? 48.676 59.073  80.614  1.00 29.33  ? 303 THR C O   1 
ATOM   6958 C  CB  . THR C 1 280 ? 47.622 57.112  78.354  1.00 31.97  ? 303 THR C CB  1 
ATOM   6959 O  OG1 . THR C 1 280 ? 48.021 55.768  78.540  1.00 44.18  ? 303 THR C OG1 1 
ATOM   6960 C  CG2 . THR C 1 280 ? 48.679 57.947  77.872  1.00 41.36  ? 303 THR C CG2 1 
ATOM   6961 N  N   . SER C 1 281 ? 46.776 60.033  79.895  1.00 22.09  ? 304 SER C N   1 
ATOM   6962 C  CA  . SER C 1 281 ? 47.230 61.326  80.386  1.00 29.10  ? 304 SER C CA  1 
ATOM   6963 C  C   . SER C 1 281 ? 46.070 62.045  81.056  1.00 29.25  ? 304 SER C C   1 
ATOM   6964 O  O   . SER C 1 281 ? 44.899 61.699  80.855  1.00 23.69  ? 304 SER C O   1 
ATOM   6965 C  CB  . SER C 1 281 ? 47.751 62.190  79.242  1.00 25.33  ? 304 SER C CB  1 
ATOM   6966 O  OG  . SER C 1 281 ? 46.694 62.590  78.384  1.00 25.82  ? 304 SER C OG  1 
ATOM   6967 N  N   . GLU C 1 282 ? 46.391 63.063  81.838  1.00 25.34  ? 305 GLU C N   1 
ATOM   6968 C  CA  . GLU C 1 282 ? 45.362 63.854  82.488  1.00 22.91  ? 305 GLU C CA  1 
ATOM   6969 C  C   . GLU C 1 282 ? 44.479 64.545  81.444  1.00 28.10  ? 305 GLU C C   1 
ATOM   6970 O  O   . GLU C 1 282 ? 43.259 64.651  81.604  1.00 23.44  ? 305 GLU C O   1 
ATOM   6971 C  CB  . GLU C 1 282 ? 46.023 64.882  83.411  1.00 45.76  ? 305 GLU C CB  1 
ATOM   6972 C  CG  . GLU C 1 282 ? 45.087 65.622  84.344  1.00 56.18  ? 305 GLU C CG  1 
ATOM   6973 C  CD  . GLU C 1 282 ? 44.732 64.820  85.582  1.00 74.36  ? 305 GLU C CD  1 
ATOM   6974 O  OE1 . GLU C 1 282 ? 44.530 63.592  85.465  1.00 69.74  ? 305 GLU C OE1 1 
ATOM   6975 O  OE2 . GLU C 1 282 ? 44.672 65.419  86.679  1.00 76.83  ? 305 GLU C OE2 1 
ATOM   6976 N  N   . GLU C 1 283 ? 45.103 64.958  80.349  1.00 19.58  ? 306 GLU C N   1 
ATOM   6977 C  CA  . GLU C 1 283 ? 44.392 65.562  79.236  1.00 28.93  ? 306 GLU C CA  1 
ATOM   6978 C  C   . GLU C 1 283 ? 43.353 64.616  78.634  1.00 24.92  ? 306 GLU C C   1 
ATOM   6979 O  O   . GLU C 1 283 ? 42.234 65.032  78.361  1.00 22.98  ? 306 GLU C O   1 
ATOM   6980 C  CB  . GLU C 1 283 ? 45.389 66.013  78.166  1.00 27.34  ? 306 GLU C CB  1 
ATOM   6981 C  CG  . GLU C 1 283 ? 44.753 66.725  76.989  1.00 43.53  ? 306 GLU C CG  1 
ATOM   6982 C  CD  . GLU C 1 283 ? 44.783 65.881  75.730  1.00 66.49  ? 306 GLU C CD  1 
ATOM   6983 O  OE1 . GLU C 1 283 ? 45.899 65.590  75.242  1.00 72.94  ? 306 GLU C OE1 1 
ATOM   6984 O  OE2 . GLU C 1 283 ? 43.695 65.500  75.236  1.00 61.75  ? 306 GLU C OE2 1 
ATOM   6985 N  N   . GLU C 1 284 ? 43.722 63.354  78.426  1.00 20.35  ? 307 GLU C N   1 
ATOM   6986 C  CA  . GLU C 1 284 ? 42.791 62.367  77.873  1.00 21.65  ? 307 GLU C CA  1 
ATOM   6987 C  C   . GLU C 1 284 ? 41.578 62.151  78.779  1.00 24.06  ? 307 GLU C C   1 
ATOM   6988 O  O   . GLU C 1 284 ? 40.449 61.994  78.301  1.00 17.26  ? 307 GLU C O   1 
ATOM   6989 C  CB  . GLU C 1 284 ? 43.495 61.024  77.638  1.00 18.66  ? 307 GLU C CB  1 
ATOM   6990 C  CG  . GLU C 1 284 ? 44.368 60.961  76.396  1.00 25.07  ? 307 GLU C CG  1 
ATOM   6991 C  CD  . GLU C 1 284 ? 44.772 59.533  76.058  1.00 33.22  ? 307 GLU C CD  1 
ATOM   6992 O  OE1 . GLU C 1 284 ? 44.503 58.626  76.877  1.00 29.97  ? 307 GLU C OE1 1 
ATOM   6993 O  OE2 . GLU C 1 284 ? 45.364 59.315  74.980  1.00 32.33  ? 307 GLU C OE2 1 
ATOM   6994 N  N   . ALA C 1 285 ? 41.811 62.139  80.087  1.00 14.89  ? 308 ALA C N   1 
ATOM   6995 C  CA  . ALA C 1 285 ? 40.720 61.981  81.034  1.00 16.03  ? 308 ALA C CA  1 
ATOM   6996 C  C   . ALA C 1 285 ? 39.819 63.195  80.976  1.00 16.67  ? 308 ALA C C   1 
ATOM   6997 O  O   . ALA C 1 285 ? 38.595 63.066  80.895  1.00 13.77  ? 308 ALA C O   1 
ATOM   6998 C  CB  . ALA C 1 285 ? 41.258 61.770  82.465  1.00 18.77  ? 308 ALA C CB  1 
ATOM   6999 N  N   . LYS C 1 286 ? 40.415 64.383  80.999  1.00 13.96  ? 309 LYS C N   1 
ATOM   7000 C  CA  . LYS C 1 286 ? 39.613 65.604  81.001  1.00 17.38  ? 309 LYS C CA  1 
ATOM   7001 C  C   . LYS C 1 286 ? 38.807 65.782  79.723  1.00 18.19  ? 309 LYS C C   1 
ATOM   7002 O  O   . LYS C 1 286 ? 37.655 66.214  79.766  1.00 15.26  ? 309 LYS C O   1 
ATOM   7003 C  CB  . LYS C 1 286 ? 40.477 66.847  81.232  1.00 19.28  ? 309 LYS C CB  1 
ATOM   7004 C  CG  . LYS C 1 286 ? 41.013 66.984  82.651  1.00 33.77  ? 309 LYS C CG  1 
ATOM   7005 C  CD  . LYS C 1 286 ? 41.642 68.354  82.841  1.00 42.17  ? 309 LYS C CD  1 
ATOM   7006 C  CE  . LYS C 1 286 ? 43.118 68.199  83.168  1.00 51.38  ? 309 LYS C CE  1 
ATOM   7007 N  NZ  . LYS C 1 286 ? 43.838 69.484  83.391  1.00 59.42  ? 309 LYS C NZ  1 
ATOM   7008 N  N   . THR C 1 287 ? 39.400 65.467  78.582  1.00 15.41  ? 310 THR C N   1 
ATOM   7009 C  CA  A THR C 1 287 ? 38.695 65.670  77.329  0.58 15.75  ? 310 THR C CA  1 
ATOM   7010 C  CA  B THR C 1 287 ? 38.687 65.650  77.320  0.42 15.76  ? 310 THR C CA  1 
ATOM   7011 C  C   . THR C 1 287 ? 37.498 64.713  77.233  1.00 12.96  ? 310 THR C C   1 
ATOM   7012 O  O   . THR C 1 287 ? 36.451 65.087  76.718  1.00 14.04  ? 310 THR C O   1 
ATOM   7013 C  CB  A THR C 1 287 ? 39.660 65.626  76.097  0.58 17.46  ? 310 THR C CB  1 
ATOM   7014 C  CB  B THR C 1 287 ? 39.581 65.467  76.072  0.42 17.45  ? 310 THR C CB  1 
ATOM   7015 O  OG1 A THR C 1 287 ? 38.967 66.029  74.906  0.58 13.96  ? 310 THR C OG1 1 
ATOM   7016 O  OG1 B THR C 1 287 ? 40.030 64.110  75.985  0.42 24.67  ? 310 THR C OG1 1 
ATOM   7017 C  CG2 A THR C 1 287 ? 40.276 64.254  75.912  0.58 24.48  ? 310 THR C CG2 1 
ATOM   7018 C  CG2 B THR C 1 287 ? 40.766 66.411  76.110  0.42 18.13  ? 310 THR C CG2 1 
ATOM   7019 N  N   . THR C 1 288 ? 37.650 63.493  77.753  1.00 11.91  ? 311 THR C N   1 
ATOM   7020 C  CA  . THR C 1 288 ? 36.540 62.517  77.748  1.00 11.37  ? 311 THR C CA  1 
ATOM   7021 C  C   . THR C 1 288 ? 35.386 63.009  78.600  1.00 11.51  ? 311 THR C C   1 
ATOM   7022 O  O   . THR C 1 288 ? 34.222 62.916  78.206  1.00 10.38  ? 311 THR C O   1 
ATOM   7023 C  CB  . THR C 1 288 ? 37.003 61.118  78.195  1.00 11.11  ? 311 THR C CB  1 
ATOM   7024 O  OG1 . THR C 1 288 ? 38.075 60.693  77.348  1.00 12.39  ? 311 THR C OG1 1 
ATOM   7025 C  CG2 . THR C 1 288 ? 35.867 60.091  78.101  1.00 10.51  ? 311 THR C CG2 1 
ATOM   7026 N  N   . ALA C 1 289 ? 35.723 63.539  79.772  1.00 13.03  ? 312 ALA C N   1 
ATOM   7027 C  CA  . ALA C 1 289 ? 34.731 64.076  80.684  1.00 12.49  ? 312 ALA C CA  1 
ATOM   7028 C  C   . ALA C 1 289 ? 34.055 65.312  80.109  1.00 11.16  ? 312 ALA C C   1 
ATOM   7029 O  O   . ALA C 1 289 ? 32.840 65.480  80.247  1.00 12.44  ? 312 ALA C O   1 
ATOM   7030 C  CB  . ALA C 1 289 ? 35.369 64.391  82.042  1.00 13.47  ? 312 ALA C CB  1 
ATOM   7031 N  N   . ASN C 1 290 ? 34.843 66.187  79.487  1.00 10.43  ? 313 ASN C N   1 
ATOM   7032 C  CA  . ASN C 1 290 ? 34.291 67.375  78.849  1.00 13.97  ? 313 ASN C CA  1 
ATOM   7033 C  C   . ASN C 1 290 ? 33.315 66.995  77.756  1.00 12.01  ? 313 ASN C C   1 
ATOM   7034 O  O   . ASN C 1 290 ? 32.270 67.629  77.597  1.00 11.50  ? 313 ASN C O   1 
ATOM   7035 C  CB  . ASN C 1 290 ? 35.403 68.239  78.242  1.00 13.57  ? 313 ASN C CB  1 
ATOM   7036 C  CG  . ASN C 1 290 ? 36.245 68.932  79.292  1.00 22.41  ? 313 ASN C CG  1 
ATOM   7037 O  OD1 . ASN C 1 290 ? 35.811 69.113  80.424  1.00 20.50  ? 313 ASN C OD1 1 
ATOM   7038 N  ND2 . ASN C 1 290 ? 37.455 69.347  78.908  1.00 20.52  ? 313 ASN C ND2 1 
ATOM   7039 N  N   . LEU C 1 291 ? 33.668 65.956  77.006  1.00 8.46   ? 314 LEU C N   1 
ATOM   7040 C  CA  . LEU C 1 291 ? 32.817 65.451  75.935  1.00 12.97  ? 314 LEU C CA  1 
ATOM   7041 C  C   . LEU C 1 291 ? 31.508 64.928  76.504  1.00 12.83  ? 314 LEU C C   1 
ATOM   7042 O  O   . LEU C 1 291 ? 30.437 65.163  75.942  1.00 9.00   ? 314 LEU C O   1 
ATOM   7043 C  CB  . LEU C 1 291 ? 33.532 64.325  75.190  1.00 10.43  ? 314 LEU C CB  1 
ATOM   7044 C  CG  . LEU C 1 291 ? 32.789 63.720  73.996  1.00 11.82  ? 314 LEU C CG  1 
ATOM   7045 C  CD1 . LEU C 1 291 ? 32.503 64.776  72.944  1.00 12.07  ? 314 LEU C CD1 1 
ATOM   7046 C  CD2 . LEU C 1 291 ? 33.613 62.573  73.415  1.00 13.61  ? 314 LEU C CD2 1 
ATOM   7047 N  N   . ALA C 1 292 ? 31.600 64.202  77.614  1.00 8.68   ? 315 ALA C N   1 
ATOM   7048 C  CA  . ALA C 1 292 ? 30.408 63.711  78.311  1.00 8.99   ? 315 ALA C CA  1 
ATOM   7049 C  C   . ALA C 1 292 ? 29.504 64.871  78.712  1.00 12.31  ? 315 ALA C C   1 
ATOM   7050 O  O   . ALA C 1 292 ? 28.282 64.816  78.552  1.00 8.07   ? 315 ALA C O   1 
ATOM   7051 C  CB  . ALA C 1 292 ? 30.817 62.895  79.552  1.00 7.30   ? 315 ALA C CB  1 
ATOM   7052 N  N   . VAL C 1 293 ? 30.104 65.928  79.245  1.00 7.96   ? 316 VAL C N   1 
ATOM   7053 C  CA  . VAL C 1 293 ? 29.328 67.102  79.605  1.00 9.67   ? 316 VAL C CA  1 
ATOM   7054 C  C   . VAL C 1 293 ? 28.678 67.752  78.372  1.00 11.40  ? 316 VAL C C   1 
ATOM   7055 O  O   . VAL C 1 293 ? 27.522 68.135  78.429  1.00 10.51  ? 316 VAL C O   1 
ATOM   7056 C  CB  . VAL C 1 293 ? 30.176 68.111  80.411  1.00 10.79  ? 316 VAL C CB  1 
ATOM   7057 C  CG1 . VAL C 1 293 ? 29.490 69.446  80.512  1.00 8.97   ? 316 VAL C CG1 1 
ATOM   7058 C  CG2 . VAL C 1 293 ? 30.449 67.553  81.824  1.00 10.41  ? 316 VAL C CG2 1 
ATOM   7059 N  N   . ASP C 1 294 ? 29.416 67.853  77.267  1.00 8.61   ? 317 ASP C N   1 
ATOM   7060 C  CA  . ASP C 1 294 ? 28.851 68.378  76.012  1.00 12.78  ? 317 ASP C CA  1 
ATOM   7061 C  C   . ASP C 1 294 ? 27.610 67.603  75.532  1.00 12.15  ? 317 ASP C C   1 
ATOM   7062 O  O   . ASP C 1 294 ? 26.616 68.195  75.101  1.00 9.91   ? 317 ASP C O   1 
ATOM   7063 C  CB  . ASP C 1 294 ? 29.916 68.394  74.903  1.00 11.93  ? 317 ASP C CB  1 
ATOM   7064 C  CG  . ASP C 1 294 ? 30.886 69.570  75.021  1.00 17.92  ? 317 ASP C CG  1 
ATOM   7065 O  OD1 . ASP C 1 294 ? 30.657 70.465  75.865  1.00 18.77  ? 317 ASP C OD1 1 
ATOM   7066 O  OD2 . ASP C 1 294 ? 31.880 69.593  74.255  1.00 16.25  ? 317 ASP C OD2 1 
ATOM   7067 N  N   . VAL C 1 295 ? 27.664 66.279  75.602  1.00 10.39  ? 318 VAL C N   1 
ATOM   7068 C  CA  . VAL C 1 295 ? 26.508 65.466  75.226  1.00 10.97  ? 318 VAL C CA  1 
ATOM   7069 C  C   . VAL C 1 295 ? 25.296 65.759  76.099  1.00 14.02  ? 318 VAL C C   1 
ATOM   7070 O  O   . VAL C 1 295 ? 24.191 65.971  75.600  1.00 8.86   ? 318 VAL C O   1 
ATOM   7071 C  CB  . VAL C 1 295 ? 26.821 63.961  75.338  1.00 8.28   ? 318 VAL C CB  1 
ATOM   7072 C  CG1 . VAL C 1 295 ? 25.554 63.127  75.112  1.00 11.23  ? 318 VAL C CG1 1 
ATOM   7073 C  CG2 . VAL C 1 295 ? 27.877 63.584  74.334  1.00 10.84  ? 318 VAL C CG2 1 
ATOM   7074 N  N   . ILE C 1 296 ? 25.493 65.758  77.412  1.00 10.77  ? 319 ILE C N   1 
ATOM   7075 C  CA  . ILE C 1 296 ? 24.373 65.990  78.312  1.00 8.91   ? 319 ILE C CA  1 
ATOM   7076 C  C   . ILE C 1 296 ? 23.805 67.393  78.121  1.00 13.22  ? 319 ILE C C   1 
ATOM   7077 O  O   . ILE C 1 296 ? 22.586 67.569  78.042  1.00 11.96  ? 319 ILE C O   1 
ATOM   7078 C  CB  . ILE C 1 296 ? 24.771 65.759  79.793  1.00 12.47  ? 319 ILE C CB  1 
ATOM   7079 C  CG1 . ILE C 1 296 ? 25.289 64.330  79.978  1.00 12.64  ? 319 ILE C CG1 1 
ATOM   7080 C  CG2 . ILE C 1 296 ? 23.585 65.995  80.706  1.00 12.43  ? 319 ILE C CG2 1 
ATOM   7081 C  CD1 . ILE C 1 296 ? 25.905 64.067  81.344  1.00 16.22  ? 319 ILE C CD1 1 
ATOM   7082 N  N   . ALA C 1 297 ? 24.681 68.392  78.034  1.00 10.72  ? 320 ALA C N   1 
ATOM   7083 C  CA  . ALA C 1 297 ? 24.214 69.772  77.846  1.00 11.93  ? 320 ALA C CA  1 
ATOM   7084 C  C   . ALA C 1 297 ? 23.455 69.941  76.527  1.00 12.40  ? 320 ALA C C   1 
ATOM   7085 O  O   . ALA C 1 297 ? 22.435 70.619  76.479  1.00 14.16  ? 320 ALA C O   1 
ATOM   7086 C  CB  . ALA C 1 297 ? 25.390 70.765  77.929  1.00 10.44  ? 320 ALA C CB  1 
ATOM   7087 N  N   . SER C 1 298 ? 23.950 69.331  75.455  1.00 10.40  ? 321 SER C N   1 
ATOM   7088 C  CA  A SER C 1 298 ? 23.283 69.422  74.159  0.32 10.76  ? 321 SER C CA  1 
ATOM   7089 C  CA  B SER C 1 298 ? 23.280 69.440  74.164  0.68 10.70  ? 321 SER C CA  1 
ATOM   7090 C  C   . SER C 1 298 ? 21.925 68.727  74.207  1.00 13.20  ? 321 SER C C   1 
ATOM   7091 O  O   . SER C 1 298 ? 20.963 69.148  73.556  1.00 14.08  ? 321 SER C O   1 
ATOM   7092 C  CB  A SER C 1 298 ? 24.155 68.802  73.067  0.32 13.58  ? 321 SER C CB  1 
ATOM   7093 C  CB  B SER C 1 298 ? 24.164 68.886  73.039  0.68 13.61  ? 321 SER C CB  1 
ATOM   7094 O  OG  A SER C 1 298 ? 23.488 68.823  71.822  0.32 13.63  ? 321 SER C OG  1 
ATOM   7095 O  OG  B SER C 1 298 ? 25.289 69.716  72.824  0.68 12.20  ? 321 SER C OG  1 
ATOM   7096 N  N   . SER C 1 299 ? 21.847 67.653  74.982  1.00 10.87  ? 322 SER C N   1 
ATOM   7097 C  CA  . SER C 1 299 ? 20.589 66.923  75.129  1.00 12.55  ? 322 SER C CA  1 
ATOM   7098 C  C   . SER C 1 299 ? 19.533 67.756  75.854  1.00 14.31  ? 322 SER C C   1 
ATOM   7099 O  O   . SER C 1 299 ? 18.336 67.490  75.735  1.00 13.36  ? 322 SER C O   1 
ATOM   7100 C  CB  . SER C 1 299 ? 20.817 65.607  75.875  1.00 10.81  ? 322 SER C CB  1 
ATOM   7101 O  OG  . SER C 1 299 ? 21.688 64.757  75.140  1.00 10.80  ? 322 SER C OG  1 
ATOM   7102 N  N   . PHE C 1 300 ? 19.979 68.755  76.611  1.00 12.51  ? 323 PHE C N   1 
ATOM   7103 C  CA  . PHE C 1 300 ? 19.066 69.632  77.339  1.00 13.79  ? 323 PHE C CA  1 
ATOM   7104 C  C   . PHE C 1 300 ? 19.021 71.050  76.803  1.00 19.23  ? 323 PHE C C   1 
ATOM   7105 O  O   . PHE C 1 300 ? 18.527 71.965  77.467  1.00 19.81  ? 323 PHE C O   1 
ATOM   7106 C  CB  . PHE C 1 300 ? 19.375 69.624  78.836  1.00 15.87  ? 323 PHE C CB  1 
ATOM   7107 C  CG  . PHE C 1 300 ? 18.945 68.360  79.517  1.00 15.21  ? 323 PHE C CG  1 
ATOM   7108 C  CD1 . PHE C 1 300 ? 17.621 68.195  79.908  1.00 19.88  ? 323 PHE C CD1 1 
ATOM   7109 C  CD2 . PHE C 1 300 ? 19.839 67.324  79.723  1.00 16.48  ? 323 PHE C CD2 1 
ATOM   7110 C  CE1 . PHE C 1 300 ? 17.206 67.022  80.515  1.00 18.52  ? 323 PHE C CE1 1 
ATOM   7111 C  CE2 . PHE C 1 300 ? 19.431 66.146  80.328  1.00 20.42  ? 323 PHE C CE2 1 
ATOM   7112 C  CZ  . PHE C 1 300 ? 18.114 65.999  80.734  1.00 21.96  ? 323 PHE C CZ  1 
ATOM   7113 N  N   . GLY C 1 301 ? 19.545 71.232  75.598  1.00 12.98  ? 324 GLY C N   1 
ATOM   7114 C  CA  . GLY C 1 301 ? 19.281 72.448  74.858  1.00 14.39  ? 324 GLY C CA  1 
ATOM   7115 C  C   . GLY C 1 301 ? 20.464 73.288  74.449  1.00 15.68  ? 324 GLY C C   1 
ATOM   7116 O  O   . GLY C 1 301 ? 20.275 74.314  73.802  1.00 16.08  ? 324 GLY C O   1 
ATOM   7117 N  N   . GLN C 1 302 ? 21.681 72.888  74.808  1.00 11.74  ? 325 GLN C N   1 
ATOM   7118 C  CA  . GLN C 1 302 ? 22.820 73.670  74.343  1.00 14.83  ? 325 GLN C CA  1 
ATOM   7119 C  C   . GLN C 1 302 ? 22.926 73.560  72.828  1.00 17.87  ? 325 GLN C C   1 
ATOM   7120 O  O   . GLN C 1 302 ? 22.871 72.462  72.268  1.00 16.40  ? 325 GLN C O   1 
ATOM   7121 C  CB  . GLN C 1 302 ? 24.135 73.279  75.025  1.00 19.68  ? 325 GLN C CB  1 
ATOM   7122 C  CG  . GLN C 1 302 ? 25.252 74.273  74.682  1.00 25.25  ? 325 GLN C CG  1 
ATOM   7123 C  CD  . GLN C 1 302 ? 26.424 74.245  75.649  1.00 39.70  ? 325 GLN C CD  1 
ATOM   7124 O  OE1 . GLN C 1 302 ? 26.293 73.833  76.809  1.00 28.32  ? 325 GLN C OE1 1 
ATOM   7125 N  NE2 . GLN C 1 302 ? 27.582 74.704  75.177  1.00 37.37  ? 325 GLN C NE2 1 
ATOM   7126 N  N   . THR C 1 303 ? 23.042 74.712  72.175  1.00 17.88  ? 326 THR C N   1 
ATOM   7127 C  CA  . THR C 1 303 ? 23.103 74.786  70.715  1.00 25.86  ? 326 THR C CA  1 
ATOM   7128 C  C   . THR C 1 303 ? 24.463 75.254  70.249  1.00 21.93  ? 326 THR C C   1 
ATOM   7129 O  O   . THR C 1 303 ? 25.250 75.770  71.035  1.00 25.94  ? 326 THR C O   1 
ATOM   7130 C  CB  . THR C 1 303 ? 22.063 75.773  70.154  1.00 26.86  ? 326 THR C CB  1 
ATOM   7131 O  OG1 . THR C 1 303 ? 22.518 77.120  70.365  1.00 29.45  ? 326 THR C OG1 1 
ATOM   7132 C  CG2 . THR C 1 303 ? 20.726 75.579  70.839  1.00 26.68  ? 326 THR C CG2 1 
ATOM   7133 N  N   . ARG C 1 304 ? 24.725 75.084  68.959  1.00 22.91  ? 327 ARG C N   1 
ATOM   7134 C  CA  . ARG C 1 304 ? 25.930 75.628  68.355  1.00 18.97  ? 327 ARG C CA  1 
ATOM   7135 C  C   . ARG C 1 304 ? 25.642 76.929  67.598  1.00 23.23  ? 327 ARG C C   1 
ATOM   7136 O  O   . ARG C 1 304 ? 26.436 77.348  66.767  1.00 36.50  ? 327 ARG C O   1 
ATOM   7137 C  CB  . ARG C 1 304 ? 26.556 74.582  67.437  1.00 19.75  ? 327 ARG C CB  1 
ATOM   7138 C  CG  . ARG C 1 304 ? 27.079 73.376  68.208  1.00 24.73  ? 327 ARG C CG  1 
ATOM   7139 C  CD  . ARG C 1 304 ? 27.569 72.304  67.282  1.00 13.38  ? 327 ARG C CD  1 
ATOM   7140 N  NE  . ARG C 1 304 ? 26.498 71.451  66.758  1.00 13.28  ? 327 ARG C NE  1 
ATOM   7141 C  CZ  . ARG C 1 304 ? 26.677 70.601  65.749  1.00 11.60  ? 327 ARG C CZ  1 
ATOM   7142 N  NH1 . ARG C 1 304 ? 27.864 70.524  65.165  1.00 9.11   ? 327 ARG C NH1 1 
ATOM   7143 N  NH2 . ARG C 1 304 ? 25.677 69.856  65.300  1.00 11.40  ? 327 ARG C NH2 1 
ATOM   7144 N  N   . GLU C 1 305 ? 24.503 77.561  67.864  1.00 32.74  ? 328 GLU C N   1 
ATOM   7145 C  CA  . GLU C 1 305 ? 24.226 78.852  67.227  1.00 30.11  ? 328 GLU C CA  1 
ATOM   7146 C  C   . GLU C 1 305 ? 23.705 79.935  68.168  1.00 31.27  ? 328 GLU C C   1 
ATOM   7147 O  O   . GLU C 1 305 ? 23.278 80.999  67.712  1.00 33.13  ? 328 GLU C O   1 
ATOM   7148 C  CB  . GLU C 1 305 ? 23.269 78.734  66.035  1.00 27.82  ? 328 GLU C CB  1 
ATOM   7149 C  CG  . GLU C 1 305 ? 21.853 78.346  66.427  1.00 34.78  ? 328 GLU C CG  1 
ATOM   7150 C  CD  . GLU C 1 305 ? 20.862 78.493  65.279  1.00 49.86  ? 328 GLU C CD  1 
ATOM   7151 O  OE1 . GLU C 1 305 ? 19.912 79.299  65.432  1.00 48.09  ? 328 GLU C OE1 1 
ATOM   7152 O  OE2 . GLU C 1 305 ? 21.025 77.819  64.235  1.00 33.03  ? 328 GLU C OE2 1 
ATOM   7153 N  N   . GLY C 1 306 ? 23.741 79.678  69.470  1.00 39.03  ? 329 GLY C N   1 
ATOM   7154 C  CA  . GLY C 1 306 ? 23.360 80.694  70.434  1.00 31.97  ? 329 GLY C CA  1 
ATOM   7155 C  C   . GLY C 1 306 ? 21.866 80.768  70.701  1.00 31.18  ? 329 GLY C C   1 
ATOM   7156 O  O   . GLY C 1 306 ? 21.088 79.948  70.203  1.00 35.92  ? 329 GLY C O   1 
HETATM 7157 MN MN  . MN  D 2 .   ? 36.699 86.276  63.558  1.00 7.90   ? 401 MN  A MN  1 
HETATM 7158 MN MN  . MN  E 2 .   ? 36.639 83.434  65.308  1.00 8.40   ? 402 MN  A MN  1 
HETATM 7159 C  C1  . BEN F 3 .   ? 30.003 99.818  81.846  1.00 14.06  ? 403 BEN A C1  1 
HETATM 7160 C  C2  . BEN F 3 .   ? 28.768 99.205  82.006  1.00 16.75  ? 403 BEN A C2  1 
HETATM 7161 C  C3  . BEN F 3 .   ? 27.623 99.901  81.626  1.00 18.60  ? 403 BEN A C3  1 
HETATM 7162 C  C4  . BEN F 3 .   ? 27.747 101.180 81.089  1.00 15.94  ? 403 BEN A C4  1 
HETATM 7163 C  C5  . BEN F 3 .   ? 28.980 101.789 80.918  1.00 20.60  ? 403 BEN A C5  1 
HETATM 7164 C  C6  . BEN F 3 .   ? 30.118 101.092 81.298  1.00 16.95  ? 403 BEN A C6  1 
HETATM 7165 C  C   . BEN F 3 .   ? 31.243 99.089  82.238  1.00 10.82  ? 403 BEN A C   1 
HETATM 7166 N  N1  . BEN F 3 .   ? 32.346 99.326  81.544  1.00 10.71  ? 403 BEN A N1  1 
HETATM 7167 N  N2  . BEN F 3 .   ? 31.206 98.221  83.250  1.00 10.26  ? 403 BEN A N2  1 
HETATM 7168 C  C1  B BME G 4 .   ? 45.665 83.185  39.779  0.54 34.51  ? 404 BME A C1  1 
HETATM 7169 C  C2  B BME G 4 .   ? 45.956 84.272  40.810  0.54 23.72  ? 404 BME A C2  1 
HETATM 7170 O  O1  B BME G 4 .   ? 44.283 82.899  39.779  0.54 34.13  ? 404 BME A O1  1 
HETATM 7171 S  S2  B BME G 4 .   ? 47.501 83.962  41.697  0.54 27.88  ? 404 BME A S2  1 
HETATM 7172 C  C1  B BME H 4 .   ? 35.928 95.024  40.698  0.46 26.33  ? 405 BME A C1  1 
HETATM 7173 C  C2  B BME H 4 .   ? 35.910 96.309  41.518  0.46 14.33  ? 405 BME A C2  1 
HETATM 7174 O  O1  B BME H 4 .   ? 36.636 94.008  41.418  0.46 43.87  ? 405 BME A O1  1 
HETATM 7175 S  S2  B BME H 4 .   ? 34.231 96.983  41.546  0.46 28.45  ? 405 BME A S2  1 
HETATM 7176 CL CL2 . 38I I 5 .   ? 28.074 86.584  77.006  1.00 82.78  ? 406 38I A CL2 1 
HETATM 7177 C  C26 . 38I I 5 .   ? 29.340 85.320  77.054  1.00 84.09  ? 406 38I A C26 1 
HETATM 7178 C  C25 . 38I I 5 .   ? 29.709 84.668  78.226  1.00 102.26 ? 406 38I A C25 1 
HETATM 7179 CL CL1 . 38I I 5 .   ? 28.947 85.034  79.806  1.00 127.09 ? 406 38I A CL1 1 
HETATM 7180 C  C24 . 38I I 5 .   ? 30.694 83.690  78.207  1.00 103.77 ? 406 38I A C24 1 
HETATM 7181 C  C23 . 38I I 5 .   ? 31.311 83.363  77.015  1.00 84.75  ? 406 38I A C23 1 
HETATM 7182 C  C27 . 38I I 5 .   ? 29.959 84.995  75.863  1.00 69.83  ? 406 38I A C27 1 
HETATM 7183 C  C22 . 38I I 5 .   ? 30.936 84.018  75.852  1.00 65.81  ? 406 38I A C22 1 
HETATM 7184 C  C21 . 38I I 5 .   ? 31.625 83.664  74.574  1.00 45.16  ? 406 38I A C21 1 
HETATM 7185 N  N16 . 38I I 5 .   ? 33.036 83.979  74.847  1.00 41.11  ? 406 38I A N16 1 
HETATM 7186 C  C17 . 38I I 5 .   ? 33.961 83.657  73.769  1.00 45.70  ? 406 38I A C17 1 
HETATM 7187 C  C19 . 38I I 5 .   ? 35.277 84.178  74.331  1.00 37.78  ? 406 38I A C19 1 
HETATM 7188 C  C20 . 38I I 5 .   ? 34.878 85.203  75.393  1.00 45.53  ? 406 38I A C20 1 
HETATM 7189 C  C15 . 38I I 5 .   ? 33.380 85.367  75.224  1.00 43.82  ? 406 38I A C15 1 
HETATM 7190 C  C14 . 38I I 5 .   ? 33.222 86.431  74.132  1.00 31.56  ? 406 38I A C14 1 
HETATM 7191 C  C18 . 38I I 5 .   ? 33.605 84.444  72.516  1.00 33.67  ? 406 38I A C18 1 
HETATM 7192 C  C7  . 38I I 5 .   ? 33.066 85.874  72.715  1.00 27.48  ? 406 38I A C7  1 
HETATM 7193 C  C4  . 38I I 5 .   ? 33.467 86.770  71.537  1.00 18.67  ? 406 38I A C4  1 
HETATM 7194 C  C1  . 38I I 5 .   ? 33.864 88.202  71.848  1.00 20.61  ? 406 38I A C1  1 
HETATM 7195 O  O3  . 38I I 5 .   ? 34.941 88.458  72.446  1.00 15.11  ? 406 38I A O3  1 
HETATM 7196 O  O2  . 38I I 5 .   ? 33.094 89.113  71.453  1.00 17.40  ? 406 38I A O2  1 
HETATM 7197 N  N6  . 38I I 5 .   ? 32.193 86.818  70.809  1.00 10.16  ? 406 38I A N6  1 
HETATM 7198 C  C5  . 38I I 5 .   ? 34.573 86.077  70.731  1.00 20.09  ? 406 38I A C5  1 
HETATM 7199 C  C8  . 38I I 5 .   ? 35.026 86.827  69.499  1.00 20.21  ? 406 38I A C8  1 
HETATM 7200 C  C9  . 38I I 5 .   ? 36.192 86.136  68.781  1.00 10.81  ? 406 38I A C9  1 
HETATM 7201 C  C10 . 38I I 5 .   ? 36.622 87.027  67.612  1.00 10.78  ? 406 38I A C10 1 
HETATM 7202 B  B11 . 38I I 5 .   ? 37.140 86.144  66.403  1.00 10.62  ? 406 38I A B11 1 
HETATM 7203 O  O30 . 38I I 5 .   ? 37.697 87.197  65.415  1.00 10.63  ? 406 38I A O30 1 
HETATM 7204 O  O13 . 38I I 5 .   ? 38.358 85.311  66.692  1.00 12.05  ? 406 38I A O13 1 
HETATM 7205 O  O12 . 38I I 5 .   ? 36.094 85.530  65.521  1.00 9.15   ? 406 38I A O12 1 
HETATM 7206 MN MN  . MN  J 2 .   ? 50.190 54.592  44.360  1.00 8.42   ? 401 MN  B MN  1 
