data_4IYM
# 
_entry.id   4IYM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4IYM         
RCSB  RCSB077373   
WWPDB D_1000077373 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB         4E4G          apoenzyme unspecified 
TargetTrack NYSGRC-011934 .         unspecified 
# 
_pdbx_database_status.entry_id                        4IYM 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-01-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Malashkevich, V.N.'                                        1  
'Bhosle, R.'                                                2  
'Toro, R.'                                                  3  
'Hillerich, B.'                                             4  
'Gizzi, A.'                                                 5  
'Garforth, S.'                                              6  
'Kar, A.'                                                   7  
'Chan, M.K.'                                                8  
'Lafluer, J.'                                               9  
'Patel, H.'                                                 10 
'Matikainen, B.'                                            11 
'Chamala, S.'                                               12 
'Lim, S.'                                                   13 
'Celikgil, A.'                                              14 
'Villegas, G.'                                              15 
'Evans, B.'                                                 16 
'Zenchek, W.'                                               17 
'Love, J.'                                                  18 
'Fiser, A.'                                                 19 
'Khafizov, K.'                                              20 
'Seidel, R.'                                                21 
'Bonanno, J.B.'                                             22 
'Almo, S.C.'                                                23 
'New York Structural Genomics Research Consortium (NYSGRC)' 24 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD, target 011934
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Malashkevich, V.N.' 1  
primary 'Bhosle, R.'         2  
primary 'Toro, R.'           3  
primary 'Hillerich, B.'      4  
primary 'Gizzi, A.'          5  
primary 'Garforth, S.'       6  
primary 'Kar, A.'            7  
primary 'Chan, M.K.'         8  
primary 'Lafluer, J.'        9  
primary 'Patel, H.'          10 
primary 'Matikainen, B.'     11 
primary 'Chamala, S.'        12 
primary 'Lim, S.'            13 
primary 'Celikgil, A.'       14 
primary 'Villegas, G.'       15 
primary 'Evans, B.'          16 
primary 'Zenchek, W.'        17 
primary 'Love, J.'           18 
primary 'Fiser, A.'          19 
primary 'Khafizov, K.'       20 
primary 'Seidel, R.'         21 
primary 'Bonanno, J.B.'      22 
primary 'Almo, S.C.'         23 
# 
_cell.length_a           159.472 
_cell.length_b           170.910 
_cell.length_c           170.466 
_cell.angle_alpha        90.000 
_cell.angle_beta         106.330 
_cell.angle_gamma        90.000 
_cell.entry_id           4IYM 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              32 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4IYM 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Methylmalonate-semialdehyde dehydrogenase' 57243.699 16   1.2.1.27 ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE           663.425   16   ?        ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                             24.305    6    ?        ? ? ? 
4 water       nat water                                       18.015    4622 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)HHHHHHSSGVDLGTENLYFQS(MSE)(MSE)YELGHFIDGKRVAGTSGRVSNIFNPATGEVQGTVALASDADLAA
AVESAKAAQPKWAATNPQRRARVF(MSE)KFVQLLNDN(MSE)NELAE(MSE)LSREHGKTIDDAKGDIVRGLEVCEFVI
GIPHLQKSEFTEGAGPGID(MSE)YSIRQPVGIGAGITPFNFPG(MSE)IP(MSE)W(MSE)FAPAIACGNAFILKPSER
DPSVPIRLAEL(MSE)IEAGLPAGILNVVNGDKGAVDAILTHPDIAAVSFVGSTPIARYVYGTAA(MSE)NGKRAQCFGG
AKNH(MSE)II(MSE)PDADLDQAANALIGAGYGSAGERC(MSE)AISVAVPVGEETANRLIDKLVP(MSE)VESLRIGP
YTDEKAD(MSE)GPVVTKEAEQRIRSLIDSGIEQGAKLVVDGRDFKLQGYENGHFIGGCLFDDVTPD(MSE)DIYKTEIF
GPVLSVVRARNYEEALSLP(MSE)KHEYGNGVAIYTRDGDAARDFASRINIG(MSE)VGVNVPIPVPLAYHSFGGWKSSS
FGDLNQHGTDSIKFWTRTKTITSRWPSGIKDGAEFSIPT(MSE)R
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMMYELGHFIDGKRVAGTSGRVSNIFNPATGEVQGTVALASDADLAAAVESAKAAQPKW
AATNPQRRARVFMKFVQLLNDNMNELAEMLSREHGKTIDDAKGDIVRGLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIR
QPVGIGAGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSVPIRLAELMIEAGLPAGILNVVNGDKGAVDAILTHPD
IAAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERCMAISVAVPVGEETANR
LIDKLVPMVESLRIGPYTDEKADMGPVVTKEAEQRIRSLIDSGIEQGAKLVVDGRDFKLQGYENGHFIGGCLFDDVTPDM
DIYKTEIFGPVLSVVRARNYEEALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPLAYHSFGGWKSSS
FGDLNQHGTDSIKFWTRTKTITSRWPSGIKDGAEFSIPTMR
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         NYSGRC-011934 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MSE n 
1 24  MSE n 
1 25  TYR n 
1 26  GLU n 
1 27  LEU n 
1 28  GLY n 
1 29  HIS n 
1 30  PHE n 
1 31  ILE n 
1 32  ASP n 
1 33  GLY n 
1 34  LYS n 
1 35  ARG n 
1 36  VAL n 
1 37  ALA n 
1 38  GLY n 
1 39  THR n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  VAL n 
1 44  SER n 
1 45  ASN n 
1 46  ILE n 
1 47  PHE n 
1 48  ASN n 
1 49  PRO n 
1 50  ALA n 
1 51  THR n 
1 52  GLY n 
1 53  GLU n 
1 54  VAL n 
1 55  GLN n 
1 56  GLY n 
1 57  THR n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  ALA n 
1 62  SER n 
1 63  ASP n 
1 64  ALA n 
1 65  ASP n 
1 66  LEU n 
1 67  ALA n 
1 68  ALA n 
1 69  ALA n 
1 70  VAL n 
1 71  GLU n 
1 72  SER n 
1 73  ALA n 
1 74  LYS n 
1 75  ALA n 
1 76  ALA n 
1 77  GLN n 
1 78  PRO n 
1 79  LYS n 
1 80  TRP n 
1 81  ALA n 
1 82  ALA n 
1 83  THR n 
1 84  ASN n 
1 85  PRO n 
1 86  GLN n 
1 87  ARG n 
1 88  ARG n 
1 89  ALA n 
1 90  ARG n 
1 91  VAL n 
1 92  PHE n 
1 93  MSE n 
1 94  LYS n 
1 95  PHE n 
1 96  VAL n 
1 97  GLN n 
1 98  LEU n 
1 99  LEU n 
1 100 ASN n 
1 101 ASP n 
1 102 ASN n 
1 103 MSE n 
1 104 ASN n 
1 105 GLU n 
1 106 LEU n 
1 107 ALA n 
1 108 GLU n 
1 109 MSE n 
1 110 LEU n 
1 111 SER n 
1 112 ARG n 
1 113 GLU n 
1 114 HIS n 
1 115 GLY n 
1 116 LYS n 
1 117 THR n 
1 118 ILE n 
1 119 ASP n 
1 120 ASP n 
1 121 ALA n 
1 122 LYS n 
1 123 GLY n 
1 124 ASP n 
1 125 ILE n 
1 126 VAL n 
1 127 ARG n 
1 128 GLY n 
1 129 LEU n 
1 130 GLU n 
1 131 VAL n 
1 132 CYS n 
1 133 GLU n 
1 134 PHE n 
1 135 VAL n 
1 136 ILE n 
1 137 GLY n 
1 138 ILE n 
1 139 PRO n 
1 140 HIS n 
1 141 LEU n 
1 142 GLN n 
1 143 LYS n 
1 144 SER n 
1 145 GLU n 
1 146 PHE n 
1 147 THR n 
1 148 GLU n 
1 149 GLY n 
1 150 ALA n 
1 151 GLY n 
1 152 PRO n 
1 153 GLY n 
1 154 ILE n 
1 155 ASP n 
1 156 MSE n 
1 157 TYR n 
1 158 SER n 
1 159 ILE n 
1 160 ARG n 
1 161 GLN n 
1 162 PRO n 
1 163 VAL n 
1 164 GLY n 
1 165 ILE n 
1 166 GLY n 
1 167 ALA n 
1 168 GLY n 
1 169 ILE n 
1 170 THR n 
1 171 PRO n 
1 172 PHE n 
1 173 ASN n 
1 174 PHE n 
1 175 PRO n 
1 176 GLY n 
1 177 MSE n 
1 178 ILE n 
1 179 PRO n 
1 180 MSE n 
1 181 TRP n 
1 182 MSE n 
1 183 PHE n 
1 184 ALA n 
1 185 PRO n 
1 186 ALA n 
1 187 ILE n 
1 188 ALA n 
1 189 CYS n 
1 190 GLY n 
1 191 ASN n 
1 192 ALA n 
1 193 PHE n 
1 194 ILE n 
1 195 LEU n 
1 196 LYS n 
1 197 PRO n 
1 198 SER n 
1 199 GLU n 
1 200 ARG n 
1 201 ASP n 
1 202 PRO n 
1 203 SER n 
1 204 VAL n 
1 205 PRO n 
1 206 ILE n 
1 207 ARG n 
1 208 LEU n 
1 209 ALA n 
1 210 GLU n 
1 211 LEU n 
1 212 MSE n 
1 213 ILE n 
1 214 GLU n 
1 215 ALA n 
1 216 GLY n 
1 217 LEU n 
1 218 PRO n 
1 219 ALA n 
1 220 GLY n 
1 221 ILE n 
1 222 LEU n 
1 223 ASN n 
1 224 VAL n 
1 225 VAL n 
1 226 ASN n 
1 227 GLY n 
1 228 ASP n 
1 229 LYS n 
1 230 GLY n 
1 231 ALA n 
1 232 VAL n 
1 233 ASP n 
1 234 ALA n 
1 235 ILE n 
1 236 LEU n 
1 237 THR n 
1 238 HIS n 
1 239 PRO n 
1 240 ASP n 
1 241 ILE n 
1 242 ALA n 
1 243 ALA n 
1 244 VAL n 
1 245 SER n 
1 246 PHE n 
1 247 VAL n 
1 248 GLY n 
1 249 SER n 
1 250 THR n 
1 251 PRO n 
1 252 ILE n 
1 253 ALA n 
1 254 ARG n 
1 255 TYR n 
1 256 VAL n 
1 257 TYR n 
1 258 GLY n 
1 259 THR n 
1 260 ALA n 
1 261 ALA n 
1 262 MSE n 
1 263 ASN n 
1 264 GLY n 
1 265 LYS n 
1 266 ARG n 
1 267 ALA n 
1 268 GLN n 
1 269 CYS n 
1 270 PHE n 
1 271 GLY n 
1 272 GLY n 
1 273 ALA n 
1 274 LYS n 
1 275 ASN n 
1 276 HIS n 
1 277 MSE n 
1 278 ILE n 
1 279 ILE n 
1 280 MSE n 
1 281 PRO n 
1 282 ASP n 
1 283 ALA n 
1 284 ASP n 
1 285 LEU n 
1 286 ASP n 
1 287 GLN n 
1 288 ALA n 
1 289 ALA n 
1 290 ASN n 
1 291 ALA n 
1 292 LEU n 
1 293 ILE n 
1 294 GLY n 
1 295 ALA n 
1 296 GLY n 
1 297 TYR n 
1 298 GLY n 
1 299 SER n 
1 300 ALA n 
1 301 GLY n 
1 302 GLU n 
1 303 ARG n 
1 304 CYS n 
1 305 MSE n 
1 306 ALA n 
1 307 ILE n 
1 308 SER n 
1 309 VAL n 
1 310 ALA n 
1 311 VAL n 
1 312 PRO n 
1 313 VAL n 
1 314 GLY n 
1 315 GLU n 
1 316 GLU n 
1 317 THR n 
1 318 ALA n 
1 319 ASN n 
1 320 ARG n 
1 321 LEU n 
1 322 ILE n 
1 323 ASP n 
1 324 LYS n 
1 325 LEU n 
1 326 VAL n 
1 327 PRO n 
1 328 MSE n 
1 329 VAL n 
1 330 GLU n 
1 331 SER n 
1 332 LEU n 
1 333 ARG n 
1 334 ILE n 
1 335 GLY n 
1 336 PRO n 
1 337 TYR n 
1 338 THR n 
1 339 ASP n 
1 340 GLU n 
1 341 LYS n 
1 342 ALA n 
1 343 ASP n 
1 344 MSE n 
1 345 GLY n 
1 346 PRO n 
1 347 VAL n 
1 348 VAL n 
1 349 THR n 
1 350 LYS n 
1 351 GLU n 
1 352 ALA n 
1 353 GLU n 
1 354 GLN n 
1 355 ARG n 
1 356 ILE n 
1 357 ARG n 
1 358 SER n 
1 359 LEU n 
1 360 ILE n 
1 361 ASP n 
1 362 SER n 
1 363 GLY n 
1 364 ILE n 
1 365 GLU n 
1 366 GLN n 
1 367 GLY n 
1 368 ALA n 
1 369 LYS n 
1 370 LEU n 
1 371 VAL n 
1 372 VAL n 
1 373 ASP n 
1 374 GLY n 
1 375 ARG n 
1 376 ASP n 
1 377 PHE n 
1 378 LYS n 
1 379 LEU n 
1 380 GLN n 
1 381 GLY n 
1 382 TYR n 
1 383 GLU n 
1 384 ASN n 
1 385 GLY n 
1 386 HIS n 
1 387 PHE n 
1 388 ILE n 
1 389 GLY n 
1 390 GLY n 
1 391 CYS n 
1 392 LEU n 
1 393 PHE n 
1 394 ASP n 
1 395 ASP n 
1 396 VAL n 
1 397 THR n 
1 398 PRO n 
1 399 ASP n 
1 400 MSE n 
1 401 ASP n 
1 402 ILE n 
1 403 TYR n 
1 404 LYS n 
1 405 THR n 
1 406 GLU n 
1 407 ILE n 
1 408 PHE n 
1 409 GLY n 
1 410 PRO n 
1 411 VAL n 
1 412 LEU n 
1 413 SER n 
1 414 VAL n 
1 415 VAL n 
1 416 ARG n 
1 417 ALA n 
1 418 ARG n 
1 419 ASN n 
1 420 TYR n 
1 421 GLU n 
1 422 GLU n 
1 423 ALA n 
1 424 LEU n 
1 425 SER n 
1 426 LEU n 
1 427 PRO n 
1 428 MSE n 
1 429 LYS n 
1 430 HIS n 
1 431 GLU n 
1 432 TYR n 
1 433 GLY n 
1 434 ASN n 
1 435 GLY n 
1 436 VAL n 
1 437 ALA n 
1 438 ILE n 
1 439 TYR n 
1 440 THR n 
1 441 ARG n 
1 442 ASP n 
1 443 GLY n 
1 444 ASP n 
1 445 ALA n 
1 446 ALA n 
1 447 ARG n 
1 448 ASP n 
1 449 PHE n 
1 450 ALA n 
1 451 SER n 
1 452 ARG n 
1 453 ILE n 
1 454 ASN n 
1 455 ILE n 
1 456 GLY n 
1 457 MSE n 
1 458 VAL n 
1 459 GLY n 
1 460 VAL n 
1 461 ASN n 
1 462 VAL n 
1 463 PRO n 
1 464 ILE n 
1 465 PRO n 
1 466 VAL n 
1 467 PRO n 
1 468 LEU n 
1 469 ALA n 
1 470 TYR n 
1 471 HIS n 
1 472 SER n 
1 473 PHE n 
1 474 GLY n 
1 475 GLY n 
1 476 TRP n 
1 477 LYS n 
1 478 SER n 
1 479 SER n 
1 480 SER n 
1 481 PHE n 
1 482 GLY n 
1 483 ASP n 
1 484 LEU n 
1 485 ASN n 
1 486 GLN n 
1 487 HIS n 
1 488 GLY n 
1 489 THR n 
1 490 ASP n 
1 491 SER n 
1 492 ILE n 
1 493 LYS n 
1 494 PHE n 
1 495 TRP n 
1 496 THR n 
1 497 ARG n 
1 498 THR n 
1 499 LYS n 
1 500 THR n 
1 501 ILE n 
1 502 THR n 
1 503 SER n 
1 504 ARG n 
1 505 TRP n 
1 506 PRO n 
1 507 SER n 
1 508 GLY n 
1 509 ILE n 
1 510 LYS n 
1 511 ASP n 
1 512 GLY n 
1 513 ALA n 
1 514 GLU n 
1 515 PHE n 
1 516 SER n 
1 517 ILE n 
1 518 PRO n 
1 519 THR n 
1 520 MSE n 
1 521 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Ensifer meliloti' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'iolA, mmsA, R00726, SMc00781' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    1021 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sinorhizobium meliloti' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     266834 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)CODON+RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'BC-PSGX3(BC)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q92RW4_RHIME 
_struct_ref.pdbx_db_accession          Q92RW4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYELGHFIDGKRVAGTSGRVSNIFNPATGEVQGTVALASDADLAAAVESAKAAQPKWAATNPQRRARVFMKFVQLLNDNM
NELAEMLSREHGKTIDDAKGDIVRGLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIRQPVGIGAGITPFNFPGMIPMWMF
APAIACGNAFILKPSERDPSVPIRLAELMIEAGLPAGILNVVNGDKGAVDAILTHPDIAAVSFVGSTPIARYVYGTAAMN
GKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERCMAISVAVPVGEETANRLIDKLVPMVESLRIGPYTDEKAD
MGPVVTKEAEQRIRSLIDSGIEQGAKLVVDGRDFKLQGYENGHFIGGCLFDDVTPDMDIYKTEIFGPVLSVVRARNYEEA
LSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPLAYHSFGGWKSSSFGDLNQHGTDSIKFWTRTKTITS
RWPSGIKDGAEFSIPTMR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4IYM A 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
2  1 4IYM B 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
3  1 4IYM C 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
4  1 4IYM D 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
5  1 4IYM E 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
6  1 4IYM F 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
7  1 4IYM G 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
8  1 4IYM H 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
9  1 4IYM I 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
10 1 4IYM J 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
11 1 4IYM K 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
12 1 4IYM L 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
13 1 4IYM M 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
14 1 4IYM N 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
15 1 4IYM O 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
16 1 4IYM P 24 ? 521 ? Q92RW4 1 ? 498 ? -1 496 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4IYM MSE A 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 1   
1  4IYM HIS A 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 2   
1  4IYM HIS A 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 3   
1  4IYM HIS A 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 4   
1  4IYM HIS A 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 5   
1  4IYM HIS A 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 6   
1  4IYM HIS A 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 7   
1  4IYM SER A 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 8   
1  4IYM SER A 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 9   
1  4IYM GLY A 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 10  
1  4IYM VAL A 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 11  
1  4IYM ASP A 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 12  
1  4IYM LEU A 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 13  
1  4IYM GLY A 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 14  
1  4IYM THR A 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 15  
1  4IYM GLU A 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  16  
1  4IYM ASN A 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  17  
1  4IYM LEU A 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  18  
1  4IYM TYR A 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  19  
1  4IYM PHE A 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  20  
1  4IYM GLN A 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  21  
1  4IYM SER A 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  22  
1  4IYM MSE A 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  23  
2  4IYM MSE B 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 24  
2  4IYM HIS B 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 25  
2  4IYM HIS B 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 26  
2  4IYM HIS B 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 27  
2  4IYM HIS B 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 28  
2  4IYM HIS B 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 29  
2  4IYM HIS B 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 30  
2  4IYM SER B 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 31  
2  4IYM SER B 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 32  
2  4IYM GLY B 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 33  
2  4IYM VAL B 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 34  
2  4IYM ASP B 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 35  
2  4IYM LEU B 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 36  
2  4IYM GLY B 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 37  
2  4IYM THR B 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 38  
2  4IYM GLU B 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  39  
2  4IYM ASN B 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  40  
2  4IYM LEU B 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  41  
2  4IYM TYR B 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  42  
2  4IYM PHE B 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  43  
2  4IYM GLN B 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  44  
2  4IYM SER B 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  45  
2  4IYM MSE B 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  46  
3  4IYM MSE C 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 47  
3  4IYM HIS C 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 48  
3  4IYM HIS C 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 49  
3  4IYM HIS C 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 50  
3  4IYM HIS C 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 51  
3  4IYM HIS C 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 52  
3  4IYM HIS C 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 53  
3  4IYM SER C 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 54  
3  4IYM SER C 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 55  
3  4IYM GLY C 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 56  
3  4IYM VAL C 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 57  
3  4IYM ASP C 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 58  
3  4IYM LEU C 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 59  
3  4IYM GLY C 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 60  
3  4IYM THR C 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 61  
3  4IYM GLU C 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  62  
3  4IYM ASN C 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  63  
3  4IYM LEU C 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  64  
3  4IYM TYR C 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  65  
3  4IYM PHE C 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  66  
3  4IYM GLN C 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  67  
3  4IYM SER C 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  68  
3  4IYM MSE C 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  69  
4  4IYM MSE D 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 70  
4  4IYM HIS D 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 71  
4  4IYM HIS D 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 72  
4  4IYM HIS D 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 73  
4  4IYM HIS D 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 74  
4  4IYM HIS D 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 75  
4  4IYM HIS D 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 76  
4  4IYM SER D 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 77  
4  4IYM SER D 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 78  
4  4IYM GLY D 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 79  
4  4IYM VAL D 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 80  
4  4IYM ASP D 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 81  
4  4IYM LEU D 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 82  
4  4IYM GLY D 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 83  
4  4IYM THR D 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 84  
4  4IYM GLU D 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  85  
4  4IYM ASN D 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  86  
4  4IYM LEU D 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  87  
4  4IYM TYR D 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  88  
4  4IYM PHE D 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  89  
4  4IYM GLN D 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  90  
4  4IYM SER D 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  91  
4  4IYM MSE D 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  92  
5  4IYM MSE E 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 93  
5  4IYM HIS E 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 94  
5  4IYM HIS E 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 95  
5  4IYM HIS E 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 96  
5  4IYM HIS E 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 97  
5  4IYM HIS E 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 98  
5  4IYM HIS E 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 99  
5  4IYM SER E 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 100 
5  4IYM SER E 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 101 
5  4IYM GLY E 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 102 
5  4IYM VAL E 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 103 
5  4IYM ASP E 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 104 
5  4IYM LEU E 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 105 
5  4IYM GLY E 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 106 
5  4IYM THR E 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 107 
5  4IYM GLU E 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  108 
5  4IYM ASN E 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  109 
5  4IYM LEU E 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  110 
5  4IYM TYR E 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  111 
5  4IYM PHE E 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  112 
5  4IYM GLN E 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  113 
5  4IYM SER E 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  114 
5  4IYM MSE E 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  115 
6  4IYM MSE F 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 116 
6  4IYM HIS F 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 117 
6  4IYM HIS F 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 118 
6  4IYM HIS F 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 119 
6  4IYM HIS F 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 120 
6  4IYM HIS F 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 121 
6  4IYM HIS F 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 122 
6  4IYM SER F 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 123 
6  4IYM SER F 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 124 
6  4IYM GLY F 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 125 
6  4IYM VAL F 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 126 
6  4IYM ASP F 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 127 
6  4IYM LEU F 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 128 
6  4IYM GLY F 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 129 
6  4IYM THR F 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 130 
6  4IYM GLU F 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  131 
6  4IYM ASN F 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  132 
6  4IYM LEU F 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  133 
6  4IYM TYR F 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  134 
6  4IYM PHE F 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  135 
6  4IYM GLN F 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  136 
6  4IYM SER F 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  137 
6  4IYM MSE F 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  138 
7  4IYM MSE G 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 139 
7  4IYM HIS G 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 140 
7  4IYM HIS G 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 141 
7  4IYM HIS G 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 142 
7  4IYM HIS G 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 143 
7  4IYM HIS G 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 144 
7  4IYM HIS G 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 145 
7  4IYM SER G 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 146 
7  4IYM SER G 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 147 
7  4IYM GLY G 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 148 
7  4IYM VAL G 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 149 
7  4IYM ASP G 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 150 
7  4IYM LEU G 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 151 
7  4IYM GLY G 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 152 
7  4IYM THR G 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 153 
7  4IYM GLU G 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  154 
7  4IYM ASN G 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  155 
7  4IYM LEU G 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  156 
7  4IYM TYR G 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  157 
7  4IYM PHE G 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  158 
7  4IYM GLN G 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  159 
7  4IYM SER G 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  160 
7  4IYM MSE G 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  161 
8  4IYM MSE H 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 162 
8  4IYM HIS H 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 163 
8  4IYM HIS H 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 164 
8  4IYM HIS H 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 165 
8  4IYM HIS H 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 166 
8  4IYM HIS H 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 167 
8  4IYM HIS H 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 168 
8  4IYM SER H 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 169 
8  4IYM SER H 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 170 
8  4IYM GLY H 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 171 
8  4IYM VAL H 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 172 
8  4IYM ASP H 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 173 
8  4IYM LEU H 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 174 
8  4IYM GLY H 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 175 
8  4IYM THR H 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 176 
8  4IYM GLU H 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  177 
8  4IYM ASN H 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  178 
8  4IYM LEU H 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  179 
8  4IYM TYR H 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  180 
8  4IYM PHE H 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  181 
8  4IYM GLN H 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  182 
8  4IYM SER H 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  183 
8  4IYM MSE H 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  184 
9  4IYM MSE I 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 185 
9  4IYM HIS I 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 186 
9  4IYM HIS I 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 187 
9  4IYM HIS I 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 188 
9  4IYM HIS I 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 189 
9  4IYM HIS I 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 190 
9  4IYM HIS I 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 191 
9  4IYM SER I 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 192 
9  4IYM SER I 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 193 
9  4IYM GLY I 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 194 
9  4IYM VAL I 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 195 
9  4IYM ASP I 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 196 
9  4IYM LEU I 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 197 
9  4IYM GLY I 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 198 
9  4IYM THR I 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 199 
9  4IYM GLU I 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  200 
9  4IYM ASN I 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  201 
9  4IYM LEU I 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  202 
9  4IYM TYR I 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  203 
9  4IYM PHE I 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  204 
9  4IYM GLN I 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  205 
9  4IYM SER I 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  206 
9  4IYM MSE I 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  207 
10 4IYM MSE J 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 208 
10 4IYM HIS J 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 209 
10 4IYM HIS J 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 210 
10 4IYM HIS J 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 211 
10 4IYM HIS J 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 212 
10 4IYM HIS J 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 213 
10 4IYM HIS J 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 214 
10 4IYM SER J 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 215 
10 4IYM SER J 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 216 
10 4IYM GLY J 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 217 
10 4IYM VAL J 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 218 
10 4IYM ASP J 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 219 
10 4IYM LEU J 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 220 
10 4IYM GLY J 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 221 
10 4IYM THR J 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 222 
10 4IYM GLU J 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  223 
10 4IYM ASN J 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  224 
10 4IYM LEU J 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  225 
10 4IYM TYR J 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  226 
10 4IYM PHE J 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  227 
10 4IYM GLN J 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  228 
10 4IYM SER J 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  229 
10 4IYM MSE J 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  230 
11 4IYM MSE K 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 231 
11 4IYM HIS K 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 232 
11 4IYM HIS K 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 233 
11 4IYM HIS K 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 234 
11 4IYM HIS K 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 235 
11 4IYM HIS K 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 236 
11 4IYM HIS K 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 237 
11 4IYM SER K 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 238 
11 4IYM SER K 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 239 
11 4IYM GLY K 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 240 
11 4IYM VAL K 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 241 
11 4IYM ASP K 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 242 
11 4IYM LEU K 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 243 
11 4IYM GLY K 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 244 
11 4IYM THR K 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 245 
11 4IYM GLU K 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  246 
11 4IYM ASN K 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  247 
11 4IYM LEU K 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  248 
11 4IYM TYR K 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  249 
11 4IYM PHE K 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  250 
11 4IYM GLN K 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  251 
11 4IYM SER K 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  252 
11 4IYM MSE K 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  253 
12 4IYM MSE L 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 254 
12 4IYM HIS L 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 255 
12 4IYM HIS L 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 256 
12 4IYM HIS L 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 257 
12 4IYM HIS L 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 258 
12 4IYM HIS L 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 259 
12 4IYM HIS L 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 260 
12 4IYM SER L 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 261 
12 4IYM SER L 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 262 
12 4IYM GLY L 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 263 
12 4IYM VAL L 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 264 
12 4IYM ASP L 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 265 
12 4IYM LEU L 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 266 
12 4IYM GLY L 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 267 
12 4IYM THR L 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 268 
12 4IYM GLU L 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  269 
12 4IYM ASN L 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  270 
12 4IYM LEU L 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  271 
12 4IYM TYR L 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  272 
12 4IYM PHE L 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  273 
12 4IYM GLN L 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  274 
12 4IYM SER L 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  275 
12 4IYM MSE L 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  276 
13 4IYM MSE M 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 277 
13 4IYM HIS M 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 278 
13 4IYM HIS M 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 279 
13 4IYM HIS M 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 280 
13 4IYM HIS M 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 281 
13 4IYM HIS M 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 282 
13 4IYM HIS M 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 283 
13 4IYM SER M 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 284 
13 4IYM SER M 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 285 
13 4IYM GLY M 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 286 
13 4IYM VAL M 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 287 
13 4IYM ASP M 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 288 
13 4IYM LEU M 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 289 
13 4IYM GLY M 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 290 
13 4IYM THR M 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 291 
13 4IYM GLU M 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  292 
13 4IYM ASN M 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  293 
13 4IYM LEU M 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  294 
13 4IYM TYR M 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  295 
13 4IYM PHE M 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  296 
13 4IYM GLN M 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  297 
13 4IYM SER M 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  298 
13 4IYM MSE M 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  299 
14 4IYM MSE N 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 300 
14 4IYM HIS N 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 301 
14 4IYM HIS N 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 302 
14 4IYM HIS N 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 303 
14 4IYM HIS N 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 304 
14 4IYM HIS N 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 305 
14 4IYM HIS N 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 306 
14 4IYM SER N 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 307 
14 4IYM SER N 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 308 
14 4IYM GLY N 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 309 
14 4IYM VAL N 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 310 
14 4IYM ASP N 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 311 
14 4IYM LEU N 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 312 
14 4IYM GLY N 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 313 
14 4IYM THR N 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 314 
14 4IYM GLU N 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  315 
14 4IYM ASN N 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  316 
14 4IYM LEU N 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  317 
14 4IYM TYR N 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  318 
14 4IYM PHE N 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  319 
14 4IYM GLN N 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  320 
14 4IYM SER N 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  321 
14 4IYM MSE N 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  322 
15 4IYM MSE O 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 323 
15 4IYM HIS O 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 324 
15 4IYM HIS O 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 325 
15 4IYM HIS O 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 326 
15 4IYM HIS O 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 327 
15 4IYM HIS O 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 328 
15 4IYM HIS O 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 329 
15 4IYM SER O 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 330 
15 4IYM SER O 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 331 
15 4IYM GLY O 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 332 
15 4IYM VAL O 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 333 
15 4IYM ASP O 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 334 
15 4IYM LEU O 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 335 
15 4IYM GLY O 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 336 
15 4IYM THR O 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 337 
15 4IYM GLU O 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  338 
15 4IYM ASN O 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  339 
15 4IYM LEU O 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  340 
15 4IYM TYR O 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  341 
15 4IYM PHE O 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  342 
15 4IYM GLN O 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  343 
15 4IYM SER O 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  344 
15 4IYM MSE O 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  345 
16 4IYM MSE P 1  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -24 346 
16 4IYM HIS P 2  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -23 347 
16 4IYM HIS P 3  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -22 348 
16 4IYM HIS P 4  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -21 349 
16 4IYM HIS P 5  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -20 350 
16 4IYM HIS P 6  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -19 351 
16 4IYM HIS P 7  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -18 352 
16 4IYM SER P 8  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -17 353 
16 4IYM SER P 9  ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -16 354 
16 4IYM GLY P 10 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -15 355 
16 4IYM VAL P 11 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -14 356 
16 4IYM ASP P 12 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -13 357 
16 4IYM LEU P 13 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -12 358 
16 4IYM GLY P 14 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -11 359 
16 4IYM THR P 15 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -10 360 
16 4IYM GLU P 16 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -9  361 
16 4IYM ASN P 17 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -8  362 
16 4IYM LEU P 18 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -7  363 
16 4IYM TYR P 19 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -6  364 
16 4IYM PHE P 20 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -5  365 
16 4IYM GLN P 21 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -4  366 
16 4IYM SER P 22 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -3  367 
16 4IYM MSE P 23 ? UNP Q92RW4 ? ? 'EXPRESSION TAG' -2  368 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MG  non-polymer         . 'MAGNESIUM ION'                   ? 'Mg 2'              24.305  
MSE 'L-peptide linking' n SELENOMETHIONINE                  ? 'C5 H11 N O2 Se'    196.106 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4IYM 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    '0.1M MgCl2, 0.1M MES, pH 6.5, 30% PEG400, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2012-10-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.entry_id                     4IYM 
_reflns.d_resolution_high            2.200 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   440045 
_reflns.pdbx_Rmerge_I_obs            0.131 
_reflns.pdbx_netI_over_sigmaI        5.600 
_reflns.pdbx_chi_squared             1.165 
_reflns.pdbx_redundancy              3.800 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.200 2.240  ? ? ? 0.640 ? ? 0.837 3.700 ? 21797 99.300  1  1 
2.240 2.280  ? ? ? 0.571 ? ? 0.851 3.700 ? 21876 99.300  2  1 
2.280 2.320  ? ? ? 0.526 ? ? 0.848 3.700 ? 21802 99.400  3  1 
2.320 2.370  ? ? ? 0.482 ? ? 0.868 3.700 ? 21917 99.500  4  1 
2.370 2.420  ? ? ? 0.429 ? ? 0.878 3.700 ? 21832 99.500  5  1 
2.420 2.480  ? ? ? 0.381 ? ? 0.886 3.700 ? 21962 99.600  6  1 
2.480 2.540  ? ? ? 0.333 ? ? 0.910 3.700 ? 21951 99.700  7  1 
2.540 2.610  ? ? ? 0.302 ? ? 0.928 3.700 ? 21890 99.800  8  1 
2.610 2.690  ? ? ? 0.264 ? ? 0.972 3.700 ? 22009 99.900  9  1 
2.690 2.770  ? ? ? 0.234 ? ? 0.978 3.700 ? 21988 99.900  10 1 
2.770 2.870  ? ? ? 0.205 ? ? 1.008 3.800 ? 22072 100.000 11 1 
2.870 2.990  ? ? ? 0.178 ? ? 1.056 3.800 ? 21981 100.000 12 1 
2.990 3.120  ? ? ? 0.144 ? ? 1.120 3.800 ? 22037 100.000 13 1 
3.120 3.290  ? ? ? 0.123 ? ? 1.186 3.800 ? 22046 100.000 14 1 
3.290 3.490  ? ? ? 0.102 ? ? 1.385 3.800 ? 22074 100.000 15 1 
3.490 3.760  ? ? ? 0.091 ? ? 1.669 3.800 ? 22057 100.000 16 1 
3.760 4.140  ? ? ? 0.081 ? ? 1.903 3.800 ? 22041 100.000 17 1 
4.140 4.740  ? ? ? 0.067 ? ? 1.844 3.800 ? 22165 100.000 18 1 
4.740 5.970  ? ? ? 0.063 ? ? 1.482 3.800 ? 22160 100.000 19 1 
5.970 50.000 ? ? ? 0.051 ? ? 1.515 3.800 ? 22388 99.900  20 1 
# 
_refine.entry_id                                 4IYM 
_refine.ls_d_res_high                            2.2000 
_refine.ls_d_res_low                             19.9900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.4800 
_refine.ls_number_reflns_obs                     439434 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES      : RESIDUAL ONLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1673 
_refine.ls_R_factor_R_work                       0.1651 
_refine.ls_wR_factor_R_work                      0.1443 
_refine.ls_R_factor_R_free                       0.2094 
_refine.ls_wR_factor_R_free                      0.1829 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  22028 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               26.892 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[2][2]                            0.0100 
_refine.aniso_B[3][3]                            -0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0100 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9660 
_refine.correlation_coeff_Fo_to_Fc_free          0.9450 
_refine.overall_SU_R_Cruickshank_DPI             0.2358 
_refine.overall_SU_R_free                        0.1847 
_refine.pdbx_overall_ESU_R                       0.2360 
_refine.pdbx_overall_ESU_R_Free                  0.1850 
_refine.overall_SU_ML                            0.1240 
_refine.overall_SU_B                             9.7000 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4E4G 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8582 
_refine.B_iso_max                                138.450 
_refine.B_iso_min                                7.530 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        58959 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         710 
_refine_hist.number_atoms_solvent             4622 
_refine_hist.number_atoms_total               64291 
_refine_hist.d_res_high                       2.2000 
_refine_hist.d_res_low                        19.9900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       61228 0.008  0.019  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    83136 1.309  1.990  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 7873  5.832  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 2579  33.714 23.943 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 8990  14.586 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 413   17.498 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         9136  0.089  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   46741 0.005  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 718 0.310 19.370 ? ? ? 
2   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 715 0.340 19.370 ? ? ? 
3   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 715 0.290 19.370 ? ? ? 
4   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 718 0.250 19.370 ? ? ? 
5   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 715 0.360 19.370 ? ? ? 
6   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 715 0.340 19.370 ? ? ? 
7   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 714 0.320 19.370 ? ? ? 
8   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 717 0.320 19.370 ? ? ? 
9   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 714 0.310 19.370 ? ? ? 
10  'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' . 717 0.260 19.370 ? ? ? 
11  'X-RAY DIFFRACTION' 1   1 'TIGHT THERMAL'    . 718 1.990 38.730 ? ? ? 
12  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 717 0.310 19.370 ? ? ? 
13  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 714 0.320 19.370 ? ? ? 
14  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 714 0.260 19.370 ? ? ? 
15  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 717 0.240 19.370 ? ? ? 
16  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 717 0.310 19.370 ? ? ? 
17  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 714 0.300 19.370 ? ? ? 
18  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 714 0.270 19.370 ? ? ? 
19  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 717 0.250 19.370 ? ? ? 
20  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 714 0.350 19.370 ? ? ? 
21  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' . 714 0.320 19.370 ? ? ? 
22  'X-RAY DIFFRACTION' 2   1 'TIGHT THERMAL'    . 715 2.420 38.730 ? ? ? 
23  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.230 19.370 ? ? ? 
24  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 716 0.300 19.370 ? ? ? 
25  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.310 19.370 ? ? ? 
26  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.220 19.370 ? ? ? 
27  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.260 19.370 ? ? ? 
28  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.280 19.370 ? ? ? 
29  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.320 19.370 ? ? ? 
30  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.280 19.370 ? ? ? 
31  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.250 19.370 ? ? ? 
32  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' . 714 0.290 19.370 ? ? ? 
33  'X-RAY DIFFRACTION' 3   1 'TIGHT THERMAL'    . 718 2.600 38.730 ? ? ? 
34  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 714 0.320 19.370 ? ? ? 
35  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 716 0.310 19.370 ? ? ? 
36  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 714 0.280 19.370 ? ? ? 
37  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 716 0.330 19.370 ? ? ? 
38  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 719 0.340 19.370 ? ? ? 
39  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 719 0.300 19.370 ? ? ? 
40  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 716 0.250 19.370 ? ? ? 
41  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 716 0.290 19.370 ? ? ? 
42  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 719 0.310 19.370 ? ? ? 
43  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' . 719 0.290 19.370 ? ? ? 
44  'X-RAY DIFFRACTION' 4   1 'TIGHT THERMAL'    . 715 2.300 38.730 ? ? ? 
45  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 716 0.270 19.370 ? ? ? 
46  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 716 0.300 19.370 ? ? ? 
47  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 719 0.320 19.370 ? ? ? 
48  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 716 0.320 19.370 ? ? ? 
49  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 716 0.280 19.370 ? ? ? 
50  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 715 0.310 19.370 ? ? ? 
51  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 715 0.330 19.370 ? ? ? 
52  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 718 0.320 19.370 ? ? ? 
53  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 718 0.260 19.370 ? ? ? 
54  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' . 715 0.290 19.370 ? ? ? 
55  'X-RAY DIFFRACTION' 5   1 'TIGHT THERMAL'    . 718 2.250 38.730 ? ? ? 
56  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 715 0.330 19.370 ? ? ? 
57  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 718 0.320 19.370 ? ? ? 
58  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 718 0.280 19.370 ? ? ? 
59  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 715 0.300 19.370 ? ? ? 
60  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 717 0.320 19.370 ? ? ? 
61  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 718 0.340 19.370 ? ? ? 
62  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 717 0.300 19.370 ? ? ? 
63  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 714 0.300 19.370 ? ? ? 
64  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 714 0.280 19.370 ? ? ? 
65  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' . 717 0.220 19.370 ? ? ? 
66  'X-RAY DIFFRACTION' 6   1 'TIGHT THERMAL'    . 718 2.440 38.730 ? ? ? 
67  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 717 0.310 19.370 ? ? ? 
68  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 714 0.300 19.370 ? ? ? 
69  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 714 0.290 19.370 ? ? ? 
70  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 717 0.240 19.370 ? ? ? 
71  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 714 0.360 19.370 ? ? ? 
72  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 714 0.330 19.370 ? ? ? 
73  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 713 0.250 19.370 ? ? ? 
74  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 713 0.260 19.370 ? ? ? 
75  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 716 0.310 19.370 ? ? ? 
76  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' . 716 0.230 19.370 ? ? ? 
77  'X-RAY DIFFRACTION' 7   1 'TIGHT THERMAL'    . 715 2.720 38.730 ? ? ? 
78  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 713 0.230 19.370 ? ? ? 
79  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 713 0.280 19.370 ? ? ? 
80  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 716 0.320 19.370 ? ? ? 
81  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 713 0.260 19.370 ? ? ? 
82  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 713 0.260 19.370 ? ? ? 
83  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 717 0.270 19.370 ? ? ? 
84  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 713 0.300 19.370 ? ? ? 
85  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 713 0.270 19.370 ? ? ? 
86  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 717 0.200 19.370 ? ? ? 
87  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' . 717 0.290 19.370 ? ? ? 
88  'X-RAY DIFFRACTION' 8   1 'TIGHT THERMAL'    . 715 2.830 38.730 ? ? ? 
89  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 713 0.310 19.370 ? ? ? 
90  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 713 0.320 19.370 ? ? ? 
91  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 717 0.230 19.370 ? ? ? 
92  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 713 0.240 19.370 ? ? ? 
93  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 713 0.240 19.370 ? ? ? 
94  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 717 0.260 19.370 ? ? ? 
95  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 717 0.150 19.370 ? ? ? 
96  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 713 0.270 19.370 ? ? ? 
97  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 713 0.300 19.370 ? ? ? 
98  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' . 717 0.270 19.370 ? ? ? 
99  'X-RAY DIFFRACTION' 9   1 'TIGHT THERMAL'    . 718 2.690 38.730 ? ? ? 
100 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 716 0.270 19.370 ? ? ? 
101 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 713 0.310 19.370 ? ? ? 
102 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 713 0.250 19.370 ? ? ? 
103 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 716 0.180 19.370 ? ? ? 
104 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 713 0.330 19.370 ? ? ? 
105 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 713 0.310 19.370 ? ? ? 
106 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 716 0.280 19.370 ? ? ? 
107 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 716 0.240 19.370 ? ? ? 
108 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 719 0.280 19.370 ? ? ? 
109 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' . 716 0.280 19.370 ? ? ? 
110 'X-RAY DIFFRACTION' 10  1 'TIGHT THERMAL'    . 718 2.690 38.730 ? ? ? 
111 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 716 0.270 19.370 ? ? ? 
112 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 720 0.290 19.370 ? ? ? 
113 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 716 0.330 19.370 ? ? ? 
114 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 716 0.330 19.370 ? ? ? 
115 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 720 0.240 19.370 ? ? ? 
116 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 714 0.270 19.370 ? ? ? 
117 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 714 0.310 19.370 ? ? ? 
118 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 718 0.290 19.370 ? ? ? 
119 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 713 0.340 19.370 ? ? ? 
120 'X-RAY DIFFRACTION' 11  1 'TIGHT POSITIONAL' . 713 0.320 19.370 ? ? ? 
121 'X-RAY DIFFRACTION' 11  1 'TIGHT THERMAL'    . 715 2.710 38.730 ? ? ? 
122 'X-RAY DIFFRACTION' 12  1 'TIGHT POSITIONAL' . 714 0.310 19.370 ? ? ? 
123 'X-RAY DIFFRACTION' 12  1 'TIGHT THERMAL'    . 715 2.570 38.730 ? ? ? 
124 'X-RAY DIFFRACTION' 13  1 'TIGHT THERMAL'    . 718 2.770 38.730 ? ? ? 
125 'X-RAY DIFFRACTION' 14  1 'TIGHT THERMAL'    . 715 2.680 38.730 ? ? ? 
126 'X-RAY DIFFRACTION' 15  1 'TIGHT THERMAL'    . 715 2.670 38.730 ? ? ? 
127 'X-RAY DIFFRACTION' 16  1 'TIGHT THERMAL'    . 714 2.040 38.730 ? ? ? 
128 'X-RAY DIFFRACTION' 17  1 'TIGHT THERMAL'    . 717 2.300 38.730 ? ? ? 
129 'X-RAY DIFFRACTION' 18  1 'TIGHT THERMAL'    . 714 2.230 38.730 ? ? ? 
130 'X-RAY DIFFRACTION' 19  1 'TIGHT THERMAL'    . 717 1.960 38.730 ? ? ? 
131 'X-RAY DIFFRACTION' 20  1 'TIGHT THERMAL'    . 717 2.130 38.730 ? ? ? 
132 'X-RAY DIFFRACTION' 21  1 'TIGHT THERMAL'    . 714 2.330 38.730 ? ? ? 
133 'X-RAY DIFFRACTION' 22  1 'TIGHT THERMAL'    . 714 2.430 38.730 ? ? ? 
134 'X-RAY DIFFRACTION' 23  1 'TIGHT THERMAL'    . 717 2.210 38.730 ? ? ? 
135 'X-RAY DIFFRACTION' 24  1 'TIGHT THERMAL'    . 717 2.510 38.730 ? ? ? 
136 'X-RAY DIFFRACTION' 25  1 'TIGHT THERMAL'    . 714 2.260 38.730 ? ? ? 
137 'X-RAY DIFFRACTION' 26  1 'TIGHT THERMAL'    . 714 2.200 38.730 ? ? ? 
138 'X-RAY DIFFRACTION' 27  1 'TIGHT THERMAL'    . 717 2.110 38.730 ? ? ? 
139 'X-RAY DIFFRACTION' 28  1 'TIGHT THERMAL'    . 714 2.530 38.730 ? ? ? 
140 'X-RAY DIFFRACTION' 29  1 'TIGHT THERMAL'    . 714 2.340 38.730 ? ? ? 
141 'X-RAY DIFFRACTION' 30  1 'TIGHT THERMAL'    . 714 2.110 38.730 ? ? ? 
142 'X-RAY DIFFRACTION' 31  1 'TIGHT THERMAL'    . 716 2.060 38.730 ? ? ? 
143 'X-RAY DIFFRACTION' 32  1 'TIGHT THERMAL'    . 714 1.850 38.730 ? ? ? 
144 'X-RAY DIFFRACTION' 33  1 'TIGHT THERMAL'    . 714 1.600 38.730 ? ? ? 
145 'X-RAY DIFFRACTION' 34  1 'TIGHT THERMAL'    . 714 2.190 38.730 ? ? ? 
146 'X-RAY DIFFRACTION' 35  1 'TIGHT THERMAL'    . 714 1.940 38.730 ? ? ? 
147 'X-RAY DIFFRACTION' 36  1 'TIGHT THERMAL'    . 714 1.900 38.730 ? ? ? 
148 'X-RAY DIFFRACTION' 37  1 'TIGHT THERMAL'    . 714 2.170 38.730 ? ? ? 
149 'X-RAY DIFFRACTION' 38  1 'TIGHT THERMAL'    . 714 2.330 38.730 ? ? ? 
150 'X-RAY DIFFRACTION' 39  1 'TIGHT THERMAL'    . 714 1.890 38.730 ? ? ? 
151 'X-RAY DIFFRACTION' 40  1 'TIGHT THERMAL'    . 714 1.930 38.730 ? ? ? 
152 'X-RAY DIFFRACTION' 41  1 'TIGHT THERMAL'    . 716 2.170 38.730 ? ? ? 
153 'X-RAY DIFFRACTION' 42  1 'TIGHT THERMAL'    . 714 2.080 38.730 ? ? ? 
154 'X-RAY DIFFRACTION' 43  1 'TIGHT THERMAL'    . 716 2.380 38.730 ? ? ? 
155 'X-RAY DIFFRACTION' 44  1 'TIGHT THERMAL'    . 719 2.090 38.730 ? ? ? 
156 'X-RAY DIFFRACTION' 45  1 'TIGHT THERMAL'    . 719 2.100 38.730 ? ? ? 
157 'X-RAY DIFFRACTION' 46  1 'TIGHT THERMAL'    . 716 2.000 38.730 ? ? ? 
158 'X-RAY DIFFRACTION' 47  1 'TIGHT THERMAL'    . 716 2.110 38.730 ? ? ? 
159 'X-RAY DIFFRACTION' 48  1 'TIGHT THERMAL'    . 719 1.970 38.730 ? ? ? 
160 'X-RAY DIFFRACTION' 49  1 'TIGHT THERMAL'    . 719 2.440 38.730 ? ? ? 
161 'X-RAY DIFFRACTION' 50  1 'TIGHT THERMAL'    . 716 2.050 38.730 ? ? ? 
162 'X-RAY DIFFRACTION' 51  1 'TIGHT THERMAL'    . 716 2.150 38.730 ? ? ? 
163 'X-RAY DIFFRACTION' 52  1 'TIGHT THERMAL'    . 719 2.230 38.730 ? ? ? 
164 'X-RAY DIFFRACTION' 53  1 'TIGHT THERMAL'    . 716 2.470 38.730 ? ? ? 
165 'X-RAY DIFFRACTION' 54  1 'TIGHT THERMAL'    . 716 2.280 38.730 ? ? ? 
166 'X-RAY DIFFRACTION' 55  1 'TIGHT THERMAL'    . 715 1.920 38.730 ? ? ? 
167 'X-RAY DIFFRACTION' 56  1 'TIGHT THERMAL'    . 715 1.940 38.730 ? ? ? 
168 'X-RAY DIFFRACTION' 57  1 'TIGHT THERMAL'    . 718 2.620 38.730 ? ? ? 
169 'X-RAY DIFFRACTION' 58  1 'TIGHT THERMAL'    . 718 1.970 38.730 ? ? ? 
170 'X-RAY DIFFRACTION' 59  1 'TIGHT THERMAL'    . 715 2.260 38.730 ? ? ? 
171 'X-RAY DIFFRACTION' 60  1 'TIGHT THERMAL'    . 715 2.120 38.730 ? ? ? 
172 'X-RAY DIFFRACTION' 61  1 'TIGHT THERMAL'    . 718 2.420 38.730 ? ? ? 
173 'X-RAY DIFFRACTION' 62  1 'TIGHT THERMAL'    . 718 2.190 38.730 ? ? ? 
174 'X-RAY DIFFRACTION' 63  1 'TIGHT THERMAL'    . 715 2.300 38.730 ? ? ? 
175 'X-RAY DIFFRACTION' 64  1 'TIGHT THERMAL'    . 717 2.310 38.730 ? ? ? 
176 'X-RAY DIFFRACTION' 65  1 'TIGHT THERMAL'    . 718 2.080 38.730 ? ? ? 
177 'X-RAY DIFFRACTION' 66  1 'TIGHT THERMAL'    . 717 1.720 38.730 ? ? ? 
178 'X-RAY DIFFRACTION' 67  1 'TIGHT THERMAL'    . 714 2.400 38.730 ? ? ? 
179 'X-RAY DIFFRACTION' 68  1 'TIGHT THERMAL'    . 714 1.750 38.730 ? ? ? 
180 'X-RAY DIFFRACTION' 69  1 'TIGHT THERMAL'    . 717 1.750 38.730 ? ? ? 
181 'X-RAY DIFFRACTION' 70  1 'TIGHT THERMAL'    . 717 2.010 38.730 ? ? ? 
182 'X-RAY DIFFRACTION' 71  1 'TIGHT THERMAL'    . 714 2.250 38.730 ? ? ? 
183 'X-RAY DIFFRACTION' 72  1 'TIGHT THERMAL'    . 714 1.980 38.730 ? ? ? 
184 'X-RAY DIFFRACTION' 73  1 'TIGHT THERMAL'    . 717 1.920 38.730 ? ? ? 
185 'X-RAY DIFFRACTION' 74  1 'TIGHT THERMAL'    . 714 2.020 38.730 ? ? ? 
186 'X-RAY DIFFRACTION' 75  1 'TIGHT THERMAL'    . 714 2.010 38.730 ? ? ? 
187 'X-RAY DIFFRACTION' 76  1 'TIGHT THERMAL'    . 713 2.310 38.730 ? ? ? 
188 'X-RAY DIFFRACTION' 77  1 'TIGHT THERMAL'    . 713 1.760 38.730 ? ? ? 
189 'X-RAY DIFFRACTION' 78  1 'TIGHT THERMAL'    . 716 1.720 38.730 ? ? ? 
190 'X-RAY DIFFRACTION' 79  1 'TIGHT THERMAL'    . 716 1.790 38.730 ? ? ? 
191 'X-RAY DIFFRACTION' 80  1 'TIGHT THERMAL'    . 713 2.310 38.730 ? ? ? 
192 'X-RAY DIFFRACTION' 81  1 'TIGHT THERMAL'    . 713 1.940 38.730 ? ? ? 
193 'X-RAY DIFFRACTION' 82  1 'TIGHT THERMAL'    . 716 1.890 38.730 ? ? ? 
194 'X-RAY DIFFRACTION' 83  1 'TIGHT THERMAL'    . 713 1.970 38.730 ? ? ? 
195 'X-RAY DIFFRACTION' 84  1 'TIGHT THERMAL'    . 713 2.000 38.730 ? ? ? 
196 'X-RAY DIFFRACTION' 85  1 'TIGHT THERMAL'    . 717 2.260 38.730 ? ? ? 
197 'X-RAY DIFFRACTION' 86  1 'TIGHT THERMAL'    . 713 2.240 38.730 ? ? ? 
198 'X-RAY DIFFRACTION' 87  1 'TIGHT THERMAL'    . 713 2.680 38.730 ? ? ? 
199 'X-RAY DIFFRACTION' 88  1 'TIGHT THERMAL'    . 717 2.030 38.730 ? ? ? 
200 'X-RAY DIFFRACTION' 89  1 'TIGHT THERMAL'    . 717 2.180 38.730 ? ? ? 
201 'X-RAY DIFFRACTION' 90  1 'TIGHT THERMAL'    . 713 2.250 38.730 ? ? ? 
202 'X-RAY DIFFRACTION' 91  1 'TIGHT THERMAL'    . 713 2.780 38.730 ? ? ? 
203 'X-RAY DIFFRACTION' 92  1 'TIGHT THERMAL'    . 717 2.370 38.730 ? ? ? 
204 'X-RAY DIFFRACTION' 93  1 'TIGHT THERMAL'    . 713 1.520 38.730 ? ? ? 
205 'X-RAY DIFFRACTION' 94  1 'TIGHT THERMAL'    . 713 1.910 38.730 ? ? ? 
206 'X-RAY DIFFRACTION' 95  1 'TIGHT THERMAL'    . 717 2.320 38.730 ? ? ? 
207 'X-RAY DIFFRACTION' 96  1 'TIGHT THERMAL'    . 717 1.770 38.730 ? ? ? 
208 'X-RAY DIFFRACTION' 97  1 'TIGHT THERMAL'    . 713 1.950 38.730 ? ? ? 
209 'X-RAY DIFFRACTION' 98  1 'TIGHT THERMAL'    . 713 2.030 38.730 ? ? ? 
210 'X-RAY DIFFRACTION' 99  1 'TIGHT THERMAL'    . 717 1.960 38.730 ? ? ? 
211 'X-RAY DIFFRACTION' 100 1 'TIGHT THERMAL'    . 716 2.180 38.730 ? ? ? 
212 'X-RAY DIFFRACTION' 101 1 'TIGHT THERMAL'    . 713 2.300 38.730 ? ? ? 
213 'X-RAY DIFFRACTION' 102 1 'TIGHT THERMAL'    . 713 1.930 38.730 ? ? ? 
214 'X-RAY DIFFRACTION' 103 1 'TIGHT THERMAL'    . 716 1.650 38.730 ? ? ? 
215 'X-RAY DIFFRACTION' 104 1 'TIGHT THERMAL'    . 713 2.040 38.730 ? ? ? 
216 'X-RAY DIFFRACTION' 105 1 'TIGHT THERMAL'    . 713 2.020 38.730 ? ? ? 
217 'X-RAY DIFFRACTION' 106 1 'TIGHT THERMAL'    . 716 2.660 38.730 ? ? ? 
218 'X-RAY DIFFRACTION' 107 1 'TIGHT THERMAL'    . 716 2.260 38.730 ? ? ? 
219 'X-RAY DIFFRACTION' 108 1 'TIGHT THERMAL'    . 719 2.370 38.730 ? ? ? 
220 'X-RAY DIFFRACTION' 109 1 'TIGHT THERMAL'    . 716 1.570 38.730 ? ? ? 
221 'X-RAY DIFFRACTION' 110 1 'TIGHT THERMAL'    . 716 2.330 38.730 ? ? ? 
222 'X-RAY DIFFRACTION' 111 1 'TIGHT THERMAL'    . 720 2.120 38.730 ? ? ? 
223 'X-RAY DIFFRACTION' 112 1 'TIGHT THERMAL'    . 716 2.180 38.730 ? ? ? 
224 'X-RAY DIFFRACTION' 113 1 'TIGHT THERMAL'    . 716 2.730 38.730 ? ? ? 
225 'X-RAY DIFFRACTION' 114 1 'TIGHT THERMAL'    . 720 2.130 38.730 ? ? ? 
226 'X-RAY DIFFRACTION' 115 1 'TIGHT THERMAL'    . 714 2.020 38.730 ? ? ? 
227 'X-RAY DIFFRACTION' 116 1 'TIGHT THERMAL'    . 714 2.320 38.730 ? ? ? 
228 'X-RAY DIFFRACTION' 117 1 'TIGHT THERMAL'    . 718 2.160 38.730 ? ? ? 
229 'X-RAY DIFFRACTION' 118 1 'TIGHT THERMAL'    . 713 2.340 38.730 ? ? ? 
230 'X-RAY DIFFRACTION' 119 1 'TIGHT THERMAL'    . 713 2.220 38.730 ? ? ? 
231 'X-RAY DIFFRACTION' 120 1 'TIGHT THERMAL'    . 714 2.410 38.730 ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.2020 
_refine_ls_shell.d_res_low                        2.2580 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               97.0500 
_refine_ls_shell.number_reflns_R_work             29655 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2230 
_refine_ls_shell.R_factor_R_free                  0.2700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             1614 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                31269 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1   1 ? 
2   1 ? 
3   1 ? 
4   1 ? 
5   1 ? 
6   1 ? 
7   1 ? 
8   1 ? 
9   1 ? 
10  1 ? 
11  1 ? 
12  1 ? 
13  1 ? 
14  1 ? 
15  1 ? 
16  1 ? 
17  1 ? 
18  1 ? 
19  1 ? 
20  1 ? 
21  1 ? 
22  1 ? 
23  1 ? 
24  1 ? 
25  1 ? 
26  1 ? 
27  1 ? 
28  1 ? 
29  1 ? 
30  1 ? 
31  1 ? 
32  1 ? 
33  1 ? 
34  1 ? 
35  1 ? 
36  1 ? 
37  1 ? 
38  1 ? 
39  1 ? 
40  1 ? 
41  1 ? 
42  1 ? 
43  1 ? 
44  1 ? 
45  1 ? 
46  1 ? 
47  1 ? 
48  1 ? 
49  1 ? 
50  1 ? 
51  1 ? 
52  1 ? 
53  1 ? 
54  1 ? 
55  1 ? 
56  1 ? 
57  1 ? 
58  1 ? 
59  1 ? 
60  1 ? 
61  1 ? 
62  1 ? 
63  1 ? 
64  1 ? 
65  1 ? 
66  1 ? 
67  1 ? 
68  1 ? 
69  1 ? 
70  1 ? 
71  1 ? 
72  1 ? 
73  1 ? 
74  1 ? 
75  1 ? 
76  1 ? 
77  1 ? 
78  1 ? 
79  1 ? 
80  1 ? 
81  1 ? 
82  1 ? 
83  1 ? 
84  1 ? 
85  1 ? 
86  1 ? 
87  1 ? 
88  1 ? 
89  1 ? 
90  1 ? 
91  1 ? 
92  1 ? 
93  1 ? 
94  1 ? 
95  1 ? 
96  1 ? 
97  1 ? 
98  1 ? 
99  1 ? 
100 1 ? 
101 1 ? 
102 1 ? 
103 1 ? 
104 1 ? 
105 1 ? 
106 1 ? 
107 1 ? 
108 1 ? 
109 1 ? 
110 1 ? 
111 1 ? 
112 1 ? 
113 1 ? 
114 1 ? 
115 1 ? 
116 1 ? 
117 1 ? 
118 1 ? 
119 1 ? 
120 1 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1   ? 
2   ? 
3   ? 
4   ? 
5   ? 
6   ? 
7   ? 
8   ? 
9   ? 
10  ? 
11  ? 
12  ? 
13  ? 
14  ? 
15  ? 
16  ? 
17  ? 
18  ? 
19  ? 
20  ? 
21  ? 
22  ? 
23  ? 
24  ? 
25  ? 
26  ? 
27  ? 
28  ? 
29  ? 
30  ? 
31  ? 
32  ? 
33  ? 
34  ? 
35  ? 
36  ? 
37  ? 
38  ? 
39  ? 
40  ? 
41  ? 
42  ? 
43  ? 
44  ? 
45  ? 
46  ? 
47  ? 
48  ? 
49  ? 
50  ? 
51  ? 
52  ? 
53  ? 
54  ? 
55  ? 
56  ? 
57  ? 
58  ? 
59  ? 
60  ? 
61  ? 
62  ? 
63  ? 
64  ? 
65  ? 
66  ? 
67  ? 
68  ? 
69  ? 
70  ? 
71  ? 
72  ? 
73  ? 
74  ? 
75  ? 
76  ? 
77  ? 
78  ? 
79  ? 
80  ? 
81  ? 
82  ? 
83  ? 
84  ? 
85  ? 
86  ? 
87  ? 
88  ? 
89  ? 
90  ? 
91  ? 
92  ? 
93  ? 
94  ? 
95  ? 
96  ? 
97  ? 
98  ? 
99  ? 
100 ? 
101 ? 
102 ? 
103 ? 
104 ? 
105 ? 
106 ? 
107 ? 
108 ? 
109 ? 
110 ? 
111 ? 
112 ? 
113 ? 
114 ? 
115 ? 
116 ? 
117 ? 
118 ? 
119 ? 
120 ? 
# 
_struct.entry_id                  4IYM 
_struct.title                     
;Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD, target 011934
;
_struct.pdbx_descriptor           'Methylmalonate-semialdehyde dehydrogenase (E.C.1.2.1.27)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4IYM 
_struct_keywords.text            
'structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 2 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 4 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 62  ? ALA A 82  ? SER A 37  ALA A 57  1 ? 21 
HELX_P HELX_P2   2   ASN A 84  ? ASN A 102 ? ASN A 59  ASN A 77  1 ? 19 
HELX_P HELX_P3   3   ASN A 102 ? GLY A 115 ? ASN A 77  GLY A 90  1 ? 14 
HELX_P HELX_P4   4   THR A 117 ? ILE A 136 ? THR A 92  ILE A 111 1 ? 20 
HELX_P HELX_P5   5   GLY A 137 ? GLN A 142 ? GLY A 112 GLN A 117 1 ? 6  
HELX_P HELX_P6   6   GLY A 176 ? CYS A 189 ? GLY A 151 CYS A 164 1 ? 14 
HELX_P HELX_P7   7   PRO A 202 ? ALA A 215 ? PRO A 177 ALA A 190 1 ? 14 
HELX_P HELX_P8   8   ASP A 228 ? HIS A 238 ? ASP A 203 HIS A 213 1 ? 11 
HELX_P HELX_P9   9   SER A 249 ? ASN A 263 ? SER A 224 ASN A 238 1 ? 15 
HELX_P HELX_P10  10  ASP A 284 ? GLY A 298 ? ASP A 259 GLY A 273 1 ? 15 
HELX_P HELX_P11  11  SER A 299 ? GLU A 302 ? SER A 274 GLU A 277 5 ? 4  
HELX_P HELX_P12  12  GLY A 314 ? SER A 331 ? GLY A 289 SER A 306 1 ? 18 
HELX_P HELX_P13  13  THR A 349 ? GLN A 366 ? THR A 324 GLN A 341 1 ? 18 
HELX_P HELX_P14  14  MSE A 400 ? THR A 405 ? MSE A 375 THR A 380 1 ? 6  
HELX_P HELX_P15  15  ASN A 419 ? HIS A 430 ? ASN A 394 HIS A 405 1 ? 12 
HELX_P HELX_P16  16  ASP A 442 ? ILE A 453 ? ASP A 417 ILE A 428 1 ? 12 
HELX_P HELX_P17  17  HIS A 487 ? TRP A 495 ? HIS A 462 TRP A 470 1 ? 9  
HELX_P HELX_P18  18  SER B 62  ? ALA B 82  ? SER B 37  ALA B 57  1 ? 21 
HELX_P HELX_P19  19  ASN B 84  ? ASN B 102 ? ASN B 59  ASN B 77  1 ? 19 
HELX_P HELX_P20  20  ASN B 102 ? GLY B 115 ? ASN B 77  GLY B 90  1 ? 14 
HELX_P HELX_P21  21  THR B 117 ? ILE B 136 ? THR B 92  ILE B 111 1 ? 20 
HELX_P HELX_P22  22  GLY B 137 ? GLN B 142 ? GLY B 112 GLN B 117 1 ? 6  
HELX_P HELX_P23  23  GLY B 176 ? CYS B 189 ? GLY B 151 CYS B 164 1 ? 14 
HELX_P HELX_P24  24  PRO B 202 ? ALA B 215 ? PRO B 177 ALA B 190 1 ? 14 
HELX_P HELX_P25  25  ASP B 228 ? HIS B 238 ? ASP B 203 HIS B 213 1 ? 11 
HELX_P HELX_P26  26  SER B 249 ? ASN B 263 ? SER B 224 ASN B 238 1 ? 15 
HELX_P HELX_P27  27  ASP B 284 ? GLY B 298 ? ASP B 259 GLY B 273 1 ? 15 
HELX_P HELX_P28  28  SER B 299 ? GLU B 302 ? SER B 274 GLU B 277 5 ? 4  
HELX_P HELX_P29  29  GLY B 314 ? SER B 331 ? GLY B 289 SER B 306 1 ? 18 
HELX_P HELX_P30  30  THR B 349 ? GLN B 366 ? THR B 324 GLN B 341 1 ? 18 
HELX_P HELX_P31  31  MSE B 400 ? THR B 405 ? MSE B 375 THR B 380 1 ? 6  
HELX_P HELX_P32  32  ASN B 419 ? HIS B 430 ? ASN B 394 HIS B 405 1 ? 12 
HELX_P HELX_P33  33  ASP B 442 ? ILE B 453 ? ASP B 417 ILE B 428 1 ? 12 
HELX_P HELX_P34  34  HIS B 487 ? TRP B 495 ? HIS B 462 TRP B 470 1 ? 9  
HELX_P HELX_P35  35  SER C 62  ? ALA C 82  ? SER C 37  ALA C 57  1 ? 21 
HELX_P HELX_P36  36  ASN C 84  ? ASN C 102 ? ASN C 59  ASN C 77  1 ? 19 
HELX_P HELX_P37  37  ASN C 102 ? GLY C 115 ? ASN C 77  GLY C 90  1 ? 14 
HELX_P HELX_P38  38  THR C 117 ? VAL C 135 ? THR C 92  VAL C 110 1 ? 19 
HELX_P HELX_P39  39  GLY C 137 ? GLN C 142 ? GLY C 112 GLN C 117 1 ? 6  
HELX_P HELX_P40  40  GLY C 176 ? CYS C 189 ? GLY C 151 CYS C 164 1 ? 14 
HELX_P HELX_P41  41  PRO C 202 ? ALA C 215 ? PRO C 177 ALA C 190 1 ? 14 
HELX_P HELX_P42  42  ASP C 228 ? HIS C 238 ? ASP C 203 HIS C 213 1 ? 11 
HELX_P HELX_P43  43  SER C 249 ? ASN C 263 ? SER C 224 ASN C 238 1 ? 15 
HELX_P HELX_P44  44  ASP C 284 ? GLY C 298 ? ASP C 259 GLY C 273 1 ? 15 
HELX_P HELX_P45  45  SER C 299 ? GLU C 302 ? SER C 274 GLU C 277 5 ? 4  
HELX_P HELX_P46  46  GLY C 314 ? SER C 331 ? GLY C 289 SER C 306 1 ? 18 
HELX_P HELX_P47  47  THR C 349 ? GLN C 366 ? THR C 324 GLN C 341 1 ? 18 
HELX_P HELX_P48  48  MSE C 400 ? THR C 405 ? MSE C 375 THR C 380 1 ? 6  
HELX_P HELX_P49  49  ASN C 419 ? HIS C 430 ? ASN C 394 HIS C 405 1 ? 12 
HELX_P HELX_P50  50  ASP C 442 ? ILE C 453 ? ASP C 417 ILE C 428 1 ? 12 
HELX_P HELX_P51  51  HIS C 487 ? TRP C 495 ? HIS C 462 TRP C 470 1 ? 9  
HELX_P HELX_P52  52  SER D 62  ? ALA D 82  ? SER D 37  ALA D 57  1 ? 21 
HELX_P HELX_P53  53  ASN D 84  ? ASN D 102 ? ASN D 59  ASN D 77  1 ? 19 
HELX_P HELX_P54  54  ASN D 102 ? GLY D 115 ? ASN D 77  GLY D 90  1 ? 14 
HELX_P HELX_P55  55  THR D 117 ? ILE D 136 ? THR D 92  ILE D 111 1 ? 20 
HELX_P HELX_P56  56  GLY D 137 ? GLN D 142 ? GLY D 112 GLN D 117 1 ? 6  
HELX_P HELX_P57  57  GLY D 176 ? CYS D 189 ? GLY D 151 CYS D 164 1 ? 14 
HELX_P HELX_P58  58  PRO D 202 ? ALA D 215 ? PRO D 177 ALA D 190 1 ? 14 
HELX_P HELX_P59  59  ASP D 228 ? HIS D 238 ? ASP D 203 HIS D 213 1 ? 11 
HELX_P HELX_P60  60  SER D 249 ? ASN D 263 ? SER D 224 ASN D 238 1 ? 15 
HELX_P HELX_P61  61  ASP D 284 ? GLY D 298 ? ASP D 259 GLY D 273 1 ? 15 
HELX_P HELX_P62  62  SER D 299 ? GLU D 302 ? SER D 274 GLU D 277 5 ? 4  
HELX_P HELX_P63  63  GLY D 314 ? SER D 331 ? GLY D 289 SER D 306 1 ? 18 
HELX_P HELX_P64  64  THR D 349 ? GLN D 366 ? THR D 324 GLN D 341 1 ? 18 
HELX_P HELX_P65  65  MSE D 400 ? THR D 405 ? MSE D 375 THR D 380 1 ? 6  
HELX_P HELX_P66  66  ASN D 419 ? HIS D 430 ? ASN D 394 HIS D 405 1 ? 12 
HELX_P HELX_P67  67  ASP D 442 ? ILE D 453 ? ASP D 417 ILE D 428 1 ? 12 
HELX_P HELX_P68  68  HIS D 487 ? TRP D 495 ? HIS D 462 TRP D 470 1 ? 9  
HELX_P HELX_P69  69  SER E 62  ? ALA E 82  ? SER E 37  ALA E 57  1 ? 21 
HELX_P HELX_P70  70  ASN E 84  ? ASN E 102 ? ASN E 59  ASN E 77  1 ? 19 
HELX_P HELX_P71  71  ASN E 102 ? GLY E 115 ? ASN E 77  GLY E 90  1 ? 14 
HELX_P HELX_P72  72  THR E 117 ? ILE E 136 ? THR E 92  ILE E 111 1 ? 20 
HELX_P HELX_P73  73  GLY E 137 ? GLN E 142 ? GLY E 112 GLN E 117 1 ? 6  
HELX_P HELX_P74  74  GLY E 176 ? CYS E 189 ? GLY E 151 CYS E 164 1 ? 14 
HELX_P HELX_P75  75  PRO E 202 ? ALA E 215 ? PRO E 177 ALA E 190 1 ? 14 
HELX_P HELX_P76  76  ASP E 228 ? HIS E 238 ? ASP E 203 HIS E 213 1 ? 11 
HELX_P HELX_P77  77  SER E 249 ? ASN E 263 ? SER E 224 ASN E 238 1 ? 15 
HELX_P HELX_P78  78  ASP E 284 ? GLY E 298 ? ASP E 259 GLY E 273 1 ? 15 
HELX_P HELX_P79  79  SER E 299 ? GLU E 302 ? SER E 274 GLU E 277 5 ? 4  
HELX_P HELX_P80  80  GLY E 314 ? SER E 331 ? GLY E 289 SER E 306 1 ? 18 
HELX_P HELX_P81  81  THR E 349 ? GLN E 366 ? THR E 324 GLN E 341 1 ? 18 
HELX_P HELX_P82  82  MSE E 400 ? THR E 405 ? MSE E 375 THR E 380 1 ? 6  
HELX_P HELX_P83  83  ASN E 419 ? HIS E 430 ? ASN E 394 HIS E 405 1 ? 12 
HELX_P HELX_P84  84  ASP E 442 ? ILE E 453 ? ASP E 417 ILE E 428 1 ? 12 
HELX_P HELX_P85  85  HIS E 487 ? TRP E 495 ? HIS E 462 TRP E 470 1 ? 9  
HELX_P HELX_P86  86  GLY E 508 ? GLY E 512 ? GLY E 483 GLY E 487 5 ? 5  
HELX_P HELX_P87  87  SER F 62  ? ALA F 82  ? SER F 37  ALA F 57  1 ? 21 
HELX_P HELX_P88  88  ASN F 84  ? ASN F 102 ? ASN F 59  ASN F 77  1 ? 19 
HELX_P HELX_P89  89  ASN F 102 ? GLY F 115 ? ASN F 77  GLY F 90  1 ? 14 
HELX_P HELX_P90  90  THR F 117 ? ILE F 136 ? THR F 92  ILE F 111 1 ? 20 
HELX_P HELX_P91  91  GLY F 137 ? GLN F 142 ? GLY F 112 GLN F 117 1 ? 6  
HELX_P HELX_P92  92  GLY F 176 ? CYS F 189 ? GLY F 151 CYS F 164 1 ? 14 
HELX_P HELX_P93  93  PRO F 202 ? ALA F 215 ? PRO F 177 ALA F 190 1 ? 14 
HELX_P HELX_P94  94  ASP F 228 ? HIS F 238 ? ASP F 203 HIS F 213 1 ? 11 
HELX_P HELX_P95  95  SER F 249 ? ASN F 263 ? SER F 224 ASN F 238 1 ? 15 
HELX_P HELX_P96  96  ASP F 284 ? GLY F 298 ? ASP F 259 GLY F 273 1 ? 15 
HELX_P HELX_P97  97  SER F 299 ? GLU F 302 ? SER F 274 GLU F 277 5 ? 4  
HELX_P HELX_P98  98  GLY F 314 ? SER F 331 ? GLY F 289 SER F 306 1 ? 18 
HELX_P HELX_P99  99  THR F 349 ? GLN F 366 ? THR F 324 GLN F 341 1 ? 18 
HELX_P HELX_P100 100 MSE F 400 ? THR F 405 ? MSE F 375 THR F 380 1 ? 6  
HELX_P HELX_P101 101 ASN F 419 ? HIS F 430 ? ASN F 394 HIS F 405 1 ? 12 
HELX_P HELX_P102 102 ASP F 442 ? ILE F 453 ? ASP F 417 ILE F 428 1 ? 12 
HELX_P HELX_P103 103 HIS F 487 ? TRP F 495 ? HIS F 462 TRP F 470 1 ? 9  
HELX_P HELX_P104 104 SER G 62  ? ALA G 82  ? SER G 37  ALA G 57  1 ? 21 
HELX_P HELX_P105 105 ASN G 84  ? ASN G 102 ? ASN G 59  ASN G 77  1 ? 19 
HELX_P HELX_P106 106 ASN G 102 ? GLY G 115 ? ASN G 77  GLY G 90  1 ? 14 
HELX_P HELX_P107 107 THR G 117 ? ILE G 136 ? THR G 92  ILE G 111 1 ? 20 
HELX_P HELX_P108 108 GLY G 137 ? GLN G 142 ? GLY G 112 GLN G 117 1 ? 6  
HELX_P HELX_P109 109 GLY G 176 ? CYS G 189 ? GLY G 151 CYS G 164 1 ? 14 
HELX_P HELX_P110 110 PRO G 202 ? ALA G 215 ? PRO G 177 ALA G 190 1 ? 14 
HELX_P HELX_P111 111 ASP G 228 ? HIS G 238 ? ASP G 203 HIS G 213 1 ? 11 
HELX_P HELX_P112 112 SER G 249 ? ASN G 263 ? SER G 224 ASN G 238 1 ? 15 
HELX_P HELX_P113 113 ASP G 284 ? GLY G 298 ? ASP G 259 GLY G 273 1 ? 15 
HELX_P HELX_P114 114 SER G 299 ? GLU G 302 ? SER G 274 GLU G 277 5 ? 4  
HELX_P HELX_P115 115 GLY G 314 ? SER G 331 ? GLY G 289 SER G 306 1 ? 18 
HELX_P HELX_P116 116 THR G 349 ? GLN G 366 ? THR G 324 GLN G 341 1 ? 18 
HELX_P HELX_P117 117 MSE G 400 ? THR G 405 ? MSE G 375 THR G 380 1 ? 6  
HELX_P HELX_P118 118 ASN G 419 ? HIS G 430 ? ASN G 394 HIS G 405 1 ? 12 
HELX_P HELX_P119 119 ASP G 442 ? ILE G 453 ? ASP G 417 ILE G 428 1 ? 12 
HELX_P HELX_P120 120 HIS G 487 ? TRP G 495 ? HIS G 462 TRP G 470 1 ? 9  
HELX_P HELX_P121 121 SER H 62  ? THR H 83  ? SER H 37  THR H 58  1 ? 22 
HELX_P HELX_P122 122 ASN H 84  ? ASN H 102 ? ASN H 59  ASN H 77  1 ? 19 
HELX_P HELX_P123 123 ASN H 102 ? GLY H 115 ? ASN H 77  GLY H 90  1 ? 14 
HELX_P HELX_P124 124 THR H 117 ? ILE H 136 ? THR H 92  ILE H 111 1 ? 20 
HELX_P HELX_P125 125 GLY H 137 ? GLN H 142 ? GLY H 112 GLN H 117 1 ? 6  
HELX_P HELX_P126 126 GLY H 176 ? CYS H 189 ? GLY H 151 CYS H 164 1 ? 14 
HELX_P HELX_P127 127 PRO H 202 ? ALA H 215 ? PRO H 177 ALA H 190 1 ? 14 
HELX_P HELX_P128 128 ASP H 228 ? HIS H 238 ? ASP H 203 HIS H 213 1 ? 11 
HELX_P HELX_P129 129 SER H 249 ? ASN H 263 ? SER H 224 ASN H 238 1 ? 15 
HELX_P HELX_P130 130 ASP H 284 ? GLY H 298 ? ASP H 259 GLY H 273 1 ? 15 
HELX_P HELX_P131 131 SER H 299 ? GLU H 302 ? SER H 274 GLU H 277 5 ? 4  
HELX_P HELX_P132 132 GLY H 314 ? SER H 331 ? GLY H 289 SER H 306 1 ? 18 
HELX_P HELX_P133 133 THR H 349 ? GLN H 366 ? THR H 324 GLN H 341 1 ? 18 
HELX_P HELX_P134 134 MSE H 400 ? THR H 405 ? MSE H 375 THR H 380 1 ? 6  
HELX_P HELX_P135 135 ASN H 419 ? HIS H 430 ? ASN H 394 HIS H 405 1 ? 12 
HELX_P HELX_P136 136 ASP H 442 ? ILE H 453 ? ASP H 417 ILE H 428 1 ? 12 
HELX_P HELX_P137 137 HIS H 487 ? TRP H 495 ? HIS H 462 TRP H 470 1 ? 9  
HELX_P HELX_P138 138 GLY H 508 ? GLY H 512 ? GLY H 483 GLY H 487 5 ? 5  
HELX_P HELX_P139 139 SER I 62  ? ALA I 82  ? SER I 37  ALA I 57  1 ? 21 
HELX_P HELX_P140 140 ASN I 84  ? ASN I 102 ? ASN I 59  ASN I 77  1 ? 19 
HELX_P HELX_P141 141 ASN I 102 ? GLY I 115 ? ASN I 77  GLY I 90  1 ? 14 
HELX_P HELX_P142 142 THR I 117 ? ILE I 136 ? THR I 92  ILE I 111 1 ? 20 
HELX_P HELX_P143 143 GLY I 137 ? GLN I 142 ? GLY I 112 GLN I 117 1 ? 6  
HELX_P HELX_P144 144 GLY I 176 ? CYS I 189 ? GLY I 151 CYS I 164 1 ? 14 
HELX_P HELX_P145 145 PRO I 202 ? ALA I 215 ? PRO I 177 ALA I 190 1 ? 14 
HELX_P HELX_P146 146 ASP I 228 ? HIS I 238 ? ASP I 203 HIS I 213 1 ? 11 
HELX_P HELX_P147 147 SER I 249 ? ASN I 263 ? SER I 224 ASN I 238 1 ? 15 
HELX_P HELX_P148 148 ASP I 284 ? GLY I 298 ? ASP I 259 GLY I 273 1 ? 15 
HELX_P HELX_P149 149 SER I 299 ? GLU I 302 ? SER I 274 GLU I 277 5 ? 4  
HELX_P HELX_P150 150 GLY I 314 ? SER I 331 ? GLY I 289 SER I 306 1 ? 18 
HELX_P HELX_P151 151 THR I 349 ? GLN I 366 ? THR I 324 GLN I 341 1 ? 18 
HELX_P HELX_P152 152 MSE I 400 ? THR I 405 ? MSE I 375 THR I 380 1 ? 6  
HELX_P HELX_P153 153 ASN I 419 ? HIS I 430 ? ASN I 394 HIS I 405 1 ? 12 
HELX_P HELX_P154 154 ASP I 442 ? ILE I 453 ? ASP I 417 ILE I 428 1 ? 12 
HELX_P HELX_P155 155 HIS I 487 ? TRP I 495 ? HIS I 462 TRP I 470 1 ? 9  
HELX_P HELX_P156 156 GLY I 508 ? GLY I 512 ? GLY I 483 GLY I 487 5 ? 5  
HELX_P HELX_P157 157 SER J 62  ? ALA J 82  ? SER J 37  ALA J 57  1 ? 21 
HELX_P HELX_P158 158 ASN J 84  ? ASN J 102 ? ASN J 59  ASN J 77  1 ? 19 
HELX_P HELX_P159 159 ASN J 102 ? GLY J 115 ? ASN J 77  GLY J 90  1 ? 14 
HELX_P HELX_P160 160 THR J 117 ? ILE J 136 ? THR J 92  ILE J 111 1 ? 20 
HELX_P HELX_P161 161 GLY J 137 ? GLN J 142 ? GLY J 112 GLN J 117 1 ? 6  
HELX_P HELX_P162 162 GLY J 176 ? CYS J 189 ? GLY J 151 CYS J 164 1 ? 14 
HELX_P HELX_P163 163 PRO J 202 ? GLY J 216 ? PRO J 177 GLY J 191 1 ? 15 
HELX_P HELX_P164 164 ASP J 228 ? HIS J 238 ? ASP J 203 HIS J 213 1 ? 11 
HELX_P HELX_P165 165 SER J 249 ? ASN J 263 ? SER J 224 ASN J 238 1 ? 15 
HELX_P HELX_P166 166 ASP J 284 ? GLY J 298 ? ASP J 259 GLY J 273 1 ? 15 
HELX_P HELX_P167 167 SER J 299 ? GLU J 302 ? SER J 274 GLU J 277 5 ? 4  
HELX_P HELX_P168 168 GLY J 314 ? SER J 331 ? GLY J 289 SER J 306 1 ? 18 
HELX_P HELX_P169 169 THR J 349 ? GLN J 366 ? THR J 324 GLN J 341 1 ? 18 
HELX_P HELX_P170 170 MSE J 400 ? THR J 405 ? MSE J 375 THR J 380 1 ? 6  
HELX_P HELX_P171 171 ASN J 419 ? HIS J 430 ? ASN J 394 HIS J 405 1 ? 12 
HELX_P HELX_P172 172 ASP J 442 ? ILE J 453 ? ASP J 417 ILE J 428 1 ? 12 
HELX_P HELX_P173 173 HIS J 487 ? TRP J 495 ? HIS J 462 TRP J 470 1 ? 9  
HELX_P HELX_P174 174 SER K 62  ? ALA K 82  ? SER K 37  ALA K 57  1 ? 21 
HELX_P HELX_P175 175 ASN K 84  ? ASN K 102 ? ASN K 59  ASN K 77  1 ? 19 
HELX_P HELX_P176 176 ASN K 102 ? GLY K 115 ? ASN K 77  GLY K 90  1 ? 14 
HELX_P HELX_P177 177 THR K 117 ? ILE K 136 ? THR K 92  ILE K 111 1 ? 20 
HELX_P HELX_P178 178 GLY K 137 ? GLN K 142 ? GLY K 112 GLN K 117 1 ? 6  
HELX_P HELX_P179 179 GLY K 176 ? CYS K 189 ? GLY K 151 CYS K 164 1 ? 14 
HELX_P HELX_P180 180 PRO K 202 ? ALA K 215 ? PRO K 177 ALA K 190 1 ? 14 
HELX_P HELX_P181 181 ASP K 228 ? HIS K 238 ? ASP K 203 HIS K 213 1 ? 11 
HELX_P HELX_P182 182 SER K 249 ? ASN K 263 ? SER K 224 ASN K 238 1 ? 15 
HELX_P HELX_P183 183 ASP K 284 ? GLY K 298 ? ASP K 259 GLY K 273 1 ? 15 
HELX_P HELX_P184 184 SER K 299 ? GLU K 302 ? SER K 274 GLU K 277 5 ? 4  
HELX_P HELX_P185 185 GLY K 314 ? SER K 331 ? GLY K 289 SER K 306 1 ? 18 
HELX_P HELX_P186 186 THR K 349 ? GLN K 366 ? THR K 324 GLN K 341 1 ? 18 
HELX_P HELX_P187 187 MSE K 400 ? THR K 405 ? MSE K 375 THR K 380 1 ? 6  
HELX_P HELX_P188 188 ASN K 419 ? HIS K 430 ? ASN K 394 HIS K 405 1 ? 12 
HELX_P HELX_P189 189 ASP K 442 ? ILE K 453 ? ASP K 417 ILE K 428 1 ? 12 
HELX_P HELX_P190 190 HIS K 487 ? TRP K 495 ? HIS K 462 TRP K 470 1 ? 9  
HELX_P HELX_P191 191 SER L 62  ? ALA L 82  ? SER L 37  ALA L 57  1 ? 21 
HELX_P HELX_P192 192 ASN L 84  ? ASN L 102 ? ASN L 59  ASN L 77  1 ? 19 
HELX_P HELX_P193 193 ASN L 102 ? GLY L 115 ? ASN L 77  GLY L 90  1 ? 14 
HELX_P HELX_P194 194 THR L 117 ? ILE L 136 ? THR L 92  ILE L 111 1 ? 20 
HELX_P HELX_P195 195 GLY L 137 ? GLN L 142 ? GLY L 112 GLN L 117 1 ? 6  
HELX_P HELX_P196 196 GLY L 176 ? CYS L 189 ? GLY L 151 CYS L 164 1 ? 14 
HELX_P HELX_P197 197 PRO L 202 ? ALA L 215 ? PRO L 177 ALA L 190 1 ? 14 
HELX_P HELX_P198 198 ASP L 228 ? HIS L 238 ? ASP L 203 HIS L 213 1 ? 11 
HELX_P HELX_P199 199 SER L 249 ? ASN L 263 ? SER L 224 ASN L 238 1 ? 15 
HELX_P HELX_P200 200 ASP L 284 ? GLY L 298 ? ASP L 259 GLY L 273 1 ? 15 
HELX_P HELX_P201 201 SER L 299 ? GLU L 302 ? SER L 274 GLU L 277 5 ? 4  
HELX_P HELX_P202 202 GLY L 314 ? LEU L 332 ? GLY L 289 LEU L 307 1 ? 19 
HELX_P HELX_P203 203 THR L 349 ? GLY L 367 ? THR L 324 GLY L 342 1 ? 19 
HELX_P HELX_P204 204 MSE L 400 ? THR L 405 ? MSE L 375 THR L 380 1 ? 6  
HELX_P HELX_P205 205 ASN L 419 ? HIS L 430 ? ASN L 394 HIS L 405 1 ? 12 
HELX_P HELX_P206 206 ASP L 442 ? ILE L 453 ? ASP L 417 ILE L 428 1 ? 12 
HELX_P HELX_P207 207 HIS L 487 ? TRP L 495 ? HIS L 462 TRP L 470 1 ? 9  
HELX_P HELX_P208 208 GLY L 508 ? GLY L 512 ? GLY L 483 GLY L 487 5 ? 5  
HELX_P HELX_P209 209 SER M 62  ? ALA M 82  ? SER M 37  ALA M 57  1 ? 21 
HELX_P HELX_P210 210 ASN M 84  ? ASN M 102 ? ASN M 59  ASN M 77  1 ? 19 
HELX_P HELX_P211 211 ASN M 102 ? GLY M 115 ? ASN M 77  GLY M 90  1 ? 14 
HELX_P HELX_P212 212 THR M 117 ? VAL M 135 ? THR M 92  VAL M 110 1 ? 19 
HELX_P HELX_P213 213 GLY M 137 ? GLN M 142 ? GLY M 112 GLN M 117 1 ? 6  
HELX_P HELX_P214 214 GLY M 176 ? CYS M 189 ? GLY M 151 CYS M 164 1 ? 14 
HELX_P HELX_P215 215 PRO M 202 ? ALA M 215 ? PRO M 177 ALA M 190 1 ? 14 
HELX_P HELX_P216 216 ASP M 228 ? THR M 237 ? ASP M 203 THR M 212 1 ? 10 
HELX_P HELX_P217 217 SER M 249 ? ASN M 263 ? SER M 224 ASN M 238 1 ? 15 
HELX_P HELX_P218 218 ASP M 284 ? GLY M 298 ? ASP M 259 GLY M 273 1 ? 15 
HELX_P HELX_P219 219 SER M 299 ? GLU M 302 ? SER M 274 GLU M 277 5 ? 4  
HELX_P HELX_P220 220 GLY M 314 ? SER M 331 ? GLY M 289 SER M 306 1 ? 18 
HELX_P HELX_P221 221 THR M 349 ? GLN M 366 ? THR M 324 GLN M 341 1 ? 18 
HELX_P HELX_P222 222 MSE M 400 ? THR M 405 ? MSE M 375 THR M 380 1 ? 6  
HELX_P HELX_P223 223 ASN M 419 ? HIS M 430 ? ASN M 394 HIS M 405 1 ? 12 
HELX_P HELX_P224 224 ASP M 442 ? ILE M 453 ? ASP M 417 ILE M 428 1 ? 12 
HELX_P HELX_P225 225 HIS M 487 ? TRP M 495 ? HIS M 462 TRP M 470 1 ? 9  
HELX_P HELX_P226 226 GLY M 508 ? GLY M 512 ? GLY M 483 GLY M 487 5 ? 5  
HELX_P HELX_P227 227 SER N 62  ? ALA N 82  ? SER N 37  ALA N 57  1 ? 21 
HELX_P HELX_P228 228 ASN N 84  ? ASN N 102 ? ASN N 59  ASN N 77  1 ? 19 
HELX_P HELX_P229 229 ASN N 102 ? GLY N 115 ? ASN N 77  GLY N 90  1 ? 14 
HELX_P HELX_P230 230 THR N 117 ? VAL N 135 ? THR N 92  VAL N 110 1 ? 19 
HELX_P HELX_P231 231 GLY N 137 ? GLN N 142 ? GLY N 112 GLN N 117 1 ? 6  
HELX_P HELX_P232 232 GLY N 176 ? CYS N 189 ? GLY N 151 CYS N 164 1 ? 14 
HELX_P HELX_P233 233 PRO N 202 ? GLY N 216 ? PRO N 177 GLY N 191 1 ? 15 
HELX_P HELX_P234 234 ASP N 228 ? HIS N 238 ? ASP N 203 HIS N 213 1 ? 11 
HELX_P HELX_P235 235 SER N 249 ? ASN N 263 ? SER N 224 ASN N 238 1 ? 15 
HELX_P HELX_P236 236 ASP N 284 ? GLY N 298 ? ASP N 259 GLY N 273 1 ? 15 
HELX_P HELX_P237 237 SER N 299 ? GLU N 302 ? SER N 274 GLU N 277 5 ? 4  
HELX_P HELX_P238 238 GLY N 314 ? SER N 331 ? GLY N 289 SER N 306 1 ? 18 
HELX_P HELX_P239 239 THR N 349 ? GLN N 366 ? THR N 324 GLN N 341 1 ? 18 
HELX_P HELX_P240 240 MSE N 400 ? THR N 405 ? MSE N 375 THR N 380 1 ? 6  
HELX_P HELX_P241 241 ASN N 419 ? HIS N 430 ? ASN N 394 HIS N 405 1 ? 12 
HELX_P HELX_P242 242 ASP N 442 ? ILE N 453 ? ASP N 417 ILE N 428 1 ? 12 
HELX_P HELX_P243 243 HIS N 487 ? TRP N 495 ? HIS N 462 TRP N 470 1 ? 9  
HELX_P HELX_P244 244 SER O 62  ? ALA O 82  ? SER O 37  ALA O 57  1 ? 21 
HELX_P HELX_P245 245 ASN O 84  ? ASN O 102 ? ASN O 59  ASN O 77  1 ? 19 
HELX_P HELX_P246 246 ASN O 102 ? GLY O 115 ? ASN O 77  GLY O 90  1 ? 14 
HELX_P HELX_P247 247 THR O 117 ? ILE O 136 ? THR O 92  ILE O 111 1 ? 20 
HELX_P HELX_P248 248 GLY O 137 ? GLN O 142 ? GLY O 112 GLN O 117 1 ? 6  
HELX_P HELX_P249 249 GLY O 176 ? CYS O 189 ? GLY O 151 CYS O 164 1 ? 14 
HELX_P HELX_P250 250 PRO O 202 ? GLY O 216 ? PRO O 177 GLY O 191 1 ? 15 
HELX_P HELX_P251 251 ASP O 228 ? HIS O 238 ? ASP O 203 HIS O 213 1 ? 11 
HELX_P HELX_P252 252 SER O 249 ? ASN O 263 ? SER O 224 ASN O 238 1 ? 15 
HELX_P HELX_P253 253 ASP O 284 ? GLY O 298 ? ASP O 259 GLY O 273 1 ? 15 
HELX_P HELX_P254 254 SER O 299 ? GLU O 302 ? SER O 274 GLU O 277 5 ? 4  
HELX_P HELX_P255 255 GLY O 314 ? SER O 331 ? GLY O 289 SER O 306 1 ? 18 
HELX_P HELX_P256 256 THR O 349 ? GLN O 366 ? THR O 324 GLN O 341 1 ? 18 
HELX_P HELX_P257 257 MSE O 400 ? THR O 405 ? MSE O 375 THR O 380 1 ? 6  
HELX_P HELX_P258 258 ASN O 419 ? HIS O 430 ? ASN O 394 HIS O 405 1 ? 12 
HELX_P HELX_P259 259 ASP O 442 ? ILE O 453 ? ASP O 417 ILE O 428 1 ? 12 
HELX_P HELX_P260 260 HIS O 487 ? TRP O 495 ? HIS O 462 TRP O 470 1 ? 9  
HELX_P HELX_P261 261 SER P 62  ? ALA P 82  ? SER P 37  ALA P 57  1 ? 21 
HELX_P HELX_P262 262 ASN P 84  ? ASN P 102 ? ASN P 59  ASN P 77  1 ? 19 
HELX_P HELX_P263 263 ASN P 102 ? GLY P 115 ? ASN P 77  GLY P 90  1 ? 14 
HELX_P HELX_P264 264 THR P 117 ? VAL P 135 ? THR P 92  VAL P 110 1 ? 19 
HELX_P HELX_P265 265 GLY P 137 ? GLN P 142 ? GLY P 112 GLN P 117 1 ? 6  
HELX_P HELX_P266 266 GLY P 176 ? CYS P 189 ? GLY P 151 CYS P 164 1 ? 14 
HELX_P HELX_P267 267 PRO P 202 ? ALA P 215 ? PRO P 177 ALA P 190 1 ? 14 
HELX_P HELX_P268 268 ASP P 228 ? HIS P 238 ? ASP P 203 HIS P 213 1 ? 11 
HELX_P HELX_P269 269 SER P 249 ? ASN P 263 ? SER P 224 ASN P 238 1 ? 15 
HELX_P HELX_P270 270 ASP P 284 ? GLY P 298 ? ASP P 259 GLY P 273 1 ? 15 
HELX_P HELX_P271 271 SER P 299 ? GLU P 302 ? SER P 274 GLU P 277 5 ? 4  
HELX_P HELX_P272 272 GLY P 314 ? SER P 331 ? GLY P 289 SER P 306 1 ? 18 
HELX_P HELX_P273 273 THR P 349 ? GLN P 366 ? THR P 324 GLN P 341 1 ? 18 
HELX_P HELX_P274 274 MSE P 400 ? THR P 405 ? MSE P 375 THR P 380 1 ? 6  
HELX_P HELX_P275 275 ASN P 419 ? HIS P 430 ? ASN P 394 HIS P 405 1 ? 12 
HELX_P HELX_P276 276 ASP P 442 ? ILE P 453 ? ASP P 417 ILE P 428 1 ? 12 
HELX_P HELX_P277 277 HIS P 487 ? TRP P 495 ? HIS P 462 TRP P 470 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? A  MSE 24  C  ? ? ? 1_555 A  TYR 25  N ? ? A MSE -1  A TYR 0   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2   covale ? ? A  PHE 92  C  ? ? ? 1_555 A  MSE 93  N ? ? A PHE 67  A MSE 68  1_555 ? ? ? ? ? ? ? 1.340 ? 