HETATM 7207 MN MN  . MN  K 2 .   ? 49.977 57.284  46.328  1.00 10.00  ? 402 MN  B MN  1 
HETATM 7208 C  C1  . BEN L 3 .   ? 66.515 64.046  29.976  1.00 16.03  ? 403 BEN B C1  1 
HETATM 7209 C  C2  . BEN L 3 .   ? 65.668 65.057  29.539  1.00 23.16  ? 403 BEN B C2  1 
HETATM 7210 C  C3  . BEN L 3 .   ? 65.170 65.017  28.242  1.00 24.94  ? 403 BEN B C3  1 
HETATM 7211 C  C4  . BEN L 3 .   ? 65.517 63.965  27.400  1.00 23.88  ? 403 BEN B C4  1 
HETATM 7212 C  C5  . BEN L 3 .   ? 66.359 62.951  27.837  1.00 20.69  ? 403 BEN B C5  1 
HETATM 7213 C  C6  . BEN L 3 .   ? 66.856 62.994  29.131  1.00 17.79  ? 403 BEN B C6  1 
HETATM 7214 C  C   . BEN L 3 .   ? 67.067 64.068  31.366  1.00 17.34  ? 403 BEN B C   1 
HETATM 7215 N  N1  . BEN L 3 .   ? 67.307 62.922  32.000  1.00 13.15  ? 403 BEN B N1  1 
HETATM 7216 N  N2  . BEN L 3 .   ? 67.334 65.236  31.940  1.00 13.73  ? 403 BEN B N2  1 
HETATM 7217 C  C1  B BME M 4 .   ? 35.260 35.499  53.110  0.77 34.97  ? 404 BME B C1  1 
HETATM 7218 C  C2  B BME M 4 .   ? 36.232 34.328  53.081  0.77 34.00  ? 404 BME B C2  1 
HETATM 7219 O  O1  B BME M 4 .   ? 35.114 36.038  51.811  0.77 45.89  ? 404 BME B O1  1 
HETATM 7220 S  S2  B BME M 4 .   ? 37.682 34.692  52.062  0.77 47.24  ? 404 BME B S2  1 
HETATM 7221 C  C1  B BME N 4 .   ? 36.805 35.740  37.102  0.83 17.85  ? 405 BME B C1  1 
HETATM 7222 C  C2  B BME N 4 .   ? 38.017 35.479  37.996  0.83 35.60  ? 405 BME B C2  1 
HETATM 7223 O  O1  B BME N 4 .   ? 35.610 35.439  37.787  0.83 34.96  ? 405 BME B O1  1 
HETATM 7224 S  S2  B BME N 4 .   ? 38.353 33.721  38.306  0.83 63.49  ? 405 BME B S2  1 
HETATM 7225 CL CL2 . 38I O 5 .   ? 55.574 67.812  37.823  1.00 70.48  ? 406 38I B CL2 1 
HETATM 7226 C  C26 . 38I O 5 .   ? 55.692 67.978  39.610  1.00 70.55  ? 406 38I B C26 1 
HETATM 7227 C  C25 . 38I O 5 .   ? 56.538 68.853  40.297  1.00 85.50  ? 406 38I B C25 1 
HETATM 7228 CL CL1 . 38I O 5 .   ? 57.674 69.983  39.527  1.00 113.96 ? 406 38I B CL1 1 
HETATM 7229 C  C24 . 38I O 5 .   ? 56.561 68.919  41.679  1.00 85.96  ? 406 38I B C24 1 
HETATM 7230 C  C23 . 38I O 5 .   ? 55.725 68.111  42.408  1.00 68.80  ? 406 38I B C23 1 
HETATM 7231 C  C27 . 38I O 5 .   ? 54.863 67.164  40.348  1.00 60.51  ? 406 38I B C27 1 
HETATM 7232 C  C22 . 38I O 5 .   ? 54.883 67.237  41.731  1.00 59.61  ? 406 38I B C22 1 
HETATM 7233 C  C21 . 38I O 5 .   ? 54.021 66.322  42.540  1.00 50.96  ? 406 38I B C21 1 
HETATM 7234 N  N16 . 38I O 5 .   ? 55.083 65.595  43.272  1.00 39.84  ? 406 38I B N16 1 
HETATM 7235 C  C17 . 38I O 5 .   ? 54.663 64.559  44.204  1.00 46.37  ? 406 38I B C17 1 
HETATM 7236 C  C19 . 38I O 5 .   ? 56.013 64.131  44.767  1.00 39.36  ? 406 38I B C19 1 
HETATM 7237 C  C20 . 38I O 5 .   ? 57.047 64.532  43.712  1.00 44.19  ? 406 38I B C20 1 
HETATM 7238 C  C15 . 38I O 5 .   ? 56.218 64.983  42.526  1.00 38.64  ? 406 38I B C15 1 
HETATM 7239 C  C14 . 38I O 5 .   ? 55.920 63.732  41.701  1.00 29.19  ? 406 38I B C14 1 
HETATM 7240 C  C18 . 38I O 5 .   ? 54.039 63.391  43.458  1.00 30.67  ? 406 38I B C18 1 
HETATM 7241 C  C7  . 38I O 5 .   ? 54.587 63.076  42.053  1.00 26.65  ? 406 38I B C7  1 
HETATM 7242 C  C4  . 38I O 5 .   ? 54.462 61.582  41.737  1.00 17.42  ? 406 38I B C4  1 
HETATM 7243 C  C1  . 38I O 5 .   ? 55.603 60.921  40.977  1.00 16.42  ? 406 38I B C1  1 
HETATM 7244 O  O3  . 38I O 5 .   ? 56.705 60.693  41.526  1.00 16.24  ? 406 38I B O3  1 
HETATM 7245 O  O2  . 38I O 5 .   ? 55.396 60.578  39.786  1.00 16.76  ? 406 38I B O2  1 
HETATM 7246 N  N6  . 38I O 5 .   ? 53.322 61.649  40.827  1.00 9.49   ? 406 38I B N6  1 
HETATM 7247 C  C5  . 38I O 5 .   ? 54.091 60.797  43.001  1.00 24.47  ? 406 38I B C5  1 
HETATM 7248 C  C8  . 38I O 5 .   ? 54.095 59.285  42.833  1.00 19.64  ? 406 38I B C8  1 
HETATM 7249 C  C9  . 38I O 5 .   ? 53.530 58.576  44.068  1.00 15.03  ? 406 38I B C9  1 
HETATM 7250 C  C10 . 38I O 5 .   ? 53.339 57.093  43.749  1.00 12.58  ? 406 38I B C10 1 
HETATM 7251 B  B11 . 38I O 5 .   ? 52.321 56.435  44.753  1.00 14.68  ? 406 38I B B11 1 
HETATM 7252 O  O30 . 38I O 5 .   ? 52.382 54.937  44.370  1.00 11.76  ? 406 38I B O30 1 
HETATM 7253 O  O13 . 38I O 5 .   ? 52.714 56.413  46.204  1.00 11.85  ? 406 38I B O13 1 
HETATM 7254 O  O12 . 38I O 5 .   ? 50.878 56.707  44.488  1.00 9.21   ? 406 38I B O12 1 
HETATM 7255 MN MN  . MN  P 2 .   ? 29.969 50.282  74.342  1.00 9.72   ? 401 MN  C MN  1 
HETATM 7256 MN MN  . MN  Q 2 .   ? 27.242 50.121  76.350  1.00 8.96   ? 402 MN  C MN  1 
HETATM 7257 C  C1  . BEN R 3 .   ? 30.199 27.082  81.376  1.00 19.73  ? 403 BEN C C1  1 
HETATM 7258 C  C2  . BEN R 3 .   ? 30.123 26.498  80.118  1.00 20.80  ? 403 BEN C C2  1 
HETATM 7259 C  C3  . BEN R 3 .   ? 28.969 25.816  79.748  1.00 29.26  ? 403 BEN C C3  1 
HETATM 7260 C  C4  . BEN R 3 .   ? 27.908 25.718  80.639  1.00 21.04  ? 403 BEN C C4  1 
HETATM 7261 C  C5  . BEN R 3 .   ? 27.983 26.294  81.902  1.00 22.52  ? 403 BEN C C5  1 
HETATM 7262 C  C6  . BEN R 3 .   ? 29.138 26.979  82.270  1.00 22.86  ? 403 BEN C C6  1 
HETATM 7263 C  C   . BEN R 3 .   ? 31.454 27.806  81.763  1.00 14.50  ? 403 BEN C C   1 
HETATM 7264 N  N1  . BEN R 3 .   ? 31.410 28.783  82.666  1.00 13.55  ? 403 BEN C N1  1 
HETATM 7265 N  N2  . BEN R 3 .   ? 32.593 27.431  81.190  1.00 14.87  ? 403 BEN C N2  1 
HETATM 7266 C  C1  B BME S 4 .   ? 16.395 72.844  80.504  0.64 40.79  ? 404 BME C C1  1 
HETATM 7267 C  C2  B BME S 4 .   ? 16.795 71.701  81.427  0.64 23.51  ? 404 BME C C2  1 
HETATM 7268 O  O1  B BME S 4 .   ? 15.512 72.346  79.528  0.64 45.41  ? 404 BME C O1  1 
HETATM 7269 S  S2  B BME S 4 .   ? 18.327 72.099  82.297  0.64 35.99  ? 404 BME C S2  1 
HETATM 7270 C  C1  B BME T 4 .   ? 7.191  58.620  82.870  0.43 35.79  ? 405 BME C C1  1 
HETATM 7271 C  C2  B BME T 4 .   ? 7.993  57.903  81.790  0.43 28.93  ? 405 BME C C2  1 
HETATM 7272 O  O1  B BME T 4 .   ? 6.039  59.214  82.306  0.43 23.67  ? 405 BME C O1  1 
HETATM 7273 S  S2  B BME T 4 .   ? 7.310  56.286  81.342  0.43 40.03  ? 405 BME C S2  1 
HETATM 7274 CL CL2 . 38I U 5 .   ? 31.647 36.067  70.575  1.00 86.39  ? 406 38I C CL2 1 
HETATM 7275 C  C26 . 38I U 5 .   ? 32.969 37.215  70.154  1.00 82.03  ? 406 38I C C26 1 
HETATM 7276 C  C25 . 38I U 5 .   ? 34.032 36.844  69.339  1.00 104.11 ? 406 38I C C25 1 
HETATM 7277 CL CL1 . 38I U 5 .   ? 34.152 35.183  68.657  1.00 110.49 ? 406 38I C CL1 1 
HETATM 7278 C  C24 . 38I U 5 .   ? 35.025 37.776  69.045  1.00 97.76  ? 406 38I C C24 1 
HETATM 7279 C  C23 . 38I U 5 .   ? 34.968 39.071  69.555  1.00 85.28  ? 406 38I C C23 1 
HETATM 7280 C  C27 . 38I U 5 .   ? 32.921 38.510  70.661  1.00 69.89  ? 406 38I C C27 1 
HETATM 7281 C  C22 . 38I U 5 .   ? 33.917 39.444  70.386  1.00 69.59  ? 406 38I C C22 1 
HETATM 7282 C  C21 . 38I U 5 .   ? 33.798 40.856  70.935  1.00 44.07  ? 406 38I C C21 1 
HETATM 7283 N  N16 . 38I U 5 .   ? 34.572 41.257  72.123  1.00 42.64  ? 406 38I C N16 1 
HETATM 7284 C  C17 . 38I U 5 .   ? 34.427 42.686  72.434  1.00 40.99  ? 406 38I C C17 1 
HETATM 7285 C  C19 . 38I U 5 .   ? 35.228 42.825  73.718  1.00 37.28  ? 406 38I C C19 1 
HETATM 7286 C  C20 . 38I U 5 .   ? 35.246 41.416  74.305  1.00 36.70  ? 406 38I C C20 1 
HETATM 7287 C  C15 . 38I U 5 .   ? 34.307 40.611  73.422  1.00 34.81  ? 406 38I C C15 1 
HETATM 7288 C  C14 . 38I U 5 .   ? 32.908 40.826  74.021  1.00 24.01  ? 406 38I C C14 1 
HETATM 7289 C  C18 . 38I U 5 .   ? 32.984 43.080  72.751  1.00 25.83  ? 406 38I C C18 1 
HETATM 7290 C  C7  . 38I U 5 .   ? 32.124 42.037  73.497  1.00 33.70  ? 406 38I C C7  1 
HETATM 7291 C  C4  . 38I U 5 .   ? 31.111 42.689  74.455  1.00 20.96  ? 406 38I C C4  1 
HETATM 7292 C  C1  . 38I U 5 .   ? 30.816 41.923  75.727  1.00 22.47  ? 406 38I C C1  1 
HETATM 7293 O  O3  . 38I U 5 .   ? 31.640 41.908  76.676  1.00 17.55  ? 406 38I C O3  1 
HETATM 7294 O  O2  . 38I U 5 .   ? 29.709 41.329  75.789  1.00 16.26  ? 406 38I C O2  1 
HETATM 7295 N  N6  . 38I U 5 .   ? 29.874 42.627  73.669  1.00 13.76  ? 406 38I C N6  1 
HETATM 7296 C  C5  . 38I U 5 .   ? 31.494 44.142  74.754  1.00 25.71  ? 406 38I C C5  1 
HETATM 7297 C  C8  . 38I U 5 .   ? 30.680 44.785  75.864  1.00 25.06  ? 406 38I C C8  1 
HETATM 7298 C  C9  . 38I U 5 .   ? 30.855 46.302  75.962  1.00 15.52  ? 406 38I C C9  1 
HETATM 7299 C  C10 . 38I U 5 .   ? 29.763 46.882  76.868  1.00 12.47  ? 406 38I C C10 1 
HETATM 7300 B  B11 . 38I U 5 .   ? 29.546 48.436  76.597  1.00 16.15  ? 406 38I C B11 1 
HETATM 7301 O  O30 . 38I U 5 .   ? 28.602 48.844  77.745  1.00 12.30  ? 406 38I C O30 1 
HETATM 7302 O  O13 . 38I U 5 .   ? 30.740 49.332  76.835  1.00 12.44  ? 406 38I C O13 1 
HETATM 7303 O  O12 . 38I U 5 .   ? 28.643 48.842  75.469  1.00 12.58  ? 406 38I C O12 1 
HETATM 7304 O  O   . HOH V 6 .   ? 41.760 91.811  52.185  1.00 12.02  ? 501 HOH A O   1 
HETATM 7305 O  O   . HOH V 6 .   ? 46.291 85.181  60.255  1.00 7.94   ? 502 HOH A O   1 
HETATM 7306 O  O   . HOH V 6 .   ? 33.591 91.707  71.304  1.00 10.19  ? 503 HOH A O   1 
HETATM 7307 O  O   . HOH V 6 .   ? 30.401 68.618  54.672  1.00 12.57  ? 504 HOH A O   1 
HETATM 7308 O  O   . HOH V 6 .   ? 34.904 66.517  55.876  1.00 9.33   ? 505 HOH A O   1 
HETATM 7309 O  O   A HOH V 6 .   ? 39.957 70.681  43.566  0.61 26.56  ? 506 HOH A O   1 
HETATM 7310 O  O   B HOH V 6 .   ? 39.968 68.770  42.341  0.39 26.56  ? 506 HOH A O   1 
HETATM 7311 O  O   . HOH V 6 .   ? 40.659 76.205  43.780  1.00 8.09   ? 507 HOH A O   1 
HETATM 7312 O  O   . HOH V 6 .   ? 39.558 66.671  56.252  1.00 9.88   ? 508 HOH A O   1 
HETATM 7313 O  O   . HOH V 6 .   ? 30.897 73.011  68.503  1.00 11.06  ? 509 HOH A O   1 
HETATM 7314 O  O   . HOH V 6 .   ? 38.849 103.786 44.189  1.00 28.85  ? 510 HOH A O   1 
HETATM 7315 O  O   . HOH V 6 .   ? 30.411 71.789  66.049  1.00 10.56  ? 511 HOH A O   1 
HETATM 7316 O  O   . HOH V 6 .   ? 22.657 88.468  43.780  1.00 13.51  ? 512 HOH A O   1 
HETATM 7317 O  O   . HOH V 6 .   ? 26.244 68.950  50.318  1.00 13.59  ? 513 HOH A O   1 
HETATM 7318 O  O   . HOH V 6 .   ? 45.703 105.173 77.560  1.00 33.38  ? 514 HOH A O   1 
HETATM 7319 O  O   . HOH V 6 .   ? 40.082 95.785  70.951  1.00 11.61  ? 515 HOH A O   1 
HETATM 7320 O  O   . HOH V 6 .   ? 26.836 78.995  70.514  1.00 30.77  ? 516 HOH A O   1 
HETATM 7321 O  O   . HOH V 6 .   ? 42.139 72.943  46.690  1.00 18.25  ? 517 HOH A O   1 
HETATM 7322 O  O   . HOH V 6 .   ? 35.634 64.051  56.551  1.00 12.73  ? 518 HOH A O   1 
HETATM 7323 O  O   . HOH V 6 .   ? 40.845 82.627  67.246  1.00 11.08  ? 519 HOH A O   1 
HETATM 7324 O  O   . HOH V 6 .   ? 22.637 87.527  54.901  1.00 10.89  ? 520 HOH A O   1 
HETATM 7325 O  O   . HOH V 6 .   ? 44.221 84.552  67.215  1.00 9.97   ? 521 HOH A O   1 
HETATM 7326 O  O   . HOH V 6 .   ? 40.774 105.025 54.918  1.00 15.55  ? 522 HOH A O   1 
HETATM 7327 O  O   . HOH V 6 .   ? 29.044 73.644  46.002  1.00 12.35  ? 523 HOH A O   1 
HETATM 7328 O  O   . HOH V 6 .   ? 48.780 71.499  50.115  1.00 31.25  ? 524 HOH A O   1 
HETATM 7329 O  O   . HOH V 6 .   ? 54.152 89.256  61.256  1.00 16.87  ? 525 HOH A O   1 
HETATM 7330 O  O   . HOH V 6 .   ? 31.800 88.153  68.625  1.00 12.29  ? 526 HOH A O   1 
HETATM 7331 O  O   . HOH V 6 .   ? 25.431 95.556  50.463  1.00 19.06  ? 527 HOH A O   1 
HETATM 7332 O  O   . HOH V 6 .   ? 30.332 95.336  40.839  1.00 24.65  ? 528 HOH A O   1 
HETATM 7333 O  O   . HOH V 6 .   ? 37.618 109.378 64.728  1.00 31.73  ? 529 HOH A O   1 
HETATM 7334 O  O   . HOH V 6 .   ? 37.328 83.739  42.112  1.00 12.92  ? 530 HOH A O   1 
HETATM 7335 O  O   . HOH V 6 .   ? 40.323 84.949  68.426  1.00 18.18  ? 531 HOH A O   1 
HETATM 7336 O  O   . HOH V 6 .   ? 40.257 67.395  58.968  1.00 16.87  ? 532 HOH A O   1 
HETATM 7337 O  O   . HOH V 6 .   ? 32.394 102.986 47.641  1.00 11.92  ? 533 HOH A O   1 
HETATM 7338 O  O   . HOH V 6 .   ? 55.971 83.545  51.092  1.00 16.45  ? 534 HOH A O   1 
HETATM 7339 O  O   . HOH V 6 .   ? 39.925 83.094  42.713  1.00 13.67  ? 535 HOH A O   1 
HETATM 7340 O  O   . HOH V 6 .   ? 55.351 79.297  59.345  1.00 18.09  ? 536 HOH A O   1 
HETATM 7341 O  O   . HOH V 6 .   ? 45.542 85.651  69.428  1.00 12.08  ? 537 HOH A O   1 
HETATM 7342 O  O   . HOH V 6 .   ? 41.779 88.393  73.636  1.00 17.30  ? 538 HOH A O   1 
HETATM 7343 O  O   . HOH V 6 .   ? 34.826 106.426 77.269  1.00 27.41  ? 539 HOH A O   1 
HETATM 7344 O  O   . HOH V 6 .   ? 30.083 102.189 61.716  1.00 23.43  ? 540 HOH A O   1 
HETATM 7345 O  O   . HOH V 6 .   ? 47.287 102.052 65.459  1.00 17.48  ? 541 HOH A O   1 
HETATM 7346 O  O   . HOH V 6 .   ? 50.929 70.910  57.924  1.00 25.86  ? 542 HOH A O   1 
HETATM 7347 O  O   . HOH V 6 .   ? 42.348 101.270 75.386  1.00 25.44  ? 543 HOH A O   1 
HETATM 7348 O  O   . HOH V 6 .   ? 37.650 88.048  72.500  1.00 14.79  ? 544 HOH A O   1 
HETATM 7349 O  O   . HOH V 6 .   ? 24.813 78.456  43.699  1.00 16.96  ? 545 HOH A O   1 
HETATM 7350 O  O   . HOH V 6 .   ? 55.855 93.050  44.856  1.00 22.85  ? 546 HOH A O   1 
HETATM 7351 O  O   . HOH V 6 .   ? 47.756 103.961 54.604  1.00 21.94  ? 547 HOH A O   1 
HETATM 7352 O  O   . HOH V 6 .   ? 38.141 95.076  78.342  1.00 15.80  ? 548 HOH A O   1 
HETATM 7353 O  O   . HOH V 6 .   ? 14.773 89.343  66.813  1.00 44.15  ? 549 HOH A O   1 
HETATM 7354 O  O   . HOH V 6 .   ? 29.067 76.281  45.044  1.00 16.79  ? 550 HOH A O   1 
HETATM 7355 O  O   . HOH V 6 .   ? 57.190 81.940  49.306  1.00 21.89  ? 551 HOH A O   1 
HETATM 7356 O  O   . HOH V 6 .   ? 35.828 68.837  62.819  1.00 17.95  ? 552 HOH A O   1 
HETATM 7357 O  O   . HOH V 6 .   ? 47.247 70.156  57.868  1.00 34.02  ? 553 HOH A O   1 
HETATM 7358 O  O   . HOH V 6 .   ? 23.825 64.534  58.019  1.00 16.50  ? 554 HOH A O   1 
HETATM 7359 O  O   . HOH V 6 .   ? 50.757 74.665  52.942  1.00 18.84  ? 555 HOH A O   1 
HETATM 7360 O  O   . HOH V 6 .   ? 20.048 73.072  58.164  1.00 23.91  ? 556 HOH A O   1 
HETATM 7361 O  O   . HOH V 6 .   ? 33.936 102.329 55.792  1.00 22.94  ? 557 HOH A O   1 
HETATM 7362 O  O   . HOH V 6 .   ? 41.145 106.851 63.054  1.00 19.62  ? 558 HOH A O   1 
HETATM 7363 O  O   . HOH V 6 .   ? 49.032 87.144  76.071  1.00 32.96  ? 559 HOH A O   1 
HETATM 7364 O  O   . HOH V 6 .   ? 41.245 105.545 49.850  1.00 23.70  ? 560 HOH A O   1 
HETATM 7365 O  O   . HOH V 6 .   ? 38.745 75.370  42.224  1.00 16.86  ? 561 HOH A O   1 
HETATM 7366 O  O   . HOH V 6 .   ? 38.286 72.666  42.262  1.00 27.65  ? 562 HOH A O   1 
HETATM 7367 O  O   . HOH V 6 .   ? 40.054 107.579 55.505  1.00 27.41  ? 563 HOH A O   1 
HETATM 7368 O  O   . HOH V 6 .   ? 24.013 97.679  70.122  1.00 17.89  ? 564 HOH A O   1 
HETATM 7369 O  O   . HOH V 6 .   ? 54.683 88.339  39.973  1.00 21.30  ? 565 HOH A O   1 
HETATM 7370 O  O   . HOH V 6 .   ? 27.219 77.362  43.350  1.00 21.11  ? 566 HOH A O   1 
HETATM 7371 O  O   . HOH V 6 .   ? 35.821 74.497  72.541  1.00 17.27  ? 567 HOH A O   1 
HETATM 7372 O  O   A HOH V 6 .   ? 35.523 91.877  79.624  0.44 20.04  ? 568 HOH A O   1 
HETATM 7373 O  O   B HOH V 6 .   ? 34.497 90.699  80.171  0.56 20.04  ? 568 HOH A O   1 
HETATM 7374 O  O   . HOH V 6 .   ? 25.496 90.101  36.634  1.00 20.81  ? 569 HOH A O   1 
HETATM 7375 O  O   . HOH V 6 .   ? 30.559 84.995  68.159  1.00 21.11  ? 570 HOH A O   1 
HETATM 7376 O  O   . HOH V 6 .   ? 48.389 109.337 66.436  1.00 26.19  ? 571 HOH A O   1 
HETATM 7377 O  O   . HOH V 6 .   ? 28.066 94.003  40.973  1.00 22.40  ? 572 HOH A O   1 
HETATM 7378 O  O   . HOH V 6 .   ? 34.905 63.698  59.170  1.00 14.71  ? 573 HOH A O   1 
HETATM 7379 O  O   . HOH V 6 .   ? 31.991 103.554 66.100  1.00 19.75  ? 574 HOH A O   1 
HETATM 7380 O  O   . HOH V 6 .   ? 50.288 76.584  44.364  1.00 24.79  ? 575 HOH A O   1 
HETATM 7381 O  O   . HOH V 6 .   ? 39.826 93.237  43.253  1.00 17.25  ? 576 HOH A O   1 
HETATM 7382 O  O   . HOH V 6 .   ? 19.125 87.838  37.736  1.00 28.74  ? 577 HOH A O   1 
HETATM 7383 O  O   . HOH V 6 .   ? 21.726 86.904  52.376  1.00 19.25  ? 578 HOH A O   1 
HETATM 7384 O  O   . HOH V 6 .   ? 36.817 104.733 79.654  1.00 21.20  ? 579 HOH A O   1 
HETATM 7385 O  O   . HOH V 6 .   ? 31.767 99.418  40.843  1.00 36.25  ? 580 HOH A O   1 
HETATM 7386 O  O   . HOH V 6 .   ? 47.866 100.101 47.914  1.00 38.67  ? 581 HOH A O   1 
HETATM 7387 O  O   . HOH V 6 .   ? 48.399 102.905 69.614  1.00 24.27  ? 582 HOH A O   1 
HETATM 7388 O  O   . HOH V 6 .   ? 24.930 81.064  42.147  1.00 30.18  ? 583 HOH A O   1 
HETATM 7389 O  O   . HOH V 6 .   ? 31.540 78.259  42.819  1.00 18.94  ? 584 HOH A O   1 
HETATM 7390 O  O   . HOH V 6 .   ? 20.851 78.774  59.744  1.00 26.25  ? 585 HOH A O   1 
HETATM 7391 O  O   . HOH V 6 .   ? 47.916 104.092 73.239  1.00 24.40  ? 586 HOH A O   1 
HETATM 7392 O  O   . HOH V 6 .   ? 56.384 89.049  62.911  1.00 27.13  ? 587 HOH A O   1 
HETATM 7393 O  O   . HOH V 6 .   ? 38.194 79.471  72.973  1.00 27.58  ? 588 HOH A O   1 
HETATM 7394 O  O   . HOH V 6 .   ? 57.390 70.612  67.090  1.00 38.18  ? 589 HOH A O   1 
HETATM 7395 O  O   . HOH V 6 .   ? 44.810 78.810  71.864  1.00 20.74  ? 590 HOH A O   1 
HETATM 7396 O  O   . HOH V 6 .   ? 39.757 110.773 71.208  1.00 36.94  ? 591 HOH A O   1 
HETATM 7397 O  O   . HOH V 6 .   ? 28.684 103.102 74.042  1.00 28.66  ? 592 HOH A O   1 
HETATM 7398 O  O   . HOH V 6 .   ? 46.094 70.661  46.157  1.00 21.15  ? 593 HOH A O   1 
HETATM 7399 O  O   . HOH V 6 .   ? 39.992 95.322  41.286  1.00 26.81  ? 594 HOH A O   1 
HETATM 7400 O  O   . HOH V 6 .   ? 20.380 81.378  58.278  1.00 30.65  ? 595 HOH A O   1 
HETATM 7401 O  O   . HOH V 6 .   ? 19.134 87.095  52.448  1.00 26.46  ? 596 HOH A O   1 
HETATM 7402 O  O   . HOH V 6 .   ? 38.472 75.101  72.902  1.00 30.24  ? 597 HOH A O   1 
HETATM 7403 O  O   . HOH V 6 .   ? 31.603 103.697 63.546  1.00 21.73  ? 598 HOH A O   1 
HETATM 7404 O  O   . HOH V 6 .   ? 26.956 103.547 78.231  1.00 31.19  ? 599 HOH A O   1 
HETATM 7405 O  O   . HOH V 6 .   ? 27.123 64.814  58.991  1.00 22.35  ? 600 HOH A O   1 
HETATM 7406 O  O   . HOH V 6 .   ? 38.495 98.344  38.669  1.00 40.54  ? 601 HOH A O   1 
HETATM 7407 O  O   A HOH V 6 .   ? 42.296 86.101  70.794  0.67 31.50  ? 602 HOH A O   1 
HETATM 7408 O  O   B HOH V 6 .   ? 42.358 86.130  69.150  0.33 31.50  ? 602 HOH A O   1 
HETATM 7409 O  O   . HOH V 6 .   ? 30.112 107.197 71.661  1.00 26.29  ? 603 HOH A O   1 
HETATM 7410 O  O   . HOH V 6 .   ? 22.915 70.063  45.493  1.00 28.16  ? 604 HOH A O   1 
HETATM 7411 O  O   . HOH V 6 .   ? 30.549 107.735 57.392  1.00 44.16  ? 605 HOH A O   1 
HETATM 7412 O  O   . HOH V 6 .   ? 31.825 104.667 81.082  1.00 24.41  ? 606 HOH A O   1 
HETATM 7413 O  O   A HOH V 6 .   ? 46.338 72.664  41.552  0.52 34.28  ? 607 HOH A O   1 
HETATM 7414 O  O   B HOH V 6 .   ? 46.078 73.624  40.829  0.48 34.28  ? 607 HOH A O   1 
HETATM 7415 O  O   . HOH V 6 .   ? 21.075 89.331  45.675  1.00 29.66  ? 608 HOH A O   1 
HETATM 7416 O  O   . HOH V 6 .   ? 27.163 107.532 69.553  1.00 35.61  ? 609 HOH A O   1 
HETATM 7417 O  O   . HOH V 6 .   ? 40.364 78.658  36.982  1.00 40.10  ? 610 HOH A O   1 
HETATM 7418 O  O   . HOH V 6 .   ? 39.887 88.485  76.146  1.00 31.40  ? 611 HOH A O   1 
HETATM 7419 O  O   . HOH V 6 .   ? 44.707 104.830 41.811  1.00 60.81  ? 612 HOH A O   1 
HETATM 7420 O  O   . HOH V 6 .   ? 24.736 102.664 79.624  0.49 36.04  ? 613 HOH A O   1 
HETATM 7421 O  O   . HOH V 6 .   ? 56.942 86.328  51.580  1.00 32.69  ? 614 HOH A O   1 
HETATM 7422 O  O   . HOH V 6 .   ? 47.788 84.546  75.957  1.00 42.50  ? 615 HOH A O   1 
HETATM 7423 O  O   . HOH V 6 .   ? 44.384 70.325  49.701  1.00 44.80  ? 616 HOH A O   1 
HETATM 7424 O  O   . HOH V 6 .   ? 21.903 80.789  41.851  1.00 30.99  ? 617 HOH A O   1 
HETATM 7425 O  O   . HOH V 6 .   ? 42.036 103.165 80.214  1.00 38.62  ? 618 HOH A O   1 
HETATM 7426 O  O   . HOH V 6 .   ? 23.995 82.475  72.774  1.00 33.28  ? 619 HOH A O   1 
HETATM 7427 O  O   . HOH V 6 .   ? 45.681 74.527  48.661  1.00 17.44  ? 620 HOH A O   1 
HETATM 7428 O  O   . HOH V 6 .   ? 31.624 74.712  41.393  1.00 31.52  ? 621 HOH A O   1 
HETATM 7429 O  O   . HOH V 6 .   ? 40.563 95.615  79.950  1.00 43.49  ? 622 HOH A O   1 
HETATM 7430 O  O   . HOH V 6 .   ? 49.080 100.897 66.754  1.00 25.26  ? 623 HOH A O   1 
HETATM 7431 O  O   . HOH V 6 .   ? 37.521 77.189  37.801  1.00 37.73  ? 624 HOH A O   1 
HETATM 7432 O  O   . HOH V 6 .   ? 25.046 97.583  46.435  1.00 24.92  ? 625 HOH A O   1 
HETATM 7433 O  O   . HOH V 6 .   ? 20.188 101.756 61.525  1.00 38.05  ? 626 HOH A O   1 
HETATM 7434 O  O   . HOH V 6 .   ? 37.463 67.079  66.940  1.00 38.84  ? 627 HOH A O   1 
HETATM 7435 O  O   . HOH V 6 .   ? 46.650 91.828  77.028  1.00 36.40  ? 628 HOH A O   1 
HETATM 7436 O  O   . HOH V 6 .   ? 30.098 83.168  39.172  1.00 26.38  ? 629 HOH A O   1 
HETATM 7437 O  O   . HOH V 6 .   ? 28.853 65.918  60.693  1.00 19.06  ? 630 HOH A O   1 
HETATM 7438 O  O   . HOH V 6 .   ? 22.626 89.646  48.533  1.00 22.12  ? 631 HOH A O   1 
HETATM 7439 O  O   . HOH V 6 .   ? 28.408 67.406  56.334  1.00 24.54  ? 632 HOH A O   1 
HETATM 7440 O  O   . HOH V 6 .   ? 36.496 72.446  40.229  1.00 32.85  ? 633 HOH A O   1 
HETATM 7441 O  O   . HOH V 6 .   ? 44.925 75.916  70.767  1.00 27.12  ? 634 HOH A O   1 
HETATM 7442 O  O   A HOH V 6 .   ? 18.833 87.615  49.394  0.53 48.18  ? 635 HOH A O   1 
HETATM 7443 O  O   B HOH V 6 .   ? 19.955 86.899  48.541  0.47 48.18  ? 635 HOH A O   1 
HETATM 7444 O  O   . HOH V 6 .   ? 33.645 102.174 52.454  1.00 30.32  ? 636 HOH A O   1 
HETATM 7445 O  O   . HOH V 6 .   ? 38.169 109.085 62.305  1.00 29.46  ? 637 HOH A O   1 
HETATM 7446 O  O   . HOH V 6 .   ? 49.986 101.967 40.040  1.00 67.55  ? 638 HOH A O   1 
HETATM 7447 O  O   . HOH V 6 .   ? 38.206 69.760  68.519  1.00 27.81  ? 639 HOH A O   1 
HETATM 7448 O  O   . HOH V 6 .   ? 57.189 83.781  44.745  1.00 27.55  ? 640 HOH A O   1 
HETATM 7449 O  O   . HOH V 6 .   ? 44.333 72.021  47.703  1.00 23.77  ? 641 HOH A O   1 
HETATM 7450 O  O   . HOH V 6 .   ? 54.438 89.154  37.433  1.00 39.79  ? 642 HOH A O   1 
HETATM 7451 O  O   . HOH V 6 .   ? 29.358 82.370  72.905  1.00 31.94  ? 643 HOH A O   1 
HETATM 7452 O  O   . HOH V 6 .   ? 25.858 85.587  39.355  1.00 31.19  ? 644 HOH A O   1 
HETATM 7453 O  O   . HOH V 6 .   ? 29.253 79.336  41.868  1.00 35.88  ? 645 HOH A O   1 
HETATM 7454 O  O   . HOH V 6 .   ? 52.638 69.556  69.279  1.00 49.39  ? 646 HOH A O   1 
HETATM 7455 O  O   . HOH V 6 .   ? 53.302 99.410  51.748  1.00 46.60  ? 647 HOH A O   1 
HETATM 7456 O  O   . HOH V 6 .   ? 53.574 100.678 56.768  1.00 20.62  ? 648 HOH A O   1 