covale3   covale ? ? A  MSE 93  C  ? ? ? 1_555 A  LYS 94  N ? ? A MSE 68  A LYS 69  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale4   covale ? ? A  ASN 102 C  ? ? ? 1_555 A  MSE 103 N ? ? A ASN 77  A MSE 78  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale5   covale ? ? A  MSE 103 C  ? ? ? 1_555 A  ASN 104 N ? ? A MSE 78  A ASN 79  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale6   covale ? ? A  GLU 108 C  ? ? ? 1_555 A  MSE 109 N ? ? A GLU 83  A MSE 84  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale7   covale ? ? A  MSE 109 C  ? ? ? 1_555 A  LEU 110 N ? ? A MSE 84  A LEU 85  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8   covale ? ? A  ASP 155 C  ? ? ? 1_555 A  MSE 156 N ? ? A ASP 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale9   covale ? ? A  MSE 156 C  ? ? ? 1_555 A  TYR 157 N ? ? A MSE 131 A TYR 132 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale10  covale ? ? A  GLY 176 C  ? ? ? 1_555 A  MSE 177 N ? ? A GLY 151 A MSE 152 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale11  covale ? ? A  MSE 177 C  ? ? ? 1_555 A  ILE 178 N ? ? A MSE 152 A ILE 153 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale12  covale ? ? A  PRO 179 C  ? ? ? 1_555 A  MSE 180 N ? ? A PRO 154 A MSE 155 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale13  covale ? ? A  MSE 180 C  ? ? ? 1_555 A  TRP 181 N ? ? A MSE 155 A TRP 156 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale14  covale ? ? A  TRP 181 C  ? ? ? 1_555 A  MSE 182 N ? ? A TRP 156 A MSE 157 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale15  covale ? ? A  MSE 182 C  ? ? ? 1_555 A  PHE 183 N ? ? A MSE 157 A PHE 158 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale16  covale ? ? A  LEU 211 C  ? ? ? 1_555 A  MSE 212 N ? ? A LEU 186 A MSE 187 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale17  covale ? ? A  MSE 212 C  ? ? ? 1_555 A  ILE 213 N ? ? A MSE 187 A ILE 188 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale18  covale ? ? A  ALA 261 C  ? ? ? 1_555 A  MSE 262 N ? ? A ALA 236 A MSE 237 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale19  covale ? ? A  MSE 262 C  ? ? ? 1_555 A  ASN 263 N ? ? A MSE 237 A ASN 238 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale20  covale ? ? A  HIS 276 C  ? ? ? 1_555 A  MSE 277 N ? ? A HIS 251 A MSE 252 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale21  covale ? ? A  MSE 277 C  ? ? ? 1_555 A  ILE 278 N ? ? A MSE 252 A ILE 253 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale22  covale ? ? A  ILE 279 C  ? ? ? 1_555 A  MSE 280 N ? ? A ILE 254 A MSE 255 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale23  covale ? ? A  MSE 280 C  ? ? ? 1_555 A  PRO 281 N ? ? A MSE 255 A PRO 256 1_555 ? ? ? ? ? ? ? 1.350 ? 
covale24  covale ? ? A  CYS 304 C  ? ? ? 1_555 A  MSE 305 N ? ? A CYS 279 A MSE 280 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale25  covale ? ? A  MSE 305 C  ? ? ? 1_555 A  ALA 306 N ? ? A MSE 280 A ALA 281 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale26  covale ? ? A  PRO 327 C  ? ? ? 1_555 A  MSE 328 N ? ? A PRO 302 A MSE 303 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale27  covale ? ? A  MSE 328 C  ? ? ? 1_555 A  VAL 329 N ? ? A MSE 303 A VAL 304 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale28  covale ? ? A  ASP 343 C  ? ? ? 1_555 A  MSE 344 N ? ? A ASP 318 A MSE 319 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale29  covale ? ? A  MSE 344 C  ? ? ? 1_555 A  GLY 345 N ? ? A MSE 319 A GLY 320 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale30  covale ? ? A  ASP 399 C  ? ? ? 1_555 A  MSE 400 N ? ? A ASP 374 A MSE 375 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale31  covale ? ? A  MSE 400 C  ? ? ? 1_555 A  ASP 401 N ? ? A MSE 375 A ASP 376 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale32  covale ? ? A  PRO 427 C  ? ? ? 1_555 A  MSE 428 N ? ? A PRO 402 A MSE 403 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale33  covale ? ? A  MSE 428 C  ? ? ? 1_555 A  LYS 429 N ? ? A MSE 403 A LYS 404 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale34  covale ? ? A  GLY 456 C  ? ? ? 1_555 A  MSE 457 N ? ? A GLY 431 A MSE 432 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale35  covale ? ? A  MSE 457 C  ? ? ? 1_555 A  VAL 458 N ? ? A MSE 432 A VAL 433 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale36  covale ? ? B  MSE 24  C  ? ? ? 1_555 B  TYR 25  N ? ? B MSE -1  B TYR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale37  covale ? ? B  PHE 92  C  ? ? ? 1_555 B  MSE 93  N ? ? B PHE 67  B MSE 68  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale38  covale ? ? B  MSE 93  C  ? ? ? 1_555 B  LYS 94  N ? ? B MSE 68  B LYS 69  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale39  covale ? ? B  ASN 102 C  ? ? ? 1_555 B  MSE 103 N ? ? B ASN 77  B MSE 78  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale40  covale ? ? B  MSE 103 C  ? ? ? 1_555 B  ASN 104 N ? ? B MSE 78  B ASN 79  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale41  covale ? ? B  GLU 108 C  ? ? ? 1_555 B  MSE 109 N ? ? B GLU 83  B MSE 84  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale42  covale ? ? B  MSE 109 C  ? ? ? 1_555 B  LEU 110 N ? ? B MSE 84  B LEU 85  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale43  covale ? ? B  ASP 155 C  ? ? ? 1_555 B  MSE 156 N ? ? B ASP 130 B MSE 131 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale44  covale ? ? B  MSE 156 C  ? ? ? 1_555 B  TYR 157 N ? ? B MSE 131 B TYR 132 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale45  covale ? ? B  GLY 176 C  ? ? ? 1_555 B  MSE 177 N ? ? B GLY 151 B MSE 152 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale46  covale ? ? B  MSE 177 C  ? ? ? 1_555 B  ILE 178 N ? ? B MSE 152 B ILE 153 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale47  covale ? ? B  PRO 179 C  ? ? ? 1_555 B  MSE 180 N ? ? B PRO 154 B MSE 155 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale48  covale ? ? B  MSE 180 C  ? ? ? 1_555 B  TRP 181 N ? ? B MSE 155 B TRP 156 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale49  covale ? ? B  TRP 181 C  ? ? ? 1_555 B  MSE 182 N ? ? B TRP 156 B MSE 157 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale50  covale ? ? B  MSE 182 C  ? ? ? 1_555 B  PHE 183 N ? ? B MSE 157 B PHE 158 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale51  covale ? ? B  LEU 211 C  ? ? ? 1_555 B  MSE 212 N ? ? B LEU 186 B MSE 187 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale52  covale ? ? B  MSE 212 C  ? ? ? 1_555 B  ILE 213 N ? ? B MSE 187 B ILE 188 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale53  covale ? ? B  ALA 261 C  ? ? ? 1_555 B  MSE 262 N ? ? B ALA 236 B MSE 237 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale54  covale ? ? B  MSE 262 C  ? ? ? 1_555 B  ASN 263 N ? ? B MSE 237 B ASN 238 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale55  covale ? ? B  HIS 276 C  ? ? ? 1_555 B  MSE 277 N ? ? B HIS 251 B MSE 252 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale56  covale ? ? B  MSE 277 C  ? ? ? 1_555 B  ILE 278 N ? ? B MSE 252 B ILE 253 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale57  covale ? ? B  ILE 279 C  ? ? ? 1_555 B  MSE 280 N ? ? B ILE 254 B MSE 255 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale58  covale ? ? B  MSE 280 C  ? ? ? 1_555 B  PRO 281 N ? ? B MSE 255 B PRO 256 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale59  covale ? ? B  CYS 304 C  ? ? ? 1_555 B  MSE 305 N ? ? B CYS 279 B MSE 280 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale60  covale ? ? B  MSE 305 C  ? ? ? 1_555 B  ALA 306 N ? ? B MSE 280 B ALA 281 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale61  covale ? ? B  PRO 327 C  ? ? ? 1_555 B  MSE 328 N ? ? B PRO 302 B MSE 303 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale62  covale ? ? B  MSE 328 C  ? ? ? 1_555 B  VAL 329 N ? ? B MSE 303 B VAL 304 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale63  covale ? ? B  ASP 343 C  ? ? ? 1_555 B  MSE 344 N ? ? B ASP 318 B MSE 319 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale64  covale ? ? B  MSE 344 C  ? ? ? 1_555 B  GLY 345 N ? ? B MSE 319 B GLY 320 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale65  covale ? ? B  ASP 399 C  ? ? ? 1_555 B  MSE 400 N ? ? B ASP 374 B MSE 375 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale66  covale ? ? B  MSE 400 C  ? ? ? 1_555 B  ASP 401 N ? ? B MSE 375 B ASP 376 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale67  covale ? ? B  PRO 427 C  ? ? ? 1_555 B  MSE 428 N ? ? B PRO 402 B MSE 403 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale68  covale ? ? B  MSE 428 C  ? ? ? 1_555 B  LYS 429 N ? ? B MSE 403 B LYS 404 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale69  covale ? ? B  GLY 456 C  ? ? ? 1_555 B  MSE 457 N ? ? B GLY 431 B MSE 432 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale70  covale ? ? B  MSE 457 C  ? ? ? 1_555 B  VAL 458 N ? ? B MSE 432 B VAL 433 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale71  covale ? ? C  SER 22  C  ? ? ? 1_555 C  MSE 23  N ? ? C SER -3  C MSE -2  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale72  covale ? ? C  MSE 23  C  ? ? ? 1_555 C  MSE 24  N ? ? C MSE -2  C MSE -1  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale73  covale ? ? C  MSE 24  C  ? ? ? 1_555 C  TYR 25  N ? ? C MSE -1  C TYR 0   1_555 ? ? ? ? ? ? ? 1.313 ? 
covale74  covale ? ? C  PHE 92  C  ? ? ? 1_555 C  MSE 93  N ? ? C PHE 67  C MSE 68  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale75  covale ? ? C  MSE 93  C  ? ? ? 1_555 C  LYS 94  N ? ? C MSE 68  C LYS 69  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale76  covale ? ? C  ASN 102 C  ? ? ? 1_555 C  MSE 103 N ? ? C ASN 77  C MSE 78  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale77  covale ? ? C  MSE 103 C  ? ? ? 1_555 C  ASN 104 N ? ? C MSE 78  C ASN 79  1_555 ? ? ? ? ? ? ? 1.320 ? 
covale78  covale ? ? C  GLU 108 C  ? ? ? 1_555 C  MSE 109 N ? ? C GLU 83  C MSE 84  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale79  covale ? ? C  MSE 109 C  ? ? ? 1_555 C  LEU 110 N ? ? C MSE 84  C LEU 85  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale80  covale ? ? C  ASP 155 C  ? ? ? 1_555 C  MSE 156 N ? ? C ASP 130 C MSE 131 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale81  covale ? ? C  MSE 156 C  ? ? ? 1_555 C  TYR 157 N ? ? C MSE 131 C TYR 132 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale82  covale ? ? C  GLY 176 C  ? ? ? 1_555 C  MSE 177 N ? ? C GLY 151 C MSE 152 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale83  covale ? ? C  MSE 177 C  ? ? ? 1_555 C  ILE 178 N ? ? C MSE 152 C ILE 153 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale84  covale ? ? C  PRO 179 C  ? ? ? 1_555 C  MSE 180 N ? ? C PRO 154 C MSE 155 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale85  covale ? ? C  MSE 180 C  ? ? ? 1_555 C  TRP 181 N ? ? C MSE 155 C TRP 156 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale86  covale ? ? C  TRP 181 C  ? ? ? 1_555 C  MSE 182 N ? ? C TRP 156 C MSE 157 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale87  covale ? ? C  MSE 182 C  ? ? ? 1_555 C  PHE 183 N ? ? C MSE 157 C PHE 158 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale88  covale ? ? C  LEU 211 C  ? ? ? 1_555 C  MSE 212 N ? ? C LEU 186 C MSE 187 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale89  covale ? ? C  MSE 212 C  ? ? ? 1_555 C  ILE 213 N ? ? C MSE 187 C ILE 188 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale90  covale ? ? C  ALA 261 C  ? ? ? 1_555 C  MSE 262 N ? ? C ALA 236 C MSE 237 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale91  covale ? ? C  MSE 262 C  ? ? ? 1_555 C  ASN 263 N ? ? C MSE 237 C ASN 238 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale92  covale ? ? C  HIS 276 C  ? ? ? 1_555 C  MSE 277 N ? ? C HIS 251 C MSE 252 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale93  covale ? ? C  MSE 277 C  ? ? ? 1_555 C  ILE 278 N ? ? C MSE 252 C ILE 253 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale94  covale ? ? C  ILE 279 C  ? ? ? 1_555 C  MSE 280 N ? ? C ILE 254 C MSE 255 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale95  covale ? ? C  MSE 280 C  ? ? ? 1_555 C  PRO 281 N ? ? C MSE 255 C PRO 256 1_555 ? ? ? ? ? ? ? 1.360 ? 
covale96  covale ? ? C  CYS 304 C  ? ? ? 1_555 C  MSE 305 N ? ? C CYS 279 C MSE 280 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale97  covale ? ? C  MSE 305 C  ? ? ? 1_555 C  ALA 306 N ? ? C MSE 280 C ALA 281 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale98  covale ? ? C  PRO 327 C  ? ? ? 1_555 C  MSE 328 N ? ? C PRO 302 C MSE 303 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale99  covale ? ? C  MSE 328 C  ? ? ? 1_555 C  VAL 329 N ? ? C MSE 303 C VAL 304 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale100 covale ? ? C  ASP 343 C  ? ? ? 1_555 C  MSE 344 N ? ? C ASP 318 C MSE 319 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale101 covale ? ? C  MSE 344 C  ? ? ? 1_555 C  GLY 345 N ? ? C MSE 319 C GLY 320 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale102 covale ? ? C  ASP 399 C  ? ? ? 1_555 C  MSE 400 N ? ? C ASP 374 C MSE 375 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale103 covale ? ? C  MSE 400 C  ? ? ? 1_555 C  ASP 401 N ? ? C MSE 375 C ASP 376 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale104 covale ? ? C  PRO 427 C  ? ? ? 1_555 C  MSE 428 N ? ? C PRO 402 C MSE 403 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale105 covale ? ? C  MSE 428 C  ? ? ? 1_555 C  LYS 429 N ? ? C MSE 403 C LYS 404 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale106 covale ? ? C  GLY 456 C  ? ? ? 1_555 C  MSE 457 N ? ? C GLY 431 C MSE 432 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale107 covale ? ? C  MSE 457 C  ? ? ? 1_555 C  VAL 458 N ? ? C MSE 432 C VAL 433 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale108 covale ? ? D  MSE 24  C  ? ? ? 1_555 D  TYR 25  N ? ? D MSE -1  D TYR 0   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale109 covale ? ? D  PHE 92  C  ? ? ? 1_555 D  MSE 93  N ? ? D PHE 67  D MSE 68  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale110 covale ? ? D  MSE 93  C  ? ? ? 1_555 D  LYS 94  N ? ? D MSE 68  D LYS 69  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale111 covale ? ? D  ASN 102 C  ? ? ? 1_555 D  MSE 103 N ? ? D ASN 77  D MSE 78  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale112 covale ? ? D  MSE 103 C  ? ? ? 1_555 D  ASN 104 N ? ? D MSE 78  D ASN 79  1_555 ? ? ? ? ? ? ? 1.337 ? 
covale113 covale ? ? D  GLU 108 C  ? ? ? 1_555 D  MSE 109 N ? ? D GLU 83  D MSE 84  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale114 covale ? ? D  MSE 109 C  ? ? ? 1_555 D  LEU 110 N ? ? D MSE 84  D LEU 85  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale115 covale ? ? D  ASP 155 C  ? ? ? 1_555 D  MSE 156 N ? ? D ASP 130 D MSE 131 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale116 covale ? ? D  MSE 156 C  ? ? ? 1_555 D  TYR 157 N ? ? D MSE 131 D TYR 132 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale117 covale ? ? D  GLY 176 C  ? ? ? 1_555 D  MSE 177 N ? ? D GLY 151 D MSE 152 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale118 covale ? ? D  MSE 177 C  ? ? ? 1_555 D  ILE 178 N ? ? D MSE 152 D ILE 153 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale119 covale ? ? D  PRO 179 C  ? ? ? 1_555 D  MSE 180 N ? ? D PRO 154 D MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale120 covale ? ? D  MSE 180 C  ? ? ? 1_555 D  TRP 181 N ? ? D MSE 155 D TRP 156 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale121 covale ? ? D  TRP 181 C  ? ? ? 1_555 D  MSE 182 N ? ? D TRP 156 D MSE 157 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale122 covale ? ? D  MSE 182 C  ? ? ? 1_555 D  PHE 183 N ? ? D MSE 157 D PHE 158 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale123 covale ? ? D  LEU 211 C  ? ? ? 1_555 D  MSE 212 N ? ? D LEU 186 D MSE 187 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale124 covale ? ? D  MSE 212 C  ? ? ? 1_555 D  ILE 213 N ? ? D MSE 187 D ILE 188 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale125 covale ? ? D  ALA 261 C  ? ? ? 1_555 D  MSE 262 N ? ? D ALA 236 D MSE 237 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale126 covale ? ? D  MSE 262 C  ? ? ? 1_555 D  ASN 263 N ? ? D MSE 237 D ASN 238 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale127 covale ? ? D  HIS 276 C  ? ? ? 1_555 D  MSE 277 N ? ? D HIS 251 D MSE 252 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale128 covale ? ? D  MSE 277 C  ? ? ? 1_555 D  ILE 278 N ? ? D MSE 252 D ILE 253 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale129 covale ? ? D  ILE 279 C  ? ? ? 1_555 D  MSE 280 N ? ? D ILE 254 D MSE 255 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale130 covale ? ? D  MSE 280 C  ? ? ? 1_555 D  PRO 281 N ? ? D MSE 255 D PRO 256 1_555 ? ? ? ? ? ? ? 1.354 ? 
covale131 covale ? ? D  CYS 304 C  ? ? ? 1_555 D  MSE 305 N ? ? D CYS 279 D MSE 280 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale132 covale ? ? D  MSE 305 C  ? ? ? 1_555 D  ALA 306 N ? ? D MSE 280 D ALA 281 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale133 covale ? ? D  PRO 327 C  ? ? ? 1_555 D  MSE 328 N ? ? D PRO 302 D MSE 303 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale134 covale ? ? D  MSE 328 C  ? ? ? 1_555 D  VAL 329 N ? ? D MSE 303 D VAL 304 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale135 covale ? ? D  ASP 343 C  ? ? ? 1_555 D  MSE 344 N ? ? D ASP 318 D MSE 319 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale136 covale ? ? D  MSE 344 C  ? ? ? 1_555 D  GLY 345 N ? ? D MSE 319 D GLY 320 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale137 covale ? ? D  ASP 399 C  ? ? ? 1_555 D  MSE 400 N ? ? D ASP 374 D MSE 375 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale138 covale ? ? D  MSE 400 C  ? ? ? 1_555 D  ASP 401 N ? ? D MSE 375 D ASP 376 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale139 covale ? ? D  PRO 427 C  ? ? ? 1_555 D  MSE 428 N ? ? D PRO 402 D MSE 403 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale140 covale ? ? D  MSE 428 C  ? ? ? 1_555 D  LYS 429 N ? ? D MSE 403 D LYS 404 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale141 covale ? ? D  GLY 456 C  ? ? ? 1_555 D  MSE 457 N ? ? D GLY 431 D MSE 432 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale142 covale ? ? D  MSE 457 C  ? ? ? 1_555 D  VAL 458 N ? ? D MSE 432 D VAL 433 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale143 covale ? ? E  MSE 23  C  ? ? ? 1_555 E  MSE 24  N ? ? E MSE -2  E MSE -1  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale144 covale ? ? E  MSE 24  C  ? ? ? 1_555 E  TYR 25  N ? ? E MSE -1  E TYR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale145 covale ? ? E  PHE 92  C  ? ? ? 1_555 E  MSE 93  N ? ? E PHE 67  E MSE 68  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale146 covale ? ? E  MSE 93  C  ? ? ? 1_555 E  LYS 94  N ? ? E MSE 68  E LYS 69  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale147 covale ? ? E  ASN 102 C  ? ? ? 1_555 E  MSE 103 N ? ? E ASN 77  E MSE 78  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale148 covale ? ? E  MSE 103 C  ? ? ? 1_555 E  ASN 104 N ? ? E MSE 78  E ASN 79  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale149 covale ? ? E  GLU 108 C  ? ? ? 1_555 E  MSE 109 N ? ? E GLU 83  E MSE 84  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale150 covale ? ? E  MSE 109 C  ? ? ? 1_555 E  LEU 110 N ? ? E MSE 84  E LEU 85  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale151 covale ? ? E  ASP 155 C  ? ? ? 1_555 E  MSE 156 N ? ? E ASP 130 E MSE 131 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale152 covale ? ? E  MSE 156 C  ? ? ? 1_555 E  TYR 157 N ? ? E MSE 131 E TYR 132 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale153 covale ? ? E  GLY 176 C  ? ? ? 1_555 E  MSE 177 N ? ? E GLY 151 E MSE 152 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale154 covale ? ? E  MSE 177 C  ? ? ? 1_555 E  ILE 178 N ? ? E MSE 152 E ILE 153 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale155 covale ? ? E  PRO 179 C  ? ? ? 1_555 E  MSE 180 N ? ? E PRO 154 E MSE 155 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale156 covale ? ? E  MSE 180 C  ? ? ? 1_555 E  TRP 181 N ? ? E MSE 155 E TRP 156 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale157 covale ? ? E  TRP 181 C  ? ? ? 1_555 E  MSE 182 N ? ? E TRP 156 E MSE 157 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale158 covale ? ? E  MSE 182 C  ? ? ? 1_555 E  PHE 183 N ? ? E MSE 157 E PHE 158 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale159 covale ? ? E  LEU 211 C  ? ? ? 1_555 E  MSE 212 N ? ? E LEU 186 E MSE 187 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale160 covale ? ? E  MSE 212 C  ? ? ? 1_555 E  ILE 213 N ? ? E MSE 187 E ILE 188 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale161 covale ? ? E  ALA 261 C  ? ? ? 1_555 E  MSE 262 N ? ? E ALA 236 E MSE 237 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale162 covale ? ? E  MSE 262 C  ? ? ? 1_555 E  ASN 263 N ? ? E MSE 237 E ASN 238 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale163 covale ? ? E  HIS 276 C  ? ? ? 1_555 E  MSE 277 N ? ? E HIS 251 E MSE 252 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale164 covale ? ? E  MSE 277 C  ? ? ? 1_555 E  ILE 278 N ? ? E MSE 252 E ILE 253 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale165 covale ? ? E  ILE 279 C  ? ? ? 1_555 E  MSE 280 N ? ? E ILE 254 E MSE 255 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale166 covale ? ? E  MSE 280 C  ? ? ? 1_555 E  PRO 281 N ? ? E MSE 255 E PRO 256 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale167 covale ? ? E  CYS 304 C  ? ? ? 1_555 E  MSE 305 N ? ? E CYS 279 E MSE 280 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale168 covale ? ? E  MSE 305 C  ? ? ? 1_555 E  ALA 306 N ? ? E MSE 280 E ALA 281 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale169 covale ? ? E  PRO 327 C  ? ? ? 1_555 E  MSE 328 N ? ? E PRO 302 E MSE 303 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale170 covale ? ? E  MSE 328 C  ? ? ? 1_555 E  VAL 329 N ? ? E MSE 303 E VAL 304 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale171 covale ? ? E  ASP 343 C  ? ? ? 1_555 E  MSE 344 N ? ? E ASP 318 E MSE 319 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale172 covale ? ? E  MSE 344 C  ? ? ? 1_555 E  GLY 345 N ? ? E MSE 319 E GLY 320 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale173 covale ? ? E  ASP 399 C  ? ? ? 1_555 E  MSE 400 N ? ? E ASP 374 E MSE 375 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale174 covale ? ? E  MSE 400 C  ? ? ? 1_555 E  ASP 401 N ? ? E MSE 375 E ASP 376 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale175 covale ? ? E  PRO 427 C  ? ? ? 1_555 E  MSE 428 N ? ? E PRO 402 E MSE 403 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale176 covale ? ? E  MSE 428 C  ? ? ? 1_555 E  LYS 429 N ? ? E MSE 403 E LYS 404 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale177 covale ? ? E  GLY 456 C  ? ? ? 1_555 E  MSE 457 N ? ? E GLY 431 E MSE 432 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale178 covale ? ? E  MSE 457 C  ? ? ? 1_555 E  VAL 458 N ? ? E MSE 432 E VAL 433 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale179 covale ? ? F  MSE 24  C  ? ? ? 1_555 F  TYR 25  N ? ? F MSE -1  F TYR 0   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale180 covale ? ? F  PHE 92  C  ? ? ? 1_555 F  MSE 93  N ? ? F PHE 67  F MSE 68  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale181 covale ? ? F  MSE 93  C  ? ? ? 1_555 F  LYS 94  N ? ? F MSE 68  F LYS 69  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale182 covale ? ? F  ASN 102 C  ? ? ? 1_555 F  MSE 103 N ? ? F ASN 77  F MSE 78  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale183 covale ? ? F  MSE 103 C  ? ? ? 1_555 F  ASN 104 N ? ? F MSE 78  F ASN 79  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale184 covale ? ? F  GLU 108 C  ? ? ? 1_555 F  MSE 109 N ? ? F GLU 83  F MSE 84  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale185 covale ? ? F  MSE 109 C  ? ? ? 1_555 F  LEU 110 N ? ? F MSE 84  F LEU 85  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale186 covale ? ? F  ASP 155 C  ? ? ? 1_555 F  MSE 156 N ? ? F ASP 130 F MSE 131 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale187 covale ? ? F  MSE 156 C  ? ? ? 1_555 F  TYR 157 N ? ? F MSE 131 F TYR 132 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale188 covale ? ? F  GLY 176 C  ? ? ? 1_555 F  MSE 177 N ? ? F GLY 151 F MSE 152 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale189 covale ? ? F  MSE 177 C  ? ? ? 1_555 F  ILE 178 N ? ? F MSE 152 F ILE 153 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale190 covale ? ? F  PRO 179 C  ? ? ? 1_555 F  MSE 180 N ? ? F PRO 154 F MSE 155 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale191 covale ? ? F  MSE 180 C  ? ? ? 1_555 F  TRP 181 N ? ? F MSE 155 F TRP 156 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale192 covale ? ? F  TRP 181 C  ? ? ? 1_555 F  MSE 182 N ? ? F TRP 156 F MSE 157 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale193 covale ? ? F  MSE 182 C  ? ? ? 1_555 F  PHE 183 N ? ? F MSE 157 F PHE 158 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale194 covale ? ? F  LEU 211 C  ? ? ? 1_555 F  MSE 212 N ? ? F LEU 186 F MSE 187 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale195 covale ? ? F  MSE 212 C  ? ? ? 1_555 F  ILE 213 N ? ? F MSE 187 F ILE 188 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale196 covale ? ? F  ALA 261 C  ? ? ? 1_555 F  MSE 262 N ? ? F ALA 236 F MSE 237 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale197 covale ? ? F  MSE 262 C  ? ? ? 1_555 F  ASN 263 N ? ? F MSE 237 F ASN 238 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale198 covale ? ? F  HIS 276 C  ? ? ? 1_555 F  MSE 277 N ? ? F HIS 251 F MSE 252 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale199 covale ? ? F  MSE 277 C  ? ? ? 1_555 F  ILE 278 N ? ? F MSE 252 F ILE 253 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale200 covale ? ? F  ILE 279 C  ? ? ? 1_555 F  MSE 280 N ? ? F ILE 254 F MSE 255 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale201 covale ? ? F  MSE 280 C  ? ? ? 1_555 F  PRO 281 N ? ? F MSE 255 F PRO 256 1_555 ? ? ? ? ? ? ? 1.348 ? 
covale202 covale ? ? F  CYS 304 C  ? ? ? 1_555 F  MSE 305 N ? ? F CYS 279 F MSE 280 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale203 covale ? ? F  MSE 305 C  ? ? ? 1_555 F  ALA 306 N ? ? F MSE 280 F ALA 281 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale204 covale ? ? F  PRO 327 C  ? ? ? 1_555 F  MSE 328 N ? ? F PRO 302 F MSE 303 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale205 covale ? ? F  MSE 328 C  ? ? ? 1_555 F  VAL 329 N ? ? F MSE 303 F VAL 304 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale206 covale ? ? F  ASP 343 C  ? ? ? 1_555 F  MSE 344 N ? ? F ASP 318 F MSE 319 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale207 covale ? ? F  MSE 344 C  ? ? ? 1_555 F  GLY 345 N ? ? F MSE 319 F GLY 320 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale208 covale ? ? F  ASP 399 C  ? ? ? 1_555 F  MSE 400 N ? ? F ASP 374 F MSE 375 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale209 covale ? ? F  MSE 400 C  ? ? ? 1_555 F  ASP 401 N ? ? F MSE 375 F ASP 376 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale210 covale ? ? F  PRO 427 C  ? ? ? 1_555 F  MSE 428 N ? ? F PRO 402 F MSE 403 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale211 covale ? ? F  MSE 428 C  ? ? ? 1_555 F  LYS 429 N ? ? F MSE 403 F LYS 404 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale212 covale ? ? F  GLY 456 C  ? ? ? 1_555 F  MSE 457 N ? ? F GLY 431 F MSE 432 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale213 covale ? ? F  MSE 457 C  ? ? ? 1_555 F  VAL 458 N ? ? F MSE 432 F VAL 433 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale214 covale ? ? G  MSE 24  C  ? ? ? 1_555 G  TYR 25  N ? ? G MSE -1  G TYR 0   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale215 covale ? ? G  PHE 92  C  ? ? ? 1_555 G  MSE 93  N ? ? G PHE 67  G MSE 68  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale216 covale ? ? G  MSE 93  C  ? ? ? 1_555 G  LYS 94  N ? ? G MSE 68  G LYS 69  1_555 ? ? ? ? ? ? ? 1.312 ? 
covale217 covale ? ? G  ASN 102 C  ? ? ? 1_555 G  MSE 103 N ? ? G ASN 77  G MSE 78  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale218 covale ? ? G  MSE 103 C  ? ? ? 1_555 G  ASN 104 N ? ? G MSE 78  G ASN 79  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale219 covale ? ? G  GLU 108 C  ? ? ? 1_555 G  MSE 109 N ? ? G GLU 83  G MSE 84  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale220 covale ? ? G  MSE 109 C  ? ? ? 1_555 G  LEU 110 N ? ? G MSE 84  G LEU 85  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale221 covale ? ? G  ASP 155 C  ? ? ? 1_555 G  MSE 156 N ? ? G ASP 130 G MSE 131 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale222 covale ? ? G  MSE 156 C  ? ? ? 1_555 G  TYR 157 N ? ? G MSE 131 G TYR 132 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale223 covale ? ? G  GLY 176 C  ? ? ? 1_555 G  MSE 177 N ? ? G GLY 151 G MSE 152 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale224 covale ? ? G  MSE 177 C  ? ? ? 1_555 G  ILE 178 N ? ? G MSE 152 G ILE 153 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale225 covale ? ? G  PRO 179 C  ? ? ? 1_555 G  MSE 180 N ? ? G PRO 154 G MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale226 covale ? ? G  MSE 180 C  ? ? ? 1_555 G  TRP 181 N ? ? G MSE 155 G TRP 156 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale227 covale ? ? G  TRP 181 C  ? ? ? 1_555 G  MSE 182 N ? ? G TRP 156 G MSE 157 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale228 covale ? ? G  MSE 182 C  ? ? ? 1_555 G  PHE 183 N ? ? G MSE 157 G PHE 158 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale229 covale ? ? G  LEU 211 C  ? ? ? 1_555 G  MSE 212 N ? ? G LEU 186 G MSE 187 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale230 covale ? ? G  MSE 212 C  ? ? ? 1_555 G  ILE 213 N ? ? G MSE 187 G ILE 188 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale231 covale ? ? G  ALA 261 C  ? ? ? 1_555 G  MSE 262 N ? ? G ALA 236 G MSE 237 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale232 covale ? ? G  MSE 262 C  ? ? ? 1_555 G  ASN 263 N ? ? G MSE 237 G ASN 238 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale233 covale ? ? G  HIS 276 C  ? ? ? 1_555 G  MSE 277 N ? ? G HIS 251 G MSE 252 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale234 covale ? ? G  MSE 277 C  ? ? ? 1_555 G  ILE 278 N ? ? G MSE 252 G ILE 253 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale235 covale ? ? G  ILE 279 C  ? ? ? 1_555 G  MSE 280 N ? ? G ILE 254 G MSE 255 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale236 covale ? ? G  MSE 280 C  ? ? ? 1_555 G  PRO 281 N ? ? G MSE 255 G PRO 256 1_555 ? ? ? ? ? ? ? 1.359 ? 
covale237 covale ? ? G  CYS 304 C  ? ? ? 1_555 G  MSE 305 N ? ? G CYS 279 G MSE 280 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale238 covale ? ? G  MSE 305 C  ? ? ? 1_555 G  ALA 306 N ? ? G MSE 280 G ALA 281 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale239 covale ? ? G  PRO 327 C  ? ? ? 1_555 G  MSE 328 N ? ? G PRO 302 G MSE 303 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale240 covale ? ? G  MSE 328 C  ? ? ? 1_555 G  VAL 329 N ? ? G MSE 303 G VAL 304 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale241 covale ? ? G  ASP 343 C  ? ? ? 1_555 G  MSE 344 N ? ? G ASP 318 G MSE 319 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale242 covale ? ? G  MSE 344 C  ? ? ? 1_555 G  GLY 345 N ? ? G MSE 319 G GLY 320 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale243 covale ? ? G  ASP 399 C  ? ? ? 1_555 G  MSE 400 N ? ? G ASP 374 G MSE 375 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale244 covale ? ? G  MSE 400 C  ? ? ? 1_555 G  ASP 401 N ? ? G MSE 375 G ASP 376 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale245 covale ? ? G  PRO 427 C  ? ? ? 1_555 G  MSE 428 N ? ? G PRO 402 G MSE 403 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale246 covale ? ? G  MSE 428 C  ? ? ? 1_555 G  LYS 429 N ? ? G MSE 403 G LYS 404 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale247 covale ? ? G  GLY 456 C  ? ? ? 1_555 G  MSE 457 N ? ? G GLY 431 G MSE 432 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale248 covale ? ? G  MSE 457 C  ? ? ? 1_555 G  VAL 458 N ? ? G MSE 432 G VAL 433 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale249 covale ? ? H  MSE 24  C  ? ? ? 1_555 H  TYR 25  N ? ? H MSE -1  H TYR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale250 covale ? ? H  PHE 92  C  ? ? ? 1_555 H  MSE 93  N ? ? H PHE 67  H MSE 68  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale251 covale ? ? H  MSE 93  C  ? ? ? 1_555 H  LYS 94  N ? ? H MSE 68  H LYS 69  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale252 covale ? ? H  ASN 102 C  ? ? ? 1_555 H  MSE 103 N ? ? H ASN 77  H MSE 78  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale253 covale ? ? H  MSE 103 C  ? ? ? 1_555 H  ASN 104 N ? ? H MSE 78  H ASN 79  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale254 covale ? ? H  GLU 108 C  ? ? ? 1_555 H  MSE 109 N ? ? H GLU 83  H MSE 84  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale255 covale ? ? H  MSE 109 C  ? ? ? 1_555 H  LEU 110 N ? ? H MSE 84  H LEU 85  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale256 covale ? ? H  ASP 155 C  ? ? ? 1_555 H  MSE 156 N ? ? H ASP 130 H MSE 131 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale257 covale ? ? H  MSE 156 C  ? ? ? 1_555 H  TYR 157 N ? ? H MSE 131 H TYR 132 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale258 covale ? ? H  GLY 176 C  ? ? ? 1_555 H  MSE 177 N ? ? H GLY 151 H MSE 152 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale259 covale ? ? H  MSE 177 C  ? ? ? 1_555 H  ILE 178 N ? ? H MSE 152 H ILE 153 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale260 covale ? ? H  PRO 179 C  ? ? ? 1_555 H  MSE 180 N ? ? H PRO 154 H MSE 155 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale261 covale ? ? H  MSE 180 C  ? ? ? 1_555 H  TRP 181 N ? ? H MSE 155 H TRP 156 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale262 covale ? ? H  TRP 181 C  ? ? ? 1_555 H  MSE 182 N ? ? H TRP 156 H MSE 157 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale263 covale ? ? H  MSE 182 C  ? ? ? 1_555 H  PHE 183 N ? ? H MSE 157 H PHE 158 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale264 covale ? ? H  LEU 211 C  ? ? ? 1_555 H  MSE 212 N ? ? H LEU 186 H MSE 187 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale265 covale ? ? H  MSE 212 C  ? ? ? 1_555 H  ILE 213 N ? ? H MSE 187 H ILE 188 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale266 covale ? ? H  ALA 261 C  ? ? ? 1_555 H  MSE 262 N ? ? H ALA 236 H MSE 237 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale267 covale ? ? H  MSE 262 C  ? ? ? 1_555 H  ASN 263 N ? ? H MSE 237 H ASN 238 1_555 ? ? ? ? ? ? ? 1.314 ? 
covale268 covale ? ? H  HIS 276 C  ? ? ? 1_555 H  MSE 277 N ? ? H HIS 251 H MSE 252 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale269 covale ? ? H  MSE 277 C  ? ? ? 1_555 H  ILE 278 N ? ? H MSE 252 H ILE 253 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale270 covale ? ? H  ILE 279 C  ? ? ? 1_555 H  MSE 280 N ? ? H ILE 254 H MSE 255 1_555 ? ? ? ? ? ? ? 1.306 ? 
covale271 covale ? ? H  MSE 280 C  ? ? ? 1_555 H  PRO 281 N ? ? H MSE 255 H PRO 256 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale272 covale ? ? H  CYS 304 C  ? ? ? 1_555 H  MSE 305 N ? ? H CYS 279 H MSE 280 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale273 covale ? ? H  MSE 305 C  ? ? ? 1_555 H  ALA 306 N ? ? H MSE 280 H ALA 281 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale274 covale ? ? H  PRO 327 C  ? ? ? 1_555 H  MSE 328 N ? ? H PRO 302 H MSE 303 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale275 covale ? ? H  MSE 328 C  ? ? ? 1_555 H  VAL 329 N ? ? H MSE 303 H VAL 304 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale276 covale ? ? H  ASP 343 C  ? ? ? 1_555 H  MSE 344 N ? ? H ASP 318 H MSE 319 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale277 covale ? ? H  MSE 344 C  ? ? ? 1_555 H  GLY 345 N ? ? H MSE 319 H GLY 320 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale278 covale ? ? H  ASP 399 C  ? ? ? 1_555 H  MSE 400 N ? ? H ASP 374 H MSE 375 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale279 covale ? ? H  MSE 400 C  ? ? ? 1_555 H  ASP 401 N ? ? H MSE 375 H ASP 376 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale280 covale ? ? H  PRO 427 C  ? ? ? 1_555 H  MSE 428 N ? ? H PRO 402 H MSE 403 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale281 covale ? ? H  MSE 428 C  ? ? ? 1_555 H  LYS 429 N ? ? H MSE 403 H LYS 404 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale282 covale ? ? H  GLY 456 C  ? ? ? 1_555 H  MSE 457 N ? ? H GLY 431 H MSE 432 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale283 covale ? ? H  MSE 457 C  ? ? ? 1_555 H  VAL 458 N ? ? H MSE 432 H VAL 433 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale284 covale ? ? I  MSE 24  C  ? ? ? 1_555 I  TYR 25  N ? ? I MSE -1  I TYR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale285 covale ? ? I  PHE 92  C  ? ? ? 1_555 I  MSE 93  N ? ? I PHE 67  I MSE 68  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale286 covale ? ? I  MSE 93  C  ? ? ? 1_555 I  LYS 94  N ? ? I MSE 68  I LYS 69  1_555 ? ? ? ? ? ? ? 1.319 ? 
covale287 covale ? ? I  ASN 102 C  ? ? ? 1_555 I  MSE 103 N ? ? I ASN 77  I MSE 78  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale288 covale ? ? I  MSE 103 C  ? ? ? 1_555 I  ASN 104 N ? ? I MSE 78  I ASN 79  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale289 covale ? ? I  GLU 108 C  ? ? ? 1_555 I  MSE 109 N ? ? I GLU 83  I MSE 84  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale290 covale ? ? I  MSE 109 C  ? ? ? 1_555 I  LEU 110 N ? ? I MSE 84  I LEU 85  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale291 covale ? ? I  ASP 155 C  ? ? ? 1_555 I  MSE 156 N ? ? I ASP 130 I MSE 131 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale292 covale ? ? I  MSE 156 C  ? ? ? 1_555 I  TYR 157 N ? ? I MSE 131 I TYR 132 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale293 covale ? ? I  GLY 176 C  ? ? ? 1_555 I  MSE 177 N ? ? I GLY 151 I MSE 152 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale294 covale ? ? I  MSE 177 C  ? ? ? 1_555 I  ILE 178 N ? ? I MSE 152 I ILE 153 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale295 covale ? ? I  PRO 179 C  ? ? ? 1_555 I  MSE 180 N ? ? I PRO 154 I MSE 155 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale296 covale ? ? I  MSE 180 C  ? ? ? 1_555 I  TRP 181 N ? ? I MSE 155 I TRP 156 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale297 covale ? ? I  TRP 181 C  ? ? ? 1_555 I  MSE 182 N ? ? I TRP 156 I MSE 157 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale298 covale ? ? I  MSE 182 C  ? ? ? 1_555 I  PHE 183 N ? ? I MSE 157 I PHE 158 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale299 covale ? ? I  LEU 211 C  ? ? ? 1_555 I  MSE 212 N ? ? I LEU 186 I MSE 187 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale300 covale ? ? I  MSE 212 C  ? ? ? 1_555 I  ILE 213 N ? ? I MSE 187 I ILE 188 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale301 covale ? ? I  ALA 261 C  ? ? ? 1_555 I  MSE 262 N ? ? I ALA 236 I MSE 237 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale302 covale ? ? I  MSE 262 C  ? ? ? 1_555 I  ASN 263 N ? ? I MSE 237 I ASN 238 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale303 covale ? ? I  HIS 276 C  ? ? ? 1_555 I  MSE 277 N ? ? I HIS 251 I MSE 252 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale304 covale ? ? I  MSE 277 C  ? ? ? 1_555 I  ILE 278 N ? ? I MSE 252 I ILE 253 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale305 covale ? ? I  ILE 279 C  ? ? ? 1_555 I  MSE 280 N ? ? I ILE 254 I MSE 255 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale306 covale ? ? I  MSE 280 C  ? ? ? 1_555 I  PRO 281 N ? ? I MSE 255 I PRO 256 1_555 ? ? ? ? ? ? ? 1.353 ? 
covale307 covale ? ? I  CYS 304 C  ? ? ? 1_555 I  MSE 305 N ? ? I CYS 279 I MSE 280 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale308 covale ? ? I  MSE 305 C  ? ? ? 1_555 I  ALA 306 N ? ? I MSE 280 I ALA 281 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale309 covale ? ? I  PRO 327 C  ? ? ? 1_555 I  MSE 328 N ? ? I PRO 302 I MSE 303 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale310 covale ? ? I  MSE 328 C  ? ? ? 1_555 I  VAL 329 N ? ? I MSE 303 I VAL 304 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale311 covale ? ? I  ASP 343 C  ? ? ? 1_555 I  MSE 344 N ? ? I ASP 318 I MSE 319 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale312 covale ? ? I  MSE 344 C  ? ? ? 1_555 I  GLY 345 N ? ? I MSE 319 I GLY 320 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale313 covale ? ? I  ASP 399 C  ? ? ? 1_555 I  MSE 400 N ? ? I ASP 374 I MSE 375 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale314 covale ? ? I  MSE 400 C  ? ? ? 1_555 I  ASP 401 N ? ? I MSE 375 I ASP 376 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale315 covale ? ? I  PRO 427 C  ? ? ? 1_555 I  MSE 428 N ? ? I PRO 402 I MSE 403 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale316 covale ? ? I  MSE 428 C  ? ? ? 1_555 I  LYS 429 N ? ? I MSE 403 I LYS 404 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale317 covale ? ? I  GLY 456 C  ? ? ? 1_555 I  MSE 457 N ? ? I GLY 431 I MSE 432 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale318 covale ? ? I  MSE 457 C  ? ? ? 1_555 I  VAL 458 N ? ? I MSE 432 I VAL 433 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale319 covale ? ? J  MSE 24  C  ? ? ? 1_555 J  TYR 25  N ? ? J MSE -1  J TYR 0   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale320 covale ? ? J  PHE 92  C  ? ? ? 1_555 J  MSE 93  N ? ? J PHE 67  J MSE 68  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale321 covale ? ? J  MSE 93  C  ? ? ? 1_555 J  LYS 94  N ? ? J MSE 68  J LYS 69  1_555 ? ? ? ? ? ? ? 1.340 ? 
covale322 covale ? ? J  ASN 102 C  ? ? ? 1_555 J  MSE 103 N ? ? J ASN 77  J MSE 78  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale323 covale ? ? J  MSE 103 C  ? ? ? 1_555 J  ASN 104 N ? ? J MSE 78  J ASN 79  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale324 covale ? ? J  GLU 108 C  ? ? ? 1_555 J  MSE 109 N ? ? J GLU 83  J MSE 84  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale325 covale ? ? J  MSE 109 C  ? ? ? 1_555 J  LEU 110 N ? ? J MSE 84  J LEU 85  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale326 covale ? ? J  ASP 155 C  ? ? ? 1_555 J  MSE 156 N ? ? J ASP 130 J MSE 131 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale327 covale ? ? J  MSE 156 C  ? ? ? 1_555 J  TYR 157 N ? ? J MSE 131 J TYR 132 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale328 covale ? ? J  GLY 176 C  ? ? ? 1_555 J  MSE 177 N ? ? J GLY 151 J MSE 152 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale329 covale ? ? J  MSE 177 C  ? ? ? 1_555 J  ILE 178 N ? ? J MSE 152 J ILE 153 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale330 covale ? ? J  PRO 179 C  ? ? ? 1_555 J  MSE 180 N ? ? J PRO 154 J MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale331 covale ? ? J  MSE 180 C  ? ? ? 1_555 J  TRP 181 N ? ? J MSE 155 J TRP 156 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale332 covale ? ? J  TRP 181 C  ? ? ? 1_555 J  MSE 182 N ? ? J TRP 156 J MSE 157 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale333 covale ? ? J  MSE 182 C  ? ? ? 1_555 J  PHE 183 N ? ? J MSE 157 J PHE 158 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale334 covale ? ? J  LEU 211 C  ? ? ? 1_555 J  MSE 212 N ? ? J LEU 186 J MSE 187 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale335 covale ? ? J  MSE 212 C  ? ? ? 1_555 J  ILE 213 N ? ? J MSE 187 J ILE 188 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale336 covale ? ? J  ALA 261 C  ? ? ? 1_555 J  MSE 262 N ? ? J ALA 236 J MSE 237 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale337 covale ? ? J  MSE 262 C  ? ? ? 1_555 J  ASN 263 N ? ? J MSE 237 J ASN 238 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale338 covale ? ? J  HIS 276 C  ? ? ? 1_555 J  MSE 277 N ? ? J HIS 251 J MSE 252 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale339 covale ? ? J  MSE 277 C  ? ? ? 1_555 J  ILE 278 N ? ? J MSE 252 J ILE 253 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale340 covale ? ? J  ILE 279 C  ? ? ? 1_555 J  MSE 280 N ? ? J ILE 254 J MSE 255 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale341 covale ? ? J  MSE 280 C  ? ? ? 1_555 J  PRO 281 N ? ? J MSE 255 J PRO 256 1_555 ? ? ? ? ? ? ? 1.353 ? 
covale342 covale ? ? J  CYS 304 C  ? ? ? 1_555 J  MSE 305 N ? ? J CYS 279 J MSE 280 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale343 covale ? ? J  MSE 305 C  ? ? ? 1_555 J  ALA 306 N ? ? J MSE 280 J ALA 281 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale344 covale ? ? J  PRO 327 C  ? ? ? 1_555 J  MSE 328 N ? ? J PRO 302 J MSE 303 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale345 covale ? ? J  MSE 328 C  ? ? ? 1_555 J  VAL 329 N ? ? J MSE 303 J VAL 304 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale346 covale ? ? J  ASP 343 C  ? ? ? 1_555 J  MSE 344 N ? ? J ASP 318 J MSE 319 1_555 ? ? ? ? ? ? ? 1.307 ? 
covale347 covale ? ? J  MSE 344 C  ? ? ? 1_555 J  GLY 345 N ? ? J MSE 319 J GLY 320 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale348 covale ? ? J  ASP 399 C  ? ? ? 1_555 J  MSE 400 N ? ? J ASP 374 J MSE 375 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale349 covale ? ? J  MSE 400 C  ? ? ? 1_555 J  ASP 401 N ? ? J MSE 375 J ASP 376 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale350 covale ? ? J  PRO 427 C  ? ? ? 1_555 J  MSE 428 N ? ? J PRO 402 J MSE 403 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale351 covale ? ? J  MSE 428 C  ? ? ? 1_555 J  LYS 429 N ? ? J MSE 403 J LYS 404 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale352 covale ? ? J  GLY 456 C  ? ? ? 1_555 J  MSE 457 N ? ? J GLY 431 J MSE 432 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale353 covale ? ? J  MSE 457 C  ? ? ? 1_555 J  VAL 458 N ? ? J MSE 432 J VAL 433 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale354 covale ? ? K  MSE 24  C  ? ? ? 1_555 K  TYR 25  N ? ? K MSE -1  K TYR 0   1_555 ? ? ? ? ? ? ? 1.327 ? 
covale355 covale ? ? K  PHE 92  C  ? ? ? 1_555 K  MSE 93  N ? ? K PHE 67  K MSE 68  1_555 ? ? ? ? ? ? ? 1.310 ? 
covale356 covale ? ? K  MSE 93  C  ? ? ? 1_555 K  LYS 94  N ? ? K MSE 68  K LYS 69  1_555 ? ? ? ? ? ? ? 1.300 ? 
covale357 covale ? ? K  ASN 102 C  ? ? ? 1_555 K  MSE 103 N ? ? K ASN 77  K MSE 78  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale358 covale ? ? K  MSE 103 C  ? ? ? 1_555 K  ASN 104 N ? ? K MSE 78  K ASN 79  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale359 covale ? ? K  GLU 108 C  ? ? ? 1_555 K  MSE 109 N ? ? K GLU 83  K MSE 84  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale360 covale ? ? K  MSE 109 C  ? ? ? 1_555 K  LEU 110 N ? ? K MSE 84  K LEU 85  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale361 covale ? ? K  ASP 155 C  ? ? ? 1_555 K  MSE 156 N ? ? K ASP 130 K MSE 131 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale362 covale ? ? K  MSE 156 C  ? ? ? 1_555 K  TYR 157 N ? ? K MSE 131 K TYR 132 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale363 covale ? ? K  GLY 176 C  ? ? ? 1_555 K  MSE 177 N ? ? K GLY 151 K MSE 152 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale364 covale ? ? K  MSE 177 C  ? ? ? 1_555 K  ILE 178 N ? ? K MSE 152 K ILE 153 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale365 covale ? ? K  PRO 179 C  ? ? ? 1_555 K  MSE 180 N ? ? K PRO 154 K MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale366 covale ? ? K  MSE 180 C  ? ? ? 1_555 K  TRP 181 N ? ? K MSE 155 K TRP 156 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale367 covale ? ? K  TRP 181 C  ? ? ? 1_555 K  MSE 182 N ? ? K TRP 156 K MSE 157 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale368 covale ? ? K  MSE 182 C  ? ? ? 1_555 K  PHE 183 N ? ? K MSE 157 K PHE 158 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale369 covale ? ? K  LEU 211 C  ? ? ? 1_555 K  MSE 212 N ? ? K LEU 186 K MSE 187 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale370 covale ? ? K  MSE 212 C  ? ? ? 1_555 K  ILE 213 N ? ? K MSE 187 K ILE 188 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale371 covale ? ? K  ALA 261 C  ? ? ? 1_555 K  MSE 262 N ? ? K ALA 236 K MSE 237 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale372 covale ? ? K  MSE 262 C  ? ? ? 1_555 K  ASN 263 N ? ? K MSE 237 K ASN 238 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale373 covale ? ? K  HIS 276 C  ? ? ? 1_555 K  MSE 277 N ? ? K HIS 251 K MSE 252 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale374 covale ? ? K  MSE 277 C  ? ? ? 1_555 K  ILE 278 N ? ? K MSE 252 K ILE 253 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale375 covale ? ? K  ILE 279 C  ? ? ? 1_555 K  MSE 280 N ? ? K ILE 254 K MSE 255 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale376 covale ? ? K  MSE 280 C  ? ? ? 1_555 K  PRO 281 N ? ? K MSE 255 K PRO 256 1_555 ? ? ? ? ? ? ? 1.361 ? 
covale377 covale ? ? K  CYS 304 C  ? ? ? 1_555 K  MSE 305 N ? ? K CYS 279 K MSE 280 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale378 covale ? ? K  MSE 305 C  ? ? ? 1_555 K  ALA 306 N ? ? K MSE 280 K ALA 281 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale379 covale ? ? K  PRO 327 C  ? ? ? 1_555 K  MSE 328 N ? ? K PRO 302 K MSE 303 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale380 covale ? ? K  MSE 328 C  ? ? ? 1_555 K  VAL 329 N ? ? K MSE 303 K VAL 304 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale381 covale ? ? K  ASP 343 C  ? ? ? 1_555 K  MSE 344 N ? ? K ASP 318 K MSE 319 1_555 ? ? ? ? ? ? ? 1.311 ? 
covale382 covale ? ? K  MSE 344 C  ? ? ? 1_555 K  GLY 345 N ? ? K MSE 319 K GLY 320 1_555 ? ? ? ? ? ? ? 1.304 ? 
covale383 covale ? ? K  ASP 399 C  ? ? ? 1_555 K  MSE 400 N ? ? K ASP 374 K MSE 375 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale384 covale ? ? K  MSE 400 C  ? ? ? 1_555 K  ASP 401 N ? ? K MSE 375 K ASP 376 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale385 covale ? ? K  PRO 427 C  ? ? ? 1_555 K  MSE 428 N ? ? K PRO 402 K MSE 403 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale386 covale ? ? K  MSE 428 C  ? ? ? 1_555 K  LYS 429 N ? ? K MSE 403 K LYS 404 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale387 covale ? ? K  GLY 456 C  ? ? ? 1_555 K  MSE 457 N ? ? K GLY 431 K MSE 432 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale388 covale ? ? K  MSE 457 C  ? ? ? 1_555 K  VAL 458 N ? ? K MSE 432 K VAL 433 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale389 covale ? ? L  MSE 24  C  ? ? ? 1_555 L  TYR 25  N ? ? L MSE -1  L TYR 0   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale390 covale ? ? L  PHE 92  C  ? ? ? 1_555 L  MSE 93  N ? ? L PHE 67  L MSE 68  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale391 covale ? ? L  MSE 93  C  ? ? ? 1_555 L  LYS 94  N ? ? L MSE 68  L LYS 69  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale392 covale ? ? L  ASN 102 C  ? ? ? 1_555 L  MSE 103 N ? ? L ASN 77  L MSE 78  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale393 covale ? ? L  MSE 103 C  ? ? ? 1_555 L  ASN 104 N ? ? L MSE 78  L ASN 79  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale394 covale ? ? L  GLU 108 C  ? ? ? 1_555 L  MSE 109 N ? ? L GLU 83  L MSE 84  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale395 covale ? ? L  MSE 109 C  ? ? ? 1_555 L  LEU 110 N ? ? L MSE 84  L LEU 85  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale396 covale ? ? L  ASP 155 C  ? ? ? 1_555 L  MSE 156 N ? ? L ASP 130 L MSE 131 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale397 covale ? ? L  MSE 156 C  ? ? ? 1_555 L  TYR 157 N ? ? L MSE 131 L TYR 132 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale398 covale ? ? L  GLY 176 C  ? ? ? 1_555 L  MSE 177 N ? ? L GLY 151 L MSE 152 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale399 covale ? ? L  MSE 177 C  ? ? ? 1_555 L  ILE 178 N ? ? L MSE 152 L ILE 153 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale400 covale ? ? L  PRO 179 C  ? ? ? 1_555 L  MSE 180 N ? ? L PRO 154 L MSE 155 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale401 covale ? ? L  MSE 180 C  ? ? ? 1_555 L  TRP 181 N ? ? L MSE 155 L TRP 156 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale402 covale ? ? L  TRP 181 C  ? ? ? 1_555 L  MSE 182 N ? ? L TRP 156 L MSE 157 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale403 covale ? ? L  MSE 182 C  ? ? ? 1_555 L  PHE 183 N ? ? L MSE 157 L PHE 158 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale404 covale ? ? L  LEU 211 C  ? ? ? 1_555 L  MSE 212 N ? ? L LEU 186 L MSE 187 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale405 covale ? ? L  MSE 212 C  ? ? ? 1_555 L  ILE 213 N ? ? L MSE 187 L ILE 188 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale406 covale ? ? L  ALA 261 C  ? ? ? 1_555 L  MSE 262 N ? ? L ALA 236 L MSE 237 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale407 covale ? ? L  MSE 262 C  ? ? ? 1_555 L  ASN 263 N ? ? L MSE 237 L ASN 238 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale408 covale ? ? L  HIS 276 C  ? ? ? 1_555 L  MSE 277 N ? ? L HIS 251 L MSE 252 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale409 covale ? ? L  MSE 277 C  ? ? ? 1_555 L  ILE 278 N ? ? L MSE 252 L ILE 253 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale410 covale ? ? L  ILE 279 C  ? ? ? 1_555 L  MSE 280 N ? ? L ILE 254 L MSE 255 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale411 covale ? ? L  MSE 280 C  ? ? ? 1_555 L  PRO 281 N ? ? L MSE 255 L PRO 256 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale412 covale ? ? L  CYS 304 C  ? ? ? 1_555 L  MSE 305 N ? ? L CYS 279 L MSE 280 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale413 covale ? ? L  MSE 305 C  ? ? ? 1_555 L  ALA 306 N ? ? L MSE 280 L ALA 281 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale414 covale ? ? L  PRO 327 C  ? ? ? 1_555 L  MSE 328 N ? ? L PRO 302 L MSE 303 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale415 covale ? ? L  MSE 328 C  ? ? ? 1_555 L  VAL 329 N ? ? L MSE 303 L VAL 304 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale416 covale ? ? L  ASP 343 C  ? ? ? 1_555 L  MSE 344 N ? ? L ASP 318 L MSE 319 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale417 covale ? ? L  MSE 344 C  ? ? ? 1_555 L  GLY 345 N ? ? L MSE 319 L GLY 320 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale418 covale ? ? L  ASP 399 C  ? ? ? 1_555 L  MSE 400 N ? ? L ASP 374 L MSE 375 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale419 covale ? ? L  MSE 400 C  ? ? ? 1_555 L  ASP 401 N ? ? L MSE 375 L ASP 376 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale420 covale ? ? L  PRO 427 C  ? ? ? 1_555 L  MSE 428 N ? ? L PRO 402 L MSE 403 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale421 covale ? ? L  MSE 428 C  ? ? ? 1_555 L  LYS 429 N ? ? L MSE 403 L LYS 404 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale422 covale ? ? L  GLY 456 C  ? ? ? 1_555 L  MSE 457 N ? ? L GLY 431 L MSE 432 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale423 covale ? ? L  MSE 457 C  ? ? ? 1_555 L  VAL 458 N ? ? L MSE 432 L VAL 433 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale424 covale ? ? M  MSE 24  C  ? ? ? 1_555 M  TYR 25  N ? ? M MSE -1  M TYR 0   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale425 covale ? ? M  PHE 92  C  ? ? ? 1_555 M  MSE 93  N ? ? M PHE 67  M MSE 68  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale426 covale ? ? M  MSE 93  C  ? ? ? 1_555 M  LYS 94  N ? ? M MSE 68  M LYS 69  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale427 covale ? ? M  ASN 102 C  ? ? ? 1_555 M  MSE 103 N ? ? M ASN 77  M MSE 78  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale428 covale ? ? M  MSE 103 C  ? ? ? 1_555 M  ASN 104 N ? ? M MSE 78  M ASN 79  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale429 covale ? ? M  GLU 108 C  ? ? ? 1_555 M  MSE 109 N ? ? M GLU 83  M MSE 84  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale430 covale ? ? M  MSE 109 C  ? ? ? 1_555 M  LEU 110 N ? ? M MSE 84  M LEU 85  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale431 covale ? ? M  ASP 155 C  ? ? ? 1_555 M  MSE 156 N ? ? M ASP 130 M MSE 131 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale432 covale ? ? M  MSE 156 C  ? ? ? 1_555 M  TYR 157 N ? ? M MSE 131 M TYR 132 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale433 covale ? ? M  GLY 176 C  ? ? ? 1_555 M  MSE 177 N ? ? M GLY 151 M MSE 152 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale434 covale ? ? M  MSE 177 C  ? ? ? 1_555 M  ILE 178 N ? ? M MSE 152 M ILE 153 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale435 covale ? ? M  PRO 179 C  ? ? ? 1_555 M  MSE 180 N ? ? M PRO 154 M MSE 155 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale436 covale ? ? M  MSE 180 C  ? ? ? 1_555 M  TRP 181 N ? ? M MSE 155 M TRP 156 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale437 covale ? ? M  TRP 181 C  ? ? ? 1_555 M  MSE 182 N ? ? M TRP 156 M MSE 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale438 covale ? ? M  MSE 182 C  ? ? ? 1_555 M  PHE 183 N ? ? M MSE 157 M PHE 158 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale439 covale ? ? M  LEU 211 C  ? ? ? 1_555 M  MSE 212 N ? ? M LEU 186 M MSE 187 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale440 covale ? ? M  MSE 212 C  ? ? ? 1_555 M  ILE 213 N ? ? M MSE 187 M ILE 188 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale441 covale ? ? M  ALA 261 C  ? ? ? 1_555 M  MSE 262 N ? ? M ALA 236 M MSE 237 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale442 covale ? ? M  MSE 262 C  ? ? ? 1_555 M  ASN 263 N ? ? M MSE 237 M ASN 238 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale443 covale ? ? M  HIS 276 C  ? ? ? 1_555 M  MSE 277 N ? ? M HIS 251 M MSE 252 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale444 covale ? ? M  MSE 277 C  ? ? ? 1_555 M  ILE 278 N ? ? M MSE 252 M ILE 253 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale445 covale ? ? M  ILE 279 C  ? ? ? 1_555 M  MSE 280 N ? ? M ILE 254 M MSE 255 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale446 covale ? ? M  MSE 280 C  ? ? ? 1_555 M  PRO 281 N ? ? M MSE 255 M PRO 256 1_555 ? ? ? ? ? ? ? 1.349 ? 
covale447 covale ? ? M  CYS 304 C  ? ? ? 1_555 M  MSE 305 N ? ? M CYS 279 M MSE 280 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale448 covale ? ? M  MSE 305 C  ? ? ? 1_555 M  ALA 306 N ? ? M MSE 280 M ALA 281 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale449 covale ? ? M  PRO 327 C  ? ? ? 1_555 M  MSE 328 N ? ? M PRO 302 M MSE 303 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale450 covale ? ? M  MSE 328 C  ? ? ? 1_555 M  VAL 329 N ? ? M MSE 303 M VAL 304 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale451 covale ? ? M  ASP 343 C  ? ? ? 1_555 M  MSE 344 N ? ? M ASP 318 M MSE 319 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale452 covale ? ? M  MSE 344 C  ? ? ? 1_555 M  GLY 345 N ? ? M MSE 319 M GLY 320 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale453 covale ? ? M  ASP 399 C  ? ? ? 1_555 M  MSE 400 N ? ? M ASP 374 M MSE 375 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale454 covale ? ? M  MSE 400 C  ? ? ? 1_555 M  ASP 401 N ? ? M MSE 375 M ASP 376 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale455 covale ? ? M  PRO 427 C  ? ? ? 1_555 M  MSE 428 N ? ? M PRO 402 M MSE 403 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale456 covale ? ? M  MSE 428 C  ? ? ? 1_555 M  LYS 429 N ? ? M MSE 403 M LYS 404 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale457 covale ? ? M  GLY 456 C  ? ? ? 1_555 M  MSE 457 N ? ? M GLY 431 M MSE 432 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale458 covale ? ? M  MSE 457 C  ? ? ? 1_555 M  VAL 458 N ? ? M MSE 432 M VAL 433 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale459 covale ? ? N  MSE 24  C  ? ? ? 1_555 N  TYR 25  N ? ? N MSE -1  N TYR 0   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale460 covale ? ? N  PHE 92  C  ? ? ? 1_555 N  MSE 93  N ? ? N PHE 67  N MSE 68  1_555 ? ? ? ? ? ? ? 1.322 ? 
covale461 covale ? ? N  MSE 93  C  ? ? ? 1_555 N  LYS 94  N ? ? N MSE 68  N LYS 69  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale462 covale ? ? N  ASN 102 C  ? ? ? 1_555 N  MSE 103 N ? ? N ASN 77  N MSE 78  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale463 covale ? ? N  MSE 103 C  ? ? ? 1_555 N  ASN 104 N ? ? N MSE 78  N ASN 79  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale464 covale ? ? N  GLU 108 C  ? ? ? 1_555 N  MSE 109 N ? ? N GLU 83  N MSE 84  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale465 covale ? ? N  MSE 109 C  ? ? ? 1_555 N  LEU 110 N ? ? N MSE 84  N LEU 85  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale466 covale ? ? N  ASP 155 C  ? ? ? 1_555 N  MSE 156 N ? ? N ASP 130 N MSE 131 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale467 covale ? ? N  MSE 156 C  ? ? ? 1_555 N  TYR 157 N ? ? N MSE 131 N TYR 132 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale468 covale ? ? N  GLY 176 C  ? ? ? 1_555 N  MSE 177 N ? ? N GLY 151 N MSE 152 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale469 covale ? ? N  MSE 177 C  ? ? ? 1_555 N  ILE 178 N ? ? N MSE 152 N ILE 153 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale470 covale ? ? N  PRO 179 C  ? ? ? 1_555 N  MSE 180 N ? ? N PRO 154 N MSE 155 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale471 covale ? ? N  MSE 180 C  ? ? ? 1_555 N  TRP 181 N ? ? N MSE 155 N TRP 156 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale472 covale ? ? N  TRP 181 C  ? ? ? 1_555 N  MSE 182 N ? ? N TRP 156 N MSE 157 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale473 covale ? ? N  MSE 182 C  ? ? ? 1_555 N  PHE 183 N ? ? N MSE 157 N PHE 158 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale474 covale ? ? N  LEU 211 C  ? ? ? 1_555 N  MSE 212 N ? ? N LEU 186 N MSE 187 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale475 covale ? ? N  MSE 212 C  ? ? ? 1_555 N  ILE 213 N ? ? N MSE 187 N ILE 188 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale476 covale ? ? N  ALA 261 C  ? ? ? 1_555 N  MSE 262 N ? ? N ALA 236 N MSE 237 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale477 covale ? ? N  MSE 262 C  ? ? ? 1_555 N  ASN 263 N ? ? N MSE 237 N ASN 238 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale478 covale ? ? N  HIS 276 C  ? ? ? 1_555 N  MSE 277 N ? ? N HIS 251 N MSE 252 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale479 covale ? ? N  MSE 277 C  ? ? ? 1_555 N  ILE 278 N ? ? N MSE 252 N ILE 253 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale480 covale ? ? N  ILE 279 C  ? ? ? 1_555 N  MSE 280 N ? ? N ILE 254 N MSE 255 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale481 covale ? ? N  MSE 280 C  ? ? ? 1_555 N  PRO 281 N ? ? N MSE 255 N PRO 256 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale482 covale ? ? N  CYS 304 C  ? ? ? 1_555 N  MSE 305 N ? ? N CYS 279 N MSE 280 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale483 covale ? ? N  MSE 305 C  ? ? ? 1_555 N  ALA 306 N ? ? N MSE 280 N ALA 281 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale484 covale ? ? N  PRO 327 C  ? ? ? 1_555 N  MSE 328 N ? ? N PRO 302 N MSE 303 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale485 covale ? ? N  MSE 328 C  ? ? ? 1_555 N  VAL 329 N ? ? N MSE 303 N VAL 304 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale486 covale ? ? N  ASP 343 C  ? ? ? 1_555 N  MSE 344 N ? ? N ASP 318 N MSE 319 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale487 covale ? ? N  MSE 344 C  ? ? ? 1_555 N  GLY 345 N ? ? N MSE 319 N GLY 320 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale488 covale ? ? N  ASP 399 C  ? ? ? 1_555 N  MSE 400 N ? ? N ASP 374 N MSE 375 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale489 covale ? ? N  MSE 400 C  ? ? ? 1_555 N  ASP 401 N ? ? N MSE 375 N ASP 376 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale490 covale ? ? N  PRO 427 C  ? ? ? 1_555 N  MSE 428 N ? ? N PRO 402 N MSE 403 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale491 covale ? ? N  MSE 428 C  ? ? ? 1_555 N  LYS 429 N ? ? N MSE 403 N LYS 404 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale492 covale ? ? N  GLY 456 C  ? ? ? 1_555 N  MSE 457 N ? ? N GLY 431 N MSE 432 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale493 covale ? ? N  MSE 457 C  ? ? ? 1_555 N  VAL 458 N ? ? N MSE 432 N VAL 433 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale494 covale ? ? O  MSE 23  C  ? ? ? 1_555 O  MSE 24  N ? ? O MSE -2  O MSE -1  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale495 covale ? ? O  MSE 24  C  ? ? ? 1_555 O  TYR 25  N ? ? O MSE -1  O TYR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale496 covale ? ? O  PHE 92  C  ? ? ? 1_555 O  MSE 93  N ? ? O PHE 67  O MSE 68  1_555 ? ? ? ? ? ? ? 1.301 ? 
covale497 covale ? ? O  MSE 93  C  ? ? ? 1_555 O  LYS 94  N ? ? O MSE 68  O LYS 69  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale498 covale ? ? O  ASN 102 C  ? ? ? 1_555 O  MSE 103 N ? ? O ASN 77  O MSE 78  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale499 covale ? ? O  MSE 103 C  ? ? ? 1_555 O  ASN 104 N ? ? O MSE 78  O ASN 79  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale500 covale ? ? O  GLU 108 C  ? ? ? 1_555 O  MSE 109 N ? ? O GLU 83  O MSE 84  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale501 covale ? ? O  MSE 109 C  ? ? ? 1_555 O  LEU 110 N ? ? O MSE 84  O LEU 85  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale502 covale ? ? O  ASP 155 C  ? ? ? 1_555 O  MSE 156 N ? ? O ASP 130 O MSE 131 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale503 covale ? ? O  MSE 156 C  ? ? ? 1_555 O  TYR 157 N ? ? O MSE 131 O TYR 132 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale504 covale ? ? O  GLY 176 C  ? ? ? 1_555 O  MSE 177 N ? ? O GLY 151 O MSE 152 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale505 covale ? ? O  MSE 177 C  ? ? ? 1_555 O  ILE 178 N ? ? O MSE 152 O ILE 153 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale506 covale ? ? O  PRO 179 C  ? ? ? 1_555 O  MSE 180 N ? ? O PRO 154 O MSE 155 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale507 covale ? ? O  MSE 180 C  ? ? ? 1_555 O  TRP 181 N ? ? O MSE 155 O TRP 156 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale508 covale ? ? O  TRP 181 C  ? ? ? 1_555 O  MSE 182 N ? ? O TRP 156 O MSE 157 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale509 covale ? ? O  MSE 182 C  ? ? ? 1_555 O  PHE 183 N ? ? O MSE 157 O PHE 158 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale510 covale ? ? O  LEU 211 C  ? ? ? 1_555 O  MSE 212 N ? ? O LEU 186 O MSE 187 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale511 covale ? ? O  MSE 212 C  ? ? ? 1_555 O  ILE 213 N ? ? O MSE 187 O ILE 188 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale512 covale ? ? O  ALA 261 C  ? ? ? 1_555 O  MSE 262 N ? ? O ALA 236 O MSE 237 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale513 covale ? ? O  MSE 262 C  ? ? ? 1_555 O  ASN 263 N ? ? O MSE 237 O ASN 238 1_555 ? ? ? ? ? ? ? 1.304 ? 
covale514 covale ? ? O  HIS 276 C  ? ? ? 1_555 O  MSE 277 N ? ? O HIS 251 O MSE 252 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale515 covale ? ? O  MSE 277 C  ? ? ? 1_555 O  ILE 278 N ? ? O MSE 252 O ILE 253 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale516 covale ? ? O  ILE 279 C  ? ? ? 1_555 O  MSE 280 N ? ? O ILE 254 O MSE 255 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale517 covale ? ? O  MSE 280 C  ? ? ? 1_555 O  PRO 281 N ? ? O MSE 255 O PRO 256 1_555 ? ? ? ? ? ? ? 1.358 ? 
covale518 covale ? ? O  CYS 304 C  ? ? ? 1_555 O  MSE 305 N ? ? O CYS 279 O MSE 280 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale519 covale ? ? O  MSE 305 C  ? ? ? 1_555 O  ALA 306 N ? ? O MSE 280 O ALA 281 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale520 covale ? ? O  PRO 327 C  ? ? ? 1_555 O  MSE 328 N ? ? O PRO 302 O MSE 303 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale521 covale ? ? O  MSE 328 C  ? ? ? 1_555 O  VAL 329 N ? ? O MSE 303 O VAL 304 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale522 covale ? ? O  ASP 343 C  ? ? ? 1_555 O  MSE 344 N ? ? O ASP 318 O MSE 319 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale523 covale ? ? O  MSE 344 C  ? ? ? 1_555 O  GLY 345 N ? ? O MSE 319 O GLY 320 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale524 covale ? ? O  ASP 399 C  ? ? ? 1_555 O  MSE 400 N ? ? O ASP 374 O MSE 375 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale525 covale ? ? O  MSE 400 C  ? ? ? 1_555 O  ASP 401 N ? ? O MSE 375 O ASP 376 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale526 covale ? ? O  PRO 427 C  ? ? ? 1_555 O  MSE 428 N ? ? O PRO 402 O MSE 403 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale527 covale ? ? O  MSE 428 C  ? ? ? 1_555 O  LYS 429 N ? ? O MSE 403 O LYS 404 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale528 covale ? ? O  GLY 456 C  ? ? ? 1_555 O  MSE 457 N ? ? O GLY 431 O MSE 432 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale529 covale ? ? O  MSE 457 C  ? ? ? 1_555 O  VAL 458 N ? ? O MSE 432 O VAL 433 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale530 covale ? ? P  MSE 24  C  ? ? ? 1_555 P  TYR 25  N ? ? P MSE -1  P TYR 0   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale531 covale ? ? P  PHE 92  C  ? ? ? 1_555 P  MSE 93  N ? ? P PHE 67  P MSE 68  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale532 covale ? ? P  MSE 93  C  ? ? ? 1_555 P  LYS 94  N ? ? P MSE 68  P LYS 69  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale533 covale ? ? P  ASN 102 C  ? ? ? 1_555 P  MSE 103 N ? ? P ASN 77  P MSE 78  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale534 covale ? ? P  MSE 103 C  ? ? ? 1_555 P  ASN 104 N ? ? P MSE 78  P ASN 79  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale535 covale ? ? P  GLU 108 C  ? ? ? 1_555 P  MSE 109 N ? ? P GLU 83  P MSE 84  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale536 covale ? ? P  MSE 109 C  ? ? ? 1_555 P  LEU 110 N ? ? P MSE 84  P LEU 85  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale537 covale ? ? P  ASP 155 C  ? ? ? 1_555 P  MSE 156 N ? ? P ASP 130 P MSE 131 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale538 covale ? ? P  MSE 156 C  ? ? ? 1_555 P  TYR 157 N ? ? P MSE 131 P TYR 132 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale539 covale ? ? P  GLY 176 C  ? ? ? 1_555 P  MSE 177 N ? ? P GLY 151 P MSE 152 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale540 covale ? ? P  MSE 177 C  ? ? ? 1_555 P  ILE 178 N ? ? P MSE 152 P ILE 153 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale541 covale ? ? P  PRO 179 C  ? ? ? 1_555 P  MSE 180 N ? ? P PRO 154 P MSE 155 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale542 covale ? ? P  MSE 180 C  ? ? ? 1_555 P  TRP 181 N ? ? P MSE 155 P TRP 156 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale543 covale ? ? P  TRP 181 C  ? ? ? 1_555 P  MSE 182 N ? ? P TRP 156 P MSE 157 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale544 covale ? ? P  MSE 182 C  ? ? ? 1_555 P  PHE 183 N ? ? P MSE 157 P PHE 158 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale545 covale ? ? P  LEU 211 C  ? ? ? 1_555 P  MSE 212 N ? ? P LEU 186 P MSE 187 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale546 covale ? ? P  MSE 212 C  ? ? ? 1_555 P  ILE 213 N ? ? P MSE 187 P ILE 188 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale547 covale ? ? P  ALA 261 C  ? ? ? 1_555 P  MSE 262 N ? ? P ALA 236 P MSE 237 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale548 covale ? ? P  MSE 262 C  ? ? ? 1_555 P  ASN 263 N ? ? P MSE 237 P ASN 238 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale549 covale ? ? P  HIS 276 C  ? ? ? 1_555 P  MSE 277 N ? ? P HIS 251 P MSE 252 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale550 covale ? ? P  MSE 277 C  ? ? ? 1_555 P  ILE 278 N ? ? P MSE 252 P ILE 253 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale551 covale ? ? P  ILE 279 C  ? ? ? 1_555 P  MSE 280 N ? ? P ILE 254 P MSE 255 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale552 covale ? ? P  MSE 280 C  ? ? ? 1_555 P  PRO 281 N ? ? P MSE 255 P PRO 256 1_555 ? ? ? ? ? ? ? 1.356 ? 
covale553 covale ? ? P  CYS 304 C  ? ? ? 1_555 P  MSE 305 N ? ? P CYS 279 P MSE 280 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale554 covale ? ? P  MSE 305 C  ? ? ? 1_555 P  ALA 306 N ? ? P MSE 280 P ALA 281 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale555 covale ? ? P  PRO 327 C  ? ? ? 1_555 P  MSE 328 N ? ? P PRO 302 P MSE 303 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale556 covale ? ? P  MSE 328 C  ? ? ? 1_555 P  VAL 329 N ? ? P MSE 303 P VAL 304 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale557 covale ? ? P  ASP 343 C  ? ? ? 1_555 P  MSE 344 N ? ? P ASP 318 P MSE 319 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale558 covale ? ? P  MSE 344 C  ? ? ? 1_555 P  GLY 345 N ? ? P MSE 319 P GLY 320 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale559 covale ? ? P  ASP 399 C  ? ? ? 1_555 P  MSE 400 N ? ? P ASP 374 P MSE 375 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale560 covale ? ? P  MSE 400 C  ? ? ? 1_555 P  ASP 401 N ? ? P MSE 375 P ASP 376 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale561 covale ? ? P  PRO 427 C  ? ? ? 1_555 P  MSE 428 N ? ? P PRO 402 P MSE 403 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale562 covale ? ? P  MSE 428 C  ? ? ? 1_555 P  LYS 429 N ? ? P MSE 403 P LYS 404 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale563 covale ? ? P  GLY 456 C  ? ? ? 1_555 P  MSE 457 N ? ? P GLY 431 P MSE 432 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale564 covale ? ? P  MSE 457 C  ? ? ? 1_555 P  VAL 458 N ? ? P MSE 432 P VAL 433 1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc1   metalc ? ? DA MG  .   MG ? ? ? 1_555 UA HOH .   O ? ? I MG  502 I HOH 750 1_555 ? ? ? ? ? ? ? 1.861 ? 
metalc2   metalc ? ? AA MG  .   MG ? ? ? 1_555 OA HOH .   O ? ? G MG  502 C HOH 797 1_555 ? ? ? ? ? ? ? 1.874 ? 
metalc3   metalc ? ? R  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  502 A HOH 792 1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc4   metalc ? ? KA MG  .   MG ? ? ? 1_555 WA HOH .   O ? ? O MG  502 K HOH 917 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc5   metalc ? ? KA MG  .   MG ? ? ? 1_555 WA HOH .   O ? ? O MG  502 K HOH 813 1_555 ? ? ? ? ? ? ? 2.016 ? 
metalc6   metalc ? ? Y  MG  .   MG ? ? ? 1_555 RA HOH .   O ? ? F MG  502 F HOH 894 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc7   metalc ? ? S  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  503 A HOH 803 1_555 ? ? ? ? ? ? ? 2.076 ? 
metalc8   metalc ? ? R  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  502 A HOH 918 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc9   metalc ? ? Y  MG  .   MG ? ? ? 1_555 RA HOH .   O ? ? F MG  502 F HOH 792 1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc10  metalc ? ? S  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  503 A HOH 921 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc11  metalc ? ? R  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  502 A HOH 919 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc12  metalc ? ? S  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  503 A HOH 922 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc13  metalc ? ? DA MG  .   MG ? ? ? 1_555 UA HOH .   O ? ? I MG  502 I HOH 867 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc14  metalc ? ? S  MG  .   MG ? ? ? 1_555 MA HOH .   O ? ? A MG  503 A HOH 837 1_555 ? ? ? ? ? ? ? 2.493 ? 
metalc15  metalc ? ? DA MG  .   MG ? ? ? 1_555 UA HOH .   O ? ? I MG  502 I HOH 866 1_555 ? ? ? ? ? ? ? 2.591 ? 
metalc16  metalc ? ? AA MG  .   MG ? ? ? 1_555 SA HOH .   O ? ? G MG  502 G HOH 869 1_555 ? ? ? ? ? ? ? 2.610 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3  ? 
B  ? 2  ? 
C  ? 20 ? 
D  ? 6  ? 
E  ? 20 ? 
F  ? 2  ? 
G  ? 3  ? 
H  ? 2  ? 
I  ? 6  ? 
J  ? 2  ? 
K  ? 3  ? 
L  ? 2  ? 
M  ? 6  ? 
N  ? 2  ? 
O  ? 3  ? 
P  ? 2  ? 
Q  ? 6  ? 
R  ? 2  ? 
S  ? 3  ? 
T  ? 2  ? 
U  ? 20 ? 
V  ? 6  ? 
W  ? 20 ? 
X  ? 2  ? 
Y  ? 3  ? 
Z  ? 2  ? 
AA ? 6  ? 
AB ? 2  ? 
AC ? 3  ? 
AD ? 2  ? 
AE ? 6  ? 
AF ? 2  ? 
AG ? 3  ? 
AH ? 2  ? 
AI ? 6  ? 
AJ ? 2  ? 
AK ? 3  ? 
AL ? 2  ? 
AM ? 20 ? 
AN ? 6  ? 
AO ? 20 ? 
AP ? 2  ? 
AQ ? 3  ? 
AR ? 2  ? 
AS ? 6  ? 
AT ? 2  ? 
AU ? 3  ? 
AV ? 2  ? 
AW ? 6  ? 
AX ? 2  ? 
AY ? 3  ? 
AZ ? 2  ? 
BA ? 6  ? 
BB ? 2  ? 
BC ? 3  ? 
BD ? 2  ? 
BE ? 20 ? 
BF ? 6  ? 
BG ? 20 ? 
BH ? 2  ? 
BI ? 3  ? 
BJ ? 2  ? 
BK ? 6  ? 
BL ? 2  ? 
BM ? 3  ? 
BN ? 2  ? 
BO ? 6  ? 
BP ? 2  ? 
BQ ? 3  ? 
BR ? 2  ? 
BS ? 6  ? 
BT ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? parallel      
A  2  3  ? anti-parallel 
B  1  2  ? anti-parallel 
C  1  2  ? anti-parallel 
C  2  3  ? parallel      
C  3  4  ? parallel      
C  4  5  ? parallel      
C  5  6  ? parallel      
C  6  7  ? parallel      
C  7  8  ? parallel      
C  8  9  ? anti-parallel 
C  9  10 ? anti-parallel 
C  10 11 ? anti-parallel 
C  11 12 ? anti-parallel 
C  12 13 ? anti-parallel 
C  13 14 ? parallel      
C  14 15 ? parallel      
C  15 16 ? parallel      
C  16 17 ? parallel      
C  17 18 ? parallel      
C  18 19 ? parallel      
C  19 20 ? anti-parallel 
D  1  2  ? parallel      
D  2  3  ? parallel      
D  3  4  ? parallel      
D  4  5  ? parallel      
D  5  6  ? anti-parallel 
E  1  2  ? anti-parallel 
E  2  3  ? parallel      
E  3  4  ? parallel      
E  4  5  ? parallel      
E  5  6  ? parallel      
E  6  7  ? parallel      
E  7  8  ? parallel      
E  8  9  ? anti-parallel 
E  9  10 ? anti-parallel 
E  10 11 ? anti-parallel 
E  11 12 ? anti-parallel 
E  12 13 ? anti-parallel 
E  13 14 ? parallel      
E  14 15 ? parallel      
E  15 16 ? parallel      
E  16 17 ? parallel      
E  17 18 ? parallel      
E  18 19 ? parallel      
E  19 20 ? anti-parallel 
F  1  2  ? anti-parallel 
G  1  2  ? parallel      
G  2  3  ? anti-parallel 
H  1  2  ? anti-parallel 
I  1  2  ? parallel      
I  2  3  ? parallel      
I  3  4  ? parallel      
I  4  5  ? parallel      
I  5  6  ? anti-parallel 
J  1  2  ? anti-parallel 
K  1  2  ? parallel      
K  2  3  ? anti-parallel 
L  1  2  ? anti-parallel 
M  1  2  ? parallel      
M  2  3  ? parallel      
M  3  4  ? parallel      
M  4  5  ? parallel      
M  5  6  ? anti-parallel 
N  1  2  ? anti-parallel 
O  1  2  ? parallel      
O  2  3  ? anti-parallel 
P  1  2  ? anti-parallel 
Q  1  2  ? parallel      
Q  2  3  ? parallel      
Q  3  4  ? parallel      
Q  4  5  ? parallel      
Q  5  6  ? anti-parallel 
R  1  2  ? anti-parallel 
S  1  2  ? parallel      
S  2  3  ? anti-parallel 
T  1  2  ? anti-parallel 
U  1  2  ? anti-parallel 
U  2  3  ? parallel      
U  3  4  ? parallel      
U  4  5  ? parallel      
U  5  6  ? parallel      
U  6  7  ? parallel      
U  7  8  ? parallel      
U  8  9  ? anti-parallel 
U  9  10 ? anti-parallel 
U  10 11 ? anti-parallel 
U  11 12 ? anti-parallel 
U  12 13 ? anti-parallel 
U  13 14 ? parallel      
U  14 15 ? parallel      
U  15 16 ? parallel      
U  16 17 ? parallel      
U  17 18 ? parallel      
U  18 19 ? parallel      
U  19 20 ? anti-parallel 
V  1  2  ? parallel      
V  2  3  ? parallel      
V  3  4  ? parallel      
V  4  5  ? parallel      
V  5  6  ? anti-parallel 
W  1  2  ? anti-parallel 
W  2  3  ? parallel      
W  3  4  ? parallel      
W  4  5  ? parallel      
W  5  6  ? parallel      
W  6  7  ? parallel      
W  7  8  ? parallel      
W  8  9  ? anti-parallel 
W  9  10 ? anti-parallel 
W  10 11 ? anti-parallel 
W  11 12 ? anti-parallel 
W  12 13 ? anti-parallel 
W  13 14 ? parallel      
W  14 15 ? parallel      
W  15 16 ? parallel      
W  16 17 ? parallel      
W  17 18 ? parallel      
W  18 19 ? parallel      
W  19 20 ? anti-parallel 
X  1  2  ? anti-parallel 
Y  1  2  ? parallel      
Y  2  3  ? anti-parallel 
Z  1  2  ? anti-parallel 
AA 1  2  ? parallel      
AA 2  3  ? parallel      
AA 3  4  ? parallel      
AA 4  5  ? parallel      
AA 5  6  ? anti-parallel 
AB 1  2  ? anti-parallel 
AC 1  2  ? parallel      
AC 2  3  ? anti-parallel 
AD 1  2  ? anti-parallel 
AE 1  2  ? parallel      
AE 2  3  ? parallel      
AE 3  4  ? parallel      
AE 4  5  ? parallel      
AE 5  6  ? anti-parallel 
AF 1  2  ? anti-parallel 
AG 1  2  ? parallel      
AG 2  3  ? anti-parallel 
AH 1  2  ? anti-parallel 
AI 1  2  ? parallel      
AI 2  3  ? parallel      
AI 3  4  ? parallel      
AI 4  5  ? parallel      
AI 5  6  ? anti-parallel 
AJ 1  2  ? anti-parallel 
AK 1  2  ? parallel      
AK 2  3  ? anti-parallel 
AL 1  2  ? anti-parallel 
AM 1  2  ? anti-parallel 
AM 2  3  ? parallel      
AM 3  4  ? parallel      
AM 4  5  ? parallel      
AM 5  6  ? parallel      
AM 6  7  ? parallel      
AM 7  8  ? parallel      
AM 8  9  ? anti-parallel 
AM 9  10 ? anti-parallel 
AM 10 11 ? anti-parallel 
AM 11 12 ? anti-parallel 
AM 12 13 ? anti-parallel 
AM 13 14 ? parallel      
AM 14 15 ? parallel      
AM 15 16 ? parallel      
AM 16 17 ? parallel      
AM 17 18 ? parallel      
AM 18 19 ? parallel      
AM 19 20 ? anti-parallel 
AN 1  2  ? parallel      
AN 2  3  ? parallel      
AN 3  4  ? parallel      
AN 4  5  ? parallel      
AN 5  6  ? anti-parallel 
AO 1  2  ? anti-parallel 
AO 2  3  ? parallel      
AO 3  4  ? parallel      
AO 4  5  ? parallel      
AO 5  6  ? parallel      
AO 6  7  ? parallel      
AO 7  8  ? parallel      
AO 8  9  ? anti-parallel 
AO 9  10 ? anti-parallel 
AO 10 11 ? anti-parallel 
AO 11 12 ? anti-parallel 
AO 12 13 ? anti-parallel 
AO 13 14 ? parallel      
AO 14 15 ? parallel      
AO 15 16 ? parallel      
AO 16 17 ? parallel      
AO 17 18 ? parallel      
AO 18 19 ? parallel      
AO 19 20 ? anti-parallel 
AP 1  2  ? anti-parallel 
AQ 1  2  ? parallel      
AQ 2  3  ? anti-parallel 
AR 1  2  ? anti-parallel 
AS 1  2  ? parallel      
AS 2  3  ? parallel      
AS 3  4  ? parallel      
AS 4  5  ? parallel      
AS 5  6  ? anti-parallel 
AT 1  2  ? anti-parallel 
AU 1  2  ? parallel      
AU 2  3  ? anti-parallel 
AV 1  2  ? anti-parallel 
AW 1  2  ? parallel      
AW 2  3  ? parallel      
AW 3  4  ? parallel      
AW 4  5  ? parallel      
AW 5  6  ? anti-parallel 
AX 1  2  ? anti-parallel 
AY 1  2  ? parallel      
AY 2  3  ? anti-parallel 
AZ 1  2  ? anti-parallel 
BA 1  2  ? parallel      
BA 2  3  ? parallel      
BA 3  4  ? parallel      
BA 4  5  ? parallel      
BA 5  6  ? anti-parallel 
BB 1  2  ? anti-parallel 
BC 1  2  ? parallel      
BC 2  3  ? anti-parallel 
BD 1  2  ? anti-parallel 
BE 1  2  ? anti-parallel 
BE 2  3  ? parallel      
BE 3  4  ? parallel      
BE 4  5  ? parallel      
BE 5  6  ? parallel      
BE 6  7  ? parallel      
BE 7  8  ? parallel      
BE 8  9  ? anti-parallel 
BE 9  10 ? anti-parallel 
BE 10 11 ? anti-parallel 
BE 11 12 ? anti-parallel 
BE 12 13 ? anti-parallel 
BE 13 14 ? parallel      
BE 14 15 ? parallel      
BE 15 16 ? parallel      
BE 16 17 ? parallel      
BE 17 18 ? parallel      
BE 18 19 ? parallel      
BE 19 20 ? anti-parallel 
BF 1  2  ? parallel      
BF 2  3  ? parallel      
BF 3  4  ? parallel      
BF 4  5  ? parallel      
BF 5  6  ? anti-parallel 
BG 1  2  ? anti-parallel 
BG 2  3  ? parallel      
BG 3  4  ? parallel      
BG 4  5  ? parallel      
BG 5  6  ? parallel      
BG 6  7  ? parallel      
BG 7  8  ? parallel      
BG 8  9  ? anti-parallel 
BG 9  10 ? anti-parallel 
BG 10 11 ? anti-parallel 
BG 11 12 ? anti-parallel 
BG 12 13 ? anti-parallel 
BG 13 14 ? parallel      
BG 14 15 ? parallel      
BG 15 16 ? parallel      
BG 16 17 ? parallel      
BG 17 18 ? parallel      
BG 18 19 ? parallel      
BG 19 20 ? anti-parallel 
BH 1  2  ? anti-parallel 
BI 1  2  ? parallel      
BI 2  3  ? anti-parallel 
BJ 1  2  ? anti-parallel 
BK 1  2  ? parallel      
BK 2  3  ? parallel      
BK 3  4  ? parallel      
BK 4  5  ? parallel      
BK 5  6  ? anti-parallel 
BL 1  2  ? anti-parallel 
BM 1  2  ? parallel      
BM 2  3  ? anti-parallel 
BN 1  2  ? anti-parallel 
BO 1  2  ? parallel      
BO 2  3  ? parallel      
BO 3  4  ? parallel      
BO 4  5  ? parallel      
BO 5  6  ? anti-parallel 
BP 1  2  ? anti-parallel 
BQ 1  2  ? parallel      
BQ 2  3  ? anti-parallel 
BR 1  2  ? anti-parallel 
BS 1  2  ? parallel      
BS 2  3  ? parallel      
BS 3  4  ? parallel      
BS 4  5  ? parallel      
BS 5  6  ? anti-parallel 
BT 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  TYR A 25  ? LEU A 27  ? TYR A 0   LEU A 2   
A  2  VAL A 54  ? ALA A 59  ? VAL A 29  ALA A 34  
A  3  VAL A 43  ? PHE A 47  ? VAL A 18  PHE A 22  
B  1  HIS A 29  ? ILE A 31  ? HIS A 4   ILE A 6   
B  2  LYS A 34  ? VAL A 36  ? LYS A 9   VAL A 11  
C  1  LYS B 369 ? VAL B 372 ? LYS B 344 VAL B 347 
C  2  CYS B 391 ? ASP B 394 ? CYS B 366 ASP B 369 
C  3  VAL B 411 ? VAL B 414 ? VAL B 386 VAL B 389 
C  4  ILE B 307 ? PRO B 312 ? ILE B 282 PRO B 287 
C  5  ASN B 275 ? ILE B 279 ? ASN B 250 ILE B 254 
C  6  GLY B 435 ? TYR B 439 ? GLY B 410 TYR B 414 
C  7  MSE B 457 ? VAL B 460 ? MSE B 432 VAL B 435 
C  8  THR A 496 ? SER A 503 ? THR A 471 SER A 478 
C  9  ILE A 154 ? PRO A 162 ? ILE A 129 PRO A 137 
C  10 SER A 144 ? GLY A 151 ? SER A 119 GLY A 126 
C  11 SER D 144 ? GLY D 151 ? SER D 119 GLY D 126 
C  12 ILE D 154 ? PRO D 162 ? ILE D 129 PRO D 137 
C  13 THR D 496 ? SER D 503 ? THR D 471 SER D 478 
C  14 MSE C 457 ? VAL C 460 ? MSE C 432 VAL C 435 
C  15 GLY C 435 ? TYR C 439 ? GLY C 410 TYR C 414 
C  16 ASN C 275 ? ILE C 279 ? ASN C 250 ILE C 254 
C  17 ILE C 307 ? PRO C 312 ? ILE C 282 PRO C 287 
C  18 VAL C 411 ? VAL C 414 ? VAL C 386 VAL C 389 
C  19 CYS C 391 ? ASP C 394 ? CYS C 366 ASP C 369 
C  20 LYS C 369 ? VAL C 372 ? LYS C 344 VAL C 347 
D  1  LEU A 222 ? VAL A 224 ? LEU A 197 VAL A 199 
D  2  ALA A 192 ? LYS A 196 ? ALA A 167 LYS A 171 
D  3  ILE A 165 ? ILE A 169 ? ILE A 140 ILE A 144 
D  4  ALA A 243 ? VAL A 247 ? ALA A 218 VAL A 222 
D  5  ARG A 266 ? PHE A 270 ? ARG A 241 PHE A 245 
D  6  SER A 480 ? PHE A 481 ? SER A 455 PHE A 456 
E  1  LYS A 369 ? VAL A 372 ? LYS A 344 VAL A 347 
E  2  CYS A 391 ? ASP A 394 ? CYS A 366 ASP A 369 
E  3  VAL A 411 ? VAL A 414 ? VAL A 386 VAL A 389 
E  4  ILE A 307 ? PRO A 312 ? ILE A 282 PRO A 287 
E  5  ASN A 275 ? ILE A 279 ? ASN A 250 ILE A 254 
E  6  GLY A 435 ? TYR A 439 ? GLY A 410 TYR A 414 
E  7  MSE A 457 ? VAL A 460 ? MSE A 432 VAL A 435 
E  8  THR B 496 ? SER B 503 ? THR B 471 SER B 478 
E  9  ILE B 154 ? PRO B 162 ? ILE B 129 PRO B 137 
E  10 SER B 144 ? GLY B 151 ? SER B 119 GLY B 126 
E  11 SER C 144 ? GLY C 151 ? SER C 119 GLY C 126 
E  12 ILE C 154 ? PRO C 162 ? ILE C 129 PRO C 137 
E  13 THR C 496 ? SER C 503 ? THR C 471 SER C 478 
E  14 MSE D 457 ? VAL D 460 ? MSE D 432 VAL D 435 
E  15 GLY D 435 ? TYR D 439 ? GLY D 410 TYR D 414 
E  16 ASN D 275 ? ILE D 279 ? ASN D 250 ILE D 254 
E  17 ILE D 307 ? PRO D 312 ? ILE D 282 PRO D 287 
E  18 VAL D 411 ? VAL D 414 ? VAL D 386 VAL D 389 
E  19 CYS D 391 ? ASP D 394 ? CYS D 366 ASP D 369 
E  20 LYS D 369 ? VAL D 372 ? LYS D 344 VAL D 347 
F  1  TYR A 432 ? GLY A 433 ? TYR A 407 GLY A 408 
F  2  TRP A 476 ? LYS A 477 ? TRP A 451 LYS A 452 
G  1  TYR B 25  ? LEU B 27  ? TYR B 0   LEU B 2   
G  2  VAL B 54  ? ALA B 59  ? VAL B 29  ALA B 34  
G  3  VAL B 43  ? PHE B 47  ? VAL B 18  PHE B 22  
H  1  HIS B 29  ? ILE B 31  ? HIS B 4   ILE B 6   
H  2  LYS B 34  ? VAL B 36  ? LYS B 9   VAL B 11  
I  1  LEU B 222 ? VAL B 224 ? LEU B 197 VAL B 199 
I  2  ALA B 192 ? LYS B 196 ? ALA B 167 LYS B 171 
I  3  ILE B 165 ? ILE B 169 ? ILE B 140 ILE B 144 
I  4  ALA B 243 ? VAL B 247 ? ALA B 218 VAL B 222 
I  5  ARG B 266 ? PHE B 270 ? ARG B 241 PHE B 245 
I  6  SER B 480 ? PHE B 481 ? SER B 455 PHE B 456 
J  1  TYR B 432 ? GLY B 433 ? TYR B 407 GLY B 408 
J  2  TRP B 476 ? LYS B 477 ? TRP B 451 LYS B 452 
K  1  TYR C 25  ? LEU C 27  ? TYR C 0   LEU C 2   
K  2  VAL C 54  ? ALA C 59  ? VAL C 29  ALA C 34  
K  3  VAL C 43  ? PHE C 47  ? VAL C 18  PHE C 22  
L  1  HIS C 29  ? ILE C 31  ? HIS C 4   ILE C 6   
L  2  LYS C 34  ? VAL C 36  ? LYS C 9   VAL C 11  
M  1  LEU C 222 ? VAL C 224 ? LEU C 197 VAL C 199 
M  2  ALA C 192 ? LYS C 196 ? ALA C 167 LYS C 171 
M  3  ILE C 165 ? ILE C 169 ? ILE C 140 ILE C 144 
M  4  ALA C 243 ? VAL C 247 ? ALA C 218 VAL C 222 
M  5  ARG C 266 ? PHE C 270 ? ARG C 241 PHE C 245 
M  6  SER C 480 ? PHE C 481 ? SER C 455 PHE C 456 
N  1  TYR C 432 ? GLY C 433 ? TYR C 407 GLY C 408 
N  2  TRP C 476 ? LYS C 477 ? TRP C 451 LYS C 452 
O  1  TYR D 25  ? LEU D 27  ? TYR D 0   LEU D 2   
O  2  VAL D 54  ? ALA D 59  ? VAL D 29  ALA D 34  
O  3  VAL D 43  ? PHE D 47  ? VAL D 18  PHE D 22  
P  1  HIS D 29  ? ILE D 31  ? HIS D 4   ILE D 6   
P  2  LYS D 34  ? VAL D 36  ? LYS D 9   VAL D 11  
Q  1  LEU D 222 ? VAL D 224 ? LEU D 197 VAL D 199 
Q  2  ALA D 192 ? LYS D 196 ? ALA D 167 LYS D 171 
Q  3  ILE D 165 ? ILE D 169 ? ILE D 140 ILE D 144 
Q  4  ALA D 243 ? VAL D 247 ? ALA D 218 VAL D 222 
Q  5  ARG D 266 ? PHE D 270 ? ARG D 241 PHE D 245 
Q  6  SER D 480 ? PHE D 481 ? SER D 455 PHE D 456 
R  1  TYR D 432 ? GLY D 433 ? TYR D 407 GLY D 408 
R  2  TRP D 476 ? LYS D 477 ? TRP D 451 LYS D 452 
S  1  TYR E 25  ? LEU E 27  ? TYR E 0   LEU E 2   
S  2  VAL E 54  ? ALA E 59  ? VAL E 29  ALA E 34  
S  3  VAL E 43  ? PHE E 47  ? VAL E 18  PHE E 22  
T  1  HIS E 29  ? ILE E 31  ? HIS E 4   ILE E 6   
T  2  LYS E 34  ? VAL E 36  ? LYS E 9   VAL E 11  
U  1  LYS F 369 ? VAL F 372 ? LYS F 344 VAL F 347 
U  2  CYS F 391 ? ASP F 394 ? CYS F 366 ASP F 369 
U  3  VAL F 411 ? VAL F 414 ? VAL F 386 VAL F 389 
U  4  ILE F 307 ? PRO F 312 ? ILE F 282 PRO F 287 
U  5  ASN F 275 ? ILE F 279 ? ASN F 250 ILE F 254 
U  6  GLY F 435 ? TYR F 439 ? GLY F 410 TYR F 414 
U  7  MSE F 457 ? VAL F 460 ? MSE F 432 VAL F 435 
U  8  THR E 496 ? SER E 503 ? THR E 471 SER E 478 
U  9  ILE E 154 ? PRO E 162 ? ILE E 129 PRO E 137 
U  10 SER E 144 ? GLY E 151 ? SER E 119 GLY E 126 
U  11 SER H 144 ? GLY H 151 ? SER H 119 GLY H 126 
U  12 ILE H 154 ? PRO H 162 ? ILE H 129 PRO H 137 
U  13 THR H 496 ? SER H 503 ? THR H 471 SER H 478 
U  14 MSE G 457 ? VAL G 460 ? MSE G 432 VAL G 435 
U  15 GLY G 435 ? TYR G 439 ? GLY G 410 TYR G 414 
U  16 ASN G 275 ? ILE G 279 ? ASN G 250 ILE G 254 
U  17 ILE G 307 ? PRO G 312 ? ILE G 282 PRO G 287 
U  18 VAL G 411 ? VAL G 414 ? VAL G 386 VAL G 389 
U  19 CYS G 391 ? ASP G 394 ? CYS G 366 ASP G 369 
U  20 LYS G 369 ? VAL G 372 ? LYS G 344 VAL G 347 
V  1  LEU E 222 ? VAL E 224 ? LEU E 197 VAL E 199 
V  2  ALA E 192 ? LYS E 196 ? ALA E 167 LYS E 171 
V  3  ILE E 165 ? ILE E 169 ? ILE E 140 ILE E 144 
V  4  ALA E 243 ? VAL E 247 ? ALA E 218 VAL E 222 
V  5  ARG E 266 ? PHE E 270 ? ARG E 241 PHE E 245 
V  6  SER E 480 ? PHE E 481 ? SER E 455 PHE E 456 
W  1  LYS E 369 ? VAL E 372 ? LYS E 344 VAL E 347 
W  2  CYS E 391 ? ASP E 394 ? CYS E 366 ASP E 369 
W  3  VAL E 411 ? VAL E 414 ? VAL E 386 VAL E 389 
W  4  ILE E 307 ? PRO E 312 ? ILE E 282 PRO E 287 
W  5  ASN E 275 ? ILE E 279 ? ASN E 250 ILE E 254 
W  6  GLY E 435 ? TYR E 439 ? GLY E 410 TYR E 414 
W  7  MSE E 457 ? VAL E 460 ? MSE E 432 VAL E 435 
W  8  THR F 496 ? SER F 503 ? THR F 471 SER F 478 
W  9  ILE F 154 ? PRO F 162 ? ILE F 129 PRO F 137 
W  10 SER F 144 ? GLY F 151 ? SER F 119 GLY F 126 
W  11 SER G 144 ? GLY G 151 ? SER G 119 GLY G 126 
W  12 ILE G 154 ? PRO G 162 ? ILE G 129 PRO G 137 
W  13 THR G 496 ? SER G 503 ? THR G 471 SER G 478 
W  14 MSE H 457 ? VAL H 460 ? MSE H 432 VAL H 435 
W  15 GLY H 435 ? TYR H 439 ? GLY H 410 TYR H 414 
W  16 ASN H 275 ? ILE H 279 ? ASN H 250 ILE H 254 
W  17 ILE H 307 ? PRO H 312 ? ILE H 282 PRO H 287 
W  18 VAL H 411 ? VAL H 414 ? VAL H 386 VAL H 389 
W  19 CYS H 391 ? ASP H 394 ? CYS H 366 ASP H 369 
W  20 LYS H 369 ? VAL H 372 ? LYS H 344 VAL H 347 
X  1  TYR E 432 ? GLY E 433 ? TYR E 407 GLY E 408 
X  2  TRP E 476 ? LYS E 477 ? TRP E 451 LYS E 452 
Y  1  TYR F 25  ? LEU F 27  ? TYR F 0   LEU F 2   
Y  2  VAL F 54  ? ALA F 59  ? VAL F 29  ALA F 34  
Y  3  VAL F 43  ? PHE F 47  ? VAL F 18  PHE F 22  
Z  1  HIS F 29  ? ILE F 31  ? HIS F 4   ILE F 6   
Z  2  LYS F 34  ? VAL F 36  ? LYS F 9   VAL F 11  
AA 1  LEU F 222 ? VAL F 224 ? LEU F 197 VAL F 199 
AA 2  ALA F 192 ? LYS F 196 ? ALA F 167 LYS F 171 
AA 3  ILE F 165 ? ILE F 169 ? ILE F 140 ILE F 144 
AA 4  ALA F 243 ? VAL F 247 ? ALA F 218 VAL F 222 
AA 5  ARG F 266 ? PHE F 270 ? ARG F 241 PHE F 245 
AA 6  SER F 480 ? PHE F 481 ? SER F 455 PHE F 456 
AB 1  TYR F 432 ? GLY F 433 ? TYR F 407 GLY F 408 
AB 2  TRP F 476 ? LYS F 477 ? TRP F 451 LYS F 452 
AC 1  TYR G 25  ? LEU G 27  ? TYR G 0   LEU G 2   
AC 2  VAL G 54  ? ALA G 59  ? VAL G 29  ALA G 34  
AC 3  VAL G 43  ? PHE G 47  ? VAL G 18  PHE G 22  
AD 1  HIS G 29  ? ILE G 31  ? HIS G 4   ILE G 6   
AD 2  LYS G 34  ? VAL G 36  ? LYS G 9   VAL G 11  
AE 1  LEU G 222 ? VAL G 224 ? LEU G 197 VAL G 199 
AE 2  ALA G 192 ? LYS G 196 ? ALA G 167 LYS G 171 
AE 3  ILE G 165 ? ILE G 169 ? ILE G 140 ILE G 144 
AE 4  ALA G 243 ? VAL G 247 ? ALA G 218 VAL G 222 
AE 5  ARG G 266 ? PHE G 270 ? ARG G 241 PHE G 245 
AE 6  SER G 480 ? PHE G 481 ? SER G 455 PHE G 456 
AF 1  TYR G 432 ? GLY G 433 ? TYR G 407 GLY G 408 
AF 2  TRP G 476 ? LYS G 477 ? TRP G 451 LYS G 452 
AG 1  TYR H 25  ? LEU H 27  ? TYR H 0   LEU H 2   
AG 2  VAL H 54  ? ALA H 59  ? VAL H 29  ALA H 34  
AG 3  VAL H 43  ? PHE H 47  ? VAL H 18  PHE H 22  
AH 1  HIS H 29  ? ILE H 31  ? HIS H 4   ILE H 6   
AH 2  LYS H 34  ? VAL H 36  ? LYS H 9   VAL H 11  
AI 1  LEU H 222 ? VAL H 224 ? LEU H 197 VAL H 199 
AI 2  ALA H 192 ? LYS H 196 ? ALA H 167 LYS H 171 
AI 3  ILE H 165 ? ILE H 169 ? ILE H 140 ILE H 144 
AI 4  ALA H 243 ? VAL H 247 ? ALA H 218 VAL H 222 
AI 5  ARG H 266 ? PHE H 270 ? ARG H 241 PHE H 245 
AI 6  SER H 480 ? PHE H 481 ? SER H 455 PHE H 456 
AJ 1  TYR H 432 ? GLY H 433 ? TYR H 407 GLY H 408 
AJ 2  TRP H 476 ? LYS H 477 ? TRP H 451 LYS H 452 
AK 1  TYR I 25  ? LEU I 27  ? TYR I 0   LEU I 2   
AK 2  VAL I 54  ? ALA I 59  ? VAL I 29  ALA I 34  
AK 3  VAL I 43  ? PHE I 47  ? VAL I 18  PHE I 22  
AL 1  HIS I 29  ? ILE I 31  ? HIS I 4   ILE I 6   
AL 2  LYS I 34  ? VAL I 36  ? LYS I 9   VAL I 11  
AM 1  LYS J 369 ? VAL J 372 ? LYS J 344 VAL J 347 
AM 2  CYS J 391 ? ASP J 394 ? CYS J 366 ASP J 369 
AM 3  VAL J 411 ? VAL J 414 ? VAL J 386 VAL J 389 
AM 4  ILE J 307 ? PRO J 312 ? ILE J 282 PRO J 287 
AM 5  ASN J 275 ? ILE J 279 ? ASN J 250 ILE J 254 
AM 6  GLY J 435 ? TYR J 439 ? GLY J 410 TYR J 414 
AM 7  MSE J 457 ? VAL J 460 ? MSE J 432 VAL J 435 
AM 8  THR I 496 ? SER I 503 ? THR I 471 SER I 478 
AM 9  ILE I 154 ? PRO I 162 ? ILE I 129 PRO I 137 
AM 10 SER I 144 ? GLY I 151 ? SER I 119 GLY I 126 
AM 11 SER L 144 ? GLY L 151 ? SER L 119 GLY L 126 
AM 12 ILE L 154 ? PRO L 162 ? ILE L 129 PRO L 137 
AM 13 THR L 496 ? SER L 503 ? THR L 471 SER L 478 
AM 14 MSE K 457 ? VAL K 460 ? MSE K 432 VAL K 435 
AM 15 GLY K 435 ? TYR K 439 ? GLY K 410 TYR K 414 
AM 16 ASN K 275 ? ILE K 279 ? ASN K 250 ILE K 254 
AM 17 ILE K 307 ? PRO K 312 ? ILE K 282 PRO K 287 
AM 18 VAL K 411 ? VAL K 414 ? VAL K 386 VAL K 389 
AM 19 CYS K 391 ? ASP K 394 ? CYS K 366 ASP K 369 
AM 20 LYS K 369 ? VAL K 372 ? LYS K 344 VAL K 347 
AN 1  LEU I 222 ? VAL I 224 ? LEU I 197 VAL I 199 
AN 2  ALA I 192 ? LYS I 196 ? ALA I 167 LYS I 171 
AN 3  ILE I 165 ? ILE I 169 ? ILE I 140 ILE I 144 
AN 4  ALA I 243 ? VAL I 247 ? ALA I 218 VAL I 222 
AN 5  ARG I 266 ? PHE I 270 ? ARG I 241 PHE I 245 
AN 6  SER I 480 ? PHE I 481 ? SER I 455 PHE I 456 
AO 1  LYS I 369 ? VAL I 372 ? LYS I 344 VAL I 347 
AO 2  CYS I 391 ? ASP I 394 ? CYS I 366 ASP I 369 
AO 3  VAL I 411 ? VAL I 414 ? VAL I 386 VAL I 389 
AO 4  ILE I 307 ? PRO I 312 ? ILE I 282 PRO I 287 
AO 5  ASN I 275 ? ILE I 279 ? ASN I 250 ILE I 254 
AO 6  GLY I 435 ? TYR I 439 ? GLY I 410 TYR I 414 
AO 7  MSE I 457 ? VAL I 460 ? MSE I 432 VAL I 435 
AO 8  THR J 496 ? SER J 503 ? THR J 471 SER J 478 
AO 9  ILE J 154 ? PRO J 162 ? ILE J 129 PRO J 137 
AO 10 SER J 144 ? GLY J 151 ? SER J 119 GLY J 126 
AO 11 SER K 144 ? GLY K 151 ? SER K 119 GLY K 126 
AO 12 ILE K 154 ? PRO K 162 ? ILE K 129 PRO K 137 
AO 13 THR K 496 ? SER K 503 ? THR K 471 SER K 478 
AO 14 MSE L 457 ? VAL L 460 ? MSE L 432 VAL L 435 
AO 15 GLY L 435 ? TYR L 439 ? GLY L 410 TYR L 414 
AO 16 ASN L 275 ? ILE L 279 ? ASN L 250 ILE L 254 
AO 17 ILE L 307 ? PRO L 312 ? ILE L 282 PRO L 287 
AO 18 VAL L 411 ? VAL L 414 ? VAL L 386 VAL L 389 
AO 19 CYS L 391 ? ASP L 394 ? CYS L 366 ASP L 369 
AO 20 LYS L 369 ? VAL L 372 ? LYS L 344 VAL L 347 
AP 1  TYR I 432 ? GLY I 433 ? TYR I 407 GLY I 408 
AP 2  TRP I 476 ? LYS I 477 ? TRP I 451 LYS I 452 
AQ 1  TYR J 25  ? LEU J 27  ? TYR J 0   LEU J 2   
AQ 2  VAL J 54  ? ALA J 59  ? VAL J 29  ALA J 34  
AQ 3  VAL J 43  ? PHE J 47  ? VAL J 18  PHE J 22  
AR 1  HIS J 29  ? ILE J 31  ? HIS J 4   ILE J 6   
AR 2  LYS J 34  ? VAL J 36  ? LYS J 9   VAL J 11  
AS 1  LEU J 222 ? VAL J 224 ? LEU J 197 VAL J 199 
AS 2  ALA J 192 ? LYS J 196 ? ALA J 167 LYS J 171 
AS 3  ILE J 165 ? ILE J 169 ? ILE J 140 ILE J 144 
AS 4  ALA J 243 ? VAL J 247 ? ALA J 218 VAL J 222 
AS 5  ARG J 266 ? PHE J 270 ? ARG J 241 PHE J 245 
AS 6  SER J 480 ? PHE J 481 ? SER J 455 PHE J 456 
AT 1  TYR J 432 ? GLY J 433 ? TYR J 407 GLY J 408 
AT 2  TRP J 476 ? LYS J 477 ? TRP J 451 LYS J 452 
AU 1  TYR K 25  ? LEU K 27  ? TYR K 0   LEU K 2   
AU 2  VAL K 54  ? ALA K 59  ? VAL K 29  ALA K 34  
AU 3  VAL K 43  ? PHE K 47  ? VAL K 18  PHE K 22  
AV 1  HIS K 29  ? ILE K 31  ? HIS K 4   ILE K 6   
AV 2  LYS K 34  ? VAL K 36  ? LYS K 9   VAL K 11  
AW 1  LEU K 222 ? VAL K 224 ? LEU K 197 VAL K 199 
AW 2  ALA K 192 ? LYS K 196 ? ALA K 167 LYS K 171 
AW 3  ILE K 165 ? ILE K 169 ? ILE K 140 ILE K 144 
AW 4  ALA K 243 ? VAL K 247 ? ALA K 218 VAL K 222 
AW 5  ARG K 266 ? PHE K 270 ? ARG K 241 PHE K 245 
AW 6  SER K 480 ? PHE K 481 ? SER K 455 PHE K 456 
AX 1  TYR K 432 ? GLY K 433 ? TYR K 407 GLY K 408 
AX 2  TRP K 476 ? LYS K 477 ? TRP K 451 LYS K 452 
AY 1  TYR L 25  ? LEU L 27  ? TYR L 0   LEU L 2   
AY 2  VAL L 54  ? ALA L 59  ? VAL L 29  ALA L 34  
AY 3  VAL L 43  ? PHE L 47  ? VAL L 18  PHE L 22  
AZ 1  HIS L 29  ? ILE L 31  ? HIS L 4   ILE L 6   
AZ 2  LYS L 34  ? VAL L 36  ? LYS L 9   VAL L 11  
BA 1  LEU L 222 ? VAL L 224 ? LEU L 197 VAL L 199 
BA 2  ALA L 192 ? LYS L 196 ? ALA L 167 LYS L 171 
BA 3  ILE L 165 ? ILE L 169 ? ILE L 140 ILE L 144 
BA 4  ALA L 243 ? VAL L 247 ? ALA L 218 VAL L 222 
BA 5  ARG L 266 ? PHE L 270 ? ARG L 241 PHE L 245 
BA 6  SER L 480 ? PHE L 481 ? SER L 455 PHE L 456 
BB 1  TYR L 432 ? GLY L 433 ? TYR L 407 GLY L 408 
BB 2  TRP L 476 ? LYS L 477 ? TRP L 451 LYS L 452 
BC 1  TYR M 25  ? LEU M 27  ? TYR M 0   LEU M 2   
BC 2  VAL M 54  ? ALA M 59  ? VAL M 29  ALA M 34  
BC 3  VAL M 43  ? PHE M 47  ? VAL M 18  PHE M 22  
BD 1  HIS M 29  ? ILE M 31  ? HIS M 4   ILE M 6   
BD 2  LYS M 34  ? VAL M 36  ? LYS M 9   VAL M 11  
BE 1  LYS N 369 ? VAL N 372 ? LYS N 344 VAL N 347 
BE 2  CYS N 391 ? ASP N 394 ? CYS N 366 ASP N 369 
BE 3  VAL N 411 ? VAL N 414 ? VAL N 386 VAL N 389 
BE 4  ILE N 307 ? PRO N 312 ? ILE N 282 PRO N 287 
BE 5  ASN N 275 ? ILE N 279 ? ASN N 250 ILE N 254 
BE 6  GLY N 435 ? TYR N 439 ? GLY N 410 TYR N 414 
BE 7  MSE N 457 ? VAL N 460 ? MSE N 432 VAL N 435 
BE 8  THR M 496 ? SER M 503 ? THR M 471 SER M 478 
BE 9  ILE M 154 ? PRO M 162 ? ILE M 129 PRO M 137 
BE 10 SER M 144 ? GLY M 151 ? SER M 119 GLY M 126 
BE 11 SER P 144 ? GLY P 151 ? SER P 119 GLY P 126 
BE 12 ILE P 154 ? PRO P 162 ? ILE P 129 PRO P 137 
BE 13 THR P 496 ? SER P 503 ? THR P 471 SER P 478 
BE 14 MSE O 457 ? VAL O 460 ? MSE O 432 VAL O 435 
BE 15 GLY O 435 ? TYR O 439 ? GLY O 410 TYR O 414 
BE 16 ASN O 275 ? ILE O 279 ? ASN O 250 ILE O 254 
BE 17 ILE O 307 ? PRO O 312 ? ILE O 282 PRO O 287 
BE 18 VAL O 411 ? VAL O 414 ? VAL O 386 VAL O 389 
BE 19 CYS O 391 ? ASP O 394 ? CYS O 366 ASP O 369 
BE 20 LYS O 369 ? VAL O 372 ? LYS O 344 VAL O 347 
BF 1  LEU M 222 ? VAL M 224 ? LEU M 197 VAL M 199 
BF 2  ALA M 192 ? LYS M 196 ? ALA M 167 LYS M 171 
BF 3  ILE M 165 ? ILE M 169 ? ILE M 140 ILE M 144 
BF 4  ALA M 243 ? VAL M 247 ? ALA M 218 VAL M 222 
BF 5  ARG M 266 ? PHE M 270 ? ARG M 241 PHE M 245 
BF 6  SER M 480 ? PHE M 481 ? SER M 455 PHE M 456 
BG 1  LYS M 369 ? VAL M 372 ? LYS M 344 VAL M 347 
BG 2  CYS M 391 ? ASP M 394 ? CYS M 366 ASP M 369 
BG 3  VAL M 411 ? VAL M 414 ? VAL M 386 VAL M 389 
BG 4  ILE M 307 ? PRO M 312 ? ILE M 282 PRO M 287 
BG 5  ASN M 275 ? ILE M 279 ? ASN M 250 ILE M 254 
BG 6  GLY M 435 ? TYR M 439 ? GLY M 410 TYR M 414 
BG 7  MSE M 457 ? VAL M 460 ? MSE M 432 VAL M 435 
BG 8  THR N 496 ? SER N 503 ? THR N 471 SER N 478 
BG 9  ILE N 154 ? PRO N 162 ? ILE N 129 PRO N 137 
BG 10 SER N 144 ? GLY N 151 ? SER N 119 GLY N 126 
BG 11 SER O 144 ? GLY O 151 ? SER O 119 GLY O 126 
BG 12 ILE O 154 ? PRO O 162 ? ILE O 129 PRO O 137 
BG 13 THR O 496 ? SER O 503 ? THR O 471 SER O 478 
BG 14 MSE P 457 ? VAL P 460 ? MSE P 432 VAL P 435 
BG 15 GLY P 435 ? TYR P 439 ? GLY P 410 TYR P 414 
BG 16 ASN P 275 ? ILE P 279 ? ASN P 250 ILE P 254 
BG 17 ILE P 307 ? PRO P 312 ? ILE P 282 PRO P 287 
BG 18 VAL P 411 ? VAL P 414 ? VAL P 386 VAL P 389 
BG 19 CYS P 391 ? ASP P 394 ? CYS P 366 ASP P 369 
BG 20 LYS P 369 ? VAL P 372 ? LYS P 344 VAL P 347 
BH 1  TYR M 432 ? GLY M 433 ? TYR M 407 GLY M 408 
BH 2  TRP M 476 ? LYS M 477 ? TRP M 451 LYS M 452 
BI 1  TYR N 25  ? LEU N 27  ? TYR N 0   LEU N 2   
BI 2  VAL N 54  ? ALA N 59  ? VAL N 29  ALA N 34  
BI 3  VAL N 43  ? PHE N 47  ? VAL N 18  PHE N 22  
BJ 1  HIS N 29  ? ILE N 31  ? HIS N 4   ILE N 6   
BJ 2  LYS N 34  ? VAL N 36  ? LYS N 9   VAL N 11  
BK 1  LEU N 222 ? VAL N 224 ? LEU N 197 VAL N 199 
BK 2  ALA N 192 ? LYS N 196 ? ALA N 167 LYS N 171 
BK 3  ILE N 165 ? ILE N 169 ? ILE N 140 ILE N 144 
BK 4  ALA N 243 ? VAL N 247 ? ALA N 218 VAL N 222 
BK 5  ARG N 266 ? PHE N 270 ? ARG N 241 PHE N 245 
BK 6  SER N 480 ? PHE N 481 ? SER N 455 PHE N 456 
BL 1  TYR N 432 ? GLY N 433 ? TYR N 407 GLY N 408 
BL 2  TRP N 476 ? LYS N 477 ? TRP N 451 LYS N 452 
BM 1  TYR O 25  ? LEU O 27  ? TYR O 0   LEU O 2   
BM 2  VAL O 54  ? ALA O 59  ? VAL O 29  ALA O 34  
BM 3  VAL O 43  ? PHE O 47  ? VAL O 18  PHE O 22  
BN 1  HIS O 29  ? ILE O 31  ? HIS O 4   ILE O 6   
BN 2  LYS O 34  ? VAL O 36  ? LYS O 9   VAL O 11  
BO 1  LEU O 222 ? VAL O 224 ? LEU O 197 VAL O 199 
BO 2  ALA O 192 ? LYS O 196 ? ALA O 167 LYS O 171 
BO 3  ILE O 165 ? ILE O 169 ? ILE O 140 ILE O 144 
BO 4  ALA O 243 ? VAL O 247 ? ALA O 218 VAL O 222 
BO 5  ARG O 266 ? PHE O 270 ? ARG O 241 PHE O 245 
BO 6  SER O 480 ? PHE O 481 ? SER O 455 PHE O 456 
BP 1  TYR O 432 ? GLY O 433 ? TYR O 407 GLY O 408 
BP 2  TRP O 476 ? LYS O 477 ? TRP O 451 LYS O 452 
BQ 1  TYR P 25  ? LEU P 27  ? TYR P 0   LEU P 2   
BQ 2  VAL P 54  ? ALA P 59  ? VAL P 29  ALA P 34  
BQ 3  VAL P 43  ? PHE P 47  ? VAL P 18  PHE P 22  
BR 1  HIS P 29  ? ILE P 31  ? HIS P 4   ILE P 6   
BR 2  LYS P 34  ? VAL P 36  ? LYS P 9   VAL P 11  
BS 1  LEU P 222 ? VAL P 224 ? LEU P 197 VAL P 199 
BS 2  ALA P 192 ? LYS P 196 ? ALA P 167 LYS P 171 
BS 3  ILE P 165 ? ILE P 169 ? ILE P 140 ILE P 144 
BS 4  ALA P 243 ? VAL P 247 ? ALA P 218 VAL P 222 
BS 5  ARG P 266 ? PHE P 270 ? ARG P 241 PHE P 245 
BS 6  SER P 480 ? PHE P 481 ? SER P 455 PHE P 456 
BT 1  TYR P 432 ? GLY P 433 ? TYR P 407 GLY P 408 
BT 2  TRP P 476 ? LYS P 477 ? TRP P 451 LYS P 452 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  N LEU A 27  ? N LEU A 2   O THR A 57  ? O THR A 32  
A  2  3  O GLY A 56  ? O GLY A 31  N ILE A 46  ? N ILE A 21  
B  1  2  N HIS A 29  ? N HIS A 4   O VAL A 36  ? O VAL A 11  
C  1  2  N LYS B 369 ? N LYS B 344 O ASP B 394 ? O ASP B 369 
C  2  3  N PHE B 393 ? N PHE B 368 O LEU B 412 ? O LEU B 387 
C  3  4  O SER B 413 ? O SER B 388 N ALA B 310 ? N ALA B 285 
C  4  5  O VAL B 311 ? O VAL B 286 N MSE B 277 ? N MSE B 252 
C  5  6  N ILE B 278 ? N ILE B 253 O ALA B 437 ? O ALA B 412 
C  6  7  N VAL B 436 ? N VAL B 411 O GLY B 459 ? O GLY B 434 
C  7  8  O VAL B 458 ? O VAL B 433 N THR A 500 ? N THR A 475 
C  8  9  O ILE A 501 ? O ILE A 476 N TYR A 157 ? N TYR A 132 
C  9  10 O MSE A 156 ? O MSE A 131 N THR A 147 ? N THR A 122 
C  10 11 N PHE A 146 ? N PHE A 121 O SER D 144 ? O SER D 119 
C  11 12 N THR D 147 ? N THR D 122 O MSE D 156 ? O MSE D 131 
C  12 13 N TYR D 157 ? N TYR D 132 O ILE D 501 ? O ILE D 476 
C  13 14 O THR D 500 ? O THR D 475 N VAL C 458 ? N VAL C 433 
C  14 15 O GLY C 459 ? O GLY C 434 N ILE C 438 ? N ILE C 413 
C  15 16 O TYR C 439 ? O TYR C 414 N ILE C 278 ? N ILE C 253 
C  16 17 N MSE C 277 ? N MSE C 252 O VAL C 311 ? O VAL C 286 
C  17 18 N ALA C 310 ? N ALA C 285 O SER C 413 ? O SER C 388 
C  18 19 O LEU C 412 ? O LEU C 387 N PHE C 393 ? N PHE C 368 
C  19 20 O ASP C 394 ? O ASP C 369 N LYS C 369 ? N LYS C 344 
D  1  2  O ASN A 223 ? O ASN A 198 N LEU A 195 ? N LEU A 170 
D  2  3  O LYS A 196 ? O LYS A 171 N GLY A 168 ? N GLY A 143 
D  3  4  N ILE A 169 ? N ILE A 144 O SER A 245 ? O SER A 220 
D  4  5  N PHE A 246 ? N PHE A 221 O GLN A 268 ? O GLN A 243 
D  5  6  N CYS A 269 ? N CYS A 244 O PHE A 481 ? O PHE A 456 
E  1  2  N LYS A 369 ? N LYS A 344 O ASP A 394 ? O ASP A 369 
E  2  3  N PHE A 393 ? N PHE A 368 O LEU A 412 ? O LEU A 387 
E  3  4  O SER A 413 ? O SER A 388 N ALA A 310 ? N ALA A 285 
E  4  5  O VAL A 311 ? O VAL A 286 N MSE A 277 ? N MSE A 252 
E  5  6  N ILE A 278 ? N ILE A 253 O TYR A 439 ? O TYR A 414 
E  6  7  N VAL A 436 ? N VAL A 411 O GLY A 459 ? O GLY A 434 
E  7  8  N VAL A 458 ? N VAL A 433 O THR B 502 ? O THR B 477 
E  8  9  O ILE B 501 ? O ILE B 476 N TYR B 157 ? N TYR B 132 
E  9  10 O MSE B 156 ? O MSE B 131 N THR B 147 ? N THR B 122 
E  10 11 N PHE B 146 ? N PHE B 121 O SER C 144 ? O SER C 119 
E  11 12 N THR C 147 ? N THR C 122 O MSE C 156 ? O MSE C 131 
E  12 13 N TYR C 157 ? N TYR C 132 O ILE C 501 ? O ILE C 476 
E  13 14 N THR C 502 ? N THR C 477 O VAL D 460 ? O VAL D 435 
E  14 15 O GLY D 459 ? O GLY D 434 N VAL D 436 ? N VAL D 411 
E  15 16 O TYR D 439 ? O TYR D 414 N ILE D 278 ? N ILE D 253 
E  16 17 N MSE D 277 ? N MSE D 252 O VAL D 311 ? O VAL D 286 
E  17 18 N ALA D 310 ? N ALA D 285 O SER D 413 ? O SER D 388 
E  18 19 O LEU D 412 ? O LEU D 387 N PHE D 393 ? N PHE D 368 
E  19 20 O ASP D 394 ? O ASP D 369 N LYS D 369 ? N LYS D 344 
F  1  2  N GLY A 433 ? N GLY A 408 O TRP A 476 ? O TRP A 451 
G  1  2  N LEU B 27  ? N LEU B 2   O THR B 57  ? O THR B 32  
G  2  3  O GLN B 55  ? O GLN B 30  N ILE B 46  ? N ILE B 21  
H  1  2  N HIS B 29  ? N HIS B 4   O VAL B 36  ? O VAL B 11  
I  1  2  O ASN B 223 ? O ASN B 198 N LEU B 195 ? N LEU B 170 
I  2  3  O LYS B 196 ? O LYS B 171 N GLY B 168 ? N GLY B 143 
I  3  4  N ILE B 169 ? N ILE B 144 O SER B 245 ? O SER B 220 
I  4  5  N PHE B 246 ? N PHE B 221 O GLN B 268 ? O GLN B 243 
I  5  6  N CYS B 269 ? N CYS B 244 O PHE B 481 ? O PHE B 456 
J  1  2  N GLY B 433 ? N GLY B 408 O TRP B 476 ? O TRP B 451 
K  1  2  N LEU C 27  ? N LEU C 2   O THR C 57  ? O THR C 32  
K  2  3  O GLY C 56  ? O GLY C 31  N ILE C 46  ? N ILE C 21  
L  1  2  N HIS C 29  ? N HIS C 4   O VAL C 36  ? O VAL C 11  
M  1  2  O ASN C 223 ? O ASN C 198 N LEU C 195 ? N LEU C 170 
M  2  3  O LYS C 196 ? O LYS C 171 N GLY C 168 ? N GLY C 143 
M  3  4  N ILE C 169 ? N ILE C 144 O SER C 245 ? O SER C 220 
M  4  5  N VAL C 244 ? N VAL C 219 O ARG C 266 ? O ARG C 241 
M  5  6  N CYS C 269 ? N CYS C 244 O PHE C 481 ? O PHE C 456 
N  1  2  N GLY C 433 ? N GLY C 408 O TRP C 476 ? O TRP C 451 
O  1  2  N LEU D 27  ? N LEU D 2   O THR D 57  ? O THR D 32  
O  2  3  O GLY D 56  ? O GLY D 31  N ILE D 46  ? N ILE D 21  
P  1  2  N HIS D 29  ? N HIS D 4   O VAL D 36  ? O VAL D 11  
Q  1  2  O ASN D 223 ? O ASN D 198 N LEU D 195 ? N LEU D 170 
Q  2  3  O LYS D 196 ? O LYS D 171 N GLY D 168 ? N GLY D 143 
Q  3  4  N ILE D 169 ? N ILE D 144 O SER D 245 ? O SER D 220 
Q  4  5  N PHE D 246 ? N PHE D 221 O GLN D 268 ? O GLN D 243 
Q  5  6  N CYS D 269 ? N CYS D 244 O PHE D 481 ? O PHE D 456 
R  1  2  N GLY D 433 ? N GLY D 408 O TRP D 476 ? O TRP D 451 
S  1  2  N LEU E 27  ? N LEU E 2   O THR E 57  ? O THR E 32  
S  2  3  O GLN E 55  ? O GLN E 30  N ILE E 46  ? N ILE E 21  
T  1  2  N HIS E 29  ? N HIS E 4   O VAL E 36  ? O VAL E 11  
U  1  2  N LYS F 369 ? N LYS F 344 O ASP F 394 ? O ASP F 369 
U  2  3  N PHE F 393 ? N PHE F 368 O LEU F 412 ? O LEU F 387 
U  3  4  O SER F 413 ? O SER F 388 N ALA F 310 ? N ALA F 285 
U  4  5  O VAL F 311 ? O VAL F 286 N MSE F 277 ? N MSE F 252 
U  5  6  N ILE F 278 ? N ILE F 253 O ALA F 437 ? O ALA F 412 
U  6  7  N ILE F 438 ? N ILE F 413 O GLY F 459 ? O GLY F 434 
U  7  8  O VAL F 458 ? O VAL F 433 N THR E 500 ? N THR E 475 
U  8  9  O ILE E 501 ? O ILE E 476 N TYR E 157 ? N TYR E 132 
U  9  10 O MSE E 156 ? O MSE E 131 N THR E 147 ? N THR E 122 
U  10 11 N SER E 144 ? N SER E 119 O PHE H 146 ? O PHE H 121 
U  11 12 N THR H 147 ? N THR H 122 O MSE H 156 ? O MSE H 131 
U  12 13 N TYR H 157 ? N TYR H 132 O ILE H 501 ? O ILE H 476 
U  13 14 O THR H 502 ? O THR H 477 N VAL G 460 ? N VAL G 435 
U  14 15 O GLY G 459 ? O GLY G 434 N VAL G 436 ? N VAL G 411 
U  15 16 O ALA G 437 ? O ALA G 412 N ILE G 278 ? N ILE G 253 
U  16 17 N MSE G 277 ? N MSE G 252 O VAL G 311 ? O VAL G 286 
U  17 18 N ALA G 310 ? N ALA G 285 O SER G 413 ? O SER G 388 
U  18 19 O LEU G 412 ? O LEU G 387 N PHE G 393 ? N PHE G 368 
U  19 20 O ASP G 394 ? O ASP G 369 N LYS G 369 ? N LYS G 344 
V  1  2  O ASN E 223 ? O ASN E 198 N LEU E 195 ? N LEU E 170 
V  2  3  O LYS E 196 ? O LYS E 171 N GLY E 168 ? N GLY E 143 
V  3  4  N ILE E 169 ? N ILE E 144 O SER E 245 ? O SER E 220 
V  4  5  N PHE E 246 ? N PHE E 221 O GLN E 268 ? O GLN E 243 
V  5  6  N CYS E 269 ? N CYS E 244 O PHE E 481 ? O PHE E 456 
W  1  2  N LYS E 369 ? N LYS E 344 O ASP E 394 ? O ASP E 369 
W  2  3  N PHE E 393 ? N PHE E 368 O LEU E 412 ? O LEU E 387 
W  3  4  O SER E 413 ? O SER E 388 N ALA E 310 ? N ALA E 285 
W  4  5  O VAL E 311 ? O VAL E 286 N MSE E 277 ? N MSE E 252 
W  5  6  N ILE E 278 ? N ILE E 253 O ALA E 437 ? O ALA E 412 
W  6  7  N ILE E 438 ? N ILE E 413 O GLY E 459 ? O GLY E 434 
W  7  8  N VAL E 458 ? N VAL E 433 O THR F 500 ? O THR F 475 
W  8  9  O ILE F 501 ? O ILE F 476 N TYR F 157 ? N TYR F 132 
W  9  10 O MSE F 156 ? O MSE F 131 N THR F 147 ? N THR F 122 
W  10 11 N PHE F 146 ? N PHE F 121 O SER G 144 ? O SER G 119 
W  11 12 N THR G 147 ? N THR G 122 O MSE G 156 ? O MSE G 131 
W  12 13 N TYR G 157 ? N TYR G 132 O ILE G 501 ? O ILE G 476 
W  13 14 N THR G 502 ? N THR G 477 O VAL H 460 ? O VAL H 435 
W  14 15 O GLY H 459 ? O GLY H 434 N VAL H 436 ? N VAL H 411 
W  15 16 O TYR H 439 ? O TYR H 414 N ILE H 278 ? N ILE H 253 
W  16 17 N MSE H 277 ? N MSE H 252 O VAL H 311 ? O VAL H 286 
W  17 18 N ALA H 310 ? N ALA H 285 O SER H 413 ? O SER H 388 
W  18 19 O LEU H 412 ? O LEU H 387 N PHE H 393 ? N PHE H 368 
W  19 20 O ASP H 394 ? O ASP H 369 N LYS H 369 ? N LYS H 344 
X  1  2  N GLY E 433 ? N GLY E 408 O TRP E 476 ? O TRP E 451 
Y  1  2  N LEU F 27  ? N LEU F 2   O THR F 57  ? O THR F 32  
Y  2  3  O GLY F 56  ? O GLY F 31  N ILE F 46  ? N ILE F 21  
Z  1  2  N HIS F 29  ? N HIS F 4   O VAL F 36  ? O VAL F 11  
AA 1  2  O ASN F 223 ? O ASN F 198 N LEU F 195 ? N LEU F 170 
AA 2  3  O LYS F 196 ? O LYS F 171 N GLY F 168 ? N GLY F 143 
AA 3  4  N ILE F 169 ? N ILE F 144 O SER F 245 ? O SER F 220 
AA 4  5  N PHE F 246 ? N PHE F 221 O GLN F 268 ? O GLN F 243 
AA 5  6  N CYS F 269 ? N CYS F 244 O PHE F 481 ? O PHE F 456 
AB 1  2  N GLY F 433 ? N GLY F 408 O TRP F 476 ? O TRP F 451 
AC 1  2  N LEU G 27  ? N LEU G 2   O THR G 57  ? O THR G 32  
AC 2  3  O GLY G 56  ? O GLY G 31  N ILE G 46  ? N ILE G 21  
AD 1  2  N HIS G 29  ? N HIS G 4   O VAL G 36  ? O VAL G 11  
AE 1  2  O ASN G 223 ? O ASN G 198 N LEU G 195 ? N LEU G 170 
AE 2  3  O LYS G 196 ? O LYS G 171 N GLY G 168 ? N GLY G 143 
AE 3  4  N ILE G 169 ? N ILE G 144 O SER G 245 ? O SER G 220 
AE 4  5  N VAL G 244 ? N VAL G 219 O ARG G 266 ? O ARG G 241 
AE 5  6  N CYS G 269 ? N CYS G 244 O PHE G 481 ? O PHE G 456 
AF 1  2  N GLY G 433 ? N GLY G 408 O TRP G 476 ? O TRP G 451 
AG 1  2  N LEU H 27  ? N LEU H 2   O THR H 57  ? O THR H 32  
AG 2  3  O GLY H 56  ? O GLY H 31  N ILE H 46  ? N ILE H 21  
AH 1  2  N HIS H 29  ? N HIS H 4   O VAL H 36  ? O VAL H 11  
AI 1  2  O ASN H 223 ? O ASN H 198 N LEU H 195 ? N LEU H 170 
AI 2  3  O LYS H 196 ? O LYS H 171 N GLY H 168 ? N GLY H 143 
AI 3  4  N ILE H 169 ? N ILE H 144 O SER H 245 ? O SER H 220 
AI 4  5  N PHE H 246 ? N PHE H 221 O GLN H 268 ? O GLN H 243 
AI 5  6  N CYS H 269 ? N CYS H 244 O PHE H 481 ? O PHE H 456 
AJ 1  2  N GLY H 433 ? N GLY H 408 O TRP H 476 ? O TRP H 451 
AK 1  2  N LEU I 27  ? N LEU I 2   O THR I 57  ? O THR I 32  
AK 2  3  O GLY I 56  ? O GLY I 31  N ILE I 46  ? N ILE I 21  
AL 1  2  N HIS I 29  ? N HIS I 4   O VAL I 36  ? O VAL I 11  
AM 1  2  N LYS J 369 ? N LYS J 344 O ASP J 394 ? O ASP J 369 
AM 2  3  N PHE J 393 ? N PHE J 368 O LEU J 412 ? O LEU J 387 
AM 3  4  O SER J 413 ? O SER J 388 N ALA J 310 ? N ALA J 285 
AM 4  5  O VAL J 311 ? O VAL J 286 N MSE J 277 ? N MSE J 252 
AM 5  6  N ILE J 278 ? N ILE J 253 O TYR J 439 ? O TYR J 414 
AM 6  7  N VAL J 436 ? N VAL J 411 O GLY J 459 ? O GLY J 434 
AM 7  8  O VAL J 458 ? O VAL J 433 N THR I 500 ? N THR I 475 
AM 8  9  O ILE I 501 ? O ILE I 476 N TYR I 157 ? N TYR I 132 
AM 9  10 O MSE I 156 ? O MSE I 131 N THR I 147 ? N THR I 122 
AM 10 11 N PHE I 146 ? N PHE I 121 O SER L 144 ? O SER L 119 
AM 11 12 N THR L 147 ? N THR L 122 O MSE L 156 ? O MSE L 131 
AM 12 13 N TYR L 157 ? N TYR L 132 O ILE L 501 ? O ILE L 476 
AM 13 14 O THR L 500 ? O THR L 475 N VAL K 458 ? N VAL K 433 
AM 14 15 O GLY K 459 ? O GLY K 434 N VAL K 436 ? N VAL K 411 
AM 15 16 O TYR K 439 ? O TYR K 414 N ILE K 278 ? N ILE K 253 
AM 16 17 N MSE K 277 ? N MSE K 252 O VAL K 311 ? O VAL K 286 
AM 17 18 N ALA K 310 ? N ALA K 285 O SER K 413 ? O SER K 388 
AM 18 19 O LEU K 412 ? O LEU K 387 N PHE K 393 ? N PHE K 368 
AM 19 20 O ASP K 394 ? O ASP K 369 N LYS K 369 ? N LYS K 344 
AN 1  2  O ASN I 223 ? O ASN I 198 N LEU I 195 ? N LEU I 170 
AN 2  3  O LYS I 196 ? O LYS I 171 N GLY I 168 ? N GLY I 143 
AN 3  4  N ILE I 169 ? N ILE I 144 O SER I 245 ? O SER I 220 
AN 4  5  N PHE I 246 ? N PHE I 221 O GLN I 268 ? O GLN I 243 
AN 5  6  N CYS I 269 ? N CYS I 244 O PHE I 481 ? O PHE I 456 
AO 1  2  N LYS I 369 ? N LYS I 344 O ASP I 394 ? O ASP I 369 
AO 2  3  N PHE I 393 ? N PHE I 368 O LEU I 412 ? O LEU I 387 
AO 3  4  O SER I 413 ? O SER I 388 N ALA I 310 ? N ALA I 285 
AO 4  5  O VAL I 311 ? O VAL I 286 N MSE I 277 ? N MSE I 252 
AO 5  6  N ILE I 278 ? N ILE I 253 O ALA I 437 ? O ALA I 412 
AO 6  7  N VAL I 436 ? N VAL I 411 O GLY I 459 ? O GLY I 434 
AO 7  8  N VAL I 460 ? N VAL I 435 O THR J 502 ? O THR J 477 
AO 8  9  O ILE J 501 ? O ILE J 476 N TYR J 157 ? N TYR J 132 
AO 9  10 O ILE J 154 ? O ILE J 129 N GLY J 151 ? N GLY J 126 
AO 10 11 N SER J 144 ? N SER J 119 O PHE K 146 ? O PHE K 121 
AO 11 12 N THR K 147 ? N THR K 122 O MSE K 156 ? O MSE K 131 
AO 12 13 N TYR K 157 ? N TYR K 132 O ILE K 501 ? O ILE K 476 
AO 13 14 N THR K 502 ? N THR K 477 O VAL L 460 ? O VAL L 435 
AO 14 15 O GLY L 459 ? O GLY L 434 N VAL L 436 ? N VAL L 411 
AO 15 16 O ALA L 437 ? O ALA L 412 N ILE L 278 ? N ILE L 253 
AO 16 17 N MSE L 277 ? N MSE L 252 O VAL L 311 ? O VAL L 286 
AO 17 18 N ALA L 310 ? N ALA L 285 O SER L 413 ? O SER L 388 
AO 18 19 O LEU L 412 ? O LEU L 387 N PHE L 393 ? N PHE L 368 
AO 19 20 O ASP L 394 ? O ASP L 369 N LYS L 369 ? N LYS L 344 
AP 1  2  N GLY I 433 ? N GLY I 408 O TRP I 476 ? O TRP I 451 
AQ 1  2  N LEU J 27  ? N LEU J 2   O THR J 57  ? O THR J 32  
AQ 2  3  O GLY J 56  ? O GLY J 31  N ILE J 46  ? N ILE J 21  
AR 1  2  N HIS J 29  ? N HIS J 4   O VAL J 36  ? O VAL J 11  
AS 1  2  O ASN J 223 ? O ASN J 198 N LEU J 195 ? N LEU J 170 
AS 2  3  O LYS J 196 ? O LYS J 171 N GLY J 168 ? N GLY J 143 
AS 3  4  N ILE J 169 ? N ILE J 144 O SER J 245 ? O SER J 220 
AS 4  5  N PHE J 246 ? N PHE J 221 O GLN J 268 ? O GLN J 243 
AS 5  6  N CYS J 269 ? N CYS J 244 O PHE J 481 ? O PHE J 456 
AT 1  2  N GLY J 433 ? N GLY J 408 O TRP J 476 ? O TRP J 451 
AU 1  2  N LEU K 27  ? N LEU K 2   O THR K 57  ? O THR K 32  
AU 2  3  O GLY K 56  ? O GLY K 31  N ILE K 46  ? N ILE K 21  
AV 1  2  N HIS K 29  ? N HIS K 4   O VAL K 36  ? O VAL K 11  
AW 1  2  O ASN K 223 ? O ASN K 198 N LEU K 195 ? N LEU K 170 
AW 2  3  O LYS K 196 ? O LYS K 171 N GLY K 168 ? N GLY K 143 
AW 3  4  N ILE K 169 ? N ILE K 144 O SER K 245 ? O SER K 220 
AW 4  5  N VAL K 244 ? N VAL K 219 O ARG K 266 ? O ARG K 241 
AW 5  6  N CYS K 269 ? N CYS K 244 O PHE K 481 ? O PHE K 456 
AX 1  2  N GLY K 433 ? N GLY K 408 O TRP K 476 ? O TRP K 451 
AY 1  2  N LEU L 27  ? N LEU L 2   O THR L 57  ? O THR L 32  
AY 2  3  O GLY L 56  ? O GLY L 31  N ILE L 46  ? N ILE L 21  
AZ 1  2  N HIS L 29  ? N HIS L 4   O VAL L 36  ? O VAL L 11  
BA 1  2  O ASN L 223 ? O ASN L 198 N LEU L 195 ? N LEU L 170 
BA 2  3  O ILE L 194 ? O ILE L 169 N GLY L 166 ? N GLY L 141 
BA 3  4  N ILE L 169 ? N ILE L 144 O SER L 245 ? O SER L 220 
BA 4  5  N PHE L 246 ? N PHE L 221 O GLN L 268 ? O GLN L 243 
BA 5  6  N CYS L 269 ? N CYS L 244 O PHE L 481 ? O PHE L 456 
BB 1  2  N GLY L 433 ? N GLY L 408 O TRP L 476 ? O TRP L 451 
BC 1  2  N LEU M 27  ? N LEU M 2   O THR M 57  ? O THR M 32  
BC 2  3  O GLY M 56  ? O GLY M 31  N ILE M 46  ? N ILE M 21  
BD 1  2  N HIS M 29  ? N HIS M 4   O VAL M 36  ? O VAL M 11  
BE 1  2  N LYS N 369 ? N LYS N 344 O ASP N 394 ? O ASP N 369 
BE 2  3  N PHE N 393 ? N PHE N 368 O LEU N 412 ? O LEU N 387 
BE 3  4  O SER N 413 ? O SER N 388 N ALA N 310 ? N ALA N 285 
BE 4  5  O VAL N 311 ? O VAL N 286 N MSE N 277 ? N MSE N 252 
BE 5  6  N ILE N 278 ? N ILE N 253 O ALA N 437 ? O ALA N 412 
BE 6  7  N VAL N 436 ? N VAL N 411 O GLY N 459 ? O GLY N 434 
BE 7  8  O VAL N 458 ? O VAL N 433 N THR M 500 ? N THR M 475 
BE 8  9  O ILE M 501 ? O ILE M 476 N TYR M 157 ? N TYR M 132 
BE 9  10 O MSE M 156 ? O MSE M 131 N THR M 147 ? N THR M 122 
BE 10 11 N PHE M 146 ? N PHE M 121 O SER P 144 ? O SER P 119 
BE 11 12 N THR P 147 ? N THR P 122 O MSE P 156 ? O MSE P 131 
BE 12 13 N TYR P 157 ? N TYR P 132 O ILE P 501 ? O ILE P 476 
BE 13 14 O THR P 502 ? O THR P 477 N VAL O 458 ? N VAL O 433 
BE 14 15 O GLY O 459 ? O GLY O 434 N VAL O 436 ? N VAL O 411 
BE 15 16 O ALA O 437 ? O ALA O 412 N ILE O 278 ? N ILE O 253 
BE 16 17 N MSE O 277 ? N MSE O 252 O VAL O 311 ? O VAL O 286 
BE 17 18 N ALA O 310 ? N ALA O 285 O SER O 413 ? O SER O 388 
BE 18 19 O LEU O 412 ? O LEU O 387 N CYS O 391 ? N CYS O 366 
BE 19 20 O ASP O 394 ? O ASP O 369 N LYS O 369 ? N LYS O 344 
BF 1  2  O ASN M 223 ? O ASN M 198 N LEU M 195 ? N LEU M 170 
BF 2  3  O LYS M 196 ? O LYS M 171 N GLY M 168 ? N GLY M 143 
BF 3  4  N ILE M 169 ? N ILE M 144 O SER M 245 ? O SER M 220 
BF 4  5  N VAL M 244 ? N VAL M 219 O ARG M 266 ? O ARG M 241 
BF 5  6  N CYS M 269 ? N CYS M 244 O PHE M 481 ? O PHE M 456 
BG 1  2  N LYS M 369 ? N LYS M 344 O ASP M 394 ? O ASP M 369 
BG 2  3  N PHE M 393 ? N PHE M 368 O LEU M 412 ? O LEU M 387 
BG 3  4  O SER M 413 ? O SER M 388 N ALA M 310 ? N ALA M 285 
BG 4  5  O VAL M 311 ? O VAL M 286 N MSE M 277 ? N MSE M 252 
BG 5  6  N ILE M 278 ? N ILE M 253 O ALA M 437 ? O ALA M 412 
BG 6  7  N VAL M 436 ? N VAL M 411 O GLY M 459 ? O GLY M 434 
BG 7  8  N VAL M 460 ? N VAL M 435 O THR N 502 ? O THR N 477 
BG 8  9  O ILE N 501 ? O ILE N 476 N TYR N 157 ? N TYR N 132 
BG 9  10 O MSE N 156 ? O MSE N 131 N THR N 147 ? N THR N 122 
BG 10 11 N PHE N 146 ? N PHE N 121 O SER O 144 ? O SER O 119 
BG 11 12 N THR O 147 ? N THR O 122 O MSE O 156 ? O MSE O 131 
BG 12 13 N TYR O 157 ? N TYR O 132 O ILE O 501 ? O ILE O 476 
BG 13 14 N THR O 502 ? N THR O 477 O VAL P 460 ? O VAL P 435 
BG 14 15 O GLY P 459 ? O GLY P 434 N VAL P 436 ? N VAL P 411 
BG 15 16 O TYR P 439 ? O TYR P 414 N ILE P 278 ? N ILE P 253 
BG 16 17 N MSE P 277 ? N MSE P 252 O VAL P 311 ? O VAL P 286 
BG 17 18 N ALA P 310 ? N ALA P 285 O SER P 413 ? O SER P 388 
BG 18 19 O LEU P 412 ? O LEU P 387 N PHE P 393 ? N PHE P 368 
BG 19 20 O ASP P 394 ? O ASP P 369 N LYS P 369 ? N LYS P 344 
BH 1  2  N GLY M 433 ? N GLY M 408 O TRP M 476 ? O TRP M 451 
BI 1  2  N LEU N 27  ? N LEU N 2   O THR N 57  ? O THR N 32  
BI 2  3  O GLY N 56  ? O GLY N 31  N ILE N 46  ? N ILE N 21  
BJ 1  2  N HIS N 29  ? N HIS N 4   O VAL N 36  ? O VAL N 11  
BK 1  2  O ASN N 223 ? O ASN N 198 N LEU N 195 ? N LEU N 170 
BK 2  3  O LYS N 196 ? O LYS N 171 N GLY N 168 ? N GLY N 143 
BK 3  4  N ILE N 169 ? N ILE N 144 O SER N 245 ? O SER N 220 
BK 4  5  N PHE N 246 ? N PHE N 221 O GLN N 268 ? O GLN N 243 
BK 5  6  N CYS N 269 ? N CYS N 244 O PHE N 481 ? O PHE N 456 
BL 1  2  N GLY N 433 ? N GLY N 408 O TRP N 476 ? O TRP N 451 
BM 1  2  N LEU O 27  ? N LEU O 2   O THR O 57  ? O THR O 32  
BM 2  3  O GLY O 56  ? O GLY O 31  N ILE O 46  ? N ILE O 21  
BN 1  2  N HIS O 29  ? N HIS O 4   O VAL O 36  ? O VAL O 11  
BO 1  2  O ASN O 223 ? O ASN O 198 N LEU O 195 ? N LEU O 170 
BO 2  3  O LYS O 196 ? O LYS O 171 N GLY O 168 ? N GLY O 143 
BO 3  4  N ILE O 169 ? N ILE O 144 O SER O 245 ? O SER O 220 
BO 4  5  N VAL O 244 ? N VAL O 219 O ARG O 266 ? O ARG O 241 
BO 5  6  N CYS O 269 ? N CYS O 244 O PHE O 481 ? O PHE O 456 
BP 1  2  N GLY O 433 ? N GLY O 408 O TRP O 476 ? O TRP O 451 
BQ 1  2  N LEU P 27  ? N LEU P 2   O THR P 57  ? O THR P 32  
BQ 2  3  O GLY P 56  ? O GLY P 31  N ILE P 46  ? N ILE P 21  
BR 1  2  N HIS P 29  ? N HIS P 4   O VAL P 36  ? O VAL P 11  
BS 1  2  O ASN P 223 ? O ASN P 198 N LEU P 195 ? N LEU P 170 
BS 2  3  O LYS P 196 ? O LYS P 171 N GLY P 168 ? N GLY P 143 
BS 3  4  N ILE P 169 ? N ILE P 144 O SER P 245 ? O SER P 220 
BS 4  5  N VAL P 244 ? N VAL P 219 O ARG P 266 ? O ARG P 241 
BS 5  6  N CYS P 269 ? N CYS P 244 O PHE P 481 ? O PHE P 456 
BT 1  2  N GLY P 433 ? N GLY P 408 O TRP P 476 ? O TRP P 451 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD A 501' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD B 500' 
AC5 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAD C 500' 
AC6 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAD D 500' 
AC7 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE NAD E 500' 
AC8 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD F 501' 
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG F 502'  
BC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE NAD G 501' 
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG G 502'  
BC3 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD H 500' 
BC4 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAD I 501' 
BC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG I 502'  
BC6 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAD J 500' 
BC7 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD K 500' 
BC8 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAD L 500' 
BC9 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAD M 500' 
CC1 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE NAD N 500' 
CC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD O 501' 
CC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG O 502'  
CC4 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAD P 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 27 ILE A  169 ? ILE A 144 . ? 1_555 ? 