HETATM 7457 O  O   . HOH V 6 .   ? 53.322 69.054  71.885  1.00 63.61  ? 649 HOH A O   1 
HETATM 7458 O  O   . HOH V 6 .   ? 37.190 80.642  38.173  1.00 28.15  ? 650 HOH A O   1 
HETATM 7459 O  O   . HOH V 6 .   ? 18.454 72.466  56.627  1.00 36.21  ? 651 HOH A O   1 
HETATM 7460 O  O   . HOH V 6 .   ? 21.191 93.809  46.736  1.00 35.86  ? 652 HOH A O   1 
HETATM 7461 O  O   . HOH V 6 .   ? 37.516 85.979  36.832  1.00 34.76  ? 653 HOH A O   1 
HETATM 7462 O  O   A HOH V 6 .   ? 38.266 90.814  78.710  0.56 38.50  ? 654 HOH A O   1 
HETATM 7463 O  O   B HOH V 6 .   ? 38.790 90.117  77.867  0.44 38.50  ? 654 HOH A O   1 
HETATM 7464 O  O   . HOH V 6 .   ? 44.304 94.704  73.588  1.00 27.81  ? 655 HOH A O   1 
HETATM 7465 O  O   . HOH V 6 .   ? 20.616 79.359  56.433  1.00 39.05  ? 656 HOH A O   1 
HETATM 7466 O  O   . HOH V 6 .   ? 30.165 100.802 75.143  1.00 23.05  ? 657 HOH A O   1 
HETATM 7467 O  O   . HOH V 6 .   ? 24.058 85.975  37.442  1.00 36.59  ? 658 HOH A O   1 
HETATM 7468 O  O   . HOH V 6 .   ? 26.837 88.332  76.166  1.00 30.64  ? 659 HOH A O   1 
HETATM 7469 O  O   . HOH V 6 .   ? 58.381 85.822  56.962  1.00 40.54  ? 660 HOH A O   1 
HETATM 7470 O  O   . HOH V 6 .   ? 39.607 75.093  38.954  1.00 37.44  ? 661 HOH A O   1 
HETATM 7471 O  O   . HOH V 6 .   ? 30.115 104.326 51.764  1.00 45.99  ? 662 HOH A O   1 
HETATM 7472 O  O   . HOH V 6 .   ? 58.402 76.496  63.793  1.00 66.29  ? 663 HOH A O   1 
HETATM 7473 O  O   . HOH V 6 .   ? 33.273 65.738  59.932  1.00 11.08  ? 664 HOH A O   1 
HETATM 7474 O  O   . HOH V 6 .   ? 48.288 71.605  56.514  1.00 31.87  ? 665 HOH A O   1 
HETATM 7475 O  O   . HOH V 6 .   ? 26.064 65.714  54.717  1.00 36.39  ? 666 HOH A O   1 
HETATM 7476 O  O   . HOH V 6 .   ? 34.874 105.053 51.835  1.00 26.09  ? 667 HOH A O   1 
HETATM 7477 O  O   . HOH V 6 .   ? 20.622 105.152 62.813  1.00 43.78  ? 668 HOH A O   1 
HETATM 7478 O  O   . HOH V 6 .   ? 39.253 110.551 60.282  1.00 38.37  ? 669 HOH A O   1 
HETATM 7479 O  O   . HOH V 6 .   ? 32.607 66.798  57.565  1.00 12.89  ? 670 HOH A O   1 
HETATM 7480 O  O   . HOH V 6 .   ? 31.120 84.561  70.270  1.00 33.45  ? 671 HOH A O   1 
HETATM 7481 O  O   . HOH V 6 .   ? 28.295 89.595  73.952  1.00 27.08  ? 672 HOH A O   1 
HETATM 7482 O  O   . HOH V 6 .   ? 41.230 71.112  37.165  1.00 42.95  ? 673 HOH A O   1 
HETATM 7483 O  O   . HOH V 6 .   ? 49.296 71.786  53.984  1.00 24.96  ? 674 HOH A O   1 
HETATM 7484 O  O   . HOH V 6 .   ? 47.112 94.992  37.536  1.00 39.11  ? 675 HOH A O   1 
HETATM 7485 O  O   . HOH V 6 .   ? 52.094 97.818  63.185  1.00 33.76  ? 676 HOH A O   1 
HETATM 7486 O  O   . HOH V 6 .   ? 22.346 67.072  51.600  1.00 32.61  ? 677 HOH A O   1 
HETATM 7487 O  O   . HOH V 6 .   ? 50.299 84.918  73.817  1.00 31.41  ? 678 HOH A O   1 
HETATM 7488 O  O   . HOH V 6 .   ? 27.384 95.631  48.792  1.00 18.12  ? 679 HOH A O   1 
HETATM 7489 O  O   . HOH V 6 .   ? 42.386 104.568 46.412  1.00 31.95  ? 680 HOH A O   1 
HETATM 7490 O  O   . HOH V 6 .   ? 31.000 89.467  73.726  1.00 24.37  ? 681 HOH A O   1 
HETATM 7491 O  O   . HOH V 6 .   ? 35.348 68.113  65.613  1.00 31.01  ? 682 HOH A O   1 
HETATM 7492 O  O   . HOH V 6 .   ? 19.279 76.524  53.697  1.00 40.09  ? 683 HOH A O   1 
HETATM 7493 O  O   . HOH V 6 .   ? 19.526 79.337  52.048  1.00 31.14  ? 684 HOH A O   1 
HETATM 7494 O  O   . HOH V 6 .   ? 18.179 98.804  63.873  1.00 37.60  ? 685 HOH A O   1 
HETATM 7495 O  O   . HOH V 6 .   ? 19.448 78.209  47.204  1.00 29.28  ? 686 HOH A O   1 
HETATM 7496 O  O   . HOH V 6 .   ? 26.469 103.915 55.125  1.00 46.89  ? 687 HOH A O   1 
HETATM 7497 O  O   . HOH V 6 .   ? 19.049 84.879  60.519  1.00 30.51  ? 688 HOH A O   1 
HETATM 7498 O  O   . HOH V 6 .   ? 29.890 75.302  70.247  1.00 26.55  ? 689 HOH A O   1 
HETATM 7499 O  O   . HOH V 6 .   ? 51.147 91.702  71.183  1.00 37.17  ? 690 HOH A O   1 
HETATM 7500 O  O   . HOH V 6 .   ? 44.236 102.931 40.484  1.00 36.42  ? 691 HOH A O   1 
HETATM 7501 O  O   . HOH V 6 .   ? 26.903 103.985 63.932  1.00 33.33  ? 692 HOH A O   1 
HETATM 7502 O  O   . HOH V 6 .   ? 57.815 94.210  55.341  1.00 36.80  ? 693 HOH A O   1 
HETATM 7503 O  O   . HOH V 6 .   ? 55.565 77.270  48.838  1.00 33.14  ? 694 HOH A O   1 
HETATM 7504 O  O   . HOH V 6 .   ? 44.732 93.580  36.952  1.00 47.82  ? 695 HOH A O   1 
HETATM 7505 O  O   . HOH V 6 .   ? 20.509 73.255  48.839  1.00 43.02  ? 696 HOH A O   1 
HETATM 7506 O  O   . HOH V 6 .   ? 33.514 87.649  77.836  1.00 37.80  ? 697 HOH A O   1 
HETATM 7507 O  O   . HOH V 6 .   ? 37.396 110.416 66.745  1.00 34.92  ? 698 HOH A O   1 
HETATM 7508 O  O   . HOH V 6 .   ? 51.399 98.086  40.661  1.00 48.94  ? 699 HOH A O   1 
HETATM 7509 O  O   . HOH V 6 .   ? 17.934 93.474  57.909  1.00 30.45  ? 700 HOH A O   1 
HETATM 7510 O  O   . HOH V 6 .   ? 43.011 110.153 74.953  1.00 35.97  ? 701 HOH A O   1 
HETATM 7511 O  O   . HOH V 6 .   ? 43.624 104.765 48.714  1.00 27.75  ? 702 HOH A O   1 
HETATM 7512 O  O   . HOH V 6 .   ? 49.093 99.339  37.783  1.00 59.83  ? 703 HOH A O   1 
HETATM 7513 O  O   . HOH V 6 .   ? 46.676 71.275  60.348  1.00 23.01  ? 704 HOH A O   1 
HETATM 7514 O  O   . HOH V 6 .   ? 18.747 88.986  54.637  1.00 33.16  ? 705 HOH A O   1 
HETATM 7515 O  O   . HOH V 6 .   ? 42.369 107.079 66.120  1.00 26.06  ? 706 HOH A O   1 
HETATM 7516 O  O   . HOH V 6 .   ? 19.632 83.354  72.690  1.00 40.11  ? 707 HOH A O   1 
HETATM 7517 O  O   A HOH V 6 .   ? 18.744 73.319  62.318  0.30 36.46  ? 708 HOH A O   1 
HETATM 7518 O  O   B HOH V 6 .   ? 20.300 74.900  61.712  0.20 36.46  ? 708 HOH A O   1 
HETATM 7519 O  O   C HOH V 6 .   ? 17.137 72.634  62.034  0.50 36.46  ? 708 HOH A O   1 
HETATM 7520 O  O   . HOH V 6 .   ? 26.254 92.967  38.379  1.00 29.73  ? 709 HOH A O   1 
HETATM 7521 O  O   . HOH V 6 .   ? 46.509 112.490 73.904  1.00 44.16  ? 710 HOH A O   1 
HETATM 7522 O  O   . HOH V 6 .   ? 52.546 74.920  44.032  1.00 39.56  ? 711 HOH A O   1 
HETATM 7523 O  O   . HOH V 6 .   ? 43.587 107.115 82.497  1.00 46.85  ? 712 HOH A O   1 
HETATM 7524 O  O   . HOH V 6 .   ? 54.304 79.071  61.989  1.00 24.64  ? 713 HOH A O   1 
HETATM 7525 O  O   . HOH V 6 .   ? 55.214 96.162  60.700  1.00 33.03  ? 714 HOH A O   1 
HETATM 7526 O  O   . HOH V 6 .   ? 54.223 76.243  44.642  1.00 30.14  ? 715 HOH A O   1 
HETATM 7527 O  O   . HOH V 6 .   ? 53.754 75.530  50.580  1.00 30.18  ? 716 HOH A O   1 
HETATM 7528 O  O   A HOH V 6 .   ? 46.712 97.882  65.368  0.39 29.97  ? 717 HOH A O   1 
HETATM 7529 O  O   B HOH V 6 .   ? 47.129 96.515  66.491  0.61 29.97  ? 717 HOH A O   1 
HETATM 7530 O  O   . HOH V 6 .   ? 20.926 98.077  53.524  1.00 45.24  ? 718 HOH A O   1 
HETATM 7531 O  O   . HOH V 6 .   ? 38.079 85.602  73.302  1.00 32.26  ? 719 HOH A O   1 
HETATM 7532 O  O   . HOH V 6 .   ? 19.859 91.812  45.678  1.00 37.53  ? 720 HOH A O   1 
HETATM 7533 O  O   . HOH V 6 .   ? 26.988 66.043  44.359  1.00 27.24  ? 721 HOH A O   1 
HETATM 7534 O  O   . HOH V 6 .   ? 53.205 104.639 61.046  1.00 42.43  ? 722 HOH A O   1 
HETATM 7535 O  O   . HOH V 6 .   ? 45.418 106.427 48.563  1.00 50.54  ? 723 HOH A O   1 
HETATM 7536 O  O   . HOH V 6 .   ? 42.348 101.817 78.445  1.00 50.05  ? 724 HOH A O   1 
HETATM 7537 O  O   . HOH V 6 .   ? 38.059 106.891 76.160  1.00 34.56  ? 725 HOH A O   1 
HETATM 7538 O  O   . HOH V 6 .   ? 43.247 104.565 44.129  1.00 35.07  ? 726 HOH A O   1 
HETATM 7539 O  O   . HOH V 6 .   ? 34.844 79.980  73.464  1.00 37.67  ? 727 HOH A O   1 
HETATM 7540 O  O   . HOH V 6 .   ? 47.550 108.190 59.466  1.00 29.86  ? 728 HOH A O   1 
HETATM 7541 O  O   . HOH V 6 .   ? 31.905 109.234 73.908  1.00 44.12  ? 729 HOH A O   1 
HETATM 7542 O  O   . HOH V 6 .   ? 30.832 88.119  35.844  1.00 55.32  ? 730 HOH A O   1 
HETATM 7543 O  O   . HOH V 6 .   ? 57.577 79.822  60.683  1.00 34.26  ? 731 HOH A O   1 
HETATM 7544 O  O   . HOH V 6 .   ? 16.584 71.854  52.461  1.00 42.26  ? 732 HOH A O   1 
HETATM 7545 O  O   . HOH V 6 .   ? 45.247 103.886 79.521  1.00 45.39  ? 733 HOH A O   1 
HETATM 7546 O  O   . HOH V 6 .   ? 24.984 103.668 52.866  1.00 37.12  ? 734 HOH A O   1 
HETATM 7547 O  O   . HOH V 6 .   ? 21.024 92.112  48.315  1.00 43.51  ? 735 HOH A O   1 
HETATM 7548 O  O   . HOH V 6 .   ? 21.467 73.834  46.704  1.00 32.62  ? 736 HOH A O   1 
HETATM 7549 O  O   . HOH V 6 .   ? 47.383 103.364 63.063  1.00 45.52  ? 737 HOH A O   1 
HETATM 7550 O  O   . HOH V 6 .   ? 43.264 71.796  36.624  1.00 44.91  ? 738 HOH A O   1 
HETATM 7551 O  O   . HOH V 6 .   ? 43.282 79.000  74.307  1.00 37.63  ? 739 HOH A O   1 
HETATM 7552 O  O   . HOH V 6 .   ? 44.267 71.321  69.578  1.00 43.01  ? 740 HOH A O   1 
HETATM 7553 O  O   . HOH V 6 .   ? 46.288 101.956 76.128  1.00 33.28  ? 741 HOH A O   1 
HETATM 7554 O  O   . HOH V 6 .   ? 29.136 104.416 61.083  1.00 40.46  ? 742 HOH A O   1 
HETATM 7555 O  O   . HOH V 6 .   ? 51.710 72.538  46.008  1.00 40.74  ? 743 HOH A O   1 
HETATM 7556 O  O   . HOH V 6 .   ? 55.967 93.268  60.840  1.00 37.27  ? 744 HOH A O   1 
HETATM 7557 O  O   . HOH V 6 .   ? 55.233 92.497  63.746  1.00 42.20  ? 745 HOH A O   1 
HETATM 7558 O  O   . HOH V 6 .   ? 18.963 85.210  45.113  1.00 38.19  ? 746 HOH A O   1 
HETATM 7559 O  O   . HOH V 6 .   ? 45.451 99.260  75.914  1.00 37.52  ? 747 HOH A O   1 
HETATM 7560 O  O   . HOH V 6 .   ? 49.570 95.479  67.260  1.00 34.81  ? 748 HOH A O   1 
HETATM 7561 O  O   . HOH V 6 .   ? 40.829 111.405 58.557  1.00 40.79  ? 749 HOH A O   1 
HETATM 7562 O  O   . HOH V 6 .   ? 47.074 69.556  66.525  1.00 42.80  ? 750 HOH A O   1 
HETATM 7563 O  O   . HOH V 6 .   ? 49.553 90.863  34.259  1.00 58.37  ? 751 HOH A O   1 
HETATM 7564 O  O   . HOH V 6 .   ? 19.473 95.590  67.788  1.00 39.43  ? 752 HOH A O   1 
HETATM 7565 O  O   . HOH V 6 .   ? 20.847 76.098  45.803  1.00 36.49  ? 753 HOH A O   1 
HETATM 7566 O  O   . HOH V 6 .   ? 32.484 103.567 83.365  1.00 30.00  ? 754 HOH A O   1 
HETATM 7567 O  O   . HOH V 6 .   ? 21.307 92.195  71.059  1.00 38.41  ? 755 HOH A O   1 
HETATM 7568 O  O   . HOH V 6 .   ? 50.362 72.345  47.777  1.00 35.00  ? 756 HOH A O   1 
HETATM 7569 O  O   . HOH V 6 .   ? 19.593 93.807  53.414  1.00 33.35  ? 757 HOH A O   1 
HETATM 7570 O  O   . HOH V 6 .   ? 40.219 91.416  41.303  1.00 33.27  ? 758 HOH A O   1 
HETATM 7571 O  O   . HOH V 6 .   ? 45.712 87.967  77.805  1.00 44.31  ? 759 HOH A O   1 
HETATM 7572 O  O   . HOH V 6 .   ? 41.499 102.511 38.673  1.00 41.16  ? 760 HOH A O   1 
HETATM 7573 O  O   . HOH V 6 .   ? 32.741 85.276  36.692  1.00 39.29  ? 761 HOH A O   1 
HETATM 7574 O  O   . HOH V 6 .   ? 14.976 96.003  68.585  1.00 52.07  ? 762 HOH A O   1 
HETATM 7575 O  O   . HOH V 6 .   ? 36.415 65.991  38.013  1.00 42.39  ? 763 HOH A O   1 
HETATM 7576 O  O   . HOH V 6 .   ? 47.431 75.328  71.623  1.00 32.06  ? 764 HOH A O   1 
HETATM 7577 O  O   . HOH V 6 .   ? 53.090 68.438  67.403  1.00 49.05  ? 765 HOH A O   1 
HETATM 7578 O  O   . HOH V 6 .   ? 37.893 90.166  40.241  1.00 37.78  ? 766 HOH A O   1 
HETATM 7579 O  O   . HOH V 6 .   ? 21.792 95.107  69.268  1.00 34.60  ? 767 HOH A O   1 
HETATM 7580 O  O   A HOH V 6 .   ? 17.169 85.968  70.651  0.60 40.02  ? 768 HOH A O   1 
HETATM 7581 O  O   B HOH V 6 .   ? 18.263 84.965  70.014  0.40 40.02  ? 768 HOH A O   1 
HETATM 7582 O  O   . HOH V 6 .   ? 38.383 76.900  66.548  1.00 30.00  ? 769 HOH A O   1 
HETATM 7583 O  O   . HOH V 6 .   ? 34.783 66.655  62.174  1.00 30.00  ? 770 HOH A O   1 
HETATM 7584 O  O   . HOH V 6 .   ? 40.833 76.222  65.337  1.00 30.00  ? 771 HOH A O   1 
HETATM 7585 O  O   . HOH V 6 .   ? 31.173 96.901  42.889  1.00 30.00  ? 772 HOH A O   1 
HETATM 7586 O  O   . HOH V 6 .   ? 29.462 99.102  49.776  1.00 30.00  ? 773 HOH A O   1 
HETATM 7587 O  O   . HOH V 6 .   ? 35.350 104.425 54.690  1.00 30.00  ? 774 HOH A O   1 
HETATM 7588 O  O   . HOH V 6 .   ? 31.269 91.967  39.179  1.00 30.00  ? 775 HOH A O   1 
HETATM 7589 O  O   . HOH V 6 .   ? 27.193 103.114 52.249  1.00 30.00  ? 776 HOH A O   1 
HETATM 7590 O  O   . HOH V 6 .   ? 41.175 93.782  73.045  1.00 30.00  ? 777 HOH A O   1 
HETATM 7591 O  O   . HOH V 6 .   ? 53.326 75.411  53.765  1.00 30.00  ? 778 HOH A O   1 
HETATM 7592 O  O   . HOH V 6 .   ? 42.445 109.094 67.189  1.00 30.00  ? 779 HOH A O   1 
HETATM 7593 O  O   . HOH V 6 .   ? 20.595 86.747  45.312  1.00 30.00  ? 780 HOH A O   1 
HETATM 7594 O  O   . HOH V 6 .   ? 41.822 75.944  39.231  1.00 30.00  ? 781 HOH A O   1 
HETATM 7595 O  O   . HOH V 6 .   ? 57.295 89.091  48.490  1.00 30.00  ? 782 HOH A O   1 
HETATM 7596 O  O   . HOH V 6 .   ? 56.585 88.285  46.025  1.00 30.00  ? 783 HOH A O   1 
HETATM 7597 O  O   . HOH W 6 .   ? 52.151 48.056  51.854  1.00 8.48   ? 501 HOH B O   1 
HETATM 7598 O  O   . HOH W 6 .   ? 56.818 58.915  38.332  1.00 9.89   ? 502 HOH B O   1 
HETATM 7599 O  O   . HOH W 6 .   ? 47.419 41.311  44.037  1.00 13.13  ? 503 HOH B O   1 
HETATM 7600 O  O   . HOH W 6 .   ? 49.671 61.590  40.933  1.00 23.07  ? 504 HOH B O   1 
HETATM 7601 O  O   . HOH W 6 .   ? 52.190 59.661  39.526  1.00 12.92  ? 505 HOH B O   1 
HETATM 7602 O  O   . HOH W 6 .   ? 31.485 65.700  42.011  1.00 25.90  ? 506 HOH B O   1 
HETATM 7603 O  O   A HOH W 6 .   ? 29.884 46.605  57.747  0.58 29.44  ? 507 HOH B O   1 
HETATM 7604 O  O   B HOH W 6 .   ? 28.309 47.304  58.922  0.42 29.44  ? 507 HOH B O   1 
HETATM 7605 O  O   . HOH W 6 .   ? 26.917 59.236  49.219  1.00 12.99  ? 508 HOH B O   1 
HETATM 7606 O  O   . HOH W 6 .   ? 44.298 67.611  49.875  1.00 10.72  ? 509 HOH B O   1 
HETATM 7607 O  O   . HOH W 6 .   ? 31.995 60.298  52.476  1.00 13.05  ? 510 HOH B O   1 
HETATM 7608 O  O   . HOH W 6 .   ? 29.123 45.583  55.232  1.00 29.88  ? 511 HOH B O   1 
HETATM 7609 O  O   . HOH W 6 .   ? 34.228 46.321  57.452  1.00 19.16  ? 512 HOH B O   1 
HETATM 7610 O  O   . HOH W 6 .   ? 27.705 52.398  47.845  1.00 14.67  ? 513 HOH B O   1 
HETATM 7611 O  O   . HOH W 6 .   ? 34.100 40.581  46.542  1.00 13.51  ? 514 HOH B O   1 
HETATM 7612 O  O   . HOH W 6 .   ? 54.840 64.455  36.094  1.00 26.84  ? 515 HOH B O   1 
HETATM 7613 O  O   . HOH W 6 .   ? 40.490 63.170  56.307  1.00 21.27  ? 516 HOH B O   1 
HETATM 7614 O  O   . HOH W 6 .   ? 33.150 43.621  54.347  1.00 9.93   ? 517 HOH B O   1 
HETATM 7615 O  O   . HOH W 6 .   ? 30.663 44.058  53.553  1.00 17.17  ? 518 HOH B O   1 
HETATM 7616 O  O   . HOH W 6 .   ? 49.735 37.589  59.925  1.00 14.21  ? 519 HOH B O   1 
HETATM 7617 O  O   . HOH W 6 .   ? 41.672 66.750  50.328  1.00 11.83  ? 520 HOH B O   1 
HETATM 7618 O  O   . HOH W 6 .   ? 37.771 55.008  33.476  1.00 11.20  ? 521 HOH B O   1 
HETATM 7619 O  O   . HOH W 6 .   ? 68.632 52.525  37.542  1.00 27.35  ? 522 HOH B O   1 
HETATM 7620 O  O   . HOH W 6 .   ? 36.605 57.828  60.357  1.00 12.53  ? 523 HOH B O   1 
HETATM 7621 O  O   . HOH W 6 .   ? 55.738 54.288  50.806  1.00 11.99  ? 524 HOH B O   1 
HETATM 7622 O  O   . HOH W 6 .   ? 34.020 59.891  57.081  1.00 10.01  ? 525 HOH B O   1 
HETATM 7623 O  O   . HOH W 6 .   ? 28.906 68.140  50.667  1.00 15.54  ? 526 HOH B O   1 
HETATM 7624 O  O   . HOH W 6 .   ? 61.765 53.387  39.910  1.00 12.26  ? 527 HOH B O   1 
HETATM 7625 O  O   . HOH W 6 .   ? 26.265 50.582  41.463  1.00 18.84  ? 528 HOH B O   1 
HETATM 7626 O  O   . HOH W 6 .   ? 39.953 46.477  29.706  1.00 16.98  ? 529 HOH B O   1 
HETATM 7627 O  O   A HOH W 6 .   ? 70.209 48.309  28.348  0.55 37.32  ? 530 HOH B O   1 
HETATM 7628 O  O   B HOH W 6 .   ? 69.578 46.679  29.120  0.45 37.32  ? 530 HOH B O   1 
HETATM 7629 O  O   . HOH W 6 .   ? 37.776 37.919  32.542  1.00 24.23  ? 531 HOH B O   1 
HETATM 7630 O  O   . HOH W 6 .   ? 56.108 63.041  38.046  1.00 25.16  ? 532 HOH B O   1 
HETATM 7631 O  O   . HOH W 6 .   ? 54.871 56.823  47.868  1.00 20.76  ? 533 HOH B O   1 
HETATM 7632 O  O   . HOH W 6 .   ? 62.376 41.856  32.835  1.00 19.97  ? 534 HOH B O   1 
HETATM 7633 O  O   . HOH W 6 .   ? 73.067 41.728  40.549  1.00 18.84  ? 535 HOH B O   1 
HETATM 7634 O  O   A HOH W 6 .   ? 62.429 46.483  44.564  0.52 23.79  ? 536 HOH B O   1 
HETATM 7635 O  O   B HOH W 6 .   ? 62.349 44.993  43.515  0.48 23.79  ? 536 HOH B O   1 
HETATM 7636 O  O   . HOH W 6 .   ? 32.377 40.478  60.373  1.00 29.63  ? 537 HOH B O   1 
HETATM 7637 O  O   . HOH W 6 .   ? 39.468 46.353  63.498  1.00 30.54  ? 538 HOH B O   1 
HETATM 7638 O  O   . HOH W 6 .   ? 39.761 44.436  31.076  1.00 19.16  ? 539 HOH B O   1 
HETATM 7639 O  O   . HOH W 6 .   ? 58.451 54.587  50.955  1.00 16.22  ? 540 HOH B O   1 
HETATM 7640 O  O   A HOH W 6 .   ? 29.968 46.843  32.650  0.73 20.90  ? 541 HOH B O   1 
HETATM 7641 O  O   B HOH W 6 .   ? 30.491 48.633  31.609  0.27 20.90  ? 541 HOH B O   1 
HETATM 7642 O  O   . HOH W 6 .   ? 38.316 64.313  57.028  1.00 14.48  ? 542 HOH B O   1 
HETATM 7643 O  O   . HOH W 6 .   ? 58.886 42.636  54.493  1.00 14.38  ? 543 HOH B O   1 
HETATM 7644 O  O   . HOH W 6 .   ? 58.061 50.162  28.658  1.00 21.58  ? 544 HOH B O   1 
HETATM 7645 O  O   . HOH W 6 .   ? 50.275 67.262  52.037  1.00 17.66  ? 545 HOH B O   1 
HETATM 7646 O  O   . HOH W 6 .   ? 53.087 45.885  62.374  1.00 16.87  ? 546 HOH B O   1 
HETATM 7647 O  O   . HOH W 6 .   ? 48.231 36.368  61.869  1.00 19.71  ? 547 HOH B O   1 
HETATM 7648 O  O   . HOH W 6 .   ? 57.980 59.652  43.643  1.00 14.25  ? 548 HOH B O   1 
HETATM 7649 O  O   . HOH W 6 .   ? 46.695 68.086  42.714  1.00 29.99  ? 549 HOH B O   1 
HETATM 7650 O  O   . HOH W 6 .   ? 64.970 43.122  33.499  1.00 22.85  ? 550 HOH B O   1 
HETATM 7651 O  O   . HOH W 6 .   ? 54.109 59.897  27.347  1.00 18.00  ? 551 HOH B O   1 
HETATM 7652 O  O   . HOH W 6 .   ? 37.461 36.054  34.205  1.00 19.75  ? 552 HOH B O   1 
HETATM 7653 O  O   . HOH W 6 .   ? 68.559 44.765  40.909  1.00 21.23  ? 553 HOH B O   1 
HETATM 7654 O  O   . HOH W 6 .   ? 65.888 43.527  42.707  1.00 21.34  ? 554 HOH B O   1 
HETATM 7655 O  O   . HOH W 6 .   ? 73.744 50.605  37.591  1.00 40.28  ? 555 HOH B O   1 
HETATM 7656 O  O   . HOH W 6 .   ? 55.222 54.564  70.081  1.00 33.13  ? 556 HOH B O   1 
HETATM 7657 O  O   . HOH W 6 .   ? 45.417 54.732  62.051  1.00 34.48  ? 557 HOH B O   1 
HETATM 7658 O  O   A HOH W 6 .   ? 42.624 66.134  26.114  0.55 39.67  ? 558 HOH B O   1 
HETATM 7659 O  O   B HOH W 6 .   ? 43.724 65.964  27.350  0.45 39.67  ? 558 HOH B O   1 
HETATM 7660 O  O   . HOH W 6 .   ? 43.965 45.894  62.667  1.00 18.69  ? 559 HOH B O   1 
HETATM 7661 O  O   . HOH W 6 .   ? 34.144 62.074  55.336  1.00 11.50  ? 560 HOH B O   1 
HETATM 7662 O  O   . HOH W 6 .   ? 35.495 39.774  48.942  1.00 14.42  ? 561 HOH B O   1 
HETATM 7663 O  O   A HOH W 6 .   ? 64.992 51.998  47.094  0.60 31.47  ? 562 HOH B O   1 
HETATM 7664 O  O   B HOH W 6 .   ? 64.885 52.420  48.525  0.20 31.47  ? 562 HOH B O   1 
HETATM 7665 O  O   C HOH W 6 .   ? 65.438 50.286  47.165  0.20 31.47  ? 562 HOH B O   1 
HETATM 7666 O  O   D HOH W 6 .   ? 65.008 51.029  48.986  0.00 31.47  ? 562 HOH B O   1 
HETATM 7667 O  O   . HOH W 6 .   ? 69.118 50.453  53.842  1.00 44.67  ? 563 HOH B O   1 
HETATM 7668 O  O   . HOH W 6 .   ? 53.023 56.893  49.894  1.00 13.06  ? 564 HOH B O   1 
HETATM 7669 O  O   . HOH W 6 .   ? 41.352 27.174  45.391  1.00 33.69  ? 565 HOH B O   1 
HETATM 7670 O  O   . HOH W 6 .   ? 40.657 32.673  40.418  1.00 20.16  ? 566 HOH B O   1 
HETATM 7671 O  O   . HOH W 6 .   ? 65.673 56.697  52.265  1.00 26.66  ? 567 HOH B O   1 
HETATM 7672 O  O   . HOH W 6 .   ? 34.444 37.282  38.389  1.00 27.49  ? 568 HOH B O   1 
HETATM 7673 O  O   . HOH W 6 .   ? 45.446 35.544  35.826  1.00 32.82  ? 569 HOH B O   1 
HETATM 7674 O  O   . HOH W 6 .   ? 60.962 58.147  46.429  1.00 17.48  ? 570 HOH B O   1 
HETATM 7675 O  O   . HOH W 6 .   ? 34.818 45.500  62.154  1.00 25.47  ? 571 HOH B O   1 
HETATM 7676 O  O   . HOH W 6 .   ? 26.954 43.206  36.811  1.00 20.28  ? 572 HOH B O   1 
HETATM 7677 O  O   . HOH W 6 .   ? 35.932 46.661  60.190  1.00 26.35  ? 573 HOH B O   1 
HETATM 7678 O  O   . HOH W 6 .   ? 56.456 60.111  55.418  1.00 22.95  ? 574 HOH B O   1 
HETATM 7679 O  O   . HOH W 6 .   ? 35.451 60.075  61.073  1.00 15.66  ? 575 HOH B O   1 
HETATM 7680 O  O   . HOH W 6 .   ? 35.818 63.737  38.539  1.00 27.18  ? 576 HOH B O   1 
HETATM 7681 O  O   . HOH W 6 .   ? 26.574 41.188  58.708  1.00 40.32  ? 577 HOH B O   1 
HETATM 7682 O  O   . HOH W 6 .   ? 37.526 43.718  27.980  1.00 26.45  ? 578 HOH B O   1 
HETATM 7683 O  O   . HOH W 6 .   ? 61.087 34.014  46.090  1.00 22.53  ? 579 HOH B O   1 
HETATM 7684 O  O   . HOH W 6 .   ? 38.181 29.150  43.534  1.00 28.85  ? 580 HOH B O   1 
HETATM 7685 O  O   . HOH W 6 .   ? 50.065 28.560  53.360  1.00 23.19  ? 581 HOH B O   1 
HETATM 7686 O  O   . HOH W 6 .   ? 25.966 67.310  48.101  1.00 22.11  ? 582 HOH B O   1 
HETATM 7687 O  O   . HOH W 6 .   ? 64.610 42.832  40.645  1.00 17.72  ? 583 HOH B O   1 
HETATM 7688 O  O   . HOH W 6 .   ? 39.272 58.887  60.289  1.00 14.15  ? 584 HOH B O   1 
HETATM 7689 O  O   . HOH W 6 .   ? 65.778 59.946  38.969  1.00 17.77  ? 585 HOH B O   1 
HETATM 7690 O  O   . HOH W 6 .   ? 58.076 34.007  39.541  1.00 22.11  ? 586 HOH B O   1 
HETATM 7691 O  O   . HOH W 6 .   ? 70.760 56.731  31.469  1.00 22.14  ? 587 HOH B O   1 
HETATM 7692 O  O   . HOH W 6 .   ? 26.364 47.176  48.867  1.00 28.60  ? 588 HOH B O   1 
HETATM 7693 O  O   . HOH W 6 .   ? 28.055 41.996  41.911  1.00 24.91  ? 589 HOH B O   1 
HETATM 7694 O  O   . HOH W 6 .   ? 52.055 36.021  58.516  1.00 28.07  ? 590 HOH B O   1 
HETATM 7695 O  O   . HOH W 6 .   ? 40.899 35.107  41.487  1.00 16.68  ? 591 HOH B O   1 
HETATM 7696 O  O   . HOH W 6 .   ? 29.266 36.522  38.885  1.00 22.44  ? 592 HOH B O   1 
HETATM 7697 O  O   . HOH W 6 .   ? 34.059 66.602  53.363  1.00 18.45  ? 593 HOH B O   1 
HETATM 7698 O  O   . HOH W 6 .   ? 60.796 42.743  56.373  1.00 20.61  ? 594 HOH B O   1 
HETATM 7699 O  O   . HOH W 6 .   ? 68.958 55.240  28.581  1.00 22.36  ? 595 HOH B O   1 
HETATM 7700 O  O   . HOH W 6 .   ? 28.091 50.467  46.226  1.00 19.27  ? 596 HOH B O   1 
HETATM 7701 O  O   . HOH W 6 .   ? 55.517 61.773  68.041  1.00 66.90  ? 597 HOH B O   1 
HETATM 7702 O  O   . HOH W 6 .   ? 25.089 62.980  48.003  1.00 29.21  ? 598 HOH B O   1 
HETATM 7703 O  O   . HOH W 6 .   ? 44.876 39.215  64.188  1.00 26.52  ? 599 HOH B O   1 
HETATM 7704 O  O   . HOH W 6 .   ? 51.959 33.209  33.753  1.00 30.01  ? 600 HOH B O   1 
HETATM 7705 O  O   . HOH W 6 .   ? 26.350 48.552  39.408  1.00 29.13  ? 601 HOH B O   1 