2   AC1 27 THR A  170 ? THR A 145 . ? 1_555 ? 
3   AC1 27 PRO A  171 ? PRO A 146 . ? 1_555 ? 
4   AC1 27 PHE A  172 ? PHE A 147 . ? 1_555 ? 
5   AC1 27 ASN A  173 ? ASN A 148 . ? 1_555 ? 
6   AC1 27 PHE A  174 ? PHE A 149 . ? 1_555 ? 
7   AC1 27 MSE A  177 ? MSE A 152 . ? 1_555 ? 
8   AC1 27 ILE A  178 ? ILE A 153 . ? 1_555 ? 
9   AC1 27 LYS A  196 ? LYS A 171 . ? 1_555 ? 
10  AC1 27 GLU A  199 ? GLU A 174 . ? 1_555 ? 
11  AC1 27 LYS A  229 ? LYS A 204 . ? 1_555 ? 
12  AC1 27 VAL A  232 ? VAL A 207 . ? 1_555 ? 
13  AC1 27 PHE A  246 ? PHE A 221 . ? 1_555 ? 
14  AC1 27 VAL A  247 ? VAL A 222 . ? 1_555 ? 
15  AC1 27 GLY A  248 ? GLY A 223 . ? 1_555 ? 
16  AC1 27 SER A  249 ? SER A 224 . ? 1_555 ? 
17  AC1 27 ILE A  252 ? ILE A 227 . ? 1_555 ? 
18  AC1 27 GLY A  271 ? GLY A 246 . ? 1_555 ? 
19  AC1 27 GLY A  272 ? GLY A 247 . ? 1_555 ? 
20  AC1 27 CYS A  304 ? CYS A 279 . ? 1_555 ? 
21  AC1 27 GLU A  406 ? GLU A 381 . ? 1_555 ? 
22  AC1 27 PHE A  408 ? PHE A 383 . ? 1_555 ? 
23  AC1 27 HOH MA .   ? HOH A 793 . ? 1_555 ? 
24  AC1 27 HOH MA .   ? HOH A 848 . ? 1_555 ? 
25  AC1 27 HOH MA .   ? HOH A 861 . ? 1_555 ? 
26  AC1 27 HOH MA .   ? HOH A 888 . ? 1_555 ? 
27  AC1 27 HOH MA .   ? HOH A 911 . ? 1_555 ? 
28  AC2 3  HOH MA .   ? HOH A 792 . ? 1_555 ? 
29  AC2 3  HOH MA .   ? HOH A 918 . ? 1_555 ? 
30  AC2 3  HOH MA .   ? HOH A 919 . ? 1_555 ? 
31  AC3 5  ASP A  343 ? ASP A 318 . ? 1_555 ? 
32  AC3 5  HOH MA .   ? HOH A 803 . ? 1_555 ? 
33  AC3 5  HOH MA .   ? HOH A 837 . ? 1_555 ? 
34  AC3 5  HOH MA .   ? HOH A 921 . ? 1_555 ? 
35  AC3 5  HOH MA .   ? HOH A 922 . ? 1_555 ? 
36  AC4 27 ILE B  169 ? ILE B 144 . ? 1_555 ? 
37  AC4 27 THR B  170 ? THR B 145 . ? 1_555 ? 
38  AC4 27 PRO B  171 ? PRO B 146 . ? 1_555 ? 
39  AC4 27 PHE B  172 ? PHE B 147 . ? 1_555 ? 
40  AC4 27 ASN B  173 ? ASN B 148 . ? 1_555 ? 
41  AC4 27 PHE B  174 ? PHE B 149 . ? 1_555 ? 
42  AC4 27 ILE B  178 ? ILE B 153 . ? 1_555 ? 
43  AC4 27 LYS B  196 ? LYS B 171 . ? 1_555 ? 
44  AC4 27 GLU B  199 ? GLU B 174 . ? 1_555 ? 
45  AC4 27 LYS B  229 ? LYS B 204 . ? 1_555 ? 
46  AC4 27 PHE B  246 ? PHE B 221 . ? 1_555 ? 
47  AC4 27 VAL B  247 ? VAL B 222 . ? 1_555 ? 
48  AC4 27 GLY B  248 ? GLY B 223 . ? 1_555 ? 
49  AC4 27 SER B  249 ? SER B 224 . ? 1_555 ? 
50  AC4 27 ILE B  252 ? ILE B 227 . ? 1_555 ? 
51  AC4 27 GLY B  271 ? GLY B 246 . ? 1_555 ? 
52  AC4 27 GLY B  272 ? GLY B 247 . ? 1_555 ? 
53  AC4 27 ARG B  303 ? ARG B 278 . ? 1_555 ? 
54  AC4 27 CYS B  304 ? CYS B 279 . ? 1_555 ? 
55  AC4 27 GLU B  406 ? GLU B 381 . ? 1_555 ? 
56  AC4 27 PHE B  408 ? PHE B 383 . ? 1_555 ? 
57  AC4 27 HOH NA .   ? HOH B 613 . ? 1_555 ? 
58  AC4 27 HOH NA .   ? HOH B 669 . ? 1_555 ? 
59  AC4 27 HOH NA .   ? HOH B 839 . ? 1_555 ? 
60  AC4 27 HOH NA .   ? HOH B 840 . ? 1_555 ? 
61  AC4 27 HOH NA .   ? HOH B 842 . ? 1_555 ? 
62  AC4 27 HOH NA .   ? HOH B 886 . ? 1_555 ? 
63  AC5 26 ILE C  169 ? ILE C 144 . ? 1_555 ? 
64  AC5 26 THR C  170 ? THR C 145 . ? 1_555 ? 
65  AC5 26 PRO C  171 ? PRO C 146 . ? 1_555 ? 
66  AC5 26 PHE C  172 ? PHE C 147 . ? 1_555 ? 
67  AC5 26 ASN C  173 ? ASN C 148 . ? 1_555 ? 
68  AC5 26 PHE C  174 ? PHE C 149 . ? 1_555 ? 
69  AC5 26 LYS C  196 ? LYS C 171 . ? 1_555 ? 
70  AC5 26 GLU C  199 ? GLU C 174 . ? 1_555 ? 
71  AC5 26 LYS C  229 ? LYS C 204 . ? 1_555 ? 
72  AC5 26 VAL C  232 ? VAL C 207 . ? 1_555 ? 
73  AC5 26 PHE C  246 ? PHE C 221 . ? 1_555 ? 
74  AC5 26 VAL C  247 ? VAL C 222 . ? 1_555 ? 
75  AC5 26 GLY C  248 ? GLY C 223 . ? 1_555 ? 
76  AC5 26 SER C  249 ? SER C 224 . ? 1_555 ? 
77  AC5 26 ILE C  252 ? ILE C 227 . ? 1_555 ? 
78  AC5 26 GLY C  271 ? GLY C 246 . ? 1_555 ? 
79  AC5 26 GLY C  272 ? GLY C 247 . ? 1_555 ? 
80  AC5 26 CYS C  304 ? CYS C 279 . ? 1_555 ? 
81  AC5 26 GLU C  406 ? GLU C 381 . ? 1_555 ? 
82  AC5 26 PHE C  408 ? PHE C 383 . ? 1_555 ? 
83  AC5 26 HOH OA .   ? HOH C 610 . ? 1_555 ? 
84  AC5 26 HOH OA .   ? HOH C 656 . ? 1_555 ? 
85  AC5 26 HOH OA .   ? HOH C 676 . ? 1_555 ? 
86  AC5 26 HOH OA .   ? HOH C 725 . ? 1_555 ? 
87  AC5 26 HOH OA .   ? HOH C 816 . ? 1_555 ? 
88  AC5 26 HOH OA .   ? HOH C 874 . ? 1_555 ? 
89  AC6 25 ILE D  169 ? ILE D 144 . ? 1_555 ? 
90  AC6 25 THR D  170 ? THR D 145 . ? 1_555 ? 
91  AC6 25 PRO D  171 ? PRO D 146 . ? 1_555 ? 
92  AC6 25 PHE D  172 ? PHE D 147 . ? 1_555 ? 
93  AC6 25 ASN D  173 ? ASN D 148 . ? 1_555 ? 
94  AC6 25 PHE D  174 ? PHE D 149 . ? 1_555 ? 
95  AC6 25 LYS D  196 ? LYS D 171 . ? 1_555 ? 
96  AC6 25 GLU D  199 ? GLU D 174 . ? 1_555 ? 
97  AC6 25 LYS D  229 ? LYS D 204 . ? 1_555 ? 
98  AC6 25 VAL D  232 ? VAL D 207 . ? 1_555 ? 
99  AC6 25 PHE D  246 ? PHE D 221 . ? 1_555 ? 
100 AC6 25 VAL D  247 ? VAL D 222 . ? 1_555 ? 
101 AC6 25 GLY D  248 ? GLY D 223 . ? 1_555 ? 
102 AC6 25 SER D  249 ? SER D 224 . ? 1_555 ? 
103 AC6 25 ILE D  252 ? ILE D 227 . ? 1_555 ? 
104 AC6 25 GLY D  271 ? GLY D 246 . ? 1_555 ? 
105 AC6 25 GLY D  272 ? GLY D 247 . ? 1_555 ? 
106 AC6 25 ARG D  303 ? ARG D 278 . ? 1_555 ? 
107 AC6 25 CYS D  304 ? CYS D 279 . ? 1_555 ? 
108 AC6 25 GLU D  406 ? GLU D 381 . ? 1_555 ? 
109 AC6 25 PHE D  408 ? PHE D 383 . ? 1_555 ? 
110 AC6 25 HOH PA .   ? HOH D 663 . ? 1_555 ? 
111 AC6 25 HOH PA .   ? HOH D 730 . ? 1_555 ? 
112 AC6 25 HOH PA .   ? HOH D 774 . ? 1_555 ? 
113 AC6 25 HOH PA .   ? HOH D 804 . ? 1_555 ? 
114 AC7 29 ILE E  169 ? ILE E 144 . ? 1_555 ? 
115 AC7 29 THR E  170 ? THR E 145 . ? 1_555 ? 
116 AC7 29 PRO E  171 ? PRO E 146 . ? 1_555 ? 
117 AC7 29 PHE E  172 ? PHE E 147 . ? 1_555 ? 
118 AC7 29 ASN E  173 ? ASN E 148 . ? 1_555 ? 
119 AC7 29 PHE E  174 ? PHE E 149 . ? 1_555 ? 
120 AC7 29 ILE E  178 ? ILE E 153 . ? 1_555 ? 
121 AC7 29 LYS E  196 ? LYS E 171 . ? 1_555 ? 
122 AC7 29 GLU E  199 ? GLU E 174 . ? 1_555 ? 
123 AC7 29 LYS E  229 ? LYS E 204 . ? 1_555 ? 
124 AC7 29 VAL E  232 ? VAL E 207 . ? 1_555 ? 
125 AC7 29 PHE E  246 ? PHE E 221 . ? 1_555 ? 
126 AC7 29 VAL E  247 ? VAL E 222 . ? 1_555 ? 
127 AC7 29 GLY E  248 ? GLY E 223 . ? 1_555 ? 
128 AC7 29 SER E  249 ? SER E 224 . ? 1_555 ? 
129 AC7 29 ILE E  252 ? ILE E 227 . ? 1_555 ? 
130 AC7 29 GLY E  271 ? GLY E 246 . ? 1_555 ? 
131 AC7 29 GLY E  272 ? GLY E 247 . ? 1_555 ? 
132 AC7 29 ARG E  303 ? ARG E 278 . ? 1_555 ? 
133 AC7 29 CYS E  304 ? CYS E 279 . ? 1_555 ? 
134 AC7 29 GLU E  406 ? GLU E 381 . ? 1_555 ? 
135 AC7 29 PHE E  408 ? PHE E 383 . ? 1_555 ? 
136 AC7 29 HOH QA .   ? HOH E 684 . ? 1_555 ? 
137 AC7 29 HOH QA .   ? HOH E 687 . ? 1_555 ? 
138 AC7 29 HOH QA .   ? HOH E 755 . ? 1_555 ? 
139 AC7 29 HOH QA .   ? HOH E 833 . ? 1_555 ? 
140 AC7 29 HOH QA .   ? HOH E 867 . ? 1_555 ? 
141 AC7 29 HOH QA .   ? HOH E 872 . ? 1_555 ? 
142 AC7 29 HOH QA .   ? HOH E 934 . ? 1_555 ? 
143 AC8 27 ILE F  169 ? ILE F 144 . ? 1_555 ? 
144 AC8 27 THR F  170 ? THR F 145 . ? 1_555 ? 
145 AC8 27 PRO F  171 ? PRO F 146 . ? 1_555 ? 
146 AC8 27 PHE F  172 ? PHE F 147 . ? 1_555 ? 
147 AC8 27 ASN F  173 ? ASN F 148 . ? 1_555 ? 
148 AC8 27 PHE F  174 ? PHE F 149 . ? 1_555 ? 
149 AC8 27 MSE F  177 ? MSE F 152 . ? 1_555 ? 
150 AC8 27 ILE F  178 ? ILE F 153 . ? 1_555 ? 
151 AC8 27 LYS F  196 ? LYS F 171 . ? 1_555 ? 
152 AC8 27 GLU F  199 ? GLU F 174 . ? 1_555 ? 
153 AC8 27 LYS F  229 ? LYS F 204 . ? 1_555 ? 
154 AC8 27 VAL F  232 ? VAL F 207 . ? 1_555 ? 
155 AC8 27 PHE F  246 ? PHE F 221 . ? 1_555 ? 
156 AC8 27 VAL F  247 ? VAL F 222 . ? 1_555 ? 
157 AC8 27 GLY F  248 ? GLY F 223 . ? 1_555 ? 
158 AC8 27 SER F  249 ? SER F 224 . ? 1_555 ? 
159 AC8 27 ILE F  252 ? ILE F 227 . ? 1_555 ? 
160 AC8 27 GLY F  271 ? GLY F 246 . ? 1_555 ? 
161 AC8 27 GLY F  272 ? GLY F 247 . ? 1_555 ? 
162 AC8 27 CYS F  304 ? CYS F 279 . ? 1_555 ? 
163 AC8 27 GLU F  406 ? GLU F 381 . ? 1_555 ? 
164 AC8 27 PHE F  408 ? PHE F 383 . ? 1_555 ? 
165 AC8 27 HOH RA .   ? HOH F 736 . ? 1_555 ? 
166 AC8 27 HOH RA .   ? HOH F 802 . ? 1_555 ? 
167 AC8 27 HOH RA .   ? HOH F 848 . ? 1_555 ? 
168 AC8 27 HOH RA .   ? HOH F 849 . ? 1_555 ? 
169 AC8 27 HOH RA .   ? HOH F 861 . ? 1_555 ? 
170 AC9 2  HOH RA .   ? HOH F 792 . ? 1_555 ? 
171 AC9 2  HOH RA .   ? HOH F 894 . ? 1_555 ? 
172 BC1 24 ILE G  169 ? ILE G 144 . ? 1_555 ? 
173 BC1 24 THR G  170 ? THR G 145 . ? 1_555 ? 
174 BC1 24 PRO G  171 ? PRO G 146 . ? 1_555 ? 
175 BC1 24 PHE G  172 ? PHE G 147 . ? 1_555 ? 
176 BC1 24 ASN G  173 ? ASN G 148 . ? 1_555 ? 
177 BC1 24 PHE G  174 ? PHE G 149 . ? 1_555 ? 
178 BC1 24 LYS G  196 ? LYS G 171 . ? 1_555 ? 
179 BC1 24 GLU G  199 ? GLU G 174 . ? 1_555 ? 
180 BC1 24 LYS G  229 ? LYS G 204 . ? 1_555 ? 
181 BC1 24 VAL G  232 ? VAL G 207 . ? 1_555 ? 
182 BC1 24 PHE G  246 ? PHE G 221 . ? 1_555 ? 
183 BC1 24 VAL G  247 ? VAL G 222 . ? 1_555 ? 
184 BC1 24 GLY G  248 ? GLY G 223 . ? 1_555 ? 
185 BC1 24 SER G  249 ? SER G 224 . ? 1_555 ? 
186 BC1 24 ILE G  252 ? ILE G 227 . ? 1_555 ? 
187 BC1 24 GLY G  271 ? GLY G 246 . ? 1_555 ? 
188 BC1 24 GLY G  272 ? GLY G 247 . ? 1_555 ? 
189 BC1 24 CYS G  304 ? CYS G 279 . ? 1_555 ? 
190 BC1 24 GLU G  406 ? GLU G 381 . ? 1_555 ? 
191 BC1 24 PHE G  408 ? PHE G 383 . ? 1_555 ? 
192 BC1 24 HOH SA .   ? HOH G 713 . ? 1_555 ? 
193 BC1 24 HOH SA .   ? HOH G 811 . ? 1_555 ? 
194 BC1 24 HOH SA .   ? HOH G 812 . ? 1_555 ? 
195 BC1 24 HOH SA .   ? HOH G 829 . ? 1_555 ? 
196 BC2 2  HOH OA .   ? HOH C 797 . ? 1_555 ? 
197 BC2 2  HOH SA .   ? HOH G 869 . ? 1_555 ? 
198 BC3 27 ILE H  169 ? ILE H 144 . ? 1_555 ? 
199 BC3 27 THR H  170 ? THR H 145 . ? 1_555 ? 
200 BC3 27 PRO H  171 ? PRO H 146 . ? 1_555 ? 
201 BC3 27 PHE H  172 ? PHE H 147 . ? 1_555 ? 
202 BC3 27 ASN H  173 ? ASN H 148 . ? 1_555 ? 
203 BC3 27 PHE H  174 ? PHE H 149 . ? 1_555 ? 
204 BC3 27 ILE H  178 ? ILE H 153 . ? 1_555 ? 
205 BC3 27 LYS H  196 ? LYS H 171 . ? 1_555 ? 
206 BC3 27 GLU H  199 ? GLU H 174 . ? 1_555 ? 
207 BC3 27 LYS H  229 ? LYS H 204 . ? 1_555 ? 
208 BC3 27 VAL H  232 ? VAL H 207 . ? 1_555 ? 
209 BC3 27 PHE H  246 ? PHE H 221 . ? 1_555 ? 
210 BC3 27 VAL H  247 ? VAL H 222 . ? 1_555 ? 
211 BC3 27 GLY H  248 ? GLY H 223 . ? 1_555 ? 
212 BC3 27 SER H  249 ? SER H 224 . ? 1_555 ? 
213 BC3 27 ILE H  252 ? ILE H 227 . ? 1_555 ? 
214 BC3 27 GLY H  271 ? GLY H 246 . ? 1_555 ? 
215 BC3 27 GLY H  272 ? GLY H 247 . ? 1_555 ? 
216 BC3 27 ARG H  303 ? ARG H 278 . ? 1_555 ? 
217 BC3 27 CYS H  304 ? CYS H 279 . ? 1_555 ? 
218 BC3 27 GLU H  406 ? GLU H 381 . ? 1_555 ? 
219 BC3 27 PHE H  408 ? PHE H 383 . ? 1_555 ? 
220 BC3 27 HOH TA .   ? HOH H 703 . ? 1_555 ? 
221 BC3 27 HOH TA .   ? HOH H 753 . ? 1_555 ? 
222 BC3 27 HOH TA .   ? HOH H 803 . ? 1_555 ? 
223 BC3 27 HOH TA .   ? HOH H 809 . ? 1_555 ? 
224 BC3 27 HOH TA .   ? HOH H 828 . ? 1_555 ? 
225 BC4 25 ILE I  169 ? ILE I 144 . ? 1_555 ? 
226 BC4 25 THR I  170 ? THR I 145 . ? 1_555 ? 
227 BC4 25 PRO I  171 ? PRO I 146 . ? 1_555 ? 
228 BC4 25 PHE I  172 ? PHE I 147 . ? 1_555 ? 
229 BC4 25 ASN I  173 ? ASN I 148 . ? 1_555 ? 
230 BC4 25 PHE I  174 ? PHE I 149 . ? 1_555 ? 
231 BC4 25 ILE I  178 ? ILE I 153 . ? 1_555 ? 
232 BC4 25 LYS I  196 ? LYS I 171 . ? 1_555 ? 
233 BC4 25 GLU I  199 ? GLU I 174 . ? 1_555 ? 
234 BC4 25 LYS I  229 ? LYS I 204 . ? 1_555 ? 
235 BC4 25 VAL I  232 ? VAL I 207 . ? 1_555 ? 
236 BC4 25 PHE I  246 ? PHE I 221 . ? 1_555 ? 
237 BC4 25 VAL I  247 ? VAL I 222 . ? 1_555 ? 
238 BC4 25 GLY I  248 ? GLY I 223 . ? 1_555 ? 
239 BC4 25 SER I  249 ? SER I 224 . ? 1_555 ? 
240 BC4 25 ILE I  252 ? ILE I 227 . ? 1_555 ? 
241 BC4 25 GLY I  271 ? GLY I 246 . ? 1_555 ? 
242 BC4 25 GLY I  272 ? GLY I 247 . ? 1_555 ? 
243 BC4 25 ARG I  303 ? ARG I 278 . ? 1_555 ? 
244 BC4 25 CYS I  304 ? CYS I 279 . ? 1_555 ? 
245 BC4 25 GLU I  406 ? GLU I 381 . ? 1_555 ? 
246 BC4 25 PHE I  408 ? PHE I 383 . ? 1_555 ? 
247 BC4 25 HOH UA .   ? HOH I 815 . ? 1_555 ? 
248 BC4 25 HOH UA .   ? HOH I 833 . ? 1_555 ? 
249 BC4 25 HOH UA .   ? HOH I 864 . ? 1_555 ? 
250 BC5 3  HOH UA .   ? HOH I 750 . ? 1_555 ? 
251 BC5 3  HOH UA .   ? HOH I 866 . ? 1_555 ? 
252 BC5 3  HOH UA .   ? HOH I 867 . ? 1_555 ? 
253 BC6 25 ILE J  169 ? ILE J 144 . ? 1_555 ? 
254 BC6 25 THR J  170 ? THR J 145 . ? 1_555 ? 
255 BC6 25 PRO J  171 ? PRO J 146 . ? 1_555 ? 
256 BC6 25 PHE J  172 ? PHE J 147 . ? 1_555 ? 
257 BC6 25 ASN J  173 ? ASN J 148 . ? 1_555 ? 
258 BC6 25 PHE J  174 ? PHE J 149 . ? 1_555 ? 
259 BC6 25 LYS J  196 ? LYS J 171 . ? 1_555 ? 
260 BC6 25 GLU J  199 ? GLU J 174 . ? 1_555 ? 
261 BC6 25 LYS J  229 ? LYS J 204 . ? 1_555 ? 
262 BC6 25 VAL J  232 ? VAL J 207 . ? 1_555 ? 
263 BC6 25 PHE J  246 ? PHE J 221 . ? 1_555 ? 
264 BC6 25 VAL J  247 ? VAL J 222 . ? 1_555 ? 
265 BC6 25 GLY J  248 ? GLY J 223 . ? 1_555 ? 
266 BC6 25 SER J  249 ? SER J 224 . ? 1_555 ? 
267 BC6 25 ILE J  252 ? ILE J 227 . ? 1_555 ? 
268 BC6 25 GLY J  271 ? GLY J 246 . ? 1_555 ? 
269 BC6 25 GLY J  272 ? GLY J 247 . ? 1_555 ? 
270 BC6 25 CYS J  304 ? CYS J 279 . ? 1_555 ? 
271 BC6 25 GLU J  406 ? GLU J 381 . ? 1_555 ? 
272 BC6 25 PHE J  408 ? PHE J 383 . ? 1_555 ? 
273 BC6 25 HOH VA .   ? HOH J 638 . ? 1_555 ? 
274 BC6 25 HOH VA .   ? HOH J 642 . ? 1_555 ? 
275 BC6 25 HOH VA .   ? HOH J 822 . ? 1_555 ? 
276 BC6 25 HOH VA .   ? HOH J 855 . ? 1_555 ? 
277 BC6 25 HOH VA .   ? HOH J 869 . ? 1_555 ? 
278 BC7 27 ILE K  169 ? ILE K 144 . ? 1_555 ? 
279 BC7 27 THR K  170 ? THR K 145 . ? 1_555 ? 
280 BC7 27 PRO K  171 ? PRO K 146 . ? 1_555 ? 
281 BC7 27 PHE K  172 ? PHE K 147 . ? 1_555 ? 
282 BC7 27 ASN K  173 ? ASN K 148 . ? 1_555 ? 
283 BC7 27 PHE K  174 ? PHE K 149 . ? 1_555 ? 
284 BC7 27 LYS K  196 ? LYS K 171 . ? 1_555 ? 
285 BC7 27 GLU K  199 ? GLU K 174 . ? 1_555 ? 
286 BC7 27 LYS K  229 ? LYS K 204 . ? 1_555 ? 
287 BC7 27 VAL K  232 ? VAL K 207 . ? 1_555 ? 
288 BC7 27 PHE K  246 ? PHE K 221 . ? 1_555 ? 
289 BC7 27 VAL K  247 ? VAL K 222 . ? 1_555 ? 
290 BC7 27 GLY K  248 ? GLY K 223 . ? 1_555 ? 
291 BC7 27 SER K  249 ? SER K 224 . ? 1_555 ? 
292 BC7 27 ILE K  252 ? ILE K 227 . ? 1_555 ? 
293 BC7 27 GLY K  271 ? GLY K 246 . ? 1_555 ? 
294 BC7 27 GLY K  272 ? GLY K 247 . ? 1_555 ? 
295 BC7 27 CYS K  304 ? CYS K 279 . ? 1_555 ? 
296 BC7 27 GLU K  406 ? GLU K 381 . ? 1_555 ? 
297 BC7 27 PHE K  408 ? PHE K 383 . ? 1_555 ? 
298 BC7 27 HOH WA .   ? HOH K 698 . ? 1_555 ? 
299 BC7 27 HOH WA .   ? HOH K 701 . ? 1_555 ? 
300 BC7 27 HOH WA .   ? HOH K 745 . ? 1_555 ? 
301 BC7 27 HOH WA .   ? HOH K 748 . ? 1_555 ? 
302 BC7 27 HOH WA .   ? HOH K 763 . ? 1_555 ? 
303 BC7 27 HOH WA .   ? HOH K 906 . ? 1_555 ? 
304 BC7 27 HOH WA .   ? HOH K 919 . ? 1_555 ? 
305 BC8 25 ILE L  169 ? ILE L 144 . ? 1_555 ? 
306 BC8 25 THR L  170 ? THR L 145 . ? 1_555 ? 
307 BC8 25 PRO L  171 ? PRO L 146 . ? 1_555 ? 
308 BC8 25 PHE L  172 ? PHE L 147 . ? 1_555 ? 
309 BC8 25 ASN L  173 ? ASN L 148 . ? 1_555 ? 
310 BC8 25 PHE L  174 ? PHE L 149 . ? 1_555 ? 
311 BC8 25 MSE L  177 ? MSE L 152 . ? 1_555 ? 
312 BC8 25 LYS L  196 ? LYS L 171 . ? 1_555 ? 
313 BC8 25 GLU L  199 ? GLU L 174 . ? 1_555 ? 
314 BC8 25 LYS L  229 ? LYS L 204 . ? 1_555 ? 
315 BC8 25 VAL L  232 ? VAL L 207 . ? 1_555 ? 
316 BC8 25 PHE L  246 ? PHE L 221 . ? 1_555 ? 
317 BC8 25 VAL L  247 ? VAL L 222 . ? 1_555 ? 
318 BC8 25 GLY L  248 ? GLY L 223 . ? 1_555 ? 
319 BC8 25 SER L  249 ? SER L 224 . ? 1_555 ? 
320 BC8 25 ILE L  252 ? ILE L 227 . ? 1_555 ? 
321 BC8 25 GLY L  271 ? GLY L 246 . ? 1_555 ? 
322 BC8 25 GLY L  272 ? GLY L 247 . ? 1_555 ? 
323 BC8 25 ARG L  303 ? ARG L 278 . ? 1_555 ? 
324 BC8 25 CYS L  304 ? CYS L 279 . ? 1_555 ? 
325 BC8 25 GLU L  406 ? GLU L 381 . ? 1_555 ? 
326 BC8 25 PHE L  408 ? PHE L 383 . ? 1_555 ? 
327 BC8 25 HOH XA .   ? HOH L 657 . ? 1_555 ? 
328 BC8 25 HOH XA .   ? HOH L 678 . ? 1_555 ? 
329 BC8 25 HOH XA .   ? HOH L 802 . ? 1_555 ? 
330 BC9 26 ILE M  169 ? ILE M 144 . ? 1_555 ? 
331 BC9 26 THR M  170 ? THR M 145 . ? 1_555 ? 
332 BC9 26 PRO M  171 ? PRO M 146 . ? 1_555 ? 
333 BC9 26 PHE M  172 ? PHE M 147 . ? 1_555 ? 
334 BC9 26 ASN M  173 ? ASN M 148 . ? 1_555 ? 
335 BC9 26 PHE M  174 ? PHE M 149 . ? 1_555 ? 
336 BC9 26 MSE M  177 ? MSE M 152 . ? 1_555 ? 
337 BC9 26 LYS M  196 ? LYS M 171 . ? 1_555 ? 
338 BC9 26 GLU M  199 ? GLU M 174 . ? 1_555 ? 
339 BC9 26 LYS M  229 ? LYS M 204 . ? 1_555 ? 
340 BC9 26 VAL M  232 ? VAL M 207 . ? 1_555 ? 
341 BC9 26 PHE M  246 ? PHE M 221 . ? 1_555 ? 
342 BC9 26 VAL M  247 ? VAL M 222 . ? 1_555 ? 
343 BC9 26 GLY M  248 ? GLY M 223 . ? 1_555 ? 
344 BC9 26 SER M  249 ? SER M 224 . ? 1_555 ? 
345 BC9 26 ILE M  252 ? ILE M 227 . ? 1_555 ? 
346 BC9 26 GLY M  271 ? GLY M 246 . ? 1_555 ? 
347 BC9 26 GLY M  272 ? GLY M 247 . ? 1_555 ? 
348 BC9 26 ARG M  303 ? ARG M 278 . ? 1_555 ? 
349 BC9 26 CYS M  304 ? CYS M 279 . ? 1_555 ? 
350 BC9 26 GLU M  406 ? GLU M 381 . ? 1_555 ? 
351 BC9 26 PHE M  408 ? PHE M 383 . ? 1_555 ? 
352 BC9 26 HOH YA .   ? HOH M 679 . ? 1_555 ? 
353 BC9 26 HOH YA .   ? HOH M 694 . ? 1_555 ? 
354 BC9 26 HOH YA .   ? HOH M 733 . ? 1_555 ? 
355 BC9 26 HOH YA .   ? HOH M 764 . ? 1_555 ? 
356 CC1 25 ILE N  169 ? ILE N 144 . ? 1_555 ? 
357 CC1 25 THR N  170 ? THR N 145 . ? 1_555 ? 
358 CC1 25 PRO N  171 ? PRO N 146 . ? 1_555 ? 
359 CC1 25 PHE N  172 ? PHE N 147 . ? 1_555 ? 
360 CC1 25 ASN N  173 ? ASN N 148 . ? 1_555 ? 
361 CC1 25 PHE N  174 ? PHE N 149 . ? 1_555 ? 
362 CC1 25 ILE N  178 ? ILE N 153 . ? 1_555 ? 
363 CC1 25 LYS N  196 ? LYS N 171 . ? 1_555 ? 
364 CC1 25 GLU N  199 ? GLU N 174 . ? 1_555 ? 
365 CC1 25 LYS N  229 ? LYS N 204 . ? 1_555 ? 
366 CC1 25 VAL N  232 ? VAL N 207 . ? 1_555 ? 
367 CC1 25 PHE N  246 ? PHE N 221 . ? 1_555 ? 
368 CC1 25 VAL N  247 ? VAL N 222 . ? 1_555 ? 
369 CC1 25 GLY N  248 ? GLY N 223 . ? 1_555 ? 
370 CC1 25 SER N  249 ? SER N 224 . ? 1_555 ? 
371 CC1 25 ILE N  252 ? ILE N 227 . ? 1_555 ? 
372 CC1 25 GLY N  271 ? GLY N 246 . ? 1_555 ? 
373 CC1 25 GLY N  272 ? GLY N 247 . ? 1_555 ? 
374 CC1 25 CYS N  304 ? CYS N 279 . ? 1_555 ? 
375 CC1 25 GLU N  406 ? GLU N 381 . ? 1_555 ? 
376 CC1 25 PHE N  408 ? PHE N 383 . ? 1_555 ? 
377 CC1 25 HOH ZA .   ? HOH N 754 . ? 1_555 ? 
378 CC1 25 HOH ZA .   ? HOH N 785 . ? 1_555 ? 
379 CC1 25 HOH ZA .   ? HOH N 812 . ? 1_555 ? 
380 CC1 25 HOH ZA .   ? HOH N 816 . ? 1_555 ? 
381 CC2 27 ILE O  169 ? ILE O 144 . ? 1_555 ? 
382 CC2 27 THR O  170 ? THR O 145 . ? 1_555 ? 
383 CC2 27 PRO O  171 ? PRO O 146 . ? 1_555 ? 
384 CC2 27 PHE O  172 ? PHE O 147 . ? 1_555 ? 
385 CC2 27 ASN O  173 ? ASN O 148 . ? 1_555 ? 
386 CC2 27 PHE O  174 ? PHE O 149 . ? 1_555 ? 
387 CC2 27 LYS O  196 ? LYS O 171 . ? 1_555 ? 
388 CC2 27 GLU O  199 ? GLU O 174 . ? 1_555 ? 
389 CC2 27 LYS O  229 ? LYS O 204 . ? 1_555 ? 
390 CC2 27 VAL O  232 ? VAL O 207 . ? 1_555 ? 
391 CC2 27 PHE O  246 ? PHE O 221 . ? 1_555 ? 
392 CC2 27 VAL O  247 ? VAL O 222 . ? 1_555 ? 
393 CC2 27 GLY O  248 ? GLY O 223 . ? 1_555 ? 
394 CC2 27 SER O  249 ? SER O 224 . ? 1_555 ? 
395 CC2 27 ILE O  252 ? ILE O 227 . ? 1_555 ? 
396 CC2 27 GLY O  271 ? GLY O 246 . ? 1_555 ? 
397 CC2 27 GLY O  272 ? GLY O 247 . ? 1_555 ? 
398 CC2 27 ARG O  303 ? ARG O 278 . ? 1_555 ? 
399 CC2 27 CYS O  304 ? CYS O 279 . ? 1_555 ? 
400 CC2 27 GLU O  406 ? GLU O 381 . ? 1_555 ? 
401 CC2 27 PHE O  408 ? PHE O 383 . ? 1_555 ? 
402 CC2 27 HOH AB .   ? HOH O 605 . ? 1_555 ? 
403 CC2 27 HOH AB .   ? HOH O 618 . ? 1_555 ? 
404 CC2 27 HOH AB .   ? HOH O 640 . ? 1_555 ? 
405 CC2 27 HOH AB .   ? HOH O 653 . ? 1_555 ? 
406 CC2 27 HOH AB .   ? HOH O 664 . ? 1_555 ? 
407 CC2 27 HOH AB .   ? HOH O 851 . ? 1_555 ? 
408 CC3 2  HOH WA .   ? HOH K 813 . ? 1_555 ? 
409 CC3 2  HOH WA .   ? HOH K 917 . ? 1_555 ? 
410 CC4 26 ILE P  169 ? ILE P 144 . ? 1_555 ? 
411 CC4 26 THR P  170 ? THR P 145 . ? 1_555 ? 
412 CC4 26 PRO P  171 ? PRO P 146 . ? 1_555 ? 
413 CC4 26 PHE P  172 ? PHE P 147 . ? 1_555 ? 
414 CC4 26 ASN P  173 ? ASN P 148 . ? 1_555 ? 
415 CC4 26 PHE P  174 ? PHE P 149 . ? 1_555 ? 
416 CC4 26 LYS P  196 ? LYS P 171 . ? 1_555 ? 
417 CC4 26 GLU P  199 ? GLU P 174 . ? 1_555 ? 
418 CC4 26 LYS P  229 ? LYS P 204 . ? 1_555 ? 
419 CC4 26 VAL P  232 ? VAL P 207 . ? 1_555 ? 
420 CC4 26 PHE P  246 ? PHE P 221 . ? 1_555 ? 
421 CC4 26 VAL P  247 ? VAL P 222 . ? 1_555 ? 
422 CC4 26 GLY P  248 ? GLY P 223 . ? 1_555 ? 
423 CC4 26 SER P  249 ? SER P 224 . ? 1_555 ? 
424 CC4 26 ILE P  252 ? ILE P 227 . ? 1_555 ? 
425 CC4 26 GLY P  271 ? GLY P 246 . ? 1_555 ? 
426 CC4 26 GLY P  272 ? GLY P 247 . ? 1_555 ? 
427 CC4 26 ARG P  303 ? ARG P 278 . ? 1_555 ? 
428 CC4 26 CYS P  304 ? CYS P 279 . ? 1_555 ? 
429 CC4 26 GLU P  406 ? GLU P 381 . ? 1_555 ? 
430 CC4 26 PHE P  408 ? PHE P 383 . ? 1_555 ? 
431 CC4 26 HOH BB .   ? HOH P 654 . ? 1_555 ? 
432 CC4 26 HOH BB .   ? HOH P 779 . ? 1_555 ? 
433 CC4 26 HOH BB .   ? HOH P 815 . ? 1_555 ? 
434 CC4 26 HOH BB .   ? HOH P 821 . ? 1_555 ? 
435 CC4 26 HOH BB .   ? HOH P 866 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4IYM 
_atom_sites.fract_transf_matrix[1][1]   0.006271 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001838 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005851 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006113 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     N  N   . MSE A  1 24  ? 93.639  -28.934 -25.447  1.00 38.90  ? -1  MSE A N   1 
HETATM 2     C  CA  . MSE A  1 24  ? 94.253  -27.689 -24.881  1.00 41.67  ? -1  MSE A CA  1 
HETATM 3     C  C   . MSE A  1 24  ? 93.629  -26.466 -25.485  1.00 38.01  ? -1  MSE A C   1 
HETATM 4     O  O   . MSE A  1 24  ? 93.690  -26.272 -26.698  1.00 40.56  ? -1  MSE A O   1 
HETATM 5     C  CB  . MSE A  1 24  ? 95.746  -27.619 -25.206  1.00 50.08  ? -1  MSE A CB  1 
HETATM 6     C  CG  . MSE A  1 24  ? 96.573  -28.752 -24.599  1.00 58.82  ? -1  MSE A CG  1 
HETATM 7     SE SE  . MSE A  1 24  ? 96.591  -28.646 -22.622  1.00 64.70  ? -1  MSE A SE  1 
HETATM 8     C  CE  . MSE A  1 24  ? 95.477  -30.256 -22.328  1.00 59.00  ? -1  MSE A CE  1 
ATOM   9     N  N   . TYR A  1 25  ? 93.035  -25.624 -24.645  1.00 33.17  ? 0   TYR A N   1 
ATOM   10    C  CA  . TYR A  1 25  ? 92.472  -24.341 -25.091  1.00 29.66  ? 0   TYR A CA  1 
ATOM   11    C  C   . TYR A  1 25  ? 93.339  -23.125 -24.709  1.00 29.11  ? 0   TYR A C   1 
ATOM   12    O  O   . TYR A  1 25  ? 94.035  -23.134 -23.691  1.00 28.10  ? 0   TYR A O   1 
ATOM   13    C  CB  . TYR A  1 25  ? 91.018  -24.181 -24.619  1.00 26.23  ? 0   TYR A CB  1 
ATOM   14    C  CG  . TYR A  1 25  ? 90.807  -24.234 -23.114  1.00 24.42  ? 0   TYR A CG  1 
ATOM   15    C  CD1 . TYR A  1 25  ? 90.565  -25.440 -22.463  1.00 23.86  ? 0   TYR A CD1 1 
ATOM   16    C  CD2 . TYR A  1 25  ? 90.813  -23.063 -22.347  1.00 23.57  ? 0   TYR A CD2 1 
ATOM   17    C  CE1 . TYR A  1 25  ? 90.368  -25.480 -21.087  1.00 23.41  ? 0   TYR A CE1 1 
ATOM   18    C  CE2 . TYR A  1 25  ? 90.613  -23.089 -20.979  1.00 22.59  ? 0   TYR A CE2 1 
ATOM   19    C  CZ  . TYR A  1 25  ? 90.392  -24.298 -20.344  1.00 22.93  ? 0   TYR A CZ  1 
ATOM   20    O  OH  . TYR A  1 25  ? 90.171  -24.325 -18.968  1.00 22.05  ? 0   TYR A OH  1 
ATOM   21    N  N   . GLU A  1 26  ? 93.306  -22.090 -25.548  1.00 29.21  ? 1   GLU A N   1 
ATOM   22    C  CA  . GLU A  1 26  ? 94.111  -20.887 -25.332  1.00 30.01  ? 1   GLU A CA  1 
ATOM   23    C  C   . GLU A  1 26  ? 93.238  -19.649 -25.184  1.00 27.60  ? 1   GLU A C   1 
ATOM   24    O  O   . GLU A  1 26  ? 92.654  -19.194 -26.166  1.00 28.67  ? 1   GLU A O   1 
ATOM   25    C  CB  . GLU A  1 26  ? 95.061  -20.652 -26.510  1.00 33.35  ? 1   GLU A CB  1 
ATOM   26    C  CG  . GLU A  1 26  ? 96.119  -21.713 -26.722  1.00 39.00  ? 1   GLU A CG  1 
ATOM   27    C  CD  . GLU A  1 26  ? 96.725  -21.661 -28.118  1.00 45.50  ? 1   GLU A CD  1 
ATOM   28    O  OE1 . GLU A  1 26  ? 96.151  -20.991 -29.010  1.00 48.54  ? 1   GLU A OE1 1 
ATOM   29    O  OE2 . GLU A  1 26  ? 97.778  -22.302 -28.329  1.00 47.75  ? 1   GLU A OE2 1 
ATOM   30    N  N   . LEU A  1 27  ? 93.158  -19.096 -23.978  1.00 24.97  ? 2   LEU A N   1 
ATOM   31    C  CA  . LEU A  1 27  ? 92.426  -17.836 -23.775  1.00 24.01  ? 2   LEU A CA  1 
ATOM   32    C  C   . LEU A  1 27  ? 93.314  -16.616 -24.052  1.00 23.00  ? 2   LEU A C   1 
ATOM   33    O  O   . LEU A  1 27  ? 94.480  -16.551 -23.628  1.00 22.13  ? 2   LEU A O   1 
ATOM   34    C  CB  . LEU A  1 27  ? 91.782  -17.746 -22.374  1.00 23.70  ? 2   LEU A CB  1 
ATOM   35    C  CG  . LEU A  1 27  ? 90.947  -18.913 -21.817  1.00 25.57  ? 2   LEU A CG  1 
ATOM   36    C  CD1 . LEU A  1 27  ? 90.425  -18.570 -20.433  1.00 27.93  ? 2   LEU A CD1 1 
ATOM   37    C  CD2 . LEU A  1 27  ? 89.777  -19.302 -22.710  1.00 25.74  ? 2   LEU A CD2 1 
ATOM   38    N  N   . GLY A  1 28  ? 92.751  -15.662 -24.787  1.00 22.19  ? 3   GLY A N   1 
ATOM   39    C  CA  . GLY A  1 28  ? 93.404  -14.379 -25.006  1.00 22.35  ? 3   GLY A CA  1 
ATOM   40    C  C   . GLY A  1 28  ? 92.714  -13.340 -24.146  1.00 21.77  ? 3   GLY A C   1 
ATOM   41    O  O   . GLY A  1 28  ? 92.504  -13.557 -22.952  1.00 20.93  ? 3   GLY A O   1 
ATOM   42    N  N   . HIS A  1 29  ? 92.349  -12.222 -24.767  1.00 21.84  ? 4   HIS A N   1 
ATOM   43    C  CA  . HIS A  1 29  ? 91.611  -11.143 -24.098  1.00 21.14  ? 4   HIS A CA  1 
ATOM   44    C  C   . HIS A  1 29  ? 90.261  -10.912 -24.778  1.00 20.69  ? 4   HIS A C   1 
ATOM   45    O  O   . HIS A  1 29  ? 89.973  -11.512 -25.819  1.00 20.91  ? 4   HIS A O   1 
ATOM   46    C  CB  . HIS A  1 29  ? 92.448  -9.863  -24.103  1.00 20.37  ? 4   HIS A CB  1 
ATOM   47    C  CG  . HIS A  1 29  ? 93.866  -10.096 -23.710  1.00 20.85  ? 4   HIS A CG  1 
ATOM   48    N  ND1 . HIS A  1 29  ? 94.251  -10.268 -22.399  1.00 20.81  ? 4   HIS A ND1 1 
ATOM   49    C  CD2 . HIS A  1 29  ? 94.985  -10.255 -24.459  1.00 21.48  ? 4   HIS A CD2 1 
ATOM   50    C  CE1 . HIS A  1 29  ? 95.554  -10.490 -22.354  1.00 21.73  ? 4   HIS A CE1 1 
ATOM   51    N  NE2 . HIS A  1 29  ? 96.022  -10.486 -23.591  1.00 22.00  ? 4   HIS A NE2 1 
ATOM   52    N  N   . PHE A  1 30  ? 89.438  -10.062 -24.177  1.00 19.85  ? 5   PHE A N   1 
ATOM   53    C  CA  . PHE A  1 30  ? 88.193  -9.631  -24.802  1.00 20.09  ? 5   PHE A CA  1 
ATOM   54    C  C   . PHE A  1 30  ? 88.203  -8.114  -24.941  1.00 20.16  ? 5   PHE A C   1 
ATOM   55    O  O   . PHE A  1 30  ? 88.072  -7.383  -23.947  1.00 18.47  ? 5   PHE A O   1 
ATOM   56    C  CB  . PHE A  1 30  ? 86.964  -10.090 -24.014  1.00 19.60  ? 5   PHE A CB  1 
ATOM   57    C  CG  . PHE A  1 30  ? 85.673  -10.016 -24.800  1.00 19.80  ? 5   PHE A CG  1 
ATOM   58    C  CD1 . PHE A  1 30  ? 84.898  -8.849  -24.793  1.00 19.21  ? 5   PHE A CD1 1 
ATOM   59    C  CD2 . PHE A  1 30  ? 85.229  -11.116 -25.547  1.00 19.73  ? 5   PHE A CD2 1 
ATOM   60    C  CE1 . PHE A  1 30  ? 83.707  -8.785  -25.510  1.00 19.00  ? 5   PHE A CE1 1 
ATOM   61    C  CE2 . PHE A  1 30  ? 84.037  -11.059 -26.259  1.00 20.06  ? 5   PHE A CE2 1 
ATOM   62    C  CZ  . PHE A  1 30  ? 83.273  -9.892  -26.238  1.00 19.62  ? 5   PHE A CZ  1 
ATOM   63    N  N   . ILE A  1 31  ? 88.338  -7.680  -26.170  1.00 21.74  ? 6   ILE A N   1 
ATOM   64    C  CA  . ILE A  1 31  ? 88.489  -6.284  -26.492  1.00 23.30  ? 6   ILE A CA  1 
ATOM   65    C  C   . ILE A  1 31  ? 87.682  -5.867  -27.675  1.00 24.13  ? 6   ILE A C   1 
ATOM   66    O  O   . ILE A  1 31  ? 87.663  -6.487  -28.687  1.00 23.05  ? 6   ILE A O   1 
ATOM   67    C  CB  . ILE A  1 31  ? 89.931  -5.842  -26.661  1.00 23.82  ? 6   ILE A CB  1 
ATOM   68    C  CG1 . ILE A  1 31  ? 90.815  -6.445  -25.581  1.00 25.39  ? 6   ILE A CG1 1 
ATOM   69    C  CG2 . ILE A  1 31  ? 90.000  -4.347  -26.666  1.00 23.20  ? 6   ILE A CG2 1 
ATOM   70    C  CD1 . ILE A  1 31  ? 92.156  -5.790  -25.435  1.00 26.34  ? 6   ILE A CD1 1 
ATOM   71    N  N   . ASP A  1 32  ? 86.979  -4.783  -27.456  1.00 26.62  ? 7   ASP A N   1 
ATOM   72    C  CA  . ASP A  1 32  ? 86.142  -4.172  -28.441  1.00 29.78  ? 7   ASP A CA  1 
ATOM   73    C  C   . ASP A  1 32  ? 85.126  -5.096  -29.063  1.00 27.71  ? 7   ASP A C   1 
ATOM   74    O  O   . ASP A  1 32  ? 84.924  -5.091  -30.225  1.00 28.97  ? 7   ASP A O   1 
ATOM   75    C  CB  . ASP A  1 32  ? 86.968  -3.478  -29.498  1.00 33.77  ? 7   ASP A CB  1 
ATOM   76    C  CG  . ASP A  1 32  ? 86.474  -2.137  -29.772  1.00 39.66  ? 7   ASP A CG  1 
ATOM   77    O  OD1 . ASP A  1 32  ? 86.593  -1.291  -28.936  1.00 39.76  ? 7   ASP A OD1 1 
ATOM   78    O  OD2 . ASP A  1 32  ? 85.892  -1.921  -30.800  1.00 49.23  ? 7   ASP A OD2 1 
ATOM   79    N  N   . GLY A  1 33  ? 84.549  -5.914  -28.239  1.00 24.79  ? 8   GLY A N   1 
ATOM   80    C  CA  . GLY A  1 33  ? 83.569  -6.862  -28.607  1.00 25.75  ? 8   GLY A CA  1 
ATOM   81    C  C   . GLY A  1 33  ? 83.998  -8.210  -29.084  1.00 26.05  ? 8   GLY A C   1 
ATOM   82    O  O   . GLY A  1 33  ? 83.189  -8.976  -29.404  1.00 26.11  ? 8   GLY A O   1 
ATOM   83    N  N   . LYS A  1 34  ? 85.281  -8.464  -29.108  1.00 26.84  ? 9   LYS A N   1 
ATOM   84    C  CA  . LYS A  1 34  ? 85.814  -9.696  -29.610  1.00 27.89  ? 9   LYS A CA  1 
ATOM   85    C  C   . LYS A  1 34  ? 86.877  -10.323 -28.742  1.00 26.12  ? 9   LYS A C   1 
ATOM   86    O  O   . LYS A  1 34  ? 87.646  -9.667  -28.094  1.00 26.06  ? 9   LYS A O   1 
ATOM   87    C  CB  . LYS A  1 34  ? 86.377  -9.506  -31.008  1.00 30.04  ? 9   LYS A CB  1 
ATOM   88    C  CG  . LYS A  1 34  ? 85.431  -8.890  -32.010  1.00 35.58  ? 9   LYS A CG  1 
ATOM   89    C  CD  . LYS A  1 34  ? 86.186  -8.337  -33.187  1.00 42.53  ? 9   LYS A CD  1 
ATOM   90    C  CE  . LYS A  1 34  ? 85.316  -7.553  -34.151  1.00 49.08  ? 9   LYS A CE  1 
ATOM   91    N  NZ  . LYS A  1 34  ? 84.714  -8.340  -35.274  1.00 52.44  ? 9   LYS A NZ  1 
ATOM   92    N  N   . ARG A  1 35  ? 86.913  -11.622 -28.783  1.00 23.95  ? 10  ARG A N   1 
ATOM   93    C  CA  . ARG A  1 35  ? 88.073  -12.338 -28.273  1.00 25.06  ? 10  ARG A CA  1 
ATOM   94    C  C   . ARG A  1 35  ? 89.268  -12.006 -29.170  1.00 24.76  ? 10  ARG A C   1 
ATOM   95    O  O   . ARG A  1 35  ? 89.175  -12.083 -30.399  1.00 25.94  ? 10  ARG A O   1 
ATOM   96    C  CB  . ARG A  1 35  ? 87.818  -13.852 -28.278  1.00 26.83  ? 10  ARG A CB  1 
ATOM   97    C  CG  . ARG A  1 35  ? 86.788  -14.331 -27.258  1.00 28.02  ? 10  ARG A CG  1 
ATOM   98    C  CD  . ARG A  1 35  ? 86.498  -15.823 -27.435  1.00 29.80  ? 10  ARG A CD  1 
ATOM   99    N  NE  . ARG A  1 35  ? 85.335  -16.250 -26.652  1.00 31.28  ? 10  ARG A NE  1 
ATOM   100   C  CZ  . ARG A  1 35  ? 85.400  -16.983 -25.540  1.00 33.93  ? 10  ARG A CZ  1 
ATOM   101   N  NH1 . ARG A  1 35  ? 86.570  -17.389 -25.068  1.00 34.04  ? 10  ARG A NH1 1 
ATOM   102   N  NH2 . ARG A  1 35  ? 84.288  -17.313 -24.888  1.00 35.17  ? 10  ARG A NH2 1 
ATOM   103   N  N   . VAL A  1 36  ? 90.381  -11.611 -28.567  1.00 23.18  ? 11  VAL A N   1 
ATOM   104   C  CA  . VAL A  1 36  ? 91.576  -11.277 -29.328  1.00 24.02  ? 11  VAL A CA  1 
ATOM   105   C  C   . VAL A  1 36  ? 92.798  -11.934 -28.682  1.00 25.39  ? 11  VAL A C   1 
ATOM   106   O  O   . VAL A  1 36  ? 92.789  -12.249 -27.494  1.00 25.67  ? 11  VAL A O   1 
ATOM   107   C  CB  . VAL A  1 36  ? 91.766  -9.741  -29.506  1.00 24.05  ? 11  VAL A CB  1 
ATOM   108   C  CG1 . VAL A  1 36  ? 90.543  -9.096  -30.165  1.00 22.87  ? 11  VAL A CG1 1 
ATOM   109   C  CG2 . VAL A  1 36  ? 92.081  -9.058  -28.180  1.00 23.57  ? 11  VAL A CG2 1 
ATOM   110   N  N   . ALA A  1 37  ? 93.845  -12.137 -29.474  1.00 27.39  ? 12  ALA A N   1 
ATOM   111   C  CA  . ALA A  1 37  ? 94.998  -12.935 -29.037  1.00 28.04  ? 12  ALA A CA  1 
ATOM   112   C  C   . ALA A  1 37  ? 95.968  -12.168 -28.135  1.00 27.22  ? 12  ALA A C   1 
ATOM   113   O  O   . ALA A  1 37  ? 96.630  -12.772 -27.297  1.00 26.10  ? 12  ALA A O   1 
ATOM   114   C  CB  . ALA A  1 37  ? 95.729  -13.540 -30.238  1.00 26.41  ? 12  ALA A CB  1 
ATOM   115   N  N   . GLY A  1 38  ? 96.038  -10.846 -28.299  1.00 28.02  ? 13  GLY A N   1 
ATOM   116   C  CA  . GLY A  1 38  ? 97.025  -10.035 -27.574  1.00 28.57  ? 13  GLY A CA  1 
ATOM   117   C  C   . GLY A  1 38  ? 98.410  -10.219 -28.174  1.00 29.23  ? 13  GLY A C   1 
ATOM   118   O  O   . GLY A  1 38  ? 98.614  -11.075 -29.043  1.00 28.85  ? 13  GLY A O   1 
ATOM   119   N  N   . THR A  1 39  ? 99.369  -9.429  -27.709  1.00 29.13  ? 14  THR A N   1 
ATOM   120   C  CA  . THR A  1 39  ? 100.642 -9.309  -28.413  1.00 29.83  ? 14  THR A CA  1 
ATOM   121   C  C   . THR A  1 39  ? 101.874 -9.566  -27.531  1.00 30.21  ? 14  THR A C   1 
ATOM   122   O  O   . THR A  1 39  ? 102.997 -9.282  -27.930  1.00 30.57  ? 14  THR A O   1 
ATOM   123   C  CB  . THR A  1 39  ? 100.765 -7.912  -29.077  1.00 30.35  ? 14  THR A CB  1 
ATOM   124   O  OG1 . THR A  1 39  ? 100.675 -6.883  -28.078  1.00 28.92  ? 14  THR A OG1 1 
ATOM   125   C  CG2 . THR A  1 39  ? 99.674  -7.705  -30.123  1.00 31.04  ? 14  THR A CG2 1 
ATOM   126   N  N   . SER A  1 40  ? 101.667 -10.118 -26.342  1.00 29.15  ? 15  SER A N   1 
ATOM   127   C  CA  . SER A  1 40  ? 102.737 -10.176 -25.356  1.00 27.42  ? 15  SER A CA  1 
ATOM   128   C  C   . SER A  1 40  ? 103.714 -11.333 -25.526  1.00 28.39  ? 15  SER A C   1 
ATOM   129   O  O   . SER A  1 40  ? 104.821 -11.275 -24.995  1.00 29.80  ? 15  SER A O   1 
ATOM   130   C  CB  . SER A  1 40  ? 102.148 -10.225 -23.951  1.00 24.76  ? 15  SER A CB  1 
ATOM   131   O  OG  . SER A  1 40  ? 101.605 -11.510 -23.696  1.00 24.30  ? 15  SER A OG  1 
ATOM   132   N  N   . GLY A  1 41  ? 103.303 -12.391 -26.228  1.00 27.69  ? 16  GLY A N   1 
ATOM   133   C  CA  . GLY A  1 41  ? 104.083 -13.627 -26.276  1.00 27.39  ? 16  GLY A CA  1 
ATOM   134   C  C   . GLY A  1 41  ? 104.216 -14.347 -24.934  1.00 28.76  ? 16  GLY A C   1 
ATOM   135   O  O   . GLY A  1 41  ? 105.062 -15.235 -24.796  1.00 29.62  ? 16  GLY A O   1 
ATOM   136   N  N   . ARG A  1 42  ? 103.390 -13.956 -23.949  1.00 27.77  ? 17  ARG A N   1 
ATOM   137   C  CA  . ARG A  1 42  ? 103.402 -14.523 -22.596  1.00 27.25  ? 17  ARG A CA  1 
ATOM   138   C  C   . ARG A  1 42  ? 102.116 -15.279 -22.322  1.00 25.72  ? 17  ARG A C   1 
ATOM   139   O  O   . ARG A  1 42  ? 101.027 -14.805 -22.670  1.00 25.02  ? 17  ARG A O   1 
ATOM   140   C  CB  . ARG A  1 42  ? 103.507 -13.429 -21.528  1.00 27.26  ? 17  ARG A CB  1 
ATOM   141   C  CG  . ARG A  1 42  ? 104.848 -12.747 -21.426  1.00 29.53  ? 17  ARG A CG  1 
ATOM   142   C  CD  . ARG A  1 42  ? 104.874 -11.823 -20.223  1.00 31.60  ? 17  ARG A CD  1 
ATOM   143   N  NE  . ARG A  1 42  ? 105.028 -12.552 -18.957  1.00 33.10  ? 17  ARG A NE  1 
ATOM   144   C  CZ  . ARG A  1 42  ? 104.475 -12.192 -17.799  1.00 32.98  ? 17  ARG A CZ  1 
ATOM   145   N  NH1 . ARG A  1 42  ? 103.687 -11.122 -17.718  1.00 32.31  ? 17  ARG A NH1 1 
ATOM   146   N  NH2 . ARG A  1 42  ? 104.695 -12.917 -16.713  1.00 33.03  ? 17  ARG A NH2 1 
ATOM   147   N  N   . VAL A  1 43  ? 102.252 -16.440 -21.682  1.00 25.29  ? 18  VAL A N   1 
ATOM   148   C  CA  . VAL A  1 43  ? 101.105 -17.218 -21.201  1.00 25.76  ? 18  VAL A CA  1 
ATOM   149   C  C   . VAL A  1 43  ? 101.326 -17.766 -19.786  1.00 26.76  ? 18  VAL A C   1 
ATOM   150   O  O   . VAL A  1 43  ? 102.449 -17.852 -19.284  1.00 26.09  ? 18  VAL A O   1 
ATOM   151   C  CB  . VAL A  1 43  ? 100.732 -18.399 -22.138  1.00 25.49  ? 18  VAL A CB  1 
ATOM   152   C  CG1 . VAL A  1 43  ? 100.215 -17.900 -23.481  1.00 24.65  ? 18  VAL A CG1 1 
ATOM   153   C  CG2 . VAL A  1 43  ? 101.908 -19.356 -22.315  1.00 25.82  ? 18  VAL A CG2 1 
ATOM   154   N  N   . SER A  1 44  ? 100.223 -18.145 -19.166  1.00 27.97  ? 19  SER A N   1 
ATOM   155   C  CA  . SER A  1 44  ? 100.209 -18.793 -17.878  1.00 28.76  ? 19  SER A CA  1 
ATOM   156   C  C   . SER A  1 44  ? 99.340  -20.052 -18.049  1.00 26.93  ? 19  SER A C   1 
ATOM   157   O  O   . SER A  1 44  ? 98.375  -20.034 -18.826  1.00 25.58  ? 19  SER A O   1 
ATOM   158   C  CB  . SER A  1 44  ? 99.575  -17.831 -16.886  1.00 31.08  ? 19  SER A CB  1 
ATOM   159   O  OG  . SER A  1 44  ? 99.724  -18.296 -15.577  1.00 33.51  ? 19  SER A OG  1 
ATOM   160   N  N   . ASN A  1 45  ? 99.673  -21.137 -17.354  1.00 25.93  ? 20  ASN A N   1 
ATOM   161   C  CA  . ASN A  1 45  ? 98.854  -22.352 -17.432  1.00 25.91  ? 20  ASN A CA  1 
ATOM   162   C  C   . ASN A  1 45  ? 97.550  -22.288 -16.632  1.00 24.14  ? 20  ASN A C   1 
ATOM   163   O  O   . ASN A  1 45  ? 97.508  -21.778 -15.506  1.00 22.49  ? 20  ASN A O   1 
ATOM   164   C  CB  . ASN A  1 45  ? 99.646  -23.591 -17.008  1.00 26.78  ? 20  ASN A CB  1 
ATOM   165   C  CG  . ASN A  1 45  ? 100.727 -23.958 -17.998  1.00 28.53  ? 20  ASN A CG  1 
ATOM   166   O  OD1 . ASN A  1 45  ? 100.534 -23.864 -19.210  1.00 31.67  ? 20  ASN A OD1 1 
ATOM   167   N  ND2 . ASN A  1 45  ? 101.874 -24.377 -17.488  1.00 26.80  ? 20  ASN A ND2 1 
ATOM   168   N  N   . ILE A  1 46  ? 96.492  -22.816 -17.240  1.00 24.25  ? 21  ILE A N   1 
ATOM   169   C  CA  . ILE A  1 46  ? 95.233  -23.079 -16.549  1.00 22.91  ? 21  ILE A CA  1 
ATOM   170   C  C   . ILE A  1 46  ? 95.233  -24.562 -16.204  1.00 23.96  ? 21  ILE A C   1 
ATOM   171   O  O   . ILE A  1 46  ? 95.383  -25.395 -17.097  1.00 24.36  ? 21  ILE A O   1 
ATOM   172   C  CB  . ILE A  1 46  ? 94.014  -22.772 -17.436  1.00 21.19  ? 21  ILE A CB  1 
ATOM   173   C  CG1 . ILE A  1 46  ? 94.095  -21.324 -17.971  1.00 20.67  ? 21  ILE A CG1 1 
ATOM   174   C  CG2 . ILE A  1 46  ? 92.726  -23.056 -16.665  1.00 20.49  ? 21  ILE A CG2 1 
ATOM   175   C  CD1 . ILE A  1 46  ? 93.122  -20.965 -19.086  1.00 19.15  ? 21  ILE A CD1 1 
ATOM   176   N  N   . PHE A  1 47  ? 95.088  -24.882 -14.917  1.00 24.07  ? 22  PHE A N   1 
ATOM   177   C  CA  . PHE A  1 47  ? 95.022  -26.277 -14.473  1.00 25.15  ? 22  PHE A CA  1 
ATOM   178   C  C   . PHE A  1 47  ? 93.591  -26.795 -14.327  1.00 24.60  ? 22  PHE A C   1 
ATOM   179   O  O   . PHE A  1 47  ? 92.649  -26.017 -14.226  1.00 24.73  ? 22  PHE A O   1 
ATOM   180   C  CB  . PHE A  1 47  ? 95.797  -26.462 -13.153  1.00 25.67  ? 22  PHE A CB  1 
ATOM   181   C  CG  . PHE A  1 47  ? 97.291  -26.471 -13.331  1.00 26.96  ? 22  PHE A CG  1 
ATOM   182   C  CD1 . PHE A  1 47  ? 98.019  -25.275 -13.326  1.00 26.65  ? 22  PHE A CD1 1 
ATOM   183   C  CD2 . PHE A  1 47  ? 97.980  -27.678 -13.514  1.00 28.20  ? 22  PHE A CD2 1 
ATOM   184   C  CE1 . PHE A  1 47  ? 99.398  -25.288 -13.494  1.00 26.90  ? 22  PHE A CE1 1 
ATOM   185   C  CE2 . PHE A  1 47  ? 99.360  -27.697 -13.685  1.00 27.59  ? 22  PHE A CE2 1 
ATOM   186   C  CZ  . PHE A  1 47  ? 100.069 -26.502 -13.675  1.00 27.31  ? 22  PHE A CZ  1 
ATOM   187   N  N   . ASN A  1 48  ? 93.438  -28.113 -14.367  1.00 24.90  ? 23  ASN A N   1 
ATOM   188   C  CA  . ASN A  1 48  ? 92.254  -28.769 -13.821  1.00 26.12  ? 23  ASN A CA  1 
ATOM   189   C  C   . ASN A  1 48  ? 92.663  -29.316 -12.449  1.00 26.56  ? 23  ASN A C   1 
ATOM   190   O  O   . ASN A  1 48  ? 93.358  -30.331 -12.370  1.00 26.70  ? 23  ASN A O   1 
ATOM   191   C  CB  . ASN A  1 48  ? 91.783  -29.905 -14.734  1.00 28.00  ? 23  ASN A CB  1 
ATOM   192   C  CG  . ASN A  1 48  ? 90.558  -30.630 -14.191  1.00 30.35  ? 23  ASN A CG  1 
ATOM   193   O  OD1 . ASN A  1 48  ? 90.319  -30.692 -12.972  1.00 29.34  ? 23  ASN A OD1 1 
ATOM   194   N  ND2 . ASN A  1 48  ? 89.772  -31.192 -15.101  1.00 31.81  ? 23  ASN A ND2 1 
ATOM   195   N  N   . PRO A  1 49  ? 92.250  -28.639 -11.363  1.00 26.04  ? 24  PRO A N   1 
ATOM   196   C  CA  . PRO A  1 49  ? 92.757  -28.987 -10.036  1.00 25.66  ? 24  PRO A CA  1 
ATOM   197   C  C   . PRO A  1 49  ? 92.308  -30.365 -9.519   1.00 26.80  ? 24  PRO A C   1 
ATOM   198   O  O   . PRO A  1 49  ? 92.893  -30.870 -8.567   1.00 27.65  ? 24  PRO A O   1 
ATOM   199   C  CB  . PRO A  1 49  ? 92.224  -27.865 -9.149   1.00 24.84  ? 24  PRO A CB  1 
ATOM   200   C  CG  . PRO A  1 49  ? 91.010  -27.372 -9.855   1.00 25.38  ? 24  PRO A CG  1 
ATOM   201   C  CD  . PRO A  1 49  ? 91.253  -27.551 -11.317  1.00 25.58  ? 24  PRO A CD  1 
ATOM   202   N  N   . ALA A  1 50  ? 91.291  -30.967 -10.128  1.00 26.03  ? 25  ALA A N   1 
ATOM   203   C  CA  . ALA A  1 50  ? 90.911  -32.344 -9.775   1.00 26.12  ? 25  ALA A CA  1 
ATOM   204   C  C   . ALA A  1 50  ? 91.897  -33.408 -10.321  1.00 26.08  ? 25  ALA A C   1 
ATOM   205   O  O   . ALA A  1 50  ? 92.063  -34.475 -9.731   1.00 25.89  ? 25  ALA A O   1 
ATOM   206   C  CB  . ALA A  1 50  ? 89.474  -32.633 -10.202  1.00 25.32  ? 25  ALA A CB  1 
ATOM   207   N  N   . THR A  1 51  ? 92.567  -33.106 -11.431  1.00 26.41  ? 26  THR A N   1 
ATOM   208   C  CA  . THR A  1 51  ? 93.532  -34.047 -12.014  1.00 26.43  ? 26  THR A CA  1 
ATOM   209   C  C   . THR A  1 51  ? 94.960  -33.556 -11.871  1.00 26.82  ? 26  THR A C   1 
ATOM   210   O  O   . THR A  1 51  ? 95.901  -34.329 -12.046  1.00 26.57  ? 26  THR A O   1 
ATOM   211   C  CB  . THR A  1 51  ? 93.251  -34.335 -13.509  1.00 26.00  ? 26  THR A CB  1 
ATOM   212   O  OG1 . THR A  1 51  ? 93.482  -33.148 -14.289  1.00 25.20  ? 26  THR A OG1 1 
ATOM   213   C  CG2 . THR A  1 51  ? 91.798  -34.851 -13.717  1.00 25.03  ? 26  THR A CG2 1 
ATOM   214   N  N   . GLY A  1 52  ? 95.114  -32.262 -11.583  1.00 27.18  ? 27  GLY A N   1 
ATOM   215   C  CA  . GLY A  1 52  ? 96.428  -31.629 -11.471  1.00 26.88  ? 27  GLY A CA  1 
ATOM   216   C  C   . GLY A  1 52  ? 97.087  -31.392 -12.816  1.00 27.71  ? 27  GLY A C   1 
ATOM   217   O  O   . GLY A  1 52  ? 98.227  -30.937 -12.878  1.00 28.36  ? 27  GLY A O   1 
ATOM   218   N  N   . GLU A  1 53  ? 96.370  -31.701 -13.891  1.00 28.87  ? 28  GLU A N   1 
ATOM   219   C  CA  . GLU A  1 53  ? 96.884  -31.553 -15.257  1.00 32.08  ? 28  GLU A CA  1 
ATOM   220   C  C   . GLU A  1 53  ? 96.585  -30.165 -15.807  1.00 30.30  ? 28  GLU A C   1 
ATOM   221   O  O   . GLU A  1 53  ? 95.600  -29.532 -15.411  1.00 28.57  ? 28  GLU A O   1 
ATOM   222   C  CB  . GLU A  1 53  ? 96.282  -32.608 -16.207  1.00 37.68  ? 28  GLU A CB  1 
ATOM   223   C  CG  . GLU A  1 53  ? 96.456  -34.068 -15.785  1.00 47.36  ? 28  GLU A CG  1 
ATOM   224   C  CD  . GLU A  1 53  ? 97.901  -34.439 -15.484  1.00 60.01  ? 28  GLU A CD  1 
ATOM   225   O  OE1 . GLU A  1 53  ? 98.157  -35.006 -14.393  1.00 68.88  ? 28  GLU A OE1 1 
ATOM   226   O  OE2 . GLU A  1 53  ? 98.784  -34.155 -16.325  1.00 61.25  ? 28  GLU A OE2 1 
ATOM   227   N  N   . VAL A  1 54  ? 97.446  -29.705 -16.715  1.00 29.37  ? 29  VAL A N   1 
ATOM   228   C  CA  . VAL A  1 54  ? 97.223  -28.470 -17.469  1.00 28.59  ? 29  VAL A CA  1 
ATOM   229   C  C   . VAL A  1 54  ? 96.123  -28.744 -18.498  1.00 27.70  ? 29  VAL A C   1 
ATOM   230   O  O   . VAL A  1 54  ? 96.134  -29.773 -19.169  1.00 26.34  ? 29  VAL A O   1 
ATOM   231   C  CB  . VAL A  1 54  ? 98.524  -27.980 -18.174  1.00 27.42  ? 29  VAL A CB  1 
ATOM   232   C  CG1 . VAL A  1 54  ? 98.274  -26.713 -18.996  1.00 25.96  ? 29  VAL A CG1 1 
ATOM   233   C  CG2 . VAL A  1 54  ? 99.643  -27.759 -17.152  1.00 26.83  ? 29  VAL A CG2 1 
ATOM   234   N  N   . GLN A  1 55  ? 95.156  -27.839 -18.599  1.00 27.46  ? 30  GLN A N   1 
ATOM   235   C  CA  . GLN A  1 55  ? 94.058  -28.037 -19.539  1.00 26.42  ? 30  GLN A CA  1 
ATOM   236   C  C   . GLN A  1 55  ? 94.010  -26.923 -20.573  1.00 25.39  ? 30  GLN A C   1 
ATOM   237   O  O   . GLN A  1 55  ? 93.309  -27.028 -21.577  1.00 24.82  ? 30  GLN A O   1 
ATOM   238   C  CB  . GLN A  1 55  ? 92.726  -28.162 -18.798  1.00 26.07  ? 30  GLN A CB  1 
ATOM   239   C  CG  . GLN A  1 55  ? 92.301  -26.927 -18.005  1.00 25.81  ? 30  GLN A CG  1 
ATOM   240   C  CD  . GLN A  1 55  ? 90.912  -27.086 -17.424  1.00 25.30  ? 30  GLN A CD  1 
ATOM   241   O  OE1 . GLN A  1 55  ? 90.002  -27.527 -18.121  1.00 26.74  ? 30  GLN A OE1 1 
ATOM   242   N  NE2 . GLN A  1 55  ? 90.737  -26.728 -16.146  1.00 23.61  ? 30  GLN A NE2 1 
ATOM   243   N  N   . GLY A  1 56  ? 94.754  -25.852 -20.316  1.00 25.01  ? 31  GLY A N   1 
ATOM   244   C  CA  . GLY A  1 56  ? 94.825  -24.730 -21.248  1.00 24.33  ? 31  GLY A CA  1 
ATOM   245   C  C   . GLY A  1 56  ? 95.795  -23.649 -20.806  1.00 23.17  ? 31  GLY A C   1 
ATOM   246   O  O   . GLY A  1 56  ? 96.455  -23.772 -19.771  1.00 23.13  ? 31  GLY A O   1 
ATOM   247   N  N   . THR A  1 57  ? 95.878  -22.587 -21.600  1.00 21.62  ? 32  THR A N   1 
ATOM   248   C  CA  . THR A  1 57  ? 96.715  -21.447 -21.271  1.00 21.28  ? 32  THR A CA  1 
ATOM   249   C  C   . THR A  1 57  ? 95.876  -20.162 -21.305  1.00 22.12  ? 32  THR A C   1 
ATOM   250   O  O   . THR A  1 57  ? 94.783  -20.119 -21.910  1.00 22.61  ? 32  THR A O   1 
ATOM   251   C  CB  . THR A  1 57  ? 97.900  -21.306 -22.254  1.00 21.54  ? 32  THR A CB  1 
ATOM   252   O  OG1 . THR A  1 57  ? 97.390  -21.081 -23.573  1.00 22.23  ? 32  THR A OG1 1 
ATOM   253   C  CG2 . THR A  1 57  ? 98.804  -22.563 -22.252  1.00 21.34  ? 32  THR A CG2 1 
ATOM   254   N  N   . VAL A  1 58  ? 96.382  -19.121 -20.646  1.00 22.05  ? 33  VAL A N   1 
ATOM   255   C  CA  . VAL A  1 58  ? 95.784  -17.780 -20.721  1.00 20.94  ? 33  VAL A CA  1 
ATOM   256   C  C   . VAL A  1 58  ? 96.899  -16.784 -21.014  1.00 20.66  ? 33  VAL A C   1 
ATOM   257   O  O   . VAL A  1 58  ? 97.978  -16.876 -20.420  1.00 20.31  ? 33  VAL A O   1 
ATOM   258   C  CB  . VAL A  1 58  ? 94.999  -17.390 -19.438  1.00 19.01  ? 33  VAL A CB  1 
ATOM   259   C  CG1 . VAL A  1 58  ? 95.871  -17.438 -18.175  1.00 17.40  ? 33  VAL A CG1 1 
ATOM   260   C  CG2 . VAL A  1 58  ? 94.338  -16.025 -19.608  1.00 18.29  ? 33  VAL A CG2 1 
ATOM   261   N  N   . ALA A  1 59  ? 96.644  -15.879 -21.961  1.00 20.42  ? 34  ALA A N   1 
ATOM   262   C  CA  . ALA A  1 59  ? 97.599  -14.841 -22.346  1.00 21.02  ? 34  ALA A CA  1 
ATOM   263   C  C   . ALA A  1 59  ? 97.756  -13.799 -21.237  1.00 20.54  ? 34  ALA A C   1 
ATOM   264   O  O   . ALA A  1 59  ? 96.792  -13.441 -20.560  1.00 19.64  ? 34  ALA A O   1 
ATOM   265   C  CB  . ALA A  1 59  ? 97.170  -14.170 -23.646  1.00 20.81  ? 34  ALA A CB  1 
ATOM   266   N  N   . LEU A  1 60  ? 98.973  -13.324 -21.038  1.00 20.75  ? 35  LEU A N   1 
ATOM   267   C  CA  . LEU A  1 60  ? 99.202  -12.316 -20.021  1.00 21.11  ? 35  LEU A CA  1 
ATOM   268   C  C   . LEU A  1 60  ? 99.472  -10.978 -20.693  1.00 22.13  ? 35  LEU A C   1 
ATOM   269   O  O   . LEU A  1 60  ? 100.491 -10.810 -21.362  1.00 23.35  ? 35  LEU A O   1 
ATOM   270   C  CB  . LEU A  1 60  ? 100.352 -12.739 -19.107  1.00 21.94  ? 35  LEU A CB  1 
ATOM   271   C  CG  . LEU A  1 60  ? 100.237 -14.142 -18.482  1.00 22.58  ? 35  LEU A CG  1 
ATOM   272   C  CD1 . LEU A  1 60  ? 101.549 -14.599 -17.842  1.00 21.89  ? 35  LEU A CD1 1 
ATOM   273   C  CD2 . LEU A  1 60  ? 99.086  -14.186 -17.482  1.00 22.43  ? 35  LEU A CD2 1 
ATOM   274   N  N   . ALA A  1 61  ? 98.567  -10.017 -20.515  1.00 21.21  ? 36  ALA A N   1 
ATOM   275   C  CA  . ALA A  1 61  ? 98.687  -8.734  -21.204  1.00 20.81  ? 36  ALA A CA  1 
ATOM   276   C  C   . ALA A  1 61  ? 99.996  -7.979  -20.949  1.00 22.36  ? 36  ALA A C   1 
ATOM   277   O  O   . ALA A  1 61  ? 100.445 -7.850  -19.807  1.00 22.03  ? 36  ALA A O   1 
ATOM   278   C  CB  . ALA A  1 61  ? 97.517  -7.840  -20.859  1.00 19.94  ? 36  ALA A CB  1 
ATOM   279   N  N   . SER A  1 62  ? 100.573 -7.473  -22.039  1.00 23.12  ? 37  SER A N   1 
ATOM   280   C  CA  . SER A  1 62  ? 101.640 -6.477  -22.011  1.00 22.84  ? 37  SER A CA  1 
ATOM   281   C  C   . SER A  1 62  ? 101.024 -5.105  -21.741  1.00 22.90  ? 37  SER A C   1 
ATOM   282   O  O   . SER A  1 62  ? 99.792  -4.951  -21.779  1.00 22.67  ? 37  SER A O   1 
ATOM   283   C  CB  . SER A  1 62  ? 102.366 -6.453  -23.374  1.00 22.71  ? 37  SER A CB  1 
ATOM   284   O  OG  . SER A  1 62  ? 101.486 -6.038  -24.420  1.00 21.28  ? 37  SER A OG  1 
ATOM   285   N  N   . ASP A  1 63  ? 101.873 -4.112  -21.492  1.00 23.23  ? 38  ASP A N   1 
ATOM   286   C  CA  . ASP A  1 63  ? 101.428 -2.721  -21.362  1.00 25.56  ? 38  ASP A CA  1 
ATOM   287   C  C   . ASP A  1 63  ? 100.684 -2.223  -22.602  1.00 24.16  ? 38  ASP A C   1 
ATOM   288   O  O   . ASP A  1 63  ? 99.719  -1.459  -22.489  1.00 24.24  ? 38  ASP A O   1 
ATOM   289   C  CB  . ASP A  1 63  ? 102.623 -1.806  -21.090  1.00 29.66  ? 38  ASP A CB  1 
ATOM   290   C  CG  . ASP A  1 63  ? 103.276 -2.087  -19.752  1.00 35.32  ? 38  ASP A CG  1 
ATOM   291   O  OD1 . ASP A  1 63  ? 102.899 -3.074  -19.092  1.00 35.33  ? 38  ASP A OD1 1 
ATOM   292   O  OD2 . ASP A  1 63  ? 104.169 -1.321  -19.349  1.00 41.84  ? 38  ASP A OD2 1 
ATOM   293   N  N   . ALA A  1 64  ? 101.144 -2.656  -23.773  1.00 22.25  ? 39  ALA A N   1 
ATOM   294   C  CA  . ALA A  1 64  ? 100.514 -2.291  -25.041  1.00 22.06  ? 39  ALA A CA  1 
ATOM   295   C  C   . ALA A  1 64  ? 99.132  -2.919  -25.174  1.00 21.19  ? 39  ALA A C   1 
ATOM   296   O  O   . ALA A  1 64  ? 98.230  -2.290  -25.703  1.00 21.05  ? 39  ALA A O   1 
ATOM   297   C  CB  . ALA A  1 64  ? 101.399 -2.665  -26.233  1.00 21.30  ? 39  ALA A CB  1 
ATOM   298   N  N   . ASP A  1 65  ? 98.969  -4.148  -24.697  1.00 20.84  ? 40  ASP A N   1 
ATOM   299   C  CA  . ASP A  1 65  ? 97.649  -4.789  -24.721  1.00 22.47  ? 40  ASP A CA  1 
ATOM   300   C  C   . ASP A  1 65  ? 96.661  -4.046  -23.806  1.00 22.17  ? 40  ASP A C   1 
ATOM   301   O  O   . ASP A  1 65  ? 95.486  -3.916  -24.134  1.00 21.07  ? 40  ASP A O   1 
ATOM   302   C  CB  . ASP A  1 65  ? 97.718  -6.268  -24.295  1.00 24.86  ? 40  ASP A CB  1 
ATOM   303   C  CG  . ASP A  1 65  ? 98.508  -7.141  -25.272  1.00 29.40  ? 40  ASP A CG  1 
ATOM   304   O  OD1 . ASP A  1 65  ? 98.456  -6.910  -26.507  1.00 30.09  ? 40  ASP A OD1 1 
ATOM   305   O  OD2 . ASP A  1 65  ? 99.178  -8.087  -24.790  1.00 31.74  ? 40  ASP A OD2 1 
ATOM   306   N  N   . LEU A  1 66  ? 97.121  -3.589  -22.645  1.00 23.13  ? 41  LEU A N   1 
ATOM   307   C  CA  . LEU A  1 66  ? 96.321  -2.762  -21.772  1.00 23.02  ? 41  LEU A CA  1 
ATOM   308   C  C   . LEU A  1 66  ? 95.959  -1.415  -22.375  1.00 22.12  ? 41  LEU A C   1 
ATOM   309   O  O   . LEU A  1 66  ? 94.838  -1.063  -22.368  1.00 21.86  ? 41  LEU A O   1 
ATOM   310   C  CB  . LEU A  1 66  ? 96.945  -2.617  -20.396  1.00 24.35  ? 41  LEU A CB  1 
ATOM   311   C  CG  . LEU A  1 66  ? 96.070  -2.048  -19.270  1.00 25.89  ? 41  LEU A CG  1 
ATOM   312   C  CD1 . LEU A  1 66  ? 96.195  -0.556  -19.159  1.00 26.25  ? 41  LEU A CD1 1 
ATOM   313   C  CD2 . LEU A  1 66  ? 94.635  -2.529  -19.193  1.00 23.45  ? 41  LEU A CD2 1 
ATOM   314   N  N   . ALA A  1 67  ? 96.926  -0.740  -22.966  1.00 22.12  ? 42  ALA A N   1 
ATOM   315   C  CA  . ALA A  1 67  ? 96.691  0.508   -23.699  1.00 22.62  ? 42  ALA A CA  1 
ATOM   316   C  C   . ALA A  1 67  ? 95.585  0.361   -24.766  1.00 22.44  ? 42  ALA A C   1 
ATOM   317   O  O   . ALA A  1 67  ? 94.714  1.231   -24.894  1.00 22.50  ? 42  ALA A O   1 
ATOM   318   C  CB  . ALA A  1 67  ? 97.991  1.015   -24.326  1.00 23.20  ? 42  ALA A CB  1 
ATOM   319   N  N   . ALA A  1 68  ? 95.612  -0.743  -25.517  1.00 21.78  ? 43  ALA A N   1 
ATOM   320   C  CA  . ALA A  1 68  ? 94.590  -1.020  -26.542  1.00 21.79  ? 43  ALA A CA  1 
ATOM   321   C  C   . ALA A  1 68  ? 93.185  -1.142  -25.937  1.00 19.85  ? 43  ALA A C   1 
ATOM   322   O  O   . ALA A  1 68  ? 92.212  -0.617  -26.482  1.00 19.27  ? 43  ALA A O   1 
ATOM   323   C  CB  . ALA A  1 68  ? 94.941  -2.286  -27.324  1.00 23.25  ? 43  ALA A CB  1 
ATOM   324   N  N   . ALA A  1 69  ? 93.090  -1.828  -24.802  1.00 18.96  ? 44  ALA A N   1 
ATOM   325   C  CA  . ALA A  1 69  ? 91.822  -1.939  -24.078  1.00 18.42  ? 44  ALA A CA  1 
ATOM   326   C  C   . ALA A  1 69  ? 91.348  -0.568  -23.578  1.00 18.04  ? 44  ALA A C   1 
ATOM   327   O  O   . ALA A  1 69  ? 90.145  -0.268  -23.646  1.00 17.88  ? 44  ALA A O   1 
ATOM   328   C  CB  . ALA A  1 69  ? 91.940  -2.930  -22.923  1.00 18.25  ? 44  ALA A CB  1 
ATOM   329   N  N   . VAL A  1 70  ? 92.280  0.260   -23.093  1.00 18.01  ? 45  VAL A N   1 
ATOM   330   C  CA  . VAL A  1 70  ? 91.926  1.606   -22.608  1.00 18.24  ? 45  VAL A CA  1 
ATOM   331   C  C   . VAL A  1 70  ? 91.471  2.480   -23.760  1.00 19.34  ? 45  VAL A C   1 
ATOM   332   O  O   . VAL A  1 70  ? 90.478  3.209   -23.629  1.00 19.92  ? 45  VAL A O   1 
ATOM   333   C  CB  . VAL A  1 70  ? 93.060  2.299   -21.805  1.00 18.02  ? 45  VAL A CB  1 
ATOM   334   C  CG1 . VAL A  1 70  ? 92.726  3.763   -21.521  1.00 17.43  ? 45  VAL A CG1 1 
ATOM   335   C  CG2 . VAL A  1 70  ? 93.301  1.563   -20.489  1.00 17.53  ? 45  VAL A CG2 1 
ATOM   336   N  N   . GLU A  1 71  ? 92.163  2.395   -24.897  1.00 20.18  ? 46  GLU A N   1 
ATOM   337   C  CA  . GLU A  1 71  ? 91.773  3.222   -26.053  1.00 22.09  ? 46  GLU A CA  1 
ATOM   338   C  C   . GLU A  1 71  ? 90.385  2.831   -26.557  1.00 21.52  ? 46  GLU A C   1 
ATOM   339   O  O   . GLU A  1 71  ? 89.586  3.691   -26.955  1.00 21.31  ? 46  GLU A O   1 
ATOM   340   C  CB  . GLU A  1 71  ? 92.812  3.162   -27.179  1.00 26.55  ? 46  GLU A CB  1 
ATOM   341   C  CG  . GLU A  1 71  ? 94.107  3.908   -26.856  1.00 32.58  ? 46  GLU A CG  1 
ATOM   342   C  CD  . GLU A  1 71  ? 93.871  5.332   -26.341  1.00 36.63  ? 46  GLU A CD  1 
ATOM   343   O  OE1 . GLU A  1 71  ? 93.331  6.176   -27.096  1.00 34.92  ? 46  GLU A OE1 1 
ATOM   344   O  OE2 . GLU A  1 71  ? 94.221  5.606   -25.167  1.00 39.88  ? 46  GLU A OE2 1 
ATOM   345   N  N   . SER A  1 72  ? 90.098  1.530   -26.511  1.00 21.35  ? 47  SER A N   1 
ATOM   346   C  CA  . SER A  1 72  ? 88.784  1.003   -26.899  1.00 21.43  ? 47  SER A CA  1 
ATOM   347   C  C   . SER A  1 72  ? 87.682  1.488   -25.941  1.00 19.86  ? 47  SER A C   1 
ATOM   348   O  O   . SER A  1 72  ? 86.593  1.875   -26.378  1.00 19.45  ? 47  SER A O   1 
ATOM   349   C  CB  . SER A  1 72  ? 88.832  -0.526  -27.003  1.00 22.50  ? 47  SER A CB  1 
ATOM   350   O  OG  . SER A  1 72  ? 87.581  -1.118  -26.668  1.00 23.70  ? 47  SER A OG  1 
ATOM   351   N  N   . ALA A  1 73  ? 87.969  1.476   -24.637  1.00 18.97  ? 48  ALA A N   1 
ATOM   352   C  CA  . ALA A  1 73  ? 87.042  2.044   -23.653  1.00 19.26  ? 48  ALA A CA  1 
ATOM   353   C  C   . ALA A  1 73  ? 86.865  3.570   -23.829  1.00 21.89  ? 48  ALA A C   1 
ATOM   354   O  O   . ALA A  1 73  ? 85.749  4.076   -23.713  1.00 22.14  ? 48  ALA A O   1 
ATOM   355   C  CB  . ALA A  1 73  ? 87.478  1.694   -22.236  1.00 17.87  ? 48  ALA A CB  1 
ATOM   356   N  N   . LYS A  1 74  ? 87.952  4.287   -24.125  1.00 24.11  ? 49  LYS A N   1 
ATOM   357   C  CA  . LYS A  1 74  ? 87.887  5.733   -24.387  1.00 27.71  ? 49  LYS A CA  1 
ATOM   358   C  C   . LYS A  1 74  ? 87.001  6.070   -25.577  1.00 26.78  ? 49  LYS A C   1 
ATOM   359   O  O   . LYS A  1 74  ? 86.245  7.038   -25.532  1.00 26.81  ? 49  LYS A O   1 
ATOM   360   C  CB  . LYS A  1 74  ? 89.279  6.315   -24.641  1.00 31.19  ? 49  LYS A CB  1 
ATOM   361   C  CG  . LYS A  1 74  ? 89.905  6.936   -23.411  1.00 35.70  ? 49  LYS A CG  1 
ATOM   362   C  CD  . LYS A  1 74  ? 91.419  6.989   -23.502  1.00 40.49  ? 49  LYS A CD  1 
ATOM   363   C  CE  . LYS A  1 74  ? 91.885  8.011   -24.520  1.00 44.89  ? 49  LYS A CE  1 
ATOM   364   N  NZ  . LYS A  1 74  ? 93.375  8.088   -24.550  1.00 48.49  ? 49  LYS A NZ  1 
ATOM   365   N  N   . ALA A  1 75  ? 87.095  5.269   -26.637  1.00 25.07  ? 50  ALA A N   1 
ATOM   366   C  CA  . ALA A  1 75  ? 86.324  5.540   -27.854  1.00 24.27  ? 50  ALA A CA  1 
ATOM   367   C  C   . ALA A  1 75  ? 84.832  5.233   -27.661  1.00 23.97  ? 50  ALA A C   1 
ATOM   368   O  O   . ALA A  1 75  ? 83.981  5.875   -28.283  1.00 24.77  ? 50  ALA A O   1 
ATOM   369   C  CB  . ALA A  1 75  ? 86.881  4.769   -29.049  1.00 23.26  ? 50  ALA A CB  1 
ATOM   370   N  N   . ALA A  1 76  ? 84.525  4.259   -26.803  1.00 21.52  ? 51  ALA A N   1 
ATOM   371   C  CA  . ALA A  1 76  ? 83.145  3.800   -26.613  1.00 20.16  ? 51  ALA A CA  1 
ATOM   372   C  C   . ALA A  1 76  ? 82.378  4.514   -25.479  1.00 18.32  ? 51  ALA A C   1 
ATOM   373   O  O   . ALA A  1 76  ? 81.163  4.687   -25.572  1.00 17.44  ? 51  ALA A O   1 
ATOM   374   C  CB  . ALA A  1 76  ? 83.099  2.282   -26.416  1.00 19.84  ? 51  ALA A CB  1 
ATOM   375   N  N   . GLN A  1 77  ? 83.072  4.908   -24.414  1.00 17.77  ? 52  GLN A N   1 
ATOM   376   C  CA  . GLN A  1 77  ? 82.391  5.426   -23.204  1.00 17.69  ? 52  GLN A CA  1 
ATOM   377   C  C   . GLN A  1 77  ? 81.404  6.622   -23.401  1.00 19.17  ? 52  GLN A C   1 
ATOM   378   O  O   . GLN A  1 77  ? 80.293  6.557   -22.877  1.00 19.63  ? 52  GLN A O   1 
ATOM   379   C  CB  . GLN A  1 77  ? 83.388  5.671   -22.055  1.00 16.45  ? 52  GLN A CB  1 
ATOM   380   C  CG  . GLN A  1 77  ? 82.743  5.986   -20.699  1.00 15.51  ? 52  GLN A CG  1 
ATOM   381   C  CD  . GLN A  1 77  ? 82.501  7.476   -20.491  1.00 14.99  ? 52  GLN A CD  1 
ATOM   382   O  OE1 . GLN A  1 77  ? 83.125  8.310   -21.145  1.00 14.36  ? 52  GLN A OE1 1 
ATOM   383   N  NE2 . GLN A  1 77  ? 81.591  7.816   -19.571  1.00 14.74  ? 52  GLN A NE2 1 
ATOM   384   N  N   . PRO A  1 78  ? 81.793  7.694   -24.145  1.00 20.10  ? 53  PRO A N   1 
ATOM   385   C  CA  . PRO A  1 78  ? 80.866  8.861   -24.254  1.00 20.77  ? 53  PRO A CA  1 
ATOM   386   C  C   . PRO A  1 78  ? 79.460  8.521   -24.810  1.00 21.70  ? 53  PRO A C   1 
ATOM   387   O  O   . PRO A  1 78  ? 78.463  8.973   -24.255  1.00 21.63  ? 53  PRO A O   1 
ATOM   388   C  CB  . PRO A  1 78  ? 81.617  9.845   -25.183  1.00 20.35  ? 53  PRO A CB  1 
ATOM   389   C  CG  . PRO A  1 78  ? 83.060  9.482   -25.037  1.00 20.07  ? 53  PRO A CG  1 
ATOM   390   C  CD  . PRO A  1 78  ? 83.104  7.984   -24.770  1.00 20.40  ? 53  PRO A CD  1 
ATOM   391   N  N   . LYS A  1 79  ? 79.376  7.706   -25.861  1.00 23.20  ? 54  LYS A N   1 
ATOM   392   C  CA  . LYS A  1 79  ? 78.069  7.291   -26.398  1.00 25.14  ? 54  LYS A CA  1 
ATOM   393   C  C   . LYS A  1 79  ? 77.273  6.458   -25.391  1.00 22.61  ? 54  LYS A C   1 
ATOM   394   O  O   . LYS A  1 79  ? 76.050  6.582   -25.287  1.00 22.56  ? 54  LYS A O   1 
ATOM   395   C  CB  . LYS A  1 79  ? 78.216  6.523   -27.714  1.00 30.64  ? 54  LYS A CB  1 
ATOM   396   C  CG  . LYS A  1 79  ? 78.158  7.411   -28.946  1.00 38.41  ? 54  LYS A CG  1 
ATOM   397   C  CD  . LYS A  1 79  ? 77.975  6.606   -30.229  1.00 48.51  ? 54  LYS A CD  1 
ATOM   398   C  CE  . LYS A  1 79  ? 76.646  5.848   -30.257  1.00 54.47  ? 54  LYS A CE  1 
ATOM   399   N  NZ  . LYS A  1 79  ? 76.352  5.266   -31.600  1.00 57.02  ? 54  LYS A NZ  1 
ATOM   400   N  N   . TRP A  1 80  ? 77.976  5.622   -24.639  1.00 21.03  ? 55  TRP A N   1 
ATOM   401   C  CA  . TRP A  1 80  ? 77.331  4.818   -23.608  1.00 20.28  ? 55  TRP A CA  1 
ATOM   402   C  C   . TRP A  1 80  ? 76.803  5.710   -22.480  1.00 19.40  ? 55  TRP A C   1 
ATOM   403   O  O   . TRP A  1 80  ? 75.668  5.542   -22.067  1.00 18.36  ? 55  TRP A O   1 
ATOM   404   C  CB  . TRP A  1 80  ? 78.256  3.699   -23.107  1.00 18.79  ? 55  TRP A CB  1 
ATOM   405   C  CG  . TRP A  1 80  ? 77.695  2.930   -21.959  1.00 18.64  ? 55  TRP A CG  1 
ATOM   406   C  CD1 . TRP A  1 80  ? 78.155  2.941   -20.679  1.00 17.49  ? 55  TRP A CD1 1 
ATOM   407   C  CD2 . TRP A  1 80  ? 76.555  2.047   -21.970  1.00 17.97  ? 55  TRP A CD2 1 
ATOM   408   N  NE1 . TRP A  1 80  ? 77.393  2.120   -19.897  1.00 17.04  ? 55  TRP A NE1 1 
ATOM   409   C  CE2 . TRP A  1 80  ? 76.402  1.557   -20.657  1.00 17.12  ? 55  TRP A CE2 1 
ATOM   410   C  CE3 . TRP A  1 80  ? 75.655  1.623   -22.963  1.00 17.73  ? 55  TRP A CE3 1 
ATOM   411   C  CZ2 . TRP A  1 80  ? 75.387  0.650   -20.298  1.00 16.70  ? 55  TRP A CZ2 1 
ATOM   412   C  CZ3 . TRP A  1 80  ? 74.636  0.715   -22.611  1.00 17.77  ? 55  TRP A CZ3 1 
ATOM   413   C  CH2 . TRP A  1 80  ? 74.513  0.244   -21.287  1.00 17.43  ? 55  TRP A CH2 1 
ATOM   414   N  N   . ALA A  1 81  ? 77.599  6.689   -22.045  1.00 19.25  ? 56  ALA A N   1 
ATOM   415   C  CA  . ALA A  1 81  ? 77.152  7.649   -21.020  1.00 19.54  ? 56  ALA A CA  1 
ATOM   416   C  C   . ALA A  1 81  ? 75.997  8.527   -21.515  1.00 21.18  ? 56  ALA A C   1 
ATOM   417   O  O   . ALA A  1 81  ? 75.187  9.019   -20.722  1.00 21.02  ? 56  ALA A O   1 
ATOM   418   C  CB  . ALA A  1 81  ? 78.312  8.515   -20.562  1.00 18.89  ? 56  ALA A CB  1 
ATOM   419   N  N   . ALA A  1 82  ? 75.923  8.718   -22.832  1.00 22.19  ? 57  ALA A N   1 
ATOM   420   C  CA  . ALA A  1 82  ? 74.856  9.515   -23.454  1.00 20.83  ? 57  ALA A CA  1 
ATOM   421   C  C   . ALA A  1 82  ? 73.548  8.730   -23.676  1.00 19.63  ? 57  ALA A C   1 
ATOM   422   O  O   . ALA A  1 82  ? 72.558  9.300   -24.107  1.00 19.27  ? 57  ALA A O   1 
ATOM   423   C  CB  . ALA A  1 82  ? 75.348  10.114  -24.767  1.00 20.55  ? 57  ALA A CB  1 
ATOM   424   N  N   . THR A  1 83  ? 73.558  7.426   -23.399  1.00 18.88  ? 58  THR A N   1 
ATOM   425   C  CA  . THR A  1 83  ? 72.353  6.586   -23.457  1.00 18.58  ? 58  THR A CA  1 
ATOM   426   C  C   . THR A  1 83  ? 71.576  6.774   -22.148  1.00 18.55  ? 58  THR A C   1 
ATOM   427   O  O   . THR A  1 83  ? 72.182  6.716   -21.079  1.00 18.16  ? 58  THR A O   1 
ATOM   428   C  CB  . THR A  1 83  ? 72.738  5.098   -23.645  1.00 17.98  ? 58  THR A CB  1 
ATOM   429   O  OG1 . THR A  1 83  ? 73.611  4.973   -24.780  1.00 18.81  ? 58  THR A OG1 1 
ATOM   430   C  CG2 . THR A  1 83  ? 71.512  4.213   -23.863  1.00 17.07  ? 58  THR A CG2 1 
ATOM   431   N  N   . ASN A  1 84  ? 70.254  7.009   -22.231  1.00 17.96  ? 59  ASN A N   1 
ATOM   432   C  CA  . ASN A  1 84  ? 69.451  7.288   -21.037  1.00 17.65  ? 59  ASN A CA  1 
ATOM   433   C  C   . ASN A  1 84  ? 69.486  6.125   -20.016  1.00 18.14  ? 59  ASN A C   1 
ATOM   434   O  O   . ASN A  1 84  ? 69.787  4.989   -20.391  1.00 17.62  ? 59  ASN A O   1 
ATOM   435   C  CB  . ASN A  1 84  ? 68.018  7.769   -21.390  1.00 17.96  ? 59  ASN A CB  1 
ATOM   436   C  CG  . ASN A  1 84  ? 67.050  6.627   -21.694  1.00 19.37  ? 59  ASN A CG  1 
ATOM   437   O  OD1 . ASN A  1 84  ? 66.862  5.705   -20.889  1.00 18.77  ? 59  ASN A OD1 1 
ATOM   438   N  ND2 . ASN A  1 84  ? 66.429  6.682   -22.875  1.00 20.89  ? 59  ASN A ND2 1 
ATOM   439   N  N   . PRO A  1 85  ? 69.226  6.418   -18.721  1.00 18.66  ? 60  PRO A N   1 
ATOM   440   C  CA  . PRO A  1 85  ? 69.384  5.404   -17.655  1.00 19.14  ? 60  PRO A CA  1 
ATOM   441   C  C   . PRO A  1 85  ? 68.533  4.150   -17.861  1.00 19.44  ? 60  PRO A C   1 
ATOM   442   O  O   . PRO A  1 85  ? 68.994  3.027   -17.590  1.00 18.74  ? 60  PRO A O   1 
ATOM   443   C  CB  . PRO A  1 85  ? 68.917  6.140   -16.395  1.00 19.02  ? 60  PRO A CB  1 
ATOM   444   C  CG  . PRO A  1 85  ? 69.080  7.585   -16.699  1.00 19.10  ? 60  PRO A CG  1 
ATOM   445   C  CD  . PRO A  1 85  ? 69.018  7.775   -18.181  1.00 18.27  ? 60  PRO A CD  1 
ATOM   446   N  N   . GLN A  1 86  ? 67.299  4.349   -18.334  1.00 19.20  ? 61  GLN A N   1 
ATOM   447   C  CA  . GLN A  1 86  ? 66.377  3.248   -18.562  1.00 19.15  ? 61  GLN A CA  1 
ATOM   448   C  C   . GLN A  1 86  ? 66.898  2.286   -19.640  1.00 19.84  ? 61  GLN A C   1 
ATOM   449   O  O   . GLN A  1 86  ? 66.772  1.065   -19.509  1.00 19.60  ? 61  GLN A O   1 
ATOM   450   C  CB  . GLN A  1 86  ? 64.989  3.777   -18.924  1.00 18.21  ? 61  GLN A CB  1 
ATOM   451   C  CG  . GLN A  1 86  ? 64.158  4.230   -17.729  1.00 18.40  ? 61  GLN A CG  1 
ATOM   452   C  CD  . GLN A  1 86  ? 62.889  4.953   -18.151  1.00 19.35  ? 61  GLN A CD  1 
ATOM   453   O  OE1 . GLN A  1 86  ? 62.935  5.918   -18.914  1.00 20.53  ? 61  GLN A OE1 1 
ATOM   454   N  NE2 . GLN A  1 86  ? 61.755  4.497   -17.648  1.00 19.15  ? 61  GLN A NE2 1 
ATOM   455   N  N   . ARG A  1 87  ? 67.493  2.838   -20.692  1.00 20.01  ? 62  ARG A N   1 
ATOM   456   C  CA  . ARG A  1 87  ? 68.069  2.007   -21.746  1.00 21.44  ? 62  ARG A CA  1 
ATOM   457   C  C   . ARG A  1 87  ? 69.305  1.257   -21.268  1.00 19.93  ? 62  ARG A C   1 
ATOM   458   O  O   . ARG A  1 87  ? 69.456  0.081   -21.570  1.00 19.93  ? 62  ARG A O   1 
ATOM   459   C  CB  . ARG A  1 87  ? 68.345  2.818   -23.006  1.00 26.35  ? 62  ARG A CB  1 
ATOM   460   C  CG  . ARG A  1 87  ? 67.072  3.163   -23.767  1.00 34.67  ? 62  ARG A CG  1 
ATOM   461   C  CD  . ARG A  1 87  ? 67.373  3.999   -24.998  1.00 45.35  ? 62  ARG A CD  1 
ATOM   462   N  NE  . ARG A  1 87  ? 68.260  3.306   -25.933  1.00 52.74  ? 62  ARG A NE  1 
ATOM   463   C  CZ  . ARG A  1 87  ? 68.903  3.897   -26.936  1.00 60.15  ? 62  ARG A CZ  1 
ATOM   464   N  NH1 . ARG A  1 87  ? 68.764  5.203   -27.144  1.00 62.87  ? 62  ARG A NH1 1 
ATOM   465   N  NH2 . ARG A  1 87  ? 69.692  3.184   -27.727  1.00 62.88  ? 62  ARG A NH2 1 
ATOM   466   N  N   . ARG A  1 88  ? 70.165  1.916   -20.492  1.00 18.62  ? 63  ARG A N   1 
ATOM   467   C  CA  . ARG A  1 88  ? 71.298  1.213   -19.889  1.00 18.96  ? 63  ARG A CA  1 
ATOM   468   C  C   . ARG A  1 88  ? 70.797  0.052   -19.014  1.00 18.30  ? 63  ARG A C   1 
ATOM   469   O  O   . ARG A  1 88  ? 71.294  -1.070  -19.123  1.00 17.55  ? 63  ARG A O   1 
ATOM   470   C  CB  . ARG A  1 88  ? 72.202  2.167   -19.097  1.00 19.73  ? 63  ARG A CB  1 
ATOM   471   C  CG  . ARG A  1 88  ? 72.623  3.392   -19.886  1.00 20.57  ? 63  ARG A CG  1 
ATOM   472   C  CD  . ARG A  1 88  ? 73.920  4.004   -19.393  1.00 21.99  ? 63  ARG A CD  1 
ATOM   473   N  NE  . ARG A  1 88  ? 73.868  4.479   -18.013  1.00 21.68  ? 63  ARG A NE  1 
ATOM   474   C  CZ  . ARG A  1 88  ? 73.387  5.655   -17.616  1.00 22.13  ? 63  ARG A CZ  1 
ATOM   475   N  NH1 . ARG A  1 88  ? 72.877  6.517   -18.490  1.00 20.55  ? 63  ARG A NH1 1 
ATOM   476   N  NH2 . ARG A  1 88  ? 73.407  5.963   -16.316  1.00 22.14  ? 63  ARG A NH2 1 
ATOM   477   N  N   . ALA A  1 89  ? 69.782  0.315   -18.194  1.00 18.62  ? 64  ALA A N   1 
ATOM   478   C  CA  . ALA A  1 89  ? 69.210  -0.711  -17.321  1.00 18.80  ? 64  ALA A CA  1 
ATOM   479   C  C   . ALA A  1 89  ? 68.700  -1.919  -18.104  1.00 20.03  ? 64  ALA A C   1 
ATOM   480   O  O   . ALA A  1 89  ? 68.800  -3.048  -17.631  1.00 21.59  ? 64  ALA A O   1 
ATOM   481   C  CB  . ALA A  1 89  ? 68.097  -0.121  -16.469  1.00 18.92  ? 64  ALA A CB  1 
ATOM   482   N  N   . ARG A  1 90  ? 68.173  -1.691  -19.308  1.00 20.03  ? 65  ARG A N   1 
ATOM   483   C  CA  . ARG A  1 90  ? 67.651  -2.788  -20.142  1.00 19.44  ? 65  ARG A CA  1 
ATOM   484   C  C   . ARG A  1 90  ? 68.705  -3.805  -20.592  1.00 18.66  ? 65  ARG A C   1 
ATOM   485   O  O   . ARG A  1 90  ? 68.405  -5.007  -20.765  1.00 17.98  ? 65  ARG A O   1 
ATOM   486   C  CB  . ARG A  1 90  ? 66.852  -2.246  -21.334  1.00 19.60  ? 65  ARG A CB  1 
ATOM   487   C  CG  . ARG A  1 90  ? 65.429  -1.902  -20.915  1.00 19.93  ? 65  ARG A CG  1 
ATOM   488   C  CD  . ARG A  1 90  ? 64.656  -1.058  -21.918  1.00 21.05  ? 65  ARG A CD  1 
ATOM   489   N  NE  . ARG A  1 90  ? 63.582  -0.372  -21.209  1.00 21.94  ? 65  ARG A NE  1 
ATOM   490   C  CZ  . ARG A  1 90  ? 63.149  0.844   -21.496  1.00 24.00  ? 65  ARG A CZ  1 
ATOM   491   N  NH1 . ARG A  1 90  ? 63.663  1.524   -22.513  1.00 25.46  ? 65  ARG A NH1 1 
ATOM   492   N  NH2 . ARG A  1 90  ? 62.192  1.380   -20.766  1.00 24.56  ? 65  ARG A NH2 1 
ATOM   493   N  N   . VAL A  1 91  ? 69.937  -3.334  -20.764  1.00 17.95  ? 66  VAL A N   1 
ATOM   494   C  CA  . VAL A  1 91  ? 71.061  -4.248  -21.034  1.00 17.48  ? 66  VAL A CA  1 
ATOM   495   C  C   . VAL A  1 91  ? 71.202  -5.250  -19.888  1.00 17.09  ? 66  VAL A C   1 
ATOM   496   O  O   . VAL A  1 91  ? 71.260  -6.467  -20.105  1.00 16.66  ? 66  VAL A O   1 
ATOM   497   C  CB  . VAL A  1 91  ? 72.386  -3.490  -21.246  1.00 17.00  ? 66  VAL A CB  1 
ATOM   498   C  CG1 . VAL A  1 91  ? 73.543  -4.476  -21.490  1.00 16.68  ? 66  VAL A CG1 1 
ATOM   499   C  CG2 . VAL A  1 91  ? 72.233  -2.491  -22.390  1.00 16.45  ? 66  VAL A CG2 1 
ATOM   500   N  N   . PHE A  1 92  ? 71.224  -4.745  -18.661  1.00 17.89  ? 67  PHE A N   1 
ATOM   501   C  CA  . PHE A  1 92  ? 71.294  -5.637  -17.501  1.00 18.40  ? 67  PHE A CA  1 
ATOM   502   C  C   . PHE A  1 92  ? 70.129  -6.616  -17.376  1.00 20.05  ? 67  PHE A C   1 
ATOM   503   O  O   . PHE A  1 92  ? 70.360  -7.781  -17.031  1.00 20.45  ? 67  PHE A O   1 
ATOM   504   C  CB  . PHE A  1 92  ? 71.524  -4.841  -16.240  1.00 19.00  ? 67  PHE A CB  1 
ATOM   505   C  CG  . PHE A  1 92  ? 72.873  -4.218  -16.206  1.00 20.16  ? 67  PHE A CG  1 
ATOM   506   C  CD1 . PHE A  1 92  ? 73.996  -4.988  -15.863  1.00 20.50  ? 67  PHE A CD1 1 
ATOM   507   C  CD2 . PHE A  1 92  ? 73.044  -2.886  -16.569  1.00 19.22  ? 67  PHE A CD2 1 
ATOM   508   C  CE1 . PHE A  1 92  ? 75.258  -4.421  -15.864  1.00 20.06  ? 67  PHE A CE1 1 
ATOM   509   C  CE2 . PHE A  1 92  ? 74.303  -2.320  -16.556  1.00 19.11  ? 67  PHE A CE2 1 
ATOM   510   C  CZ  . PHE A  1 92  ? 75.409  -3.083  -16.210  1.00 19.30  ? 67  PHE A CZ  1 
HETATM 511   N  N   . MSE A  1 93  ? 68.908  -6.154  -17.677  1.00 21.05  ? 68  MSE A N   1 
HETATM 512   C  CA  A MSE A  1 93  ? 67.737  -7.026  -17.671  0.50 23.37  ? 68  MSE A CA  1 
HETATM 513   C  CA  B MSE A  1 93  ? 67.714  -7.015  -17.681  0.50 22.70  ? 68  MSE A CA  1 
HETATM 514   C  C   . MSE A  1 93  ? 67.934  -8.152  -18.650  1.00 23.24  ? 68  MSE A C   1 
HETATM 515   O  O   . MSE A  1 93  ? 67.685  -9.323  -18.328  1.00 23.89  ? 68  MSE A O   1 
HETATM 516   C  CB  A MSE A  1 93  ? 66.502  -6.223  -18.056  0.50 25.88  ? 68  MSE A CB  1 
HETATM 517   C  CB  B MSE A  1 93  ? 66.433  -6.269  -18.098  0.50 23.65  ? 68  MSE A CB  1 
HETATM 518   C  CG  A MSE A  1 93  ? 65.354  -6.530  -17.111  0.50 31.49  ? 68  MSE A CG  1 
HETATM 519   C  CG  B MSE A  1 93  ? 66.168  -4.937  -17.392  0.50 26.90  ? 68  MSE A CG  1 
HETATM 520   SE SE  A MSE A  1 93  ? 63.834  -5.375  -17.590  0.50 38.92  ? 68  MSE A SE  1 
HETATM 521   SE SE  B MSE A  1 93  ? 64.353  -4.250  -17.819  0.50 31.28  ? 68  MSE A SE  1 
HETATM 522   C  CE  A MSE A  1 93  ? 64.691  -3.594  -17.490  0.50 37.09  ? 68  MSE A CE  1 
HETATM 523   C  CE  B MSE A  1 93  ? 63.491  -5.983  -17.413  0.50 30.63  ? 68  MSE A CE  1 
ATOM   524   N  N   . LYS A  1 94  ? 68.394  -7.817  -19.853  1.00 22.72  ? 69  LYS A N   1 
ATOM   525   C  CA  . LYS A  1 94  ? 68.663  -8.813  -20.891  1.00 23.10  ? 69  LYS A CA  1 
ATOM   526   C  C   . LYS A  1 94  ? 69.797  -9.765  -20.457  1.00 20.40  ? 69  LYS A C   1 
ATOM   527   O  O   . LYS A  1 94  ? 69.680  -10.983 -20.607  1.00 20.01  ? 69  LYS A O   1 
ATOM   528   C  CB  . LYS A  1 94  ? 68.959  -8.126  -22.231  1.00 25.13  ? 69  LYS A CB  1 
ATOM   529   C  CG  . LYS A  1 94  ? 69.172  -9.066  -23.420  1.00 32.56  ? 69  LYS A CG  1 
ATOM   530   C  CD  . LYS A  1 94  ? 67.871  -9.651  -23.968  1.00 39.56  ? 69  LYS A CD  1 
ATOM   531   C  CE  . LYS A  1 94  ? 68.131  -10.875 -24.831  1.00 44.53  ? 69  LYS A CE  1 
ATOM   532   N  NZ  . LYS A  1 94  ? 68.797  -10.514 -26.114  1.00 45.15  ? 69  LYS A NZ  1 
ATOM   533   N  N   . PHE A  1 95  ? 70.852  -9.205  -19.870  1.00 18.09  ? 70  PHE A N   1 
ATOM   534   C  CA  . PHE A  1 95  ? 71.994  -9.989  -19.398  1.00 18.51  ? 70  PHE A CA  1 
ATOM   535   C  C   . PHE A  1 95  ? 71.589  -11.019 -18.345  1.00 18.91  ? 70  PHE A C   1 
ATOM   536   O  O   . PHE A  1 95  ? 72.086  -12.143 -18.369  1.00 19.09  ? 70  PHE A O   1 
ATOM   537   C  CB  . PHE A  1 95  ? 73.060  -9.054  -18.821  1.00 17.98  ? 70  PHE A CB  1 
ATOM   538   C  CG  . PHE A  1 95  ? 74.332  -9.739  -18.399  1.00 17.98  ? 70  PHE A CG  1 
ATOM   539   C  CD1 . PHE A  1 95  ? 75.177  -10.321 -19.339  1.00 18.22  ? 70  PHE A CD1 1 
ATOM   540   C  CD2 . PHE A  1 95  ? 74.728  -9.720  -17.070  1.00 18.45  ? 70  PHE A CD2 1 
ATOM   541   C  CE1 . PHE A  1 95  ? 76.371  -10.909 -18.953  1.00 18.54  ? 70  PHE A CE1 1 
ATOM   542   C  CE2 . PHE A  1 95  ? 75.913  -10.306 -16.673  1.00 18.60  ? 70  PHE A CE2 1 
ATOM   543   C  CZ  . PHE A  1 95  ? 76.735  -10.906 -17.616  1.00 18.92  ? 70  PHE A CZ  1 
ATOM   544   N  N   . VAL A  1 96  ? 70.679  -10.633 -17.444  1.00 18.00  ? 71  VAL A N   1 
ATOM   545   C  CA  . VAL A  1 96  ? 70.215  -11.538 -16.394  1.00 18.63  ? 71  VAL A CA  1 
ATOM   546   C  C   . VAL A  1 96  ? 69.541  -12.774 -17.009  1.00 20.56  ? 71  VAL A C   1 
ATOM   547   O  O   . VAL A  1 96  ? 69.804  -13.904 -16.575  1.00 21.11  ? 71  VAL A O   1 
ATOM   548   C  CB  . VAL A  1 96  ? 69.304  -10.821 -15.376  1.00 17.64  ? 71  VAL A CB  1 
ATOM   549   C  CG1 . VAL A  1 96  ? 68.433  -11.809 -14.612  1.00 17.30  ? 71  VAL A CG1 1 
ATOM   550   C  CG2 . VAL A  1 96  ? 70.148  -10.001 -14.413  1.00 17.01  ? 71  VAL A CG2 1 
ATOM   551   N  N   . GLN A  1 97  ? 68.701  -12.568 -18.028  1.00 20.75  ? 72  GLN A N   1 
ATOM   552   C  CA  A GLN A  1 97  ? 68.069  -13.697 -18.718  0.50 21.12  ? 72  GLN A CA  1 
ATOM   553   C  CA  B GLN A  1 97  ? 68.062  -13.677 -18.739  0.50 21.25  ? 72  GLN A CA  1 
ATOM   554   C  C   . GLN A  1 97  ? 69.128  -14.575 -19.378  1.00 20.86  ? 72  GLN A C   1 
ATOM   555   O  O   . GLN A  1 97  ? 69.017  -15.794 -19.351  1.00 20.42  ? 72  GLN A O   1 
ATOM   556   C  CB  A GLN A  1 97  ? 67.033  -13.237 -19.750  0.50 21.59  ? 72  GLN A CB  1 
ATOM   557   C  CB  B GLN A  1 97  ? 67.063  -13.157 -19.789  0.50 21.95  ? 72  GLN A CB  1 
ATOM   558   C  CG  A GLN A  1 97  ? 66.193  -14.366 -20.336  0.50 22.36  ? 72  GLN A CG  1 
ATOM   559   C  CG  B GLN A  1 97  ? 66.030  -12.175 -19.229  0.50 22.61  ? 72  GLN A CG  1 
ATOM   560   C  CD  A GLN A  1 97  ? 65.505  -15.214 -19.269  0.50 22.67  ? 72  GLN A CD  1 
ATOM   561   C  CD  B GLN A  1 97  ? 64.860  -11.916 -20.165  0.50 23.55  ? 72  GLN A CD  1 
ATOM   562   O  OE1 A GLN A  1 97  ? 64.968  -14.695 -18.287  0.50 23.48  ? 72  GLN A OE1 1 
ATOM   563   O  OE1 B GLN A  1 97  ? 63.703  -11.954 -19.741  0.50 24.94  ? 72  GLN A OE1 1 
ATOM   564   N  NE2 A GLN A  1 97  ? 65.511  -16.523 -19.467  0.50 21.64  ? 72  GLN A NE2 1 
ATOM   565   N  NE2 B GLN A  1 97  ? 65.152  -11.664 -21.442  0.50 22.43  ? 72  GLN A NE2 1 
ATOM   566   N  N   . LEU A  1 98  ? 70.169  -13.956 -19.941  1.00 20.74  ? 73  LEU A N   1 
ATOM   567   C  CA  . LEU A  1 98  ? 71.246  -14.712 -20.603  1.00 20.36  ? 73  LEU A CA  1 
ATOM   568   C  C   . LEU A  1 98  ? 72.024  -15.586 -19.635  1.00 19.81  ? 73  LEU A C   1 
ATOM   569   O  O   . LEU A  1 98  ? 72.401  -16.721 -19.971  1.00 18.98  ? 73  LEU A O   1 
ATOM   570   C  CB  . LEU A  1 98  ? 72.201  -13.788 -21.360  1.00 19.71  ? 73  LEU A CB  1 
ATOM   571   C  CG  . LEU A  1 98  ? 71.590  -13.143 -22.608  1.00 20.33  ? 73  LEU A CG  1 
ATOM   572   C  CD1 . LEU A  1 98  ? 72.596  -12.201 -23.255  1.00 19.78  ? 73  LEU A CD1 1 
ATOM   573   C  CD2 . LEU A  1 98  ? 71.069  -14.187 -23.608  1.00 20.38  ? 73  LEU A CD2 1 
ATOM   574   N  N   . LEU A  1 99  ? 72.252  -15.049 -18.434  1.00 19.49  ? 74  LEU A N   1 
ATOM   575   C  CA  . LEU A  1 99  ? 72.905  -15.793 -17.365  1.00 19.35  ? 74  LEU A CA  1 
ATOM   576   C  C   . LEU A  1 99  ? 72.069  -17.026 -17.008  1.00 19.95  ? 74  LEU A C   1 
ATOM   577   O  O   . LEU A  1 99  ? 72.601  -18.132 -16.923  1.00 19.19  ? 74  LEU A O   1 
ATOM   578   C  CB  . LEU A  1 99  ? 73.130  -14.899 -16.140  1.00 18.62  ? 74  LEU A CB  1 
ATOM   579   C  CG  . LEU A  1 99  ? 74.165  -13.778 -16.305  1.00 17.66  ? 74  LEU A CG  1 
ATOM   580   C  CD1 . LEU A  1 99  ? 74.131  -12.842 -15.107  1.00 17.07  ? 74  LEU A CD1 1 
ATOM   581   C  CD2 . LEU A  1 99  ? 75.553  -14.368 -16.496  1.00 17.42  ? 74  LEU A CD2 1 
ATOM   582   N  N   . ASN A  1 100 ? 70.765  -16.836 -16.820  1.00 21.09  ? 75  ASN A N   1 
ATOM   583   C  CA  . ASN A  1 100 ? 69.871  -17.953 -16.500  1.00 23.00  ? 75  ASN A CA  1 
ATOM   584   C  C   . ASN A  1 100 ? 69.841  -18.987 -17.627  1.00 23.46  ? 75  ASN A C   1 
ATOM   585   O  O   . ASN A  1 100 ? 69.848  -20.189 -17.358  1.00 23.01  ? 75  ASN A O   1 
ATOM   586   C  CB  . ASN A  1 100 ? 68.465  -17.459 -16.135  1.00 23.97  ? 75  ASN A CB  1 
ATOM   587   C  CG  . ASN A  1 100 ? 68.410  -16.807 -14.759  1.00 26.20  ? 75  ASN A CG  1 
ATOM   588   O  OD1 . ASN A  1 100 ? 68.956  -17.326 -13.784  1.00 29.01  ? 75  ASN A OD1 1 
ATOM   589   N  ND2 . ASN A  1 100 ? 67.762  -15.657 -14.678  1.00 26.28  ? 75  ASN A ND2 1 
ATOM   590   N  N   . ASP A  1 101 ? 69.858  -18.506 -18.876  1.00 24.17  ? 76  ASP A N   1 
ATOM   591   C  CA  . ASP A  1 101 ? 69.941  -19.361 -20.067  1.00 25.76  ? 76  ASP A CA  1 
ATOM   592   C  C   . ASP A  1 101 ? 71.250  -20.139 -20.155  1.00 25.71  ? 76  ASP A C   1 
ATOM   593   O  O   . ASP A  1 101 ? 71.246  -21.283 -20.591  1.00 26.32  ? 76  ASP A O   1 
ATOM   594   C  CB  . ASP A  1 101 ? 69.798  -18.547 -21.358  1.00 28.72  ? 76  ASP A CB  1 
ATOM   595   C  CG  . ASP A  1 101 ? 68.405  -17.963 -21.552  1.00 32.23  ? 76  ASP A CG  1 
ATOM   596   O  OD1 . ASP A  1 101 ? 67.481  -18.256 -20.761  1.00 32.35  ? 76  ASP A OD1 1 
ATOM   597   O  OD2 . ASP A  1 101 ? 68.241  -17.186 -22.515  1.00 35.79  ? 76  ASP A OD2 1 
ATOM   598   N  N   . ASN A  1 102 ? 72.361  -19.506 -19.773  1.00 23.95  ? 77  ASN A N   1 
ATOM   599   C  CA  . ASN A  1 102 ? 73.691  -20.089 -19.928  1.00 23.70  ? 77  ASN A CA  1 
ATOM   600   C  C   . ASN A  1 102 ? 74.282  -20.655 -18.606  1.00 23.76  ? 77  ASN A C   1 
ATOM   601   O  O   . ASN A  1 102 ? 75.503  -20.892 -18.493  1.00 22.87  ? 77  ASN A O   1 
ATOM   602   C  CB  . ASN A  1 102 ? 74.616  -19.037 -20.551  1.00 23.46  ? 77  ASN A CB  1 
ATOM   603   C  CG  . ASN A  1 102 ? 74.255  -18.732 -21.994  1.00 25.14  ? 77  ASN A CG  1 
ATOM   604   O  OD1 . ASN A  1 102 ? 74.688  -19.432 -22.902  1.00 29.59  ? 77  ASN A OD1 1 
ATOM   605   N  ND2 . ASN A  1 102 ? 73.459  -17.691 -22.215  1.00 23.58  ? 77  ASN A ND2 1 
HETATM 606   N  N   . MSE A  1 103 ? 73.405  -20.876 -17.624  1.00 22.89  ? 78  MSE A N   1 
HETATM 607   C  CA  . MSE A  1 103 ? 73.804  -21.240 -16.251  1.00 25.63  ? 78  MSE A CA  1 
HETATM 608   C  C   . MSE A  1 103 ? 74.632  -22.502 -16.177  1.00 26.33  ? 78  MSE A C   1 
HETATM 609   O  O   . MSE A  1 103 ? 75.719  -22.497 -15.596  1.00 26.30  ? 78  MSE A O   1 
HETATM 610   C  CB  . MSE A  1 103 ? 72.549  -21.335 -15.367  1.00 27.29  ? 78  MSE A CB  1 
HETATM 611   C  CG  . MSE A  1 103 ? 72.861  -21.723 -13.923  1.00 31.18  ? 78  MSE A CG  1 
HETATM 612   SE SE  . MSE A  1 103 ? 73.813  -20.276 -12.963  1.00 35.93  ? 78  MSE A SE  1 
HETATM 613   C  CE  . MSE A  1 103 ? 72.371  -18.911 -12.969  1.00 36.03  ? 78  MSE A CE  1 
ATOM   614   N  N   . ASN A  1 104 ? 74.123  -23.583 -16.764  1.00 26.83  ? 79  ASN A N   1 
ATOM   615   C  CA  . ASN A  1 104 ? 74.826  -24.862 -16.787  1.00 28.23  ? 79  ASN A CA  1 
ATOM   616   C  C   . ASN A  1 104 ? 76.206  -24.787 -17.457  1.00 27.73  ? 79  ASN A C   1 
ATOM   617   O  O   . ASN A  1 104 ? 77.185  -25.323 -16.933  1.00 26.98  ? 79  ASN A O   1 
ATOM   618   C  CB  . ASN A  1 104 ? 73.963  -25.932 -17.456  1.00 30.75  ? 79  ASN A CB  1 
ATOM   619   C  CG  . ASN A  1 104 ? 72.679  -26.212 -16.690  1.00 34.43  ? 79  ASN A CG  1 
ATOM   620   O  OD1 . ASN A  1 104 ? 72.586  -25.979 -15.480  1.00 33.55  ? 79  ASN A OD1 1 
ATOM   621   N  ND2 . ASN A  1 104 ? 71.677  -26.713 -17.400  1.00 36.37  ? 79  ASN A ND2 1 
ATOM   622   N  N   . GLU A  1 105 ? 76.271  -24.130 -18.614  1.00 27.81  ? 80  GLU A N   1 
ATOM   623   C  CA  . GLU A  1 105 ? 77.529  -23.914 -19.320  1.00 29.02  ? 80  GLU A CA  1 
ATOM   624   C  C   . GLU A  1 105 ? 78.545  -23.131 -18.454  1.00 26.25  ? 80  GLU A C   1 
ATOM   625   O  O   . GLU A  1 105 ? 79.676  -23.581 -18.271  1.00 26.39  ? 80  GLU A O   1 
ATOM   626   C  CB  . GLU A  1 105 ? 77.261  -23.211 -20.653  1.00 34.87  ? 80  GLU A CB  1 
ATOM   627   C  CG  . GLU A  1 105 ? 78.472  -23.120 -21.573  1.00 42.38  ? 80  GLU A CG  1 
ATOM   628   C  CD  . GLU A  1 105 ? 78.492  -21.850 -22.421  1.00 48.94  ? 80  GLU A CD  1 
ATOM   629   O  OE1 . GLU A  1 105 ? 78.922  -21.939 -23.594  1.00 48.02  ? 80  GLU A OE1 1 
ATOM   630   O  OE2 . GLU A  1 105 ? 78.092  -20.763 -21.921  1.00 52.47  ? 80  GLU A OE2 1 
ATOM   631   N  N   . LEU A  1 106 ? 78.124  -21.984 -17.915  1.00 23.37  ? 81  LEU A N   1 
ATOM   632   C  CA  . LEU A  1 106 ? 78.945  -21.152 -17.025  1.00 21.78  ? 81  LEU A CA  1 
ATOM   633   C  C   . LEU A  1 106 ? 79.478  -21.907 -15.799  1.00 21.41  ? 81  LEU A C   1 
ATOM   634   O  O   . LEU A  1 106 ? 80.659  -21.776 -15.433  1.00 22.24  ? 81  LEU A O   1 
ATOM   635   C  CB  . LEU A  1 106 ? 78.141  -19.922 -16.552  1.00 20.21  ? 81  LEU A CB  1 
ATOM   636   C  CG  . LEU A  1 106 ? 77.882  -18.840 -17.611  1.00 19.95  ? 81  LEU A CG  1 
ATOM   637   C  CD1 . LEU A  1 106 ? 76.746  -17.921 -17.192  1.00 18.93  ? 81  LEU A CD1 1 
ATOM   638   C  CD2 . LEU A  1 106 ? 79.161  -18.068 -17.942  1.00 19.72  ? 81  LEU A CD2 1 
ATOM   639   N  N   . ALA A  1 107 ? 78.609  -22.671 -15.153  1.00 20.48  ? 82  ALA A N   1 
ATOM   640   C  CA  . ALA A  1 107 ? 79.011  -23.424 -13.969  1.00 22.39  ? 82  ALA A CA  1 
ATOM   641   C  C   . ALA A  1 107 ? 80.049  -24.509 -14.289  1.00 23.01  ? 82  ALA A C   1 
ATOM   642   O  O   . ALA A  1 107 ? 80.993  -24.705 -13.517  1.00 23.60  ? 82  ALA A O   1 
ATOM   643   C  CB  . ALA A  1 107 ? 77.796  -24.021 -13.259  1.00 22.35  ? 82  ALA A CB  1 
ATOM   644   N  N   . GLU A  1 108 ? 79.879  -25.201 -15.421  1.00 23.15  ? 83  GLU A N   1 
ATOM   645   C  CA  . GLU A  1 108 ? 80.820  -26.262 -15.829  1.00 24.45  ? 83  GLU A CA  1 
ATOM   646   C  C   . GLU A  1 108 ? 82.227  -25.698 -16.087  1.00 23.17  ? 83  GLU A C   1 
ATOM   647   O  O   . GLU A  1 108 ? 83.223  -26.279 -15.654  1.00 22.71  ? 83  GLU A O   1 
ATOM   648   C  CB  . GLU A  1 108 ? 80.296  -27.038 -17.058  1.00 25.96  ? 83  GLU A CB  1 
ATOM   649   C  CG  . GLU A  1 108 ? 81.134  -28.250 -17.462  1.00 29.41  ? 83  GLU A CG  1 
ATOM   650   C  CD  . GLU A  1 108 ? 82.376  -27.896 -18.288  1.00 33.69  ? 83  GLU A CD  1 
ATOM   651   O  OE1 . GLU A  1 108 ? 82.443  -26.794 -18.887  1.00 33.80  ? 83  GLU A OE1 1 
ATOM   652   O  OE2 . GLU A  1 108 ? 83.303  -28.734 -18.342  1.00 37.09  ? 83  GLU A OE2 1 
HETATM 653   N  N   . MSE A  1 109 ? 82.305  -24.571 -16.788  1.00 22.12  ? 84  MSE A N   1 
HETATM 654   C  CA  . MSE A  1 109 ? 83.609  -23.954 -17.086  1.00 22.76  ? 84  MSE A CA  1 
HETATM 655   C  C   . MSE A  1 109 ? 84.232  -23.364 -15.839  1.00 19.89  ? 84  MSE A C   1 
HETATM 656   O  O   . MSE A  1 109 ? 85.459  -23.363 -15.683  1.00 18.32  ? 84  MSE A O   1 
HETATM 657   C  CB  . MSE A  1 109 ? 83.520  -22.954 -18.245  1.00 24.33  ? 84  MSE A CB  1 
HETATM 658   C  CG  . MSE A  1 109 ? 82.848  -21.630 -17.880  1.00 26.87  ? 84  MSE A CG  1 
HETATM 659   SE SE  . MSE A  1 109 ? 82.856  -20.413 -19.440  1.00 32.15  ? 84  MSE A SE  1 
HETATM 660   C  CE  . MSE A  1 109 ? 81.571  -21.369 -20.595  1.00 30.92  ? 84  MSE A CE  1 
ATOM   661   N  N   . LEU A  1 110 ? 83.387  -22.893 -14.926  1.00 18.77  ? 85  LEU A N   1 
ATOM   662   C  CA  . LEU A  1 110 ? 83.872  -22.362 -13.652  1.00 18.46  ? 85  LEU A CA  1 
ATOM   663   C  C   . LEU A  1 110 ? 84.471  -23.484 -12.762  1.00 18.81  ? 85  LEU A C   1 
ATOM   664   O  O   . LEU A  1 110 ? 85.635  -23.404 -12.317  1.00 18.45  ? 85  LEU A O   1 
ATOM   665   C  CB  . LEU A  1 110 ? 82.736  -21.610 -12.947  1.00 17.59  ? 85  LEU A CB  1 
ATOM   666   C  CG  . LEU A  1 110 ? 83.091  -20.540 -11.911  1.00 18.21  ? 85  LEU A CG  1 
ATOM   667   C  CD1 . LEU A  1 110 ? 81.867  -19.711 -11.539  1.00 17.59  ? 85  LEU A CD1 1 
ATOM   668   C  CD2 . LEU A  1 110 ? 83.703  -21.130 -10.644  1.00 18.68  ? 85  LEU A CD2 1 
ATOM   669   N  N   . SER A  1 111 ? 83.664  -24.518 -12.512  1.00 19.26  ? 86  SER A N   1 
ATOM   670   C  CA  . SER A  1 111 ? 84.076  -25.692 -11.733  1.00 19.60  ? 86  SER A CA  1 
ATOM   671   C  C   . SER A  1 111 ? 85.312  -26.402 -12.322  1.00 20.00  ? 86  SER A C   1 
ATOM   672   O  O   . SER A  1 111 ? 86.221  -26.812 -11.592  1.00 19.93  ? 86  SER A O   1 
ATOM   673   C  CB  . SER A  1 111 ? 82.911  -26.687 -11.625  1.00 19.17  ? 86  SER A CB  1 
ATOM   674   O  OG  . SER A  1 111 ? 81.864  -26.158 -10.826  1.00 19.27  ? 86  SER A OG  1 
ATOM   675   N  N   . ARG A  1 112 ? 85.347  -26.549 -13.637  1.00 20.88  ? 87  ARG A N   1 
ATOM   676   C  CA  . ARG A  1 112 ? 86.446  -27.272 -14.271  1.00 23.62  ? 87  ARG A CA  1 
ATOM   677   C  C   . ARG A  1 112 ? 87.785  -26.566 -14.041  1.00 24.32  ? 87  ARG A C   1 
ATOM   678   O  O   . ARG A  1 112 ? 88.796  -27.239 -13.899  1.00 25.35  ? 87  ARG A O   1 
ATOM   679   C  CB  . ARG A  1 112 ? 86.170  -27.505 -15.755  1.00 25.69  ? 87  ARG A CB  1 
ATOM   680   C  CG  . ARG A  1 112 ? 87.281  -28.211 -16.510  1.00 27.81  ? 87  ARG A CG  1 
ATOM   681   C  CD  . ARG A  1 112 ? 86.832  -28.650 -17.904  1.00 30.15  ? 87  ARG A CD  1 
ATOM   682   N  NE  . ARG A  1 112 ? 85.918  -27.690 -18.539  1.00 30.54  ? 87  ARG A NE  1 
ATOM   683   C  CZ  . ARG A  1 112 ? 86.271  -26.497 -19.013  1.00 29.74  ? 87  ARG A CZ  1 
ATOM   684   N  NH1 . ARG A  1 112 ? 87.528  -26.066 -18.929  1.00 28.80  ? 87  ARG A NH1 1 
ATOM   685   N  NH2 . ARG A  1 112 ? 85.349  -25.721 -19.554  1.00 30.00  ? 87  ARG A NH2 1 
ATOM   686   N  N   . GLU A  1 113 ? 87.789  -25.228 -13.970  1.00 23.48  ? 88  GLU A N   1 
ATOM   687   C  CA  . GLU A  1 113 ? 89.032  -24.484 -13.692  1.00 23.24  ? 88  GLU A CA  1 
ATOM   688   C  C   . GLU A  1 113 ? 89.273  -24.216 -12.208  1.00 23.69  ? 88  GLU A C   1 
ATOM   689   O  O   . GLU A  1 113 ? 90.408  -24.292 -11.749  1.00 25.49  ? 88  GLU A O   1 
ATOM   690   C  CB  . GLU A  1 113 ? 89.090  -23.170 -14.470  1.00 22.78  ? 88  GLU A CB  1 
ATOM   691   C  CG  . GLU A  1 113 ? 89.058  -23.351 -15.981  1.00 23.22  ? 88  GLU A CG  1 
ATOM   692   C  CD  . GLU A  1 113 ? 89.059  -22.034 -16.750  1.00 23.46  ? 88  GLU A CD  1 
ATOM   693   O  OE1 . GLU A  1 113 ? 88.583  -20.994 -16.214  1.00 22.55  ? 88  GLU A OE1 1 
ATOM   694   O  OE2 . GLU A  1 113 ? 89.534  -22.050 -17.915  1.00 23.92  ? 88  GLU A OE2 1 
ATOM   695   N  N   . HIS A  1 114 ? 88.214  -23.898 -11.469  1.00 22.41  ? 89  HIS A N   1 
ATOM   696   C  CA  . HIS A  1 114 ? 88.337  -23.552 -10.048  1.00 22.34  ? 89  HIS A CA  1 
ATOM   697   C  C   . HIS A  1 114 ? 88.509  -24.786 -9.146   1.00 23.73  ? 89  HIS A C   1 
ATOM   698   O  O   . HIS A  1 114 ? 89.363  -24.792 -8.241   1.00 24.68  ? 89  HIS A O   1 
ATOM   699   C  CB  . HIS A  1 114 ? 87.110  -22.746 -9.597   1.00 21.81  ? 89  HIS A CB  1 
ATOM   700   C  CG  . HIS A  1 114 ? 87.096  -22.414 -8.136   1.00 21.50  ? 89  HIS A CG  1 
ATOM   701   N  ND1 . HIS A  1 114 ? 86.921  -23.369 -7.154   1.00 21.68  ? 89  HIS A ND1 1 
ATOM   702   C  CD2 . HIS A  1 114 ? 87.227  -21.231 -7.490   1.00 21.73  ? 89  HIS A CD2 1 
ATOM   703   C  CE1 . HIS A  1 114 ? 86.960  -22.789 -5.967   1.00 21.66  ? 89  HIS A CE1 1 
ATOM   704   N  NE2 . HIS A  1 114 ? 87.140  -21.492 -6.144   1.00 22.05  ? 89  HIS A NE2 1 
ATOM   705   N  N   . GLY A  1 115 ? 87.674  -25.806 -9.364   1.00 22.68  ? 90  GLY A N   1 
ATOM   706   C  CA  . GLY A  1 115 ? 87.696  -26.998 -8.526   1.00 23.54  ? 90  GLY A CA  1 
ATOM   707   C  C   . GLY A  1 115 ? 86.419  -27.230 -7.739   1.00 24.42  ? 90  GLY A C   1 
ATOM   708   O  O   . GLY A  1 115 ? 86.092  -28.370 -7.443   1.00 24.93  ? 90  GLY A O   1 
ATOM   709   N  N   . LYS A  1 116 ? 85.693  -26.158 -7.404   1.00 24.55  ? 91  LYS A N   1 
ATOM   710   C  CA  . LYS A  1 116 ? 84.464  -26.275 -6.613   1.00 24.69  ? 91  LYS A CA  1 
ATOM   711   C  C   . LYS A  1 116 ? 83.316  -26.979 -7.333   1.00 24.22  ? 91  LYS A C   1 
ATOM   712   O  O   . LYS A  1 116 ? 83.336  -27.131 -8.550   1.00 23.85  ? 91  LYS A O   1 
ATOM   713   C  CB  . LYS A  1 116 ? 84.018  -24.924 -6.057   1.00 24.71  ? 91  LYS A CB  1 
ATOM   714   C  CG  . LYS A  1 116 ? 83.614  -23.870 -7.073   1.00 26.36  ? 91  LYS A CG  1 
ATOM   715   C  CD  . LYS A  1 116 ? 83.719  -22.509 -6.391   1.00 27.67  ? 91  LYS A CD  1 
ATOM   716   C  CE  . LYS A  1 116 ? 83.079  -21.400 -7.189   1.00 28.89  ? 91  LYS A CE  1 
ATOM   717   N  NZ  . LYS A  1 116 ? 83.213  -20.113 -6.449   1.00 28.19  ? 91  LYS A NZ  1 
ATOM   718   N  N   . THR A  1 117 ? 82.327  -27.425 -6.563   1.00 24.23  ? 92  THR A N   1 
ATOM   719   C  CA  . THR A  1 117 ? 81.194  -28.199 -7.107   1.00 23.59  ? 92  THR A CA  1 
ATOM   720   C  C   . THR A  1 117 ? 80.361  -27.373 -8.093   1.00 23.58  ? 92  THR A C   1 
ATOM   721   O  O   . THR A  1 117 ? 80.438  -26.127 -8.100   1.00 23.98  ? 92  THR A O   1 
ATOM   722   C  CB  . THR A  1 117 ? 80.249  -28.709 -5.991   1.00 22.69  ? 92  THR A CB  1 
ATOM   723   O  OG1 . THR A  1 117 ? 79.398  -27.646 -5.557   1.00 22.09  ? 92  THR A OG1 1 
ATOM   724   C  CG2 . THR A  1 117 ? 81.025  -29.283 -4.785   1.00 22.66  ? 92  THR A CG2 1 
ATOM   725   N  N   . ILE A  1 118 ? 79.564  -28.063 -8.910   1.00 23.76  ? 93  ILE A N   1 
ATOM   726   C  CA  . ILE A  1 118 ? 78.636  -27.404 -9.822   1.00 25.10  ? 93  ILE A CA  1 
ATOM   727   C  C   . ILE A  1 118 ? 77.700  -26.477 -9.038   1.00 26.90  ? 93  ILE A C   1 
ATOM   728   O  O   . ILE A  1 118 ? 77.573  -25.307 -9.400   1.00 28.20  ? 93  ILE A O   1 
ATOM   729   C  CB  . ILE A  1 118 ? 77.860  -28.394 -10.745  1.00 26.68  ? 93  ILE A CB  1 
ATOM   730   C  CG1 . ILE A  1 118 ? 78.815  -29.171 -11.682  1.00 28.77  ? 93  ILE A CG1 1 
ATOM   731   C  CG2 . ILE A  1 118 ? 76.784  -27.674 -11.562  1.00 25.24  ? 93  ILE A CG2 1 
ATOM   732   C  CD1 . ILE A  1 118 ? 79.541  -28.341 -12.742  1.00 29.36  ? 93  ILE A CD1 1 
ATOM   733   N  N   . ASP A  1 119 ? 77.086  -26.968 -7.953   1.00 27.83  ? 94  ASP A N   1 
ATOM   734   C  CA  . ASP A  1 119 ? 76.215  -26.113 -7.118   1.00 29.17  ? 94  ASP A CA  1 
ATOM   735   C  C   . ASP A  1 119 ? 76.907  -24.854 -6.563   1.00 26.41  ? 94  ASP A C   1 
ATOM   736   O  O   . ASP A  1 119 ? 76.316  -23.780 -6.617   1.00 24.58  ? 94  ASP A O   1 
ATOM   737   C  CB  . ASP A  1 119 ? 75.549  -26.896 -5.985   1.00 34.14  ? 94  ASP A CB  1 
ATOM   738   C  CG  . ASP A  1 119 ? 74.433  -27.811 -6.473   1.00 43.25  ? 94  ASP A CG  1 
ATOM   739   O  OD1 . ASP A  1 119 ? 74.191  -27.896 -7.704   1.00 43.40  ? 94  ASP A OD1 1 
ATOM   740   O  OD2 . ASP A  1 119 ? 73.795  -28.456 -5.609   1.00 48.35  ? 94  ASP A OD2 1 
ATOM   741   N  N   . ASP A  1 120 ? 78.133  -24.997 -6.030   1.00 27.17  ? 95  ASP A N   1 
ATOM   742   C  CA  . ASP A  1 120 ? 78.978  -23.846 -5.618   1.00 27.61  ? 95  ASP A CA  1 
ATOM   743   C  C   . ASP A  1 120 ? 79.109  -22.858 -6.759   1.00 24.37  ? 95  ASP A C   1 
ATOM   744   O  O   . ASP A  1 120 ? 78.900  -21.666 -6.582   1.00 23.93  ? 95  ASP A O   1 
ATOM   745   C  CB  . ASP A  1 120 ? 80.402  -24.266 -5.225   1.00 33.74  ? 95  ASP A CB  1 
ATOM   746   C  CG  . ASP A  1 120 ? 80.453  -25.173 -4.011   1.00 41.90  ? 95  ASP A CG  1 
ATOM   747   O  OD1 . ASP A  1 120 ? 79.499  -25.166 -3.206   1.00 46.04  ? 95  ASP A OD1 1 
ATOM   748   O  OD2 . ASP A  1 120 ? 81.464  -25.898 -3.856   1.00 44.67  ? 95  ASP A OD2 1 
ATOM   749   N  N   . ALA A  1 121 ? 79.450  -23.373 -7.938   1.00 22.61  ? 96  ALA A N   1 
ATOM   750   C  CA  . ALA A  1 121 ? 79.666  -22.540 -9.113   1.00 21.42  ? 96  ALA A CA  1 
ATOM   751   C  C   . ALA A  1 121 ? 78.400  -21.771 -9.509   1.00 21.51  ? 96  ALA A C   1 
ATOM   752   O  O   . ALA A  1 121 ? 78.476  -20.593 -9.882   1.00 20.81  ? 96  ALA A O   1 
ATOM   753   C  CB  . ALA A  1 121 ? 80.161  -23.395 -10.260  1.00 20.79  ? 96  ALA A CB  1 
ATOM   754   N  N   . LYS A  1 122 ? 77.245  -22.441 -9.418   1.00 21.07  ? 97  LYS A N   1 
ATOM   755   C  CA  . LYS A  1 122 ? 75.958  -21.803 -9.689   1.00 22.01  ? 97  LYS A CA  1 
ATOM   756   C  C   . LYS A  1 122 ? 75.663  -20.700 -8.680   1.00 23.56  ? 97  LYS A C   1 
ATOM   757   O  O   . LYS A  1 122 ? 75.163  -19.643 -9.062   1.00 25.67  ? 97  LYS A O   1 
ATOM   758   C  CB  . LYS A  1 122 ? 74.805  -22.819 -9.747   1.00 21.46  ? 97  LYS A CB  1 
ATOM   759   C  CG  . LYS A  1 122 ? 74.758  -23.571 -11.063  1.00 21.94  ? 97  LYS A CG  1 
ATOM   760   C  CD  . LYS A  1 122 ? 73.816  -24.761 -11.049  1.00 22.98  ? 97  LYS A CD  1 
ATOM   761   C  CE  . LYS A  1 122 ? 73.996  -25.505 -12.368  1.00 24.52  ? 97  LYS A CE  1 
ATOM   762   N  NZ  . LYS A  1 122 ? 72.885  -26.433 -12.679  1.00 25.73  ? 97  LYS A NZ  1 
ATOM   763   N  N   . GLY A  1 123 ? 75.981  -20.942 -7.408   1.00 23.48  ? 98  GLY A N   1 
ATOM   764   C  CA  . GLY A  1 123 ? 75.857  -19.915 -6.365   1.00 23.53  ? 98  GLY A CA  1 
ATOM   765   C  C   . GLY A  1 123 ? 76.711  -18.682 -6.642   1.00 23.27  ? 98  GLY A C   1 
ATOM   766   O  O   . GLY A  1 123 ? 76.296  -17.569 -6.380   1.00 23.02  ? 98  GLY A O   1 
ATOM   767   N  N   . ASP A  1 124 ? 77.917  -18.910 -7.155   1.00 24.22  ? 99  ASP A N   1 
ATOM   768   C  CA  . ASP A  1 124 ? 78.831  -17.882 -7.622   1.00 25.32  ? 99  ASP A CA  1 
ATOM   769   C  C   . ASP A  1 124 ? 78.146  -17.007 -8.690   1.00 24.61  ? 99  ASP A C   1 
ATOM   770   O  O   . ASP A  1 124 ? 78.077  -15.783 -8.557   1.00 24.34  ? 99  ASP A O   1 
ATOM   771   C  CB  . ASP A  1 124 ? 80.051  -18.604 -8.220   1.00 28.33  ? 99  ASP A CB  1 
ATOM   772   C  CG  . ASP A  1 124 ? 81.241  -17.695 -8.473   1.00 29.66  ? 99  ASP A CG  1 
ATOM   773   O  OD1 . ASP A  1 124 ? 81.075  -16.546 -8.935   1.00 30.20  ? 99  ASP A OD1 1 
ATOM   774   O  OD2 . ASP A  1 124 ? 82.368  -18.173 -8.238   1.00 30.32  ? 99  ASP A OD2 1 
ATOM   775   N  N   . ILE A  1 125 ? 77.639  -17.658 -9.740   1.00 23.18  ? 100 ILE A N   1 
ATOM   776   C  CA  . ILE A  1 125 ? 76.985  -16.987 -10.856  1.00 21.87  ? 100 ILE A CA  1 
ATOM   777   C  C   . ILE A  1 125 ? 75.750  -16.228 -10.353  1.00 21.39  ? 100 ILE A C   1 
ATOM   778   O  O   . ILE A  1 125 ? 75.576  -15.046 -10.669  1.00 20.78  ? 100 ILE A O   1 
ATOM   779   C  CB  . ILE A  1 125 ? 76.617  -18.002 -11.981  1.00 22.41  ? 100 ILE A CB  1 
ATOM   780   C  CG1 . ILE A  1 125 ? 77.877  -18.639 -12.602  1.00 22.77  ? 100 ILE A CG1 1 
ATOM   781   C  CG2 . ILE A  1 125 ? 75.743  -17.382 -13.056  1.00 21.98  ? 100 ILE A CG2 1 
ATOM   782   C  CD1 . ILE A  1 125 ? 78.955  -17.653 -13.006  1.00 23.47  ? 100 ILE A CD1 1 
ATOM   783   N  N   . VAL A  1 126 ? 74.922  -16.902 -9.550   1.00 20.57  ? 101 VAL A N   1 
ATOM   784   C  CA  . VAL A  1 126 ? 73.686  -16.319 -9.033   1.00 20.15  ? 101 VAL A CA  1 
ATOM   785   C  C   . VAL A  1 126 ? 73.945  -15.033 -8.218   1.00 20.85  ? 101 VAL A C   1 
ATOM   786   O  O   . VAL A  1 126 ? 73.221  -14.043 -8.376   1.00 19.98  ? 101 VAL A O   1 
ATOM   787   C  CB  . VAL A  1 126 ? 72.831  -17.351 -8.238   1.00 19.53  ? 101 VAL A CB  1 
ATOM   788   C  CG1 . VAL A  1 126 ? 71.774  -16.663 -7.384   1.00 19.15  ? 101 VAL A CG1 1 
ATOM   789   C  CG2 . VAL A  1 126 ? 72.151  -18.348 -9.179   1.00 19.70  ? 101 VAL A CG2 1 
ATOM   790   N  N   . ARG A  1 127 ? 74.969  -15.031 -7.365   1.00 21.82  ? 102 ARG A N   1 
ATOM   791   C  CA  . ARG A  1 127 ? 75.241  -13.841 -6.539   1.00 23.35  ? 102 ARG A CA  1 
ATOM   792   C  C   . ARG A  1 127 ? 75.757  -12.667 -7.383   1.00 22.02  ? 102 ARG A C   1 
ATOM   793   O  O   . ARG A  1 127 ? 75.513  -11.510 -7.054   1.00 22.71  ? 102 ARG A O   1 
ATOM   794   C  CB  . ARG A  1 127 ? 76.166  -14.144 -5.353   1.00 28.19  ? 102 ARG A CB  1 
ATOM   795   C  CG  . ARG A  1 127 ? 75.678  -15.258 -4.433   1.00 35.08  ? 102 ARG A CG  1 
ATOM   796   C  CD  . ARG A  1 127 ? 75.829  -14.946 -2.942   1.00 48.97  ? 102 ARG A CD  1 
ATOM   797   N  NE  . ARG A  1 127 ? 77.167  -14.512 -2.514   1.00 60.05  ? 102 ARG A NE  1 
ATOM   798   C  CZ  . ARG A  1 127 ? 77.972  -15.184 -1.686   1.00 69.49  ? 102 ARG A CZ  1 
ATOM   799   N  NH1 . ARG A  1 127 ? 79.164  -14.684 -1.368   1.00 68.17  ? 102 ARG A NH1 1 
ATOM   800   N  NH2 . ARG A  1 127 ? 77.597  -16.351 -1.169   1.00 78.43  ? 102 ARG A NH2 1 
ATOM   801   N  N   . GLY A  1 128 ? 76.441  -12.970 -8.483   1.00 21.06  ? 103 GLY A N   1 
ATOM   802   C  CA  . GLY A  1 128 ? 76.798  -11.948 -9.467   1.00 20.83  ? 103 GLY A CA  1 
ATOM   803   C  C   . GLY A  1 128 ? 75.541  -11.416 -10.139  1.00 19.29  ? 103 GLY A C   1 
ATOM   804   O  O   . GLY A  1 128 ? 75.345  -10.201 -10.279  1.00 18.55  ? 103 GLY A O   1 
ATOM   805   N  N   . LEU A  1 129 ? 74.685  -12.350 -10.536  1.00 18.26  ? 104 LEU A N   1 
ATOM   806   C  CA  . LEU A  1 129 ? 73.443  -12.047 -11.212  1.00 18.89  ? 104 LEU A CA  1 
ATOM   807   C  C   . LEU A  1 129 ? 72.597  -11.060 -10.393  1.00 19.12  ? 104 LEU A C   1 
ATOM   808   O  O   . LEU A  1 129 ? 71.955  -10.162 -10.957  1.00 19.50  ? 104 LEU A O   1 
ATOM   809   C  CB  . LEU A  1 129 ? 72.692  -13.358 -11.496  1.00 19.38  ? 104 LEU A CB  1 
ATOM   810   C  CG  . LEU A  1 129 ? 71.304  -13.409 -12.135  1.00 20.15  ? 104 LEU A CG  1 
ATOM   811   C  CD1 . LEU A  1 129 ? 71.117  -14.709 -12.909  1.00 19.66  ? 104 LEU A CD1 1 
ATOM   812   C  CD2 . LEU A  1 129 ? 70.211  -13.273 -11.077  1.00 20.22  ? 104 LEU A CD2 1 
ATOM   813   N  N   . GLU A  1 130 ? 72.618  -11.231 -9.069   1.00 18.44  ? 105 GLU A N   1 
ATOM   814   C  CA  . GLU A  1 130 ? 71.849  -10.400 -8.153   1.00 18.68  ? 105 GLU A CA  1 
ATOM   815   C  C   . GLU A  1 130 ? 72.310  -8.945  -8.105   1.00 17.66  ? 105 GLU A C   1 
ATOM   816   O  O   . GLU A  1 130 ? 71.490  -8.068  -7.864   1.00 17.48  ? 105 GLU A O   1 
ATOM   817   C  CB  . GLU A  1 130 ? 71.786  -11.043 -6.759   1.00 19.44  ? 105 GLU A CB  1 
ATOM   818   C  CG  . GLU A  1 130 ? 70.932  -12.305 -6.775   1.00 21.58  ? 105 GLU A CG  1 
ATOM   819   C  CD  . GLU A  1 130 ? 70.724  -12.957 -5.416   1.00 25.77  ? 105 GLU A CD  1 
ATOM   820   O  OE1 . GLU A  1 130 ? 71.287  -12.494 -4.403   1.00 28.13  ? 105 GLU A OE1 1 
ATOM   821   O  OE2 . GLU A  1 130 ? 69.965  -13.946 -5.363   1.00 28.25  ? 105 GLU A OE2 1 
ATOM   822   N  N   . VAL A  1 131 ? 73.595  -8.683  -8.357   1.00 16.88  ? 106 VAL A N   1 
ATOM   823   C  CA  . VAL A  1 131 ? 74.066  -7.302  -8.485   1.00 17.75  ? 106 VAL A CA  1 
ATOM   824   C  C   . VAL A  1 131 ? 73.560  -6.700  -9.794   1.00 18.82  ? 106 VAL A C   1 
ATOM   825   O  O   . VAL A  1 131 ? 73.198  -5.524  -9.835   1.00 19.63  ? 106 VAL A O   1 
ATOM   826   C  CB  . VAL A  1 131 ? 75.600  -7.169  -8.425   1.00 17.62  ? 106 VAL A CB  1 
ATOM   827   C  CG1 . VAL A  1 131 ? 75.992  -5.701  -8.518   1.00 16.99  ? 106 VAL A CG1 1 
ATOM   828   C  CG2 . VAL A  1 131 ? 76.127  -7.762  -7.126   1.00 18.20  ? 106 VAL A CG2 1 
ATOM   829   N  N   . CYS A  1 132 ? 73.540  -7.512  -10.854  1.00 18.14  ? 107 CYS A N   1 
ATOM   830   C  CA  . CYS A  1 132 ? 72.948  -7.109  -12.122  1.00 18.96  ? 107 CYS A CA  1 
ATOM   831   C  C   . CYS A  1 132 ? 71.456  -6.756  -11.981  1.00 19.33  ? 107 CYS A C   1 
ATOM   832   O  O   . CYS A  1 132 ? 70.989  -5.778  -12.577  1.00 19.25  ? 107 CYS A O   1 
ATOM   833   C  CB  . CYS A  1 132 ? 73.140  -8.193  -13.176  1.00 19.56  ? 107 CYS A CB  1 
ATOM   834   S  SG  . CYS A  1 132 ? 74.878  -8.544  -13.507  1.00 20.24  ? 107 CYS A SG  1 
ATOM   835   N  N   . GLU A  1 133 ? 70.723  -7.545  -11.190  1.00 18.94  ? 108 GLU A N   1 
ATOM   836   C  CA  . GLU A  1 133 ? 69.316  -7.260  -10.909  1.00 18.66  ? 108 GLU A CA  1 
ATOM   837   C  C   . GLU A  1 133 ? 69.204  -5.924  -10.174  1.00 19.20  ? 108 GLU A C   1 
ATOM   838   O  O   . GLU A  1 133 ? 68.324  -5.100  -10.477  1.00 19.80  ? 108 GLU A O   1 
ATOM   839   C  CB  . GLU A  1 133 ? 68.676  -8.369  -10.074  1.00 17.79  ? 108 GLU A CB  1 
ATOM   840   C  CG  . GLU A  1 133 ? 68.462  -9.689  -10.803  1.00 17.91  ? 108 GLU A CG  1 
ATOM   841   C  CD  . GLU A  1 133 ? 67.911  -10.772 -9.885   1.00 19.38  ? 108 GLU A CD  1 
ATOM   842   O  OE1 . GLU A  1 133 ? 68.230  -10.761 -8.668   1.00 20.54  ? 108 GLU A OE1 1 
ATOM   843   O  OE2 . GLU A  1 133 ? 67.151  -11.641 -10.375  1.00 19.61  ? 108 GLU A OE2 1 
ATOM   844   N  N   . PHE A  1 134 ? 70.116  -5.708  -9.231   1.00 18.04  ? 109 PHE A N   1 
ATOM   845   C  CA  . PHE A  1 134 ? 70.134  -4.481  -8.440   1.00 16.98  ? 109 PHE A CA  1 
ATOM   846   C  C   . PHE A  1 134 ? 70.311  -3.254  -9.344   1.00 18.21  ? 109 PHE A C   1 
ATOM   847   O  O   . PHE A  1 134 ? 69.604  -2.256  -9.194   1.00 18.49  ? 109 PHE A O   1 
ATOM   848   C  CB  . PHE A  1 134 ? 71.232  -4.556  -7.367   1.00 15.10  ? 109 PHE A CB  1 
ATOM   849   C  CG  . PHE A  1 134 ? 71.456  -3.258  -6.618   1.00 14.75  ? 109 PHE A CG  1 
ATOM   850   C  CD1 . PHE A  1 134 ? 70.468  -2.738  -5.773   1.00 14.28  ? 109 PHE A CD1 1 
ATOM   851   C  CD2 . PHE A  1 134 ? 72.665  -2.565  -6.732   1.00 13.87  ? 109 PHE A CD2 1 
ATOM   852   C  CE1 . PHE A  1 134 ? 70.680  -1.548  -5.083   1.00 14.12  ? 109 PHE A CE1 1 
ATOM   853   C  CE2 . PHE A  1 134 ? 72.878  -1.376  -6.037   1.00 13.62  ? 109 PHE A CE2 1 
ATOM   854   C  CZ  . PHE A  1 134 ? 71.887  -0.870  -5.212   1.00 14.12  ? 109 PHE A CZ  1 
ATOM   855   N  N   . VAL A  1 135 ? 71.239  -3.330  -10.295  1.00 17.84  ? 110 VAL A N   1 
ATOM   856   C  CA  . VAL A  1 135 ? 71.532  -2.144  -11.116  1.00 17.52  ? 110 VAL A CA  1 
ATOM   857   C  C   . VAL A  1 135 ? 70.481  -1.860  -12.202  1.00 16.04  ? 110 VAL A C   1 
ATOM   858   O  O   . VAL A  1 135 ? 70.515  -0.808  -12.834  1.00 15.99  ? 110 VAL A O   1 
ATOM   859   C  CB  . VAL A  1 135 ? 72.968  -2.154  -11.709  1.00 17.36  ? 110 VAL A CB  1 
ATOM   860   C  CG1 . VAL A  1 135 ? 74.012  -2.246  -10.594  1.00 16.69  ? 110 VAL A CG1 1 
ATOM   861   C  CG2 . VAL A  1 135 ? 73.126  -3.276  -12.719  1.00 17.18  ? 110 VAL A CG2 1 
ATOM   862   N  N   . ILE A  1 136 ? 69.544  -2.787  -12.411  1.00 14.93  ? 111 ILE A N   1 
ATOM   863   C  CA  . ILE A  1 136 ? 68.352  -2.478  -13.211  1.00 14.85  ? 111 ILE A CA  1 
ATOM   864   C  C   . ILE A  1 136 ? 67.668  -1.192  -12.686  1.00 14.56  ? 111 ILE A C   1 
ATOM   865   O  O   . ILE A  1 136 ? 67.061  -0.441  -13.459  1.00 14.84  ? 111 ILE A O   1 
ATOM   866   C  CB  . ILE A  1 136 ? 67.370  -3.675  -13.275  1.00 14.87  ? 111 ILE A CB  1 
ATOM   867   C  CG1 . ILE A  1 136 ? 68.056  -4.878  -13.947  1.00 14.78  ? 111 ILE A CG1 1 
ATOM   868   C  CG2 . ILE A  1 136 ? 66.077  -3.300  -13.989  1.00 14.22  ? 111 ILE A CG2 1 
ATOM   869   C  CD1 . ILE A  1 136 ? 67.242  -6.152  -13.930  1.00 14.79  ? 111 ILE A CD1 1 
ATOM   870   N  N   . GLY A  1 137 ? 67.817  -0.935  -11.385  1.00 14.28  ? 112 GLY A N   1 
ATOM   871   C  CA  . GLY A  1 137 ? 67.251  0.244   -10.720  1.00 14.14  ? 112 GLY A CA  1 
ATOM   872   C  C   . GLY A  1 137 ? 68.121  1.479   -10.819  1.00 13.73  ? 112 GLY A C   1 
ATOM   873   O  O   . GLY A  1 137 ? 67.921  2.449   -10.088  1.00 13.46  ? 112 GLY A O   1 
ATOM   874   N  N   . ILE A  1 138 ? 69.085  1.462   -11.738  1.00 13.65  ? 113 ILE A N   1 
ATOM   875   C  CA  . ILE A  1 138 ? 69.991  2.608   -11.878  1.00 13.97  ? 113 ILE A CA  1 
ATOM   876   C  C   . ILE A  1 138 ? 69.278  3.961   -12.136  1.00 14.68  ? 113 ILE A C   1 
ATOM   877   O  O   . ILE A  1 138 ? 69.759  4.988   -11.681  1.00 15.71  ? 113 ILE A O   1 
ATOM   878   C  CB  . ILE A  1 138 ? 71.133  2.345   -12.902  1.00 13.74  ? 113 ILE A CB  1 
ATOM   879   C  CG1 . ILE A  1 138 ? 72.177  3.468   -12.847  1.00 13.28  ? 113 ILE A CG1 1 
ATOM   880   C  CG2 . ILE A  1 138 ? 70.587  2.203   -14.317  1.00 13.47  ? 113 ILE A CG2 1 
ATOM   881   C  CD1 . ILE A  1 138 ? 73.033  3.453   -11.601  1.00 13.06  ? 113 ILE A CD1 1 
ATOM   882   N  N   . PRO A  1 139 ? 68.119  3.973   -12.842  1.00 14.99  ? 114 PRO A N   1 
ATOM   883   C  CA  . PRO A  1 139 ? 67.529  5.309   -13.030  1.00 15.26  ? 114 PRO A CA  1 
ATOM   884   C  C   . PRO A  1 139 ? 67.194  5.968   -11.682  1.00 15.52  ? 114 PRO A C   1 
ATOM   885   O  O   . PRO A  1 139 ? 67.528  7.141   -11.464  1.00 15.41  ? 114 PRO A O   1 
ATOM   886   C  CB  . PRO A  1 139 ? 66.263  5.041   -13.869  1.00 15.35  ? 114 PRO A CB  1 
ATOM   887   C  CG  . PRO A  1 139 ? 66.464  3.669   -14.461  1.00 14.81  ? 114 PRO A CG  1 
ATOM   888   C  CD  . PRO A  1 139 ? 67.305  2.912   -13.476  1.00 14.60  ? 114 PRO A CD  1 
ATOM   889   N  N   . HIS A  1 140 ? 66.576  5.215   -10.773  1.00 16.02  ? 115 HIS A N   1 
ATOM   890   C  CA  . HIS A  1 140 ? 66.372  5.705   -9.401   1.00 15.73  ? 115 HIS A CA  1 
ATOM   891   C  C   . HIS A  1 140 ? 67.676  5.860   -8.603   1.00 15.88  ? 115 HIS A C   1 
ATOM   892   O  O   . HIS A  1 140 ? 67.900  6.894   -7.949   1.00 14.48  ? 115 HIS A O   1 
ATOM   893   C  CB  . HIS A  1 140 ? 65.443  4.779   -8.639   1.00 15.91  ? 115 HIS A CB  1 
ATOM   894   C  CG  . HIS A  1 140 ? 65.298  5.145   -7.193   1.00 16.00  ? 115 HIS A CG  1 
ATOM   895   N  ND1 . HIS A  1 140 ? 64.617  6.268   -6.776   1.00 16.58  ? 115 HIS A ND1 1 
ATOM   896   C  CD2 . HIS A  1 140 ? 65.771  4.549   -6.073   1.00 16.04  ? 115 HIS A CD2 1 
ATOM   897   C  CE1 . HIS A  1 140 ? 64.660  6.338   -5.455   1.00 17.11  ? 115 HIS A CE1 1 
ATOM   898   N  NE2 . HIS A  1 140 ? 65.355  5.306   -5.006   1.00 16.91  ? 115 HIS A NE2 1 
ATOM   899   N  N   . LEU A  1 141 ? 68.539  4.841   -8.677   1.00 16.90  ? 116 LEU A N   1 
ATOM   900   C  CA  . LEU A  1 141 ? 69.788  4.835   -7.883   1.00 17.52  ? 116 LEU A CA  1 
ATOM   901   C  C   . LEU A  1 141 ? 70.695  6.014   -8.152   1.00 18.61  ? 116 LEU A C   1 
ATOM   902   O  O   . LEU A  1 141 ? 71.380  6.479   -7.245   1.00 20.50  ? 116 LEU A O   1 
ATOM   903   C  CB  . LEU A  1 141 ? 70.582  3.532   -8.060   1.00 15.70  ? 116 LEU A CB  1 
ATOM   904   C  CG  . LEU A  1 141 ? 69.974  2.302   -7.370   1.00 15.07  ? 116 LEU A CG  1 
ATOM   905   C  CD1 . LEU A  1 141 ? 70.572  1.020   -7.932   1.00 14.39  ? 116 LEU A CD1 1 
ATOM   906   C  CD2 . LEU A  1 141 ? 70.099  2.361   -5.840   1.00 14.63  ? 116 LEU A CD2 1 
ATOM   907   N  N   . GLN A  1 142 ? 70.704  6.499   -9.391   1.00 18.22  ? 117 GLN A N   1 
ATOM   908   C  CA  . GLN A  1 142 ? 71.641  7.554   -9.780   1.00 17.86  ? 117 GLN A CA  1 
ATOM   909   C  C   . GLN A  1 142 ? 71.101  8.989   -9.586   1.00 15.74  ? 117 GLN A C   1 
ATOM   910   O  O   . GLN A  1 142 ? 71.808  9.956   -9.846   1.00 14.96  ? 117 GLN A O   1 
ATOM   911   C  CB  . GLN A  1 142 ? 72.144  7.305   -11.215  1.00 21.39  ? 117 GLN A CB  1 
ATOM   912   C  CG  . GLN A  1 142 ? 73.432  8.042   -11.590  1.00 24.10  ? 117 GLN A CG  1 
ATOM   913   C  CD  . GLN A  1 142 ? 74.095  7.520   -12.866  1.00 26.89  ? 117 GLN A CD  1 
ATOM   914   O  OE1 . GLN A  1 142 ? 73.727  6.468   -13.392  1.00 30.16  ? 117 GLN A OE1 1 
ATOM   915   N  NE2 . GLN A  1 142 ? 75.105  8.239   -13.344  1.00 26.30  ? 117 GLN A NE2 1 
ATOM   916   N  N   . LYS A  1 143 ? 69.860  9.121   -9.108   1.00 15.61  ? 118 LYS A N   1 
ATOM   917   C  CA  . LYS A  1 143 ? 69.288  10.427  -8.766   1.00 15.59  ? 118 LYS A CA  1 
ATOM   918   C  C   . LYS A  1 143 ? 70.218  11.272  -7.890   1.00 16.69  ? 118 LYS A C   1 
ATOM   919   O  O   . LYS A  1 143 ? 70.883  10.757  -6.986   1.00 16.03  ? 118 LYS A O   1 
ATOM   920   C  CB  . LYS A  1 143 ? 67.970  10.265  -8.030   1.00 14.67  ? 118 LYS A CB  1 
ATOM   921   C  CG  . LYS A  1 143 ? 66.785  9.928   -8.915   1.00 14.34  ? 118 LYS A CG  1 
ATOM   922   C  CD  . LYS A  1 143 ? 65.630  9.537   -8.025   1.00 14.39  ? 118 LYS A CD  1 
ATOM   923   C  CE  . LYS A  1 143 ? 64.390  9.218   -8.844   1.00 14.84  ? 118 LYS A CE  1 
ATOM   924   N  NZ  . LYS A  1 143 ? 63.467  8.483   -7.942   1.00 15.61  ? 118 LYS A NZ  1 
ATOM   925   N  N   . SER A  1 144 ? 70.246  12.570  -8.166   1.00 17.36  ? 119 SER A N   1 
ATOM   926   C  CA  . SER A  1 144 ? 70.957  13.521  -7.322   1.00 18.55  ? 119 SER A CA  1 
ATOM   927   C  C   . SER A  1 144 ? 69.962  14.467  -6.645   1.00 18.60  ? 119 SER A C   1 
ATOM   928   O  O   . SER A  1 144 ? 68.755  14.255  -6.757   1.00 18.97  ? 119 SER A O   1 
ATOM   929   C  CB  . SER A  1 144 ? 71.977  14.283  -8.163   1.00 19.53  ? 119 SER A CB  1 
ATOM   930   O  OG  . SER A  1 144 ? 71.410  14.684  -9.401   1.00 19.46  ? 119 SER A OG  1 
ATOM   931   N  N   . GLU A  1 145 ? 70.456  15.504  -5.964   1.00 18.94  ? 120 GLU A N   1 
ATOM   932   C  CA  . GLU A  1 145 ? 69.626  16.324  -5.055   1.00 19.52  ? 120 GLU A CA  1 
ATOM   933   C  C   . GLU A  1 145 ? 69.379  17.718  -5.607   1.00 18.30  ? 120 GLU A C   1 
ATOM   934   O  O   . GLU A  1 145 ? 70.273  18.307  -6.195   1.00 18.25  ? 120 GLU A O   1 
ATOM   935   C  CB  . GLU A  1 145 ? 70.290  16.481  -3.673   1.00 21.62  ? 120 GLU A CB  1 
ATOM   936   C  CG  . GLU A  1 145 ? 70.723  15.209  -2.953   1.00 24.50  ? 120 GLU A CG  1 
ATOM   937   C  CD  . GLU A  1 145 ? 71.571  15.505  -1.711   1.00 31.12  ? 120 GLU A CD  1 
ATOM   938   O  OE1 . GLU A  1 145 ? 72.556  16.278  -1.823   1.00 31.17  ? 120 GLU A OE1 1 
ATOM   939   O  OE2 . GLU A  1 145 ? 71.263  14.976  -0.603   1.00 34.71  ? 120 GLU A OE2 1 
ATOM   940   N  N   . PHE A  1 146 ? 68.178  18.254  -5.387   1.00 17.60  ? 121 PHE A N   1 
ATOM   941   C  CA  . PHE A  1 146 ? 67.789  19.584  -5.883   1.00 17.10  ? 121 PHE A CA  1 
ATOM   942   C  C   . PHE A  1 146 ? 67.268  20.423  -4.725   1.00 17.87  ? 121 PHE A C   1 
ATOM   943   O  O   . PHE A  1 146 ? 66.480  19.929  -3.909   1.00 18.25  ? 121 PHE A O   1 
ATOM   944   C  CB  . PHE A  1 146 ? 66.679  19.472  -6.963   1.00 16.03  ? 121 PHE A CB  1 
ATOM   945   C  CG  . PHE A  1 146 ? 66.326  20.791  -7.643   1.00 14.85  ? 121 PHE A CG  1 
ATOM   946   C  CD1 . PHE A  1 146 ? 65.478  21.703  -7.039   1.00 14.20  ? 121 PHE A CD1 1 
ATOM   947   C  CD2 . PHE A  1 146 ? 66.848  21.106  -8.900   1.00 14.97  ? 121 PHE A CD2 1 
ATOM   948   C  CE1 . PHE A  1 146 ? 65.163  22.910  -7.651   1.00 14.51  ? 121 PHE A CE1 1 
ATOM   949   C  CE2 . PHE A  1 146 ? 66.538  22.313  -9.528   1.00 15.06  ? 121 PHE A CE2 1 
ATOM   950   C  CZ  . PHE A  1 146 ? 65.691  23.223  -8.903   1.00 14.95  ? 121 PHE A CZ  1 
ATOM   951   N  N   . THR A  1 147 ? 67.690  21.691  -4.673   1.00 17.43  ? 122 THR A N   1 
ATOM   952   C  CA  . THR A  1 147 ? 67.160  22.670  -3.723   1.00 16.94  ? 122 THR A CA  1 
ATOM   953   C  C   . THR A  1 147 ? 66.737  23.897  -4.493   1.00 17.94  ? 122 THR A C   1 
ATOM   954   O  O   . THR A  1 147 ? 67.543  24.472  -5.230   1.00 18.78  ? 122 THR A O   1 
ATOM   955   C  CB  . THR A  1 147 ? 68.227  23.134  -2.700   1.00 16.59  ? 122 THR A CB  1 
ATOM   956   O  OG1 . THR A  1 147 ? 68.640  22.032  -1.890   1.00 16.62  ? 122 THR A OG1 1 
ATOM   957   C  CG2 . THR A  1 147 ? 67.693  24.289  -1.790   1.00 15.73  ? 122 THR A CG2 1 
ATOM   958   N  N   . GLU A  1 148 ? 65.483  24.298  -4.313   1.00 18.64  ? 123 GLU A N   1 