HETATM 7706 O  O   . HOH W 6 .   ? 47.078 55.357  19.493  1.00 52.17  ? 602 HOH B O   1 
HETATM 7707 O  O   . HOH W 6 .   ? 44.392 56.261  21.917  1.00 41.93  ? 603 HOH B O   1 
HETATM 7708 O  O   . HOH W 6 .   ? 26.583 49.571  44.207  1.00 27.37  ? 604 HOH B O   1 
HETATM 7709 O  O   . HOH W 6 .   ? 34.340 49.618  32.135  1.00 16.52  ? 605 HOH B O   1 
HETATM 7710 O  O   . HOH W 6 .   ? 36.241 61.720  36.226  1.00 26.89  ? 606 HOH B O   1 
HETATM 7711 O  O   . HOH W 6 .   ? 54.518 60.640  57.357  1.00 27.64  ? 607 HOH B O   1 
HETATM 7712 O  O   . HOH W 6 .   ? 63.288 40.928  46.906  1.00 34.93  ? 608 HOH B O   1 
HETATM 7713 O  O   . HOH W 6 .   ? 24.541 58.555  50.225  1.00 25.44  ? 609 HOH B O   1 
HETATM 7714 O  O   . HOH W 6 .   ? 63.112 43.377  28.482  1.00 32.58  ? 610 HOH B O   1 
HETATM 7715 O  O   . HOH W 6 .   ? 63.287 58.794  52.965  1.00 32.50  ? 611 HOH B O   1 
HETATM 7716 O  O   . HOH W 6 .   ? 40.911 61.733  58.904  1.00 27.85  ? 612 HOH B O   1 
HETATM 7717 O  O   . HOH W 6 .   ? 31.825 62.977  52.043  1.00 17.02  ? 613 HOH B O   1 
HETATM 7718 O  O   . HOH W 6 .   ? 62.243 57.401  26.410  1.00 39.02  ? 614 HOH B O   1 
HETATM 7719 O  O   . HOH W 6 .   ? 24.658 51.555  47.799  1.00 25.24  ? 615 HOH B O   1 
HETATM 7720 O  O   . HOH W 6 .   ? 49.065 40.338  31.054  1.00 24.47  ? 616 HOH B O   1 
HETATM 7721 O  O   . HOH W 6 .   ? 57.584 61.105  45.817  1.00 35.95  ? 617 HOH B O   1 
HETATM 7722 O  O   . HOH W 6 .   ? 34.882 53.895  33.438  1.00 20.23  ? 618 HOH B O   1 
HETATM 7723 O  O   . HOH W 6 .   ? 38.296 45.314  59.148  1.00 22.80  ? 619 HOH B O   1 
HETATM 7724 O  O   . HOH W 6 .   ? 57.631 56.472  48.339  1.00 27.19  ? 620 HOH B O   1 
HETATM 7725 O  O   . HOH W 6 .   ? 45.722 51.194  65.368  1.00 25.97  ? 621 HOH B O   1 
HETATM 7726 O  O   . HOH W 6 .   ? 46.025 32.141  60.624  1.00 29.88  ? 622 HOH B O   1 
HETATM 7727 O  O   A HOH W 6 .   ? 49.570 30.576  35.160  0.57 33.19  ? 623 HOH B O   1 
HETATM 7728 O  O   B HOH W 6 .   ? 49.459 28.654  35.352  0.43 33.19  ? 623 HOH B O   1 
HETATM 7729 O  O   . HOH W 6 .   ? 44.577 41.859  64.159  1.00 33.27  ? 624 HOH B O   1 
HETATM 7730 O  O   . HOH W 6 .   ? 47.098 27.069  38.350  1.00 44.49  ? 625 HOH B O   1 
HETATM 7731 O  O   . HOH W 6 .   ? 45.443 47.356  21.873  1.00 55.85  ? 626 HOH B O   1 
HETATM 7732 O  O   . HOH W 6 .   ? 52.115 65.764  53.695  1.00 33.69  ? 627 HOH B O   1 
HETATM 7733 O  O   . HOH W 6 .   ? 43.165 42.033  29.553  1.00 25.86  ? 628 HOH B O   1 
HETATM 7734 O  O   . HOH W 6 .   ? 44.660 40.514  28.314  1.00 41.48  ? 629 HOH B O   1 
HETATM 7735 O  O   . HOH W 6 .   ? 46.255 27.564  55.263  1.00 31.07  ? 630 HOH B O   1 
HETATM 7736 O  O   . HOH W 6 .   ? 45.977 68.115  47.587  1.00 29.71  ? 631 HOH B O   1 
HETATM 7737 O  O   . HOH W 6 .   ? 64.275 43.382  45.151  1.00 47.30  ? 632 HOH B O   1 
HETATM 7738 O  O   . HOH W 6 .   ? 55.405 36.780  33.816  1.00 22.70  ? 633 HOH B O   1 
HETATM 7739 O  O   . HOH W 6 .   ? 33.926 55.169  31.413  1.00 26.11  ? 634 HOH B O   1 
HETATM 7740 O  O   . HOH W 6 .   ? 54.347 50.713  24.695  1.00 30.22  ? 635 HOH B O   1 
HETATM 7741 O  O   . HOH W 6 .   ? 46.057 35.628  70.500  1.00 33.08  ? 636 HOH B O   1 
HETATM 7742 O  O   . HOH W 6 .   ? 54.381 63.900  50.312  1.00 26.87  ? 637 HOH B O   1 
HETATM 7743 O  O   . HOH W 6 .   ? 69.542 39.262  36.495  1.00 25.95  ? 638 HOH B O   1 
HETATM 7744 O  O   . HOH W 6 .   ? 22.094 46.249  58.252  1.00 44.05  ? 639 HOH B O   1 
HETATM 7745 O  O   . HOH W 6 .   ? 54.375 36.732  60.298  1.00 35.34  ? 640 HOH B O   1 
HETATM 7746 O  O   . HOH W 6 .   ? 64.034 61.241  25.151  1.00 33.45  ? 641 HOH B O   1 
HETATM 7747 O  O   . HOH W 6 .   ? 25.565 64.178  40.151  1.00 41.28  ? 642 HOH B O   1 
HETATM 7748 O  O   . HOH W 6 .   ? 21.360 55.329  46.046  1.00 57.49  ? 643 HOH B O   1 
HETATM 7749 O  O   . HOH W 6 .   ? 28.866 46.666  46.512  1.00 18.60  ? 644 HOH B O   1 
HETATM 7750 O  O   . HOH W 6 .   ? 23.862 43.780  31.075  1.00 29.20  ? 645 HOH B O   1 
HETATM 7751 O  O   . HOH W 6 .   ? 27.056 39.269  59.735  1.00 45.01  ? 646 HOH B O   1 
HETATM 7752 O  O   . HOH W 6 .   ? 57.229 38.816  56.509  1.00 35.46  ? 647 HOH B O   1 
HETATM 7753 O  O   . HOH W 6 .   ? 24.043 51.839  41.118  1.00 44.98  ? 648 HOH B O   1 
HETATM 7754 O  O   . HOH W 6 .   ? 29.887 39.329  48.801  1.00 26.05  ? 649 HOH B O   1 
HETATM 7755 O  O   . HOH W 6 .   ? 37.396 28.745  46.021  1.00 40.15  ? 650 HOH B O   1 
HETATM 7756 O  O   . HOH W 6 .   ? 49.732 69.040  40.931  1.00 35.95  ? 651 HOH B O   1 
HETATM 7757 O  O   . HOH W 6 .   ? 35.816 37.404  40.642  1.00 20.67  ? 652 HOH B O   1 
HETATM 7758 O  O   . HOH W 6 .   ? 27.925 43.740  28.523  1.00 31.20  ? 653 HOH B O   1 
HETATM 7759 O  O   . HOH W 6 .   ? 22.474 52.146  42.877  1.00 46.36  ? 654 HOH B O   1 
HETATM 7760 O  O   . HOH W 6 .   ? 50.275 57.693  64.893  1.00 48.57  ? 655 HOH B O   1 
HETATM 7761 O  O   . HOH W 6 .   ? 36.367 48.957  61.201  1.00 27.26  ? 656 HOH B O   1 
HETATM 7762 O  O   . HOH W 6 .   ? 48.134 40.912  24.888  1.00 66.02  ? 657 HOH B O   1 
HETATM 7763 O  O   . HOH W 6 .   ? 56.639 36.373  31.380  1.00 35.04  ? 658 HOH B O   1 
HETATM 7764 O  O   A HOH W 6 .   ? 41.945 29.833  57.501  0.46 24.87  ? 659 HOH B O   1 
HETATM 7765 O  O   B HOH W 6 .   ? 43.096 29.911  57.072  0.54 24.87  ? 659 HOH B O   1 
HETATM 7766 O  O   . HOH W 6 .   ? 26.535 70.647  40.780  1.00 37.00  ? 660 HOH B O   1 
HETATM 7767 O  O   . HOH W 6 .   ? 50.376 63.976  29.198  1.00 29.46  ? 661 HOH B O   1 
HETATM 7768 O  O   . HOH W 6 .   ? 46.240 65.453  57.179  1.00 27.10  ? 662 HOH B O   1 
HETATM 7769 O  O   . HOH W 6 .   ? 39.025 43.465  64.093  1.00 34.00  ? 663 HOH B O   1 
HETATM 7770 O  O   . HOH W 6 .   ? 51.310 31.234  42.380  1.00 40.21  ? 664 HOH B O   1 
HETATM 7771 O  O   . HOH W 6 .   ? 38.539 38.646  61.125  1.00 26.90  ? 665 HOH B O   1 
HETATM 7772 O  O   . HOH W 6 .   ? 21.833 56.283  51.757  1.00 32.44  ? 666 HOH B O   1 
HETATM 7773 O  O   . HOH W 6 .   ? 42.761 65.676  59.137  1.00 34.12  ? 667 HOH B O   1 
HETATM 7774 O  O   A HOH W 6 .   ? 30.251 40.069  55.285  0.48 34.75  ? 668 HOH B O   1 
HETATM 7775 O  O   B HOH W 6 .   ? 28.851 41.078  54.744  0.52 34.75  ? 668 HOH B O   1 
HETATM 7776 O  O   . HOH W 6 .   ? 43.901 28.051  55.703  1.00 22.44  ? 669 HOH B O   1 
HETATM 7777 O  O   . HOH W 6 .   ? 56.423 63.880  51.349  1.00 42.84  ? 670 HOH B O   1 
HETATM 7778 O  O   . HOH W 6 .   ? 24.679 51.056  34.153  1.00 40.83  ? 671 HOH B O   1 
HETATM 7779 O  O   . HOH W 6 .   ? 33.626 61.316  59.539  1.00 14.01  ? 672 HOH B O   1 
HETATM 7780 O  O   . HOH W 6 .   ? 36.935 35.500  41.628  1.00 37.81  ? 673 HOH B O   1 
HETATM 7781 O  O   . HOH W 6 .   ? 54.384 29.897  42.163  1.00 36.44  ? 674 HOH B O   1 
HETATM 7782 O  O   . HOH W 6 .   ? 62.293 58.613  29.481  1.00 23.65  ? 675 HOH B O   1 
HETATM 7783 O  O   . HOH W 6 .   ? 29.234 66.067  41.421  1.00 35.40  ? 676 HOH B O   1 
HETATM 7784 O  O   . HOH W 6 .   ? 51.224 62.880  41.972  1.00 30.73  ? 677 HOH B O   1 
HETATM 7785 O  O   . HOH W 6 .   ? 31.565 66.922  52.804  1.00 19.86  ? 678 HOH B O   1 
HETATM 7786 O  O   . HOH W 6 .   ? 33.659 61.606  38.200  1.00 39.16  ? 679 HOH B O   1 
HETATM 7787 O  O   . HOH W 6 .   ? 41.982 65.456  56.496  1.00 31.20  ? 680 HOH B O   1 
HETATM 7788 O  O   . HOH W 6 .   ? 51.482 67.949  41.755  1.00 42.48  ? 681 HOH B O   1 
HETATM 7789 O  O   . HOH W 6 .   ? 63.670 45.935  47.274  1.00 30.95  ? 682 HOH B O   1 
HETATM 7790 O  O   . HOH W 6 .   ? 26.746 45.106  53.975  1.00 31.27  ? 683 HOH B O   1 
HETATM 7791 O  O   . HOH W 6 .   ? 62.501 38.775  50.179  1.00 32.78  ? 684 HOH B O   1 
HETATM 7792 O  O   . HOH W 6 .   ? 57.818 33.670  34.895  1.00 47.19  ? 685 HOH B O   1 
HETATM 7793 O  O   . HOH W 6 .   ? 20.176 55.002  50.560  1.00 44.47  ? 686 HOH B O   1 
HETATM 7794 O  O   . HOH W 6 .   ? 43.981 66.702  57.445  1.00 33.48  ? 687 HOH B O   1 
HETATM 7795 O  O   . HOH W 6 .   ? 30.301 37.476  53.142  1.00 39.86  ? 688 HOH B O   1 
HETATM 7796 O  O   A HOH W 6 .   ? 59.451 66.026  40.917  0.67 42.56  ? 689 HOH B O   1 
HETATM 7797 O  O   B HOH W 6 .   ? 59.201 67.924  40.427  0.33 42.56  ? 689 HOH B O   1 
HETATM 7798 O  O   . HOH W 6 .   ? 60.543 52.721  22.673  1.00 36.46  ? 690 HOH B O   1 
HETATM 7799 O  O   . HOH W 6 .   ? 59.332 33.405  37.248  1.00 35.76  ? 691 HOH B O   1 
HETATM 7800 O  O   . HOH W 6 .   ? 66.286 39.054  46.147  1.00 39.42  ? 692 HOH B O   1 
HETATM 7801 O  O   A HOH W 6 .   ? 40.834 37.493  63.904  0.56 27.99  ? 693 HOH B O   1 
HETATM 7802 O  O   B HOH W 6 .   ? 42.564 38.359  64.752  0.44 27.99  ? 693 HOH B O   1 
HETATM 7803 O  O   . HOH W 6 .   ? 63.763 55.874  54.558  1.00 32.38  ? 694 HOH B O   1 
HETATM 7804 O  O   . HOH W 6 .   ? 28.949 38.421  42.248  1.00 34.39  ? 695 HOH B O   1 
HETATM 7805 O  O   . HOH W 6 .   ? 60.292 60.171  58.657  1.00 41.95  ? 696 HOH B O   1 
HETATM 7806 O  O   . HOH W 6 .   ? 55.944 53.156  21.640  1.00 45.79  ? 697 HOH B O   1 
HETATM 7807 O  O   . HOH W 6 .   ? 55.880 59.986  59.692  1.00 29.87  ? 698 HOH B O   1 
HETATM 7808 O  O   . HOH W 6 .   ? 53.407 48.486  28.407  1.00 23.61  ? 699 HOH B O   1 
HETATM 7809 O  O   . HOH W 6 .   ? 45.783 25.968  49.960  1.00 44.61  ? 700 HOH B O   1 
HETATM 7810 O  O   . HOH W 6 .   ? 51.623 42.734  30.718  1.00 33.06  ? 701 HOH B O   1 
HETATM 7811 O  O   . HOH W 6 .   ? 42.245 33.196  63.493  1.00 36.55  ? 702 HOH B O   1 
HETATM 7812 O  O   . HOH W 6 .   ? 61.302 41.593  29.327  1.00 29.37  ? 703 HOH B O   1 
HETATM 7813 O  O   . HOH W 6 .   ? 33.232 32.347  53.324  1.00 56.61  ? 704 HOH B O   1 
HETATM 7814 O  O   . HOH W 6 .   ? 31.690 42.284  63.136  1.00 48.16  ? 705 HOH B O   1 
HETATM 7815 O  O   . HOH W 6 .   ? 35.534 67.490  41.077  1.00 34.72  ? 706 HOH B O   1 
HETATM 7816 O  O   . HOH W 6 .   ? 46.154 44.967  63.785  1.00 31.14  ? 707 HOH B O   1 
HETATM 7817 O  O   . HOH W 6 .   ? 58.852 34.649  53.742  1.00 37.98  ? 708 HOH B O   1 
HETATM 7818 O  O   . HOH W 6 .   ? 54.458 48.276  61.855  1.00 27.79  ? 709 HOH B O   1 
HETATM 7819 O  O   . HOH W 6 .   ? 63.535 35.311  36.351  1.00 30.07  ? 710 HOH B O   1 
HETATM 7820 O  O   . HOH W 6 .   ? 29.191 45.483  29.133  1.00 37.73  ? 711 HOH B O   1 
HETATM 7821 O  O   . HOH W 6 .   ? 40.467 56.432  26.236  1.00 28.02  ? 712 HOH B O   1 
HETATM 7822 O  O   . HOH W 6 .   ? 40.663 25.641  43.637  1.00 34.70  ? 713 HOH B O   1 
HETATM 7823 O  O   . HOH W 6 .   ? 48.903 28.437  43.360  1.00 25.68  ? 714 HOH B O   1 
HETATM 7824 O  O   A HOH W 6 .   ? 61.791 60.916  45.220  0.15 41.84  ? 715 HOH B O   1 
HETATM 7825 O  O   B HOH W 6 .   ? 62.516 61.400  43.609  0.16 41.84  ? 715 HOH B O   1 
HETATM 7826 O  O   C HOH W 6 .   ? 63.853 62.113  42.414  0.49 41.84  ? 715 HOH B O   1 
HETATM 7827 O  O   D HOH W 6 .   ? 64.587 61.922  39.792  0.20 41.84  ? 715 HOH B O   1 
HETATM 7828 O  O   . HOH W 6 .   ? 45.898 57.319  63.925  1.00 38.54  ? 716 HOH B O   1 
HETATM 7829 O  O   A HOH W 6 .   ? 28.517 55.930  37.262  0.56 24.94  ? 717 HOH B O   1 
HETATM 7830 O  O   B HOH W 6 .   ? 26.081 55.964  37.625  0.44 24.94  ? 717 HOH B O   1 
HETATM 7831 O  O   . HOH W 6 .   ? 43.671 26.683  50.438  1.00 41.58  ? 718 HOH B O   1 
HETATM 7832 O  O   . HOH W 6 .   ? 37.099 62.172  22.964  1.00 58.81  ? 719 HOH B O   1 
HETATM 7833 O  O   . HOH W 6 .   ? 46.730 25.140  46.158  1.00 46.72  ? 720 HOH B O   1 
HETATM 7834 O  O   . HOH W 6 .   ? 64.882 49.175  25.794  1.00 41.52  ? 721 HOH B O   1 
HETATM 7835 O  O   . HOH W 6 .   ? 38.393 62.205  33.087  1.00 28.51  ? 722 HOH B O   1 
HETATM 7836 O  O   . HOH W 6 .   ? 46.770 52.567  20.904  1.00 45.30  ? 723 HOH B O   1 
HETATM 7837 O  O   . HOH W 6 .   ? 47.081 69.847  32.461  1.00 32.85  ? 724 HOH B O   1 
HETATM 7838 O  O   . HOH W 6 .   ? 32.433 29.759  50.043  1.00 63.68  ? 725 HOH B O   1 
HETATM 7839 O  O   . HOH W 6 .   ? 56.271 48.338  28.197  1.00 33.08  ? 726 HOH B O   1 
HETATM 7840 O  O   . HOH W 6 .   ? 45.561 69.606  30.731  1.00 40.68  ? 727 HOH B O   1 
HETATM 7841 O  O   . HOH W 6 .   ? 22.004 58.855  42.935  1.00 58.71  ? 728 HOH B O   1 
HETATM 7842 O  O   . HOH W 6 .   ? 45.219 38.265  28.959  1.00 32.44  ? 729 HOH B O   1 
HETATM 7843 O  O   . HOH W 6 .   ? 22.847 56.948  46.427  1.00 35.79  ? 730 HOH B O   1 
HETATM 7844 O  O   . HOH W 6 .   ? 48.571 26.567  44.866  1.00 49.29  ? 731 HOH B O   1 
HETATM 7845 O  O   . HOH W 6 .   ? 54.430 30.215  39.946  1.00 39.39  ? 732 HOH B O   1 
HETATM 7846 O  O   A HOH W 6 .   ? 44.483 51.835  62.607  0.24 34.63  ? 733 HOH B O   1 
HETATM 7847 O  O   B HOH W 6 .   ? 43.291 50.639  63.787  0.28 34.63  ? 733 HOH B O   1 
HETATM 7848 O  O   C HOH W 6 .   ? 42.590 48.604  63.754  0.48 34.63  ? 733 HOH B O   1 
HETATM 7849 O  O   . HOH W 6 .   ? 53.036 58.336  67.991  1.00 38.39  ? 734 HOH B O   1 
HETATM 7850 O  O   . HOH W 6 .   ? 74.061 52.864  38.255  1.00 41.10  ? 735 HOH B O   1 
HETATM 7851 O  O   . HOH W 6 .   ? 65.428 53.580  43.844  1.00 27.79  ? 736 HOH B O   1 
HETATM 7852 O  O   . HOH W 6 .   ? 49.358 71.286  39.823  1.00 47.60  ? 737 HOH B O   1 
HETATM 7853 O  O   . HOH W 6 .   ? 42.339 25.776  55.116  1.00 36.77  ? 738 HOH B O   1 
HETATM 7854 O  O   . HOH W 6 .   ? 33.174 64.850  38.621  1.00 40.44  ? 739 HOH B O   1 
HETATM 7855 O  O   . HOH W 6 .   ? 50.857 39.027  20.913  1.00 63.84  ? 740 HOH B O   1 
HETATM 7856 O  O   . HOH W 6 .   ? 51.246 31.952  57.028  1.00 31.40  ? 741 HOH B O   1 
HETATM 7857 O  O   . HOH W 6 .   ? 31.389 38.494  58.951  1.00 46.92  ? 742 HOH B O   1 
HETATM 7858 O  O   . HOH W 6 .   ? 50.779 61.101  66.958  1.00 67.88  ? 743 HOH B O   1 
HETATM 7859 O  O   . HOH W 6 .   ? 69.291 60.237  27.708  1.00 28.33  ? 744 HOH B O   1 
HETATM 7860 O  O   . HOH W 6 .   ? 38.690 34.445  43.222  1.00 36.41  ? 745 HOH B O   1 
HETATM 7861 O  O   . HOH W 6 .   ? 51.518 62.514  59.999  1.00 44.30  ? 746 HOH B O   1 
HETATM 7862 O  O   . HOH W 6 .   ? 22.913 42.360  57.496  1.00 62.06  ? 747 HOH B O   1 
HETATM 7863 O  O   . HOH W 6 .   ? 27.481 45.080  56.660  1.00 42.04  ? 748 HOH B O   1 
HETATM 7864 O  O   . HOH W 6 .   ? 43.708 31.271  62.594  1.00 41.02  ? 749 HOH B O   1 
HETATM 7865 O  O   . HOH W 6 .   ? 44.010 58.541  64.554  1.00 42.21  ? 750 HOH B O   1 
HETATM 7866 O  O   . HOH W 6 .   ? 36.406 33.311  42.222  1.00 42.60  ? 751 HOH B O   1 
HETATM 7867 O  O   . HOH W 6 .   ? 41.077 49.680  24.247  1.00 39.51  ? 752 HOH B O   1 
HETATM 7868 O  O   A HOH W 6 .   ? 35.017 48.048  28.965  0.63 38.29  ? 753 HOH B O   1 
HETATM 7869 O  O   B HOH W 6 .   ? 36.635 48.890  28.385  0.37 38.29  ? 753 HOH B O   1 
HETATM 7870 O  O   . HOH W 6 .   ? 54.072 49.523  60.013  1.00 37.52  ? 754 HOH B O   1 
HETATM 7871 O  O   . HOH W 6 .   ? 64.775 44.627  27.662  1.00 37.40  ? 755 HOH B O   1 
HETATM 7872 O  O   A HOH W 6 .   ? 33.800 69.622  40.636  0.48 35.90  ? 756 HOH B O   1 
HETATM 7873 O  O   B HOH W 6 .   ? 32.447 70.496  40.564  0.52 35.90  ? 756 HOH B O   1 
HETATM 7874 O  O   . HOH W 6 .   ? 23.880 43.847  63.516  1.00 49.03  ? 757 HOH B O   1 
HETATM 7875 O  O   . HOH W 6 .   ? 55.168 33.532  55.425  1.00 39.80  ? 758 HOH B O   1 
HETATM 7876 O  O   . HOH W 6 .   ? 57.576 31.350  44.213  1.00 49.58  ? 759 HOH B O   1 
HETATM 7877 O  O   . HOH W 6 .   ? 73.382 47.481  32.014  1.00 42.76  ? 760 HOH B O   1 
HETATM 7878 O  O   . HOH W 6 .   ? 65.172 35.435  42.588  1.00 33.67  ? 761 HOH B O   1 
HETATM 7879 O  O   . HOH W 6 .   ? 39.863 42.444  27.264  1.00 41.04  ? 762 HOH B O   1 
HETATM 7880 O  O   . HOH W 6 .   ? 56.735 65.382  28.966  1.00 31.42  ? 763 HOH B O   1 
HETATM 7881 O  O   . HOH W 6 .   ? 70.203 52.388  30.800  1.00 33.21  ? 764 HOH B O   1 
HETATM 7882 O  O   . HOH W 6 .   ? 28.147 72.688  42.976  1.00 33.50  ? 765 HOH B O   1 
HETATM 7883 O  O   . HOH W 6 .   ? 60.875 48.417  59.835  1.00 41.81  ? 766 HOH B O   1 
HETATM 7884 O  O   . HOH W 6 .   ? 40.048 34.029  36.006  1.00 35.06  ? 767 HOH B O   1 
HETATM 7885 O  O   . HOH W 6 .   ? 47.426 26.057  51.623  1.00 41.54  ? 768 HOH B O   1 
HETATM 7886 O  O   . HOH W 6 .   ? 31.386 35.413  45.226  1.00 43.53  ? 769 HOH B O   1 
HETATM 7887 O  O   . HOH W 6 .   ? 55.925 48.600  67.220  1.00 59.65  ? 770 HOH B O   1 
HETATM 7888 O  O   . HOH W 6 .   ? 50.741 46.366  64.324  1.00 40.41  ? 771 HOH B O   1 
HETATM 7889 O  O   . HOH W 6 .   ? 57.966 58.213  70.593  1.00 52.29  ? 772 HOH B O   1 
HETATM 7890 O  O   . HOH W 6 .   ? 32.231 36.361  53.207  1.00 52.72  ? 773 HOH B O   1 
HETATM 7891 O  O   . HOH W 6 .   ? 54.760 64.794  26.873  1.00 34.14  ? 774 HOH B O   1 
HETATM 7892 O  O   . HOH W 6 .   ? 57.191 56.284  22.306  1.00 43.96  ? 775 HOH B O   1 
HETATM 7893 O  O   . HOH W 6 .   ? 32.631 36.343  56.790  1.00 42.60  ? 776 HOH B O   1 
HETATM 7894 O  O   . HOH W 6 .   ? 48.501 60.403  52.217  1.00 30.00  ? 777 HOH B O   1 
HETATM 7895 O  O   . HOH W 6 .   ? 48.733 58.677  54.315  1.00 30.00  ? 778 HOH B O   1 
HETATM 7896 O  O   . HOH W 6 .   ? 71.332 47.085  39.689  1.00 30.00  ? 779 HOH B O   1 
HETATM 7897 O  O   . HOH W 6 .   ? 71.380 50.731  39.839  1.00 30.00  ? 780 HOH B O   1 
HETATM 7898 O  O   . HOH W 6 .   ? 48.978 37.185  64.489  1.00 30.00  ? 781 HOH B O   1 
HETATM 7899 O  O   . HOH W 6 .   ? 33.535 39.468  30.913  1.00 30.00  ? 782 HOH B O   1 
HETATM 7900 O  O   . HOH W 6 .   ? 71.444 37.114  41.666  1.00 30.00  ? 783 HOH B O   1 
HETATM 7901 O  O   . HOH W 6 .   ? 58.834 58.829  47.308  1.00 30.00  ? 784 HOH B O   1 
HETATM 7902 O  O   . HOH W 6 .   ? 51.454 64.859  55.925  1.00 30.00  ? 785 HOH B O   1 
HETATM 7903 O  O   . HOH W 6 .   ? 57.236 31.742  39.892  1.00 30.00  ? 786 HOH B O   1 
HETATM 7904 O  O   . HOH W 6 .   ? 37.863 61.363  60.940  1.00 30.00  ? 787 HOH B O   1 
HETATM 7905 O  O   . HOH W 6 .   ? 26.703 64.879  50.968  1.00 30.00  ? 788 HOH B O   1 
HETATM 7906 O  O   . HOH W 6 .   ? 38.363 64.792  59.648  1.00 30.00  ? 789 HOH B O   1 
HETATM 7907 O  O   . HOH W 6 .   ? 69.585 52.520  41.669  1.00 30.00  ? 790 HOH B O   1 
HETATM 7908 O  O   . HOH W 6 .   ? 36.547 56.027  29.851  1.00 30.00  ? 791 HOH B O   1 
HETATM 7909 O  O   . HOH W 6 .   ? 67.263 54.874  44.196  1.00 30.00  ? 792 HOH B O   1 
HETATM 7910 O  O   . HOH W 6 .   ? 63.104 42.460  52.882  1.00 30.00  ? 793 HOH B O   1 
HETATM 7911 O  O   . HOH W 6 .   ? 51.581 67.311  49.129  1.00 30.00  ? 794 HOH B O   1 
HETATM 7912 O  O   . HOH X 6 .   ? 28.515 40.360  77.906  1.00 12.45  ? 501 HOH C O   1 
HETATM 7913 O  O   . HOH X 6 .   ? 30.234 57.769  82.422  1.00 9.23   ? 502 HOH C O   1 
HETATM 7914 O  O   . HOH X 6 .   ? 29.340 41.818  85.439  1.00 15.81  ? 503 HOH C O   1 
HETATM 7915 O  O   . HOH X 6 .   ? 18.802 57.929  83.710  1.00 17.55  ? 504 HOH C O   1 
HETATM 7916 O  O   . HOH X 6 .   ? 22.225 52.061  55.132  1.00 20.48  ? 505 HOH C O   1 
HETATM 7917 O  O   . HOH X 6 .   ? 33.398 52.455  61.804  1.00 10.31  ? 506 HOH C O   1 
HETATM 7918 O  O   . HOH X 6 .   ? 31.049 64.586  61.160  1.00 10.94  ? 507 HOH C O   1 
HETATM 7919 O  O   . HOH X 6 .   ? 31.289 37.139  90.770  1.00 21.82  ? 508 HOH C O   1 
HETATM 7920 O  O   . HOH X 6 .   ? 21.827 62.924  56.515  1.00 15.30  ? 509 HOH C O   1 
HETATM 7921 O  O   . HOH X 6 .   ? 13.714 66.725  74.811  1.00 17.50  ? 510 HOH C O   1 
HETATM 7922 O  O   . HOH X 6 .   ? 33.782 51.405  76.817  1.00 11.10  ? 511 HOH C O   1 
HETATM 7923 O  O   . HOH X 6 .   ? 27.061 62.072  59.417  1.00 10.22  ? 512 HOH C O   1 
HETATM 7924 O  O   . HOH X 6 .   ? 33.283 49.262  78.210  1.00 19.72  ? 513 HOH C O   1 
HETATM 7925 O  O   . HOH X 6 .   ? 20.393 71.184  71.870  1.00 12.42  ? 514 HOH C O   1 
HETATM 7926 O  O   . HOH X 6 .   ? 34.378 52.186  80.583  1.00 10.86  ? 515 HOH C O   1 
HETATM 7927 O  O   . HOH X 6 .   ? 34.194 70.362  75.100  1.00 26.04  ? 516 HOH C O   1 
HETATM 7928 O  O   . HOH X 6 .   ? 28.140 58.466  51.760  1.00 14.75  ? 517 HOH C O   1 
HETATM 7929 O  O   . HOH X 6 .   ? 32.421 58.967  90.938  1.00 18.11  ? 518 HOH C O   1 
HETATM 7930 O  O   . HOH X 6 .   ? 34.888 50.386  63.032  1.00 13.43  ? 519 HOH C O   1 
HETATM 7931 O  O   . HOH X 6 .   ? 33.607 66.685  64.640  1.00 8.50   ? 520 HOH C O   1 
HETATM 7932 O  O   . HOH X 6 .   ? 20.121 75.385  88.358  1.00 18.98  ? 521 HOH C O   1 
HETATM 7933 O  O   . HOH X 6 .   ? 27.470 43.180  74.205  1.00 17.75  ? 522 HOH C O   1 
HETATM 7934 O  O   . HOH X 6 .   ? 15.737 68.135  76.214  1.00 17.13  ? 523 HOH C O   1 
HETATM 7935 O  O   . HOH X 6 .   ? 37.076 65.819  84.805  1.00 17.66  ? 524 HOH C O   1 
HETATM 7936 O  O   . HOH X 6 .   ? 35.882 44.566  81.549  1.00 18.01  ? 525 HOH C O   1 
HETATM 7937 O  O   . HOH X 6 .   ? 28.425 44.414  71.144  1.00 21.07  ? 526 HOH C O   1 
HETATM 7938 O  O   . HOH X 6 .   ? 29.364 69.834  88.158  1.00 18.40  ? 527 HOH C O   1 
HETATM 7939 O  O   . HOH X 6 .   ? 36.503 39.081  80.480  1.00 30.29  ? 528 HOH C O   1 
HETATM 7940 O  O   . HOH X 6 .   ? 35.319 59.435  63.626  1.00 17.08  ? 529 HOH C O   1 
HETATM 7941 O  O   . HOH X 6 .   ? 17.649 64.965  61.861  1.00 15.81  ? 530 HOH C O   1 
HETATM 7942 O  O   A HOH X 6 .   ? 23.876 48.391  52.303  0.49 40.55  ? 531 HOH C O   1 
HETATM 7943 O  O   B HOH X 6 .   ? 24.206 48.305  54.152  0.16 40.55  ? 531 HOH C O   1 
HETATM 7944 O  O   C HOH X 6 .   ? 24.265 48.934  56.484  0.35 40.55  ? 531 HOH C O   1 
HETATM 7945 O  O   . HOH X 6 .   ? 36.056 50.669  82.357  1.00 13.97  ? 532 HOH C O   1 
HETATM 7946 O  O   . HOH X 6 .   ? 39.180 49.215  67.595  1.00 15.98  ? 533 HOH C O   1 
HETATM 7947 O  O   . HOH X 6 .   ? 35.639 64.498  65.635  1.00 20.17  ? 534 HOH C O   1 
HETATM 7948 O  O   . HOH X 6 .   ? 18.224 50.596  59.407  1.00 35.16  ? 535 HOH C O   1 
HETATM 7949 O  O   . HOH X 6 .   ? 13.662 48.534  67.048  1.00 17.45  ? 536 HOH C O   1 
HETATM 7950 O  O   . HOH X 6 .   ? 30.992 62.146  59.718  1.00 14.20  ? 537 HOH C O   1 
HETATM 7951 O  O   . HOH X 6 .   ? 36.765 69.796  89.721  1.00 43.05  ? 538 HOH C O   1 
HETATM 7952 O  O   . HOH X 6 .   ? 33.185 43.389  78.350  1.00 14.03  ? 539 HOH C O   1 
HETATM 7953 O  O   . HOH X 6 .   ? 30.916 44.124  64.437  1.00 27.36  ? 540 HOH C O   1 
HETATM 7954 O  O   . HOH X 6 .   ? 22.529 77.530  73.715  1.00 35.34  ? 541 HOH C O   1 
HETATM 7955 O  O   . HOH X 6 .   ? 0.942  61.671  70.523  1.00 28.84  ? 542 HOH C O   1 