ATOM   959   C  CA  . GLU A  1 148 ? 64.981  25.552  -4.843   1.00 19.37  ? 123 GLU A CA  1 
ATOM   960   C  C   . GLU A  1 148 ? 65.130  26.662  -3.824   1.00 20.05  ? 123 GLU A C   1 
ATOM   961   O  O   . GLU A  1 148 ? 64.822  26.473  -2.651   1.00 21.27  ? 123 GLU A O   1 
ATOM   962   C  CB  . GLU A  1 148 ? 63.508  25.448  -5.231   1.00 20.94  ? 123 GLU A CB  1 
ATOM   963   C  CG  . GLU A  1 148 ? 62.910  26.811  -5.561   1.00 23.44  ? 123 GLU A CG  1 
ATOM   964   C  CD  . GLU A  1 148 ? 61.437  26.775  -5.883   1.00 27.02  ? 123 GLU A CD  1 
ATOM   965   O  OE1 . GLU A  1 148 ? 61.104  26.974  -7.070   1.00 29.26  ? 123 GLU A OE1 1 
ATOM   966   O  OE2 . GLU A  1 148 ? 60.618  26.568  -4.959   1.00 27.88  ? 123 GLU A OE2 1 
ATOM   967   N  N   . GLY A  1 149 ? 65.589  27.824  -4.277   1.00 20.28  ? 124 GLY A N   1 
ATOM   968   C  CA  . GLY A  1 149 ? 65.682  28.993  -3.410   1.00 21.03  ? 124 GLY A CA  1 
ATOM   969   C  C   . GLY A  1 149 ? 66.752  28.869  -2.335   1.00 20.95  ? 124 GLY A C   1 
ATOM   970   O  O   . GLY A  1 149 ? 66.585  29.372  -1.223   1.00 20.45  ? 124 GLY A O   1 
ATOM   971   N  N   . ALA A  1 150 ? 67.854  28.191  -2.663   1.00 20.92  ? 125 ALA A N   1 
ATOM   972   C  CA  . ALA A  1 150 ? 69.039  28.168  -1.799   1.00 20.60  ? 125 ALA A CA  1 
ATOM   973   C  C   . ALA A  1 150 ? 69.389  29.597  -1.391   1.00 21.45  ? 125 ALA A C   1 
ATOM   974   O  O   . ALA A  1 150 ? 69.791  29.839  -0.259   1.00 22.75  ? 125 ALA A O   1 
ATOM   975   C  CB  . ALA A  1 150 ? 70.206  27.519  -2.511   1.00 20.35  ? 125 ALA A CB  1 
ATOM   976   N  N   . GLY A  1 151 ? 69.231  30.528  -2.329   1.00 20.67  ? 126 GLY A N   1 
ATOM   977   C  CA  . GLY A  1 151 ? 69.230  31.968  -2.054   1.00 21.64  ? 126 GLY A CA  1 
ATOM   978   C  C   . GLY A  1 151 ? 68.135  32.576  -2.926   1.00 23.25  ? 126 GLY A C   1 
ATOM   979   O  O   . GLY A  1 151 ? 67.402  31.834  -3.582   1.00 22.57  ? 126 GLY A O   1 
ATOM   980   N  N   . PRO A  1 152 ? 68.011  33.923  -2.951   1.00 25.36  ? 127 PRO A N   1 
ATOM   981   C  CA  . PRO A  1 152 ? 66.916  34.574  -3.714   1.00 25.51  ? 127 PRO A CA  1 
ATOM   982   C  C   . PRO A  1 152 ? 66.993  34.328  -5.238   1.00 24.96  ? 127 PRO A C   1 
ATOM   983   O  O   . PRO A  1 152 ? 67.927  34.783  -5.894   1.00 25.38  ? 127 PRO A O   1 
ATOM   984   C  CB  . PRO A  1 152 ? 67.088  36.063  -3.383   1.00 27.11  ? 127 PRO A CB  1 
ATOM   985   C  CG  . PRO A  1 152 ? 68.523  36.199  -2.960   1.00 27.36  ? 127 PRO A CG  1 
ATOM   986   C  CD  . PRO A  1 152 ? 68.879  34.909  -2.276   1.00 25.91  ? 127 PRO A CD  1 
ATOM   987   N  N   . GLY A  1 153 ? 66.027  33.579  -5.778   1.00 22.63  ? 128 GLY A N   1 
ATOM   988   C  CA  . GLY A  1 153 ? 66.033  33.196  -7.187   1.00 21.88  ? 128 GLY A CA  1 
ATOM   989   C  C   . GLY A  1 153 ? 67.177  32.262  -7.559   1.00 21.35  ? 128 GLY A C   1 
ATOM   990   O  O   . GLY A  1 153 ? 67.459  32.063  -8.739   1.00 22.31  ? 128 GLY A O   1 
ATOM   991   N  N   . ILE A  1 154 ? 67.830  31.675  -6.559   1.00 19.53  ? 129 ILE A N   1 
ATOM   992   C  CA  . ILE A  1 154 ? 69.013  30.864  -6.801   1.00 19.56  ? 129 ILE A CA  1 
ATOM   993   C  C   . ILE A  1 154 ? 68.712  29.404  -6.489   1.00 20.74  ? 129 ILE A C   1 
ATOM   994   O  O   . ILE A  1 154 ? 68.357  29.081  -5.353   1.00 21.80  ? 129 ILE A O   1 
ATOM   995   C  CB  . ILE A  1 154 ? 70.218  31.326  -5.942   1.00 18.99  ? 129 ILE A CB  1 
ATOM   996   C  CG1 . ILE A  1 154 ? 70.657  32.759  -6.323   1.00 19.26  ? 129 ILE A CG1 1 
ATOM   997   C  CG2 . ILE A  1 154 ? 71.365  30.328  -6.061   1.00 18.21  ? 129 ILE A CG2 1 
ATOM   998   C  CD1 . ILE A  1 154 ? 71.674  33.392  -5.377   1.00 18.83  ? 129 ILE A CD1 1 
ATOM   999   N  N   . ASP A  1 155 ? 68.852  28.523  -7.478   1.00 18.81  ? 130 ASP A N   1 
ATOM   1000  C  CA  . ASP A  1 155 ? 68.671  27.104  -7.210   1.00 18.94  ? 130 ASP A CA  1 
ATOM   1001  C  C   . ASP A  1 155 ? 70.007  26.377  -7.142   1.00 19.02  ? 130 ASP A C   1 
ATOM   1002  O  O   . ASP A  1 155 ? 71.004  26.854  -7.666   1.00 18.78  ? 130 ASP A O   1 
ATOM   1003  C  CB  . ASP A  1 155 ? 67.743  26.464  -8.241   1.00 19.90  ? 130 ASP A CB  1 
ATOM   1004  C  CG  . ASP A  1 155 ? 66.385  27.156  -8.310   1.00 21.03  ? 130 ASP A CG  1 
ATOM   1005  O  OD1 . ASP A  1 155 ? 65.849  27.576  -7.259   1.00 20.93  ? 130 ASP A OD1 1 
ATOM   1006  O  OD2 . ASP A  1 155 ? 65.860  27.271  -9.428   1.00 22.19  ? 130 ASP A OD2 1 
HETATM 1007  N  N   . MSE A  1 156 ? 70.020  25.228  -6.478   1.00 19.30  ? 131 MSE A N   1 
HETATM 1008  C  CA  . MSE A  1 156 ? 71.254  24.512  -6.245   1.00 20.17  ? 131 MSE A CA  1 
HETATM 1009  C  C   . MSE A  1 156 ? 70.922  23.055  -6.352   1.00 20.22  ? 131 MSE A C   1 
HETATM 1010  O  O   . MSE A  1 156 ? 70.000  22.580  -5.691   1.00 21.32  ? 131 MSE A O   1 
HETATM 1011  C  CB  . MSE A  1 156 ? 71.758  24.898  -4.854   1.00 20.32  ? 131 MSE A CB  1 
HETATM 1012  C  CG  . MSE A  1 156 ? 73.144  24.328  -4.551   1.00 22.44  ? 131 MSE A CG  1 
HETATM 1013  SE SE  . MSE A  1 156 ? 73.731  24.930  -2.750   1.00 25.52  ? 131 MSE A SE  1 
HETATM 1014  C  CE  . MSE A  1 156 ? 73.834  26.843  -3.229   1.00 21.68  ? 131 MSE A CE  1 
ATOM   1015  N  N   . TYR A  1 157 ? 71.677  22.330  -7.172   1.00 18.60  ? 132 TYR A N   1 
ATOM   1016  C  CA  . TYR A  1 157 ? 71.375  20.931  -7.437   1.00 18.75  ? 132 TYR A CA  1 
ATOM   1017  C  C   . TYR A  1 157 ? 72.605  20.196  -7.885   1.00 19.24  ? 132 TYR A C   1 
ATOM   1018  O  O   . TYR A  1 157 ? 73.449  20.759  -8.585   1.00 20.40  ? 132 TYR A O   1 
ATOM   1019  C  CB  . TYR A  1 157 ? 70.262  20.781  -8.498   1.00 18.44  ? 132 TYR A CB  1 
ATOM   1020  C  CG  . TYR A  1 157 ? 70.485  21.504  -9.833   1.00 17.93  ? 132 TYR A CG  1 
ATOM   1021  C  CD1 . TYR A  1 157 ? 70.139  22.850  -9.992   1.00 17.78  ? 132 TYR A CD1 1 
ATOM   1022  C  CD2 . TYR A  1 157 ? 70.994  20.821  -10.944  1.00 18.33  ? 132 TYR A CD2 1 
ATOM   1023  C  CE1 . TYR A  1 157 ? 70.321  23.503  -11.201  1.00 18.24  ? 132 TYR A CE1 1 
ATOM   1024  C  CE2 . TYR A  1 157 ? 71.182  21.464  -12.167  1.00 18.00  ? 132 TYR A CE2 1 
ATOM   1025  C  CZ  . TYR A  1 157 ? 70.844  22.805  -12.288  1.00 18.57  ? 132 TYR A CZ  1 
ATOM   1026  O  OH  . TYR A  1 157 ? 71.029  23.451  -13.491  1.00 18.11  ? 132 TYR A OH  1 
ATOM   1027  N  N   . SER A  1 158 ? 72.715  18.938  -7.484   1.00 18.40  ? 133 SER A N   1 
ATOM   1028  C  CA  . SER A  1 158 ? 73.835  18.128  -7.923   1.00 18.16  ? 133 SER A CA  1 
ATOM   1029  C  C   . SER A  1 158 ? 73.447  17.231  -9.105   1.00 17.23  ? 133 SER A C   1 
ATOM   1030  O  O   . SER A  1 158 ? 72.254  17.095  -9.424   1.00 16.89  ? 133 SER A O   1 
ATOM   1031  C  CB  . SER A  1 158 ? 74.403  17.302  -6.758   1.00 19.24  ? 133 SER A CB  1 
ATOM   1032  O  OG  . SER A  1 158 ? 73.410  16.491  -6.172   1.00 20.82  ? 133 SER A OG  1 
ATOM   1033  N  N   . ILE A  1 159 ? 74.468  16.655  -9.750   1.00 16.01  ? 134 ILE A N   1 
ATOM   1034  C  CA  . ILE A  1 159 ? 74.329  15.662  -10.805  1.00 16.13  ? 134 ILE A CA  1 
ATOM   1035  C  C   . ILE A  1 159 ? 75.382  14.563  -10.606  1.00 16.55  ? 134 ILE A C   1 
ATOM   1036  O  O   . ILE A  1 159 ? 76.554  14.861  -10.383  1.00 16.58  ? 134 ILE A O   1 
ATOM   1037  C  CB  . ILE A  1 159 ? 74.564  16.278  -12.207  1.00 17.58  ? 134 ILE A CB  1 
ATOM   1038  C  CG1 . ILE A  1 159 ? 73.704  17.548  -12.414  1.00 18.27  ? 134 ILE A CG1 1 
ATOM   1039  C  CG2 . ILE A  1 159 ? 74.342  15.216  -13.297  1.00 17.64  ? 134 ILE A CG2 1 
ATOM   1040  C  CD1 . ILE A  1 159 ? 73.665  18.068  -13.837  1.00 20.30  ? 134 ILE A CD1 1 
ATOM   1041  N  N   . ARG A  1 160 ? 74.988  13.295  -10.709  1.00 16.90  ? 135 ARG A N   1 
ATOM   1042  C  CA  . ARG A  1 160 ? 75.972  12.205  -10.594  1.00 18.53  ? 135 ARG A CA  1 
ATOM   1043  C  C   . ARG A  1 160 ? 76.416  11.691  -11.962  1.00 19.38  ? 135 ARG A C   1 
ATOM   1044  O  O   . ARG A  1 160 ? 75.688  10.943  -12.639  1.00 19.58  ? 135 ARG A O   1 
ATOM   1045  C  CB  . ARG A  1 160 ? 75.438  11.059  -9.742   1.00 20.14  ? 135 ARG A CB  1 
ATOM   1046  C  CG  . ARG A  1 160 ? 74.946  11.463  -8.354   1.00 22.44  ? 135 ARG A CG  1 
ATOM   1047  C  CD  . ARG A  1 160 ? 75.020  10.235  -7.487   1.00 29.36  ? 135 ARG A CD  1 
ATOM   1048  N  NE  . ARG A  1 160 ? 74.179  10.253  -6.300   1.00 38.61  ? 135 ARG A NE  1 
ATOM   1049  C  CZ  . ARG A  1 160 ? 74.038  9.198   -5.501   1.00 45.90  ? 135 ARG A CZ  1 
ATOM   1050  N  NH1 . ARG A  1 160 ? 73.253  9.266   -4.430   1.00 51.64  ? 135 ARG A NH1 1 
ATOM   1051  N  NH2 . ARG A  1 160 ? 74.694  8.072   -5.773   1.00 43.08  ? 135 ARG A NH2 1 
ATOM   1052  N  N   . GLN A  1 161 ? 77.626  12.086  -12.355  1.00 18.89  ? 136 GLN A N   1 
ATOM   1053  C  CA  . GLN A  1 161 ? 78.143  11.826  -13.695  1.00 17.56  ? 136 GLN A CA  1 
ATOM   1054  C  C   . GLN A  1 161 ? 79.192  10.692  -13.650  1.00 18.05  ? 136 GLN A C   1 
ATOM   1055  O  O   . GLN A  1 161 ? 79.806  10.470  -12.608  1.00 18.11  ? 136 GLN A O   1 
ATOM   1056  C  CB  . GLN A  1 161 ? 78.701  13.125  -14.289  1.00 16.01  ? 136 GLN A CB  1 
ATOM   1057  C  CG  . GLN A  1 161 ? 77.616  14.178  -14.554  1.00 15.86  ? 136 GLN A CG  1 
ATOM   1058  C  CD  . GLN A  1 161 ? 78.060  15.302  -15.470  1.00 15.86  ? 136 GLN A CD  1 
ATOM   1059  O  OE1 . GLN A  1 161 ? 79.124  15.870  -15.276  1.00 16.40  ? 136 GLN A OE1 1 
ATOM   1060  N  NE2 . GLN A  1 161 ? 77.235  15.648  -16.455  1.00 14.98  ? 136 GLN A NE2 1 
ATOM   1061  N  N   . PRO A  1 162 ? 79.385  9.965   -14.768  1.00 17.98  ? 137 PRO A N   1 
ATOM   1062  C  CA  . PRO A  1 162 ? 80.397  8.897   -14.801  1.00 19.47  ? 137 PRO A CA  1 
ATOM   1063  C  C   . PRO A  1 162 ? 81.795  9.398   -14.404  1.00 19.44  ? 137 PRO A C   1 
ATOM   1064  O  O   . PRO A  1 162 ? 82.112  10.575  -14.630  1.00 20.05  ? 137 PRO A O   1 
ATOM   1065  C  CB  . PRO A  1 162 ? 80.384  8.440   -16.278  1.00 19.22  ? 137 PRO A CB  1 
ATOM   1066  C  CG  . PRO A  1 162 ? 79.012  8.772   -16.759  1.00 19.07  ? 137 PRO A CG  1 
ATOM   1067  C  CD  . PRO A  1 162 ? 78.584  10.008  -16.009  1.00 18.88  ? 137 PRO A CD  1 
ATOM   1068  N  N   . VAL A  1 163 ? 82.607  8.540   -13.786  1.00 18.64  ? 138 VAL A N   1 
ATOM   1069  C  CA  . VAL A  1 163 ? 84.035  8.884   -13.582  1.00 19.86  ? 138 VAL A CA  1 
ATOM   1070  C  C   . VAL A  1 163 ? 84.838  8.778   -14.889  1.00 21.89  ? 138 VAL A C   1 
ATOM   1071  O  O   . VAL A  1 163 ? 85.881  9.415   -15.040  1.00 24.87  ? 138 VAL A O   1 
ATOM   1072  C  CB  . VAL A  1 163 ? 84.724  8.066   -12.459  1.00 20.05  ? 138 VAL A CB  1 
ATOM   1073  C  CG1 . VAL A  1 163 ? 84.107  8.380   -11.102  1.00 19.84  ? 138 VAL A CG1 1 
ATOM   1074  C  CG2 . VAL A  1 163 ? 84.679  6.563   -12.740  1.00 19.76  ? 138 VAL A CG2 1 
ATOM   1075  N  N   . GLY A  1 164 ? 84.332  7.978   -15.827  1.00 21.64  ? 139 GLY A N   1 
ATOM   1076  C  CA  . GLY A  1 164 ? 84.944  7.782   -17.128  1.00 20.63  ? 139 GLY A CA  1 
ATOM   1077  C  C   . GLY A  1 164 ? 85.251  6.306   -17.311  1.00 19.94  ? 139 GLY A C   1 
ATOM   1078  O  O   . GLY A  1 164 ? 84.405  5.521   -17.745  1.00 19.22  ? 139 GLY A O   1 
ATOM   1079  N  N   . ILE A  1 165 ? 86.475  5.925   -16.970  1.00 19.55  ? 140 ILE A N   1 
ATOM   1080  C  CA  . ILE A  1 165 ? 86.919  4.559   -17.176  1.00 19.15  ? 140 ILE A CA  1 
ATOM   1081  C  C   . ILE A  1 165 ? 87.392  3.963   -15.864  1.00 19.33  ? 140 ILE A C   1 
ATOM   1082  O  O   . ILE A  1 165 ? 88.217  4.542   -15.155  1.00 18.72  ? 140 ILE A O   1 
ATOM   1083  C  CB  . ILE A  1 165 ? 88.026  4.469   -18.246  1.00 19.49  ? 140 ILE A CB  1 
ATOM   1084  C  CG1 . ILE A  1 165 ? 87.556  5.125   -19.552  1.00 19.73  ? 140 ILE A CG1 1 
ATOM   1085  C  CG2 . ILE A  1 165 ? 88.406  3.008   -18.489  1.00 19.06  ? 140 ILE A CG2 1 
ATOM   1086  C  CD1 . ILE A  1 165 ? 88.655  5.297   -20.580  1.00 20.30  ? 140 ILE A CD1 1 
ATOM   1087  N  N   . GLY A  1 166 ? 86.836  2.804   -15.546  1.00 20.29  ? 141 GLY A N   1 
ATOM   1088  C  CA  . GLY A  1 166 ? 87.193  2.095   -14.337  1.00 20.36  ? 141 GLY A CA  1 
ATOM   1089  C  C   . GLY A  1 166 ? 87.925  0.804   -14.642  1.00 19.97  ? 141 GLY A C   1 
ATOM   1090  O  O   . GLY A  1 166 ? 87.897  0.301   -15.774  1.00 19.89  ? 141 GLY A O   1 
ATOM   1091  N  N   . ALA A  1 167 ? 88.605  0.286   -13.624  1.00 19.61  ? 142 ALA A N   1 
ATOM   1092  C  CA  . ALA A  1 167 ? 89.226  -1.016  -13.712  1.00 19.12  ? 142 ALA A CA  1 
ATOM   1093  C  C   . ALA A  1 167 ? 88.960  -1.783  -12.433  1.00 18.67  ? 142 ALA A C   1 
ATOM   1094  O  O   . ALA A  1 167 ? 88.852  -1.193  -11.358  1.00 17.15  ? 142 ALA A O   1 
ATOM   1095  C  CB  . ALA A  1 167 ? 90.714  -0.889  -13.955  1.00 18.38  ? 142 ALA A CB  1 
ATOM   1096  N  N   . GLY A  1 168 ? 88.857  -3.099  -12.569  1.00 19.10  ? 143 GLY A N   1 
ATOM   1097  C  CA  . GLY A  1 168 ? 88.690  -3.984  -11.431  1.00 19.87  ? 143 GLY A CA  1 
ATOM   1098  C  C   . GLY A  1 168 ? 89.608  -5.179  -11.523  1.00 20.86  ? 143 GLY A C   1 
ATOM   1099  O  O   . GLY A  1 168 ? 89.876  -5.690  -12.627  1.00 21.68  ? 143 GLY A O   1 
ATOM   1100  N  N   . ILE A  1 169 ? 90.090  -5.612  -10.356  1.00 20.10  ? 144 ILE A N   1 
ATOM   1101  C  CA  . ILE A  1 169 ? 91.055  -6.695  -10.231  1.00 18.79  ? 144 ILE A CA  1 
ATOM   1102  C  C   . ILE A  1 169 ? 90.459  -7.730  -9.292   1.00 18.54  ? 144 ILE A C   1 
ATOM   1103  O  O   . ILE A  1 169 ? 90.130  -7.401  -8.151   1.00 18.25  ? 144 ILE A O   1 
ATOM   1104  C  CB  . ILE A  1 169 ? 92.388  -6.177  -9.655   1.00 18.58  ? 144 ILE A CB  1 
ATOM   1105  C  CG1 . ILE A  1 169 ? 92.895  -4.982  -10.489  1.00 18.88  ? 144 ILE A CG1 1 
ATOM   1106  C  CG2 . ILE A  1 169 ? 93.405  -7.319  -9.601   1.00 18.29  ? 144 ILE A CG2 1 
ATOM   1107  C  CD1 . ILE A  1 169 ? 93.939  -4.114  -9.810   1.00 18.61  ? 144 ILE A CD1 1 
ATOM   1108  N  N   . THR A  1 170 ? 90.311  -8.973  -9.766   1.00 17.94  ? 145 THR A N   1 
ATOM   1109  C  CA  . THR A  1 170 ? 89.517  -9.979  -9.041   1.00 16.71  ? 145 THR A CA  1 
ATOM   1110  C  C   . THR A  1 170 ? 90.315  -11.258 -8.705   1.00 17.21  ? 145 THR A C   1 
ATOM   1111  O  O   . THR A  1 170 ? 91.289  -11.564 -9.382   1.00 17.56  ? 145 THR A O   1 
ATOM   1112  C  CB  . THR A  1 170 ? 88.211  -10.331 -9.801   1.00 16.61  ? 145 THR A CB  1 
ATOM   1113  O  OG1 . THR A  1 170 ? 88.521  -10.877 -11.087  1.00 18.23  ? 145 THR A OG1 1 
ATOM   1114  C  CG2 . THR A  1 170 ? 87.339  -9.097  -10.001  1.00 16.39  ? 145 THR A CG2 1 
ATOM   1115  N  N   . PRO A  1 171 ? 89.889  -12.010 -7.665   1.00 16.94  ? 146 PRO A N   1 
ATOM   1116  C  CA  . PRO A  1 171 ? 90.615  -13.185 -7.195   1.00 17.33  ? 146 PRO A CA  1 
ATOM   1117  C  C   . PRO A  1 171 ? 90.066  -14.486 -7.805   1.00 17.75  ? 146 PRO A C   1 
ATOM   1118  O  O   . PRO A  1 171 ? 89.036  -14.466 -8.490   1.00 17.41  ? 146 PRO A O   1 
ATOM   1119  C  CB  . PRO A  1 171 ? 90.326  -13.161 -5.694   1.00 16.89  ? 146 PRO A CB  1 
ATOM   1120  C  CG  . PRO A  1 171 ? 88.937  -12.578 -5.584   1.00 16.37  ? 146 PRO A CG  1 
ATOM   1121  C  CD  . PRO A  1 171 ? 88.667  -11.794 -6.855   1.00 16.57  ? 146 PRO A CD  1 
ATOM   1122  N  N   . PHE A  1 172 ? 90.728  -15.599 -7.526   1.00 18.57  ? 147 PHE A N   1 
ATOM   1123  C  CA  . PHE A  1 172 ? 90.370  -16.890 -8.117   1.00 20.45  ? 147 PHE A CA  1 
ATOM   1124  C  C   . PHE A  1 172 ? 89.074  -17.501 -7.592   1.00 22.18  ? 147 PHE A C   1 
ATOM   1125  O  O   . PHE A  1 172 ? 88.458  -18.308 -8.289   1.00 24.12  ? 147 PHE A O   1 
ATOM   1126  C  CB  . PHE A  1 172 ? 91.517  -17.908 -7.922   1.00 20.80  ? 147 PHE A CB  1 
ATOM   1127  C  CG  . PHE A  1 172 ? 91.536  -18.551 -6.545   1.00 20.85  ? 147 PHE A CG  1 
ATOM   1128  C  CD1 . PHE A  1 172 ? 90.722  -19.666 -6.256   1.00 21.31  ? 147 PHE A CD1 1 
ATOM   1129  C  CD2 . PHE A  1 172 ? 92.346  -18.043 -5.539   1.00 19.76  ? 147 PHE A CD2 1 
ATOM   1130  C  CE1 . PHE A  1 172 ? 90.726  -20.256 -4.987   1.00 21.52  ? 147 PHE A CE1 1 
ATOM   1131  C  CE2 . PHE A  1 172 ? 92.364  -18.632 -4.275   1.00 20.26  ? 147 PHE A CE2 1 
ATOM   1132  C  CZ  . PHE A  1 172 ? 91.555  -19.738 -3.995   1.00 21.38  ? 147 PHE A CZ  1 
ATOM   1133  N  N   . ASN A  1 173 ? 88.677  -17.167 -6.366   1.00 22.59  ? 148 ASN A N   1 
ATOM   1134  C  CA  . ASN A  1 173 ? 87.621  -17.942 -5.709   1.00 23.10  ? 148 ASN A CA  1 
ATOM   1135  C  C   . ASN A  1 173 ? 86.198  -17.648 -6.181   1.00 22.85  ? 148 ASN A C   1 
ATOM   1136  O  O   . ASN A  1 173 ? 85.350  -18.538 -6.148   1.00 22.10  ? 148 ASN A O   1 
ATOM   1137  C  CB  . ASN A  1 173 ? 87.746  -17.937 -4.179   1.00 23.70  ? 148 ASN A CB  1 
ATOM   1138  C  CG  . ASN A  1 173 ? 87.473  -16.585 -3.555   1.00 25.82  ? 148 ASN A CG  1 
ATOM   1139  O  OD1 . ASN A  1 173 ? 87.497  -15.539 -4.219   1.00 28.77  ? 148 ASN A OD1 1 
ATOM   1140  N  ND2 . ASN A  1 173 ? 87.220  -16.597 -2.260   1.00 25.84  ? 148 ASN A ND2 1 
ATOM   1141  N  N   . PHE A  1 174 ? 85.952  -16.424 -6.651   1.00 22.54  ? 149 PHE A N   1 
ATOM   1142  C  CA  . PHE A  1 174 ? 84.655  -16.084 -7.261   1.00 22.40  ? 149 PHE A CA  1 
ATOM   1143  C  C   . PHE A  1 174 ? 84.778  -15.387 -8.639   1.00 22.63  ? 149 PHE A C   1 
ATOM   1144  O  O   . PHE A  1 174 ? 84.543  -14.179 -8.747   1.00 22.42  ? 149 PHE A O   1 
ATOM   1145  C  CB  . PHE A  1 174 ? 83.810  -15.245 -6.290   1.00 22.66  ? 149 PHE A CB  1 
ATOM   1146  C  CG  . PHE A  1 174 ? 83.317  -16.010 -5.086   1.00 22.65  ? 149 PHE A CG  1 
ATOM   1147  C  CD1 . PHE A  1 174 ? 82.182  -16.811 -5.169   1.00 22.17  ? 149 PHE A CD1 1 
ATOM   1148  C  CD2 . PHE A  1 174 ? 83.982  -15.916 -3.865   1.00 23.65  ? 149 PHE A CD2 1 
ATOM   1149  C  CE1 . PHE A  1 174 ? 81.722  -17.498 -4.057   1.00 24.22  ? 149 PHE A CE1 1 
ATOM   1150  C  CE2 . PHE A  1 174 ? 83.534  -16.607 -2.752   1.00 24.76  ? 149 PHE A CE2 1 
ATOM   1151  C  CZ  . PHE A  1 174 ? 82.400  -17.399 -2.843   1.00 24.52  ? 149 PHE A CZ  1 
ATOM   1152  N  N   . PRO A  1 175 ? 85.128  -16.151 -9.699   1.00 22.04  ? 150 PRO A N   1 
ATOM   1153  C  CA  . PRO A  1 175 ? 85.426  -15.546 -11.002  1.00 22.74  ? 150 PRO A CA  1 
ATOM   1154  C  C   . PRO A  1 175 ? 84.188  -15.081 -11.769  1.00 22.38  ? 150 PRO A C   1 
ATOM   1155  O  O   . PRO A  1 175 ? 84.318  -14.498 -12.840  1.00 20.77  ? 150 PRO A O   1 
ATOM   1156  C  CB  . PRO A  1 175 ? 86.142  -16.677 -11.760  1.00 23.04  ? 150 PRO A CB  1 
ATOM   1157  C  CG  . PRO A  1 175 ? 85.575  -17.921 -11.169  1.00 22.62  ? 150 PRO A CG  1 
ATOM   1158  C  CD  . PRO A  1 175 ? 85.365  -17.610 -9.711   1.00 22.13  ? 150 PRO A CD  1 
ATOM   1159  N  N   . GLY A  1 176 ? 83.003  -15.334 -11.212  1.00 23.91  ? 151 GLY A N   1 
ATOM   1160  C  CA  . GLY A  1 176 ? 81.745  -14.800 -11.751  1.00 23.62  ? 151 GLY A CA  1 
ATOM   1161  C  C   . GLY A  1 176 ? 81.194  -13.670 -10.895  1.00 23.24  ? 151 GLY A C   1 
ATOM   1162  O  O   . GLY A  1 176 ? 81.010  -12.542 -11.375  1.00 24.81  ? 151 GLY A O   1 
HETATM 1163  N  N   . MSE A  1 177 ? 80.950  -13.968 -9.618   1.00 20.68  ? 152 MSE A N   1 
HETATM 1164  C  CA  . MSE A  1 177 ? 80.370  -13.010 -8.681   1.00 21.37  ? 152 MSE A CA  1 
HETATM 1165  C  C   . MSE A  1 177 ? 81.134  -11.699 -8.535   1.00 20.03  ? 152 MSE A C   1 
HETATM 1166  O  O   . MSE A  1 177 ? 80.536  -10.625 -8.616   1.00 18.67  ? 152 MSE A O   1 
HETATM 1167  C  CB  . MSE A  1 177 ? 80.187  -13.696 -7.326   1.00 22.48  ? 152 MSE A CB  1 
HETATM 1168  C  CG  . MSE A  1 177 ? 79.670  -12.704 -6.293   1.00 25.38  ? 152 MSE A CG  1 
HETATM 1169  SE SE  . MSE A  1 177 ? 79.575  -13.540 -4.500   1.00 30.38  ? 152 MSE A SE  1 
HETATM 1170  C  CE  . MSE A  1 177 ? 81.459  -13.293 -3.966   1.00 27.29  ? 152 MSE A CE  1 
ATOM   1171  N  N   . ILE A  1 178 ? 82.437  -11.768 -8.287   1.00 19.08  ? 153 ILE A N   1 
ATOM   1172  C  CA  . ILE A  1 178 ? 83.190  -10.557 -7.958   1.00 19.45  ? 153 ILE A CA  1 
ATOM   1173  C  C   . ILE A  1 178 ? 83.382  -9.646  -9.175   1.00 19.41  ? 153 ILE A C   1 
ATOM   1174  O  O   . ILE A  1 178 ? 83.254  -8.422  -9.054   1.00 20.34  ? 153 ILE A O   1 
ATOM   1175  C  CB  . ILE A  1 178 ? 84.502  -10.874 -7.193   1.00 19.78  ? 153 ILE A CB  1 
ATOM   1176  C  CG1 . ILE A  1 178 ? 84.163  -11.375 -5.777   1.00 19.05  ? 153 ILE A CG1 1 
ATOM   1177  C  CG2 . ILE A  1 178 ? 85.365  -9.634  -7.048   1.00 20.35  ? 153 ILE A CG2 1 
ATOM   1178  C  CD1 . ILE A  1 178 ? 85.279  -12.121 -5.105   1.00 18.52  ? 153 ILE A CD1 1 
ATOM   1179  N  N   . PRO A  1 179 ? 83.657  -10.225 -10.359  1.00 19.28  ? 154 PRO A N   1 
ATOM   1180  C  CA  . PRO A  1 179 ? 83.646  -9.350  -11.530  1.00 19.39  ? 154 PRO A CA  1 
ATOM   1181  C  C   . PRO A  1 179 ? 82.312  -8.593  -11.708  1.00 20.35  ? 154 PRO A C   1 
ATOM   1182  O  O   . PRO A  1 179 ? 82.317  -7.384  -12.003  1.00 21.14  ? 154 PRO A O   1 
ATOM   1183  C  CB  . PRO A  1 179 ? 83.885  -10.337 -12.676  1.00 19.19  ? 154 PRO A CB  1 
ATOM   1184  C  CG  . PRO A  1 179 ? 84.797  -11.355 -12.070  1.00 19.01  ? 154 PRO A CG  1 
ATOM   1185  C  CD  . PRO A  1 179 ? 84.222  -11.552 -10.691  1.00 18.97  ? 154 PRO A CD  1 
HETATM 1186  N  N   . MSE A  1 180 ? 81.192  -9.286  -11.505  1.00 19.30  ? 155 MSE A N   1 
HETATM 1187  C  CA  . MSE A  1 180 ? 79.878  -8.664  -11.690  1.00 19.47  ? 155 MSE A CA  1 
HETATM 1188  C  C   . MSE A  1 180 ? 79.632  -7.677  -10.576  1.00 19.21  ? 155 MSE A C   1 
HETATM 1189  O  O   . MSE A  1 180 ? 79.046  -6.635  -10.831  1.00 18.77  ? 155 MSE A O   1 
HETATM 1190  C  CB  . MSE A  1 180 ? 78.724  -9.663  -11.835  1.00 19.49  ? 155 MSE A CB  1 
HETATM 1191  C  CG  . MSE A  1 180 ? 78.857  -10.495 -13.100  1.00 21.86  ? 155 MSE A CG  1 
HETATM 1192  SE SE  . MSE A  1 180 ? 77.332  -11.756 -13.276  1.00 26.86  ? 155 MSE A SE  1 
HETATM 1193  C  CE  . MSE A  1 180 ? 78.128  -13.460 -12.651  1.00 24.30  ? 155 MSE A CE  1 
ATOM   1194  N  N   . TRP A  1 181 ? 80.093  -7.971  -9.350   1.00 19.16  ? 156 TRP A N   1 
ATOM   1195  C  CA  . TRP A  1 181 ? 80.093  -6.974  -8.247   1.00 20.12  ? 156 TRP A CA  1 
ATOM   1196  C  C   . TRP A  1 181 ? 80.557  -5.600  -8.729   1.00 18.39  ? 156 TRP A C   1 
ATOM   1197  O  O   . TRP A  1 181 ? 79.959  -4.594  -8.404   1.00 17.26  ? 156 TRP A O   1 
ATOM   1198  C  CB  . TRP A  1 181 ? 81.061  -7.357  -7.117   1.00 21.05  ? 156 TRP A CB  1 
ATOM   1199  C  CG  . TRP A  1 181 ? 80.567  -8.259  -6.035   1.00 21.53  ? 156 TRP A CG  1 
ATOM   1200  C  CD1 . TRP A  1 181 ? 79.414  -9.011  -6.023   1.00 22.48  ? 156 TRP A CD1 1 
ATOM   1201  C  CD2 . TRP A  1 181 ? 81.256  -8.564  -4.817   1.00 20.89  ? 156 TRP A CD2 1 
ATOM   1202  N  NE1 . TRP A  1 181 ? 79.341  -9.745  -4.856   1.00 22.63  ? 156 TRP A NE1 1 
ATOM   1203  C  CE2 . TRP A  1 181 ? 80.462  -9.499  -4.104   1.00 21.74  ? 156 TRP A CE2 1 
ATOM   1204  C  CE3 . TRP A  1 181 ? 82.473  -8.142  -4.259   1.00 20.91  ? 156 TRP A CE3 1 
ATOM   1205  C  CZ2 . TRP A  1 181 ? 80.834  -9.998  -2.850   1.00 21.39  ? 156 TRP A CZ2 1 
ATOM   1206  C  CZ3 . TRP A  1 181 ? 82.845  -8.640  -3.009   1.00 21.53  ? 156 TRP A CZ3 1 
ATOM   1207  C  CH2 . TRP A  1 181 ? 82.029  -9.562  -2.323   1.00 21.43  ? 156 TRP A CH2 1 
HETATM 1208  N  N   . MSE A  1 182 ? 81.627  -5.587  -9.514   1.00 18.99  ? 157 MSE A N   1 
HETATM 1209  C  CA  . MSE A  1 182 ? 82.287  -4.345  -9.898   1.00 19.79  ? 157 MSE A CA  1 
HETATM 1210  C  C   . MSE A  1 182 ? 81.794  -3.822  -11.217  1.00 18.05  ? 157 MSE A C   1 
HETATM 1211  O  O   . MSE A  1 182 ? 81.541  -2.623  -11.348  1.00 17.52  ? 157 MSE A O   1 
HETATM 1212  C  CB  . MSE A  1 182 ? 83.771  -4.626  -10.063  1.00 21.56  ? 157 MSE A CB  1 
HETATM 1213  C  CG  . MSE A  1 182 ? 84.397  -5.134  -8.781   1.00 24.04  ? 157 MSE A CG  1 
HETATM 1214  SE SE  . MSE A  1 182 ? 86.257  -5.567  -9.275   1.00 27.97  ? 157 MSE A SE  1 
HETATM 1215  C  CE  . MSE A  1 182 ? 86.904  -6.017  -7.461   1.00 24.27  ? 157 MSE A CE  1 
ATOM   1216  N  N   . PHE A  1 183 ? 81.696  -4.670  -12.226  1.00 17.46  ? 158 PHE A N   1 
ATOM   1217  C  CA  . PHE A  1 183 ? 81.326  -4.135  -13.521  1.00 17.21  ? 158 PHE A CA  1 
ATOM   1218  C  C   . PHE A  1 183 ? 79.853  -3.748  -13.660  1.00 17.39  ? 158 PHE A C   1 
ATOM   1219  O  O   . PHE A  1 183 ? 79.549  -2.802  -14.348  1.00 18.09  ? 158 PHE A O   1 
ATOM   1220  C  CB  . PHE A  1 183 ? 81.918  -4.911  -14.712  1.00 17.02  ? 158 PHE A CB  1 
ATOM   1221  C  CG  . PHE A  1 183 ? 81.192  -6.164  -15.073  1.00 17.75  ? 158 PHE A CG  1 
ATOM   1222  C  CD1 . PHE A  1 183 ? 79.911  -6.125  -15.571  1.00 18.01  ? 158 PHE A CD1 1 
ATOM   1223  C  CD2 . PHE A  1 183 ? 81.825  -7.384  -14.974  1.00 19.10  ? 158 PHE A CD2 1 
ATOM   1224  C  CE1 . PHE A  1 183 ? 79.258  -7.285  -15.932  1.00 18.38  ? 158 PHE A CE1 1 
ATOM   1225  C  CE2 . PHE A  1 183 ? 81.177  -8.546  -15.328  1.00 19.36  ? 158 PHE A CE2 1 
ATOM   1226  C  CZ  . PHE A  1 183 ? 79.891  -8.496  -15.806  1.00 18.60  ? 158 PHE A CZ  1 
ATOM   1227  N  N   . ALA A  1 184 ? 78.960  -4.435  -12.957  1.00 17.66  ? 159 ALA A N   1 
ATOM   1228  C  CA  . ALA A  1 184 ? 77.531  -4.074  -12.995  1.00 18.45  ? 159 ALA A CA  1 
ATOM   1229  C  C   . ALA A  1 184 ? 77.272  -2.606  -12.585  1.00 18.26  ? 159 ALA A C   1 
ATOM   1230  O  O   . ALA A  1 184 ? 76.751  -1.843  -13.401  1.00 18.83  ? 159 ALA A O   1 
ATOM   1231  C  CB  . ALA A  1 184 ? 76.654  -5.061  -12.217  1.00 18.01  ? 159 ALA A CB  1 
ATOM   1232  N  N   . PRO A  1 185 ? 77.662  -2.193  -11.357  1.00 18.19  ? 160 PRO A N   1 
ATOM   1233  C  CA  . PRO A  1 185 ? 77.435  -0.772  -11.042  1.00 17.80  ? 160 PRO A CA  1 
ATOM   1234  C  C   . PRO A  1 185 ? 78.266  0.190   -11.884  1.00 17.23  ? 160 PRO A C   1 
ATOM   1235  O  O   . PRO A  1 185 ? 77.752  1.232   -12.277  1.00 16.62  ? 160 PRO A O   1 
ATOM   1236  C  CB  . PRO A  1 185 ? 77.804  -0.654  -9.557   1.00 17.77  ? 160 PRO A CB  1 
ATOM   1237  C  CG  . PRO A  1 185 ? 78.704  -1.804  -9.290   1.00 19.56  ? 160 PRO A CG  1 
ATOM   1238  C  CD  . PRO A  1 185 ? 78.283  -2.914  -10.229  1.00 19.91  ? 160 PRO A CD  1 
ATOM   1239  N  N   . ALA A  1 186 ? 79.525  -0.154  -12.174  1.00 17.37  ? 161 ALA A N   1 
ATOM   1240  C  CA  . ALA A  1 186 ? 80.378  0.740   -12.950  1.00 16.33  ? 161 ALA A CA  1 
ATOM   1241  C  C   . ALA A  1 186 ? 79.758  1.030   -14.322  1.00 15.94  ? 161 ALA A C   1 
ATOM   1242  O  O   . ALA A  1 186 ? 79.649  2.199   -14.723  1.00 14.92  ? 161 ALA A O   1 
ATOM   1243  C  CB  . ALA A  1 186 ? 81.770  0.171   -13.109  1.00 16.43  ? 161 ALA A CB  1 
ATOM   1244  N  N   . ILE A  1 187 ? 79.319  -0.027  -15.010  1.00 15.47  ? 162 ILE A N   1 
ATOM   1245  C  CA  . ILE A  1 187 ? 78.734  0.119   -16.353  1.00 15.86  ? 162 ILE A CA  1 
ATOM   1246  C  C   . ILE A  1 187 ? 77.327  0.737   -16.303  1.00 16.95  ? 162 ILE A C   1 
ATOM   1247  O  O   . ILE A  1 187 ? 76.983  1.598   -17.140  1.00 17.58  ? 162 ILE A O   1 
ATOM   1248  C  CB  . ILE A  1 187 ? 78.782  -1.218  -17.147  1.00 15.86  ? 162 ILE A CB  1 
ATOM   1249  C  CG1 . ILE A  1 187 ? 80.247  -1.586  -17.461  1.00 16.48  ? 162 ILE A CG1 1 
ATOM   1250  C  CG2 . ILE A  1 187 ? 77.935  -1.161  -18.419  1.00 14.85  ? 162 ILE A CG2 1 
ATOM   1251  C  CD1 . ILE A  1 187 ? 80.434  -3.009  -17.966  1.00 17.96  ? 162 ILE A CD1 1 
ATOM   1252  N  N   . ALA A  1 188 ? 76.530  0.323   -15.318  1.00 16.21  ? 163 ALA A N   1 
ATOM   1253  C  CA  . ALA A  1 188 ? 75.205  0.922   -15.102  1.00 17.24  ? 163 ALA A CA  1 
ATOM   1254  C  C   . ALA A  1 188 ? 75.269  2.456   -14.925  1.00 17.87  ? 163 ALA A C   1 
ATOM   1255  O  O   . ALA A  1 188 ? 74.373  3.168   -15.386  1.00 17.55  ? 163 ALA A O   1 
ATOM   1256  C  CB  . ALA A  1 188 ? 74.508  0.277   -13.908  1.00 16.30  ? 163 ALA A CB  1 
ATOM   1257  N  N   . CYS A  1 189 ? 76.329  2.939   -14.267  1.00 17.52  ? 164 CYS A N   1 
ATOM   1258  C  CA  . CYS A  1 189 ? 76.546  4.376   -14.037  1.00 18.08  ? 164 CYS A CA  1 
ATOM   1259  C  C   . CYS A  1 189 ? 77.035  5.113   -15.292  1.00 19.25  ? 164 CYS A C   1 
ATOM   1260  O  O   . CYS A  1 189 ? 77.149  6.344   -15.282  1.00 20.16  ? 164 CYS A O   1 
ATOM   1261  C  CB  . CYS A  1 189 ? 77.548  4.589   -12.892  1.00 18.02  ? 164 CYS A CB  1 
ATOM   1262  S  SG  . CYS A  1 189 ? 76.864  4.220   -11.259  1.00 18.42  ? 164 CYS A SG  1 
ATOM   1263  N  N   . GLY A  1 190 ? 77.337  4.358   -16.355  1.00 18.41  ? 165 GLY A N   1 
ATOM   1264  C  CA  . GLY A  1 190 ? 77.718  4.939   -17.652  1.00 17.73  ? 165 GLY A CA  1 
ATOM   1265  C  C   . GLY A  1 190 ? 79.220  5.061   -17.883  1.00 18.19  ? 165 GLY A C   1 
ATOM   1266  O  O   . GLY A  1 190 ? 79.658  5.804   -18.757  1.00 18.92  ? 165 GLY A O   1 
ATOM   1267  N  N   . ASN A  1 191 ? 80.003  4.340   -17.083  1.00 17.19  ? 166 ASN A N   1 
ATOM   1268  C  CA  . ASN A  1 191 ? 81.439  4.209   -17.280  1.00 16.52  ? 166 ASN A CA  1 
ATOM   1269  C  C   . ASN A  1 191 ? 81.741  3.058   -18.227  1.00 17.20  ? 166 ASN A C   1 
ATOM   1270  O  O   . ASN A  1 191 ? 80.887  2.173   -18.418  1.00 17.91  ? 166 ASN A O   1 
ATOM   1271  C  CB  . ASN A  1 191 ? 82.108  3.876   -15.950  1.00 15.88  ? 166 ASN A CB  1 
ATOM   1272  C  CG  . ASN A  1 191 ? 81.798  4.891   -14.877  1.00 15.03  ? 166 ASN A CG  1 
ATOM   1273  O  OD1 . ASN A  1 191 ? 82.348  6.003   -14.882  1.00 14.69  ? 166 ASN A OD1 1 
ATOM   1274  N  ND2 . ASN A  1 191 ? 80.905  4.525   -13.957  1.00 13.99  ? 166 ASN A ND2 1 
ATOM   1275  N  N   . ALA A  1 192 ? 82.937  3.070   -18.821  1.00 16.78  ? 167 ALA A N   1 
ATOM   1276  C  CA  . ALA A  1 192 ? 83.496  1.858   -19.414  1.00 17.27  ? 167 ALA A CA  1 
ATOM   1277  C  C   . ALA A  1 192 ? 84.342  1.165   -18.352  1.00 17.92  ? 167 ALA A C   1 
ATOM   1278  O  O   . ALA A  1 192 ? 84.777  1.802   -17.366  1.00 17.05  ? 167 ALA A O   1 
ATOM   1279  C  CB  . ALA A  1 192 ? 84.327  2.171   -20.654  1.00 17.10  ? 167 ALA A CB  1 
ATOM   1280  N  N   . PHE A  1 193 ? 84.584  -0.134  -18.553  1.00 18.53  ? 168 PHE A N   1 
ATOM   1281  C  CA  . PHE A  1 193 ? 85.204  -0.954  -17.522  1.00 18.51  ? 168 PHE A CA  1 
ATOM   1282  C  C   . PHE A  1 193 ? 86.205  -1.965  -18.043  1.00 18.44  ? 168 PHE A C   1 
ATOM   1283  O  O   . PHE A  1 193 ? 85.895  -2.735  -18.947  1.00 19.43  ? 168 PHE A O   1 
ATOM   1284  C  CB  . PHE A  1 193 ? 84.124  -1.689  -16.718  1.00 18.57  ? 168 PHE A CB  1 
ATOM   1285  C  CG  . PHE A  1 193 ? 84.615  -2.242  -15.407  1.00 19.27  ? 168 PHE A CG  1 
ATOM   1286  C  CD1 . PHE A  1 193 ? 84.743  -1.418  -14.293  1.00 19.14  ? 168 PHE A CD1 1 
ATOM   1287  C  CD2 . PHE A  1 193 ? 84.956  -3.591  -15.284  1.00 18.90  ? 168 PHE A CD2 1 
ATOM   1288  C  CE1 . PHE A  1 193 ? 85.175  -1.930  -13.077  1.00 18.52  ? 168 PHE A CE1 1 
ATOM   1289  C  CE2 . PHE A  1 193 ? 85.395  -4.106  -14.074  1.00 18.59  ? 168 PHE A CE2 1 
ATOM   1290  C  CZ  . PHE A  1 193 ? 85.496  -3.274  -12.969  1.00 18.24  ? 168 PHE A CZ  1 
ATOM   1291  N  N   . ILE A  1 194 ? 87.393  -1.966  -17.442  1.00 17.92  ? 169 ILE A N   1 
ATOM   1292  C  CA  . ILE A  1 194 ? 88.421  -2.942  -17.728  1.00 17.83  ? 169 ILE A CA  1 
ATOM   1293  C  C   . ILE A  1 194 ? 88.557  -3.891  -16.535  1.00 18.14  ? 169 ILE A C   1 
ATOM   1294  O  O   . ILE A  1 194 ? 88.920  -3.491  -15.417  1.00 16.94  ? 169 ILE A O   1 
ATOM   1295  C  CB  . ILE A  1 194 ? 89.771  -2.274  -18.044  1.00 19.52  ? 169 ILE A CB  1 
ATOM   1296  C  CG1 . ILE A  1 194 ? 89.649  -1.421  -19.308  1.00 20.93  ? 169 ILE A CG1 1 
ATOM   1297  C  CG2 . ILE A  1 194 ? 90.860  -3.319  -18.236  1.00 19.47  ? 169 ILE A CG2 1 
ATOM   1298  C  CD1 . ILE A  1 194 ? 90.663  -0.309  -19.355  1.00 22.20  ? 169 ILE A CD1 1 
ATOM   1299  N  N   . LEU A  1 195 ? 88.251  -5.156  -16.805  1.00 18.37  ? 170 LEU A N   1 
ATOM   1300  C  CA  . LEU A  1 195 ? 88.328  -6.217  -15.825  1.00 18.94  ? 170 LEU A CA  1 
ATOM   1301  C  C   . LEU A  1 195 ? 89.634  -6.986  -16.002  1.00 19.54  ? 170 LEU A C   1 
ATOM   1302  O  O   . LEU A  1 195 ? 89.933  -7.470  -17.101  1.00 20.62  ? 170 LEU A O   1 
ATOM   1303  C  CB  . LEU A  1 195 ? 87.136  -7.159  -16.012  1.00 18.61  ? 170 LEU A CB  1 
ATOM   1304  C  CG  . LEU A  1 195 ? 87.165  -8.456  -15.213  1.00 19.03  ? 170 LEU A CG  1 
ATOM   1305  C  CD1 . LEU A  1 195 ? 86.896  -8.191  -13.729  1.00 17.74  ? 170 LEU A CD1 1 
ATOM   1306  C  CD2 . LEU A  1 195 ? 86.172  -9.442  -15.826  1.00 18.70  ? 170 LEU A CD2 1 
ATOM   1307  N  N   . LYS A  1 196 ? 90.405  -7.105  -14.947  1.00 18.72  ? 171 LYS A N   1 
ATOM   1308  C  CA  . LYS A  1 196 ? 91.575  -7.917  -14.927  1.00 17.91  ? 171 LYS A CA  1 
ATOM   1309  C  C   . LYS A  1 196 ? 91.314  -9.025  -13.937  1.00 18.24  ? 171 LYS A C   1 
ATOM   1310  O  O   . LYS A  1 196 ? 91.587  -8.909  -12.794  1.00 17.91  ? 171 LYS A O   1 
ATOM   1311  C  CB  . LYS A  1 196 ? 92.764  -7.075  -14.510  1.00 17.01  ? 171 LYS A CB  1 
ATOM   1312  C  CG  . LYS A  1 196 ? 94.150  -7.579  -14.780  1.00 16.88  ? 171 LYS A CG  1 
ATOM   1313  C  CD  . LYS A  1 196 ? 94.463  -9.042  -14.480  1.00 16.67  ? 171 LYS A CD  1 
ATOM   1314  C  CE  . LYS A  1 196 ? 94.920  -9.308  -13.076  1.00 16.85  ? 171 LYS A CE  1 
ATOM   1315  N  NZ  . LYS A  1 196 ? 94.861  -10.745 -12.819  1.00 16.68  ? 171 LYS A NZ  1 
ATOM   1316  N  N   . PRO A  1 197 ? 90.838  -10.148 -14.426  1.00 19.40  ? 172 PRO A N   1 
ATOM   1317  C  CA  . PRO A  1 197 ? 90.509  -11.265 -13.540  1.00 19.49  ? 172 PRO A CA  1 
ATOM   1318  C  C   . PRO A  1 197 ? 91.714  -12.128 -13.178  1.00 19.39  ? 172 PRO A C   1 
ATOM   1319  O  O   . PRO A  1 197 ? 92.805  -11.977 -13.746  1.00 18.96  ? 172 PRO A O   1 
ATOM   1320  C  CB  . PRO A  1 197 ? 89.506  -12.075 -14.368  1.00 19.75  ? 172 PRO A CB  1 
ATOM   1321  C  CG  . PRO A  1 197 ? 89.893  -11.809 -15.797  1.00 20.48  ? 172 PRO A CG  1 
ATOM   1322  C  CD  . PRO A  1 197 ? 90.570  -10.464 -15.848  1.00 20.34  ? 172 PRO A CD  1 
ATOM   1323  N  N   . SER A  1 198 ? 91.501  -13.025 -12.224  1.00 18.95  ? 173 SER A N   1 
ATOM   1324  C  CA  . SER A  1 198 ? 92.509  -13.999 -11.833  1.00 18.77  ? 173 SER A CA  1 
ATOM   1325  C  C   . SER A  1 198 ? 92.890  -14.881 -13.003  1.00 19.47  ? 173 SER A C   1 
ATOM   1326  O  O   . SER A  1 198 ? 92.023  -15.426 -13.695  1.00 19.51  ? 173 SER A O   1 
ATOM   1327  C  CB  . SER A  1 198 ? 91.982  -14.879 -10.713  1.00 18.13  ? 173 SER A CB  1 
ATOM   1328  O  OG  . SER A  1 198 ? 92.820  -16.006 -10.553  1.00 19.19  ? 173 SER A OG  1 
ATOM   1329  N  N   . GLU A  1 199 ? 94.192  -15.043 -13.203  1.00 20.09  ? 174 GLU A N   1 
ATOM   1330  C  CA  . GLU A  1 199 ? 94.669  -15.873 -14.285  1.00 22.84  ? 174 GLU A CA  1 
ATOM   1331  C  C   . GLU A  1 199 ? 94.482  -17.368 -13.983  1.00 22.62  ? 174 GLU A C   1 
ATOM   1332  O  O   . GLU A  1 199 ? 94.704  -18.202 -14.855  1.00 23.43  ? 174 GLU A O   1 
ATOM   1333  C  CB  . GLU A  1 199 ? 96.122  -15.520 -14.671  1.00 24.40  ? 174 GLU A CB  1 
ATOM   1334  C  CG  . GLU A  1 199 ? 97.148  -15.667 -13.556  1.00 27.65  ? 174 GLU A CG  1 
ATOM   1335  C  CD  . GLU A  1 199 ? 97.213  -14.469 -12.613  1.00 31.28  ? 174 GLU A CD  1 
ATOM   1336  O  OE1 . GLU A  1 199 ? 98.344  -14.011 -12.328  1.00 32.39  ? 174 GLU A OE1 1 
ATOM   1337  O  OE2 . GLU A  1 199 ? 96.148  -13.990 -12.147  1.00 30.94  ? 174 GLU A OE2 1 
ATOM   1338  N  N   . ARG A  1 200 ? 94.054  -17.704 -12.767  1.00 21.23  ? 175 ARG A N   1 
ATOM   1339  C  CA  . ARG A  1 200 ? 93.859  -19.117 -12.400  1.00 21.69  ? 175 ARG A CA  1 
ATOM   1340  C  C   . ARG A  1 200 ? 92.673  -19.747 -13.129  1.00 21.40  ? 175 ARG A C   1 
ATOM   1341  O  O   . ARG A  1 200 ? 92.697  -20.933 -13.472  1.00 21.30  ? 175 ARG A O   1 
ATOM   1342  C  CB  . ARG A  1 200 ? 93.654  -19.298 -10.882  1.00 21.59  ? 175 ARG A CB  1 
ATOM   1343  C  CG  . ARG A  1 200 ? 94.802  -18.862 -9.976   1.00 22.00  ? 175 ARG A CG  1 
ATOM   1344  C  CD  . ARG A  1 200 ? 96.016  -19.769 -10.057  1.00 23.52  ? 175 ARG A CD  1 
ATOM   1345  N  NE  . ARG A  1 200 ? 96.872  -19.513 -11.222  1.00 25.90  ? 175 ARG A NE  1 
ATOM   1346  C  CZ  . ARG A  1 200 ? 97.772  -18.530 -11.313  1.00 27.19  ? 175 ARG A CZ  1 
ATOM   1347  N  NH1 . ARG A  1 200 ? 98.497  -18.408 -12.415  1.00 27.24  ? 175 ARG A NH1 1 
ATOM   1348  N  NH2 . ARG A  1 200 ? 97.936  -17.654 -10.320  1.00 27.87  ? 175 ARG A NH2 1 
ATOM   1349  N  N   . ASP A  1 201 ? 91.625  -18.951 -13.334  1.00 20.56  ? 176 ASP A N   1 
ATOM   1350  C  CA  . ASP A  1 201 ? 90.368  -19.463 -13.876  1.00 19.60  ? 176 ASP A CA  1 
ATOM   1351  C  C   . ASP A  1 201 ? 89.650  -18.400 -14.710  1.00 18.14  ? 176 ASP A C   1 
ATOM   1352  O  O   . ASP A  1 201 ? 88.640  -17.850 -14.284  1.00 17.79  ? 176 ASP A O   1 
ATOM   1353  C  CB  . ASP A  1 201 ? 89.465  -20.019 -12.762  1.00 19.34  ? 176 ASP A CB  1 
ATOM   1354  C  CG  . ASP A  1 201 ? 89.393  -19.121 -11.530  1.00 19.76  ? 176 ASP A CG  1 
ATOM   1355  O  OD1 . ASP A  1 201 ? 89.853  -17.951 -11.573  1.00 19.40  ? 176 ASP A OD1 1 
ATOM   1356  O  OD2 . ASP A  1 201 ? 88.864  -19.605 -10.496  1.00 20.48  ? 176 ASP A OD2 1 
ATOM   1357  N  N   . PRO A  1 202 ? 90.168  -18.126 -15.917  1.00 17.24  ? 177 PRO A N   1 
ATOM   1358  C  CA  . PRO A  1 202 ? 89.700  -16.982 -16.699  1.00 16.52  ? 177 PRO A CA  1 
ATOM   1359  C  C   . PRO A  1 202 ? 88.580  -17.229 -17.728  1.00 16.57  ? 177 PRO A C   1 
ATOM   1360  O  O   . PRO A  1 202 ? 88.214  -16.289 -18.431  1.00 16.70  ? 177 PRO A O   1 
ATOM   1361  C  CB  . PRO A  1 202 ? 90.979  -16.498 -17.400  1.00 16.92  ? 177 PRO A CB  1 
ATOM   1362  C  CG  . PRO A  1 202 ? 92.009  -17.601 -17.214  1.00 17.67  ? 177 PRO A CG  1 
ATOM   1363  C  CD  . PRO A  1 202 ? 91.339  -18.763 -16.539  1.00 17.27  ? 177 PRO A CD  1 
ATOM   1364  N  N   . SER A  1 203 ? 88.034  -18.450 -17.825  1.00 16.49  ? 178 SER A N   1 
ATOM   1365  C  CA  . SER A  1 203 ? 86.991  -18.745 -18.845  1.00 16.95  ? 178 SER A CA  1 
ATOM   1366  C  C   . SER A  1 203 ? 85.668  -18.009 -18.590  1.00 16.51  ? 178 SER A C   1 
ATOM   1367  O  O   . SER A  1 203 ? 85.030  -17.498 -19.510  1.00 15.60  ? 178 SER A O   1 
ATOM   1368  C  CB  . SER A  1 203 ? 86.723  -20.257 -18.966  1.00 17.52  ? 178 SER A CB  1 
ATOM   1369  O  OG  . SER A  1 203 ? 87.856  -20.931 -19.505  1.00 17.74  ? 178 SER A OG  1 
ATOM   1370  N  N   . VAL A  1 204 ? 85.254  -17.969 -17.332  1.00 16.60  ? 179 VAL A N   1 
ATOM   1371  C  CA  . VAL A  1 204 ? 83.999  -17.300 -17.017  1.00 17.49  ? 179 VAL A CA  1 
ATOM   1372  C  C   . VAL A  1 204 ? 84.039  -15.786 -17.359  1.00 18.16  ? 179 VAL A C   1 
ATOM   1373  O  O   . VAL A  1 204 ? 83.146  -15.310 -18.065  1.00 18.30  ? 179 VAL A O   1 
ATOM   1374  C  CB  . VAL A  1 204 ? 83.485  -17.628 -15.574  1.00 16.86  ? 179 VAL A CB  1 
ATOM   1375  C  CG1 . VAL A  1 204 ? 82.323  -16.726 -15.180  1.00 16.52  ? 179 VAL A CG1 1 
ATOM   1376  C  CG2 . VAL A  1 204 ? 83.056  -19.091 -15.485  1.00 16.41  ? 179 VAL A CG2 1 
ATOM   1377  N  N   . PRO A  1 205 ? 85.068  -15.034 -16.888  1.00 18.62  ? 180 PRO A N   1 
ATOM   1378  C  CA  . PRO A  1 205 ? 85.054  -13.598 -17.183  1.00 18.73  ? 180 PRO A CA  1 
ATOM   1379  C  C   . PRO A  1 205 ? 84.951  -13.250 -18.668  1.00 19.21  ? 180 PRO A C   1 
ATOM   1380  O  O   . PRO A  1 205 ? 84.199  -12.335 -19.013  1.00 18.61  ? 180 PRO A O   1 
ATOM   1381  C  CB  . PRO A  1 205 ? 86.369  -13.115 -16.585  1.00 19.68  ? 180 PRO A CB  1 
ATOM   1382  C  CG  . PRO A  1 205 ? 86.526  -13.980 -15.374  1.00 19.82  ? 180 PRO A CG  1 
ATOM   1383  C  CD  . PRO A  1 205 ? 85.992  -15.336 -15.774  1.00 19.73  ? 180 PRO A CD  1 
ATOM   1384  N  N   . ILE A  1 206 ? 85.679  -13.967 -19.534  1.00 19.09  ? 181 ILE A N   1 
ATOM   1385  C  CA  . ILE A  1 206 ? 85.551  -13.739 -20.976  1.00 19.65  ? 181 ILE A CA  1 
ATOM   1386  C  C   . ILE A  1 206 ? 84.129  -14.036 -21.469  1.00 18.30  ? 181 ILE A C   1 
ATOM   1387  O  O   . ILE A  1 206 ? 83.550  -13.243 -22.211  1.00 17.73  ? 181 ILE A O   1 
ATOM   1388  C  CB  . ILE A  1 206 ? 86.580  -14.536 -21.813  1.00 21.76  ? 181 ILE A CB  1 
ATOM   1389  C  CG1 . ILE A  1 206 ? 87.990  -13.983 -21.584  1.00 23.45  ? 181 ILE A CG1 1 
ATOM   1390  C  CG2 . ILE A  1 206 ? 86.231  -14.457 -23.303  1.00 22.11  ? 181 ILE A CG2 1 
ATOM   1391  C  CD1 . ILE A  1 206 ? 89.092  -14.905 -22.066  1.00 24.87  ? 181 ILE A CD1 1 
ATOM   1392  N  N   . ARG A  1 207 ? 83.584  -15.177 -21.057  1.00 17.44  ? 182 ARG A N   1 
ATOM   1393  C  CA  . ARG A  1 207 ? 82.228  -15.551 -21.432  1.00 18.73  ? 182 ARG A CA  1 
ATOM   1394  C  C   . ARG A  1 207 ? 81.192  -14.522 -20.965  1.00 19.16  ? 182 ARG A C   1 
ATOM   1395  O  O   . ARG A  1 207 ? 80.233  -14.240 -21.690  1.00 18.77  ? 182 ARG A O   1 
ATOM   1396  C  CB  . ARG A  1 207 ? 81.897  -16.960 -20.903  1.00 19.49  ? 182 ARG A CB  1 
ATOM   1397  C  CG  . ARG A  1 207 ? 80.573  -17.548 -21.382  1.00 20.54  ? 182 ARG A CG  1 
ATOM   1398  C  CD  . ARG A  1 207 ? 80.444  -17.611 -22.898  1.00 22.11  ? 182 ARG A CD  1 
ATOM   1399  N  NE  . ARG A  1 207 ? 79.128  -18.143 -23.250  1.00 22.75  ? 182 ARG A NE  1 
ATOM   1400  C  CZ  . ARG A  1 207 ? 78.397  -17.755 -24.289  1.00 21.88  ? 182 ARG A CZ  1 
ATOM   1401  N  NH1 . ARG A  1 207 ? 77.214  -18.309 -24.511  1.00 21.78  ? 182 ARG A NH1 1 
ATOM   1402  N  NH2 . ARG A  1 207 ? 78.833  -16.816 -25.102  1.00 22.19  ? 182 ARG A NH2 1 
ATOM   1403  N  N   . LEU A  1 208 ? 81.392  -13.959 -19.762  1.00 19.95  ? 183 LEU A N   1 
ATOM   1404  C  CA  . LEU A  1 208 ? 80.536  -12.865 -19.260  1.00 19.77  ? 183 LEU A CA  1 
ATOM   1405  C  C   . LEU A  1 208 ? 80.546  -11.633 -20.171  1.00 20.47  ? 183 LEU A C   1 
ATOM   1406  O  O   . LEU A  1 208 ? 79.480  -11.028 -20.416  1.00 20.86  ? 183 LEU A O   1 
ATOM   1407  C  CB  . LEU A  1 208 ? 80.914  -12.453 -17.829  1.00 18.73  ? 183 LEU A CB  1 
ATOM   1408  C  CG  . LEU A  1 208 ? 80.758  -13.514 -16.724  1.00 18.17  ? 183 LEU A CG  1 
ATOM   1409  C  CD1 . LEU A  1 208 ? 81.086  -12.907 -15.366  1.00 18.13  ? 183 LEU A CD1 1 
ATOM   1410  C  CD2 . LEU A  1 208 ? 79.367  -14.153 -16.720  1.00 17.12  ? 183 LEU A CD2 1 
ATOM   1411  N  N   . ALA A  1 209 ? 81.735  -11.258 -20.657  1.00 18.51  ? 184 ALA A N   1 
ATOM   1412  C  CA  . ALA A  1 209 ? 81.867  -10.072 -21.493  1.00 19.13  ? 184 ALA A CA  1 
ATOM   1413  C  C   . ALA A  1 209 ? 81.246  -10.332 -22.881  1.00 19.42  ? 184 ALA A C   1 
ATOM   1414  O  O   . ALA A  1 209 ? 80.631  -9.448  -23.491  1.00 18.99  ? 184 ALA A O   1 
ATOM   1415  C  CB  . ALA A  1 209 ? 83.331  -9.657  -21.614  1.00 18.71  ? 184 ALA A CB  1 
ATOM   1416  N  N   . GLU A  1 210 ? 81.412  -11.560 -23.358  1.00 19.33  ? 185 GLU A N   1 
ATOM   1417  C  CA  . GLU A  1 210 ? 80.749  -12.033 -24.577  1.00 21.02  ? 185 GLU A CA  1 
ATOM   1418  C  C   . GLU A  1 210 ? 79.222  -11.962 -24.436  1.00 20.27  ? 185 GLU A C   1 
ATOM   1419  O  O   . GLU A  1 210 ? 78.522  -11.539 -25.372  1.00 19.89  ? 185 GLU A O   1 
ATOM   1420  C  CB  . GLU A  1 210 ? 81.166  -13.475 -24.841  1.00 22.59  ? 185 GLU A CB  1 
ATOM   1421  C  CG  . GLU A  1 210 ? 81.087  -13.916 -26.279  1.00 25.52  ? 185 GLU A CG  1 
ATOM   1422  C  CD  . GLU A  1 210 ? 81.830  -15.227 -26.501  1.00 28.55  ? 185 GLU A CD  1 
ATOM   1423  O  OE1 . GLU A  1 210 ? 81.628  -16.172 -25.711  1.00 26.59  ? 185 GLU A OE1 1 
ATOM   1424  O  OE2 . GLU A  1 210 ? 82.629  -15.315 -27.462  1.00 31.79  ? 185 GLU A OE2 1 
ATOM   1425  N  N   . LEU A  1 211 ? 78.714  -12.374 -23.270  1.00 19.41  ? 186 LEU A N   1 
ATOM   1426  C  CA  . LEU A  1 211 ? 77.278  -12.352 -23.015  1.00 19.45  ? 186 LEU A CA  1 
ATOM   1427  C  C   . LEU A  1 211 ? 76.767  -10.912 -22.885  1.00 19.71  ? 186 LEU A C   1 
ATOM   1428  O  O   . LEU A  1 211 ? 75.607  -10.643 -23.219  1.00 20.17  ? 186 LEU A O   1 
ATOM   1429  C  CB  . LEU A  1 211 ? 76.896  -13.204 -21.785  1.00 18.87  ? 186 LEU A CB  1 
ATOM   1430  C  CG  . LEU A  1 211 ? 76.938  -14.743 -21.914  1.00 19.54  ? 186 LEU A CG  1 
ATOM   1431  C  CD1 . LEU A  1 211 ? 76.767  -15.440 -20.566  1.00 19.30  ? 186 LEU A CD1 1 
ATOM   1432  C  CD2 . LEU A  1 211 ? 75.931  -15.307 -22.925  1.00 18.81  ? 186 LEU A CD2 1 
HETATM 1433  N  N   . MSE A  1 212 ? 77.620  -9.995  -22.418  1.00 19.54  ? 187 MSE A N   1 
HETATM 1434  C  CA  . MSE A  1 212 ? 77.212  -8.582  -22.288  1.00 19.88  ? 187 MSE A CA  1 
HETATM 1435  C  C   . MSE A  1 212 ? 76.963  -8.050  -23.675  1.00 19.28  ? 187 MSE A C   1 
HETATM 1436  O  O   . MSE A  1 212 ? 75.962  -7.382  -23.897  1.00 19.01  ? 187 MSE A O   1 
HETATM 1437  C  CB  . MSE A  1 212 ? 78.186  -7.688  -21.523  1.00 21.01  ? 187 MSE A CB  1 
HETATM 1438  C  CG  . MSE A  1 212 ? 78.041  -7.813  -19.996  1.00 25.38  ? 187 MSE A CG  1 
HETATM 1439  SE SE  . MSE A  1 212 ? 76.330  -7.112  -19.245  1.00 31.95  ? 187 MSE A SE  1 
HETATM 1440  C  CE  . MSE A  1 212 ? 76.911  -5.228  -19.022  1.00 27.66  ? 187 MSE A CE  1 
ATOM   1441  N  N   . ILE A  1 213 ? 77.862  -8.349  -24.618  1.00 19.11  ? 188 ILE A N   1 
ATOM   1442  C  CA  . ILE A  1 213 ? 77.655  -8.013  -26.039  1.00 19.81  ? 188 ILE A CA  1 
ATOM   1443  C  C   . ILE A  1 213 ? 76.304  -8.552  -26.550  1.00 20.62  ? 188 ILE A C   1 
ATOM   1444  O  O   . ILE A  1 213 ? 75.523  -7.810  -27.148  1.00 21.15  ? 188 ILE A O   1 
ATOM   1445  C  CB  . ILE A  1 213 ? 78.811  -8.549  -26.932  1.00 20.78  ? 188 ILE A CB  1 
ATOM   1446  C  CG1 . ILE A  1 213 ? 80.128  -7.837  -26.583  1.00 20.47  ? 188 ILE A CG1 1 
ATOM   1447  C  CG2 . ILE A  1 213 ? 78.474  -8.444  -28.435  1.00 19.64  ? 188 ILE A CG2 1 
ATOM   1448  C  CD1 . ILE A  1 213 ? 80.054  -6.319  -26.631  1.00 20.17  ? 188 ILE A CD1 1 
ATOM   1449  N  N   . GLU A  1 214 ? 76.031  -9.833  -26.293  1.00 20.51  ? 189 GLU A N   1 
ATOM   1450  C  CA  . GLU A  1 214 ? 74.770  -10.455 -26.689  1.00 21.55  ? 189 GLU A CA  1 
ATOM   1451  C  C   . GLU A  1 214 ? 73.558  -9.776  -26.047  1.00 20.38  ? 189 GLU A C   1 
ATOM   1452  O  O   . GLU A  1 214 ? 72.493  -9.706  -26.656  1.00 19.55  ? 189 GLU A O   1 
ATOM   1453  C  CB  . GLU A  1 214 ? 74.780  -11.944 -26.354  1.00 23.80  ? 189 GLU A CB  1 
ATOM   1454  C  CG  . GLU A  1 214 ? 73.718  -12.728 -27.105  1.00 27.42  ? 189 GLU A CG  1 
ATOM   1455  C  CD  . GLU A  1 214 ? 73.770  -14.227 -26.821  1.00 33.08  ? 189 GLU A CD  1 
ATOM   1456  O  OE1 . GLU A  1 214 ? 74.882  -14.779 -26.599  1.00 33.62  ? 189 GLU A OE1 1 
ATOM   1457  O  OE2 . GLU A  1 214 ? 72.687  -14.856 -26.835  1.00 34.82  ? 189 GLU A OE2 1 
ATOM   1458  N  N   . ALA A  1 215 ? 73.738  -9.270  -24.826  1.00 19.88  ? 190 ALA A N   1 
ATOM   1459  C  CA  . ALA A  1 215 ? 72.712  -8.467  -24.129  1.00 19.31  ? 190 ALA A CA  1 
ATOM   1460  C  C   . ALA A  1 215 ? 72.494  -7.039  -24.688  1.00 19.51  ? 190 ALA A C   1 
ATOM   1461  O  O   . ALA A  1 215 ? 71.564  -6.335  -24.261  1.00 18.83  ? 190 ALA A O   1 
ATOM   1462  C  CB  . ALA A  1 215 ? 73.009  -8.408  -22.631  1.00 18.83  ? 190 ALA A CB  1 
ATOM   1463  N  N   . GLY A  1 216 ? 73.338  -6.609  -25.624  1.00 19.45  ? 191 GLY A N   1 
ATOM   1464  C  CA  . GLY A  1 216 ? 73.198  -5.261  -26.198  1.00 19.05  ? 191 GLY A CA  1 
ATOM   1465  C  C   . GLY A  1 216 ? 74.175  -4.210  -25.688  1.00 18.47  ? 191 GLY A C   1 
ATOM   1466  O  O   . GLY A  1 216 ? 74.028  -3.034  -25.992  1.00 18.35  ? 191 GLY A O   1 
ATOM   1467  N  N   . LEU A  1 217 ? 75.191  -4.616  -24.933  1.00 18.45  ? 192 LEU A N   1 
ATOM   1468  C  CA  . LEU A  1 217 ? 76.224  -3.662  -24.484  1.00 17.75  ? 192 LEU A CA  1 
ATOM   1469  C  C   . LEU A  1 217 ? 77.111  -3.275  -25.672  1.00 18.44  ? 192 LEU A C   1 
ATOM   1470  O  O   . LEU A  1 217 ? 77.577  -4.162  -26.395  1.00 18.73  ? 192 LEU A O   1 
ATOM   1471  C  CB  . LEU A  1 217 ? 77.086  -4.277  -23.385  1.00 16.85  ? 192 LEU A CB  1 
ATOM   1472  C  CG  . LEU A  1 217 ? 78.021  -3.293  -22.648  1.00 16.49  ? 192 LEU A CG  1 
ATOM   1473  C  CD1 . LEU A  1 217 ? 77.232  -2.397  -21.678  1.00 15.02  ? 192 LEU A CD1 1 
ATOM   1474  C  CD2 . LEU A  1 217 ? 79.132  -4.046  -21.925  1.00 15.97  ? 192 LEU A CD2 1 
ATOM   1475  N  N   . PRO A  1 218 ? 77.354  -1.963  -25.880  1.00 17.98  ? 193 PRO A N   1 
ATOM   1476  C  CA  . PRO A  1 218 ? 78.265  -1.537  -26.934  1.00 17.68  ? 193 PRO A CA  1 
ATOM   1477  C  C   . PRO A  1 218 ? 79.649  -2.160  -26.773  1.00 17.04  ? 193 PRO A C   1 
ATOM   1478  O  O   . PRO A  1 218 ? 80.092  -2.413  -25.638  1.00 16.04  ? 193 PRO A O   1 
ATOM   1479  C  CB  . PRO A  1 218 ? 78.362  -0.010  -26.722  1.00 17.94  ? 193 PRO A CB  1 
ATOM   1480  C  CG  . PRO A  1 218 ? 77.075  0.341   -26.063  1.00 17.89  ? 193 PRO A CG  1 
ATOM   1481  C  CD  . PRO A  1 218 ? 76.829  -0.809  -25.128  1.00 18.15  ? 193 PRO A CD  1 
ATOM   1482  N  N   . ALA A  1 219 ? 80.309  -2.426  -27.904  1.00 16.92  ? 194 ALA A N   1 
ATOM   1483  C  CA  . ALA A  1 219 ? 81.696  -2.909  -27.909  1.00 18.15  ? 194 ALA A CA  1 
ATOM   1484  C  C   . ALA A  1 219 ? 82.605  -1.892  -27.186  1.00 18.89  ? 194 ALA A C   1 
ATOM   1485  O  O   . ALA A  1 219 ? 82.404  -0.674  -27.308  1.00 19.98  ? 194 ALA A O   1 
ATOM   1486  C  CB  . ALA A  1 219 ? 82.179  -3.147  -29.357  1.00 17.76  ? 194 ALA A CB  1 
ATOM   1487  N  N   . GLY A  1 220 ? 83.589  -2.387  -26.437  1.00 18.32  ? 195 GLY A N   1 
ATOM   1488  C  CA  . GLY A  1 220 ? 84.524  -1.510  -25.720  1.00 17.85  ? 195 GLY A CA  1 
ATOM   1489  C  C   . GLY A  1 220 ? 84.105  -1.023  -24.336  1.00 18.31  ? 195 GLY A C   1 
ATOM   1490  O  O   . GLY A  1 220 ? 84.911  -0.410  -23.636  1.00 19.68  ? 195 GLY A O   1 
ATOM   1491  N  N   . ILE A  1 221 ? 82.862  -1.283  -23.928  1.00 16.95  ? 196 ILE A N   1 
ATOM   1492  C  CA  . ILE A  1 221 ? 82.383  -0.842  -22.609  1.00 16.75  ? 196 ILE A CA  1 
ATOM   1493  C  C   . ILE A  1 221 ? 82.753  -1.821  -21.474  1.00 16.48  ? 196 ILE A C   1 
ATOM   1494  O  O   . ILE A  1 221 ? 83.001  -1.397  -20.331  1.00 15.17  ? 196 ILE A O   1 
ATOM   1495  C  CB  . ILE A  1 221 ? 80.862  -0.549  -22.640  1.00 17.02  ? 196 ILE A CB  1 
ATOM   1496  C  CG1 . ILE A  1 221 ? 80.566  0.615   -23.614  1.00 17.38  ? 196 ILE A CG1 1 
ATOM   1497  C  CG2 . ILE A  1 221 ? 80.295  -0.323  -21.229  1.00 16.49  ? 196 ILE A CG2 1 
ATOM   1498  C  CD1 . ILE A  1 221 ? 81.282  1.915   -23.281  1.00 17.74  ? 196 ILE A CD1 1 
ATOM   1499  N  N   . LEU A  1 222 ? 82.771  -3.124  -21.792  1.00 16.52  ? 197 LEU A N   1 
ATOM   1500  C  CA  . LEU A  1 222 ? 83.377  -4.126  -20.908  1.00 16.42  ? 197 LEU A CA  1 
ATOM   1501  C  C   . LEU A  1 222 ? 84.457  -4.901  -21.649  1.00 16.91  ? 197 LEU A C   1 
ATOM   1502  O  O   . LEU A  1 222 ? 84.164  -5.821  -22.447  1.00 16.24  ? 197 LEU A O   1 
ATOM   1503  C  CB  . LEU A  1 222 ? 82.333  -5.104  -20.339  1.00 16.57  ? 197 LEU A CB  1 
ATOM   1504  C  CG  . LEU A  1 222 ? 82.844  -6.280  -19.489  1.00 17.00  ? 197 LEU A CG  1 
ATOM   1505  C  CD1 . LEU A  1 222 ? 83.521  -5.787  -18.219  1.00 16.59  ? 197 LEU A CD1 1 
ATOM   1506  C  CD2 . LEU A  1 222 ? 81.693  -7.218  -19.139  1.00 17.70  ? 197 LEU A CD2 1 
ATOM   1507  N  N   . ASN A  1 223 ? 85.703  -4.530  -21.369  1.00 17.28  ? 198 ASN A N   1 
ATOM   1508  C  CA  . ASN A  1 223 ? 86.862  -5.267  -21.849  1.00 17.22  ? 198 ASN A CA  1 
ATOM   1509  C  C   . ASN A  1 223 ? 87.461  -6.120  -20.744  1.00 16.80  ? 198 ASN A C   1 
ATOM   1510  O  O   . ASN A  1 223 ? 87.483  -5.708  -19.588  1.00 16.55  ? 198 ASN A O   1 
ATOM   1511  C  CB  . ASN A  1 223 ? 87.920  -4.305  -22.399  1.00 17.93  ? 198 ASN A CB  1 
ATOM   1512  C  CG  . ASN A  1 223 ? 87.480  -3.621  -23.691  1.00 18.42  ? 198 ASN A CG  1 
ATOM   1513  O  OD1 . ASN A  1 223 ? 86.753  -4.201  -24.504  1.00 19.75  ? 198 ASN A OD1 1 
ATOM   1514  N  ND2 . ASN A  1 223 ? 87.926  -2.390  -23.887  1.00 18.21  ? 198 ASN A ND2 1 
ATOM   1515  N  N   . VAL A  1 224 ? 87.933  -7.313  -21.109  1.00 16.85  ? 199 VAL A N   1 
ATOM   1516  C  CA  . VAL A  1 224 ? 88.631  -8.197  -20.193  1.00 17.13  ? 199 VAL A CA  1 
ATOM   1517  C  C   . VAL A  1 224 ? 90.087  -8.289  -20.630  1.00 17.78  ? 199 VAL A C   1 
ATOM   1518  O  O   . VAL A  1 224 ? 90.395  -8.649  -21.766  1.00 17.38  ? 199 VAL A O   1 
ATOM   1519  C  CB  . VAL A  1 224 ? 88.007  -9.621  -20.154  1.00 17.88  ? 199 VAL A CB  1 
ATOM   1520  C  CG1 . VAL A  1 224 ? 88.794  -10.535 -19.213  1.00 17.93  ? 199 VAL A CG1 1 
ATOM   1521  C  CG2 . VAL A  1 224 ? 86.540  -9.563  -19.747  1.00 17.11  ? 199 VAL A CG2 1 
ATOM   1522  N  N   . VAL A  1 225 ? 90.981  -7.955  -19.709  1.00 18.18  ? 200 VAL A N   1 
ATOM   1523  C  CA  . VAL A  1 225 ? 92.408  -7.991  -19.964  1.00 17.85  ? 200 VAL A CA  1 
ATOM   1524  C  C   . VAL A  1 225 ? 93.034  -8.980  -18.978  1.00 18.17  ? 200 VAL A C   1 
ATOM   1525  O  O   . VAL A  1 225 ? 93.228  -8.671  -17.791  1.00 18.14  ? 200 VAL A O   1 
ATOM   1526  C  CB  . VAL A  1 225 ? 93.016  -6.581  -19.801  1.00 17.87  ? 200 VAL A CB  1 
ATOM   1527  C  CG1 . VAL A  1 225 ? 94.522  -6.599  -20.033  1.00 17.87  ? 200 VAL A CG1 1 
ATOM   1528  C  CG2 . VAL A  1 225 ? 92.316  -5.594  -20.742  1.00 17.46  ? 200 VAL A CG2 1 
ATOM   1529  N  N   . ASN A  1 226 ? 93.320  -10.179 -19.460  1.00 17.42  ? 201 ASN A N   1 
ATOM   1530  C  CA  . ASN A  1 226 ? 94.008  -11.148 -18.638  1.00 17.98  ? 201 ASN A CA  1 
ATOM   1531  C  C   . ASN A  1 226 ? 95.476  -10.806 -18.439  1.00 19.76  ? 201 ASN A C   1 
ATOM   1532  O  O   . ASN A  1 226 ? 96.085  -10.133 -19.287  1.00 20.47  ? 201 ASN A O   1 
ATOM   1533  C  CB  . ASN A  1 226 ? 93.817  -12.551 -19.204  1.00 17.32  ? 201 ASN A CB  1 
ATOM   1534  C  CG  . ASN A  1 226 ? 92.411  -13.050 -18.971  1.00 17.12  ? 201 ASN A CG  1 
ATOM   1535  O  OD1 . ASN A  1 226 ? 91.987  -13.189 -17.817  1.00 17.17  ? 201 ASN A OD1 1 
ATOM   1536  N  ND2 . ASN A  1 226 ? 91.666  -13.292 -20.058  1.00 16.57  ? 201 ASN A ND2 1 
ATOM   1537  N  N   . GLY A  1 227 ? 96.022  -11.247 -17.306  1.00 20.40  ? 202 GLY A N   1 
ATOM   1538  C  CA  . GLY A  1 227 ? 97.408  -10.963 -16.945  1.00 21.04  ? 202 GLY A CA  1 
ATOM   1539  C  C   . GLY A  1 227 ? 97.734  -11.181 -15.472  1.00 20.99  ? 202 GLY A C   1 
ATOM   1540  O  O   . GLY A  1 227 ? 96.889  -11.572 -14.676  1.00 19.66  ? 202 GLY A O   1 
ATOM   1541  N  N   . ASP A  1 228 ? 98.991  -10.940 -15.128  1.00 23.44  ? 203 ASP A N   1 
ATOM   1542  C  CA  . ASP A  1 228 ? 99.456  -11.012 -13.745  1.00 25.07  ? 203 ASP A CA  1 
ATOM   1543  C  C   . ASP A  1 228 ? 99.762  -9.595  -13.213  1.00 23.12  ? 203 ASP A C   1 
ATOM   1544  O  O   . ASP A  1 228 ? 99.124  -8.616  -13.623  1.00 20.98  ? 203 ASP A O   1 
ATOM   1545  C  CB  . ASP A  1 228 ? 100.675 -11.957 -13.646  1.00 27.45  ? 203 ASP A CB  1 
ATOM   1546  C  CG  . ASP A  1 228 ? 101.870 -11.496 -14.490  1.00 29.57  ? 203 ASP A CG  1 
ATOM   1547  O  OD1 . ASP A  1 228 ? 101.842 -10.388 -15.075  1.00 30.66  ? 203 ASP A OD1 1 
ATOM   1548  O  OD2 . ASP A  1 228 ? 102.857 -12.254 -14.562  1.00 31.70  ? 203 ASP A OD2 1 