HETATM 7956 O  O   . HOH X 6 .   ? 16.417 34.934  62.468  1.00 50.52  ? 543 HOH C O   1 
HETATM 7957 O  O   . HOH X 6 .   ? 18.956 71.698  69.940  1.00 20.61  ? 544 HOH C O   1 
HETATM 7958 O  O   . HOH X 6 .   ? 30.352 59.233  54.424  1.00 18.59  ? 545 HOH C O   1 
HETATM 7959 O  O   . HOH X 6 .   ? 34.057 35.967  83.672  1.00 18.73  ? 546 HOH C O   1 
HETATM 7960 O  O   . HOH X 6 .   ? 18.679 74.507  90.470  1.00 21.86  ? 547 HOH C O   1 
HETATM 7961 O  O   . HOH X 6 .   ? 5.255  55.733  67.495  1.00 26.24  ? 548 HOH C O   1 
HETATM 7962 O  O   . HOH X 6 .   ? 24.929 71.404  70.764  1.00 19.15  ? 549 HOH C O   1 
HETATM 7963 O  O   . HOH X 6 .   ? 32.593 70.468  78.194  1.00 20.86  ? 550 HOH C O   1 
HETATM 7964 O  O   A HOH X 6 .   ? 31.483 72.991  75.038  0.54 30.84  ? 551 HOH C O   1 
HETATM 7965 O  O   B HOH X 6 .   ? 31.046 73.945  73.271  0.46 30.84  ? 551 HOH C O   1 
HETATM 7966 O  O   . HOH X 6 .   ? 35.009 44.330  77.043  1.00 28.41  ? 552 HOH C O   1 
HETATM 7967 O  O   . HOH X 6 .   ? 4.248  56.294  79.269  1.00 26.24  ? 553 HOH C O   1 
HETATM 7968 O  O   . HOH X 6 .   ? 35.787 46.332  79.525  1.00 31.06  ? 554 HOH C O   1 
HETATM 7969 O  O   . HOH X 6 .   ? 27.369 71.253  74.561  1.00 19.10  ? 555 HOH C O   1 
HETATM 7970 O  O   . HOH X 6 .   ? 28.897 43.658  96.243  1.00 26.12  ? 556 HOH C O   1 
HETATM 7971 O  O   . HOH X 6 .   ? 29.458 72.489  87.862  1.00 23.34  ? 557 HOH C O   1 
HETATM 7972 O  O   . HOH X 6 .   ? 15.010 69.007  64.464  1.00 35.04  ? 558 HOH C O   1 
HETATM 7973 O  O   . HOH X 6 .   ? 15.627 40.587  93.337  1.00 34.97  ? 559 HOH C O   1 
HETATM 7974 O  O   . HOH X 6 .   ? 31.809 58.471  56.553  1.00 20.11  ? 560 HOH C O   1 
HETATM 7975 O  O   . HOH X 6 .   ? 25.758 46.318  94.870  1.00 19.81  ? 561 HOH C O   1 
HETATM 7976 O  O   . HOH X 6 .   ? 7.680  48.588  74.362  1.00 29.89  ? 562 HOH C O   1 
HETATM 7977 O  O   . HOH X 6 .   ? 22.887 73.745  67.486  1.00 28.86  ? 563 HOH C O   1 
HETATM 7978 O  O   . HOH X 6 .   ? 18.570 42.310  93.832  1.00 24.70  ? 564 HOH C O   1 
HETATM 7979 O  O   . HOH X 6 .   ? 23.325 56.206  98.557  1.00 28.93  ? 565 HOH C O   1 
HETATM 7980 O  O   . HOH X 6 .   ? 34.959 59.068  92.492  1.00 26.57  ? 566 HOH C O   1 
HETATM 7981 O  O   . HOH X 6 .   ? 13.446 48.742  92.410  1.00 24.97  ? 567 HOH C O   1 
HETATM 7982 O  O   . HOH X 6 .   ? 19.953 33.429  75.313  1.00 23.53  ? 568 HOH C O   1 
HETATM 7983 O  O   . HOH X 6 .   ? 41.937 47.730  83.018  1.00 32.22  ? 569 HOH C O   1 
HETATM 7984 O  O   . HOH X 6 .   ? 23.704 51.100  100.462 1.00 34.60  ? 570 HOH C O   1 
HETATM 7985 O  O   . HOH X 6 .   ? 33.532 65.773  91.379  1.00 34.98  ? 571 HOH C O   1 
HETATM 7986 O  O   . HOH X 6 .   ? 25.866 29.381  89.275  1.00 29.06  ? 572 HOH C O   1 
HETATM 7987 O  O   . HOH X 6 .   ? 15.690 64.581  63.543  1.00 22.86  ? 573 HOH C O   1 
HETATM 7988 O  O   . HOH X 6 .   ? 39.752 52.403  90.997  1.00 38.68  ? 574 HOH C O   1 
HETATM 7989 O  O   . HOH X 6 .   ? 17.978 75.429  73.014  1.00 41.11  ? 575 HOH C O   1 
HETATM 7990 O  O   . HOH X 6 .   ? 27.914 60.496  57.455  1.00 21.22  ? 576 HOH C O   1 
HETATM 7991 O  O   . HOH X 6 .   ? 3.131  57.714  74.848  1.00 33.48  ? 577 HOH C O   1 
HETATM 7992 O  O   . HOH X 6 .   ? 43.805 55.294  76.652  1.00 31.32  ? 578 HOH C O   1 
HETATM 7993 O  O   . HOH X 6 .   ? 41.701 54.163  75.339  1.00 29.99  ? 579 HOH C O   1 
HETATM 7994 O  O   A HOH X 6 .   ? 37.779 56.993  62.846  0.53 27.79  ? 580 HOH C O   1 
HETATM 7995 O  O   B HOH X 6 .   ? 39.567 56.823  63.446  0.47 27.79  ? 580 HOH C O   1 
HETATM 7996 O  O   . HOH X 6 .   ? 13.016 64.282  62.992  1.00 27.08  ? 581 HOH C O   1 
HETATM 7997 O  O   . HOH X 6 .   ? 34.319 47.599  63.914  1.00 20.87  ? 582 HOH C O   1 
HETATM 7998 O  O   . HOH X 6 .   ? 37.331 64.944  73.047  1.00 24.07  ? 583 HOH C O   1 
HETATM 7999 O  O   . HOH X 6 .   ? 17.106 53.093  96.283  1.00 30.63  ? 584 HOH C O   1 
HETATM 8000 O  O   . HOH X 6 .   ? 11.616 62.164  62.088  1.00 23.80  ? 585 HOH C O   1 
HETATM 8001 O  O   . HOH X 6 .   ? 29.449 29.646  89.378  1.00 24.80  ? 586 HOH C O   1 
HETATM 8002 O  O   . HOH X 6 .   ? 7.227  51.496  75.870  1.00 26.55  ? 587 HOH C O   1 
HETATM 8003 O  O   . HOH X 6 .   ? 11.739 50.291  65.877  1.00 25.65  ? 588 HOH C O   1 
HETATM 8004 O  O   . HOH X 6 .   ? 27.639 77.346  81.664  1.00 28.02  ? 589 HOH C O   1 
HETATM 8005 O  O   . HOH X 6 .   ? 36.427 45.476  70.815  1.00 29.55  ? 590 HOH C O   1 
HETATM 8006 O  O   . HOH X 6 .   ? 17.979 37.374  84.996  1.00 26.15  ? 591 HOH C O   1 
HETATM 8007 O  O   . HOH X 6 .   ? 39.783 55.515  65.863  1.00 37.51  ? 592 HOH C O   1 
HETATM 8008 O  O   . HOH X 6 .   ? 28.420 52.635  95.359  1.00 35.54  ? 593 HOH C O   1 
HETATM 8009 O  O   . HOH X 6 .   ? 8.761  33.479  78.218  1.00 50.65  ? 594 HOH C O   1 
HETATM 8010 O  O   . HOH X 6 .   ? 21.984 60.947  52.635  1.00 34.65  ? 595 HOH C O   1 
HETATM 8011 O  O   A HOH X 6 .   ? 33.871 37.631  94.134  0.51 36.63  ? 596 HOH C O   1 
HETATM 8012 O  O   B HOH X 6 .   ? 32.472 38.951  93.874  0.49 36.63  ? 596 HOH C O   1 
HETATM 8013 O  O   . HOH X 6 .   ? 23.520 36.550  62.265  1.00 38.90  ? 597 HOH C O   1 
HETATM 8014 O  O   . HOH X 6 .   ? 6.950  49.283  79.674  1.00 35.02  ? 598 HOH C O   1 
HETATM 8015 O  O   A HOH X 6 .   ? 27.628 71.623  71.886  0.41 41.51  ? 599 HOH C O   1 
HETATM 8016 O  O   B HOH X 6 .   ? 27.443 72.722  71.496  0.59 41.51  ? 599 HOH C O   1 
HETATM 8017 O  O   . HOH X 6 .   ? 28.255 46.565  95.178  1.00 25.15  ? 600 HOH C O   1 
HETATM 8018 O  O   . HOH X 6 .   ? 28.955 68.786  90.750  1.00 32.95  ? 601 HOH C O   1 
HETATM 8019 O  O   . HOH X 6 .   ? 32.362 41.682  68.373  1.00 32.47  ? 602 HOH C O   1 
HETATM 8020 O  O   . HOH X 6 .   ? 36.767 61.508  64.729  1.00 31.73  ? 603 HOH C O   1 
HETATM 8021 O  O   . HOH X 6 .   ? 19.151 78.962  69.278  1.00 39.49  ? 604 HOH C O   1 
HETATM 8022 O  O   . HOH X 6 .   ? 19.367 73.013  92.704  1.00 33.51  ? 605 HOH C O   1 
HETATM 8023 O  O   . HOH X 6 .   ? 14.404 66.222  66.640  1.00 25.44  ? 606 HOH C O   1 
HETATM 8024 O  O   . HOH X 6 .   ? 6.485  62.839  77.686  1.00 50.83  ? 607 HOH C O   1 
HETATM 8025 O  O   . HOH X 6 .   ? 16.253 35.682  90.497  1.00 50.26  ? 608 HOH C O   1 
HETATM 8026 O  O   . HOH X 6 .   ? 21.046 65.227  55.262  1.00 25.50  ? 609 HOH C O   1 
HETATM 8027 O  O   . HOH X 6 .   ? 15.691 66.741  60.205  1.00 27.06  ? 610 HOH C O   1 
HETATM 8028 O  O   . HOH X 6 .   ? 10.770 41.093  68.244  1.00 30.59  ? 611 HOH C O   1 
HETATM 8029 O  O   . HOH X 6 .   ? 10.002 48.503  85.272  1.00 28.35  ? 612 HOH C O   1 
HETATM 8030 O  O   . HOH X 6 .   ? 16.220 53.094  57.584  1.00 37.00  ? 613 HOH C O   1 
HETATM 8031 O  O   . HOH X 6 .   ? 17.336 44.520  62.336  1.00 31.01  ? 614 HOH C O   1 
HETATM 8032 O  O   . HOH X 6 .   ? 8.561  61.408  62.498  1.00 43.87  ? 615 HOH C O   1 
HETATM 8033 O  O   . HOH X 6 .   ? 37.918 62.000  88.932  1.00 43.77  ? 616 HOH C O   1 
HETATM 8034 O  O   . HOH X 6 .   ? 15.667 38.772  84.782  1.00 34.12  ? 617 HOH C O   1 
HETATM 8035 O  O   . HOH X 6 .   ? 10.534 48.874  64.087  1.00 31.04  ? 618 HOH C O   1 
HETATM 8036 O  O   . HOH X 6 .   ? 8.384  62.703  84.929  1.00 32.49  ? 619 HOH C O   1 
HETATM 8037 O  O   . HOH X 6 .   ? 41.882 54.918  67.832  1.00 30.90  ? 620 HOH C O   1 
HETATM 8038 O  O   . HOH X 6 .   ? 30.543 25.316  85.626  1.00 33.79  ? 621 HOH C O   1 
HETATM 8039 O  O   . HOH X 6 .   ? 10.377 45.502  91.809  1.00 43.97  ? 622 HOH C O   1 
HETATM 8040 O  O   . HOH X 6 .   ? 1.520  61.974  91.244  1.00 63.39  ? 623 HOH C O   1 
HETATM 8041 O  O   . HOH X 6 .   ? 30.430 62.715  57.031  1.00 42.03  ? 624 HOH C O   1 
HETATM 8042 O  O   . HOH X 6 .   ? 13.626 68.478  80.662  1.00 39.50  ? 625 HOH C O   1 
HETATM 8043 O  O   . HOH X 6 .   ? 11.991 76.628  83.878  1.00 70.10  ? 626 HOH C O   1 
HETATM 8044 O  O   . HOH X 6 .   ? 21.070 79.376  78.096  1.00 42.61  ? 627 HOH C O   1 
HETATM 8045 O  O   . HOH X 6 .   ? 18.145 47.514  99.195  1.00 37.64  ? 628 HOH C O   1 
HETATM 8046 O  O   . HOH X 6 .   ? 34.791 48.278  80.333  1.00 26.57  ? 629 HOH C O   1 
HETATM 8047 O  O   . HOH X 6 .   ? 20.746 52.868  53.687  1.00 39.25  ? 630 HOH C O   1 
HETATM 8048 O  O   . HOH X 6 .   ? 22.874 75.417  66.036  1.00 39.07  ? 631 HOH C O   1 
HETATM 8049 O  O   . HOH X 6 .   ? 38.244 68.838  75.783  1.00 26.83  ? 632 HOH C O   1 
HETATM 8050 O  O   . HOH X 6 .   ? 30.308 43.314  70.776  1.00 39.24  ? 633 HOH C O   1 
HETATM 8051 O  O   . HOH X 6 .   ? 30.297 38.588  74.843  1.00 23.31  ? 634 HOH C O   1 
HETATM 8052 O  O   . HOH X 6 .   ? 25.376 75.305  79.282  1.00 28.07  ? 635 HOH C O   1 
HETATM 8053 O  O   . HOH X 6 .   ? 38.495 47.689  72.867  1.00 27.74  ? 636 HOH C O   1 
HETATM 8054 O  O   . HOH X 6 .   ? 28.828 36.705  72.671  1.00 27.98  ? 637 HOH C O   1 
HETATM 8055 O  O   . HOH X 6 .   ? 16.851 37.962  93.206  1.00 42.27  ? 638 HOH C O   1 
HETATM 8056 O  O   . HOH X 6 .   ? 8.212  52.053  68.267  1.00 25.92  ? 639 HOH C O   1 
HETATM 8057 O  O   . HOH X 6 .   ? 31.669 50.065  91.959  1.00 35.34  ? 640 HOH C O   1 
HETATM 8058 O  O   . HOH X 6 .   ? 16.182 30.595  84.770  1.00 36.96  ? 641 HOH C O   1 
HETATM 8059 O  O   . HOH X 6 .   ? 7.773  36.715  75.370  1.00 46.18  ? 642 HOH C O   1 
HETATM 8060 O  O   . HOH X 6 .   ? 14.207 60.220  93.668  1.00 41.79  ? 643 HOH C O   1 
HETATM 8061 O  O   . HOH X 6 .   ? 13.711 36.089  82.076  1.00 34.82  ? 644 HOH C O   1 
HETATM 8062 O  O   . HOH X 6 .   ? 24.912 31.512  82.150  1.00 28.05  ? 645 HOH C O   1 
HETATM 8063 O  O   . HOH X 6 .   ? 19.526 75.799  67.358  1.00 53.31  ? 646 HOH C O   1 
HETATM 8064 O  O   . HOH X 6 .   ? 10.924 62.439  83.301  1.00 26.44  ? 647 HOH C O   1 
HETATM 8065 O  O   . HOH X 6 .   ? 27.744 75.012  72.069  1.00 25.71  ? 648 HOH C O   1 
HETATM 8066 O  O   . HOH X 6 .   ? 42.079 50.325  85.296  1.00 37.18  ? 649 HOH C O   1 
HETATM 8067 O  O   . HOH X 6 .   ? 29.222 77.068  78.043  1.00 49.74  ? 650 HOH C O   1 
HETATM 8068 O  O   . HOH X 6 .   ? 8.851  63.536  78.014  1.00 38.69  ? 651 HOH C O   1 
HETATM 8069 O  O   . HOH X 6 .   ? 28.151 26.065  85.770  1.00 30.13  ? 652 HOH C O   1 
HETATM 8070 O  O   . HOH X 6 .   ? 36.621 41.506  80.539  1.00 33.62  ? 653 HOH C O   1 
HETATM 8071 O  O   . HOH X 6 .   ? 31.150 63.126  92.894  1.00 41.20  ? 654 HOH C O   1 
HETATM 8072 O  O   . HOH X 6 .   ? 32.250 38.835  63.919  1.00 52.77  ? 655 HOH C O   1 
HETATM 8073 O  O   . HOH X 6 .   ? 41.040 52.031  77.009  1.00 27.82  ? 656 HOH C O   1 
HETATM 8074 O  O   . HOH X 6 .   ? 20.727 48.240  59.754  1.00 29.79  ? 657 HOH C O   1 
HETATM 8075 O  O   . HOH X 6 .   ? 22.088 30.257  82.929  1.00 39.82  ? 658 HOH C O   1 
HETATM 8076 O  O   . HOH X 6 .   ? 12.372 70.901  72.938  1.00 36.43  ? 659 HOH C O   1 
HETATM 8077 O  O   . HOH X 6 .   ? 29.881 75.451  76.566  1.00 44.46  ? 660 HOH C O   1 
HETATM 8078 O  O   . HOH X 6 .   ? 18.216 47.773  61.131  1.00 28.71  ? 661 HOH C O   1 
HETATM 8079 O  O   . HOH X 6 .   ? 19.774 67.601  54.303  1.00 49.30  ? 662 HOH C O   1 
HETATM 8080 O  O   . HOH X 6 .   ? 9.640  52.246  92.433  1.00 36.51  ? 663 HOH C O   1 
HETATM 8081 O  O   . HOH X 6 .   ? 29.586 71.710  70.534  1.00 28.55  ? 664 HOH C O   1 
HETATM 8082 O  O   . HOH X 6 .   ? 5.843  46.347  69.628  1.00 39.71  ? 665 HOH C O   1 
HETATM 8083 O  O   . HOH X 6 .   ? 38.699 65.899  86.727  1.00 34.91  ? 666 HOH C O   1 
HETATM 8084 O  O   . HOH X 6 .   ? 21.253 40.809  94.917  1.00 30.95  ? 667 HOH C O   1 
HETATM 8085 O  O   . HOH X 6 .   ? 35.294 37.791  75.201  1.00 36.25  ? 668 HOH C O   1 
HETATM 8086 O  O   . HOH X 6 .   ? 17.745 73.650  66.101  1.00 40.28  ? 669 HOH C O   1 
HETATM 8087 O  O   . HOH X 6 .   ? 42.651 61.994  72.668  1.00 35.67  ? 670 HOH C O   1 
HETATM 8088 O  O   . HOH X 6 .   ? 11.743 66.037  59.067  1.00 62.50  ? 671 HOH C O   1 
HETATM 8089 O  O   . HOH X 6 .   ? 20.786 60.710  97.533  1.00 39.04  ? 672 HOH C O   1 
HETATM 8090 O  O   . HOH X 6 .   ? 16.340 68.921  55.236  1.00 44.04  ? 673 HOH C O   1 
HETATM 8091 O  O   . HOH X 6 .   ? 9.766  69.177  89.980  1.00 45.86  ? 674 HOH C O   1 
HETATM 8092 O  O   . HOH X 6 .   ? 12.174 46.014  85.471  1.00 30.16  ? 675 HOH C O   1 
HETATM 8093 O  O   . HOH X 6 .   ? 38.385 63.656  84.059  1.00 26.81  ? 676 HOH C O   1 
HETATM 8094 O  O   A HOH X 6 .   ? 31.023 39.330  97.052  0.58 26.37  ? 677 HOH C O   1 
HETATM 8095 O  O   B HOH X 6 .   ? 31.200 40.590  96.719  0.42 26.37  ? 677 HOH C O   1 
HETATM 8096 O  O   . HOH X 6 .   ? 13.595 32.106  80.708  1.00 45.98  ? 678 HOH C O   1 
HETATM 8097 O  O   . HOH X 6 .   ? 44.602 59.063  84.477  1.00 46.79  ? 679 HOH C O   1 
HETATM 8098 O  O   . HOH X 6 .   ? 3.905  44.937  71.366  1.00 66.17  ? 680 HOH C O   1 
HETATM 8099 O  O   . HOH X 6 .   ? 26.679 31.625  92.105  1.00 34.84  ? 681 HOH C O   1 
HETATM 8100 O  O   . HOH X 6 .   ? 31.048 74.590  83.431  1.00 29.38  ? 682 HOH C O   1 
HETATM 8101 O  O   . HOH X 6 .   ? 16.148 64.343  55.179  1.00 41.23  ? 683 HOH C O   1 
HETATM 8102 O  O   . HOH X 6 .   ? 19.331 33.837  72.010  1.00 43.07  ? 684 HOH C O   1 
HETATM 8103 O  O   A HOH X 6 .   ? 35.676 68.514  74.354  0.72 35.04  ? 685 HOH C O   1 
HETATM 8104 O  O   B HOH X 6 .   ? 36.028 66.963  74.617  0.28 35.04  ? 685 HOH C O   1 
HETATM 8105 O  O   . HOH X 6 .   ? 20.001 72.644  67.712  1.00 35.43  ? 686 HOH C O   1 
HETATM 8106 O  O   . HOH X 6 .   ? 29.627 76.299  82.157  1.00 35.81  ? 687 HOH C O   1 
HETATM 8107 O  O   . HOH X 6 .   ? 34.004 42.810  88.191  1.00 31.74  ? 688 HOH C O   1 
HETATM 8108 O  O   . HOH X 6 .   ? 32.219 73.261  81.197  1.00 33.18  ? 689 HOH C O   1 
HETATM 8109 O  O   . HOH X 6 .   ? 33.211 71.711  88.778  1.00 39.09  ? 690 HOH C O   1 
HETATM 8110 O  O   . HOH X 6 .   ? 39.297 48.547  93.427  1.00 37.99  ? 691 HOH C O   1 
HETATM 8111 O  O   . HOH X 6 .   ? 40.730 53.984  93.650  1.00 45.79  ? 692 HOH C O   1 
HETATM 8112 O  O   . HOH X 6 .   ? 42.858 56.802  71.811  1.00 37.94  ? 693 HOH C O   1 
HETATM 8113 O  O   . HOH X 6 .   ? 37.754 60.879  82.384  1.00 39.92  ? 694 HOH C O   1 
HETATM 8114 O  O   . HOH X 6 .   ? 33.692 70.905  80.465  1.00 29.20  ? 695 HOH C O   1 
HETATM 8115 O  O   . HOH X 6 .   ? 31.147 23.556  88.308  1.00 40.64  ? 696 HOH C O   1 
HETATM 8116 O  O   . HOH X 6 .   ? 20.477 69.813  94.688  1.00 37.57  ? 697 HOH C O   1 
HETATM 8117 O  O   A HOH X 6 .   ? 41.619 47.324  85.724  0.48 36.19  ? 698 HOH C O   1 
HETATM 8118 O  O   B HOH X 6 .   ? 41.333 46.432  86.866  0.52 36.19  ? 698 HOH C O   1 
HETATM 8119 O  O   . HOH X 6 .   ? 8.307  65.854  69.153  1.00 37.26  ? 699 HOH C O   1 
HETATM 8120 O  O   . HOH X 6 .   ? 14.897 74.809  73.026  1.00 45.98  ? 700 HOH C O   1 
HETATM 8121 O  O   . HOH X 6 .   ? 25.522 35.905  63.060  1.00 41.92  ? 701 HOH C O   1 
HETATM 8122 O  O   . HOH X 6 .   ? 32.673 35.782  95.946  1.00 32.50  ? 702 HOH C O   1 
HETATM 8123 O  O   . HOH X 6 .   ? 14.503 40.344  82.846  1.00 31.98  ? 703 HOH C O   1 
HETATM 8124 O  O   . HOH X 6 .   ? 40.368 58.816  88.888  1.00 46.85  ? 704 HOH C O   1 
HETATM 8125 O  O   . HOH X 6 .   ? 34.347 79.791  86.792  1.00 31.48  ? 705 HOH C O   1 
HETATM 8126 O  O   . HOH X 6 .   ? 26.674 58.074  98.883  1.00 43.26  ? 706 HOH C O   1 
HETATM 8127 O  O   . HOH X 6 .   ? 9.371  54.164  59.888  1.00 38.05  ? 707 HOH C O   1 
HETATM 8128 O  O   . HOH X 6 .   ? 18.136 35.768  93.974  1.00 49.28  ? 708 HOH C O   1 
HETATM 8129 O  O   . HOH X 6 .   ? 15.175 77.928  79.636  1.00 46.30  ? 709 HOH C O   1 
HETATM 8130 O  O   . HOH X 6 .   ? 28.782 34.161  103.006 1.00 44.19  ? 710 HOH C O   1 
HETATM 8131 O  O   . HOH X 6 .   ? 25.494 75.195  89.081  1.00 35.89  ? 711 HOH C O   1 
HETATM 8132 O  O   . HOH X 6 .   ? 11.589 57.107  57.904  1.00 35.63  ? 712 HOH C O   1 
HETATM 8133 O  O   . HOH X 6 .   ? 30.326 22.072  86.517  1.00 35.29  ? 713 HOH C O   1 
HETATM 8134 O  O   . HOH X 6 .   ? 34.970 53.634  71.056  1.00 30.00  ? 714 HOH C O   1 
HETATM 8135 O  O   . HOH X 6 .   ? 35.657 55.975  72.592  1.00 30.00  ? 715 HOH C O   1 
HETATM 8136 O  O   A HOH X 6 .   ? 35.423 35.423  79.624  0.53 30.00  ? 716 HOH C O   1 
HETATM 8137 O  O   B HOH X 6 .   ? 34.693 35.951  81.468  0.47 30.00  ? 716 HOH C O   1 
HETATM 8138 O  O   . HOH X 6 .   ? 21.320 48.378  102.552 1.00 30.00  ? 717 HOH C O   1 
HETATM 8139 O  O   . HOH X 6 .   ? 26.541 61.340  54.115  1.00 30.00  ? 718 HOH C O   1 
HETATM 8140 O  O   . HOH X 6 .   ? 47.994 65.518  79.990  1.00 30.00  ? 719 HOH C O   1 
HETATM 8141 O  O   . HOH X 6 .   ? 8.271  44.940  69.602  1.00 30.00  ? 720 HOH C O   1 
HETATM 8142 O  O   . HOH X 6 .   ? 30.001 39.496  64.689  1.00 30.00  ? 721 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   24  24  HIS HIS A . n 
A 1 2   SER 2   25  25  SER SER A . n 
A 1 3   VAL 3   26  26  VAL VAL A . n 
A 1 4   ALA 4   27  27  ALA ALA A . n 
A 1 5   VAL 5   28  28  VAL VAL A . n 
A 1 6   ILE 6   29  29  ILE ILE A . n 
A 1 7   GLY 7   30  30  GLY GLY A . n 
A 1 8   ALA 8   31  31  ALA ALA A . n 
A 1 9   PRO 9   32  32  PRO PRO A . n 
A 1 10  PHE 10  33  33  PHE PHE A . n 
A 1 11  SER 11  34  34  SER SER A . n 
A 1 12  GLN 12  35  35  GLN GLN A . n 
A 1 13  GLY 13  36  36  GLY GLY A . n 
A 1 14  GLN 14  37  37  GLN GLN A . n 
A 1 15  LYS 15  38  38  LYS LYS A . n 
A 1 16  ARG 16  39  39  ARG ARG A . n 
A 1 17  LYS 17  40  40  LYS LYS A . n 
A 1 18  GLY 18  41  41  GLY GLY A . n 
A 1 19  VAL 19  42  42  VAL VAL A . n 
A 1 20  GLU 20  43  43  GLU GLU A . n 
A 1 21  HIS 21  44  44  HIS HIS A . n 
A 1 22  GLY 22  45  45  GLY GLY A . n 
A 1 23  PRO 23  46  46  PRO PRO A . n 
A 1 24  ALA 24  47  47  ALA ALA A . n 
A 1 25  ALA 25  48  48  ALA ALA A . n 
A 1 26  ILE 26  49  49  ILE ILE A . n 
A 1 27  ARG 27  50  50  ARG ARG A . n 
A 1 28  GLU 28  51  51  GLU GLU A . n 
A 1 29  ALA 29  52  52  ALA ALA A . n 
A 1 30  GLY 30  53  53  GLY GLY A . n 
A 1 31  LEU 31  54  54  LEU LEU A . n 
A 1 32  MET 32  55  55  MET MET A . n 
A 1 33  LYS 33  56  56  LYS LYS A . n 
A 1 34  ARG 34  57  57  ARG ARG A . n 
A 1 35  LEU 35  58  58  LEU LEU A . n 
A 1 36  SER 36  59  59  SER SER A . n 
A 1 37  SER 37  60  60  SER SER A . n 
A 1 38  LEU 38  61  61  LEU LEU A . n 
A 1 39  GLY 39  62  62  GLY GLY A . n 
A 1 40  CYS 40  63  63  CYS CYS A . n 
A 1 41  HIS 41  64  64  HIS HIS A . n 
A 1 42  LEU 42  65  65  LEU LEU A . n 
A 1 43  LYS 43  66  66  LYS LYS A . n 
A 1 44  ASP 44  67  67  ASP ASP A . n 
A 1 45  PHE 45  68  68  PHE PHE A . n 
A 1 46  GLY 46  69  69  GLY GLY A . n 
A 1 47  ASP 47  70  70  ASP ASP A . n 
A 1 48  LEU 48  71  71  LEU LEU A . n 
A 1 49  SER 49  72  72  SER SER A . n 
A 1 50  PHE 50  73  73  PHE PHE A . n 
A 1 51  THR 51  74  74  THR THR A . n 
A 1 52  PRO 52  75  75  PRO PRO A . n 
A 1 53  VAL 53  76  76  VAL VAL A . n 
A 1 54  PRO 54  77  77  PRO PRO A . n 
A 1 55  LYS 55  78  78  LYS LYS A . n 
A 1 56  ASP 56  79  79  ASP ASP A . n 
A 1 57  ASP 57  80  80  ASP ASP A . n 
A 1 58  LEU 58  81  81  LEU LEU A . n 
A 1 59  TYR 59  82  82  TYR TYR A . n 
A 1 60  ASN 60  83  83  ASN ASN A . n 
A 1 61  ASN 61  84  84  ASN ASN A . n 
A 1 62  LEU 62  85  85  LEU LEU A . n 
A 1 63  ILE 63  86  86  ILE ILE A . n 
A 1 64  VAL 64  87  87  VAL VAL A . n 
A 1 65  ASN 65  88  88  ASN ASN A . n 
A 1 66  PRO 66  89  89  PRO PRO A . n 
A 1 67  ARG 67  90  90  ARG ARG A . n 
A 1 68  SER 68  91  91  SER SER A . n 
A 1 69  VAL 69  92  92  VAL VAL A . n 
A 1 70  GLY 70  93  93  GLY GLY A . n 
A 1 71  LEU 71  94  94  LEU LEU A . n 
A 1 72  ALA 72  95  95  ALA ALA A . n 
A 1 73  ASN 73  96  96  ASN ASN A . n 
A 1 74  GLN 74  97  97  GLN GLN A . n 
A 1 75  GLU 75  98  98  GLU GLU A . n 
A 1 76  LEU 76  99  99  LEU LEU A . n 
A 1 77  ALA 77  100 100 ALA ALA A . n 
A 1 78  GLU 78  101 101 GLU GLU A . n 
A 1 79  VAL 79  102 102 VAL VAL A . n 
A 1 80  VAL 80  103 103 VAL VAL A . n 
A 1 81  SER 81  104 104 SER SER A . n 
A 1 82  ARG 82  105 105 ARG ARG A . n 
A 1 83  ALA 83  106 106 ALA ALA A . n 
A 1 84  VAL 84  107 107 VAL VAL A . n 
A 1 85  SER 85  108 108 SER SER A . n 
A 1 86  ASP 86  109 109 ASP ASP A . n 
A 1 87  GLY 87  110 110 GLY GLY A . n 
A 1 88  TYR 88  111 111 TYR TYR A . n 
A 1 89  SER 89  112 112 SER SER A . n 
A 1 90  CYS 90  113 113 CYS CYS A . n 
A 1 91  VAL 91  114 114 VAL VAL A . n 
A 1 92  THR 92  115 115 THR THR A . n 
A 1 93  LEU 93  116 116 LEU LEU A . n 
A 1 94  GLY 94  117 117 GLY GLY A . n 
A 1 95  GLY 95  118 118 GLY GLY A . n 
A 1 96  ASP 96  119 119 ASP ASP A . n 
A 1 97  HIS 97  120 120 HIS HIS A . n 
A 1 98  SER 98  121 121 SER SER A . n 
A 1 99  LEU 99  122 122 LEU LEU A . n 
A 1 100 ALA 100 123 123 ALA ALA A . n 
A 1 101 ILE 101 124 124 ILE ILE A . n 
A 1 102 GLY 102 125 125 GLY GLY A . n 
A 1 103 THR 103 126 126 THR THR A . n 
A 1 104 ILE 104 127 127 ILE ILE A . n 
A 1 105 SER 105 128 128 SER SER A . n 
A 1 106 GLY 106 129 129 GLY GLY A . n 
A 1 107 HIS 107 130 130 HIS HIS A . n 
A 1 108 ALA 108 131 131 ALA ALA A . n 
A 1 109 ARG 109 132 132 ARG ARG A . n 
A 1 110 HIS 110 133 133 HIS HIS A . n 
A 1 111 CYS 111 134 134 CYS CYS A . n 
A 1 112 PRO 112 135 135 PRO PRO A . n 
A 1 113 ASP 113 136 136 ASP ASP A . n 
A 1 114 LEU 114 137 137 LEU LEU A . n 
A 1 115 CYS 115 138 138 CYS CYS A . n 
A 1 116 VAL 116 139 139 VAL VAL A . n 
A 1 117 VAL 117 140 140 VAL VAL A . n 
A 1 118 TRP 118 141 141 TRP TRP A . n 
A 1 119 VAL 119 142 142 VAL VAL A . n 
A 1 120 ASP 120 143 143 ASP ASP A . n 
A 1 121 ALA 121 144 144 ALA ALA A . n 
A 1 122 HIS 122 145 145 HIS HIS A . n 
A 1 123 ALA 123 146 146 ALA ALA A . n 
A 1 124 ASP 124 147 147 ASP ASP A . n 
A 1 125 ILE 125 148 148 ILE ILE A . n 
A 1 126 ASN 126 149 149 ASN ASN A . n 
A 1 127 THR 127 150 150 THR THR A . n 
A 1 128 PRO 128 151 151 PRO PRO A . n 
A 1 129 LEU 129 152 152 LEU LEU A . n 
A 1 130 THR 130 153 153 THR THR A . n 
A 1 131 THR 131 154 154 THR THR A . n 
A 1 132 SER 132 155 155 SER SER A . n 
A 1 133 SER 133 156 156 SER SER A . n 
A 1 134 GLY 134 157 157 GLY GLY A . n 
A 1 135 ASN 135 158 158 ASN ASN A . n 
A 1 136 LEU 136 159 159 LEU LEU A . n 
A 1 137 HIS 137 160 160 HIS HIS A . n 
A 1 138 GLY 138 161 161 GLY GLY A . n 
A 1 139 GLN 139 162 162 GLN GLN A . n 
A 1 140 PRO 140 163 163 PRO PRO A . n 
A 1 141 VAL 141 164 164 VAL VAL A . n 