ATOM   1549  N  N   . LYS A  1 229 ? 100.739 -9.509  -12.315  1.00 23.81  ? 204 LYS A N   1 
ATOM   1550  C  CA  . LYS A  1 229 ? 101.229 -8.252  -11.764  1.00 25.47  ? 204 LYS A CA  1 
ATOM   1551  C  C   . LYS A  1 229 ? 101.557 -7.185  -12.818  1.00 23.63  ? 204 LYS A C   1 
ATOM   1552  O  O   . LYS A  1 229 ? 101.318 -5.997  -12.580  1.00 22.70  ? 204 LYS A O   1 
ATOM   1553  C  CB  . LYS A  1 229 ? 102.466 -8.512  -10.892  1.00 31.18  ? 204 LYS A CB  1 
ATOM   1554  C  CG  . LYS A  1 229 ? 103.111 -7.247  -10.358  1.00 37.13  ? 204 LYS A CG  1 
ATOM   1555  C  CD  . LYS A  1 229 ? 104.143 -7.544  -9.287   1.00 45.78  ? 204 LYS A CD  1 
ATOM   1556  C  CE  . LYS A  1 229 ? 104.115 -6.474  -8.198   1.00 51.26  ? 204 LYS A CE  1 
ATOM   1557  N  NZ  . LYS A  1 229 ? 104.091 -5.082  -8.736   1.00 53.09  ? 204 LYS A NZ  1 
ATOM   1558  N  N   . GLY A  1 230 ? 102.134 -7.603  -13.957  1.00 22.68  ? 205 GLY A N   1 
ATOM   1559  C  CA  . GLY A  1 230 ? 102.428 -6.691  -15.061  1.00 21.15  ? 205 GLY A CA  1 
ATOM   1560  C  C   . GLY A  1 230 ? 101.195 -5.914  -15.520  1.00 21.32  ? 205 GLY A C   1 
ATOM   1561  O  O   . GLY A  1 230 ? 101.227 -4.674  -15.589  1.00 20.39  ? 205 GLY A O   1 
ATOM   1562  N  N   . ALA A  1 231 ? 100.101 -6.634  -15.813  1.00 21.36  ? 206 ALA A N   1 
ATOM   1563  C  CA  . ALA A  1 231 ? 98.836  -6.002  -16.227  1.00 21.10  ? 206 ALA A CA  1 
ATOM   1564  C  C   . ALA A  1 231 ? 98.269  -5.074  -15.132  1.00 22.26  ? 206 ALA A C   1 
ATOM   1565  O  O   . ALA A  1 231 ? 97.779  -3.960  -15.430  1.00 22.79  ? 206 ALA A O   1 
ATOM   1566  C  CB  . ALA A  1 231 ? 97.809  -7.053  -16.629  1.00 20.12  ? 206 ALA A CB  1 
ATOM   1567  N  N   . VAL A  1 232 ? 98.343  -5.534  -13.877  1.00 21.67  ? 207 VAL A N   1 
ATOM   1568  C  CA  . VAL A  1 232 ? 97.895  -4.746  -12.720  1.00 21.61  ? 207 VAL A CA  1 
ATOM   1569  C  C   . VAL A  1 232 ? 98.676  -3.431  -12.606  1.00 21.76  ? 207 VAL A C   1 
ATOM   1570  O  O   . VAL A  1 232 ? 98.065  -2.368  -12.449  1.00 21.54  ? 207 VAL A O   1 
ATOM   1571  C  CB  . VAL A  1 232 ? 97.945  -5.550  -11.390  1.00 21.56  ? 207 VAL A CB  1 
ATOM   1572  C  CG1 . VAL A  1 232 ? 97.688  -4.641  -10.182  1.00 20.90  ? 207 VAL A CG1 1 
ATOM   1573  C  CG2 . VAL A  1 232 ? 96.933  -6.694  -11.411  1.00 20.72  ? 207 VAL A CG2 1 
ATOM   1574  N  N   . ASP A  1 233 ? 100.007 -3.498  -12.692  1.00 22.25  ? 208 ASP A N   1 
ATOM   1575  C  CA  . ASP A  1 233 ? 100.829 -2.279  -12.648  1.00 24.32  ? 208 ASP A CA  1 
ATOM   1576  C  C   . ASP A  1 233 ? 100.499 -1.333  -13.806  1.00 22.57  ? 208 ASP A C   1 
ATOM   1577  O  O   . ASP A  1 233 ? 100.438 -0.116  -13.605  1.00 21.94  ? 208 ASP A O   1 
ATOM   1578  C  CB  . ASP A  1 233 ? 102.334 -2.598  -12.630  1.00 28.07  ? 208 ASP A CB  1 
ATOM   1579  C  CG  . ASP A  1 233 ? 102.808 -3.134  -11.281  1.00 34.89  ? 208 ASP A CG  1 
ATOM   1580  O  OD1 . ASP A  1 233 ? 102.177 -2.842  -10.244  1.00 39.24  ? 208 ASP A OD1 1 
ATOM   1581  O  OD2 . ASP A  1 233 ? 103.824 -3.854  -11.245  1.00 39.38  ? 208 ASP A OD2 1 
ATOM   1582  N  N   . ALA A  1 234 ? 100.284 -1.893  -15.005  1.00 21.19  ? 209 ALA A N   1 
ATOM   1583  C  CA  . ALA A  1 234 ? 99.901  -1.086  -16.164  1.00 20.97  ? 209 ALA A CA  1 
ATOM   1584  C  C   . ALA A  1 234 ? 98.582  -0.343  -15.925  1.00 20.81  ? 209 ALA A C   1 
ATOM   1585  O  O   . ALA A  1 234 ? 98.439  0.811   -16.313  1.00 21.82  ? 209 ALA A O   1 
ATOM   1586  C  CB  . ALA A  1 234 ? 99.817  -1.938  -17.426  1.00 20.41  ? 209 ALA A CB  1 
ATOM   1587  N  N   . ILE A  1 235 ? 97.619  -1.012  -15.299  1.00 19.83  ? 210 ILE A N   1 
ATOM   1588  C  CA  . ILE A  1 235 ? 96.326  -0.390  -14.973  1.00 19.10  ? 210 ILE A CA  1 
ATOM   1589  C  C   . ILE A  1 235 ? 96.516  0.777   -13.989  1.00 19.87  ? 210 ILE A C   1 
ATOM   1590  O  O   . ILE A  1 235 ? 95.975  1.882   -14.202  1.00 19.47  ? 210 ILE A O   1 
ATOM   1591  C  CB  . ILE A  1 235 ? 95.341  -1.415  -14.371  1.00 18.03  ? 210 ILE A CB  1 
ATOM   1592  C  CG1 . ILE A  1 235 ? 94.756  -2.333  -15.457  1.00 17.60  ? 210 ILE A CG1 1 
ATOM   1593  C  CG2 . ILE A  1 235 ? 94.244  -0.713  -13.572  1.00 17.66  ? 210 ILE A CG2 1 
ATOM   1594  C  CD1 . ILE A  1 235 ? 94.121  -3.601  -14.912  1.00 17.46  ? 210 ILE A CD1 1 
ATOM   1595  N  N   . LEU A  1 236 ? 97.298  0.520   -12.934  1.00 19.80  ? 211 LEU A N   1 
ATOM   1596  C  CA  . LEU A  1 236 ? 97.481  1.456   -11.823  1.00 20.34  ? 211 LEU A CA  1 
ATOM   1597  C  C   . LEU A  1 236 ? 98.189  2.731   -12.253  1.00 21.10  ? 211 LEU A C   1 
ATOM   1598  O  O   . LEU A  1 236 ? 97.954  3.801   -11.678  1.00 21.05  ? 211 LEU A O   1 
ATOM   1599  C  CB  . LEU A  1 236 ? 98.251  0.798   -10.666  1.00 20.86  ? 211 LEU A CB  1 
ATOM   1600  C  CG  . LEU A  1 236 ? 97.543  -0.328  -9.910   1.00 20.75  ? 211 LEU A CG  1 
ATOM   1601  C  CD1 . LEU A  1 236 ? 98.536  -1.100  -9.067   1.00 20.69  ? 211 LEU A CD1 1 
ATOM   1602  C  CD2 . LEU A  1 236 ? 96.406  0.221   -9.056   1.00 21.57  ? 211 LEU A CD2 1 
ATOM   1603  N  N   . THR A  1 237 ? 99.037  2.611   -13.272  1.00 21.34  ? 212 THR A N   1 
ATOM   1604  C  CA  . THR A  1 237 ? 99.822  3.744   -13.751  1.00 23.09  ? 212 THR A CA  1 
ATOM   1605  C  C   . THR A  1 237 ? 99.211  4.442   -14.979  1.00 24.24  ? 212 THR A C   1 
ATOM   1606  O  O   . THR A  1 237 ? 99.708  5.483   -15.397  1.00 24.97  ? 212 THR A O   1 
ATOM   1607  C  CB  . THR A  1 237 ? 101.278 3.334   -14.070  1.00 23.04  ? 212 THR A CB  1 
ATOM   1608  O  OG1 . THR A  1 237 ? 101.274 2.405   -15.153  1.00 23.52  ? 212 THR A OG1 1 
ATOM   1609  C  CG2 . THR A  1 237 ? 101.963 2.687   -12.851  1.00 22.60  ? 212 THR A CG2 1 
ATOM   1610  N  N   . HIS A  1 238 ? 98.152  3.880   -15.559  1.00 24.36  ? 213 HIS A N   1 
ATOM   1611  C  CA  . HIS A  1 238 ? 97.524  4.501   -16.735  1.00 24.50  ? 213 HIS A CA  1 
ATOM   1612  C  C   . HIS A  1 238 ? 96.744  5.772   -16.348  1.00 24.74  ? 213 HIS A C   1 
ATOM   1613  O  O   . HIS A  1 238 ? 95.834  5.708   -15.516  1.00 24.68  ? 213 HIS A O   1 
ATOM   1614  C  CB  . HIS A  1 238 ? 96.603  3.513   -17.459  1.00 25.03  ? 213 HIS A CB  1 
ATOM   1615  C  CG  . HIS A  1 238 ? 96.468  3.784   -18.927  1.00 24.58  ? 213 HIS A CG  1 
ATOM   1616  N  ND1 . HIS A  1 238 ? 95.848  4.914   -19.425  1.00 24.59  ? 213 HIS A ND1 1 
ATOM   1617  C  CD2 . HIS A  1 238 ? 96.882  3.074   -20.004  1.00 24.22  ? 213 HIS A CD2 1 
ATOM   1618  C  CE1 . HIS A  1 238 ? 95.892  4.890   -20.746  1.00 25.32  ? 213 HIS A CE1 1 
ATOM   1619  N  NE2 . HIS A  1 238 ? 96.510  3.782   -21.123  1.00 25.54  ? 213 HIS A NE2 1 
ATOM   1620  N  N   . PRO A  1 239 ? 97.093  6.936   -16.942  1.00 24.89  ? 214 PRO A N   1 
ATOM   1621  C  CA  . PRO A  1 239 ? 96.453  8.167   -16.459  1.00 24.52  ? 214 PRO A CA  1 
ATOM   1622  C  C   . PRO A  1 239 ? 94.997  8.333   -16.927  1.00 25.86  ? 214 PRO A C   1 
ATOM   1623  O  O   . PRO A  1 239 ? 94.294  9.223   -16.438  1.00 26.63  ? 214 PRO A O   1 
ATOM   1624  C  CB  . PRO A  1 239 ? 97.342  9.265   -17.034  1.00 24.55  ? 214 PRO A CB  1 
ATOM   1625  C  CG  . PRO A  1 239 ? 97.837  8.677   -18.311  1.00 26.14  ? 214 PRO A CG  1 
ATOM   1626  C  CD  . PRO A  1 239 ? 98.062  7.213   -18.019  1.00 25.98  ? 214 PRO A CD  1 
ATOM   1627  N  N   . ASP A  1 240 ? 94.538  7.480   -17.846  1.00 24.84  ? 215 ASP A N   1 
ATOM   1628  C  CA  . ASP A  1 240 ? 93.142  7.519   -18.289  1.00 23.60  ? 215 ASP A CA  1 
ATOM   1629  C  C   . ASP A  1 240 ? 92.186  6.634   -17.462  1.00 22.73  ? 215 ASP A C   1 
ATOM   1630  O  O   . ASP A  1 240 ? 90.972  6.675   -17.672  1.00 22.72  ? 215 ASP A O   1 
ATOM   1631  C  CB  . ASP A  1 240 ? 93.033  7.162   -19.775  1.00 26.29  ? 215 ASP A CB  1 
ATOM   1632  C  CG  . ASP A  1 240 ? 93.715  8.174   -20.669  1.00 29.76  ? 215 ASP A CG  1 
ATOM   1633  O  OD1 . ASP A  1 240 ? 93.701  9.374   -20.331  1.00 32.07  ? 215 ASP A OD1 1 
ATOM   1634  O  OD2 . ASP A  1 240 ? 94.256  7.774   -21.717  1.00 31.67  ? 215 ASP A OD2 1 
ATOM   1635  N  N   . ILE A  1 241 ? 92.719  5.827   -16.547  1.00 20.86  ? 216 ILE A N   1 
ATOM   1636  C  CA  . ILE A  1 241 ? 91.854  5.056   -15.656  1.00 19.99  ? 216 ILE A CA  1 
ATOM   1637  C  C   . ILE A  1 241 ? 91.596  5.873   -14.380  1.00 19.67  ? 216 ILE A C   1 
ATOM   1638  O  O   . ILE A  1 241 ? 92.532  6.265   -13.706  1.00 19.06  ? 216 ILE A O   1 
ATOM   1639  C  CB  . ILE A  1 241 ? 92.407  3.641   -15.363  1.00 18.66  ? 216 ILE A CB  1 
ATOM   1640  C  CG1 . ILE A  1 241 ? 92.388  2.787   -16.648  1.00 17.88  ? 216 ILE A CG1 1 
ATOM   1641  C  CG2 . ILE A  1 241 ? 91.585  2.948   -14.277  1.00 18.42  ? 216 ILE A CG2 1 
ATOM   1642  C  CD1 . ILE A  1 241 ? 93.166  1.484   -16.555  1.00 17.04  ? 216 ILE A CD1 1 
ATOM   1643  N  N   . ALA A  1 242 ? 90.320  6.126   -14.075  1.00 19.63  ? 217 ALA A N   1 
ATOM   1644  C  CA  . ALA A  1 242 ? 89.923  7.013   -12.964  1.00 19.10  ? 217 ALA A CA  1 
ATOM   1645  C  C   . ALA A  1 242 ? 89.773  6.325   -11.595  1.00 19.32  ? 217 ALA A C   1 
ATOM   1646  O  O   . ALA A  1 242 ? 89.889  6.972   -10.543  1.00 20.09  ? 217 ALA A O   1 
ATOM   1647  C  CB  . ALA A  1 242 ? 88.632  7.731   -13.322  1.00 18.48  ? 217 ALA A CB  1 
ATOM   1648  N  N   . ALA A  1 243 ? 89.488  5.024   -11.614  1.00 18.37  ? 218 ALA A N   1 
ATOM   1649  C  CA  . ALA A  1 243 ? 89.051  4.322   -10.417  1.00 18.42  ? 218 ALA A CA  1 
ATOM   1650  C  C   . ALA A  1 243 ? 89.381  2.843   -10.502  1.00 18.95  ? 218 ALA A C   1 
ATOM   1651  O  O   . ALA A  1 243 ? 89.170  2.195   -11.546  1.00 19.22  ? 218 ALA A O   1 
ATOM   1652  C  CB  . ALA A  1 243 ? 87.546  4.518   -10.206  1.00 17.86  ? 218 ALA A CB  1 
ATOM   1653  N  N   . VAL A  1 244 ? 89.882  2.311   -9.394   1.00 19.62  ? 219 VAL A N   1 
ATOM   1654  C  CA  . VAL A  1 244 ? 90.244  0.893   -9.313   1.00 20.87  ? 219 VAL A CA  1 
ATOM   1655  C  C   . VAL A  1 244 ? 89.511  0.215   -8.154   1.00 20.10  ? 219 VAL A C   1 
ATOM   1656  O  O   . VAL A  1 244 ? 89.445  0.761   -7.057   1.00 20.55  ? 219 VAL A O   1 
ATOM   1657  C  CB  . VAL A  1 244 ? 91.772  0.685   -9.151   1.00 22.43  ? 219 VAL A CB  1 
ATOM   1658  C  CG1 . VAL A  1 244 ? 92.129  -0.809  -9.161   1.00 23.81  ? 219 VAL A CG1 1 
ATOM   1659  C  CG2 . VAL A  1 244 ? 92.532  1.420   -10.245  1.00 22.21  ? 219 VAL A CG2 1 
ATOM   1660  N  N   . SER A  1 245 ? 88.968  -0.975  -8.419   1.00 18.94  ? 220 SER A N   1 
ATOM   1661  C  CA  . SER A  1 245 ? 88.323  -1.793  -7.404   1.00 18.62  ? 220 SER A CA  1 
ATOM   1662  C  C   . SER A  1 245 ? 89.060  -3.124  -7.300   1.00 19.34  ? 220 SER A C   1 
ATOM   1663  O  O   . SER A  1 245 ? 89.303  -3.766  -8.321   1.00 21.79  ? 220 SER A O   1 
ATOM   1664  C  CB  . SER A  1 245 ? 86.865  -2.046  -7.778   1.00 18.32  ? 220 SER A CB  1 
ATOM   1665  O  OG  . SER A  1 245 ? 86.217  -2.666  -6.685   1.00 18.33  ? 220 SER A OG  1 
ATOM   1666  N  N   . PHE A  1 246 ? 89.420  -3.523  -6.079   1.00 18.70  ? 221 PHE A N   1 
ATOM   1667  C  CA  . PHE A  1 246 ? 90.196  -4.739  -5.839   1.00 18.65  ? 221 PHE A CA  1 
ATOM   1668  C  C   . PHE A  1 246 ? 89.585  -5.678  -4.793   1.00 19.55  ? 221 PHE A C   1 
ATOM   1669  O  O   . PHE A  1 246 ? 89.120  -5.243  -3.730   1.00 19.49  ? 221 PHE A O   1 
ATOM   1670  C  CB  . PHE A  1 246 ? 91.617  -4.384  -5.413   1.00 17.99  ? 221 PHE A CB  1 
ATOM   1671  C  CG  . PHE A  1 246 ? 92.479  -5.584  -5.129   1.00 17.22  ? 221 PHE A CG  1 
ATOM   1672  C  CD1 . PHE A  1 246 ? 92.456  -6.202  -3.870   1.00 16.49  ? 221 PHE A CD1 1 
ATOM   1673  C  CD2 . PHE A  1 246 ? 93.332  -6.098  -6.117   1.00 17.15  ? 221 PHE A CD2 1 
ATOM   1674  C  CE1 . PHE A  1 246 ? 93.260  -7.311  -3.608   1.00 17.17  ? 221 PHE A CE1 1 
ATOM   1675  C  CE2 . PHE A  1 246 ? 94.151  -7.205  -5.857   1.00 17.09  ? 221 PHE A CE2 1 
ATOM   1676  C  CZ  . PHE A  1 246 ? 94.111  -7.810  -4.605   1.00 17.41  ? 221 PHE A CZ  1 
ATOM   1677  N  N   . VAL A  1 247 ? 89.614  -6.971  -5.100   1.00 19.00  ? 222 VAL A N   1 
ATOM   1678  C  CA  . VAL A  1 247 ? 89.252  -7.998  -4.127   1.00 19.50  ? 222 VAL A CA  1 
ATOM   1679  C  C   . VAL A  1 247 ? 90.288  -9.129  -4.176   1.00 20.06  ? 222 VAL A C   1 
ATOM   1680  O  O   . VAL A  1 247 ? 90.611  -9.635  -5.262   1.00 19.63  ? 222 VAL A O   1 
ATOM   1681  C  CB  . VAL A  1 247 ? 87.807  -8.519  -4.354   1.00 19.59  ? 222 VAL A CB  1 
ATOM   1682  C  CG1 . VAL A  1 247 ? 87.541  -9.755  -3.520   1.00 20.71  ? 222 VAL A CG1 1 
ATOM   1683  C  CG2 . VAL A  1 247 ? 86.786  -7.454  -4.002   1.00 17.88  ? 222 VAL A CG2 1 
ATOM   1684  N  N   . GLY A  1 248 ? 90.822  -9.494  -3.003   1.00 20.48  ? 223 GLY A N   1 
ATOM   1685  C  CA  . GLY A  1 248 ? 91.862  -10.519 -2.892   1.00 21.38  ? 223 GLY A CA  1 
ATOM   1686  C  C   . GLY A  1 248 ? 92.520  -10.574 -1.527   1.00 22.05  ? 223 GLY A C   1 
ATOM   1687  O  O   . GLY A  1 248 ? 91.897  -10.234 -0.516   1.00 22.58  ? 223 GLY A O   1 
ATOM   1688  N  N   . SER A  1 249 ? 93.776  -11.004 -1.486   1.00 21.86  ? 224 SER A N   1 
ATOM   1689  C  CA  . SER A  1 249 ? 94.500  -11.092 -0.227   1.00 23.40  ? 224 SER A CA  1 
ATOM   1690  C  C   . SER A  1 249 ? 94.856  -9.696  0.289    1.00 24.27  ? 224 SER A C   1 
ATOM   1691  O  O   . SER A  1 249 ? 95.020  -8.749  -0.498   1.00 23.86  ? 224 SER A O   1 
ATOM   1692  C  CB  . SER A  1 249 ? 95.771  -11.924 -0.377   1.00 24.12  ? 224 SER A CB  1 
ATOM   1693  O  OG  . SER A  1 249 ? 96.703  -11.245 -1.206   1.00 26.04  ? 224 SER A OG  1 
ATOM   1694  N  N   . THR A  1 250 ? 94.982  -9.586  1.610    1.00 22.84  ? 225 THR A N   1 
ATOM   1695  C  CA  . THR A  1 250 ? 95.357  -8.328  2.245    1.00 23.34  ? 225 THR A CA  1 
ATOM   1696  C  C   . THR A  1 250 ? 96.688  -7.699  1.778    1.00 24.16  ? 225 THR A C   1 
ATOM   1697  O  O   . THR A  1 250 ? 96.722  -6.484  1.525    1.00 24.52  ? 225 THR A O   1 
ATOM   1698  C  CB  . THR A  1 250 ? 95.280  -8.430  3.788    1.00 23.43  ? 225 THR A CB  1 
ATOM   1699  O  OG1 . THR A  1 250 ? 93.901  -8.485  4.171    1.00 24.83  ? 225 THR A OG1 1 
ATOM   1700  C  CG2 . THR A  1 250 ? 95.907  -7.206  4.446    1.00 22.43  ? 225 THR A CG2 1 
ATOM   1701  N  N   . PRO A  1 251 ? 97.785  -8.498  1.675    1.00 23.58  ? 226 PRO A N   1 
ATOM   1702  C  CA  . PRO A  1 251 ? 99.026  -7.855  1.181    1.00 23.91  ? 226 PRO A CA  1 
ATOM   1703  C  C   . PRO A  1 251 ? 98.880  -7.212  -0.214   1.00 23.69  ? 226 PRO A C   1 
ATOM   1704  O  O   . PRO A  1 251 ? 99.356  -6.099  -0.431   1.00 25.36  ? 226 PRO A O   1 
ATOM   1705  C  CB  . PRO A  1 251 ? 100.050 -9.008  1.156    1.00 24.19  ? 226 PRO A CB  1 
ATOM   1706  C  CG  . PRO A  1 251 ? 99.502  -10.036 2.102    1.00 23.21  ? 226 PRO A CG  1 
ATOM   1707  C  CD  . PRO A  1 251 ? 98.004  -9.913  2.052    1.00 22.16  ? 226 PRO A CD  1 
ATOM   1708  N  N   . ILE A  1 252 ? 98.204  -7.880  -1.140   1.00 22.44  ? 227 ILE A N   1 
ATOM   1709  C  CA  . ILE A  1 252 ? 98.014  -7.309  -2.482   1.00 22.27  ? 227 ILE A CA  1 
ATOM   1710  C  C   . ILE A  1 252 ? 97.007  -6.133  -2.417   1.00 22.00  ? 227 ILE A C   1 
ATOM   1711  O  O   . ILE A  1 252 ? 97.174  -5.121  -3.098   1.00 21.90  ? 227 ILE A O   1 
ATOM   1712  C  CB  . ILE A  1 252 ? 97.597  -8.385  -3.527   1.00 21.24  ? 227 ILE A CB  1 
ATOM   1713  C  CG1 . ILE A  1 252 ? 98.565  -9.582  -3.509   1.00 22.35  ? 227 ILE A CG1 1 
ATOM   1714  C  CG2 . ILE A  1 252 ? 97.512  -7.795  -4.921   1.00 20.71  ? 227 ILE A CG2 1 
ATOM   1715  C  CD1 . ILE A  1 252 ? 100.018 -9.234  -3.761   1.00 22.84  ? 227 ILE A CD1 1 
ATOM   1716  N  N   . ALA A  1 253 ? 95.980  -6.266  -1.582   1.00 20.65  ? 228 ALA A N   1 
ATOM   1717  C  CA  . ALA A  1 253 ? 95.010  -5.181  -1.379   1.00 20.47  ? 228 ALA A CA  1 
ATOM   1718  C  C   . ALA A  1 253 ? 95.688  -3.880  -0.922   1.00 21.77  ? 228 ALA A C   1 
ATOM   1719  O  O   . ALA A  1 253 ? 95.376  -2.805  -1.442   1.00 21.47  ? 228 ALA A O   1 
ATOM   1720  C  CB  . ALA A  1 253 ? 93.898  -5.609  -0.414   1.00 18.49  ? 228 ALA A CB  1 
ATOM   1721  N  N   . ARG A  1 254 ? 96.611  -3.984  0.037    1.00 22.88  ? 229 ARG A N   1 
ATOM   1722  C  CA  . ARG A  1 254 ? 97.380  -2.824  0.517    1.00 24.25  ? 229 ARG A CA  1 
ATOM   1723  C  C   . ARG A  1 254 ? 98.190  -2.195  -0.604   1.00 26.30  ? 229 ARG A C   1 
ATOM   1724  O  O   . ARG A  1 254 ? 98.193  -0.973  -0.761   1.00 26.62  ? 229 ARG A O   1 
ATOM   1725  C  CB  . ARG A  1 254 ? 98.360  -3.248  1.598    1.00 25.54  ? 229 ARG A CB  1 
ATOM   1726  C  CG  . ARG A  1 254 ? 97.748  -3.546  2.937    1.00 27.84  ? 229 ARG A CG  1 
ATOM   1727  C  CD  . ARG A  1 254 ? 98.841  -3.809  3.977    1.00 32.18  ? 229 ARG A CD  1 
ATOM   1728  N  NE  . ARG A  1 254 ? 98.246  -4.329  5.203    1.00 35.64  ? 229 ARG A NE  1 
ATOM   1729  C  CZ  . ARG A  1 254 ? 97.708  -3.571  6.156    1.00 39.47  ? 229 ARG A CZ  1 
ATOM   1730  N  NH1 . ARG A  1 254 ? 97.718  -2.239  6.047    1.00 40.71  ? 229 ARG A NH1 1 
ATOM   1731  N  NH2 . ARG A  1 254 ? 97.172  -4.144  7.230    1.00 39.58  ? 229 ARG A NH2 1 
ATOM   1732  N  N   . TYR A  1 255 ? 98.896  -3.043  -1.362   1.00 25.66  ? 230 TYR A N   1 
ATOM   1733  C  CA  . TYR A  1 255 ? 99.723  -2.580  -2.472   1.00 25.35  ? 230 TYR A CA  1 
ATOM   1734  C  C   . TYR A  1 255 ? 98.911  -1.857  -3.558   1.00 23.10  ? 230 TYR A C   1 
ATOM   1735  O  O   . TYR A  1 255 ? 99.298  -0.787  -3.997   1.00 23.26  ? 230 TYR A O   1 
ATOM   1736  C  CB  . TYR A  1 255 ? 100.534 -3.729  -3.077   1.00 25.53  ? 230 TYR A CB  1 
ATOM   1737  C  CG  . TYR A  1 255 ? 101.280 -3.336  -4.345   1.00 26.97  ? 230 TYR A CG  1 
ATOM   1738  C  CD1 . TYR A  1 255 ? 102.506 -2.665  -4.281   1.00 26.48  ? 230 TYR A CD1 1 
ATOM   1739  C  CD2 . TYR A  1 255 ? 100.761 -3.642  -5.609   1.00 27.91  ? 230 TYR A CD2 1 
ATOM   1740  C  CE1 . TYR A  1 255 ? 103.185 -2.305  -5.435   1.00 27.19  ? 230 TYR A CE1 1 
ATOM   1741  C  CE2 . TYR A  1 255 ? 101.437 -3.288  -6.767   1.00 29.06  ? 230 TYR A CE2 1 
ATOM   1742  C  CZ  . TYR A  1 255 ? 102.647 -2.616  -6.671   1.00 28.53  ? 230 TYR A CZ  1 
ATOM   1743  O  OH  . TYR A  1 255 ? 103.322 -2.265  -7.812   1.00 29.56  ? 230 TYR A OH  1 
ATOM   1744  N  N   . VAL A  1 256 ? 97.802  -2.456  -3.988   1.00 21.41  ? 231 VAL A N   1 
ATOM   1745  C  CA  . VAL A  1 256 ? 96.917  -1.858  -5.009   1.00 19.46  ? 231 VAL A CA  1 
ATOM   1746  C  C   . VAL A  1 256 ? 96.327  -0.524  -4.513   1.00 18.60  ? 231 VAL A C   1 
ATOM   1747  O  O   . VAL A  1 256 ? 96.265  0.459   -5.251   1.00 17.44  ? 231 VAL A O   1 
ATOM   1748  C  CB  . VAL A  1 256 ? 95.812  -2.865  -5.456   1.00 18.39  ? 231 VAL A CB  1 
ATOM   1749  C  CG1 . VAL A  1 256 ? 94.705  -2.182  -6.249   1.00 16.97  ? 231 VAL A CG1 1 
ATOM   1750  C  CG2 . VAL A  1 256 ? 96.431  -4.011  -6.255   1.00 18.00  ? 231 VAL A CG2 1 
ATOM   1751  N  N   . TYR A  1 257 ? 95.924  -0.498  -3.243   1.00 19.89  ? 232 TYR A N   1 
ATOM   1752  C  CA  . TYR A  1 257 ? 95.347  0.697   -2.626   1.00 19.49  ? 232 TYR A CA  1 
ATOM   1753  C  C   . TYR A  1 257 ? 96.337  1.869   -2.576   1.00 18.68  ? 232 TYR A C   1 
ATOM   1754  O  O   . TYR A  1 257 ? 96.057  2.952   -3.076   1.00 17.58  ? 232 TYR A O   1 
ATOM   1755  C  CB  . TYR A  1 257 ? 94.840  0.368   -1.216   1.00 19.56  ? 232 TYR A CB  1 
ATOM   1756  C  CG  . TYR A  1 257 ? 94.097  1.502   -0.557   1.00 19.33  ? 232 TYR A CG  1 
ATOM   1757  C  CD1 . TYR A  1 257 ? 92.851  1.933   -1.041   1.00 19.35  ? 232 TYR A CD1 1 
ATOM   1758  C  CD2 . TYR A  1 257 ? 94.632  2.145   0.565    1.00 19.65  ? 232 TYR A CD2 1 
ATOM   1759  C  CE1 . TYR A  1 257 ? 92.174  2.981   -0.428   1.00 19.10  ? 232 TYR A CE1 1 
ATOM   1760  C  CE2 . TYR A  1 257 ? 93.957  3.188   1.193    1.00 19.02  ? 232 TYR A CE2 1 
ATOM   1761  C  CZ  . TYR A  1 257 ? 92.742  3.604   0.691    1.00 18.72  ? 232 TYR A CZ  1 
ATOM   1762  O  OH  . TYR A  1 257 ? 92.096  4.633   1.320    1.00 19.22  ? 232 TYR A OH  1 
ATOM   1763  N  N   . GLY A  1 258 ? 97.481  1.636   -1.949   1.00 19.71  ? 233 GLY A N   1 
ATOM   1764  C  CA  . GLY A  1 258 ? 98.548  2.623   -1.871   1.00 20.08  ? 233 GLY A CA  1 
ATOM   1765  C  C   . GLY A  1 258 ? 99.026  3.089   -3.234   1.00 20.94  ? 233 GLY A C   1 
ATOM   1766  O  O   . GLY A  1 258 ? 99.154  4.289   -3.473   1.00 21.31  ? 233 GLY A O   1 
ATOM   1767  N  N   . THR A  1 259 ? 99.292  2.140   -4.130   1.00 21.16  ? 234 THR A N   1 
ATOM   1768  C  CA  . THR A  1 259 ? 99.772  2.474   -5.469   1.00 21.23  ? 234 THR A CA  1 
ATOM   1769  C  C   . THR A  1 259 ? 98.723  3.277   -6.267   1.00 21.44  ? 234 THR A C   1 
ATOM   1770  O  O   . THR A  1 259 ? 99.067  4.248   -6.943   1.00 20.48  ? 234 THR A O   1 
ATOM   1771  C  CB  . THR A  1 259 ? 100.188 1.211   -6.256   1.00 21.62  ? 234 THR A CB  1 
ATOM   1772  O  OG1 . THR A  1 259 ? 101.101 0.438   -5.469   1.00 22.30  ? 234 THR A OG1 1 
ATOM   1773  C  CG2 . THR A  1 259 ? 100.868 1.577   -7.572   1.00 21.48  ? 234 THR A CG2 1 
ATOM   1774  N  N   . ALA A  1 260 ? 97.453  2.871   -6.179   1.00 21.19  ? 235 ALA A N   1 
ATOM   1775  C  CA  . ALA A  1 260 ? 96.381  3.575   -6.883   1.00 20.77  ? 235 ALA A CA  1 
ATOM   1776  C  C   . ALA A  1 260 ? 96.336  5.024   -6.430   1.00 20.54  ? 235 ALA A C   1 
ATOM   1777  O  O   . ALA A  1 260 ? 96.271  5.951   -7.256   1.00 19.44  ? 235 ALA A O   1 
ATOM   1778  C  CB  . ALA A  1 260 ? 95.035  2.901   -6.633   1.00 19.58  ? 235 ALA A CB  1 
ATOM   1779  N  N   . ALA A  1 261 ? 96.379  5.212   -5.110   1.00 20.80  ? 236 ALA A N   1 
ATOM   1780  C  CA  . ALA A  1 261 ? 96.285  6.549   -4.538   1.00 20.18  ? 236 ALA A CA  1 
ATOM   1781  C  C   . ALA A  1 261 ? 97.489  7.371   -4.973   1.00 20.29  ? 236 ALA A C   1 
ATOM   1782  O  O   . ALA A  1 261 ? 97.364  8.565   -5.264   1.00 19.89  ? 236 ALA A O   1 
ATOM   1783  C  CB  . ALA A  1 261 ? 96.183  6.481   -3.026   1.00 19.52  ? 236 ALA A CB  1 
HETATM 1784  N  N   . MSE A  1 262 ? 98.637  6.708   -5.053   1.00 21.32  ? 237 MSE A N   1 
HETATM 1785  C  CA  . MSE A  1 262 ? 99.886  7.359   -5.413   1.00 24.22  ? 237 MSE A CA  1 
HETATM 1786  C  C   . MSE A  1 262 ? 99.773  7.865   -6.823   1.00 23.51  ? 237 MSE A C   1 
HETATM 1787  O  O   . MSE A  1 262 ? 100.438 8.827   -7.188   1.00 23.75  ? 237 MSE A O   1 
HETATM 1788  C  CB  . MSE A  1 262 ? 101.074 6.402   -5.274   1.00 28.37  ? 237 MSE A CB  1 
HETATM 1789  C  CG  . MSE A  1 262 ? 101.648 6.336   -3.847   1.00 37.58  ? 237 MSE A CG  1 
HETATM 1790  SE SE  . MSE A  1 262 ? 102.380 8.060   -3.177   1.00 46.84  ? 237 MSE A SE  1 
HETATM 1791  C  CE  . MSE A  1 262 ? 102.905 7.462   -1.370   1.00 44.88  ? 237 MSE A CE  1 
ATOM   1792  N  N   . ASN A  1 263 ? 98.931  7.226   -7.629   1.00 22.24  ? 238 ASN A N   1 
ATOM   1793  C  CA  . ASN A  1 263 ? 98.722  7.662   -9.016   1.00 23.17  ? 238 ASN A CA  1 
ATOM   1794  C  C   . ASN A  1 263 ? 97.519  8.594   -9.183   1.00 22.32  ? 238 ASN A C   1 
ATOM   1795  O  O   . ASN A  1 263 ? 97.114  8.896   -10.314  1.00 22.22  ? 238 ASN A O   1 
ATOM   1796  C  CB  . ASN A  1 263 ? 98.625  6.458   -9.956   1.00 23.89  ? 238 ASN A CB  1 
ATOM   1797  C  CG  . ASN A  1 263 ? 99.990  5.850   -10.266  1.00 25.96  ? 238 ASN A CG  1 
ATOM   1798  O  OD1 . ASN A  1 263 ? 100.618 6.202   -11.264  1.00 27.37  ? 238 ASN A OD1 1 
ATOM   1799  N  ND2 . ASN A  1 263 ? 100.462 4.956   -9.401   1.00 25.04  ? 238 ASN A ND2 1 
ATOM   1800  N  N   . GLY A  1 264 ? 96.953  9.019   -8.045   1.00 21.43  ? 239 GLY A N   1 
ATOM   1801  C  CA  . GLY A  1 264 ? 95.857  9.989   -7.987   1.00 20.83  ? 239 GLY A CA  1 
ATOM   1802  C  C   . GLY A  1 264 ? 94.466  9.434   -8.251   1.00 21.51  ? 239 GLY A C   1 
ATOM   1803  O  O   . GLY A  1 264 ? 93.510  10.205  -8.385   1.00 21.83  ? 239 GLY A O   1 
ATOM   1804  N  N   . LYS A  1 265 ? 94.352  8.103   -8.313   1.00 21.25  ? 240 LYS A N   1 
ATOM   1805  C  CA  . LYS A  1 265 ? 93.093  7.415   -8.624   1.00 20.84  ? 240 LYS A CA  1 
ATOM   1806  C  C   . LYS A  1 265 ? 92.251  7.229   -7.367   1.00 20.76  ? 240 LYS A C   1 
ATOM   1807  O  O   . LYS A  1 265 ? 92.791  7.213   -6.253   1.00 21.46  ? 240 LYS A O   1 
ATOM   1808  C  CB  . LYS A  1 265 ? 93.375  6.034   -9.230   1.00 21.40  ? 240 LYS A CB  1 
ATOM   1809  C  CG  . LYS A  1 265 ? 94.050  6.023   -10.607  1.00 22.49  ? 240 LYS A CG  1 
ATOM   1810  C  CD  . LYS A  1 265 ? 94.443  4.593   -10.983  1.00 23.46  ? 240 LYS A CD  1 
ATOM   1811  C  CE  . LYS A  1 265 ? 94.880  4.455   -12.444  1.00 24.70  ? 240 LYS A CE  1 
ATOM   1812  N  NZ  . LYS A  1 265 ? 95.940  5.420   -12.854  1.00 24.18  ? 240 LYS A NZ  1 
ATOM   1813  N  N   . ARG A  1 266 ? 90.937  7.067   -7.526   1.00 18.82  ? 241 ARG A N   1 
ATOM   1814  C  CA  . ARG A  1 266 ? 90.150  6.572   -6.411   1.00 18.42  ? 241 ARG A CA  1 
ATOM   1815  C  C   . ARG A  1 266 ? 90.237  5.040   -6.324   1.00 17.56  ? 241 ARG A C   1 
ATOM   1816  O  O   . ARG A  1 266 ? 90.353  4.335   -7.344   1.00 17.39  ? 241 ARG A O   1 
ATOM   1817  C  CB  . ARG A  1 266 ? 88.703  7.072   -6.443   1.00 18.34  ? 241 ARG A CB  1 
ATOM   1818  C  CG  . ARG A  1 266 ? 87.936  6.798   -7.717   1.00 18.45  ? 241 ARG A CG  1 
ATOM   1819  C  CD  . ARG A  1 266 ? 86.455  7.154   -7.567   1.00 17.95  ? 241 ARG A CD  1 
ATOM   1820  N  NE  . ARG A  1 266 ? 86.184  8.591   -7.480   1.00 16.78  ? 241 ARG A NE  1 
ATOM   1821  C  CZ  . ARG A  1 266 ? 84.962  9.128   -7.401   1.00 17.20  ? 241 ARG A CZ  1 
ATOM   1822  N  NH1 . ARG A  1 266 ? 83.870  8.357   -7.382   1.00 15.76  ? 241 ARG A NH1 1 
ATOM   1823  N  NH2 . ARG A  1 266 ? 84.821  10.453  -7.339   1.00 18.75  ? 241 ARG A NH2 1 
ATOM   1824  N  N   . ALA A  1 267 ? 90.191  4.532   -5.099   1.00 16.72  ? 242 ALA A N   1 
ATOM   1825  C  CA  . ALA A  1 267 ? 90.404  3.105   -4.864   1.00 17.55  ? 242 ALA A CA  1 
ATOM   1826  C  C   . ALA A  1 267 ? 89.528  2.549   -3.754   1.00 16.82  ? 242 ALA A C   1 
ATOM   1827  O  O   . ALA A  1 267 ? 89.264  3.225   -2.757   1.00 16.29  ? 242 ALA A O   1 
ATOM   1828  C  CB  . ALA A  1 267 ? 91.877  2.828   -4.552   1.00 18.43  ? 242 ALA A CB  1 
ATOM   1829  N  N   . GLN A  1 268 ? 89.087  1.311   -3.957   1.00 16.76  ? 243 GLN A N   1 
ATOM   1830  C  CA  . GLN A  1 268 ? 88.461  0.510   -2.914   1.00 18.06  ? 243 GLN A CA  1 
ATOM   1831  C  C   . GLN A  1 268 ? 89.050  -0.895  -2.997   1.00 19.75  ? 243 GLN A C   1 
ATOM   1832  O  O   . GLN A  1 268 ? 89.011  -1.536  -4.063   1.00 20.23  ? 243 GLN A O   1 
ATOM   1833  C  CB  . GLN A  1 268 ? 86.920  0.487   -3.051   1.00 17.91  ? 243 GLN A CB  1 
ATOM   1834  C  CG  . GLN A  1 268 ? 86.375  0.115   -4.435   1.00 17.86  ? 243 GLN A CG  1 
ATOM   1835  C  CD  . GLN A  1 268 ? 84.888  -0.242  -4.447   1.00 19.26  ? 243 GLN A CD  1 
ATOM   1836  O  OE1 . GLN A  1 268 ? 84.431  -1.005  -5.310   1.00 19.12  ? 243 GLN A OE1 1 
ATOM   1837  N  NE2 . GLN A  1 268 ? 84.122  0.310   -3.489   1.00 19.09  ? 243 GLN A NE2 1 
ATOM   1838  N  N   . CYS A  1 269 ? 89.614  -1.361  -1.883   1.00 20.02  ? 244 CYS A N   1 
ATOM   1839  C  CA  . CYS A  1 269 ? 90.264  -2.671  -1.828   1.00 20.42  ? 244 CYS A CA  1 
ATOM   1840  C  C   . CYS A  1 269 ? 89.778  -3.493  -0.649   1.00 20.64  ? 244 CYS A C   1 
ATOM   1841  O  O   . CYS A  1 269 ? 89.497  -2.960  0.421    1.00 20.37  ? 244 CYS A O   1 
ATOM   1842  C  CB  . CYS A  1 269 ? 91.779  -2.509  -1.796   1.00 21.22  ? 244 CYS A CB  1 
ATOM   1843  S  SG  . CYS A  1 269 ? 92.341  -1.534  -3.213   1.00 22.19  ? 244 CYS A SG  1 
ATOM   1844  N  N   . PHE A  1 270 ? 89.659  -4.796  -0.878   1.00 21.19  ? 245 PHE A N   1 
ATOM   1845  C  CA  . PHE A  1 270 ? 89.021  -5.716  0.062    1.00 21.08  ? 245 PHE A CA  1 
ATOM   1846  C  C   . PHE A  1 270 ? 89.917  -6.939  0.184    1.00 23.50  ? 245 PHE A C   1 
ATOM   1847  O  O   . PHE A  1 270 ? 90.351  -7.504  -0.830   1.00 23.38  ? 245 PHE A O   1 
ATOM   1848  C  CB  . PHE A  1 270 ? 87.587  -6.034  -0.403   1.00 19.11  ? 245 PHE A CB  1 
ATOM   1849  C  CG  . PHE A  1 270 ? 86.738  -4.791  -0.579   1.00 18.57  ? 245 PHE A CG  1 
ATOM   1850  C  CD1 . PHE A  1 270 ? 86.760  -4.065  -1.792   1.00 17.81  ? 245 PHE A CD1 1 
ATOM   1851  C  CD2 . PHE A  1 270 ? 85.957  -4.304  0.478    1.00 18.27  ? 245 PHE A CD2 1 
ATOM   1852  C  CE1 . PHE A  1 270 ? 86.021  -2.898  -1.934   1.00 17.22  ? 245 PHE A CE1 1 
ATOM   1853  C  CE2 . PHE A  1 270 ? 85.201  -3.143  0.331    1.00 17.68  ? 245 PHE A CE2 1 
ATOM   1854  C  CZ  . PHE A  1 270 ? 85.230  -2.442  -0.875   1.00 17.31  ? 245 PHE A CZ  1 
ATOM   1855  N  N   . GLY A  1 271 ? 90.228  -7.308  1.427    1.00 24.16  ? 246 GLY A N   1 
ATOM   1856  C  CA  . GLY A  1 271 ? 91.337  -8.211  1.727    1.00 23.77  ? 246 GLY A CA  1 
ATOM   1857  C  C   . GLY A  1 271 ? 90.919  -9.557  2.294    1.00 24.50  ? 246 GLY A C   1 
ATOM   1858  O  O   . GLY A  1 271 ? 89.835  -10.062 2.003    1.00 23.96  ? 246 GLY A O   1 
ATOM   1859  N  N   . GLY A  1 272 ? 91.801  -10.135 3.106    1.00 24.96  ? 247 GLY A N   1 
ATOM   1860  C  CA  . GLY A  1 272 ? 91.587  -11.444 3.715    1.00 23.40  ? 247 GLY A CA  1 
ATOM   1861  C  C   . GLY A  1 272 ? 90.716  -11.437 4.967    1.00 20.60  ? 247 GLY A C   1 
ATOM   1862  O  O   . GLY A  1 272 ? 90.142  -10.413 5.356    1.00 17.66  ? 247 GLY A O   1 
ATOM   1863  N  N   . ALA A  1 273 ? 90.638  -12.606 5.603    1.00 20.80  ? 248 ALA A N   1 
ATOM   1864  C  CA  . ALA A  1 273 ? 89.738  -12.809 6.737    1.00 20.19  ? 248 ALA A CA  1 
ATOM   1865  C  C   . ALA A  1 273 ? 90.198  -13.931 7.667    1.00 19.92  ? 248 ALA A C   1 
ATOM   1866  O  O   . ALA A  1 273 ? 90.999  -14.785 7.281    1.00 20.82  ? 248 ALA A O   1 
ATOM   1867  C  CB  . ALA A  1 273 ? 88.332  -13.098 6.221    1.00 19.38  ? 248 ALA A CB  1 
ATOM   1868  N  N   . LYS A  1 274 ? 89.691  -13.908 8.896    1.00 18.89  ? 249 LYS A N   1 
ATOM   1869  C  CA  . LYS A  1 274 ? 89.756  -15.051 9.798    1.00 18.54  ? 249 LYS A CA  1 
ATOM   1870  C  C   . LYS A  1 274 ? 88.457  -14.981 10.590   1.00 18.92  ? 249 LYS A C   1 
ATOM   1871  O  O   . LYS A  1 274 ? 88.424  -14.537 11.745   1.00 18.20  ? 249 LYS A O   1 
ATOM   1872  C  CB  . LYS A  1 274 ? 90.985  -14.978 10.709   1.00 18.49  ? 249 LYS A CB  1 
ATOM   1873  C  CG  . LYS A  1 274 ? 91.269  -16.265 11.476   1.00 19.24  ? 249 LYS A CG  1 
ATOM   1874  C  CD  . LYS A  1 274 ? 92.028  -17.277 10.633   1.00 19.29  ? 249 LYS A CD  1 
ATOM   1875  C  CE  . LYS A  1 274 ? 92.263  -18.571 11.415   1.00 19.75  ? 249 LYS A CE  1 
ATOM   1876  N  NZ  . LYS A  1 274 ? 92.926  -19.605 10.561   1.00 19.44  ? 249 LYS A NZ  1 
ATOM   1877  N  N   . ASN A  1 275 ? 87.374  -15.375 9.933    1.00 19.02  ? 250 ASN A N   1 
ATOM   1878  C  CA  . ASN A  1 275 ? 86.046  -15.226 10.503   1.00 19.72  ? 250 ASN A CA  1 
ATOM   1879  C  C   . ASN A  1 275 ? 85.786  -16.185 11.663   1.00 20.73  ? 250 ASN A C   1 
ATOM   1880  O  O   . ASN A  1 275 ? 85.983  -17.402 11.524   1.00 20.36  ? 250 ASN A O   1 
ATOM   1881  C  CB  . ASN A  1 275 ? 84.977  -15.416 9.424    1.00 19.93  ? 250 ASN A CB  1 
ATOM   1882  C  CG  . ASN A  1 275 ? 84.886  -14.237 8.467    1.00 20.29  ? 250 ASN A CG  1 
ATOM   1883  O  OD1 . ASN A  1 275 ? 85.805  -13.417 8.365    1.00 20.86  ? 250 ASN A OD1 1 
ATOM   1884  N  ND2 . ASN A  1 275 ? 83.757  -14.137 7.766    1.00 20.05  ? 250 ASN A ND2 1 
ATOM   1885  N  N   . HIS A  1 276 ? 85.336  -15.612 12.787   1.00 20.59  ? 251 HIS A N   1 
ATOM   1886  C  CA  . HIS A  1 276 ? 84.979  -16.342 13.999   1.00 21.77  ? 251 HIS A CA  1 
ATOM   1887  C  C   . HIS A  1 276 ? 83.469  -16.554 14.127   1.00 22.08  ? 251 HIS A C   1 
ATOM   1888  O  O   . HIS A  1 276 ? 82.678  -15.662 13.831   1.00 21.24  ? 251 HIS A O   1 
ATOM   1889  C  CB  . HIS A  1 276 ? 85.430  -15.575 15.249   1.00 21.66  ? 251 HIS A CB  1 
ATOM   1890  C  CG  . HIS A  1 276 ? 86.916  -15.429 15.392   1.00 21.59  ? 251 HIS A CG  1 
ATOM   1891  N  ND1 . HIS A  1 276 ? 87.721  -14.937 14.389   1.00 20.41  ? 251 HIS A ND1 1 
ATOM   1892  C  CD2 . HIS A  1 276 ? 87.731  -15.639 16.454   1.00 21.97  ? 251 HIS A CD2 1 
ATOM   1893  C  CE1 . HIS A  1 276 ? 88.972  -14.881 14.813   1.00 20.48  ? 251 HIS A CE1 1 
ATOM   1894  N  NE2 . HIS A  1 276 ? 89.005  -15.295 16.065   1.00 21.24  ? 251 HIS A NE2 1 
HETATM 1895  N  N   . MSE A  1 277 ? 83.083  -17.728 14.610   1.00 23.15  ? 252 MSE A N   1 
HETATM 1896  C  CA  . MSE A  1 277 ? 81.708  -17.965 15.023   1.00 24.64  ? 252 MSE A CA  1 
HETATM 1897  C  C   . MSE A  1 277 ? 81.784  -18.252 16.488   1.00 25.24  ? 252 MSE A C   1 
HETATM 1898  O  O   . MSE A  1 277 ? 82.449  -19.212 16.918   1.00 26.13  ? 252 MSE A O   1 
HETATM 1899  C  CB  . MSE A  1 277 ? 81.080  -19.136 14.278   1.00 26.29  ? 252 MSE A CB  1 
HETATM 1900  C  CG  . MSE A  1 277 ? 79.633  -19.307 14.708   1.00 32.44  ? 252 MSE A CG  1 
HETATM 1901  SE SE  . MSE A  1 277 ? 78.907  -21.056 14.105   1.00 42.37  ? 252 MSE A SE  1 
HETATM 1902  C  CE  . MSE A  1 277 ? 79.014  -20.762 12.180   1.00 34.70  ? 252 MSE A CE  1 
ATOM   1903  N  N   . ILE A  1 278 ? 81.103  -17.416 17.268   1.00 23.63  ? 253 ILE A N   1 
ATOM   1904  C  CA  . ILE A  1 278 ? 81.014  -17.580 18.707   1.00 23.44  ? 253 ILE A CA  1 
ATOM   1905  C  C   . ILE A  1 278 ? 79.734  -18.358 19.011   1.00 23.74  ? 253 ILE A C   1 
ATOM   1906  O  O   . ILE A  1 278 ? 78.669  -18.017 18.475   1.00 23.37  ? 253 ILE A O   1 
ATOM   1907  C  CB  . ILE A  1 278 ? 81.007  -16.210 19.423   1.00 22.46  ? 253 ILE A CB  1 
ATOM   1908  C  CG1 . ILE A  1 278 ? 82.429  -15.632 19.499   1.00 22.76  ? 253 ILE A CG1 1 
ATOM   1909  C  CG2 . ILE A  1 278 ? 80.441  -16.336 20.829   1.00 22.24  ? 253 ILE A CG2 1 
ATOM   1910  C  CD1 . ILE A  1 278 ? 83.042  -15.235 18.163   1.00 22.73  ? 253 ILE A CD1 1 
ATOM   1911  N  N   . ILE A  1 279 ? 79.842  -19.396 19.850   1.00 22.45  ? 254 ILE A N   1 
ATOM   1912  C  CA  . ILE A  1 279 ? 78.678  -20.204 20.226   1.00 21.46  ? 254 ILE A CA  1 
ATOM   1913  C  C   . ILE A  1 279 ? 78.382  -20.101 21.741   1.00 22.10  ? 254 ILE A C   1 
ATOM   1914  O  O   . ILE A  1 279 ? 79.135  -20.622 22.575   1.00 21.98  ? 254 ILE A O   1 
ATOM   1915  C  CB  . ILE A  1 279 ? 78.834  -21.693 19.811   1.00 20.63  ? 254 ILE A CB  1 
ATOM   1916  C  CG1 . ILE A  1 279 ? 79.160  -21.838 18.310   1.00 19.80  ? 254 ILE A CG1 1 
ATOM   1917  C  CG2 . ILE A  1 279 ? 77.578  -22.488 20.173   1.00 20.55  ? 254 ILE A CG2 1 
ATOM   1918  C  CD1 . ILE A  1 279 ? 80.645  -21.924 17.968   1.00 19.18  ? 254 ILE A CD1 1 
HETATM 1919  N  N   . MSE A  1 280 ? 77.281  -19.434 22.078   1.00 22.70  ? 255 MSE A N   1 
HETATM 1920  C  CA  . MSE A  1 280 ? 76.862  -19.245 23.466   1.00 24.65  ? 255 MSE A CA  1 
HETATM 1921  C  C   . MSE A  1 280 ? 76.237  -20.522 23.988   1.00 24.90  ? 255 MSE A C   1 
HETATM 1922  O  O   . MSE A  1 280 ? 75.719  -21.332 23.200   1.00 24.42  ? 255 MSE A O   1 
HETATM 1923  C  CB  . MSE A  1 280 ? 75.817  -18.130 23.539   1.00 27.32  ? 255 MSE A CB  1 
HETATM 1924  C  CG  . MSE A  1 280 ? 76.360  -16.735 23.211   1.00 32.12  ? 255 MSE A CG  1 
HETATM 1925  SE SE  . MSE A  1 280 ? 77.850  -16.179 24.392   1.00 37.87  ? 255 MSE A SE  1 
HETATM 1926  C  CE  . MSE A  1 280 ? 76.890  -15.966 26.101   1.00 38.45  ? 255 MSE A CE  1 
ATOM   1927  N  N   . PRO A  1 281 ? 76.229  -20.707 25.325   1.00 24.42  ? 256 PRO A N   1 
ATOM   1928  C  CA  . PRO A  1 281 ? 75.762  -21.964 25.904   1.00 25.55  ? 256 PRO A CA  1 
ATOM   1929  C  C   . PRO A  1 281 ? 74.272  -22.251 25.674   1.00 26.48  ? 256 PRO A C   1 
ATOM   1930  O  O   . PRO A  1 281 ? 73.834  -23.383 25.872   1.00 26.72  ? 256 PRO A O   1 
ATOM   1931  C  CB  . PRO A  1 281 ? 76.044  -21.785 27.408   1.00 26.13  ? 256 PRO A CB  1 
ATOM   1932  C  CG  . PRO A  1 281 ? 77.015  -20.648 27.488   1.00 25.72  ? 256 PRO A CG  1 
ATOM   1933  C  CD  . PRO A  1 281 ? 76.624  -19.748 26.366   1.00 24.42  ? 256 PRO A CD  1 
ATOM   1934  N  N   . ASP A  1 282 ? 73.508  -21.232 25.278   1.00 26.36  ? 257 ASP A N   1 
ATOM   1935  C  CA  . ASP A  1 282 ? 72.064  -21.364 25.070   1.00 27.05  ? 257 ASP A CA  1 
ATOM   1936  C  C   . ASP A  1 282 ? 71.694  -21.573 23.600   1.00 27.59  ? 257 ASP A C   1 
ATOM   1937  O  O   . ASP A  1 282 ? 70.517  -21.673 23.260   1.00 28.75  ? 257 ASP A O   1 
ATOM   1938  C  CB  . ASP A  1 282 ? 71.350  -20.111 25.595   1.00 26.97  ? 257 ASP A CB  1 
ATOM   1939  C  CG  . ASP A  1 282 ? 71.623  -18.872 24.736   1.00 26.60  ? 257 ASP A CG  1 
ATOM   1940  O  OD1 . ASP A  1 282 ? 72.697  -18.800 24.095   1.00 25.60  ? 257 ASP A OD1 1 
ATOM   1941  O  OD2 . ASP A  1 282 ? 70.753  -17.968 24.712   1.00 27.19  ? 257 ASP A OD2 1 
ATOM   1942  N  N   . ALA A  1 283 ? 72.705  -21.608 22.738   1.00 27.22  ? 258 ALA A N   1 
ATOM   1943  C  CA  . ALA A  1 283 ? 72.520  -21.723 21.291   1.00 25.92  ? 258 ALA A CA  1 
ATOM   1944  C  C   . ALA A  1 283 ? 71.872  -23.048 20.865   1.00 27.31  ? 258 ALA A C   1 
ATOM   1945  O  O   . ALA A  1 283 ? 71.885  -24.037 21.609   1.00 26.57  ? 258 ALA A O   1 
ATOM   1946  C  CB  . ALA A  1 283 ? 73.849  -21.543 20.592   1.00 23.65  ? 258 ALA A CB  1 
ATOM   1947  N  N   . ASP A  1 284 ? 71.308  -23.065 19.659   1.00 28.48  ? 259 ASP A N   1 
ATOM   1948  C  CA  . ASP A  1 284 ? 70.863  -24.318 19.075   1.00 28.71  ? 259 ASP A CA  1 
ATOM   1949  C  C   . ASP A  1 284 ? 72.099  -25.011 18.530   1.00 26.92  ? 259 ASP A C   1 
ATOM   1950  O  O   . ASP A  1 284 ? 72.621  -24.632 17.489   1.00 27.19  ? 259 ASP A O   1 
ATOM   1951  C  CB  . ASP A  1 284 ? 69.815  -24.098 17.986   1.00 29.29  ? 259 ASP A CB  1 
ATOM   1952  C  CG  . ASP A  1 284 ? 69.200  -25.406 17.493   1.00 32.00  ? 259 ASP A CG  1 
ATOM   1953  O  OD1 . ASP A  1 284 ? 69.883  -26.453 17.485   1.00 31.15  ? 259 ASP A OD1 1 
ATOM   1954  O  OD2 . ASP A  1 284 ? 68.026  -25.388 17.081   1.00 35.45  ? 259 ASP A OD2 1 
ATOM   1955  N  N   . LEU A  1 285 ? 72.557  -26.026 19.258   1.00 26.34  ? 260 LEU A N   1 
ATOM   1956  C  CA  . LEU A  1 285 ? 73.809  -26.717 18.946   1.00 25.91  ? 260 LEU A CA  1 
ATOM   1957  C  C   . LEU A  1 285 ? 73.788  -27.549 17.668   1.00 24.34  ? 260 LEU A C   1 
ATOM   1958  O  O   . LEU A  1 285 ? 74.813  -27.668 17.008   1.00 23.41  ? 260 LEU A O   1 
ATOM   1959  C  CB  . LEU A  1 285 ? 74.279  -27.579 20.139   1.00 26.30  ? 260 LEU A CB  1 
ATOM   1960  C  CG  . LEU A  1 285 ? 74.745  -26.818 21.387   1.00 27.22  ? 260 LEU A CG  1 
ATOM   1961  C  CD1 . LEU A  1 285 ? 75.433  -27.751 22.380   1.00 27.13  ? 260 LEU A CD1 1 
ATOM   1962  C  CD2 . LEU A  1 285 ? 75.645  -25.630 21.031   1.00 26.80  ? 260 LEU A CD2 1 
ATOM   1963  N  N   . ASP A  1 286 ? 72.640  -28.144 17.350   1.00 24.21  ? 261 ASP A N   1 
ATOM   1964  C  CA  . ASP A  1 286 ? 72.450  -28.852 16.080   1.00 25.62  ? 261 ASP A CA  1 
ATOM   1965  C  C   . ASP A  1 286 ? 72.624  -27.922 14.885   1.00 25.37  ? 261 ASP A C   1 
ATOM   1966  O  O   . ASP A  1 286 ? 73.359  -28.234 13.953   1.00 24.82  ? 261 ASP A O   1 
ATOM   1967  C  CB  . ASP A  1 286 ? 71.065  -29.507 16.018   1.00 27.52  ? 261 ASP A CB  1 
ATOM   1968  C  CG  . ASP A  1 286 ? 70.983  -30.790 16.834   1.00 30.57  ? 261 ASP A CG  1 
ATOM   1969  O  OD1 . ASP A  1 286 ? 72.027  -31.401 17.127   1.00 31.12  ? 261 ASP A OD1 1 
ATOM   1970  O  OD2 . ASP A  1 286 ? 69.864  -31.208 17.176   1.00 33.63  ? 261 ASP A OD2 1 
ATOM   1971  N  N   . GLN A  1 287 ? 71.931  -26.786 14.918   1.00 25.59  ? 262 GLN A N   1 
ATOM   1972  C  CA  . GLN A  1 287 ? 72.076  -25.746 13.894   1.00 25.15  ? 262 GLN A CA  1 
ATOM   1973  C  C   . GLN A  1 287 ? 73.488  -25.153 13.869   1.00 24.14  ? 262 GLN A C   1 
ATOM   1974  O  O   . GLN A  1 287 ? 74.031  -24.902 12.791   1.00 24.67  ? 262 GLN A O   1 
ATOM   1975  C  CB  . GLN A  1 287 ? 71.013  -24.654 14.081   1.00 25.36  ? 262 GLN A CB  1 
ATOM   1976  C  CG  . GLN A  1 287 ? 69.593  -25.173 13.845   1.00 26.58  ? 262 GLN A CG  1 
ATOM   1977  C  CD  . GLN A  1 287 ? 68.517  -24.126 14.098   1.00 28.05  ? 262 GLN A CD  1 
ATOM   1978  O  OE1 . GLN A  1 287 ? 68.812  -22.961 14.368   1.00 28.94  ? 262 GLN A OE1 1 
ATOM   1979  N  NE2 . GLN A  1 287 ? 67.258  -24.538 14.001   1.00 27.75  ? 262 GLN A NE2 1 
ATOM   1980  N  N   . ALA A  1 288 ? 74.085  -24.938 15.038   1.00 22.91  ? 263 ALA A N   1 
ATOM   1981  C  CA  . ALA A  1 288 ? 75.473  -24.455 15.089   1.00 23.44  ? 263 ALA A CA  1 
ATOM   1982  C  C   . ALA A  1 288 ? 76.459  -25.435 14.415   1.00 23.78  ? 263 ALA A C   1 
ATOM   1983  O  O   . ALA A  1 288 ? 77.311  -25.024 13.610   1.00 23.10  ? 263 ALA A O   1 
ATOM   1984  C  CB  . ALA A  1 288 ? 75.891  -24.136 16.526   1.00 23.51  ? 263 ALA A CB  1 
ATOM   1985  N  N   . ALA A  1 289 ? 76.331  -26.728 14.724   1.00 24.26  ? 264 ALA A N   1 
ATOM   1986  C  CA  . ALA A  1 289 ? 77.180  -27.754 14.089   1.00 24.95  ? 264 ALA A CA  1 
ATOM   1987  C  C   . ALA A  1 289 ? 76.977  -27.787 12.562   1.00 24.81  ? 264 ALA A C   1 
ATOM   1988  O  O   . ALA A  1 289 ? 77.943  -27.739 11.797   1.00 23.30  ? 264 ALA A O   1 
ATOM   1989  C  CB  . ALA A  1 289 ? 76.921  -29.124 14.703   1.00 25.51  ? 264 ALA A CB  1 
ATOM   1990  N  N   . ASN A  1 290 ? 75.715  -27.854 12.136   1.00 26.26  ? 265 ASN A N   1 
ATOM   1991  C  CA  . ASN A  1 290 ? 75.350  -27.759 10.717   1.00 28.37  ? 265 ASN A CA  1 
ATOM   1992  C  C   . ASN A  1 290 ? 75.915  -26.525 10.001   1.00 28.07  ? 265 ASN A C   1 
ATOM   1993  O  O   . ASN A  1 290 ? 76.370  -26.624 8.862    1.00 30.41  ? 265 ASN A O   1 
ATOM   1994  C  CB  . ASN A  1 290 ? 73.826  -27.811 10.549   1.00 29.60  ? 265 ASN A CB  1 
ATOM   1995  C  CG  . ASN A  1 290 ? 73.277  -29.214 10.712   1.00 32.30  ? 265 ASN A CG  1 
ATOM   1996  O  OD1 . ASN A  1 290 ? 74.037  -30.174 10.808   1.00 34.37  ? 265 ASN A OD1 1 
ATOM   1997  N  ND2 . ASN A  1 290 ? 71.960  -29.342 10.743   1.00 31.62  ? 265 ASN A ND2 1 
ATOM   1998  N  N   . ALA A  1 291 ? 75.885  -25.379 10.674   1.00 26.02  ? 266 ALA A N   1 
ATOM   1999  C  CA  . ALA A  1 291 ? 76.421  -24.132 10.130   1.00 25.36  ? 266 ALA A CA  1 
ATOM   2000  C  C   . ALA A  1 291 ? 77.912  -24.210 9.972    1.00 25.06  ? 266 ALA A C   1 
ATOM   2001  O  O   . ALA A  1 291 ? 78.451  -23.667 9.025    1.00 25.51  ? 266 ALA A O   1 
ATOM   2002  C  CB  . ALA A  1 291 ? 76.070  -22.954 11.028   1.00 25.13  ? 266 ALA A CB  1 
ATOM   2003  N  N   . LEU A  1 292 ? 78.574  -24.877 10.910   1.00 25.08  ? 267 LEU A N   1 
ATOM   2004  C  CA  . LEU A  1 292 ? 80.028  -24.939 10.916   1.00 24.93  ? 267 LEU A CA  1 
ATOM   2005  C  C   . LEU A  1 292 ? 80.569  -25.837 9.818    1.00 25.53  ? 267 LEU A C   1 
ATOM   2006  O  O   . LEU A  1 292 ? 81.594  -25.532 9.206    1.00 24.33  ? 267 LEU A O   1 
ATOM   2007  C  CB  . LEU A  1 292 ? 80.557  -25.390 12.283   1.00 24.67  ? 267 LEU A CB  1 
ATOM   2008  C  CG  . LEU A  1 292 ? 80.662  -24.281 13.341   1.00 24.26  ? 267 LEU A CG  1 
ATOM   2009  C  CD1 . LEU A  1 292 ? 81.038  -24.871 14.693   1.00 24.78  ? 267 LEU A CD1 1 
ATOM   2010  C  CD2 . LEU A  1 292 ? 81.679  -23.224 12.922   1.00 23.10  ? 267 LEU A CD2 1 
ATOM   2011  N  N   . ILE A  1 293 ? 79.885  -26.947 9.560    1.00 26.62  ? 268 ILE A N   1 
ATOM   2012  C  CA  . ILE A  1 293 ? 80.300  -27.857 8.514    1.00 27.78  ? 268 ILE A CA  1 
ATOM   2013  C  C   . ILE A  1 293 ? 80.225  -27.194 7.140    1.00 26.81  ? 268 ILE A C   1 
ATOM   2014  O  O   . ILE A  1 293 ? 81.155  -27.222 6.396    1.00 26.49  ? 268 ILE A O   1 
ATOM   2015  C  CB  . ILE A  1 293 ? 79.500  -29.167 8.501    1.00 31.46  ? 268 ILE A CB  1 
ATOM   2016  C  CG1 . ILE A  1 293 ? 80.158  -30.213 7.616    1.00 34.63  ? 268 ILE A CG1 1 
ATOM   2017  C  CG2 . ILE A  1 293 ? 78.130  -28.969 7.923    1.00 31.71  ? 268 ILE A CG2 1 
ATOM   2018  C  CD1 . ILE A  1 293 ? 81.470  -30.706 8.141    1.00 38.20  ? 268 ILE A CD1 1 
ATOM   2019  N  N   . GLY A  1 294 ? 79.120  -26.530 6.896    1.00 25.29  ? 269 GLY A N   1 
ATOM   2020  C  CA  . GLY A  1 294 ? 78.932  -25.746 5.684    1.00 24.09  ? 269 GLY A CA  1 
ATOM   2021  C  C   . GLY A  1 294 ? 79.847  -24.535 5.584    1.00 23.66  ? 269 GLY A C   1 
ATOM   2022  O  O   . GLY A  1 294 ? 80.446  -24.296 4.540    1.00 23.63  ? 269 GLY A O   1 
ATOM   2023  N  N   . ALA A  1 295 ? 79.972  -23.771 6.667    1.00 22.73  ? 270 ALA A N   1 
ATOM   2024  C  CA  . ALA A  1 295 ? 80.738  -22.523 6.597    1.00 21.46  ? 270 ALA A CA  1 
ATOM   2025  C  C   . ALA A  1 295 ? 82.223  -22.784 6.667    1.00 21.34  ? 270 ALA A C   1 
ATOM   2026  O  O   . ALA A  1 295 ? 83.003  -21.990 6.167    1.00 20.60  ? 270 ALA A O   1 
ATOM   2027  C  CB  . ALA A  1 295 ? 80.309  -21.542 7.675    1.00 20.97  ? 270 ALA A CB  1 
ATOM   2028  N  N   . GLY A  1 296 ? 82.611  -23.897 7.291    1.00 21.85  ? 271 GLY A N   1 
ATOM   2029  C  CA  . GLY A  1 296 ? 84.028  -24.212 7.445    1.00 22.45  ? 271 GLY A CA  1 
ATOM   2030  C  C   . GLY A  1 296 ? 84.622  -24.890 6.216    1.00 23.09  ? 271 GLY A C   1 
ATOM   2031  O  O   . GLY A  1 296 ? 85.785  -24.644 5.847    1.00 24.38  ? 271 GLY A O   1 
ATOM   2032  N  N   . TYR A  1 297 ? 83.809  -25.720 5.567    1.00 21.23  ? 272 TYR A N   1 
ATOM   2033  C  CA  . TYR A  1 297 ? 84.306  -26.668 4.572    1.00 22.16  ? 272 TYR A CA  1 
ATOM   2034  C  C   . TYR A  1 297 ? 83.707  -26.470 3.184    1.00 23.36  ? 272 TYR A C   1 
ATOM   2035  O  O   . TYR A  1 297 ? 84.226  -27.022 2.206    1.00 24.70  ? 272 TYR A O   1 
ATOM   2036  C  CB  . TYR A  1 297 ? 84.149  -28.118 5.067    1.00 21.86  ? 272 TYR A CB  1 
ATOM   2037  C  CG  . TYR A  1 297 ? 84.888  -28.367 6.375    1.00 22.32  ? 272 TYR A CG  1 
ATOM   2038  C  CD1 . TYR A  1 297 ? 86.250  -28.709 6.388    1.00 21.76  ? 272 TYR A CD1 1 
ATOM   2039  C  CD2 . TYR A  1 297 ? 84.236  -28.222 7.605    1.00 22.54  ? 272 TYR A CD2 1 
ATOM   2040  C  CE1 . TYR A  1 297 ? 86.924  -28.900 7.585    1.00 21.93  ? 272 TYR A CE1 1 
ATOM   2041  C  CE2 . TYR A  1 297 ? 84.908  -28.427 8.809    1.00 22.53  ? 272 TYR A CE2 1 
ATOM   2042  C  CZ  . TYR A  1 297 ? 86.244  -28.768 8.797    1.00 22.18  ? 272 TYR A CZ  1 
ATOM   2043  O  OH  . TYR A  1 297 ? 86.891  -28.990 10.001   1.00 22.52  ? 272 TYR A OH  1 
ATOM   2044  N  N   . GLY A  1 298 ? 82.644  -25.672 3.092    1.00 22.61  ? 273 GLY A N   1 
ATOM   2045  C  CA  . GLY A  1 298 ? 82.147  -25.229 1.800    1.00 22.48  ? 273 GLY A CA  1 
ATOM   2046  C  C   . GLY A  1 298 ? 83.266  -24.620 0.966    1.00 23.46  ? 273 GLY A C   1 
ATOM   2047  O  O   . GLY A  1 298 ? 84.084  -23.832 1.478    1.00 23.82  ? 273 GLY A O   1 
ATOM   2048  N  N   . SER A  1 299 ? 83.304  -25.001 -0.315   1.00 23.61  ? 274 SER A N   1 
ATOM   2049  C  CA  . SER A  1 299 ? 84.339  -24.582 -1.273   1.00 24.42  ? 274 SER A CA  1 
ATOM   2050  C  C   . SER A  1 299 ? 85.764  -24.880 -0.777   1.00 25.25  ? 274 SER A C   1 
ATOM   2051  O  O   . SER A  1 299 ? 86.718  -24.140 -1.087   1.00 25.75  ? 274 SER A O   1 
ATOM   2052  C  CB  . SER A  1 299 ? 84.186  -23.098 -1.649   1.00 25.42  ? 274 SER A CB  1 
ATOM   2053  O  OG  . SER A  1 299 ? 82.885  -22.823 -2.155   1.00 27.38  ? 274 SER A OG  1 
ATOM   2054  N  N   . ALA A  1 300 ? 85.896  -25.968 -0.016   1.00 25.14  ? 275 ALA A N   1 
ATOM   2055  C  CA  . ALA A  1 300 ? 87.163  -26.366 0.628    1.00 24.24  ? 275 ALA A CA  1 
ATOM   2056  C  C   . ALA A  1 300 ? 87.757  -25.262 1.516    1.00 23.47  ? 275 ALA A C   1 
ATOM   2057  O  O   . ALA A  1 300 ? 88.968  -25.195 1.696    1.00 23.61  ? 275 ALA A O   1 
ATOM   2058  C  CB  . ALA A  1 300 ? 88.179  -26.848 -0.411   1.00 22.59  ? 275 ALA A CB  1 
ATOM   2059  N  N   . GLY A  1 301 ? 86.897  -24.403 2.058    1.00 22.49  ? 276 GLY A N   1 
ATOM   2060  C  CA  . GLY A  1 301 ? 87.332  -23.299 2.905    1.00 22.58  ? 276 GLY A CA  1 
ATOM   2061  C  C   . GLY A  1 301 ? 87.993  -22.150 2.161    1.00 22.44  ? 276 GLY A C   1 
ATOM   2062  O  O   . GLY A  1 301 ? 88.566  -21.251 2.780    1.00 21.80  ? 276 GLY A O   1 
ATOM   2063  N  N   . GLU A  1 302 ? 87.919  -22.176 0.831    1.00 22.11  ? 277 GLU A N   1 
ATOM   2064  C  CA  . GLU A  1 302 ? 88.477  -21.114 0.015    1.00 22.77  ? 277 GLU A CA  1 
ATOM   2065  C  C   . GLU A  1 302 ? 87.527  -19.911 -0.132   1.00 25.28  ? 277 GLU A C   1 
ATOM   2066  O  O   . GLU A  1 302 ? 87.109  -19.552 -1.251   1.00 25.36  ? 277 GLU A O   1 
ATOM   2067  C  CB  . GLU A  1 302 ? 88.865  -21.662 -1.351   1.00 23.16  ? 277 GLU A CB  1 
ATOM   2068  C  CG  . GLU A  1 302 ? 89.953  -22.729 -1.307   1.00 23.79  ? 277 GLU A CG  1 
ATOM   2069  C  CD  . GLU A  1 302 ? 90.237  -23.306 -2.676   1.00 22.85  ? 277 GLU A CD  1 
ATOM   2070  O  OE1 . GLU A  1 302 ? 91.427  -23.380 -3.051   1.00 22.32  ? 277 GLU A OE1 1 
ATOM   2071  O  OE2 . GLU A  1 302 ? 89.265  -23.662 -3.383   1.00 22.88  ? 277 GLU A OE2 1 
ATOM   2072  N  N   . ARG A  1 303 ? 87.197  -19.277 0.997    1.00 25.78  ? 278 ARG A N   1 
ATOM   2073  C  CA  . ARG A  1 303 ? 86.329  -18.083 0.997    1.00 25.52  ? 278 ARG A CA  1 
ATOM   2074  C  C   . ARG A  1 303 ? 86.790  -17.070 2.051    1.00 23.65  ? 278 ARG A C   1 
ATOM   2075  O  O   . ARG A  1 303 ? 87.147  -17.447 3.184    1.00 24.53  ? 278 ARG A O   1 
ATOM   2076  C  CB  . ARG A  1 303 ? 84.865  -18.467 1.271    1.00 27.62  ? 278 ARG A CB  1 
ATOM   2077  C  CG  . ARG A  1 303 ? 84.243  -19.443 0.286    1.00 30.12  ? 278 ARG A CG  1 
ATOM   2078  C  CD  . ARG A  1 303 ? 82.785  -19.667 0.611    1.00 33.00  ? 278 ARG A CD  1 
ATOM   2079  N  NE  . ARG A  1 303 ? 82.080  -18.388 0.596    1.00 39.73  ? 278 ARG A NE  1 
ATOM   2080  C  CZ  . ARG A  1 303 ? 80.759  -18.241 0.614    1.00 43.10  ? 278 ARG A CZ  1 
ATOM   2081  N  NH1 . ARG A  1 303 ? 80.239  -17.018 0.593    1.00 46.90  ? 278 ARG A NH1 1 
ATOM   2082  N  NH2 . ARG A  1 303 ? 79.958  -19.302 0.656    1.00 41.44  ? 278 ARG A NH2 1 
ATOM   2083  N  N   . CYS A  1 304 ? 86.770  -15.788 1.704    1.00 21.00  ? 279 CYS A N   1 
ATOM   2084  C  CA  . CYS A  1 304 ? 87.061  -14.760 2.696    1.00 22.98  ? 279 CYS A CA  1 
ATOM   2085  C  C   . CYS A  1 304 ? 85.890  -14.582 3.680    1.00 22.28  ? 279 CYS A C   1 
ATOM   2086  O  O   . CYS A  1 304 ? 85.923  -13.690 4.524    1.00 23.25  ? 279 CYS A O   1 
ATOM   2087  C  CB  . CYS A  1 304 ? 87.373  -13.425 2.024    1.00 25.61  ? 279 CYS A CB  1 
ATOM   2088  S  SG  . CYS A  1 304 ? 85.885  -12.660 1.348    1.00 30.21  ? 279 CYS A SG  1 
HETATM 2089  N  N   . MSE A  1 305 ? 84.846  -15.401 3.529    1.00 21.91  ? 280 MSE A N   1 
HETATM 2090  C  CA  . MSE A  1 305 ? 83.725  -15.461 4.484    1.00 22.53  ? 280 MSE A CA  1 
HETATM 2091  C  C   . MSE A  1 305 ? 83.517  -16.881 4.996    1.00 21.45  ? 280 MSE A C   1 
HETATM 2092  O  O   . MSE A  1 305 ? 82.459  -17.206 5.553    1.00 20.60  ? 280 MSE A O   1 
HETATM 2093  C  CB  . MSE A  1 305 ? 82.435  -14.890 3.882    1.00 23.42  ? 280 MSE A CB  1 
HETATM 2094  C  CG  . MSE A  1 305 ? 82.597  -13.424 3.458    1.00 25.74  ? 280 MSE A CG  1 
HETATM 2095  SE SE  . MSE A  1 305 ? 82.740  -12.208 5.016    1.00 28.83  ? 280 MSE A SE  1 
HETATM 2096  C  CE  . MSE A  1 305 ? 80.837  -12.267 5.536    1.00 27.06  ? 280 MSE A CE  1 
ATOM   2097  N  N   . ALA A  1 306 ? 84.519  -17.740 4.808    1.00 20.32  ? 281 ALA A N   1 
ATOM   2098  C  CA  . ALA A  1 306 ? 84.526  -19.036 5.494    1.00 20.49  ? 281 ALA A CA  1 
ATOM   2099  C  C   . ALA A  1 306 ? 84.674  -18.754 6.977    1.00 20.01  ? 281 ALA A C   1 
ATOM   2100  O  O   . ALA A  1 306 ? 85.354  -17.781 7.362    1.00 18.92  ? 281 ALA A O   1 
ATOM   2101  C  CB  . ALA A  1 306 ? 85.678  -19.915 5.014    1.00 19.68  ? 281 ALA A CB  1 
ATOM   2102  N  N   . ILE A  1 307 ? 84.016  -19.579 7.794    1.00 19.87  ? 282 ILE A N   1 
ATOM   2103  C  CA  . ILE A  1 307 ? 84.297  -19.611 9.229    1.00 20.56  ? 282 ILE A CA  1 
ATOM   2104  C  C   . ILE A  1 307 ? 85.543  -20.471 9.408    1.00 20.77  ? 282 ILE A C   1 
ATOM   2105  O  O   . ILE A  1 307 ? 85.546  -21.674 9.078    1.00 21.15  ? 282 ILE A O   1 
ATOM   2106  C  CB  . ILE A  1 307 ? 83.099  -20.122 10.081   1.00 21.27  ? 282 ILE A CB  1 
ATOM   2107  C  CG1 . ILE A  1 307 ? 81.916  -19.134 10.019   1.00 21.64  ? 282 ILE A CG1 1 
ATOM   2108  C  CG2 . ILE A  1 307 ? 83.506  -20.375 11.537   1.00 21.87  ? 282 ILE A CG2 1 
ATOM   2109  C  CD1 . ILE A  1 307 ? 82.150  -17.758 10.645   1.00 21.40  ? 282 ILE A CD1 1 
ATOM   2110  N  N   . SER A  1 308 ? 86.613  -19.844 9.888    1.00 19.88  ? 283 SER A N   1 
ATOM   2111  C  CA  . SER A  1 308 ? 87.877  -20.564 10.136   1.00 20.31  ? 283 SER A CA  1 
ATOM   2112  C  C   . SER A  1 308 ? 88.167  -20.792 11.629   1.00 20.78  ? 283 SER A C   1 
ATOM   2113  O  O   . SER A  1 308 ? 89.052  -21.583 11.961   1.00 22.00  ? 283 SER A O   1 
ATOM   2114  C  CB  . SER A  1 308 ? 89.045  -19.845 9.461    1.00 19.34  ? 283 SER A CB  1 
ATOM   2115  O  OG  . SER A  1 308 ? 89.007  -18.467 9.772    1.00 18.68  ? 283 SER A OG  1 
ATOM   2116  N  N   . VAL A  1 309 ? 87.417  -20.116 12.512   1.00 20.17  ? 284 VAL A N   1 
ATOM   2117  C  CA  . VAL A  1 309 ? 87.579  -20.238 13.975   1.00 21.01  ? 284 VAL A CA  1 
ATOM   2118  C  C   . VAL A  1 309 ? 86.224  -20.370 14.657   1.00 22.06  ? 284 VAL A C   1 
ATOM   2119  O  O   . VAL A  1 309 ? 85.350  -19.514 14.472   1.00 23.23  ? 284 VAL A O   1 
ATOM   2120  C  CB  . VAL A  1 309 ? 88.283  -19.021 14.646   1.00 20.55  ? 284 VAL A CB  1 
ATOM   2121  C  CG1 . VAL A  1 309 ? 88.438  -19.273 16.150   1.00 20.75  ? 284 VAL A CG1 1 
ATOM   2122  C  CG2 . VAL A  1 309 ? 89.638  -18.735 14.036   1.00 19.79  ? 284 VAL A CG2 1 
ATOM   2123  N  N   . ALA A  1 310 ? 86.058  -21.428 15.445   1.00 21.62  ? 285 ALA A N   1 
ATOM   2124  C  CA  . ALA A  1 310 ? 84.854  -21.627 16.256   1.00 21.66  ? 285 ALA A CA  1 
ATOM   2125  C  C   . ALA A  1 310 ? 85.210  -21.351 17.711   1.00 21.44  ? 285 ALA A C   1 
ATOM   2126  O  O   . ALA A  1 310 ? 86.206  -21.878 18.215   1.00 21.35  ? 285 ALA A O   1 
ATOM   2127  C  CB  . ALA A  1 310 ? 84.298  -23.049 16.093   1.00 21.28  ? 285 ALA A CB  1 
ATOM   2128  N  N   . VAL A  1 311 ? 84.396  -20.518 18.365   1.00 21.31  ? 286 VAL A N   1 
ATOM   2129  C  CA  . VAL A  1 311 ? 84.626  -20.073 19.743   1.00 21.53  ? 286 VAL A CA  1 
ATOM   2130  C  C   . VAL A  1 311 ? 83.425  -20.460 20.628   1.00 22.34  ? 286 VAL A C   1 
ATOM   2131  O  O   . VAL A  1 311 ? 82.541  -19.628 20.889   1.00 21.41  ? 286 VAL A O   1 
ATOM   2132  C  CB  . VAL A  1 311 ? 84.891  -18.545 19.804   1.00 20.86  ? 286 VAL A CB  1 
ATOM   2133  C  CG1 . VAL A  1 311 ? 85.164  -18.107 21.226   1.00 21.61  ? 286 VAL A CG1 1 
ATOM   2134  C  CG2 . VAL A  1 311 ? 86.056  -18.152 18.910   1.00 19.91  ? 286 VAL A CG2 1 
ATOM   2135  N  N   . PRO A  1 312 ? 83.371  -21.740 21.069   1.00 23.78  ? 287 PRO A N   1 
ATOM   2136  C  CA  . PRO A  1 312 ? 82.332  -22.135 22.027   1.00 24.62  ? 287 PRO A CA  1 
ATOM   2137  C  C   . PRO A  1 312 ? 82.622  -21.473 23.362   1.00 25.59  ? 287 PRO A C   1 
ATOM   2138  O  O   . PRO A  1 312 ? 83.795  -21.278 23.710   1.00 26.99  ? 287 PRO A O   1 