A 1 142 SER 142 165 165 SER SER A . n 
A 1 143 PHE 143 166 166 PHE PHE A . n 
A 1 144 LEU 144 167 167 LEU LEU A . n 
A 1 145 LEU 145 168 168 LEU LEU A . n 
A 1 146 ARG 146 169 169 ARG ARG A . n 
A 1 147 GLU 147 170 170 GLU GLU A . n 
A 1 148 LEU 148 171 171 LEU LEU A . n 
A 1 149 GLN 149 172 172 GLN GLN A . n 
A 1 150 ASP 150 173 173 ASP ASP A . n 
A 1 151 LYS 151 174 174 LYS LYS A . n 
A 1 152 VAL 152 175 175 VAL VAL A . n 
A 1 153 PRO 153 176 176 PRO PRO A . n 
A 1 154 GLN 154 177 177 GLN GLN A . n 
A 1 155 LEU 155 178 178 LEU LEU A . n 
A 1 156 PRO 156 179 179 PRO PRO A . n 
A 1 157 GLY 157 180 180 GLY GLY A . n 
A 1 158 PHE 158 181 181 PHE PHE A . n 
A 1 159 SER 159 182 182 SER SER A . n 
A 1 160 TRP 160 183 183 TRP TRP A . n 
A 1 161 ILE 161 184 184 ILE ILE A . n 
A 1 162 LYS 162 185 185 LYS LYS A . n 
A 1 163 PRO 163 186 186 PRO PRO A . n 
A 1 164 CYS 164 187 187 CYS CYS A . n 
A 1 165 ILE 165 188 188 ILE ILE A . n 
A 1 166 SER 166 189 189 SER SER A . n 
A 1 167 SER 167 190 190 SER SER A . n 
A 1 168 ALA 168 191 191 ALA ALA A . n 
A 1 169 SER 169 192 192 SER SER A . n 
A 1 170 ILE 170 193 193 ILE ILE A . n 
A 1 171 VAL 171 194 194 VAL VAL A . n 
A 1 172 TYR 172 195 195 TYR TYR A . n 
A 1 173 ILE 173 196 196 ILE ILE A . n 
A 1 174 GLY 174 197 197 GLY GLY A . n 
A 1 175 LEU 175 198 198 LEU LEU A . n 
A 1 176 ARG 176 199 199 ARG ARG A . n 
A 1 177 ASP 177 200 200 ASP ASP A . n 
A 1 178 VAL 178 201 201 VAL VAL A . n 
A 1 179 ASP 179 202 202 ASP ASP A . n 
A 1 180 PRO 180 203 203 PRO PRO A . n 
A 1 181 PRO 181 204 204 PRO PRO A . n 
A 1 182 GLU 182 205 205 GLU GLU A . n 
A 1 183 HIS 183 206 206 HIS HIS A . n 
A 1 184 PHE 184 207 207 PHE PHE A . n 
A 1 185 ILE 185 208 208 ILE ILE A . n 
A 1 186 LEU 186 209 209 LEU LEU A . n 
A 1 187 LYS 187 210 210 LYS LYS A . n 
A 1 188 ASN 188 211 211 ASN ASN A . n 
A 1 189 TYR 189 212 212 TYR TYR A . n 
A 1 190 ASP 190 213 213 ASP ASP A . n 
A 1 191 ILE 191 214 214 ILE ILE A . n 
A 1 192 GLN 192 215 215 GLN GLN A . n 
A 1 193 TYR 193 216 216 TYR TYR A . n 
A 1 194 PHE 194 217 217 PHE PHE A . n 
A 1 195 SER 195 218 218 SER SER A . n 
A 1 196 MET 196 219 219 MET MET A . n 
A 1 197 ARG 197 220 220 ARG ARG A . n 
A 1 198 ASP 198 221 221 ASP ASP A . n 
A 1 199 ILE 199 222 222 ILE ILE A . n 
A 1 200 ASP 200 223 223 ASP ASP A . n 
A 1 201 ARG 201 224 224 ARG ARG A . n 
A 1 202 LEU 202 225 225 LEU LEU A . n 
A 1 203 GLY 203 226 226 GLY GLY A . n 
A 1 204 ILE 204 227 227 ILE ILE A . n 
A 1 205 GLN 205 228 228 GLN GLN A . n 
A 1 206 LYS 206 229 229 LYS LYS A . n 
A 1 207 VAL 207 230 230 VAL VAL A . n 
A 1 208 MET 208 231 231 MET MET A . n 
A 1 209 GLU 209 232 232 GLU GLU A . n 
A 1 210 ARG 210 233 233 ARG ARG A . n 
A 1 211 THR 211 234 234 THR THR A . n 
A 1 212 PHE 212 235 235 PHE PHE A . n 
A 1 213 ASP 213 236 236 ASP ASP A . n 
A 1 214 LEU 214 237 237 LEU LEU A . n 
A 1 215 LEU 215 238 238 LEU LEU A . n 
A 1 216 ILE 216 239 239 ILE ILE A . n 
A 1 217 GLY 217 240 240 GLY GLY A . n 
A 1 218 LYS 218 241 241 LYS LYS A . n 
A 1 219 ARG 219 242 242 ARG ARG A . n 
A 1 220 GLN 220 243 243 GLN GLN A . n 
A 1 221 ARG 221 244 244 ARG ARG A . n 
A 1 222 PRO 222 245 245 PRO PRO A . n 
A 1 223 ILE 223 246 246 ILE ILE A . n 
A 1 224 HIS 224 247 247 HIS HIS A . n 
A 1 225 LEU 225 248 248 LEU LEU A . n 
A 1 226 SER 226 249 249 SER SER A . n 
A 1 227 PHE 227 250 250 PHE PHE A . n 
A 1 228 ASP 228 251 251 ASP ASP A . n 
A 1 229 ILE 229 252 252 ILE ILE A . n 
A 1 230 ASP 230 253 253 ASP ASP A . n 
A 1 231 ALA 231 254 254 ALA ALA A . n 
A 1 232 PHE 232 255 255 PHE PHE A . n 
A 1 233 ASP 233 256 256 ASP ASP A . n 
A 1 234 PRO 234 257 257 PRO PRO A . n 
A 1 235 THR 235 258 258 THR THR A . n 
A 1 236 LEU 236 259 259 LEU LEU A . n 
A 1 237 ALA 237 260 260 ALA ALA A . n 
A 1 238 PRO 238 261 261 PRO PRO A . n 
A 1 239 ALA 239 262 262 ALA ALA A . n 
A 1 240 THR 240 263 263 THR THR A . n 
A 1 241 GLY 241 264 264 GLY GLY A . n 
A 1 242 THR 242 265 265 THR THR A . n 
A 1 243 PRO 243 266 266 PRO PRO A . n 
A 1 244 VAL 244 267 267 VAL VAL A . n 
A 1 245 VAL 245 268 268 VAL VAL A . n 
A 1 246 GLY 246 269 269 GLY GLY A . n 
A 1 247 GLY 247 270 270 GLY GLY A . n 
A 1 248 LEU 248 271 271 LEU LEU A . n 
A 1 249 THR 249 272 272 THR THR A . n 
A 1 250 TYR 250 273 273 TYR TYR A . n 
A 1 251 ARG 251 274 274 ARG ARG A . n 
A 1 252 GLU 252 275 275 GLU GLU A . n 
A 1 253 GLY 253 276 276 GLY GLY A . n 
A 1 254 MET 254 277 277 MET MET A . n 
A 1 255 TYR 255 278 278 TYR TYR A . n 
A 1 256 ILE 256 279 279 ILE ILE A . n 
A 1 257 ALA 257 280 280 ALA ALA A . n 
A 1 258 GLU 258 281 281 GLU GLU A . n 
A 1 259 GLU 259 282 282 GLU GLU A . n 
A 1 260 ILE 260 283 283 ILE ILE A . n 
A 1 261 HIS 261 284 284 HIS HIS A . n 
A 1 262 ASN 262 285 285 ASN ASN A . n 
A 1 263 THR 263 286 286 THR THR A . n 
A 1 264 GLY 264 287 287 GLY GLY A . n 
A 1 265 LEU 265 288 288 LEU LEU A . n 
A 1 266 LEU 266 289 289 LEU LEU A . n 
A 1 267 SER 267 290 290 SER SER A . n 
A 1 268 ALA 268 291 291 ALA ALA A . n 
A 1 269 LEU 269 292 292 LEU LEU A . n 
A 1 270 ASP 270 293 293 ASP ASP A . n 
A 1 271 LEU 271 294 294 LEU LEU A . n 
A 1 272 VAL 272 295 295 VAL VAL A . n 
A 1 273 GLU 273 296 296 GLU GLU A . n 
A 1 274 VAL 274 297 297 VAL VAL A . n 
A 1 275 ASN 275 298 298 ASN ASN A . n 
A 1 276 PRO 276 299 299 PRO PRO A . n 
A 1 277 GLN 277 300 300 GLN GLN A . n 
A 1 278 LEU 278 301 301 LEU LEU A . n 
A 1 279 ALA 279 302 302 ALA ALA A . n 
A 1 280 THR 280 303 303 THR THR A . n 
A 1 281 SER 281 304 304 SER SER A . n 
A 1 282 GLU 282 305 305 GLU GLU A . n 
A 1 283 GLU 283 306 306 GLU GLU A . n 
A 1 284 GLU 284 307 307 GLU GLU A . n 
A 1 285 ALA 285 308 308 ALA ALA A . n 
A 1 286 LYS 286 309 309 LYS LYS A . n 
A 1 287 THR 287 310 310 THR THR A . n 
A 1 288 THR 288 311 311 THR THR A . n 
A 1 289 ALA 289 312 312 ALA ALA A . n 
A 1 290 ASN 290 313 313 ASN ASN A . n 
A 1 291 LEU 291 314 314 LEU LEU A . n 
A 1 292 ALA 292 315 315 ALA ALA A . n 
A 1 293 VAL 293 316 316 VAL VAL A . n 
A 1 294 ASP 294 317 317 ASP ASP A . n 
A 1 295 VAL 295 318 318 VAL VAL A . n 
A 1 296 ILE 296 319 319 ILE ILE A . n 
A 1 297 ALA 297 320 320 ALA ALA A . n 
A 1 298 SER 298 321 321 SER SER A . n 
A 1 299 SER 299 322 322 SER SER A . n 
A 1 300 PHE 300 323 323 PHE PHE A . n 
A 1 301 GLY 301 324 324 GLY GLY A . n 
A 1 302 GLN 302 325 325 GLN GLN A . n 
A 1 303 THR 303 326 326 THR THR A . n 
A 1 304 ARG 304 327 327 ARG ARG A . n 
A 1 305 GLU 305 328 328 GLU GLU A . n 
A 1 306 GLY 306 329 329 GLY GLY A . n 
B 1 1   HIS 1   24  24  HIS HIS B . n 
B 1 2   SER 2   25  25  SER SER B . n 
B 1 3   VAL 3   26  26  VAL VAL B . n 
B 1 4   ALA 4   27  27  ALA ALA B . n 
B 1 5   VAL 5   28  28  VAL VAL B . n 
B 1 6   ILE 6   29  29  ILE ILE B . n 
B 1 7   GLY 7   30  30  GLY GLY B . n 
B 1 8   ALA 8   31  31  ALA ALA B . n 
B 1 9   PRO 9   32  32  PRO PRO B . n 
B 1 10  PHE 10  33  33  PHE PHE B . n 
B 1 11  SER 11  34  34  SER SER B . n 
B 1 12  GLN 12  35  35  GLN GLN B . n 
B 1 13  GLY 13  36  36  GLY GLY B . n 
B 1 14  GLN 14  37  37  GLN GLN B . n 
B 1 15  LYS 15  38  38  LYS LYS B . n 
B 1 16  ARG 16  39  39  ARG ARG B . n 
B 1 17  LYS 17  40  40  LYS LYS B . n 
B 1 18  GLY 18  41  41  GLY GLY B . n 
B 1 19  VAL 19  42  42  VAL VAL B . n 
B 1 20  GLU 20  43  43  GLU GLU B . n 
B 1 21  HIS 21  44  44  HIS HIS B . n 
B 1 22  GLY 22  45  45  GLY GLY B . n 
B 1 23  PRO 23  46  46  PRO PRO B . n 
B 1 24  ALA 24  47  47  ALA ALA B . n 
B 1 25  ALA 25  48  48  ALA ALA B . n 
B 1 26  ILE 26  49  49  ILE ILE B . n 
B 1 27  ARG 27  50  50  ARG ARG B . n 
B 1 28  GLU 28  51  51  GLU GLU B . n 
B 1 29  ALA 29  52  52  ALA ALA B . n 
B 1 30  GLY 30  53  53  GLY GLY B . n 
B 1 31  LEU 31  54  54  LEU LEU B . n 
B 1 32  MET 32  55  55  MET MET B . n 
B 1 33  LYS 33  56  56  LYS LYS B . n 
B 1 34  ARG 34  57  57  ARG ARG B . n 
B 1 35  LEU 35  58  58  LEU LEU B . n 
B 1 36  SER 36  59  59  SER SER B . n 
B 1 37  SER 37  60  60  SER SER B . n 
B 1 38  LEU 38  61  61  LEU LEU B . n 
B 1 39  GLY 39  62  62  GLY GLY B . n 
B 1 40  CYS 40  63  63  CYS CYS B . n 
B 1 41  HIS 41  64  64  HIS HIS B . n 
B 1 42  LEU 42  65  65  LEU LEU B . n 
B 1 43  LYS 43  66  66  LYS LYS B . n 
B 1 44  ASP 44  67  67  ASP ASP B . n 
B 1 45  PHE 45  68  68  PHE PHE B . n 
B 1 46  GLY 46  69  69  GLY GLY B . n 
B 1 47  ASP 47  70  70  ASP ASP B . n 
B 1 48  LEU 48  71  71  LEU LEU B . n 
B 1 49  SER 49  72  72  SER SER B . n 
B 1 50  PHE 50  73  73  PHE PHE B . n 
B 1 51  THR 51  74  74  THR THR B . n 
B 1 52  PRO 52  75  75  PRO PRO B . n 
B 1 53  VAL 53  76  76  VAL VAL B . n 
B 1 54  PRO 54  77  77  PRO PRO B . n 
B 1 55  LYS 55  78  78  LYS LYS B . n 
B 1 56  ASP 56  79  79  ASP ASP B . n 
B 1 57  ASP 57  80  80  ASP ASP B . n 
B 1 58  LEU 58  81  81  LEU LEU B . n 
B 1 59  TYR 59  82  82  TYR TYR B . n 
B 1 60  ASN 60  83  83  ASN ASN B . n 
B 1 61  ASN 61  84  84  ASN ASN B . n 
B 1 62  LEU 62  85  85  LEU LEU B . n 
B 1 63  ILE 63  86  86  ILE ILE B . n 
B 1 64  VAL 64  87  87  VAL VAL B . n 
B 1 65  ASN 65  88  88  ASN ASN B . n 
B 1 66  PRO 66  89  89  PRO PRO B . n 
B 1 67  ARG 67  90  90  ARG ARG B . n 
B 1 68  SER 68  91  91  SER SER B . n 
B 1 69  VAL 69  92  92  VAL VAL B . n 
B 1 70  GLY 70  93  93  GLY GLY B . n 
B 1 71  LEU 71  94  94  LEU LEU B . n 
B 1 72  ALA 72  95  95  ALA ALA B . n 
B 1 73  ASN 73  96  96  ASN ASN B . n 
B 1 74  GLN 74  97  97  GLN GLN B . n 
B 1 75  GLU 75  98  98  GLU GLU B . n 
B 1 76  LEU 76  99  99  LEU LEU B . n 
B 1 77  ALA 77  100 100 ALA ALA B . n 
B 1 78  GLU 78  101 101 GLU GLU B . n 
B 1 79  VAL 79  102 102 VAL VAL B . n 
B 1 80  VAL 80  103 103 VAL VAL B . n 
B 1 81  SER 81  104 104 SER SER B . n 
B 1 82  ARG 82  105 105 ARG ARG B . n 
B 1 83  ALA 83  106 106 ALA ALA B . n 
B 1 84  VAL 84  107 107 VAL VAL B . n 
B 1 85  SER 85  108 108 SER SER B . n 
B 1 86  ASP 86  109 109 ASP ASP B . n 
B 1 87  GLY 87  110 110 GLY GLY B . n 
B 1 88  TYR 88  111 111 TYR TYR B . n 
B 1 89  SER 89  112 112 SER SER B . n 
B 1 90  CYS 90  113 113 CYS CYS B . n 
B 1 91  VAL 91  114 114 VAL VAL B . n 
B 1 92  THR 92  115 115 THR THR B . n 
B 1 93  LEU 93  116 116 LEU LEU B . n 
B 1 94  GLY 94  117 117 GLY GLY B . n 
B 1 95  GLY 95  118 118 GLY GLY B . n 
B 1 96  ASP 96  119 119 ASP ASP B . n 
B 1 97  HIS 97  120 120 HIS HIS B . n 
B 1 98  SER 98  121 121 SER SER B . n 
B 1 99  LEU 99  122 122 LEU LEU B . n 
B 1 100 ALA 100 123 123 ALA ALA B . n 
B 1 101 ILE 101 124 124 ILE ILE B . n 
B 1 102 GLY 102 125 125 GLY GLY B . n 
B 1 103 THR 103 126 126 THR THR B . n 
B 1 104 ILE 104 127 127 ILE ILE B . n 
B 1 105 SER 105 128 128 SER SER B . n 
B 1 106 GLY 106 129 129 GLY GLY B . n 
B 1 107 HIS 107 130 130 HIS HIS B . n 
B 1 108 ALA 108 131 131 ALA ALA B . n 
B 1 109 ARG 109 132 132 ARG ARG B . n 
B 1 110 HIS 110 133 133 HIS HIS B . n 
B 1 111 CYS 111 134 134 CYS CYS B . n 
B 1 112 PRO 112 135 135 PRO PRO B . n 
B 1 113 ASP 113 136 136 ASP ASP B . n 
B 1 114 LEU 114 137 137 LEU LEU B . n 
B 1 115 CYS 115 138 138 CYS CYS B . n 
B 1 116 VAL 116 139 139 VAL VAL B . n 
B 1 117 VAL 117 140 140 VAL VAL B . n 
B 1 118 TRP 118 141 141 TRP TRP B . n 
B 1 119 VAL 119 142 142 VAL VAL B . n 
B 1 120 ASP 120 143 143 ASP ASP B . n 
B 1 121 ALA 121 144 144 ALA ALA B . n 
B 1 122 HIS 122 145 145 HIS HIS B . n 
B 1 123 ALA 123 146 146 ALA ALA B . n 
B 1 124 ASP 124 147 147 ASP ASP B . n 
B 1 125 ILE 125 148 148 ILE ILE B . n 
B 1 126 ASN 126 149 149 ASN ASN B . n 
B 1 127 THR 127 150 150 THR THR B . n 
B 1 128 PRO 128 151 151 PRO PRO B . n 
B 1 129 LEU 129 152 152 LEU LEU B . n 
B 1 130 THR 130 153 153 THR THR B . n 
B 1 131 THR 131 154 154 THR THR B . n 
B 1 132 SER 132 155 155 SER SER B . n 
B 1 133 SER 133 156 156 SER SER B . n 
B 1 134 GLY 134 157 157 GLY GLY B . n 
B 1 135 ASN 135 158 158 ASN ASN B . n 
B 1 136 LEU 136 159 159 LEU LEU B . n 
B 1 137 HIS 137 160 160 HIS HIS B . n 
B 1 138 GLY 138 161 161 GLY GLY B . n 
B 1 139 GLN 139 162 162 GLN GLN B . n 
B 1 140 PRO 140 163 163 PRO PRO B . n 
B 1 141 VAL 141 164 164 VAL VAL B . n 
B 1 142 SER 142 165 165 SER SER B . n 
B 1 143 PHE 143 166 166 PHE PHE B . n 
B 1 144 LEU 144 167 167 LEU LEU B . n 
B 1 145 LEU 145 168 168 LEU LEU B . n 
B 1 146 ARG 146 169 169 ARG ARG B . n 
B 1 147 GLU 147 170 170 GLU GLU B . n 
B 1 148 LEU 148 171 171 LEU LEU B . n 
B 1 149 GLN 149 172 172 GLN GLN B . n 
B 1 150 ASP 150 173 173 ASP ASP B . n 
B 1 151 LYS 151 174 174 LYS LYS B . n 
B 1 152 VAL 152 175 175 VAL VAL B . n 
B 1 153 PRO 153 176 176 PRO PRO B . n 
B 1 154 GLN 154 177 177 GLN GLN B . n 
B 1 155 LEU 155 178 178 LEU LEU B . n 
B 1 156 PRO 156 179 179 PRO PRO B . n 
B 1 157 GLY 157 180 180 GLY GLY B . n 
B 1 158 PHE 158 181 181 PHE PHE B . n 
B 1 159 SER 159 182 182 SER SER B . n 
B 1 160 TRP 160 183 183 TRP TRP B . n 
B 1 161 ILE 161 184 184 ILE ILE B . n 
B 1 162 LYS 162 185 185 LYS LYS B . n 
B 1 163 PRO 163 186 186 PRO PRO B . n 
B 1 164 CYS 164 187 187 CYS CYS B . n 
B 1 165 ILE 165 188 188 ILE ILE B . n 
B 1 166 SER 166 189 189 SER SER B . n 
B 1 167 SER 167 190 190 SER SER B . n 
B 1 168 ALA 168 191 191 ALA ALA B . n 
B 1 169 SER 169 192 192 SER SER B . n 
B 1 170 ILE 170 193 193 ILE ILE B . n 
B 1 171 VAL 171 194 194 VAL VAL B . n 
B 1 172 TYR 172 195 195 TYR TYR B . n 
B 1 173 ILE 173 196 196 ILE ILE B . n 
B 1 174 GLY 174 197 197 GLY GLY B . n 
B 1 175 LEU 175 198 198 LEU LEU B . n 
B 1 176 ARG 176 199 199 ARG ARG B . n 
B 1 177 ASP 177 200 200 ASP ASP B . n 
B 1 178 VAL 178 201 201 VAL VAL B . n 
B 1 179 ASP 179 202 202 ASP ASP B . n 
B 1 180 PRO 180 203 203 PRO PRO B . n 
B 1 181 PRO 181 204 204 PRO PRO B . n 
B 1 182 GLU 182 205 205 GLU GLU B . n 
B 1 183 HIS 183 206 206 HIS HIS B . n 
B 1 184 PHE 184 207 207 PHE PHE B . n 
B 1 185 ILE 185 208 208 ILE ILE B . n 
B 1 186 LEU 186 209 209 LEU LEU B . n 
B 1 187 LYS 187 210 210 LYS LYS B . n 
B 1 188 ASN 188 211 211 ASN ASN B . n 
B 1 189 TYR 189 212 212 TYR TYR B . n 
B 1 190 ASP 190 213 213 ASP ASP B . n 
B 1 191 ILE 191 214 214 ILE ILE B . n 
B 1 192 GLN 192 215 215 GLN GLN B . n 
B 1 193 TYR 193 216 216 TYR TYR B . n 
B 1 194 PHE 194 217 217 PHE PHE B . n 
B 1 195 SER 195 218 218 SER SER B . n 
B 1 196 MET 196 219 219 MET MET B . n 
B 1 197 ARG 197 220 220 ARG ARG B . n 
B 1 198 ASP 198 221 221 ASP ASP B . n 
B 1 199 ILE 199 222 222 ILE ILE B . n 
B 1 200 ASP 200 223 223 ASP ASP B . n 
B 1 201 ARG 201 224 224 ARG ARG B . n 
B 1 202 LEU 202 225 225 LEU LEU B . n 
B 1 203 GLY 203 226 226 GLY GLY B . n 
B 1 204 ILE 204 227 227 ILE ILE B . n 
B 1 205 GLN 205 228 228 GLN GLN B . n 
B 1 206 LYS 206 229 229 LYS LYS B . n 
B 1 207 VAL 207 230 230 VAL VAL B . n 
B 1 208 MET 208 231 231 MET MET B . n 
B 1 209 GLU 209 232 232 GLU GLU B . n 
B 1 210 ARG 210 233 233 ARG ARG B . n 
B 1 211 THR 211 234 234 THR THR B . n 
B 1 212 PHE 212 235 235 PHE PHE B . n 
B 1 213 ASP 213 236 236 ASP ASP B . n 
B 1 214 LEU 214 237 237 LEU LEU B . n 
B 1 215 LEU 215 238 238 LEU LEU B . n 
B 1 216 ILE 216 239 239 ILE ILE B . n 
B 1 217 GLY 217 240 240 GLY GLY B . n 
B 1 218 LYS 218 241 241 LYS LYS B . n 
B 1 219 ARG 219 242 242 ARG ARG B . n 
B 1 220 GLN 220 243 243 GLN GLN B . n 
B 1 221 ARG 221 244 244 ARG ARG B . n 
B 1 222 PRO 222 245 245 PRO PRO B . n 
B 1 223 ILE 223 246 246 ILE ILE B . n 
B 1 224 HIS 224 247 247 HIS HIS B . n 
B 1 225 LEU 225 248 248 LEU LEU B . n 
B 1 226 SER 226 249 249 SER SER B . n 
B 1 227 PHE 227 250 250 PHE PHE B . n 
B 1 228 ASP 228 251 251 ASP ASP B . n 
B 1 229 ILE 229 252 252 ILE ILE B . n 
B 1 230 ASP 230 253 253 ASP ASP B . n 
B 1 231 ALA 231 254 254 ALA ALA B . n 
B 1 232 PHE 232 255 255 PHE PHE B . n 
B 1 233 ASP 233 256 256 ASP ASP B . n 
B 1 234 PRO 234 257 257 PRO PRO B . n 
B 1 235 THR 235 258 258 THR THR B . n 
B 1 236 LEU 236 259 259 LEU LEU B . n 
B 1 237 ALA 237 260 260 ALA ALA B . n 
B 1 238 PRO 238 261 261 PRO PRO B . n 
B 1 239 ALA 239 262 262 ALA ALA B . n 
B 1 240 THR 240 263 263 THR THR B . n 
B 1 241 GLY 241 264 264 GLY GLY B . n 
B 1 242 THR 242 265 265 THR THR B . n 
B 1 243 PRO 243 266 266 PRO PRO B . n 
B 1 244 VAL 244 267 267 VAL VAL B . n 
B 1 245 VAL 245 268 268 VAL VAL B . n 
B 1 246 GLY 246 269 269 GLY GLY B . n 
B 1 247 GLY 247 270 270 GLY GLY B . n 
B 1 248 LEU 248 271 271 LEU LEU B . n 
B 1 249 THR 249 272 272 THR THR B . n 
B 1 250 TYR 250 273 273 TYR TYR B . n 
B 1 251 ARG 251 274 274 ARG ARG B . n 
B 1 252 GLU 252 275 275 GLU GLU B . n 
B 1 253 GLY 253 276 276 GLY GLY B . n 
B 1 254 MET 254 277 277 MET MET B . n 
B 1 255 TYR 255 278 278 TYR TYR B . n 
B 1 256 ILE 256 279 279 ILE ILE B . n 
B 1 257 ALA 257 280 280 ALA ALA B . n 
B 1 258 GLU 258 281 281 GLU GLU B . n 
B 1 259 GLU 259 282 282 GLU GLU B . n 
B 1 260 ILE 260 283 283 ILE ILE B . n 
B 1 261 HIS 261 284 284 HIS HIS B . n 
B 1 262 ASN 262 285 285 ASN ASN B . n 
B 1 263 THR 263 286 286 THR THR B . n 
B 1 264 GLY 264 287 287 GLY GLY B . n 
B 1 265 LEU 265 288 288 LEU LEU B . n 
B 1 266 LEU 266 289 289 LEU LEU B . n 
B 1 267 SER 267 290 290 SER SER B . n 
B 1 268 ALA 268 291 291 ALA ALA B . n 
B 1 269 LEU 269 292 292 LEU LEU B . n 
B 1 270 ASP 270 293 293 ASP ASP B . n 
B 1 271 LEU 271 294 294 LEU LEU B . n 
B 1 272 VAL 272 295 295 VAL VAL B . n 
B 1 273 GLU 273 296 296 GLU GLU B . n 
B 1 274 VAL 274 297 297 VAL VAL B . n 
B 1 275 ASN 275 298 298 ASN ASN B . n 
B 1 276 PRO 276 299 299 PRO PRO B . n 
B 1 277 GLN 277 300 300 GLN GLN B . n 
B 1 278 LEU 278 301 301 LEU LEU B . n 
B 1 279 ALA 279 302 302 ALA ALA B . n 
B 1 280 THR 280 303 303 THR THR B . n 
B 1 281 SER 281 304 304 SER SER B . n 
B 1 282 GLU 282 305 305 GLU GLU B . n 
B 1 283 GLU 283 306 306 GLU GLU B . n 
B 1 284 GLU 284 307 307 GLU GLU B . n 
B 1 285 ALA 285 308 308 ALA ALA B . n 
B 1 286 LYS 286 309 309 LYS LYS B . n 
B 1 287 THR 287 310 310 THR THR B . n 
B 1 288 THR 288 311 311 THR THR B . n 
B 1 289 ALA 289 312 312 ALA ALA B . n 
B 1 290 ASN 290 313 313 ASN ASN B . n 
B 1 291 LEU 291 314 314 LEU LEU B . n 
B 1 292 ALA 292 315 315 ALA ALA B . n 
B 1 293 VAL 293 316 316 VAL VAL B . n 
B 1 294 ASP 294 317 317 ASP ASP B . n 
B 1 295 VAL 295 318 318 VAL VAL B . n 
B 1 296 ILE 296 319 319 ILE ILE B . n 
B 1 297 ALA 297 320 320 ALA ALA B . n 
B 1 298 SER 298 321 321 SER SER B . n 
B 1 299 SER 299 322 322 SER SER B . n 
B 1 300 PHE 300 323 323 PHE PHE B . n 
B 1 301 GLY 301 324 324 GLY GLY B . n 
B 1 302 GLN 302 325 325 GLN GLN B . n 
B 1 303 THR 303 326 326 THR THR B . n 
B 1 304 ARG 304 327 327 ARG ARG B . n 
B 1 305 GLU 305 328 328 GLU GLU B . n 
B 1 306 GLY 306 329 329 GLY GLY B . n 
C 1 1   HIS 1   24  24  HIS HIS C . n 
C 1 2   SER 2   25  25  SER SER C . n 
C 1 3   VAL 3   26  26  VAL VAL C . n 
C 1 4   ALA 4   27  27  ALA ALA C . n 
C 1 5   VAL 5   28  28  VAL VAL C . n 
C 1 6   ILE 6   29  29  ILE ILE C . n 
C 1 7   GLY 7   30  30  GLY GLY C . n 
C 1 8   ALA 8   31  31  ALA ALA C . n 
C 1 9   PRO 9   32  32  PRO PRO C . n 
C 1 10  PHE 10  33  33  PHE PHE C . n 
C 1 11  SER 11  34  34  SER SER C . n 
C 1 12  GLN 12  35  35  GLN GLN C . n 
C 1 13  GLY 13  36  36  GLY GLY C . n 
C 1 14  GLN 14  37  37  GLN GLN C . n 
C 1 15  LYS 15  38  38  LYS LYS C . n 
C 1 16  ARG 16  39  39  ARG ARG C . n 
C 1 17  LYS 17  40  40  LYS LYS C . n 
C 1 18  GLY 18  41  41  GLY GLY C . n 
C 1 19  VAL 19  42  42  VAL VAL C . n 
C 1 20  GLU 20  43  43  GLU GLU C . n 
C 1 21  HIS 21  44  44  HIS HIS C . n 
C 1 22  GLY 22  45  45  GLY GLY C . n 
C 1 23  PRO 23  46  46  PRO PRO C . n 
C 1 24  ALA 24  47  47  ALA ALA C . n 
C 1 25  ALA 25  48  48  ALA ALA C . n 
C 1 26  ILE 26  49  49  ILE ILE C . n 
C 1 27  ARG 27  50  50  ARG ARG C . n 
C 1 28  GLU 28  51  51  GLU GLU C . n 
C 1 29  ALA 29  52  52  ALA ALA C . n 
C 1 30  GLY 30  53  53  GLY GLY C . n 
C 1 31  LEU 31  54  54  LEU LEU C . n 
C 1 32  MET 32  55  55  MET MET C . n 
C 1 33  LYS 33  56  56  LYS LYS C . n 
C 1 34  ARG 34  57  57  ARG ARG C . n 
C 1 35  LEU 35  58  58  LEU LEU C . n 
C 1 36  SER 36  59  59  SER SER C . n 
C 1 37  SER 37  60  60  SER SER C . n 
C 1 38  LEU 38  61  61  LEU LEU C . n 
C 1 39  GLY 39  62  62  GLY GLY C . n 
C 1 40  CYS 40  63  63  CYS CYS C . n 
C 1 41  HIS 41  64  64  HIS HIS C . n 
C 1 42  LEU 42  65  65  LEU LEU C . n 
C 1 43  LYS 43  66  66  LYS LYS C . n 
C 1 44  ASP 44  67  67  ASP ASP C . n 
C 1 45  PHE 45  68  68  PHE PHE C . n 
C 1 46  GLY 46  69  69  GLY GLY C . n 
C 1 47  ASP 47  70  70  ASP ASP C . n 
C 1 48  LEU 48  71  71  LEU LEU C . n 
C 1 49  SER 49  72  72  SER SER C . n 
C 1 50  PHE 50  73  73  PHE PHE C . n 
C 1 51  THR 51  74  74  THR THR C . n 
C 1 52  PRO 52  75  75  PRO PRO C . n 
C 1 53  VAL 53  76  76  VAL VAL C . n 
C 1 54  PRO 54  77  77  PRO PRO C . n 
C 1 55  LYS 55  78  78  LYS LYS C . n 
C 1 56  ASP 56  79  79  ASP ASP C . n 
C 1 57  ASP 57  80  80  ASP ASP C . n 
C 1 58  LEU 58  81  81  LEU LEU C . n 
C 1 59  TYR 59  82  82  TYR TYR C . n 
C 1 60  ASN 60  83  83  ASN ASN C . n 
C 1 61  ASN 61  84  84  ASN ASN C . n 
C 1 62  LEU 62  85  85  LEU LEU C . n 
C 1 63  ILE 63  86  86  ILE ILE C . n 
C 1 64  VAL 64  87  87  VAL VAL C . n 
C 1 65  ASN 65  88  88  ASN ASN C . n 
C 1 66  PRO 66  89  89  PRO PRO C . n 
C 1 67  ARG 67  90  90  ARG ARG C . n 
C 1 68  SER 68  91  91  SER SER C . n 
C 1 69  VAL 69  92  92  VAL VAL C . n 
C 1 70  GLY 70  93  93  GLY GLY C . n 
C 1 71  LEU 71  94  94  LEU LEU C . n 
C 1 72  ALA 72  95  95  ALA ALA C . n 
C 1 73  ASN 73  96  96  ASN ASN C . n 
C 1 74  GLN 74  97  97  GLN GLN C . n 
C 1 75  GLU 75  98  98  GLU GLU C . n 
C 1 76  LEU 76  99  99  LEU LEU C . n 
C 1 77  ALA 77  100 100 ALA ALA C . n 
C 1 78  GLU 78  101 101 GLU GLU C . n 
C 1 79  VAL 79  102 102 VAL VAL C . n 
C 1 80  VAL 80  103 103 VAL VAL C . n 
C 1 81  SER 81  104 104 SER SER C . n 
C 1 82  ARG 82  105 105 ARG ARG C . n 
C 1 83  ALA 83  106 106 ALA ALA C . n 
C 1 84  VAL 84  107 107 VAL VAL C . n 
C 1 85  SER 85  108 108 SER SER C . n 
C 1 86  ASP 86  109 109 ASP ASP C . n 
C 1 87  GLY 87  110 110 GLY GLY C . n 
C 1 88  TYR 88  111 111 TYR TYR C . n 
C 1 89  SER 89  112 112 SER SER C . n 
C 1 90  CYS 90  113 113 CYS CYS C . n 
C 1 91  VAL 91  114 114 VAL VAL C . n 
C 1 92  THR 92  115 115 THR THR C . n 
C 1 93  LEU 93  116 116 LEU LEU C . n 
C 1 94  GLY 94  117 117 GLY GLY C . n 
C 1 95  GLY 95  118 118 GLY GLY C . n 
C 1 96  ASP 96  119 119 ASP ASP C . n 
C 1 97  HIS 97  120 120 HIS HIS C . n 
C 1 98  SER 98  121 121 SER SER C . n 
C 1 99  LEU 99  122 122 LEU LEU C . n 
C 1 100 ALA 100 123 123 ALA ALA C . n 
C 1 101 ILE 101 124 124 ILE ILE C . n 
C 1 102 GLY 102 125 125 GLY GLY C . n 
C 1 103 THR 103 126 126 THR THR C . n 
C 1 104 ILE 104 127 127 ILE ILE C . n 
C 1 105 SER 105 128 128 SER SER C . n 
C 1 106 GLY 106 129 129 GLY GLY C . n 
C 1 107 HIS 107 130 130 HIS HIS C . n 
C 1 108 ALA 108 131 131 ALA ALA C . n 
C 1 109 ARG 109 132 132 ARG ARG C . n 
C 1 110 HIS 110 133 133 HIS HIS C . n 
C 1 111 CYS 111 134 134 CYS CYS C . n 
C 1 112 PRO 112 135 135 PRO PRO C . n 
C 1 113 ASP 113 136 136 ASP ASP C . n 
C 1 114 LEU 114 137 137 LEU LEU C . n 
C 1 115 CYS 115 138 138 CYS CYS C . n 
C 1 116 VAL 116 139 139 VAL VAL C . n 
C 1 117 VAL 117 140 140 VAL VAL C . n 
C 1 118 TRP 118 141 141 TRP TRP C . n 
C 1 119 VAL 119 142 142 VAL VAL C . n 
C 1 120 ASP 120 143 143 ASP ASP C . n 
C 1 121 ALA 121 144 144 ALA ALA C . n 
C 1 122 HIS 122 145 145 HIS HIS C . n 
C 1 123 ALA 123 146 146 ALA ALA C . n 
C 1 124 ASP 124 147 147 ASP ASP C . n 
C 1 125 ILE 125 148 148 ILE ILE C . n 
C 1 126 ASN 126 149 149 ASN ASN C . n 
C 1 127 THR 127 150 150 THR THR C . n 
C 1 128 PRO 128 151 151 PRO PRO C . n 
C 1 129 LEU 129 152 152 LEU LEU C . n 
C 1 130 THR 130 153 153 THR THR C . n 
C 1 131 THR 131 154 154 THR THR C . n 
C 1 132 SER 132 155 155 SER SER C . n 
C 1 133 SER 133 156 156 SER SER C . n 
C 1 134 GLY 134 157 157 GLY GLY C . n 
C 1 135 ASN 135 158 158 ASN ASN C . n 
C 1 136 LEU 136 159 159 LEU LEU C . n 
C 1 137 HIS 137 160 160 HIS HIS C . n 
C 1 138 GLY 138 161 161 GLY GLY C . n 
C 1 139 GLN 139 162 162 GLN GLN C . n 
C 1 140 PRO 140 163 163 PRO PRO C . n 
C 1 141 VAL 141 164 164 VAL VAL C . n 
C 1 142 SER 142 165 165 SER SER C . n 
C 1 143 PHE 143 166 166 PHE PHE C . n 
C 1 144 LEU 144 167 167 LEU LEU C . n 
C 1 145 LEU 145 168 168 LEU LEU C . n 
C 1 146 ARG 146 169 169 ARG ARG C . n 
C 1 147 GLU 147 170 170 GLU GLU C . n 
C 1 148 LEU 148 171 171 LEU LEU C . n 
C 1 149 GLN 149 172 172 GLN GLN C . n 
C 1 150 ASP 150 173 173 ASP ASP C . n 
C 1 151 LYS 151 174 174 LYS LYS C . n 
C 1 152 VAL 152 175 175 VAL VAL C . n 
C 1 153 PRO 153 176 176 PRO PRO C . n 
C 1 154 GLN 154 177 177 GLN GLN C . n 
C 1 155 LEU 155 178 178 LEU LEU C . n 
C 1 156 PRO 156 179 179 PRO PRO C . n 
C 1 157 GLY 157 180 180 GLY GLY C . n 
C 1 158 PHE 158 181 181 PHE PHE C . n 
C 1 159 SER 159 182 182 SER SER C . n 
C 1 160 TRP 160 183 183 TRP TRP C . n 
C 1 161 ILE 161 184 184 ILE ILE C . n 
C 1 162 LYS 162 185 185 LYS LYS C . n 
C 1 163 PRO 163 186 186 PRO PRO C . n 
C 1 164 CYS 164 187 187 CYS CYS C . n 
C 1 165 ILE 165 188 188 ILE ILE C . n 
C 1 166 SER 166 189 189 SER SER C . n 
C 1 167 SER 167 190 190 SER SER C . n 
C 1 168 ALA 168 191 191 ALA ALA C . n 
C 1 169 SER 169 192 192 SER SER C . n 
C 1 170 ILE 170 193 193 ILE ILE C . n 
C 1 171 VAL 171 194 194 VAL VAL C . n 
C 1 172 TYR 172 195 195 TYR TYR C . n 
C 1 173 ILE 173 196 196 ILE ILE C . n 
C 1 174 GLY 174 197 197 GLY GLY C . n 
C 1 175 LEU 175 198 198 LEU LEU C . n 
C 1 176 ARG 176 199 199 ARG ARG C . n 
C 1 177 ASP 177 200 200 ASP ASP C . n 
C 1 178 VAL 178 201 201 VAL VAL C . n 
C 1 179 ASP 179 202 202 ASP ASP C . n 
C 1 180 PRO 180 203 203 PRO PRO C . n 
C 1 181 PRO 181 204 204 PRO PRO C . n 
C 1 182 GLU 182 205 205 GLU GLU C . n 
C 1 183 HIS 183 206 206 HIS HIS C . n 
C 1 184 PHE 184 207 207 PHE PHE C . n 
C 1 185 ILE 185 208 208 ILE ILE C . n 
C 1 186 LEU 186 209 209 LEU LEU C . n 
C 1 187 LYS 187 210 210 LYS LYS C . n 
C 1 188 ASN 188 211 211 ASN ASN C . n 
C 1 189 TYR 189 212 212 TYR TYR C . n 
C 1 190 ASP 190 213 213 ASP ASP C . n 
C 1 191 ILE 191 214 214 ILE ILE C . n 
C 1 192 GLN 192 215 215 GLN GLN C . n 
C 1 193 TYR 193 216 216 TYR TYR C . n 
C 1 194 PHE 194 217 217 PHE PHE C . n 
C 1 195 SER 195 218 218 SER SER C . n 
C 1 196 MET 196 219 219 MET MET C . n 
C 1 197 ARG 197 220 220 ARG ARG C . n 
C 1 198 ASP 198 221 221 ASP ASP C . n 
C 1 199 ILE 199 222 222 ILE ILE C . n 
C 1 200 ASP 200 223 223 ASP ASP C . n 
C 1 201 ARG 201 224 224 ARG ARG C . n 
C 1 202 LEU 202 225 225 LEU LEU C . n 
C 1 203 GLY 203 226 226 GLY GLY C . n 
C 1 204 ILE 204 227 227 ILE ILE C . n 
C 1 205 GLN 205 228 228 GLN GLN C . n 
C 1 206 LYS 206 229 229 LYS LYS C . n 
C 1 207 VAL 207 230 230 VAL VAL C . n 
C 1 208 MET 208 231 231 MET MET C . n 
C 1 209 GLU 209 232 232 GLU GLU C . n 
C 1 210 ARG 210 233 233 ARG ARG C . n 
C 1 211 THR 211 234 234 THR THR C . n 
C 1 212 PHE 212 235 235 PHE PHE C . n 
C 1 213 ASP 213 236 236 ASP ASP C . n 
C 1 214 LEU 214 237 237 LEU LEU C . n 
C 1 215 LEU 215 238 238 LEU LEU C . n 
C 1 216 ILE 216 239 239 ILE ILE C . n 
C 1 217 GLY 217 240 240 GLY GLY C . n 
C 1 218 LYS 218 241 241 LYS LYS C . n 
C 1 219 ARG 219 242 242 ARG ARG C . n 
C 1 220 GLN 220 243 243 GLN GLN C . n 
C 1 221 ARG 221 244 244 ARG ARG C . n 
C 1 222 PRO 222 245 245 PRO PRO C . n 
C 1 223 ILE 223 246 246 ILE ILE C . n 
C 1 224 HIS 224 247 247 HIS HIS C . n 
C 1 225 LEU 225 248 248 LEU LEU C . n 
C 1 226 SER 226 249 249 SER SER C . n 
C 1 227 PHE 227 250 250 PHE PHE C . n 
C 1 228 ASP 228 251 251 ASP ASP C . n 
C 1 229 ILE 229 252 252 ILE ILE C . n 
C 1 230 ASP 230 253 253 ASP ASP C . n 
C 1 231 ALA 231 254 254 ALA ALA C . n 
C 1 232 PHE 232 255 255 PHE PHE C . n 
C 1 233 ASP 233 256 256 ASP ASP C . n 
C 1 234 PRO 234 257 257 PRO PRO C . n 
C 1 235 THR 235 258 258 THR THR C . n 
C 1 236 LEU 236 259 259 LEU LEU C . n 
C 1 237 ALA 237 260 260 ALA ALA C . n 
C 1 238 PRO 238 261 261 PRO PRO C . n 
C 1 239 ALA 239 262 262 ALA ALA C . n 
C 1 240 THR 240 263 263 THR THR C . n 
C 1 241 GLY 241 264 264 GLY GLY C . n 
C 1 242 THR 242 265 265 THR THR C . n 
C 1 243 PRO 243 266 266 PRO PRO C . n 
C 1 244 VAL 244 267 267 VAL VAL C . n 
C 1 245 VAL 245 268 268 VAL VAL C . n 
C 1 246 GLY 246 269 269 GLY GLY C . n 
C 1 247 GLY 247 270 270 GLY GLY C . n 
C 1 248 LEU 248 271 271 LEU LEU C . n 
C 1 249 THR 249 272 272 THR THR C . n 
C 1 250 TYR 250 273 273 TYR TYR C . n 
C 1 251 ARG 251 274 274 ARG ARG C . n 
C 1 252 GLU 252 275 275 GLU GLU C . n 
C 1 253 GLY 253 276 276 GLY GLY C . n 
C 1 254 MET 254 277 277 MET MET C . n 
C 1 255 TYR 255 278 278 TYR TYR C . n 
C 1 256 ILE 256 279 279 ILE ILE C . n 
C 1 257 ALA 257 280 280 ALA ALA C . n 
C 1 258 GLU 258 281 281 GLU GLU C . n 
C 1 259 GLU 259 282 282 GLU GLU C . n 
C 1 260 ILE 260 283 283 ILE ILE C . n 
C 1 261 HIS 261 284 284 HIS HIS C . n 
C 1 262 ASN 262 285 285 ASN ASN C . n 
C 1 263 THR 263 286 286 THR THR C . n 
C 1 264 GLY 264 287 287 GLY GLY C . n 
C 1 265 LEU 265 288 288 LEU LEU C . n 
C 1 266 LEU 266 289 289 LEU LEU C . n 
C 1 267 SER 267 290 290 SER SER C . n 
C 1 268 ALA 268 291 291 ALA ALA C . n 
C 1 269 LEU 269 292 292 LEU LEU C . n 
C 1 270 ASP 270 293 293 ASP ASP C . n 
C 1 271 LEU 271 294 294 LEU LEU C . n 
C 1 272 VAL 272 295 295 VAL VAL C . n 
C 1 273 GLU 273 296 296 GLU GLU C . n 
C 1 274 VAL 274 297 297 VAL VAL C . n 
C 1 275 ASN 275 298 298 ASN ASN C . n 
C 1 276 PRO 276 299 299 PRO PRO C . n 
C 1 277 GLN 277 300 300 GLN GLN C . n 
C 1 278 LEU 278 301 301 LEU LEU C . n 
C 1 279 ALA 279 302 302 ALA ALA C . n 
C 1 280 THR 280 303 303 THR THR C . n 
C 1 281 SER 281 304 304 SER SER C . n 
C 1 282 GLU 282 305 305 GLU GLU C . n 
C 1 283 GLU 283 306 306 GLU GLU C . n 
C 1 284 GLU 284 307 307 GLU GLU C . n 
C 1 285 ALA 285 308 308 ALA ALA C . n 
C 1 286 LYS 286 309 309 LYS LYS C . n 
C 1 287 THR 287 310 310 THR THR C . n 
C 1 288 THR 288 311 311 THR THR C . n 
C 1 289 ALA 289 312 312 ALA ALA C . n 
C 1 290 ASN 290 313 313 ASN ASN C . n 
C 1 291 LEU 291 314 314 LEU LEU C . n 
C 1 292 ALA 292 315 315 ALA ALA C . n 
C 1 293 VAL 293 316 316 VAL VAL C . n 
C 1 294 ASP 294 317 317 ASP ASP C . n 
C 1 295 VAL 295 318 318 VAL VAL C . n 
C 1 296 ILE 296 319 319 ILE ILE C . n 
C 1 297 ALA 297 320 320 ALA ALA C . n 
C 1 298 SER 298 321 321 SER SER C . n 
C 1 299 SER 299 322 322 SER SER C . n 
C 1 300 PHE 300 323 323 PHE PHE C . n 
C 1 301 GLY 301 324 324 GLY GLY C . n 
C 1 302 GLN 302 325 325 GLN GLN C . n 
C 1 303 THR 303 326 326 THR THR C . n 
C 1 304 ARG 304 327 327 ARG ARG C . n 
C 1 305 GLU 305 328 328 GLU GLU C . n 
C 1 306 GLY 306 329 329 GLY GLY C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 MN  1   401 500 MN  MN  A . 
E 2 MN  1   402 501 MN  MN  A . 
F 3 BEN 1   403 952 BEN BEN A . 
G 4 BME 1   404 961 BME BME A . 
H 4 BME 1   405 971 BME BME A . 
I 5 38I 1   406 900 38I 38I A . 
J 2 MN  1   401 502 MN  MN  B . 
K 2 MN  1   402 503 MN  MN  B . 
L 3 BEN 1   403 951 BEN BEN B . 
M 4 BME 1   404 962 BME BME B . 
N 4 BME 1   405 972 BME BME B . 
O 5 38I 1   406 901 38I 38I B . 
P 2 MN  1   401 504 MN  MN  C . 
Q 2 MN  1   402 505 MN  MN  C . 
R 3 BEN 1   403 950 BEN BEN C . 
S 4 BME 1   404 963 BME BME C . 
T 4 BME 1   405 973 BME BME C . 
U 5 38I 1   406 902 38I 38I C . 
V 6 HOH 1   501 2   HOH HOH A . 
V 6 HOH 2   502 3   HOH HOH A . 
V 6 HOH 3   503 10  HOH HOH A . 
V 6 HOH 4   504 12  HOH HOH A . 
V 6 HOH 5   505 14  HOH HOH A . 
V 6 HOH 6   506 16  HOH HOH A . 
V 6 HOH 7   507 17  HOH HOH A . 
V 6 HOH 8   508 20  HOH HOH A . 
V 6 HOH 9   509 21  HOH HOH A . 
V 6 HOH 10  510 24  HOH HOH A . 
V 6 HOH 11  511 30  HOH HOH A . 
V 6 HOH 12  512 31  HOH HOH A . 
V 6 HOH 13  513 32  HOH HOH A . 
V 6 HOH 14  514 40  HOH HOH A . 
V 6 HOH 15  515 47  HOH HOH A . 
V 6 HOH 16  516 49  HOH HOH A . 
V 6 HOH 17  517 54  HOH HOH A . 
V 6 HOH 18  518 55  HOH HOH A . 
V 6 HOH 19  519 57  HOH HOH A . 
V 6 HOH 20  520 58  HOH HOH A . 
V 6 HOH 21  521 59  HOH HOH A . 
V 6 HOH 22  522 60  HOH HOH A . 
V 6 HOH 23  523 64  HOH HOH A . 
V 6 HOH 24  524 65  HOH HOH A . 
V 6 HOH 25  525 69  HOH HOH A . 
V 6 HOH 26  526 70  HOH HOH A . 
V 6 HOH 27  527 72  HOH HOH A . 
V 6 HOH 28  528 76  HOH HOH A . 
V 6 HOH 29  529 79  HOH HOH A . 
V 6 HOH 30  530 88  HOH HOH A . 
V 6 HOH 31  531 90  HOH HOH A . 
V 6 HOH 32  532 95  HOH HOH A . 
V 6 HOH 33  533 98  HOH HOH A . 
V 6 HOH 34  534 103 HOH HOH A . 
V 6 HOH 35  535 112 HOH HOH A . 
V 6 HOH 36  536 115 HOH HOH A . 
V 6 HOH 37  537 120 HOH HOH A . 
V 6 HOH 38  538 122 HOH HOH A . 
V 6 HOH 39  539 126 HOH HOH A . 
V 6 HOH 40  540 128 HOH HOH A . 
V 6 HOH 41  541 129 HOH HOH A . 
V 6 HOH 42  542 131 HOH HOH A . 
V 6 HOH 43  543 137 HOH HOH A . 
V 6 HOH 44  544 138 HOH HOH A . 
V 6 HOH 45  545 140 HOH HOH A . 
V 6 HOH 46  546 142 HOH HOH A . 
V 6 HOH 47  547 143 HOH HOH A . 
V 6 HOH 48  548 145 HOH HOH A . 
V 6 HOH 49  549 147 HOH HOH A . 
V 6 HOH 50  550 151 HOH HOH A . 
V 6 HOH 51  551 152 HOH HOH A . 
V 6 HOH 52  552 163 HOH HOH A . 
V 6 HOH 53  553 166 HOH HOH A . 
V 6 HOH 54  554 170 HOH HOH A . 
V 6 HOH 55  555 171 HOH HOH A . 
V 6 HOH 56  556 174 HOH HOH A . 
V 6 HOH 57  557 177 HOH HOH A . 
V 6 HOH 58  558 178 HOH HOH A . 
V 6 HOH 59  559 182 HOH HOH A . 
V 6 HOH 60  560 183 HOH HOH A . 
V 6 HOH 61  561 187 HOH HOH A . 
V 6 HOH 62  562 190 HOH HOH A . 
V 6 HOH 63  563 196 HOH HOH A . 
V 6 HOH 64  564 198 HOH HOH A . 
V 6 HOH 65  565 199 HOH HOH A . 
V 6 HOH 66  566 203 HOH HOH A . 
V 6 HOH 67  567 206 HOH HOH A . 
V 6 HOH 68  568 207 HOH HOH A . 
V 6 HOH 69  569 208 HOH HOH A . 
V 6 HOH 70  570 211 HOH HOH A . 
V 6 HOH 71  571 213 HOH HOH A . 
V 6 HOH 72  572 220 HOH HOH A . 
V 6 HOH 73  573 222 HOH HOH A . 
V 6 HOH 74  574 225 HOH HOH A . 
V 6 HOH 75  575 236 HOH HOH A . 
V 6 HOH 76  576 238 HOH HOH A . 
V 6 HOH 77  577 240 HOH HOH A . 
V 6 HOH 78  578 244 HOH HOH A . 
V 6 HOH 79  579 245 HOH HOH A . 
V 6 HOH 80  580 247 HOH HOH A . 
V 6 HOH 81  581 249 HOH HOH A . 
V 6 HOH 82  582 250 HOH HOH A . 
V 6 HOH 83  583 253 HOH HOH A . 
V 6 HOH 84  584 254 HOH HOH A . 
V 6 HOH 85  585 260 HOH HOH A . 
V 6 HOH 86  586 261 HOH HOH A . 
V 6 HOH 87  587 264 HOH HOH A . 
V 6 HOH 88  588 266 HOH HOH A . 
V 6 HOH 89  589 267 HOH HOH A . 
V 6 HOH 90  590 269 HOH HOH A . 
V 6 HOH 91  591 270 HOH HOH A . 
V 6 HOH 92  592 271 HOH HOH A . 
V 6 HOH 93  593 273 HOH HOH A . 
V 6 HOH 94  594 274 HOH HOH A . 
V 6 HOH 95  595 281 HOH HOH A . 
V 6 HOH 96  596 283 HOH HOH A . 
V 6 HOH 97  597 285 HOH HOH A . 
V 6 HOH 98  598 287 HOH HOH A . 
V 6 HOH 99  599 289 HOH HOH A . 
V 6 HOH 100 600 290 HOH HOH A . 
V 6 HOH 101 601 291 HOH HOH A . 
V 6 HOH 102 602 294 HOH HOH A . 
V 6 HOH 103 603 295 HOH HOH A . 
V 6 HOH 104 604 305 HOH HOH A . 
V 6 HOH 105 605 306 HOH HOH A . 
V 6 HOH 106 606 308 HOH HOH A . 
V 6 HOH 107 607 309 HOH HOH A . 
V 6 HOH 108 608 318 HOH HOH A . 
V 6 HOH 109 609 319 HOH HOH A . 
V 6 HOH 110 610 321 HOH HOH A . 
V 6 HOH 111 611 322 HOH HOH A . 
V 6 HOH 112 612 326 HOH HOH A . 
V 6 HOH 113 613 327 HOH HOH A . 
V 6 HOH 114 614 330 HOH HOH A . 
V 6 HOH 115 615 332 HOH HOH A . 
V 6 HOH 116 616 333 HOH HOH A . 
V 6 HOH 117 617 334 HOH HOH A . 
V 6 HOH 118 618 335 HOH HOH A . 
V 6 HOH 119 619 339 HOH HOH A . 
V 6 HOH 120 620 341 HOH HOH A . 
V 6 HOH 121 621 343 HOH HOH A . 
V 6 HOH 122 622 344 HOH HOH A . 
V 6 HOH 123 623 345 HOH HOH A . 
V 6 HOH 124 624 349 HOH HOH A . 
V 6 HOH 125 625 352 HOH HOH A . 
V 6 HOH 126 626 353 HOH HOH A . 
V 6 HOH 127 627 355 HOH HOH A . 
V 6 HOH 128 628 357 HOH HOH A . 
V 6 HOH 129 629 359 HOH HOH A . 
V 6 HOH 130 630 360 HOH HOH A . 
V 6 HOH 131 631 363 HOH HOH A . 
V 6 HOH 132 632 365 HOH HOH A . 
V 6 HOH 133 633 373 HOH HOH A . 
V 6 HOH 134 634 374 HOH HOH A . 
V 6 HOH 135 635 388 HOH HOH A . 
V 6 HOH 136 636 389 HOH HOH A . 
V 6 HOH 137 637 398 HOH HOH A . 
V 6 HOH 138 638 403 HOH HOH A . 
V 6 HOH 139 639 410 HOH HOH A . 
V 6 HOH 140 640 412 HOH HOH A . 
V 6 HOH 141 641 416 HOH HOH A . 
V 6 HOH 142 642 418 HOH HOH A . 
V 6 HOH 143 643 426 HOH HOH A . 
V 6 HOH 144 644 430 HOH HOH A . 
V 6 HOH 145 645 433 HOH HOH A . 
V 6 HOH 146 646 437 HOH HOH A . 
V 6 HOH 147 647 440 HOH HOH A . 
V 6 HOH 148 648 441 HOH HOH A . 
V 6 HOH 149 649 446 HOH HOH A . 
V 6 HOH 150 650 448 HOH HOH A . 
V 6 HOH 151 651 454 HOH HOH A . 
V 6 HOH 152 652 455 HOH HOH A . 
V 6 HOH 153 653 459 HOH HOH A . 
V 6 HOH 154 654 460 HOH HOH A . 
V 6 HOH 155 655 467 HOH HOH A . 
V 6 HOH 156 656 472 HOH HOH A . 
V 6 HOH 157 657 474 HOH HOH A . 
V 6 HOH 158 658 476 HOH HOH A . 
V 6 HOH 159 659 479 HOH HOH A . 
V 6 HOH 160 660 485 HOH HOH A . 
V 6 HOH 161 661 488 HOH HOH A . 
V 6 HOH 162 662 490 HOH HOH A . 
V 6 HOH 163 663 493 HOH HOH A . 
V 6 HOH 164 664 500 HOH HOH A . 
V 6 HOH 165 665 501 HOH HOH A . 
V 6 HOH 166 666 503 HOH HOH A . 
V 6 HOH 167 667 504 HOH HOH A . 
V 6 HOH 168 668 507 HOH HOH A . 
V 6 HOH 169 669 508 HOH HOH A . 
V 6 HOH 170 670 511 HOH HOH A . 
V 6 HOH 171 671 513 HOH HOH A . 
V 6 HOH 172 672 516 HOH HOH A . 
V 6 HOH 173 673 518 HOH HOH A . 
V 6 HOH 174 674 521 HOH HOH A . 
V 6 HOH 175 675 522 HOH HOH A . 
V 6 HOH 176 676 525 HOH HOH A . 
V 6 HOH 177 677 529 HOH HOH A . 
V 6 HOH 178 678 532 HOH HOH A . 
V 6 HOH 179 679 535 HOH HOH A . 
V 6 HOH 180 680 538 HOH HOH A . 
V 6 HOH 181 681 541 HOH HOH A . 
V 6 HOH 182 682 544 HOH HOH A . 
V 6 HOH 183 683 546 HOH HOH A . 
V 6 HOH 184 684 551 HOH HOH A . 
V 6 HOH 185 685 562 HOH HOH A . 
V 6 HOH 186 686 563 HOH HOH A . 
V 6 HOH 187 687 566 HOH HOH A . 
V 6 HOH 188 688 572 HOH HOH A . 
V 6 HOH 189 689 581 HOH HOH A . 
V 6 HOH 190 690 586 HOH HOH A . 
V 6 HOH 191 691 587 HOH HOH A . 
V 6 HOH 192 692 588 HOH HOH A . 
V 6 HOH 193 693 589 HOH HOH A . 
V 6 HOH 194 694 590 HOH HOH A . 
V 6 HOH 195 695 597 HOH HOH A . 
V 6 HOH 196 696 601 HOH HOH A . 
V 6 HOH 197 697 603 HOH HOH A . 
V 6 HOH 198 698 605 HOH HOH A . 
V 6 HOH 199 699 607 HOH HOH A . 
V 6 HOH 200 700 613 HOH HOH A . 
V 6 HOH 201 701 614 HOH HOH A . 
V 6 HOH 202 702 615 HOH HOH A . 
V 6 HOH 203 703 616 HOH HOH A . 
V 6 HOH 204 704 617 HOH HOH A . 
V 6 HOH 205 705 627 HOH HOH A . 
V 6 HOH 206 706 631 HOH HOH A . 
V 6 HOH 207 707 633 HOH HOH A . 
V 6 HOH 208 708 634 HOH HOH A . 
V 6 HOH 209 709 638 HOH HOH A . 
V 6 HOH 210 710 642 HOH HOH A . 
V 6 HOH 211 711 644 HOH HOH A . 
V 6 HOH 212 712 645 HOH HOH A . 
V 6 HOH 213 713 651 HOH HOH A . 
V 6 HOH 214 714 653 HOH HOH A . 
V 6 HOH 215 715 654 HOH HOH A . 
V 6 HOH 216 716 655 HOH HOH A . 
V 6 HOH 217 717 657 HOH HOH A . 
V 6 HOH 218 718 658 HOH HOH A . 
V 6 HOH 219 719 661 HOH HOH A . 
V 6 HOH 220 720 662 HOH HOH A . 
V 6 HOH 221 721 664 HOH HOH A . 
V 6 HOH 222 722 668 HOH HOH A . 
V 6 HOH 223 723 684 HOH HOH A . 
V 6 HOH 224 724 685 HOH HOH A . 
V 6 HOH 225 725 691 HOH HOH A . 
V 6 HOH 226 726 695 HOH HOH A . 
V 6 HOH 227 727 703 HOH HOH A . 
V 6 HOH 228 728 704 HOH HOH A . 
V 6 HOH 229 729 708 HOH HOH A . 
V 6 HOH 230 730 716 HOH HOH A . 
V 6 HOH 231 731 717 HOH HOH A . 
V 6 HOH 232 732 722 HOH HOH A . 
V 6 HOH 233 733 726 HOH HOH A . 
V 6 HOH 234 734 728 HOH HOH A . 
V 6 HOH 235 735 729 HOH HOH A . 
V 6 HOH 236 736 732 HOH HOH A . 
V 6 HOH 237 737 733 HOH HOH A . 
V 6 HOH 238 738 734 HOH HOH A . 
V 6 HOH 239 739 735 HOH HOH A . 
V 6 HOH 240 740 738 HOH HOH A . 
V 6 HOH 241 741 739 HOH HOH A . 
V 6 HOH 242 742 741 HOH HOH A . 
V 6 HOH 243 743 748 HOH HOH A . 
V 6 HOH 244 744 749 HOH HOH A . 
V 6 HOH 245 745 752 HOH HOH A . 
V 6 HOH 246 746 757 HOH HOH A . 
V 6 HOH 247 747 761 HOH HOH A . 
V 6 HOH 248 748 763 HOH HOH A . 
V 6 HOH 249 749 766 HOH HOH A . 
V 6 HOH 250 750 770 HOH HOH A . 
V 6 HOH 251 751 774 HOH HOH A . 
V 6 HOH 252 752 777 HOH HOH A . 
V 6 HOH 253 753 781 HOH HOH A . 
V 6 HOH 254 754 784 HOH HOH A . 
V 6 HOH 255 755 785 HOH HOH A . 
V 6 HOH 256 756 796 HOH HOH A . 
V 6 HOH 257 757 804 HOH HOH A . 
V 6 HOH 258 758 811 HOH HOH A . 
V 6 HOH 259 759 815 HOH HOH A . 
V 6 HOH 260 760 817 HOH HOH A . 
V 6 HOH 261 761 821 HOH HOH A . 
V 6 HOH 262 762 824 HOH HOH A . 
V 6 HOH 263 763 828 HOH HOH A . 
V 6 HOH 264 764 831 HOH HOH A . 
V 6 HOH 265 765 834 HOH HOH A . 
V 6 HOH 266 766 836 HOH HOH A . 
V 6 HOH 267 767 837 HOH HOH A . 
V 6 HOH 268 768 838 HOH HOH A . 
V 6 HOH 269 769 2   HOH HOH A . 
V 6 HOH 270 770 4   HOH HOH A . 
V 6 HOH 271 771 5   HOH HOH A . 
V 6 HOH 272 772 8   HOH HOH A . 
V 6 HOH 273 773 12  HOH HOH A . 
V 6 HOH 274 774 17  HOH HOH A . 
V 6 HOH 275 775 20  HOH HOH A . 
V 6 HOH 276 776 21  HOH HOH A . 
V 6 HOH 277 777 22  HOH HOH A . 
V 6 HOH 278 778 27  HOH HOH A . 
V 6 HOH 279 779 30  HOH HOH A . 
V 6 HOH 280 780 36  HOH HOH A . 
V 6 HOH 281 781 43  HOH HOH A . 
V 6 HOH 282 782 44  HOH HOH A . 
V 6 HOH 283 783 45  HOH HOH A . 
W 6 HOH 1   501 1   HOH HOH B . 
W 6 HOH 2   502 4   HOH HOH B . 
W 6 HOH 3   503 5   HOH HOH B . 
W 6 HOH 4   504 8   HOH HOH B . 
W 6 HOH 5   505 9   HOH HOH B . 
W 6 HOH 6   506 15  HOH HOH B . 
W 6 HOH 7   507 19  HOH HOH B . 
W 6 HOH 8   508 22  HOH HOH B . 
W 6 HOH 9   509 29  HOH HOH B . 
W 6 HOH 10  510 34  HOH HOH B . 
W 6 HOH 11  511 36  HOH HOH B . 
W 6 HOH 12  512 41  HOH HOH B . 
W 6 HOH 13  513 42  HOH HOH B . 
W 6 HOH 14  514 44  HOH HOH B . 
W 6 HOH 15  515 45  HOH HOH B . 
W 6 HOH 16  516 46  HOH HOH B . 
W 6 HOH 17  517 50  HOH HOH B . 
W 6 HOH 18  518 53  HOH HOH B . 
W 6 HOH 19  519 56  HOH HOH B . 
W 6 HOH 20  520 61  HOH HOH B . 
W 6 HOH 21  521 67  HOH HOH B . 
W 6 HOH 22  522 71  HOH HOH B . 
W 6 HOH 23  523 73  HOH HOH B . 
W 6 HOH 24  524 74  HOH HOH B . 
W 6 HOH 25  525 75  HOH HOH B . 
W 6 HOH 26  526 77  HOH HOH B . 
W 6 HOH 27  527 80  HOH HOH B . 
W 6 HOH 28  528 81  HOH HOH B . 
W 6 HOH 29  529 83  HOH HOH B . 
W 6 HOH 30  530 84  HOH HOH B . 
W 6 HOH 31  531 86  HOH HOH B . 
W 6 HOH 32  532 89  HOH HOH B . 
W 6 HOH 33  533 97  HOH HOH B . 
W 6 HOH 34  534 99  HOH HOH B . 
W 6 HOH 35  535 101 HOH HOH B . 
W 6 HOH 36  536 102 HOH HOH B . 
W 6 HOH 37  537 106 HOH HOH B . 
W 6 HOH 38  538 107 HOH HOH B . 
W 6 HOH 39  539 108 HOH HOH B . 
W 6 HOH 40  540 109 HOH HOH B . 
W 6 HOH 41  541 114 HOH HOH B . 
W 6 HOH 42  542 117 HOH HOH B . 
W 6 HOH 43  543 118 HOH HOH B . 
W 6 HOH 44  544 119 HOH HOH B . 
W 6 HOH 45  545 125 HOH HOH B . 
W 6 HOH 46  546 130 HOH HOH B . 
W 6 HOH 47  547 132 HOH HOH B . 
W 6 HOH 48  548 133 HOH HOH B . 
W 6 HOH 49  549 134 HOH HOH B . 
W 6 HOH 50  550 135 HOH HOH B . 
W 6 HOH 51  551 139 HOH HOH B . 
W 6 HOH 52  552 149 HOH HOH B . 
W 6 HOH 53  553 154 HOH HOH B . 
W 6 HOH 54  554 156 HOH HOH B . 
W 6 HOH 55  555 158 HOH HOH B . 
W 6 HOH 56  556 159 HOH HOH B . 
W 6 HOH 57  557 160 HOH HOH B . 
W 6 HOH 58  558 161 HOH HOH B . 
W 6 HOH 59  559 164 HOH HOH B . 
W 6 HOH 60  560 165 HOH HOH B . 
W 6 HOH 61  561 173 HOH HOH B . 
W 6 HOH 62  562 176 HOH HOH B . 
W 6 HOH 63  563 179 HOH HOH B . 
W 6 HOH 64  564 180 HOH HOH B . 
W 6 HOH 65  565 191 HOH HOH B . 
W 6 HOH 66  566 192 HOH HOH B . 
W 6 HOH 67  567 194 HOH HOH B . 
W 6 HOH 68  568 197 HOH HOH B . 
W 6 HOH 69  569 201 HOH HOH B . 
W 6 HOH 70  570 202 HOH HOH B . 
W 6 HOH 71  571 204 HOH HOH B . 
W 6 HOH 72  572 205 HOH HOH B . 
W 6 HOH 73  573 209 HOH HOH B . 
W 6 HOH 74  574 210 HOH HOH B . 
W 6 HOH 75  575 215 HOH HOH B . 
W 6 HOH 76  576 218 HOH HOH B . 
W 6 HOH 77  577 219 HOH HOH B . 
W 6 HOH 78  578 224 HOH HOH B . 
W 6 HOH 79  579 226 HOH HOH B . 
W 6 HOH 80  580 228 HOH HOH B . 
W 6 HOH 81  581 229 HOH HOH B . 
W 6 HOH 82  582 230 HOH HOH B . 
W 6 HOH 83  583 231 HOH HOH B . 
W 6 HOH 84  584 232 HOH HOH B . 
W 6 HOH 85  585 234 HOH HOH B . 
W 6 HOH 86  586 243 HOH HOH B . 
W 6 HOH 87  587 246 HOH HOH B . 
W 6 HOH 88  588 248 HOH HOH B . 
W 6 HOH 89  589 251 HOH HOH B . 
W 6 HOH 90  590 252 HOH HOH B . 
W 6 HOH 91  591 255 HOH HOH B . 
W 6 HOH 92  592 256 HOH HOH B . 
W 6 HOH 93  593 257 HOH HOH B . 
W 6 HOH 94  594 258 HOH HOH B . 
W 6 HOH 95  595 259 HOH HOH B . 
W 6 HOH 96  596 265 HOH HOH B . 
W 6 HOH 97  597 268 HOH HOH B . 
W 6 HOH 98  598 272 HOH HOH B . 
W 6 HOH 99  599 275 HOH HOH B . 
W 6 HOH 100 600 278 HOH HOH B . 
W 6 HOH 101 601 279 HOH HOH B . 
W 6 HOH 102 602 280 HOH HOH B . 
W 6 HOH 103 603 292 HOH HOH B . 
W 6 HOH 104 604 296 HOH HOH B . 
W 6 HOH 105 605 297 HOH HOH B . 
W 6 HOH 106 606 298 HOH HOH B . 
W 6 HOH 107 607 300 HOH HOH B . 
W 6 HOH 108 608 301 HOH HOH B . 
W 6 HOH 109 609 302 HOH HOH B . 
W 6 HOH 110 610 311 HOH HOH B . 
W 6 HOH 111 611 313 HOH HOH B . 
W 6 HOH 112 612 314 HOH HOH B . 
W 6 HOH 113 613 316 HOH HOH B . 
W 6 HOH 114 614 317 HOH HOH B . 
W 6 HOH 115 615 320 HOH HOH B . 
W 6 HOH 116 616 331 HOH HOH B . 
W 6 HOH 117 617 337 HOH HOH B . 
W 6 HOH 118 618 340 HOH HOH B . 
W 6 HOH 119 619 342 HOH HOH B . 
W 6 HOH 120 620 346 HOH HOH B . 
W 6 HOH 121 621 347 HOH HOH B . 
W 6 HOH 122 622 348 HOH HOH B . 
W 6 HOH 123 623 350 HOH HOH B . 
W 6 HOH 124 624 351 HOH HOH B . 
W 6 HOH 125 625 356 HOH HOH B . 
W 6 HOH 126 626 358 HOH HOH B . 
W 6 HOH 127 627 362 HOH HOH B . 
W 6 HOH 128 628 367 HOH HOH B . 
W 6 HOH 129 629 371 HOH HOH B . 
W 6 HOH 130 630 376 HOH HOH B . 
W 6 HOH 131 631 377 HOH HOH B . 
W 6 HOH 132 632 380 HOH HOH B . 
W 6 HOH 133 633 381 HOH HOH B . 
W 6 HOH 134 634 384 HOH HOH B . 
W 6 HOH 135 635 386 HOH HOH B . 
W 6 HOH 136 636 387 HOH HOH B . 
W 6 HOH 137 637 392 HOH HOH B . 
W 6 HOH 138 638 394 HOH HOH B . 
W 6 HOH 139 639 396 HOH HOH B . 
W 6 HOH 140 640 397 HOH HOH B . 
W 6 HOH 141 641 401 HOH HOH B . 
W 6 HOH 142 642 405 HOH HOH B . 
W 6 HOH 143 643 406 HOH HOH B . 
W 6 HOH 144 644 414 HOH HOH B . 
W 6 HOH 145 645 422 HOH HOH B . 
W 6 HOH 146 646 423 HOH HOH B . 
W 6 HOH 147 647 427 HOH HOH B . 
W 6 HOH 148 648 431 HOH HOH B . 
W 6 HOH 149 649 432 HOH HOH B . 
W 6 HOH 150 650 436 HOH HOH B . 
W 6 HOH 151 651 439 HOH HOH B . 
W 6 HOH 152 652 442 HOH HOH B . 
W 6 HOH 153 653 444 HOH HOH B . 
W 6 HOH 154 654 447 HOH HOH B . 
W 6 HOH 155 655 449 HOH HOH B . 
W 6 HOH 156 656 450 HOH HOH B . 
W 6 HOH 157 657 452 HOH HOH B . 
W 6 HOH 158 658 453 HOH HOH B . 
W 6 HOH 159 659 456 HOH HOH B . 
W 6 HOH 160 660 461 HOH HOH B . 
W 6 HOH 161 661 462 HOH HOH B . 
W 6 HOH 162 662 465 HOH HOH B . 
W 6 HOH 163 663 466 HOH HOH B . 
W 6 HOH 164 664 468 HOH HOH B . 
W 6 HOH 165 665 478 HOH HOH B . 
W 6 HOH 166 666 481 HOH HOH B . 
W 6 HOH 167 667 484 HOH HOH B . 
W 6 HOH 168 668 492 HOH HOH B . 
W 6 HOH 169 669 494 HOH HOH B . 
W 6 HOH 170 670 496 HOH HOH B . 
W 6 HOH 171 671 498 HOH HOH B . 
W 6 HOH 172 672 502 HOH HOH B . 
W 6 HOH 173 673 505 HOH HOH B . 
W 6 HOH 174 674 509 HOH HOH B . 
W 6 HOH 175 675 510 HOH HOH B . 
W 6 HOH 176 676 512 HOH HOH B . 
W 6 HOH 177 677 514 HOH HOH B . 
W 6 HOH 178 678 517 HOH HOH B . 
W 6 HOH 179 679 520 HOH HOH B . 
W 6 HOH 180 680 524 HOH HOH B . 
W 6 HOH 181 681 530 HOH HOH B . 
W 6 HOH 182 682 533 HOH HOH B . 
W 6 HOH 183 683 539 HOH HOH B . 
W 6 HOH 184 684 542 HOH HOH B . 
W 6 HOH 185 685 547 HOH HOH B . 
W 6 HOH 186 686 549 HOH HOH B . 
W 6 HOH 187 687 550 HOH HOH B . 
W 6 HOH 188 688 552 HOH HOH B . 
W 6 HOH 189 689 554 HOH HOH B . 
W 6 HOH 190 690 556 HOH HOH B . 
W 6 HOH 191 691 557 HOH HOH B . 
W 6 HOH 192 692 558 HOH HOH B . 
W 6 HOH 193 693 559 HOH HOH B . 
W 6 HOH 194 694 567 HOH HOH B . 
W 6 HOH 195 695 571 HOH HOH B . 
W 6 HOH 196 696 574 HOH HOH B . 
W 6 HOH 197 697 576 HOH HOH B . 
W 6 HOH 198 698 579 HOH HOH B . 
W 6 HOH 199 699 583 HOH HOH B . 
W 6 HOH 200 700 585 HOH HOH B . 
W 6 HOH 201 701 593 HOH HOH B . 
W 6 HOH 202 702 595 HOH HOH B . 
W 6 HOH 203 703 600 HOH HOH B . 
W 6 HOH 204 704 606 HOH HOH B . 
W 6 HOH 205 705 608 HOH HOH B . 
W 6 HOH 206 706 609 HOH HOH B . 
W 6 HOH 207 707 610 HOH HOH B . 
W 6 HOH 208 708 612 HOH HOH B . 
W 6 HOH 209 709 618 HOH HOH B . 
W 6 HOH 210 710 620 HOH HOH B . 
W 6 HOH 211 711 623 HOH HOH B . 
W 6 HOH 212 712 625 HOH HOH B . 
W 6 HOH 213 713 626 HOH HOH B . 
W 6 HOH 214 714 637 HOH HOH B . 
W 6 HOH 215 715 643 HOH HOH B . 
W 6 HOH 216 716 647 HOH HOH B . 
W 6 HOH 217 717 648 HOH HOH B . 
W 6 HOH 218 718 649 HOH HOH B . 
W 6 HOH 219 719 660 HOH HOH B . 
W 6 HOH 220 720 663 HOH HOH B . 
W 6 HOH 221 721 667 HOH HOH B . 
W 6 HOH 222 722 669 HOH HOH B . 
W 6 HOH 223 723 670 HOH HOH B . 
W 6 HOH 224 724 672 HOH HOH B . 
W 6 HOH 225 725 673 HOH HOH B . 
W 6 HOH 226 726 674 HOH HOH B . 
W 6 HOH 227 727 675 HOH HOH B . 
W 6 HOH 228 728 676 HOH HOH B . 
W 6 HOH 229 729 678 HOH HOH B . 
W 6 HOH 230 730 679 HOH HOH B . 
W 6 HOH 231 731 682 HOH HOH B . 
W 6 HOH 232 732 690 HOH HOH B . 
W 6 HOH 233 733 694 HOH HOH B . 
W 6 HOH 234 734 696 HOH HOH B . 
W 6 HOH 235 735 697 HOH HOH B . 
W 6 HOH 236 736 701 HOH HOH B . 
W 6 HOH 237 737 706 HOH HOH B . 
W 6 HOH 238 738 707 HOH HOH B . 
W 6 HOH 239 739 709 HOH HOH B . 
W 6 HOH 240 740 713 HOH HOH B . 
W 6 HOH 241 741 715 HOH HOH B . 
W 6 HOH 242 742 720 HOH HOH B . 
W 6 HOH 243 743 721 HOH HOH B . 
W 6 HOH 244 744 723 HOH HOH B . 
W 6 HOH 245 745 725 HOH HOH B . 
W 6 HOH 246 746 730 HOH HOH B . 
W 6 HOH 247 747 736 HOH HOH B . 
W 6 HOH 248 748 744 HOH HOH B . 
W 6 HOH 249 749 746 HOH HOH B . 
W 6 HOH 250 750 750 HOH HOH B . 
W 6 HOH 251 751 751 HOH HOH B . 
W 6 HOH 252 752 753 HOH HOH B . 
W 6 HOH 253 753 756 HOH HOH B . 
W 6 HOH 254 754 759 HOH HOH B . 
W 6 HOH 255 755 767 HOH HOH B . 
W 6 HOH 256 756 773 HOH HOH B . 
W 6 HOH 257 757 780 HOH HOH B . 
W 6 HOH 258 758 787 HOH HOH B . 
W 6 HOH 259 759 788 HOH HOH B . 
W 6 HOH 260 760 790 HOH HOH B . 
W 6 HOH 261 761 791 HOH HOH B . 
W 6 HOH 262 762 795 HOH HOH B . 
W 6 HOH 263 763 799 HOH HOH B . 
W 6 HOH 264 764 801 HOH HOH B . 
W 6 HOH 265 765 803 HOH HOH B . 
W 6 HOH 266 766 805 HOH HOH B . 
W 6 HOH 267 767 807 HOH HOH B . 
W 6 HOH 268 768 812 HOH HOH B . 
W 6 HOH 269 769 813 HOH HOH B . 
W 6 HOH 270 770 816 HOH HOH B . 
W 6 HOH 271 771 822 HOH HOH B . 
W 6 HOH 272 772 825 HOH HOH B . 
W 6 HOH 273 773 832 HOH HOH B . 
W 6 HOH 274 774 840 HOH HOH B . 
W 6 HOH 275 775 841 HOH HOH B . 
W 6 HOH 276 776 842 HOH HOH B . 
W 6 HOH 277 777 3   HOH HOH B . 
W 6 HOH 278 778 7   HOH HOH B . 
W 6 HOH 279 779 9   HOH HOH B . 
W 6 HOH 280 780 10  HOH HOH B . 
W 6 HOH 281 781 11  HOH HOH B . 
W 6 HOH 282 782 13  HOH HOH B . 
W 6 HOH 283 783 15  HOH HOH B . 
W 6 HOH 284 784 16  HOH HOH B . 
W 6 HOH 285 785 18  HOH HOH B . 
W 6 HOH 286 786 23  HOH HOH B . 
W 6 HOH 287 787 24  HOH HOH B . 
W 6 HOH 288 788 26  HOH HOH B . 
W 6 HOH 289 789 32  HOH HOH B . 
W 6 HOH 290 790 33  HOH HOH B . 
W 6 HOH 291 791 38  HOH HOH B . 
W 6 HOH 292 792 40  HOH HOH B . 
W 6 HOH 293 793 42  HOH HOH B . 
W 6 HOH 294 794 47  HOH HOH B . 
X 6 HOH 1   501 6   HOH HOH C . 
X 6 HOH 2   502 7   HOH HOH C . 
X 6 HOH 3   503 11  HOH HOH C . 
X 6 HOH 4   504 13  HOH HOH C . 
X 6 HOH 5   505 18  HOH HOH C . 
X 6 HOH 6   506 25  HOH HOH C . 
X 6 HOH 7   507 28  HOH HOH C . 
X 6 HOH 8   508 35  HOH HOH C . 
X 6 HOH 9   509 37  HOH HOH C . 
X 6 HOH 10  510 38  HOH HOH C . 
X 6 HOH 11  511 39  HOH HOH C . 
X 6 HOH 12  512 43  HOH HOH C . 
X 6 HOH 13  513 48  HOH HOH C . 
X 6 HOH 14  514 51  HOH HOH C . 
X 6 HOH 15  515 52  HOH HOH C . 
X 6 HOH 16  516 62  HOH HOH C . 
X 6 HOH 17  517 63  HOH HOH C . 
X 6 HOH 18  518 66  HOH HOH C . 
X 6 HOH 19  519 68  HOH HOH C . 
X 6 HOH 20  520 82  HOH HOH C . 
X 6 HOH 21  521 85  HOH HOH C . 
X 6 HOH 22  522 87  HOH HOH C . 
X 6 HOH 23  523 91  HOH HOH C . 
X 6 HOH 24  524 92  HOH HOH C . 
X 6 HOH 25  525 93  HOH HOH C . 
X 6 HOH 26  526 94  HOH HOH C . 
X 6 HOH 27  527 96  HOH HOH C . 
X 6 HOH 28  528 105 HOH HOH C . 
X 6 HOH 29  529 111 HOH HOH C . 
X 6 HOH 30  530 113 HOH HOH C . 
X 6 HOH 31  531 116 HOH HOH C . 
X 6 HOH 32  532 121 HOH HOH C . 
X 6 HOH 33  533 124 HOH HOH C . 
X 6 HOH 34  534 127 HOH HOH C . 
X 6 HOH 35  535 136 HOH HOH C . 
X 6 HOH 36  536 141 HOH HOH C . 
X 6 HOH 37  537 144 HOH HOH C . 
X 6 HOH 38  538 146 HOH HOH C . 
X 6 HOH 39  539 148 HOH HOH C . 
X 6 HOH 40  540 150 HOH HOH C . 
X 6 HOH 41  541 153 HOH HOH C . 
X 6 HOH 42  542 155 HOH HOH C . 
X 6 HOH 43  543 157 HOH HOH C . 
X 6 HOH 44  544 162 HOH HOH C . 
X 6 HOH 45  545 167 HOH HOH C . 
X 6 HOH 46  546 168 HOH HOH C . 
X 6 HOH 47  547 169 HOH HOH C . 
X 6 HOH 48  548 172 HOH HOH C . 
X 6 HOH 49  549 181 HOH HOH C . 
X 6 HOH 50  550 185 HOH HOH C . 
X 6 HOH 51  551 186 HOH HOH C . 
X 6 HOH 52  552 188 HOH HOH C . 
X 6 HOH 53  553 189 HOH HOH C . 
X 6 HOH 54  554 193 HOH HOH C . 
X 6 HOH 55  555 195 HOH HOH C . 
X 6 HOH 56  556 200 HOH HOH C . 
X 6 HOH 57  557 216 HOH HOH C . 
X 6 HOH 58  558 221 HOH HOH C . 
X 6 HOH 59  559 223 HOH HOH C . 
X 6 HOH 60  560 227 HOH HOH C . 
X 6 HOH 61  561 235 HOH HOH C . 
X 6 HOH 62  562 239 HOH HOH C . 
X 6 HOH 63  563 241 HOH HOH C . 
X 6 HOH 64  564 242 HOH HOH C . 
X 6 HOH 65  565 262 HOH HOH C . 
X 6 HOH 66  566 263 HOH HOH C . 
X 6 HOH 67  567 282 HOH HOH C . 
X 6 HOH 68  568 284 HOH HOH C . 
X 6 HOH 69  569 286 HOH HOH C . 
X 6 HOH 70  570 288 HOH HOH C . 
X 6 HOH 71  571 293 HOH HOH C . 
X 6 HOH 72  572 299 HOH HOH C . 
X 6 HOH 73  573 307 HOH HOH C . 
X 6 HOH 74  574 310 HOH HOH C . 
X 6 HOH 75  575 323 HOH HOH C . 
X 6 HOH 76  576 324 HOH HOH C . 
X 6 HOH 77  577 325 HOH HOH C . 
X 6 HOH 78  578 328 HOH HOH C . 
X 6 HOH 79  579 338 HOH HOH C . 
X 6 HOH 80  580 354 HOH HOH C . 
X 6 HOH 81  581 361 HOH HOH C . 
X 6 HOH 82  582 364 HOH HOH C . 
X 6 HOH 83  583 366 HOH HOH C . 
X 6 HOH 84  584 369 HOH HOH C . 
X 6 HOH 85  585 370 HOH HOH C . 
X 6 HOH 86  586 372 HOH HOH C . 
X 6 HOH 87  587 375 HOH HOH C . 
X 6 HOH 88  588 378 HOH HOH C . 
X 6 HOH 89  589 379 HOH HOH C . 
X 6 HOH 90  590 382 HOH HOH C . 
X 6 HOH 91  591 385 HOH HOH C . 
X 6 HOH 92  592 390 HOH HOH C . 
X 6 HOH 93  593 395 HOH HOH C . 
X 6 HOH 94  594 399 HOH HOH C . 
X 6 HOH 95  595 400 HOH HOH C . 
X 6 HOH 96  596 404 HOH HOH C . 
X 6 HOH 97  597 407 HOH HOH C . 
X 6 HOH 98  598 409 HOH HOH C . 
X 6 HOH 99  599 411 HOH HOH C . 
X 6 HOH 100 600 413 HOH HOH C . 
X 6 HOH 101 601 415 HOH HOH C . 
X 6 HOH 102 602 417 HOH HOH C . 
X 6 HOH 103 603 419 HOH HOH C . 
X 6 HOH 104 604 420 HOH HOH C . 
X 6 HOH 105 605 421 HOH HOH C . 
X 6 HOH 106 606 428 HOH HOH C . 
X 6 HOH 107 607 435 HOH HOH C . 
X 6 HOH 108 608 438 HOH HOH C . 
X 6 HOH 109 609 443 HOH HOH C . 
X 6 HOH 110 610 445 HOH HOH C . 
X 6 HOH 111 611 451 HOH HOH C . 
X 6 HOH 112 612 457 HOH HOH C . 
X 6 HOH 113 613 458 HOH HOH C . 
X 6 HOH 114 614 463 HOH HOH C . 
X 6 HOH 115 615 464 HOH HOH C . 
X 6 HOH 116 616 470 HOH HOH C . 
X 6 HOH 117 617 473 HOH HOH C . 
X 6 HOH 118 618 475 HOH HOH C . 
X 6 HOH 119 619 477 HOH HOH C . 
X 6 HOH 120 620 480 HOH HOH C . 
X 6 HOH 121 621 482 HOH HOH C . 
X 6 HOH 122 622 483 HOH HOH C . 
X 6 HOH 123 623 486 HOH HOH C . 
X 6 HOH 124 624 487 HOH HOH C . 
X 6 HOH 125 625 489 HOH HOH C . 
X 6 HOH 126 626 491 HOH HOH C . 
X 6 HOH 127 627 495 HOH HOH C . 
X 6 HOH 128 628 497 HOH HOH C . 
X 6 HOH 129 629 515 HOH HOH C . 
X 6 HOH 130 630 523 HOH HOH C . 
X 6 HOH 131 631 526 HOH HOH C . 
X 6 HOH 132 632 527 HOH HOH C . 
X 6 HOH 133 633 528 HOH HOH C . 
X 6 HOH 134 634 534 HOH HOH C . 
X 6 HOH 135 635 536 HOH HOH C . 
X 6 HOH 136 636 537 HOH HOH C . 
X 6 HOH 137 637 543 HOH HOH C . 
X 6 HOH 138 638 545 HOH HOH C . 
X 6 HOH 139 639 555 HOH HOH C . 
X 6 HOH 140 640 560 HOH HOH C . 
X 6 HOH 141 641 564 HOH HOH C . 
X 6 HOH 142 642 565 HOH HOH C . 
X 6 HOH 143 643 568 HOH HOH C . 
X 6 HOH 144 644 570 HOH HOH C . 
X 6 HOH 145 645 577 HOH HOH C . 
X 6 HOH 146 646 578 HOH HOH C . 
X 6 HOH 147 647 582 HOH HOH C . 
X 6 HOH 148 648 584 HOH HOH C . 
X 6 HOH 149 649 591 HOH HOH C . 
X 6 HOH 150 650 592 HOH HOH C . 
X 6 HOH 151 651 596 HOH HOH C . 
X 6 HOH 152 652 598 HOH HOH C . 
X 6 HOH 153 653 599 HOH HOH C . 
X 6 HOH 154 654 602 HOH HOH C . 
X 6 HOH 155 655 604 HOH HOH C . 
X 6 HOH 156 656 611 HOH HOH C . 
X 6 HOH 157 657 619 HOH HOH C . 
X 6 HOH 158 658 621 HOH HOH C . 
X 6 HOH 159 659 622 HOH HOH C . 
X 6 HOH 160 660 624 HOH HOH C . 
X 6 HOH 161 661 628 HOH HOH C . 
X 6 HOH 162 662 629 HOH HOH C . 
X 6 HOH 163 663 630 HOH HOH C . 
X 6 HOH 164 664 632 HOH HOH C . 
X 6 HOH 165 665 635 HOH HOH C . 
X 6 HOH 166 666 639 HOH HOH C . 
X 6 HOH 167 667 640 HOH HOH C . 
X 6 HOH 168 668 646 HOH HOH C . 
X 6 HOH 169 669 652 HOH HOH C . 
X 6 HOH 170 670 656 HOH HOH C . 
X 6 HOH 171 671 681 HOH HOH C . 
X 6 HOH 172 672 683 HOH HOH C . 
X 6 HOH 173 673 689 HOH HOH C . 
X 6 HOH 174 674 692 HOH HOH C . 
X 6 HOH 175 675 693 HOH HOH C . 
X 6 HOH 176 676 698 HOH HOH C . 
X 6 HOH 177 677 699 HOH HOH C . 
X 6 HOH 178 678 705 HOH HOH C . 
X 6 HOH 179 679 712 HOH HOH C . 
X 6 HOH 180 680 724 HOH HOH C . 
X 6 HOH 181 681 727 HOH HOH C . 
X 6 HOH 182 682 731 HOH HOH C . 
X 6 HOH 183 683 737 HOH HOH C . 
X 6 HOH 184 684 740 HOH HOH C . 
X 6 HOH 185 685 742 HOH HOH C . 
X 6 HOH 186 686 743 HOH HOH C . 
X 6 HOH 187 687 747 HOH HOH C . 
X 6 HOH 188 688 754 HOH HOH C . 
X 6 HOH 189 689 758 HOH HOH C . 
X 6 HOH 190 690 760 HOH HOH C . 
X 6 HOH 191 691 762 HOH HOH C . 
X 6 HOH 192 692 765 HOH HOH C . 
X 6 HOH 193 693 769 HOH HOH C . 
X 6 HOH 194 694 771 HOH HOH C . 
X 6 HOH 195 695 772 HOH HOH C . 
X 6 HOH 196 696 778 HOH HOH C . 
X 6 HOH 197 697 779 HOH HOH C . 
X 6 HOH 198 698 783 HOH HOH C . 
X 6 HOH 199 699 789 HOH HOH C . 
X 6 HOH 200 700 793 HOH HOH C . 
X 6 HOH 201 701 800 HOH HOH C . 
X 6 HOH 202 702 802 HOH HOH C . 
X 6 HOH 203 703 809 HOH HOH C . 
X 6 HOH 204 704 814 HOH HOH C . 
X 6 HOH 205 705 818 HOH HOH C . 
X 6 HOH 206 706 819 HOH HOH C . 
X 6 HOH 207 707 820 HOH HOH C . 
X 6 HOH 208 708 823 HOH HOH C . 
X 6 HOH 209 709 827 HOH HOH C . 
X 6 HOH 210 710 829 HOH HOH C . 
X 6 HOH 211 711 830 HOH HOH C . 
X 6 HOH 212 712 833 HOH HOH C . 
X 6 HOH 213 713 839 HOH HOH C . 
X 6 HOH 214 714 1   HOH HOH C . 
X 6 HOH 215 715 6   HOH HOH C . 
X 6 HOH 216 716 19  HOH HOH C . 
X 6 HOH 217 717 28  HOH HOH C . 
X 6 HOH 218 718 29  HOH HOH C . 
X 6 HOH 219 719 31  HOH HOH C . 
X 6 HOH 220 720 39  HOH HOH C . 
X 6 HOH 221 721 48  HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,F,G,H,I,V 
2 1 B,J,K,L,M,N,O,W 
3 1 C,P,Q,R,S,T,U,X 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 568 ? V HOH . 
2 1 A HOH 613 ? V HOH . 
3 1 C HOH 716 ? X HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 OD2 ? B ASP 124 ? B ASP 147 ? 1_555 85.7  ? 
2  OD2 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 ND1 ? B HIS 97  ? B HIS 120 ? 1_555 93.9  ? 
3  OD2 ? B ASP 124 ? B ASP 147 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 ND1 ? B HIS 97  ? B HIS 120 ? 1_555 87.6  ? 
4  OD2 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O30 ? O 38I .   ? B 38I 406 ? 1_555 156.4 ? 
5  OD2 ? B ASP 124 ? B ASP 147 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O30 ? O 38I .   ? B 38I 406 ? 1_555 91.3  ? 
6  ND1 ? B HIS 97  ? B HIS 120 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O30 ? O 38I .   ? B 38I 406 ? 1_555 109.4 ? 
7  OD2 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 87.1  ? 
8  OD2 ? B ASP 124 ? B ASP 147 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 166.5 ? 
9  ND1 ? B HIS 97  ? B HIS 120 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 104.2 ? 
10 O30 ? O 38I .   ? B 38I 406 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 90.8  ? 
11 OD2 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O12 ? O 38I .   ? B 38I 406 ? 1_555 93.4  ? 
12 OD2 ? B ASP 124 ? B ASP 147 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O12 ? O 38I .   ? B 38I 406 ? 1_555 89.8  ? 
13 ND1 ? B HIS 97  ? B HIS 120 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O12 ? O 38I .   ? B 38I 406 ? 1_555 172.0 ? 
14 O30 ? O 38I .   ? B 38I 406 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O12 ? O 38I .   ? B 38I 406 ? 1_555 63.1  ? 
15 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 MN ? J MN . ? B MN 401 ? 1_555 O12 ? O 38I .   ? B 38I 406 ? 1_555 79.3  ? 
16 OD2 ? A ASP 124 ? A ASP 147 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 120 ? A ASP 143 ? 1_555 85.3  ? 
17 OD2 ? A ASP 124 ? A ASP 147 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 ND1 ? A HIS 97  ? A HIS 120 ? 1_555 89.3  ? 
18 OD2 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 ND1 ? A HIS 97  ? A HIS 120 ? 1_555 96.5  ? 
19 OD2 ? A ASP 124 ? A ASP 147 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O12 ? I 38I .   ? A 38I 406 ? 1_555 89.0  ? 
20 OD2 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O12 ? I 38I .   ? A 38I 406 ? 1_555 94.2  ? 
21 ND1 ? A HIS 97  ? A HIS 120 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O12 ? I 38I .   ? A 38I 406 ? 1_555 169.0 ? 
22 OD2 ? A ASP 124 ? A ASP 147 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O30 ? I 38I .   ? A 38I 406 ? 1_555 90.9  ? 
23 OD2 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O30 ? I 38I .   ? A 38I 406 ? 1_555 156.1 ? 
24 ND1 ? A HIS 97  ? A HIS 120 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O30 ? I 38I .   ? A 38I 406 ? 1_555 107.1 ? 
25 O12 ? I 38I .   ? A 38I 406 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O30 ? I 38I .   ? A 38I 406 ? 1_555 62.1  ? 
26 OD2 ? A ASP 124 ? A ASP 147 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 163.7 ? 
27 OD2 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 86.6  ? 
28 ND1 ? A HIS 97  ? A HIS 120 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 105.7 ? 
29 O12 ? I 38I .   ? A 38I 406 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 77.5  ? 
30 O30 ? I 38I .   ? A 38I 406 ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 90.7  ? 
31 ND1 ? C HIS 97  ? C HIS 120 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 124 ? C ASP 147 ? 1_555 86.8  ? 
32 ND1 ? C HIS 97  ? C HIS 120 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O12 ? U 38I .   ? C 38I 406 ? 1_555 167.8 ? 
33 OD2 ? C ASP 124 ? C ASP 147 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O12 ? U 38I .   ? C 38I 406 ? 1_555 88.5  ? 
34 ND1 ? C HIS 97  ? C HIS 120 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 120 ? C ASP 143 ? 1_555 98.1  ? 
35 OD2 ? C ASP 124 ? C ASP 147 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 120 ? C ASP 143 ? 1_555 88.6  ? 
36 O12 ? U 38I .   ? C 38I 406 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 120 ? C ASP 143 ? 1_555 93.0  ? 
37 ND1 ? C HIS 97  ? C HIS 120 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 108.3 ? 
38 OD2 ? C ASP 124 ? C ASP 147 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 164.3 ? 
39 O12 ? U 38I .   ? C 38I 406 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 77.5  ? 
40 OD2 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 85.1  ? 
41 ND1 ? C HIS 97  ? C HIS 120 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O30 ? U 38I .   ? C 38I 406 ? 1_555 107.1 ? 
42 OD2 ? C ASP 124 ? C ASP 147 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O30 ? U 38I .   ? C 38I 406 ? 1_555 90.4  ? 
43 O12 ? U 38I .   ? C 38I 406 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O30 ? U 38I .   ? C 38I 406 ? 1_555 61.7  ? 
44 OD2 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O30 ? U 38I .   ? C 38I 406 ? 1_555 154.7 ? 
45 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 MN ? Q MN . ? C MN 402 ? 1_555 O30 ? U 38I .   ? C 38I 406 ? 1_555 89.2  ? 
46 OD1 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 O12 ? O 38I .   ? B 38I 406 ? 1_555 90.5  ? 
47 OD1 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 ND1 ? B HIS 122 ? B HIS 145 ? 1_555 98.5  ? 
48 O12 ? O 38I .   ? B 38I 406 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 ND1 ? B HIS 122 ? B HIS 145 ? 1_555 91.7  ? 
49 OD1 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 230 ? B ASP 253 ? 1_555 134.8 ? 
50 O12 ? O 38I .   ? B 38I 406 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 230 ? B ASP 253 ? 1_555 133.0 ? 
51 ND1 ? B HIS 122 ? B HIS 145 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 230 ? B ASP 253 ? 1_555 92.6  ? 
52 OD1 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 85.8  ? 
53 O12 ? O 38I .   ? B 38I 406 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 78.0  ? 
54 ND1 ? B HIS 122 ? B HIS 145 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 169.0 ? 
55 OD2 ? B ASP 230 ? B ASP 253 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 91.5  ? 
56 OD1 ? B ASP 120 ? B ASP 143 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD1 ? B ASP 230 ? B ASP 253 ? 1_555 79.4  ? 
57 O12 ? O 38I .   ? B 38I 406 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD1 ? B ASP 230 ? B ASP 253 ? 1_555 163.4 ? 
58 ND1 ? B HIS 122 ? B HIS 145 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD1 ? B ASP 230 ? B ASP 253 ? 1_555 102.7 ? 
59 OD2 ? B ASP 230 ? B ASP 253 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD1 ? B ASP 230 ? B ASP 253 ? 1_555 55.4  ? 
60 OD2 ? B ASP 228 ? B ASP 251 ? 1_555 MN ? K MN . ? B MN 402 ? 1_555 OD1 ? B ASP 230 ? B ASP 253 ? 1_555 88.0  ? 
61 OD1 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 O12 ? I 38I .   ? A 38I 406 ? 1_555 89.2  ? 
62 OD1 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD2 ? A ASP 230 ? A ASP 253 ? 1_555 135.2 ? 
63 O12 ? I 38I .   ? A 38I 406 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD2 ? A ASP 230 ? A ASP 253 ? 1_555 134.2 ? 
64 OD1 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 85.8  ? 
65 O12 ? I 38I .   ? A 38I 406 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 79.6  ? 
66 OD2 ? A ASP 230 ? A ASP 253 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 91.2  ? 
67 OD1 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 ND1 ? A HIS 122 ? A HIS 145 ? 1_555 97.1  ? 
68 O12 ? I 38I .   ? A 38I 406 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 ND1 ? A HIS 122 ? A HIS 145 ? 1_555 93.2  ? 
69 OD2 ? A ASP 230 ? A ASP 253 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 ND1 ? A HIS 122 ? A HIS 145 ? 1_555 91.8  ? 
70 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 ND1 ? A HIS 122 ? A HIS 145 ? 1_555 172.2 ? 
71 OD1 ? A ASP 120 ? A ASP 143 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD1 ? A ASP 230 ? A ASP 253 ? 1_555 80.4  ? 
72 O12 ? I 38I .   ? A 38I 406 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD1 ? A ASP 230 ? A ASP 253 ? 1_555 162.7 ? 
73 OD2 ? A ASP 230 ? A ASP 253 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD1 ? A ASP 230 ? A ASP 253 ? 1_555 54.8  ? 
74 OD2 ? A ASP 228 ? A ASP 251 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD1 ? A ASP 230 ? A ASP 253 ? 1_555 86.0  ? 
75 ND1 ? A HIS 122 ? A HIS 145 ? 1_555 MN ? E MN . ? A MN 402 ? 1_555 OD1 ? A ASP 230 ? A ASP 253 ? 1_555 101.6 ? 
76 OD1 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 ND1 ? C HIS 122 ? C HIS 145 ? 1_555 98.4  ? 
77 OD1 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD2 ? C ASP 230 ? C ASP 253 ? 1_555 134.9 ? 
78 ND1 ? C HIS 122 ? C HIS 145 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD2 ? C ASP 230 ? C ASP 253 ? 1_555 91.0  ? 
79 OD1 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 86.0  ? 
80 ND1 ? C HIS 122 ? C HIS 145 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 170.1 ? 
81 OD2 ? C ASP 230 ? C ASP 253 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 92.1  ? 
82 OD1 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O12 ? U 38I .   ? C 38I 406 ? 1_555 88.0  ? 
83 ND1 ? C HIS 122 ? C HIS 145 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O12 ? U 38I .   ? C 38I 406 ? 1_555 96.0  ? 
84 OD2 ? C ASP 230 ? C ASP 253 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O12 ? U 38I .   ? C 38I 406 ? 1_555 135.0 ? 
85 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O12 ? U 38I .   ? C 38I 406 ? 1_555 75.3  ? 
86 OD1 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD1 ? C ASP 230 ? C ASP 253 ? 1_555 78.8  ? 
87 ND1 ? C HIS 122 ? C HIS 145 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD1 ? C ASP 230 ? C ASP 253 ? 1_555 102.3 ? 
88 OD2 ? C ASP 230 ? C ASP 253 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD1 ? C ASP 230 ? C ASP 253 ? 1_555 56.1  ? 
89 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD1 ? C ASP 230 ? C ASP 253 ? 1_555 87.2  ? 
90 O12 ? U 38I .   ? C 38I 406 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 OD1 ? C ASP 230 ? C ASP 253 ? 1_555 158.7 ? 
91 OD1 ? C ASP 120 ? C ASP 143 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O13 ? U 38I .   ? C 38I 406 ? 1_555 143.4 ? 
92 ND1 ? C HIS 122 ? C HIS 145 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O13 ? U 38I .   ? C 38I 406 ? 1_555 101.6 ? 
93 OD2 ? C ASP 230 ? C ASP 253 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O13 ? U 38I .   ? C 38I 406 ? 1_555 75.2  ? 
94 OD2 ? C ASP 228 ? C ASP 251 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O13 ? U 38I .   ? C 38I 406 ? 1_555 70.2  ? 
95 O12 ? U 38I .   ? C 38I 406 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O13 ? U 38I .   ? C 38I 406 ? 1_555 59.8  ? 
96 OD1 ? C ASP 230 ? C ASP 253 ? 1_555 MN ? P MN . ? C MN 401 ? 1_555 O13 ? U 38I .   ? C 38I 406 ? 1_555 125.4 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2013-12-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 PHENIX      1.8_1069 ?                package 'Paul D. Adams' PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
2 PDB_EXTRACT 3.11     'April 22, 2011' package PDB             deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
3 HKL-2000    .        ?                ?       ?               ?                        'data collection' ? ?   ? 
4 HKL-2000    .        ?                ?       ?               ?                        'data reduction'  ? ?   ? 
5 HKL-2000    .        ?                ?       ?               ?                        'data scaling'    ? ?   ? 
6 AMoRE       .        ?                ?       ?               ?                        phasing           ? ?   ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              171 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             A 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              171 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             A 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              171 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             A 
_pdbx_validate_rmsd_angle.angle_value                100.54 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -10.46 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 84  ? ? 56.18   12.21  
2 1 LEU A 85  ? ? -135.43 -46.33 
3 1 ASN A 88  ? ? 37.02   43.06  
4 1 ASN B 84  ? ? 55.52   12.77  
5 1 LEU B 85  ? ? -135.66 -45.20 
6 1 ASN C 84  ? ? 57.22   11.92  
7 1 LEU C 85  ? ? -136.12 -46.42 
8 1 CYS C 134 ? A -154.68 58.90  
9 1 ASP C 143 ? ? -170.17 148.11 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 HIS C 133 ? ? -18.15 
2 1 LEU C 171 ? A 11.20  
3 1 LEU C 171 ? B 11.68  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A ASP 236 ? CA  B A ASP 213 CA  
2 1 Y 0 A ASP 236 ? CB  B A ASP 213 CB  
3 1 Y 0 A ASP 236 ? CG  B A ASP 213 CG  
4 1 Y 0 A ASP 236 ? OD1 B A ASP 213 OD1 
5 1 Y 0 A ASP 236 ? OD2 B A ASP 213 OD2 
6 1 N 0 B HOH 562 ? O   D W HOH ?   O   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'                                                                                                   MN  
3 BENZAMIDINE                                                                                                            BEN 
4 BETA-MERCAPTOETHANOL                                                                                                   BME 
5 '{(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)' 38I 
6 water                                                                                                                  HOH 
#