ATOM   2139  C  CB  . PRO A  1 312 ? 82.496  -23.665 22.132   1.00 24.55  ? 287 PRO A CB  1 
ATOM   2140  C  CG  . PRO A  1 312 ? 83.906  -23.924 21.735   1.00 23.92  ? 287 PRO A CG  1 
ATOM   2141  C  CD  . PRO A  1 312 ? 84.277  -22.861 20.741   1.00 23.46  ? 287 PRO A CD  1 
ATOM   2142  N  N   . VAL A  1 313 ? 81.572  -21.115 24.087   1.00 25.21  ? 288 VAL A N   1 
ATOM   2143  C  CA  . VAL A  1 313 ? 81.728  -20.441 25.374   1.00 26.20  ? 288 VAL A CA  1 
ATOM   2144  C  C   . VAL A  1 313 ? 81.434  -21.469 26.461   1.00 27.48  ? 288 VAL A C   1 
ATOM   2145  O  O   . VAL A  1 313 ? 80.336  -22.028 26.508   1.00 27.94  ? 288 VAL A O   1 
ATOM   2146  C  CB  . VAL A  1 313 ? 80.781  -19.214 25.487   1.00 25.92  ? 288 VAL A CB  1 
ATOM   2147  C  CG1 . VAL A  1 313 ? 81.008  -18.460 26.799   1.00 26.05  ? 288 VAL A CG1 1 
ATOM   2148  C  CG2 . VAL A  1 313 ? 80.963  -18.289 24.283   1.00 24.90  ? 288 VAL A CG2 1 
ATOM   2149  N  N   . GLY A  1 314 ? 82.423  -21.730 27.309   1.00 28.51  ? 289 GLY A N   1 
ATOM   2150  C  CA  . GLY A  1 314 ? 82.299  -22.736 28.354   1.00 30.04  ? 289 GLY A CA  1 
ATOM   2151  C  C   . GLY A  1 314 ? 82.622  -24.142 27.876   1.00 31.42  ? 289 GLY A C   1 
ATOM   2152  O  O   . GLY A  1 314 ? 82.321  -24.515 26.734   1.00 31.00  ? 289 GLY A O   1 
ATOM   2153  N  N   . GLU A  1 315 ? 83.215  -24.927 28.770   1.00 33.57  ? 290 GLU A N   1 
ATOM   2154  C  CA  . GLU A  1 315 ? 83.659  -26.278 28.460   1.00 39.47  ? 290 GLU A CA  1 
ATOM   2155  C  C   . GLU A  1 315 ? 82.542  -27.181 27.942   1.00 37.97  ? 290 GLU A C   1 
ATOM   2156  O  O   . GLU A  1 315 ? 82.754  -27.935 26.991   1.00 38.48  ? 290 GLU A O   1 
ATOM   2157  C  CB  . GLU A  1 315 ? 84.334  -26.935 29.680   1.00 48.92  ? 290 GLU A CB  1 
ATOM   2158  C  CG  . GLU A  1 315 ? 85.771  -26.485 29.943   1.00 59.38  ? 290 GLU A CG  1 
ATOM   2159  C  CD  . GLU A  1 315 ? 86.745  -26.908 28.849   1.00 65.38  ? 290 GLU A CD  1 
ATOM   2160  O  OE1 . GLU A  1 315 ? 87.128  -28.097 28.812   1.00 65.94  ? 290 GLU A OE1 1 
ATOM   2161  O  OE2 . GLU A  1 315 ? 87.134  -26.047 28.028   1.00 67.06  ? 290 GLU A OE2 1 
ATOM   2162  N  N   . GLU A  1 316 ? 81.362  -27.113 28.556   1.00 37.09  ? 291 GLU A N   1 
ATOM   2163  C  CA  . GLU A  1 316 ? 80.281  -28.020 28.171   1.00 37.39  ? 291 GLU A CA  1 
ATOM   2164  C  C   . GLU A  1 316 ? 79.855  -27.780 26.725   1.00 34.41  ? 291 GLU A C   1 
ATOM   2165  O  O   . GLU A  1 316 ? 79.671  -28.726 25.955   1.00 35.34  ? 291 GLU A O   1 
ATOM   2166  C  CB  . GLU A  1 316 ? 79.079  -27.922 29.110   1.00 41.37  ? 291 GLU A CB  1 
ATOM   2167  C  CG  . GLU A  1 316 ? 78.265  -29.209 29.123   1.00 48.51  ? 291 GLU A CG  1 
ATOM   2168  C  CD  . GLU A  1 316 ? 76.821  -29.009 29.535   1.00 56.98  ? 291 GLU A CD  1 
ATOM   2169  O  OE1 . GLU A  1 316 ? 75.936  -29.561 28.841   1.00 60.09  ? 291 GLU A OE1 1 
ATOM   2170  O  OE2 . GLU A  1 316 ? 76.572  -28.309 30.544   1.00 59.58  ? 291 GLU A OE2 1 
ATOM   2171  N  N   . THR A  1 317 ? 79.724  -26.508 26.365   1.00 32.24  ? 292 THR A N   1 
ATOM   2172  C  CA  . THR A  1 317 ? 79.389  -26.116 25.001   1.00 31.29  ? 292 THR A CA  1 
ATOM   2173  C  C   . THR A  1 317 ? 80.416  -26.641 23.995   1.00 29.51  ? 292 THR A C   1 
ATOM   2174  O  O   . THR A  1 317 ? 80.026  -27.236 22.997   1.00 29.06  ? 292 THR A O   1 
ATOM   2175  C  CB  . THR A  1 317 ? 79.207  -24.595 24.873   1.00 30.84  ? 292 THR A CB  1 
ATOM   2176  O  OG1 . THR A  1 317 ? 78.241  -24.160 25.841   1.00 32.05  ? 292 THR A OG1 1 
ATOM   2177  C  CG2 . THR A  1 317 ? 78.719  -24.232 23.477   1.00 30.28  ? 292 THR A CG2 1 
ATOM   2178  N  N   . ALA A  1 318 ? 81.708  -26.431 24.277   1.00 28.11  ? 293 ALA A N   1 
ATOM   2179  C  CA  . ALA A  1 318 ? 82.795  -26.924 23.432   1.00 27.20  ? 293 ALA A CA  1 
ATOM   2180  C  C   . ALA A  1 318 ? 82.662  -28.409 23.206   1.00 28.21  ? 293 ALA A C   1 
ATOM   2181  O  O   . ALA A  1 318 ? 82.599  -28.849 22.063   1.00 28.28  ? 293 ALA A O   1 
ATOM   2182  C  CB  . ALA A  1 318 ? 84.157  -26.595 24.034   1.00 26.65  ? 293 ALA A CB  1 
ATOM   2183  N  N   . ASN A  1 319 ? 82.571  -29.166 24.302   1.00 29.26  ? 294 ASN A N   1 
ATOM   2184  C  CA  . ASN A  1 319 ? 82.494  -30.631 24.245   1.00 30.55  ? 294 ASN A CA  1 
ATOM   2185  C  C   . ASN A  1 319 ? 81.293  -31.158 23.489   1.00 30.00  ? 294 ASN A C   1 
ATOM   2186  O  O   . ASN A  1 319 ? 81.417  -32.115 22.730   1.00 28.97  ? 294 ASN A O   1 
ATOM   2187  C  CB  . ASN A  1 319 ? 82.492  -31.235 25.651   1.00 31.61  ? 294 ASN A CB  1 
ATOM   2188  C  CG  . ASN A  1 319 ? 83.799  -31.009 26.376   1.00 32.37  ? 294 ASN A CG  1 
ATOM   2189  O  OD1 . ASN A  1 319 ? 84.786  -30.540 25.783   1.00 31.91  ? 294 ASN A OD1 1 
ATOM   2190  N  ND2 . ASN A  1 319 ? 83.817  -31.335 27.671   1.00 31.60  ? 294 ASN A ND2 1 
ATOM   2191  N  N   . ARG A  1 320 ? 80.134  -30.544 23.725   1.00 30.99  ? 295 ARG A N   1 
ATOM   2192  C  CA  . ARG A  1 320 ? 78.908  -30.962 23.060   1.00 33.11  ? 295 ARG A CA  1 
ATOM   2193  C  C   . ARG A  1 320 ? 78.952  -30.613 21.574   1.00 31.69  ? 295 ARG A C   1 
ATOM   2194  O  O   . ARG A  1 320 ? 78.498  -31.404 20.744   1.00 33.07  ? 295 ARG A O   1 
ATOM   2195  C  CB  . ARG A  1 320 ? 77.674  -30.358 23.731   1.00 36.91  ? 295 ARG A CB  1 
ATOM   2196  C  CG  . ARG A  1 320 ? 77.316  -30.994 25.068   1.00 43.29  ? 295 ARG A CG  1 
ATOM   2197  C  CD  . ARG A  1 320 ? 75.836  -30.815 25.378   1.00 49.70  ? 295 ARG A CD  1 
ATOM   2198  N  NE  . ARG A  1 320 ? 75.004  -31.520 24.398   1.00 55.87  ? 295 ARG A NE  1 
ATOM   2199  C  CZ  . ARG A  1 320 ? 73.849  -31.064 23.920   1.00 57.60  ? 295 ARG A CZ  1 
ATOM   2200  N  NH1 . ARG A  1 320 ? 73.373  -29.892 24.322   1.00 60.10  ? 295 ARG A NH1 1 
ATOM   2201  N  NH2 . ARG A  1 320 ? 73.171  -31.776 23.032   1.00 55.39  ? 295 ARG A NH2 1 
ATOM   2202  N  N   . LEU A  1 321 ? 79.524  -29.450 21.245   1.00 29.16  ? 296 LEU A N   1 
ATOM   2203  C  CA  . LEU A  1 321 ? 79.638  -28.994 19.850   1.00 27.45  ? 296 LEU A CA  1 
ATOM   2204  C  C   . LEU A  1 321 ? 80.655  -29.799 19.037   1.00 26.97  ? 296 LEU A C   1 
ATOM   2205  O  O   . LEU A  1 321 ? 80.388  -30.156 17.883   1.00 26.54  ? 296 LEU A O   1 
ATOM   2206  C  CB  . LEU A  1 321 ? 79.981  -27.504 19.803   1.00 26.63  ? 296 LEU A CB  1 
ATOM   2207  C  CG  . LEU A  1 321 ? 79.965  -26.810 18.443   1.00 26.61  ? 296 LEU A CG  1 
ATOM   2208  C  CD1 . LEU A  1 321 ? 78.562  -26.760 17.837   1.00 26.07  ? 296 LEU A CD1 1 
ATOM   2209  C  CD2 . LEU A  1 321 ? 80.557  -25.416 18.586   1.00 26.51  ? 296 LEU A CD2 1 
ATOM   2210  N  N   . ILE A  1 322 ? 81.827  -30.053 19.630   1.00 27.03  ? 297 ILE A N   1 
ATOM   2211  C  CA  . ILE A  1 322 ? 82.830  -30.942 19.037   1.00 27.60  ? 297 ILE A CA  1 
ATOM   2212  C  C   . ILE A  1 322 ? 82.231  -32.343 18.801   1.00 27.75  ? 297 ILE A C   1 
ATOM   2213  O  O   . ILE A  1 322 ? 82.469  -32.945 17.750   1.00 26.71  ? 297 ILE A O   1 
ATOM   2214  C  CB  . ILE A  1 322 ? 84.113  -31.050 19.906   1.00 29.45  ? 297 ILE A CB  1 
ATOM   2215  C  CG1 . ILE A  1 322 ? 84.738  -29.674 20.188   1.00 31.50  ? 297 ILE A CG1 1 
ATOM   2216  C  CG2 . ILE A  1 322 ? 85.140  -31.959 19.250   1.00 29.42  ? 297 ILE A CG2 1 
ATOM   2217  C  CD1 . ILE A  1 322 ? 85.470  -29.048 19.021   1.00 33.77  ? 297 ILE A CD1 1 
ATOM   2218  N  N   . ASP A  1 323 ? 81.417  -32.829 19.737   1.00 27.93  ? 298 ASP A N   1 
ATOM   2219  C  CA  . ASP A  1 323 ? 80.818  -34.150 19.636   1.00 28.42  ? 298 ASP A CA  1 
ATOM   2220  C  C   . ASP A  1 323 ? 79.942  -34.284 18.409   1.00 28.38  ? 298 ASP A C   1 
ATOM   2221  O  O   . ASP A  1 323 ? 79.965  -35.276 17.751   1.00 27.85  ? 298 ASP A O   1 
ATOM   2222  C  CB  . ASP A  1 323 ? 80.014  -34.517 20.876   1.00 28.32  ? 298 ASP A CB  1 
ATOM   2223  C  CG  . ASP A  1 323 ? 80.450  -35.844 21.502   1.00 28.45  ? 298 ASP A CG  1 
ATOM   2224  O  OD1 . ASP A  1 323 ? 81.509  -36.323 21.173   1.00 28.27  ? 298 ASP A OD1 1 
ATOM   2225  O  OD2 . ASP A  1 323 ? 79.717  -36.379 22.312   1.00 27.98  ? 298 ASP A OD2 1 
ATOM   2226  N  N   . LYS A  1 324 ? 79.204  -33.237 18.102   1.00 28.16  ? 299 LYS A N   1 
ATOM   2227  C  CA  . LYS A  1 324 ? 78.311  -33.185 16.949   1.00 28.77  ? 299 LYS A CA  1 
ATOM   2228  C  C   . LYS A  1 324 ? 79.058  -32.892 15.642   1.00 28.87  ? 299 LYS A C   1 
ATOM   2229  O  O   . LYS A  1 324 ? 78.727  -33.444 14.584   1.00 28.33  ? 299 LYS A O   1 
ATOM   2230  C  CB  . LYS A  1 324 ? 77.198  -32.155 17.193   1.00 29.09  ? 299 LYS A CB  1 
ATOM   2231  C  CG  . LYS A  1 324 ? 76.361  -32.487 18.421   1.00 30.09  ? 299 LYS A CG  1 
ATOM   2232  C  CD  . LYS A  1 324 ? 75.714  -31.250 19.021   1.00 29.63  ? 299 LYS A CD  1 
ATOM   2233  C  CE  . LYS A  1 324 ? 74.207  -31.296 18.900   1.00 28.75  ? 299 LYS A CE  1 
ATOM   2234  N  NZ  . LYS A  1 324 ? 73.629  -32.525 19.522   1.00 28.01  ? 299 LYS A NZ  1 
ATOM   2235  N  N   . LEU A  1 325 ? 80.085  -32.052 15.735   1.00 28.62  ? 300 LEU A N   1 
ATOM   2236  C  CA  . LEU A  1 325 ? 80.838  -31.610 14.569   1.00 28.66  ? 300 LEU A CA  1 
ATOM   2237  C  C   . LEU A  1 325 ? 81.757  -32.680 13.977   1.00 27.97  ? 300 LEU A C   1 
ATOM   2238  O  O   . LEU A  1 325 ? 81.771  -32.868 12.759   1.00 27.55  ? 300 LEU A O   1 
ATOM   2239  C  CB  . LEU A  1 325 ? 81.639  -30.353 14.909   1.00 29.96  ? 300 LEU A CB  1 
ATOM   2240  C  CG  . LEU A  1 325 ? 82.398  -29.671 13.777   1.00 33.23  ? 300 LEU A CG  1 
ATOM   2241  C  CD1 . LEU A  1 325 ? 81.494  -29.348 12.586   1.00 33.80  ? 300 LEU A CD1 1 
ATOM   2242  C  CD2 . LEU A  1 325 ? 83.085  -28.426 14.323   1.00 33.96  ? 300 LEU A CD2 1 
ATOM   2243  N  N   . VAL A  1 326 ? 82.534  -33.359 14.828   1.00 27.18  ? 301 VAL A N   1 
ATOM   2244  C  CA  . VAL A  1 326 ? 83.539  -34.326 14.361   1.00 26.55  ? 301 VAL A CA  1 
ATOM   2245  C  C   . VAL A  1 326 ? 82.989  -35.325 13.314   1.00 26.26  ? 301 VAL A C   1 
ATOM   2246  O  O   . VAL A  1 326 ? 83.580  -35.468 12.240   1.00 25.64  ? 301 VAL A O   1 
ATOM   2247  C  CB  . VAL A  1 326 ? 84.234  -35.051 15.545   1.00 27.33  ? 301 VAL A CB  1 
ATOM   2248  C  CG1 . VAL A  1 326 ? 85.075  -36.220 15.066   1.00 28.15  ? 301 VAL A CG1 1 
ATOM   2249  C  CG2 . VAL A  1 326 ? 85.111  -34.084 16.319   1.00 26.84  ? 301 VAL A CG2 1 
ATOM   2250  N  N   . PRO A  1 327 ? 81.848  -35.996 13.604   1.00 26.37  ? 302 PRO A N   1 
ATOM   2251  C  CA  . PRO A  1 327 ? 81.348  -36.990 12.635   1.00 26.56  ? 302 PRO A CA  1 
ATOM   2252  C  C   . PRO A  1 327 ? 81.001  -36.376 11.275   1.00 26.08  ? 302 PRO A C   1 
ATOM   2253  O  O   . PRO A  1 327 ? 81.277  -36.981 10.233   1.00 25.15  ? 302 PRO A O   1 
ATOM   2254  C  CB  . PRO A  1 327 ? 80.084  -37.550 13.314   1.00 26.79  ? 302 PRO A CB  1 
ATOM   2255  C  CG  . PRO A  1 327 ? 80.284  -37.285 14.765   1.00 27.39  ? 302 PRO A CG  1 
ATOM   2256  C  CD  . PRO A  1 327 ? 81.012  -35.966 14.822   1.00 26.92  ? 302 PRO A CD  1 
HETATM 2257  N  N   . MSE A  1 328 ? 80.437  -35.171 11.304   1.00 25.59  ? 303 MSE A N   1 
HETATM 2258  C  CA  . MSE A  1 328 ? 80.073  -34.449 10.104   1.00 26.83  ? 303 MSE A CA  1 
HETATM 2259  C  C   . MSE A  1 328 ? 81.293  -34.127 9.255    1.00 27.36  ? 303 MSE A C   1 
HETATM 2260  O  O   . MSE A  1 328 ? 81.213  -34.179 8.011    1.00 26.99  ? 303 MSE A O   1 
HETATM 2261  C  CB  . MSE A  1 328 ? 79.319  -33.183 10.496   1.00 29.60  ? 303 MSE A CB  1 
HETATM 2262  C  CG  . MSE A  1 328 ? 77.941  -33.448 11.104   1.00 34.36  ? 303 MSE A CG  1 
HETATM 2263  SE SE  . MSE A  1 328 ? 77.092  -31.681 11.415   1.00 40.55  ? 303 MSE A SE  1 
HETATM 2264  C  CE  . MSE A  1 328 ? 75.698  -32.234 12.698   1.00 39.23  ? 303 MSE A CE  1 
ATOM   2265  N  N   . VAL A  1 329 ? 82.420  -33.796 9.897    1.00 27.18  ? 304 VAL A N   1 
ATOM   2266  C  CA  . VAL A  1 329 ? 83.672  -33.532 9.162    1.00 28.18  ? 304 VAL A CA  1 
ATOM   2267  C  C   . VAL A  1 329 ? 84.214  -34.834 8.535    1.00 28.26  ? 304 VAL A C   1 
ATOM   2268  O  O   . VAL A  1 329 ? 84.536  -34.877 7.339    1.00 27.21  ? 304 VAL A O   1 
ATOM   2269  C  CB  . VAL A  1 329 ? 84.759  -32.840 10.040   1.00 28.10  ? 304 VAL A CB  1 
ATOM   2270  C  CG1 . VAL A  1 329 ? 86.053  -32.610 9.251    1.00 27.72  ? 304 VAL A CG1 1 
ATOM   2271  C  CG2 . VAL A  1 329 ? 84.244  -31.522 10.605   1.00 26.58  ? 304 VAL A CG2 1 
ATOM   2272  N  N   . GLU A  1 330 ? 84.280  -35.890 9.345    1.00 29.08  ? 305 GLU A N   1 
ATOM   2273  C  CA  . GLU A  1 330 ? 84.764  -37.209 8.902    1.00 29.85  ? 305 GLU A CA  1 
ATOM   2274  C  C   . GLU A  1 330 ? 83.978  -37.803 7.714    1.00 29.67  ? 305 GLU A C   1 
ATOM   2275  O  O   . GLU A  1 330 ? 84.563  -38.473 6.857    1.00 29.06  ? 305 GLU A O   1 
ATOM   2276  C  CB  . GLU A  1 330 ? 84.850  -38.186 10.091   1.00 31.17  ? 305 GLU A CB  1 
ATOM   2277  C  CG  . GLU A  1 330 ? 85.942  -37.799 11.091   1.00 34.51  ? 305 GLU A CG  1 
ATOM   2278  C  CD  . GLU A  1 330 ? 86.224  -38.835 12.180   1.00 37.64  ? 305 GLU A CD  1 
ATOM   2279  O  OE1 . GLU A  1 330 ? 85.520  -39.862 12.244   1.00 41.34  ? 305 GLU A OE1 1 
ATOM   2280  O  OE2 . GLU A  1 330 ? 87.170  -38.623 12.979   1.00 37.16  ? 305 GLU A OE2 1 
ATOM   2281  N  N   . SER A  1 331 ? 82.671  -37.528 7.648    1.00 29.33  ? 306 SER A N   1 
ATOM   2282  C  CA  . SER A  1 331 ? 81.823  -38.062 6.575    1.00 28.23  ? 306 SER A CA  1 
ATOM   2283  C  C   . SER A  1 331 ? 81.667  -37.158 5.339    1.00 27.58  ? 306 SER A C   1 
ATOM   2284  O  O   . SER A  1 331 ? 80.890  -37.476 4.439    1.00 26.87  ? 306 SER A O   1 
ATOM   2285  C  CB  . SER A  1 331 ? 80.450  -38.470 7.122    1.00 28.34  ? 306 SER A CB  1 
ATOM   2286  O  OG  . SER A  1 331 ? 79.656  -37.331 7.384    1.00 28.62  ? 306 SER A OG  1 
ATOM   2287  N  N   . LEU A  1 332 ? 82.397  -36.044 5.281    1.00 27.41  ? 307 LEU A N   1 
ATOM   2288  C  CA  . LEU A  1 332 ? 82.398  -35.199 4.073    1.00 27.26  ? 307 LEU A CA  1 
ATOM   2289  C  C   . LEU A  1 332 ? 82.744  -36.019 2.843    1.00 28.14  ? 307 LEU A C   1 
ATOM   2290  O  O   . LEU A  1 332 ? 83.714  -36.779 2.865    1.00 27.57  ? 307 LEU A O   1 
ATOM   2291  C  CB  . LEU A  1 332 ? 83.418  -34.054 4.193    1.00 27.24  ? 307 LEU A CB  1 
ATOM   2292  C  CG  . LEU A  1 332 ? 83.081  -32.835 5.070    1.00 27.76  ? 307 LEU A CG  1 
ATOM   2293  C  CD1 . LEU A  1 332 ? 84.301  -31.919 5.161    1.00 28.35  ? 307 LEU A CD1 1 
ATOM   2294  C  CD2 . LEU A  1 332 ? 81.862  -32.099 4.532    1.00 27.28  ? 307 LEU A CD2 1 
ATOM   2295  N  N   . ARG A  1 333 ? 81.973  -35.859 1.770    1.00 29.17  ? 308 ARG A N   1 
ATOM   2296  C  CA  . ARG A  1 333 ? 82.338  -36.474 0.492    1.00 30.63  ? 308 ARG A CA  1 
ATOM   2297  C  C   . ARG A  1 333 ? 83.191  -35.517 -0.356   1.00 30.03  ? 308 ARG A C   1 
ATOM   2298  O  O   . ARG A  1 333 ? 82.771  -34.409 -0.696   1.00 28.45  ? 308 ARG A O   1 
ATOM   2299  C  CB  . ARG A  1 333 ? 81.107  -36.959 -0.276   1.00 33.30  ? 308 ARG A CB  1 
ATOM   2300  C  CG  . ARG A  1 333 ? 81.439  -37.833 -1.483   1.00 37.28  ? 308 ARG A CG  1 
ATOM   2301  C  CD  . ARG A  1 333 ? 80.174  -38.278 -2.200   1.00 40.46  ? 308 ARG A CD  1 
ATOM   2302  N  NE  . ARG A  1 333 ? 80.447  -38.828 -3.525   1.00 42.29  ? 308 ARG A NE  1 
ATOM   2303  C  CZ  . ARG A  1 333 ? 80.414  -40.127 -3.825   1.00 44.41  ? 308 ARG A CZ  1 
ATOM   2304  N  NH1 . ARG A  1 333 ? 80.115  -41.028 -2.893   1.00 40.88  ? 308 ARG A NH1 1 
ATOM   2305  N  NH2 . ARG A  1 333 ? 80.678  -40.522 -5.069   1.00 45.39  ? 308 ARG A NH2 1 
ATOM   2306  N  N   . ILE A  1 334 ? 84.399  -35.959 -0.676   1.00 29.38  ? 309 ILE A N   1 
ATOM   2307  C  CA  . ILE A  1 334 ? 85.360  -35.147 -1.399   1.00 28.89  ? 309 ILE A CA  1 
ATOM   2308  C  C   . ILE A  1 334 ? 85.481  -35.737 -2.803   1.00 29.13  ? 309 ILE A C   1 
ATOM   2309  O  O   . ILE A  1 334 ? 85.559  -36.950 -2.953   1.00 29.95  ? 309 ILE A O   1 
ATOM   2310  C  CB  . ILE A  1 334 ? 86.718  -35.166 -0.662   1.00 29.45  ? 309 ILE A CB  1 
ATOM   2311  C  CG1 . ILE A  1 334 ? 86.534  -34.669 0.780    1.00 29.71  ? 309 ILE A CG1 1 
ATOM   2312  C  CG2 . ILE A  1 334 ? 87.777  -34.362 -1.411   1.00 27.57  ? 309 ILE A CG2 1 
ATOM   2313  C  CD1 . ILE A  1 334 ? 87.646  -35.062 1.727    1.00 29.61  ? 309 ILE A CD1 1 
ATOM   2314  N  N   . GLY A  1 335 ? 85.476  -34.887 -3.829   1.00 27.81  ? 310 GLY A N   1 
ATOM   2315  C  CA  . GLY A  1 335 ? 85.555  -35.372 -5.207   1.00 26.19  ? 310 GLY A CA  1 
ATOM   2316  C  C   . GLY A  1 335 ? 85.600  -34.281 -6.256   1.00 25.56  ? 310 GLY A C   1 
ATOM   2317  O  O   . GLY A  1 335 ? 85.434  -33.100 -5.933   1.00 25.37  ? 310 GLY A O   1 
ATOM   2318  N  N   . PRO A  1 336 ? 85.821  -34.665 -7.528   1.00 25.32  ? 311 PRO A N   1 
ATOM   2319  C  CA  . PRO A  1 336 ? 85.879  -33.687 -8.611   1.00 24.28  ? 311 PRO A CA  1 
ATOM   2320  C  C   . PRO A  1 336 ? 84.481  -33.166 -8.917   1.00 23.99  ? 311 PRO A C   1 
ATOM   2321  O  O   . PRO A  1 336 ? 83.477  -33.749 -8.455   1.00 23.21  ? 311 PRO A O   1 
ATOM   2322  C  CB  . PRO A  1 336 ? 86.404  -34.512 -9.789   1.00 25.13  ? 311 PRO A CB  1 
ATOM   2323  C  CG  . PRO A  1 336 ? 85.883  -35.897 -9.536   1.00 25.40  ? 311 PRO A CG  1 
ATOM   2324  C  CD  . PRO A  1 336 ? 85.919  -36.054 -8.035   1.00 25.56  ? 311 PRO A CD  1 
ATOM   2325  N  N   . TYR A  1 337 ? 84.415  -32.072 -9.675   1.00 24.21  ? 312 TYR A N   1 
ATOM   2326  C  CA  . TYR A  1 337 ? 83.137  -31.438 -10.003  1.00 24.56  ? 312 TYR A CA  1 
ATOM   2327  C  C   . TYR A  1 337 ? 82.208  -32.367 -10.822  1.00 26.05  ? 312 TYR A C   1 
ATOM   2328  O  O   . TYR A  1 337 ? 80.980  -32.219 -10.778  1.00 26.54  ? 312 TYR A O   1 
ATOM   2329  C  CB  . TYR A  1 337 ? 83.365  -30.108 -10.735  1.00 23.54  ? 312 TYR A CB  1 
ATOM   2330  C  CG  . TYR A  1 337 ? 83.759  -30.309 -12.173  1.00 23.73  ? 312 TYR A CG  1 
ATOM   2331  C  CD1 . TYR A  1 337 ? 85.083  -30.559 -12.511  1.00 23.76  ? 312 TYR A CD1 1 
ATOM   2332  C  CD2 . TYR A  1 337 ? 82.801  -30.286 -13.195  1.00 24.67  ? 312 TYR A CD2 1 
ATOM   2333  C  CE1 . TYR A  1 337 ? 85.454  -30.777 -13.822  1.00 24.78  ? 312 TYR A CE1 1 
ATOM   2334  C  CE2 . TYR A  1 337 ? 83.166  -30.503 -14.523  1.00 24.44  ? 312 TYR A CE2 1 
ATOM   2335  C  CZ  . TYR A  1 337 ? 84.495  -30.743 -14.819  1.00 25.44  ? 312 TYR A CZ  1 
ATOM   2336  O  OH  . TYR A  1 337 ? 84.902  -30.960 -16.106  1.00 27.67  ? 312 TYR A OH  1 
ATOM   2337  N  N   . THR A  1 338 ? 82.791  -33.317 -11.559  1.00 26.88  ? 313 THR A N   1 
ATOM   2338  C  CA  . THR A  1 338 ? 82.006  -34.307 -12.315  1.00 28.08  ? 313 THR A CA  1 
ATOM   2339  C  C   . THR A  1 338 ? 81.222  -35.270 -11.413  1.00 31.40  ? 313 THR A C   1 
ATOM   2340  O  O   . THR A  1 338 ? 80.289  -35.930 -11.870  1.00 32.88  ? 313 THR A O   1 
ATOM   2341  C  CB  . THR A  1 338 ? 82.860  -35.071 -13.348  1.00 28.30  ? 313 THR A CB  1 
ATOM   2342  O  OG1 . THR A  1 338 ? 84.072  -35.522 -12.734  1.00 29.39  ? 313 THR A OG1 1 
ATOM   2343  C  CG2 . THR A  1 338 ? 83.227  -34.151 -14.517  1.00 29.33  ? 313 THR A CG2 1 
ATOM   2344  N  N   . ASP A  1 339 ? 81.599  -35.340 -10.134  1.00 33.22  ? 314 ASP A N   1 
ATOM   2345  C  CA  . ASP A  1 339 ? 80.851  -36.099 -9.122   1.00 31.86  ? 314 ASP A CA  1 
ATOM   2346  C  C   . ASP A  1 339 ? 79.959  -35.140 -8.333   1.00 32.92  ? 314 ASP A C   1 
ATOM   2347  O  O   . ASP A  1 339 ? 80.402  -34.491 -7.367   1.00 31.58  ? 314 ASP A O   1 
ATOM   2348  C  CB  . ASP A  1 339 ? 81.808  -36.842 -8.188   1.00 31.86  ? 314 ASP A CB  1 
ATOM   2349  C  CG  . ASP A  1 339 ? 81.099  -37.513 -7.007   1.00 33.75  ? 314 ASP A CG  1 
ATOM   2350  O  OD1 . ASP A  1 339 ? 79.885  -37.834 -7.100   1.00 34.77  ? 314 ASP A OD1 1 
ATOM   2351  O  OD2 . ASP A  1 339 ? 81.771  -37.718 -5.967   1.00 34.61  ? 314 ASP A OD2 1 
ATOM   2352  N  N   . GLU A  1 340 ? 78.695  -35.085 -8.742   1.00 35.19  ? 315 GLU A N   1 
ATOM   2353  C  CA  . GLU A  1 340 ? 77.729  -34.096 -8.250   1.00 38.39  ? 315 GLU A CA  1 
ATOM   2354  C  C   . GLU A  1 340 ? 77.140  -34.434 -6.879   1.00 38.01  ? 315 GLU A C   1 
ATOM   2355  O  O   . GLU A  1 340 ? 76.258  -33.735 -6.376   1.00 41.76  ? 315 GLU A O   1 
ATOM   2356  C  CB  . GLU A  1 340 ? 76.640  -33.862 -9.303   1.00 42.70  ? 315 GLU A CB  1 
ATOM   2357  C  CG  . GLU A  1 340 ? 77.237  -33.438 -10.640  1.00 53.02  ? 315 GLU A CG  1 
ATOM   2358  C  CD  . GLU A  1 340 ? 76.231  -32.815 -11.578  1.00 62.51  ? 315 GLU A CD  1 
ATOM   2359  O  OE1 . GLU A  1 340 ? 75.281  -33.519 -11.984  1.00 73.63  ? 315 GLU A OE1 1 
ATOM   2360  O  OE2 . GLU A  1 340 ? 76.404  -31.628 -11.921  1.00 59.39  ? 315 GLU A OE2 1 
ATOM   2361  N  N   . LYS A  1 341 ? 77.662  -35.501 -6.285   1.00 35.34  ? 316 LYS A N   1 
ATOM   2362  C  CA  . LYS A  1 341 ? 77.313  -35.948 -4.947   1.00 33.52  ? 316 LYS A CA  1 
ATOM   2363  C  C   . LYS A  1 341 ? 78.320  -35.403 -3.919   1.00 31.24  ? 316 LYS A C   1 
ATOM   2364  O  O   . LYS A  1 341 ? 78.027  -35.354 -2.730   1.00 32.04  ? 316 LYS A O   1 
ATOM   2365  C  CB  . LYS A  1 341 ? 77.295  -37.481 -4.932   1.00 35.15  ? 316 LYS A CB  1 
ATOM   2366  C  CG  . LYS A  1 341 ? 76.654  -38.112 -3.704   1.00 38.37  ? 316 LYS A CG  1 
ATOM   2367  C  CD  . LYS A  1 341 ? 76.850  -39.627 -3.710   1.00 38.71  ? 316 LYS A CD  1 
ATOM   2368  C  CE  . LYS A  1 341 ? 76.422  -40.261 -2.392   1.00 38.19  ? 316 LYS A CE  1 
ATOM   2369  N  NZ  . LYS A  1 341 ? 74.945  -40.190 -2.209   1.00 38.92  ? 316 LYS A NZ  1 
ATOM   2370  N  N   . ALA A  1 342 ? 79.501  -34.998 -4.383   1.00 29.88  ? 317 ALA A N   1 
ATOM   2371  C  CA  . ALA A  1 342 ? 80.554  -34.453 -3.515   1.00 29.67  ? 317 ALA A CA  1 
ATOM   2372  C  C   . ALA A  1 342 ? 80.174  -33.161 -2.804   1.00 27.91  ? 317 ALA A C   1 
ATOM   2373  O  O   . ALA A  1 342 ? 79.520  -32.295 -3.381   1.00 27.84  ? 317 ALA A O   1 
ATOM   2374  C  CB  . ALA A  1 342 ? 81.834  -34.233 -4.314   1.00 30.43  ? 317 ALA A CB  1 
ATOM   2375  N  N   . ASP A  1 343 ? 80.604  -33.040 -1.553   1.00 28.23  ? 318 ASP A N   1 
ATOM   2376  C  CA  . ASP A  1 343 ? 80.459  -31.806 -0.765   1.00 29.77  ? 318 ASP A CA  1 
ATOM   2377  C  C   . ASP A  1 343 ? 81.560  -30.785 -1.037   1.00 28.97  ? 318 ASP A C   1 
ATOM   2378  O  O   . ASP A  1 343 ? 81.382  -29.598 -0.795   1.00 27.48  ? 318 ASP A O   1 
ATOM   2379  C  CB  . ASP A  1 343 ? 80.510  -32.122 0.732    1.00 32.59  ? 318 ASP A CB  1 
ATOM   2380  C  CG  . ASP A  1 343 ? 79.456  -33.110 1.151    1.00 35.87  ? 318 ASP A CG  1 
ATOM   2381  O  OD1 . ASP A  1 343 ? 78.264  -32.823 0.899    1.00 35.49  ? 318 ASP A OD1 1 
ATOM   2382  O  OD2 . ASP A  1 343 ? 79.827  -34.162 1.729    1.00 37.62  ? 318 ASP A OD2 1 
HETATM 2383  N  N   . MSE A  1 344 ? 82.703  -31.257 -1.516   1.00 30.20  ? 319 MSE A N   1 
HETATM 2384  C  CA  . MSE A  1 344 ? 83.911  -30.456 -1.503   1.00 31.51  ? 319 MSE A CA  1 
HETATM 2385  C  C   . MSE A  1 344 ? 84.841  -30.970 -2.549   1.00 29.57  ? 319 MSE A C   1 
HETATM 2386  O  O   . MSE A  1 344 ? 84.944  -32.183 -2.772   1.00 30.31  ? 319 MSE A O   1 
HETATM 2387  C  CB  . MSE A  1 344 ? 84.551  -30.665 -0.139   1.00 34.40  ? 319 MSE A CB  1 
HETATM 2388  C  CG  . MSE A  1 344 ? 85.639  -29.652 0.148    1.00 36.61  ? 319 MSE A CG  1 
HETATM 2389  SE SE  . MSE A  1 344 ? 86.268  -29.973 1.988    1.00 39.98  ? 319 MSE A SE  1 
HETATM 2390  C  CE  . MSE A  1 344 ? 87.879  -30.997 1.508    1.00 40.72  ? 319 MSE A CE  1 
ATOM   2391  N  N   . GLY A  1 345 ? 85.532  -30.035 -3.190   1.00 25.80  ? 320 GLY A N   1 
ATOM   2392  C  CA  . GLY A  1 345 ? 86.441  -30.353 -4.260   1.00 24.29  ? 320 GLY A CA  1 
ATOM   2393  C  C   . GLY A  1 345 ? 87.873  -30.117 -3.851   1.00 23.12  ? 320 GLY A C   1 
ATOM   2394  O  O   . GLY A  1 345 ? 88.175  -29.956 -2.667   1.00 21.61  ? 320 GLY A O   1 
ATOM   2395  N  N   . PRO A  1 346 ? 88.771  -30.094 -4.837   1.00 23.74  ? 321 PRO A N   1 
ATOM   2396  C  CA  . PRO A  1 346 ? 90.173  -29.824 -4.544   1.00 24.24  ? 321 PRO A CA  1 
ATOM   2397  C  C   . PRO A  1 346 ? 90.403  -28.317 -4.375   1.00 23.59  ? 321 PRO A C   1 
ATOM   2398  O  O   . PRO A  1 346 ? 89.532  -27.514 -4.725   1.00 23.04  ? 321 PRO A O   1 
ATOM   2399  C  CB  . PRO A  1 346 ? 90.889  -30.351 -5.792   1.00 24.77  ? 321 PRO A CB  1 
ATOM   2400  C  CG  . PRO A  1 346 ? 89.889  -30.126 -6.895   1.00 24.73  ? 321 PRO A CG  1 
ATOM   2401  C  CD  . PRO A  1 346 ? 88.517  -30.251 -6.284   1.00 24.02  ? 321 PRO A CD  1 
ATOM   2402  N  N   . VAL A  1 347 ? 91.554  -27.951 -3.821   1.00 23.55  ? 322 VAL A N   1 
ATOM   2403  C  CA  . VAL A  1 347 ? 91.966  -26.556 -3.751   1.00 22.70  ? 322 VAL A CA  1 
ATOM   2404  C  C   . VAL A  1 347 ? 92.548  -26.162 -5.102   1.00 22.42  ? 322 VAL A C   1 
ATOM   2405  O  O   . VAL A  1 347 ? 92.810  -27.021 -5.945   1.00 23.79  ? 322 VAL A O   1 
ATOM   2406  C  CB  . VAL A  1 347 ? 92.952  -26.283 -2.589   1.00 22.78  ? 322 VAL A CB  1 
ATOM   2407  C  CG1 . VAL A  1 347 ? 92.296  -26.613 -1.253   1.00 22.02  ? 322 VAL A CG1 1 
ATOM   2408  C  CG2 . VAL A  1 347 ? 94.240  -27.083 -2.769   1.00 23.00  ? 322 VAL A CG2 1 
ATOM   2409  N  N   . VAL A  1 348 ? 92.743  -24.865 -5.301   1.00 21.63  ? 323 VAL A N   1 
ATOM   2410  C  CA  . VAL A  1 348 ? 92.923  -24.296 -6.639   1.00 22.05  ? 323 VAL A CA  1 
ATOM   2411  C  C   . VAL A  1 348 ? 94.248  -24.663 -7.319   1.00 22.29  ? 323 VAL A C   1 
ATOM   2412  O  O   . VAL A  1 348 ? 94.275  -24.869 -8.533   1.00 24.06  ? 323 VAL A O   1 
ATOM   2413  C  CB  . VAL A  1 348 ? 92.674  -22.758 -6.643   1.00 22.49  ? 323 VAL A CB  1 
ATOM   2414  C  CG1 . VAL A  1 348 ? 93.782  -22.009 -5.888   1.00 21.98  ? 323 VAL A CG1 1 
ATOM   2415  C  CG2 . VAL A  1 348 ? 92.488  -22.233 -8.070   1.00 22.74  ? 323 VAL A CG2 1 
ATOM   2416  N  N   . THR A  1 349 ? 95.337  -24.721 -6.558   1.00 21.80  ? 324 THR A N   1 
ATOM   2417  C  CA  . THR A  1 349 ? 96.668  -25.014 -7.135   1.00 23.26  ? 324 THR A CA  1 
ATOM   2418  C  C   . THR A  1 349 ? 97.462  -25.908 -6.210   1.00 24.63  ? 324 THR A C   1 
ATOM   2419  O  O   . THR A  1 349 ? 97.144  -26.020 -5.012   1.00 25.09  ? 324 THR A O   1 
ATOM   2420  C  CB  . THR A  1 349 ? 97.533  -23.740 -7.363   1.00 23.24  ? 324 THR A CB  1 
ATOM   2421  O  OG1 . THR A  1 349 ? 97.664  -23.019 -6.125   1.00 23.90  ? 324 THR A OG1 1 
ATOM   2422  C  CG2 . THR A  1 349 ? 96.933  -22.823 -8.433   1.00 22.45  ? 324 THR A CG2 1 
ATOM   2423  N  N   . LYS A  1 350 ? 98.510  -26.509 -6.760   1.00 25.72  ? 325 LYS A N   1 
ATOM   2424  C  CA  . LYS A  1 350 ? 99.506  -27.242 -5.975   1.00 28.02  ? 325 LYS A CA  1 
ATOM   2425  C  C   . LYS A  1 350 ? 100.142 -26.363 -4.874   1.00 29.99  ? 325 LYS A C   1 
ATOM   2426  O  O   . LYS A  1 350 ? 100.355 -26.838 -3.741   1.00 30.01  ? 325 LYS A O   1 
ATOM   2427  C  CB  . LYS A  1 350 ? 100.582 -27.834 -6.904   1.00 28.86  ? 325 LYS A CB  1 
ATOM   2428  C  CG  . LYS A  1 350 ? 101.723 -28.578 -6.211   1.00 30.32  ? 325 LYS A CG  1 
ATOM   2429  C  CD  . LYS A  1 350 ? 101.217 -29.773 -5.409   1.00 34.52  ? 325 LYS A CD  1 
ATOM   2430  C  CE  . LYS A  1 350 ? 102.370 -30.617 -4.880   1.00 39.62  ? 325 LYS A CE  1 
ATOM   2431  N  NZ  . LYS A  1 350 ? 101.878 -31.751 -4.053   1.00 42.96  ? 325 LYS A NZ  1 
ATOM   2432  N  N   . GLU A  1 351 ? 100.424 -25.097 -5.207   1.00 30.82  ? 326 GLU A N   1 
ATOM   2433  C  CA  . GLU A  1 351 ? 100.971 -24.103 -4.246   1.00 32.72  ? 326 GLU A CA  1 
ATOM   2434  C  C   . GLU A  1 351 ? 100.050 -23.872 -3.039   1.00 31.05  ? 326 GLU A C   1 
ATOM   2435  O  O   . GLU A  1 351 ? 100.504 -23.908 -1.893   1.00 31.50  ? 326 GLU A O   1 
ATOM   2436  C  CB  . GLU A  1 351 ? 101.252 -22.752 -4.921   1.00 34.89  ? 326 GLU A CB  1 
ATOM   2437  C  CG  . GLU A  1 351 ? 102.427 -22.734 -5.877   1.00 39.30  ? 326 GLU A CG  1 
ATOM   2438  C  CD  . GLU A  1 351 ? 102.173 -23.523 -7.158   1.00 44.87  ? 326 GLU A CD  1 
ATOM   2439  O  OE1 . GLU A  1 351 ? 101.004 -23.642 -7.600   1.00 42.72  ? 326 GLU A OE1 1 
ATOM   2440  O  OE2 . GLU A  1 351 ? 103.158 -24.037 -7.724   1.00 49.87  ? 326 GLU A OE2 1 
ATOM   2441  N  N   . ALA A  1 352 ? 98.767  -23.618 -3.305   1.00 29.56  ? 327 ALA A N   1 
ATOM   2442  C  CA  . ALA A  1 352 ? 97.776  -23.503 -2.233   1.00 28.14  ? 327 ALA A CA  1 
ATOM   2443  C  C   . ALA A  1 352 ? 97.756  -24.798 -1.411   1.00 27.74  ? 327 ALA A C   1 
ATOM   2444  O  O   . ALA A  1 352 ? 97.809  -24.757 -0.181   1.00 26.79  ? 327 ALA A O   1 
ATOM   2445  C  CB  . ALA A  1 352 ? 96.386  -23.177 -2.784   1.00 25.39  ? 327 ALA A CB  1 
ATOM   2446  N  N   . GLU A  1 353 ? 97.718  -25.945 -2.086   1.00 28.58  ? 328 GLU A N   1 
ATOM   2447  C  CA  . GLU A  1 353 ? 97.790  -27.220 -1.370   1.00 29.90  ? 328 GLU A CA  1 
ATOM   2448  C  C   . GLU A  1 353 ? 98.978  -27.289 -0.403   1.00 31.82  ? 328 GLU A C   1 
ATOM   2449  O  O   . GLU A  1 353 ? 98.795  -27.594 0.783    1.00 32.24  ? 328 GLU A O   1 
ATOM   2450  C  CB  . GLU A  1 353 ? 97.808  -28.417 -2.309   1.00 29.19  ? 328 GLU A CB  1 
ATOM   2451  C  CG  . GLU A  1 353 ? 97.500  -29.705 -1.564   1.00 29.12  ? 328 GLU A CG  1 
ATOM   2452  C  CD  . GLU A  1 353 ? 97.810  -30.949 -2.360   1.00 29.71  ? 328 GLU A CD  1 
ATOM   2453  O  OE1 . GLU A  1 353 ? 97.688  -30.916 -3.606   1.00 30.57  ? 328 GLU A OE1 1 
ATOM   2454  O  OE2 . GLU A  1 353 ? 98.166  -31.970 -1.729   1.00 30.18  ? 328 GLU A OE2 1 
ATOM   2455  N  N   . GLN A  1 354 ? 100.178 -26.983 -0.897   1.00 32.55  ? 329 GLN A N   1 
ATOM   2456  C  CA  . GLN A  1 354 ? 101.382 -27.079 -0.061   1.00 34.77  ? 329 GLN A CA  1 
ATOM   2457  C  C   . GLN A  1 354 ? 101.407 -26.050 1.085    1.00 31.75  ? 329 GLN A C   1 
ATOM   2458  O  O   . GLN A  1 354 ? 101.752 -26.388 2.228    1.00 29.11  ? 329 GLN A O   1 
ATOM   2459  C  CB  . GLN A  1 354 ? 102.664 -27.031 -0.912   1.00 38.84  ? 329 GLN A CB  1 
ATOM   2460  C  CG  . GLN A  1 354 ? 102.862 -28.245 -1.826   1.00 46.53  ? 329 GLN A CG  1 
ATOM   2461  C  CD  . GLN A  1 354 ? 102.650 -29.594 -1.124   1.00 54.32  ? 329 GLN A CD  1 
ATOM   2462  O  OE1 . GLN A  1 354 ? 101.819 -30.407 -1.552   1.00 56.10  ? 329 GLN A OE1 1 
ATOM   2463  N  NE2 . GLN A  1 354 ? 103.400 -29.836 -0.044   1.00 54.08  ? 329 GLN A NE2 1 
ATOM   2464  N  N   . ARG A  1 355 ? 101.010 -24.814 0.777    1.00 30.97  ? 330 ARG A N   1 
ATOM   2465  C  CA  . ARG A  1 355 ? 100.843 -23.773 1.796    1.00 30.70  ? 330 ARG A CA  1 
ATOM   2466  C  C   . ARG A  1 355 ? 99.876  -24.182 2.935    1.00 29.24  ? 330 ARG A C   1 
ATOM   2467  O  O   . ARG A  1 355 ? 100.137 -23.902 4.116    1.00 28.05  ? 330 ARG A O   1 
ATOM   2468  C  CB  . ARG A  1 355 ? 100.375 -22.476 1.145    1.00 31.98  ? 330 ARG A CB  1 
ATOM   2469  C  CG  . ARG A  1 355 ? 100.360 -21.288 2.084    1.00 35.99  ? 330 ARG A CG  1 
ATOM   2470  C  CD  . ARG A  1 355 ? 99.777  -20.051 1.406    1.00 40.79  ? 330 ARG A CD  1 
ATOM   2471  N  NE  . ARG A  1 355 ? 99.636  -18.957 2.371    1.00 43.84  ? 330 ARG A NE  1 
ATOM   2472  C  CZ  . ARG A  1 355 ? 98.602  -18.793 3.197    1.00 44.70  ? 330 ARG A CZ  1 
ATOM   2473  N  NH1 . ARG A  1 355 ? 98.595  -17.768 4.035    1.00 45.30  ? 330 ARG A NH1 1 
ATOM   2474  N  NH2 . ARG A  1 355 ? 97.574  -19.640 3.185    1.00 45.83  ? 330 ARG A NH2 1 
ATOM   2475  N  N   . ILE A  1 356 ? 98.765  -24.826 2.569    1.00 27.62  ? 331 ILE A N   1 
ATOM   2476  C  CA  . ILE A  1 356 ? 97.780  -25.310 3.540    1.00 26.79  ? 331 ILE A CA  1 
ATOM   2477  C  C   . ILE A  1 356 ? 98.372  -26.436 4.384    1.00 28.16  ? 331 ILE A C   1 
ATOM   2478  O  O   . ILE A  1 356 ? 98.261  -26.416 5.624    1.00 28.80  ? 331 ILE A O   1 
ATOM   2479  C  CB  . ILE A  1 356 ? 96.481  -25.806 2.861    1.00 25.05  ? 331 ILE A CB  1 
ATOM   2480  C  CG1 . ILE A  1 356 ? 95.748  -24.629 2.202    1.00 24.04  ? 331 ILE A CG1 1 
ATOM   2481  C  CG2 . ILE A  1 356 ? 95.577  -26.511 3.877    1.00 24.47  ? 331 ILE A CG2 1 
ATOM   2482  C  CD1 . ILE A  1 356 ? 94.760  -25.035 1.128    1.00 23.76  ? 331 ILE A CD1 1 
ATOM   2483  N  N   . ARG A  1 357 ? 99.016  -27.393 3.710    1.00 27.32  ? 332 ARG A N   1 
ATOM   2484  C  CA  . ARG A  1 357 ? 99.633  -28.541 4.378    1.00 28.63  ? 332 ARG A CA  1 
ATOM   2485  C  C   . ARG A  1 357 ? 100.739 -28.125 5.340    1.00 29.43  ? 332 ARG A C   1 
ATOM   2486  O  O   . ARG A  1 357 ? 100.864 -28.685 6.429    1.00 29.06  ? 332 ARG A O   1 
ATOM   2487  C  CB  . ARG A  1 357 ? 100.162 -29.558 3.367    1.00 27.86  ? 332 ARG A CB  1 
ATOM   2488  C  CG  . ARG A  1 357 ? 99.059  -30.315 2.661    1.00 27.51  ? 332 ARG A CG  1 
ATOM   2489  C  CD  . ARG A  1 357 ? 99.661  -31.363 1.754    1.00 27.89  ? 332 ARG A CD  1 
ATOM   2490  N  NE  . ARG A  1 357 ? 98.669  -32.078 0.946    1.00 27.21  ? 332 ARG A NE  1 
ATOM   2491  C  CZ  . ARG A  1 357 ? 97.982  -33.132 1.361    1.00 26.66  ? 332 ARG A CZ  1 
ATOM   2492  N  NH1 . ARG A  1 357 ? 98.142  -33.596 2.596    1.00 27.41  ? 332 ARG A NH1 1 
ATOM   2493  N  NH2 . ARG A  1 357 ? 97.143  -33.730 0.533    1.00 25.85  ? 332 ARG A NH2 1 
ATOM   2494  N  N   . SER A  1 358 ? 101.530 -27.136 4.942    1.00 30.15  ? 333 SER A N   1 
ATOM   2495  C  CA  . SER A  1 358 ? 102.556 -26.614 5.829    1.00 32.44  ? 333 SER A CA  1 
ATOM   2496  C  C   . SER A  1 358 ? 101.920 -25.979 7.082    1.00 32.52  ? 333 SER A C   1 
ATOM   2497  O  O   . SER A  1 358 ? 102.373 -26.216 8.207    1.00 34.37  ? 333 SER A O   1 
ATOM   2498  C  CB  . SER A  1 358 ? 103.445 -25.630 5.086    1.00 34.89  ? 333 SER A CB  1 
ATOM   2499  O  OG  . SER A  1 358 ? 103.902 -24.647 5.983    1.00 40.54  ? 333 SER A OG  1 
ATOM   2500  N  N   . LEU A  1 359 ? 100.848 -25.214 6.888    1.00 29.42  ? 334 LEU A N   1 
ATOM   2501  C  CA  . LEU A  1 359 ? 100.136 -24.594 8.004    1.00 27.73  ? 334 LEU A CA  1 
ATOM   2502  C  C   . LEU A  1 359 ? 99.539  -25.616 8.976    1.00 28.41  ? 334 LEU A C   1 
ATOM   2503  O  O   . LEU A  1 359 ? 99.637  -25.437 10.191   1.00 28.16  ? 334 LEU A O   1 
ATOM   2504  C  CB  . LEU A  1 359 ? 99.076  -23.623 7.489    1.00 25.72  ? 334 LEU A CB  1 
ATOM   2505  C  CG  . LEU A  1 359 ? 99.638  -22.250 7.095    1.00 25.24  ? 334 LEU A CG  1 
ATOM   2506  C  CD1 . LEU A  1 359 ? 98.718  -21.519 6.123    1.00 24.31  ? 334 LEU A CD1 1 
ATOM   2507  C  CD2 . LEU A  1 359 ? 99.901  -21.382 8.323    1.00 25.25  ? 334 LEU A CD2 1 
ATOM   2508  N  N   . ILE A  1 360 ? 98.945  -26.687 8.438    1.00 27.91  ? 335 ILE A N   1 
ATOM   2509  C  CA  . ILE A  1 360 ? 98.419  -27.794 9.250    1.00 28.48  ? 335 ILE A CA  1 
ATOM   2510  C  C   . ILE A  1 360 ? 99.510  -28.426 10.126   1.00 30.09  ? 335 ILE A C   1 
ATOM   2511  O  O   . ILE A  1 360 ? 99.283  -28.693 11.313   1.00 29.92  ? 335 ILE A O   1 
ATOM   2512  C  CB  . ILE A  1 360 ? 97.755  -28.901 8.386    1.00 27.77  ? 335 ILE A CB  1 
ATOM   2513  C  CG1 . ILE A  1 360 ? 96.474  -28.382 7.703    1.00 26.26  ? 335 ILE A CG1 1 
ATOM   2514  C  CG2 . ILE A  1 360 ? 97.455  -30.145 9.230    1.00 27.12  ? 335 ILE A CG2 1 
ATOM   2515  C  CD1 . ILE A  1 360 ? 95.941  -29.311 6.626    1.00 25.77  ? 335 ILE A CD1 1 
ATOM   2516  N  N   . ASP A  1 361 ? 100.683 -28.662 9.533    1.00 30.71  ? 336 ASP A N   1 
ATOM   2517  C  CA  . ASP A  1 361 ? 101.830 -29.195 10.261   1.00 32.97  ? 336 ASP A CA  1 
ATOM   2518  C  C   . ASP A  1 361 ? 102.273 -28.260 11.389   1.00 31.13  ? 336 ASP A C   1 
ATOM   2519  O  O   . ASP A  1 361 ? 102.577 -28.716 12.489   1.00 29.31  ? 336 ASP A O   1 
ATOM   2520  C  CB  . ASP A  1 361 ? 103.000 -29.470 9.313    1.00 39.74  ? 336 ASP A CB  1 
ATOM   2521  C  CG  . ASP A  1 361 ? 102.873 -30.806 8.583    1.00 49.65  ? 336 ASP A CG  1 
ATOM   2522  O  OD1 . ASP A  1 361 ? 101.978 -31.619 8.922    1.00 49.82  ? 336 ASP A OD1 1 
ATOM   2523  O  OD2 . ASP A  1 361 ? 103.688 -31.045 7.662    1.00 58.77  ? 336 ASP A OD2 1 
ATOM   2524  N  N   . SER A  1 362 ? 102.291 -26.954 11.117   1.00 31.00  ? 337 SER A N   1 
ATOM   2525  C  CA  . SER A  1 362 ? 102.658 -25.968 12.136   1.00 31.06  ? 337 SER A CA  1 
ATOM   2526  C  C   . SER A  1 362 ? 101.693 -25.998 13.335   1.00 31.32  ? 337 SER A C   1 
ATOM   2527  O  O   . SER A  1 362 ? 102.117 -25.826 14.476   1.00 30.43  ? 337 SER A O   1 
ATOM   2528  C  CB  . SER A  1 362 ? 102.757 -24.565 11.538   1.00 29.81  ? 337 SER A CB  1 
ATOM   2529  O  OG  . SER A  1 362 ? 101.482 -23.982 11.422   1.00 29.59  ? 337 SER A OG  1 
ATOM   2530  N  N   . GLY A  1 363 ? 100.407 -26.230 13.058   1.00 32.73  ? 338 GLY A N   1 
ATOM   2531  C  CA  . GLY A  1 363 ? 99.390  -26.454 14.099   1.00 33.41  ? 338 GLY A CA  1 
ATOM   2532  C  C   . GLY A  1 363 ? 99.751  -27.570 15.079   1.00 34.25  ? 338 GLY A C   1 
ATOM   2533  O  O   . GLY A  1 363 ? 99.684  -27.378 16.300   1.00 34.80  ? 338 GLY A O   1 
ATOM   2534  N  N   . ILE A  1 364 ? 100.126 -28.735 14.547   1.00 34.07  ? 339 ILE A N   1 
ATOM   2535  C  CA  . ILE A  1 364 ? 100.573 -29.877 15.372   1.00 34.66  ? 339 ILE A CA  1 
ATOM   2536  C  C   . ILE A  1 364 ? 101.817 -29.492 16.173   1.00 36.57  ? 339 ILE A C   1 
ATOM   2537  O  O   . ILE A  1 364 ? 101.825 -29.591 17.404   1.00 37.03  ? 339 ILE A O   1 
ATOM   2538  C  CB  . ILE A  1 364 ? 100.875 -31.125 14.511   1.00 32.90  ? 339 ILE A CB  1 
ATOM   2539  C  CG1 . ILE A  1 364 ? 99.609  -31.589 13.782   1.00 32.12  ? 339 ILE A CG1 1 
ATOM   2540  C  CG2 . ILE A  1 364 ? 101.490 -32.238 15.354   1.00 32.04  ? 339 ILE A CG2 1 
ATOM   2541  C  CD1 . ILE A  1 364 ? 99.881  -32.479 12.590   1.00 31.85  ? 339 ILE A CD1 1 
ATOM   2542  N  N   . GLU A  1 365 ? 102.848 -29.042 15.456   1.00 37.09  ? 340 GLU A N   1 
ATOM   2543  C  CA  . GLU A  1 365 ? 104.111 -28.597 16.035   1.00 40.81  ? 340 GLU A CA  1 
ATOM   2544  C  C   . GLU A  1 365 ? 103.925 -27.593 17.192   1.00 37.93  ? 340 GLU A C   1 
ATOM   2545  O  O   . GLU A  1 365 ? 104.680 -27.616 18.163   1.00 36.17  ? 340 GLU A O   1 
ATOM   2546  C  CB  . GLU A  1 365 ? 104.989 -27.997 14.930   1.00 48.93  ? 340 GLU A CB  1 
ATOM   2547  C  CG  . GLU A  1 365 ? 106.344 -27.468 15.380   1.00 63.29  ? 340 GLU A CG  1 
ATOM   2548  C  CD  . GLU A  1 365 ? 106.722 -26.171 14.677   1.00 82.37  ? 340 GLU A CD  1 
ATOM   2549  O  OE1 . GLU A  1 365 ? 106.108 -25.121 14.987   1.00 86.13  ? 340 GLU A OE1 1 
ATOM   2550  O  OE2 . GLU A  1 365 ? 107.635 -26.196 13.820   1.00 90.17  ? 340 GLU A OE2 1 
ATOM   2551  N  N   . GLN A  1 366 ? 102.913 -26.732 17.101   1.00 35.25  ? 341 GLN A N   1 
ATOM   2552  C  CA  . GLN A  1 366 ? 102.716 -25.708 18.125   1.00 34.58  ? 341 GLN A CA  1 
ATOM   2553  C  C   . GLN A  1 366 ? 101.752 -26.086 19.250   1.00 33.12  ? 341 GLN A C   1 
ATOM   2554  O  O   . GLN A  1 366 ? 101.451 -25.268 20.119   1.00 33.08  ? 341 GLN A O   1 
ATOM   2555  C  CB  . GLN A  1 366 ? 102.337 -24.379 17.488   1.00 34.63  ? 341 GLN A CB  1 
ATOM   2556  C  CG  . GLN A  1 366 ? 103.512 -23.717 16.793   1.00 35.31  ? 341 GLN A CG  1 
ATOM   2557  C  CD  . GLN A  1 366 ? 103.078 -22.641 15.825   1.00 35.81  ? 341 GLN A CD  1 
ATOM   2558  O  OE1 . GLN A  1 366 ? 101.942 -22.178 15.866   1.00 37.12  ? 341 GLN A OE1 1 
ATOM   2559  N  NE2 . GLN A  1 366 ? 103.982 -22.236 14.946   1.00 35.01  ? 341 GLN A NE2 1 
ATOM   2560  N  N   . GLY A  1 367 ? 101.280 -27.331 19.231   1.00 32.34  ? 342 GLY A N   1 
ATOM   2561  C  CA  . GLY A  1 367 ? 100.516 -27.885 20.346   1.00 32.60  ? 342 GLY A CA  1 
ATOM   2562  C  C   . GLY A  1 367 ? 98.997  -27.938 20.250   1.00 33.18  ? 342 GLY A C   1 
ATOM   2563  O  O   . GLY A  1 367 ? 98.338  -28.260 21.239   1.00 33.76  ? 342 GLY A O   1 
ATOM   2564  N  N   . ALA A  1 368 ? 98.434  -27.615 19.083   1.00 32.64  ? 343 ALA A N   1 
ATOM   2565  C  CA  . ALA A  1 368 ? 97.000  -27.785 18.856   1.00 31.79  ? 343 ALA A CA  1 
ATOM   2566  C  C   . ALA A  1 368 ? 96.686  -29.268 18.677   1.00 33.22  ? 343 ALA A C   1 
ATOM   2567  O  O   . ALA A  1 368 ? 97.527  -30.035 18.202   1.00 33.26  ? 343 ALA A O   1 
ATOM   2568  C  CB  . ALA A  1 368 ? 96.549  -26.994 17.636   1.00 29.97  ? 343 ALA A CB  1 
ATOM   2569  N  N   . LYS A  1 369 ? 95.478  -29.666 19.067   1.00 33.80  ? 344 LYS A N   1 
ATOM   2570  C  CA  . LYS A  1 369 ? 95.011  -31.040 18.905   1.00 34.26  ? 344 LYS A CA  1 
ATOM   2571  C  C   . LYS A  1 369 ? 94.239  -31.231 17.587   1.00 34.20  ? 344 LYS A C   1 
ATOM   2572  O  O   . LYS A  1 369 ? 93.119  -30.742 17.416   1.00 32.53  ? 344 LYS A O   1 
ATOM   2573  C  CB  . LYS A  1 369 ? 94.153  -31.428 20.112   1.00 36.68  ? 344 LYS A CB  1 
ATOM   2574  C  CG  . LYS A  1 369 ? 93.627  -32.851 20.103   1.00 38.72  ? 344 LYS A CG  1 
ATOM   2575  C  CD  . LYS A  1 369 ? 92.512  -33.024 21.127   1.00 40.40  ? 344 LYS A CD  1 
ATOM   2576  C  CE  . LYS A  1 369 ? 93.054  -33.359 22.501   1.00 42.72  ? 344 LYS A CE  1 
ATOM   2577  N  NZ  . LYS A  1 369 ? 91.939  -33.440 23.481   1.00 45.23  ? 344 LYS A NZ  1 
ATOM   2578  N  N   . LEU A  1 370 ? 94.850  -31.949 16.654   1.00 35.39  ? 345 LEU A N   1 
ATOM   2579  C  CA  . LEU A  1 370 ? 94.192  -32.286 15.401   1.00 35.48  ? 345 LEU A CA  1 
ATOM   2580  C  C   . LEU A  1 370 ? 93.194  -33.411 15.671   1.00 34.43  ? 345 LEU A C   1 
ATOM   2581  O  O   . LEU A  1 370 ? 93.578  -34.576 15.703   1.00 36.01  ? 345 LEU A O   1 
ATOM   2582  C  CB  . LEU A  1 370 ? 95.237  -32.713 14.336   1.00 34.73  ? 345 LEU A CB  1 
ATOM   2583  C  CG  . LEU A  1 370 ? 94.816  -32.841 12.855   1.00 31.91  ? 345 LEU A CG  1 
ATOM   2584  C  CD1 . LEU A  1 370 ? 93.915  -31.690 12.427   1.00 29.40  ? 345 LEU A CD1 1 
ATOM   2585  C  CD2 . LEU A  1 370 ? 96.030  -32.949 11.927   1.00 31.30  ? 345 LEU A CD2 1 
ATOM   2586  N  N   . VAL A  1 371 ? 91.925  -33.071 15.883   1.00 32.94  ? 346 VAL A N   1 
ATOM   2587  C  CA  . VAL A  1 371 ? 90.924  -34.096 16.220   1.00 34.14  ? 346 VAL A CA  1 
ATOM   2588  C  C   . VAL A  1 371 ? 90.429  -34.861 14.993   1.00 33.07  ? 346 VAL A C   1 
ATOM   2589  O  O   . VAL A  1 371 ? 90.160  -36.058 15.077   1.00 33.91  ? 346 VAL A O   1 
ATOM   2590  C  CB  . VAL A  1 371 ? 89.742  -33.560 17.067   1.00 37.23  ? 346 VAL A CB  1 
ATOM   2591  C  CG1 . VAL A  1 371 ? 90.240  -33.064 18.414   1.00 38.15  ? 346 VAL A CG1 1 
ATOM   2592  C  CG2 . VAL A  1 371 ? 89.009  -32.441 16.347   1.00 37.79  ? 346 VAL A CG2 1 
ATOM   2593  N  N   . VAL A  1 372 ? 90.312  -34.170 13.864   1.00 31.50  ? 347 VAL A N   1 
ATOM   2594  C  CA  . VAL A  1 372 ? 90.084  -34.821 12.571   1.00 30.91  ? 347 VAL A CA  1 
ATOM   2595  C  C   . VAL A  1 372 ? 91.284  -34.471 11.684   1.00 32.49  ? 347 VAL A C   1 
ATOM   2596  O  O   . VAL A  1 372 ? 91.516  -33.289 11.366   1.00 30.19  ? 347 VAL A O   1 
ATOM   2597  C  CB  . VAL A  1 372 ? 88.776  -34.363 11.880   1.00 28.36  ? 347 VAL A CB  1 
ATOM   2598  C  CG1 . VAL A  1 372 ? 88.553  -35.141 10.588   1.00 27.61  ? 347 VAL A CG1 1 
ATOM   2599  C  CG2 . VAL A  1 372 ? 87.575  -34.500 12.807   1.00 28.00  ? 347 VAL A CG2 1 
ATOM   2600  N  N   . ASP A  1 373 ? 92.042  -35.506 11.311   1.00 34.91  ? 348 ASP A N   1 
ATOM   2601  C  CA  . ASP A  1 373 ? 93.246  -35.373 10.484   1.00 36.12  ? 348 ASP A CA  1 
ATOM   2602  C  C   . ASP A  1 373 ? 92.970  -35.788 9.026    1.00 36.29  ? 348 ASP A C   1 
ATOM   2603  O  O   . ASP A  1 373 ? 92.796  -36.975 8.722    1.00 36.28  ? 348 ASP A O   1 
ATOM   2604  C  CB  . ASP A  1 373 ? 94.397  -36.200 11.099   1.00 36.26  ? 348 ASP A CB  1 
ATOM   2605  C  CG  . ASP A  1 373 ? 95.685  -36.164 10.265   1.00 37.89  ? 348 ASP A CG  1 
ATOM   2606  O  OD1 . ASP A  1 373 ? 95.743  -35.497 9.207    1.00 37.70  ? 348 ASP A OD1 1 
ATOM   2607  O  OD2 . ASP A  1 373 ? 96.656  -36.826 10.677   1.00 40.64  ? 348 ASP A OD2 1 
ATOM   2608  N  N   . GLY A  1 374 ? 92.948  -34.806 8.132    1.00 35.09  ? 349 GLY A N   1 
ATOM   2609  C  CA  . GLY A  1 374 ? 92.662  -35.057 6.719    1.00 34.76  ? 349 GLY A CA  1 
ATOM   2610  C  C   . GLY A  1 374 ? 93.875  -35.129 5.801    1.00 33.45  ? 349 GLY A C   1 
ATOM   2611  O  O   . GLY A  1 374 ? 93.722  -35.209 4.579    1.00 32.13  ? 349 GLY A O   1 
ATOM   2612  N  N   . ARG A  1 375 ? 95.077  -35.124 6.378    1.00 33.36  ? 350 ARG A N   1 
ATOM   2613  C  CA  . ARG A  1 375 ? 96.318  -35.070 5.586    1.00 34.28  ? 350 ARG A CA  1 
ATOM   2614  C  C   . ARG A  1 375 ? 96.558  -36.292 4.687    1.00 37.36  ? 350 ARG A C   1 
ATOM   2615  O  O   . ARG A  1 375 ? 97.249  -36.181 3.663    1.00 38.34  ? 350 ARG A O   1 
ATOM   2616  C  CB  . ARG A  1 375 ? 97.529  -34.868 6.491    1.00 33.51  ? 350 ARG A CB  1 
ATOM   2617  C  CG  . ARG A  1 375 ? 97.644  -33.494 7.121    1.00 33.81  ? 350 ARG A CG  1 
ATOM   2618  C  CD  . ARG A  1 375 ? 98.784  -33.481 8.134    1.00 35.21  ? 350 ARG A CD  1 
ATOM   2619  N  NE  . ARG A  1 375 ? 98.594  -34.463 9.199    1.00 35.37  ? 350 ARG A NE  1 
ATOM   2620  C  CZ  . ARG A  1 375 ? 99.541  -34.851 10.054   1.00 35.71  ? 350 ARG A CZ  1 
ATOM   2621  N  NH1 . ARG A  1 375 ? 99.257  -35.748 10.984   1.00 34.93  ? 350 ARG A NH1 1 
ATOM   2622  N  NH2 . ARG A  1 375 ? 100.768 -34.350 9.987    1.00 35.69  ? 350 ARG A NH2 1 
ATOM   2623  N  N   . ASP A  1 376 ? 95.982  -37.437 5.074    1.00 37.91  ? 351 ASP A N   1 
ATOM   2624  C  CA  . ASP A  1 376 ? 96.203  -38.724 4.395    1.00 40.04  ? 351 ASP A CA  1 
ATOM   2625  C  C   . ASP A  1 376 ? 95.250  -38.998 3.241    1.00 38.99  ? 351 ASP A C   1 
ATOM   2626  O  O   . ASP A  1 376 ? 95.427  -39.992 2.525    1.00 37.76  ? 351 ASP A O   1 
ATOM   2627  C  CB  . ASP A  1 376 ? 96.107  -39.894 5.388    1.00 43.24  ? 351 ASP A CB  1 
ATOM   2628  C  CG  . ASP A  1 376 ? 97.343  -40.039 6.244    1.00 50.25  ? 351 ASP A CG  1 
ATOM   2629  O  OD1 . ASP A  1 376 ? 98.433  -39.609 5.809    1.00 51.57  ? 351 ASP A OD1 1 
ATOM   2630  O  OD2 . ASP A  1 376 ? 97.229  -40.591 7.357    1.00 55.38  ? 351 ASP A OD2 1 
ATOM   2631  N  N   . PHE A  1 377 ? 94.237  -38.147 3.069    1.00 37.25  ? 352 PHE A N   1 
ATOM   2632  C  CA  . PHE A  1 377 ? 93.217  -38.392 2.050    1.00 36.26  ? 352 PHE A CA  1 
ATOM   2633  C  C   . PHE A  1 377 ? 93.815  -38.486 0.637    1.00 35.96  ? 352 PHE A C   1 
ATOM   2634  O  O   . PHE A  1 377 ? 94.622  -37.653 0.228    1.00 34.29  ? 352 PHE A O   1 
ATOM   2635  C  CB  . PHE A  1 377 ? 92.093  -37.337 2.098    1.00 36.76  ? 352 PHE A CB  1 
ATOM   2636  C  CG  . PHE A  1 377 ? 91.010  -37.569 1.075    1.00 37.10  ? 352 PHE A CG  1 
ATOM   2637  C  CD1 . PHE A  1 377 ? 89.977  -38.480 1.325    1.00 39.17  ? 352 PHE A CD1 1 
ATOM   2638  C  CD2 . PHE A  1 377 ? 91.042  -36.915 -0.155   1.00 35.32  ? 352 PHE A CD2 1 
ATOM   2639  C  CE1 . PHE A  1 377 ? 88.989  -38.718 0.377    1.00 38.75  ? 352 PHE A CE1 1 
ATOM   2640  C  CE2 . PHE A  1 377 ? 90.058  -37.150 -1.108   1.00 36.93  ? 352 PHE A CE2 1 
ATOM   2641  C  CZ  . PHE A  1 377 ? 89.029  -38.053 -0.840   1.00 39.00  ? 352 PHE A CZ  1 
ATOM   2642  N  N   . LYS A  1 378 ? 93.417  -39.520 -0.090   1.00 38.25  ? 353 LYS A N   1 
ATOM   2643  C  CA  . LYS A  1 378 ? 93.722  -39.635 -1.510   1.00 40.52  ? 353 LYS A CA  1 
ATOM   2644  C  C   . LYS A  1 378 ? 92.470  -40.107 -2.208   1.00 37.41  ? 353 LYS A C   1 
ATOM   2645  O  O   . LYS A  1 378 ? 91.708  -40.900 -1.662   1.00 35.89  ? 353 LYS A O   1 
ATOM   2646  C  CB  . LYS A  1 378 ? 94.866  -40.618 -1.778   1.00 43.79  ? 353 LYS A CB  1 
ATOM   2647  C  CG  . LYS A  1 378 ? 96.220  -40.149 -1.274   1.00 48.57  ? 353 LYS A CG  1 
ATOM   2648  C  CD  . LYS A  1 378 ? 97.319  -40.335 -2.316   1.00 53.54  ? 353 LYS A CD  1 
ATOM   2649  C  CE  . LYS A  1 378 ? 97.358  -39.176 -3.308   1.00 52.95  ? 353 LYS A CE  1 
ATOM   2650  N  NZ  . LYS A  1 378 ? 97.576  -37.858 -2.641   1.00 52.22  ? 353 LYS A NZ  1 
ATOM   2651  N  N   . LEU A  1 379 ? 92.244  -39.599 -3.408   1.00 36.12  ? 354 LEU A N   1 
ATOM   2652  C  CA  . LEU A  1 379 ? 91.089  -40.019 -4.167   1.00 34.90  ? 354 LEU A CA  1 
ATOM   2653  C  C   . LEU A  1 379 ? 91.572  -40.893 -5.305   1.00 34.45  ? 354 LEU A C   1 
ATOM   2654  O  O   . LEU A  1 379 ? 92.424  -40.486 -6.110   1.00 32.23  ? 354 LEU A O   1 
ATOM   2655  C  CB  . LEU A  1 379 ? 90.288  -38.821 -4.672   1.00 33.43  ? 354 LEU A CB  1 
ATOM   2656  C  CG  . LEU A  1 379 ? 88.915  -39.112 -5.280   1.00 33.49  ? 354 LEU A CG  1 
ATOM   2657  C  CD1 . LEU A  1 379 ? 87.983  -39.779 -4.269   1.00 32.69  ? 354 LEU A CD1 1 
ATOM   2658  C  CD2 . LEU A  1 379 ? 88.318  -37.812 -5.800   1.00 33.73  ? 354 LEU A CD2 1 
ATOM   2659  N  N   . GLN A  1 380 ? 91.041  -42.111 -5.332   1.00 35.87  ? 355 GLN A N   1 
ATOM   2660  C  CA  . GLN A  1 380 ? 91.384  -43.089 -6.345   1.00 36.02  ? 355 GLN A CA  1 
ATOM   2661  C  C   . GLN A  1 380 ? 91.009  -42.520 -7.701   1.00 33.56  ? 355 GLN A C   1 
ATOM   2662  O  O   . GLN A  1 380 ? 89.921  -41.961 -7.868   1.00 34.43  ? 355 GLN A O   1 
ATOM   2663  C  CB  . GLN A  1 380 ? 90.648  -44.405 -6.082   1.00 38.93  ? 355 GLN A CB  1 
ATOM   2664  C  CG  . GLN A  1 380 ? 91.079  -45.554 -6.986   1.00 43.34  ? 355 GLN A CG  1 
ATOM   2665  C  CD  . GLN A  1 380 ? 90.320  -46.843 -6.719   1.00 48.04  ? 355 GLN A CD  1 
ATOM   2666  O  OE1 . GLN A  1 380 ? 89.602  -46.972 -5.723   1.00 50.69  ? 355 GLN A OE1 1 
ATOM   2667  N  NE2 . GLN A  1 380 ? 90.483  -47.810 -7.611   1.00 49.26  ? 355 GLN A NE2 1 
ATOM   2668  N  N   . GLY A  1 381 ? 91.929  -42.638 -8.651   1.00 32.71  ? 356 GLY A N   1 
ATOM   2669  C  CA  . GLY A  1 381 ? 91.751  -42.080 -9.989   1.00 32.24  ? 356 GLY A CA  1 
ATOM   2670  C  C   . GLY A  1 381 ? 92.163  -40.614 -10.074  1.00 31.72  ? 356 GLY A C   1 
ATOM   2671  O  O   . GLY A  1 381 ? 92.283  -40.068 -11.169  1.00 31.69  ? 356 GLY A O   1 
ATOM   2672  N  N   . TYR A  1 382 ? 92.375  -39.971 -8.925   1.00 30.72  ? 357 TYR A N   1 
ATOM   2673  C  CA  . TYR A  1 382 ? 92.651  -38.524 -8.883   1.00 30.97  ? 357 TYR A CA  1 
ATOM   2674  C  C   . TYR A  1 382 ? 93.800  -38.222 -7.936   1.00 31.75  ? 357 TYR A C   1 
ATOM   2675  O  O   . TYR A  1 382 ? 93.791  -37.216 -7.207   1.00 32.41  ? 357 TYR A O   1 
ATOM   2676  C  CB  . TYR A  1 382 ? 91.393  -37.744 -8.472   1.00 29.86  ? 357 TYR A CB  1 
ATOM   2677  C  CG  . TYR A  1 382 ? 90.251  -37.884 -9.442   1.00 29.48  ? 357 TYR A CG  1 
ATOM   2678  C  CD1 . TYR A  1 382 ? 90.111  -36.999 -10.504  1.00 30.07  ? 357 TYR A CD1 1 
ATOM   2679  C  CD2 . TYR A  1 382 ? 89.316  -38.912 -9.309   1.00 29.94  ? 357 TYR A CD2 1 
ATOM   2680  C  CE1 . TYR A  1 382 ? 89.070  -37.126 -11.402  1.00 29.99  ? 357 TYR A CE1 1 
ATOM   2681  C  CE2 . TYR A  1 382 ? 88.271  -39.047 -10.205  1.00 29.60  ? 357 TYR A CE2 1 
ATOM   2682  C  CZ  . TYR A  1 382 ? 88.164  -38.150 -11.247  1.00 29.88  ? 357 TYR A CZ  1 
ATOM   2683  O  OH  . TYR A  1 382 ? 87.144  -38.263 -12.137  1.00 31.06  ? 357 TYR A OH  1 
ATOM   2684  N  N   . GLU A  1 383 ? 94.793  -39.103 -7.961   1.00 31.88  ? 358 GLU A N   1 
ATOM   2685  C  CA  . GLU A  1 383 ? 95.890  -39.062 -7.011   1.00 33.00  ? 358 GLU A CA  1 
ATOM   2686  C  C   . GLU A  1 383 ? 96.731  -37.809 -7.159   1.00 30.80  ? 358 GLU A C   1 
ATOM   2687  O  O   . GLU A  1 383 ? 97.441  -37.425 -6.241   1.00 29.77  ? 358 GLU A O   1 
ATOM   2688  C  CB  . GLU A  1 383 ? 96.754  -40.321 -7.140   1.00 36.26  ? 358 GLU A CB  1 
ATOM   2689  C  CG  . GLU A  1 383 ? 96.078  -41.589 -6.628   1.00 38.27  ? 358 GLU A CG  1 
ATOM   2690  C  CD  . GLU A  1 383 ? 95.242  -42.308 -7.679   1.00 42.07  ? 358 GLU A CD  1 
ATOM   2691  O  OE1 . GLU A  1 383 ? 95.086  -41.807 -8.815   1.00 40.35  ? 358 GLU A OE1 1 
ATOM   2692  O  OE2 . GLU A  1 383 ? 94.738  -43.404 -7.364   1.00 47.91  ? 358 GLU A OE2 1 
ATOM   2693  N  N   . ASN A  1 384 ? 96.624  -37.184 -8.307   1.00 32.11  ? 359 ASN A N   1 
ATOM   2694  C  CA  . ASN A  1 384 ? 97.339  -35.970 -8.613   1.00 33.04  ? 359 ASN A CA  1 
ATOM   2695  C  C   . ASN A  1 384 ? 96.567  -34.687 -8.511   1.00 30.90  ? 359 ASN A C   1 
ATOM   2696  O  O   . ASN A  1 384 ? 97.103  -33.644 -8.757   1.00 30.60  ? 359 ASN A O   1 
ATOM   2697  C  CB  . ASN A  1 384 ? 97.860  -36.051 -10.002  1.00 37.73  ? 359 ASN A CB  1 
ATOM   2698  C  CG  . ASN A  1 384 ? 99.334  -36.016 -10.039  1.00 44.77  ? 359 ASN A CG  1 
ATOM   2699  O  OD1 . ASN A  1 384 ? 99.937  -34.950 -10.222  1.00 49.07  ? 359 ASN A OD1 1 
ATOM   2700  N  ND2 . ASN A  1 384 ? 99.946  -37.191 -9.845   1.00 42.51  ? 359 ASN A ND2 1 
ATOM   2701  N  N   . GLY A  1 385 ? 95.300  -34.800 -8.184   1.00 30.29  ? 360 GLY A N   1 
ATOM   2702  C  CA  . GLY A  1 385 ? 94.459  -33.644 -7.891   1.00 30.72  ? 360 GLY A CA  1 
ATOM   2703  C  C   . GLY A  1 385 ? 94.898  -32.985 -6.593   1.00 30.60  ? 360 GLY A C   1 
ATOM   2704  O  O   . GLY A  1 385 ? 95.581  -33.625 -5.780   1.00 30.00  ? 360 GLY A O   1 
ATOM   2705  N  N   . HIS A  1 386 ? 94.516  -31.716 -6.397   1.00 29.73  ? 361 HIS A N   1 
ATOM   2706  C  CA  . HIS A  1 386 ? 94.943  -30.952 -5.212   1.00 29.80  ? 361 HIS A CA  1 
ATOM   2707  C  C   . HIS A  1 386 ? 93.999  -31.162 -4.026   1.00 27.40  ? 361 HIS A C   1 
ATOM   2708  O  O   . HIS A  1 386 ? 93.469  -30.203 -3.465   1.00 26.40  ? 361 HIS A O   1 
ATOM   2709  C  CB  . HIS A  1 386 ? 95.118  -29.455 -5.536   1.00 32.40  ? 361 HIS A CB  1 
ATOM   2710  C  CG  . HIS A  1 386 ? 95.761  -29.190 -6.865   1.00 35.10  ? 361 HIS A CG  1 
ATOM   2711  N  ND1 . HIS A  1 386 ? 95.282  -28.241 -7.747   1.00 35.73  ? 361 HIS A ND1 1 
ATOM   2712  C  CD2 . HIS A  1 386 ? 96.823  -29.770 -7.476   1.00 34.04  ? 361 HIS A CD2 1 
ATOM   2713  C  CE1 . HIS A  1 386 ? 96.032  -28.234 -8.833   1.00 35.11  ? 361 HIS A CE1 1 
ATOM   2714  N  NE2 . HIS A  1 386 ? 96.972  -29.155 -8.694   1.00 35.24  ? 361 HIS A NE2 1 
ATOM   2715  N  N   . PHE A  1 387 ? 93.812  -32.428 -3.653   1.00 27.25  ? 362 PHE A N   1 
ATOM   2716  C  CA  . PHE A  1 387 ? 92.837  -32.833 -2.622   1.00 28.22  ? 362 PHE A CA  1 
ATOM   2717  C  C   . PHE A  1 387 ? 93.414  -32.893 -1.192   1.00 28.54  ? 362 PHE A C   1 
ATOM   2718  O  O   . PHE A  1 387 ? 94.458  -33.494 -0.964   1.00 27.93  ? 362 PHE A O   1 
ATOM   2719  C  CB  . PHE A  1 387 ? 92.194  -34.183 -2.987   1.00 27.23  ? 362 PHE A CB  1 
ATOM   2720  C  CG  . PHE A  1 387 ? 91.210  -34.101 -4.123   1.00 26.66  ? 362 PHE A CG  1 
ATOM   2721  C  CD1 . PHE A  1 387 ? 89.957  -33.524 -3.934   1.00 26.64  ? 362 PHE A CD1 1 
ATOM   2722  C  CD2 . PHE A  1 387 ? 91.530  -34.613 -5.377   1.00 25.43  ? 362 PHE A CD2 1 
ATOM   2723  C  CE1 . PHE A  1 387 ? 89.048  -33.442 -4.977   1.00 27.12  ? 362 PHE A CE1 1 
ATOM   2724  C  CE2 . PHE A  1 387 ? 90.628  -34.541 -6.421   1.00 25.41  ? 362 PHE A CE2 1 
ATOM   2725  C  CZ  . PHE A  1 387 ? 89.383  -33.957 -6.223   1.00 26.53  ? 362 PHE A CZ  1 
ATOM   2726  N  N   . ILE A  1 388 ? 92.718  -32.257 -0.248   1.00 29.30  ? 363 ILE A N   1 
ATOM   2727  C  CA  . ILE A  1 388 ? 93.075  -32.278 1.178    1.00 31.57  ? 363 ILE A CA  1 
ATOM   2728  C  C   . ILE A  1 388 ? 91.811  -32.663 1.933    1.00 32.46  ? 363 ILE A C   1 
ATOM   2729  O  O   . ILE A  1 388 ? 90.746  -32.077 1.704    1.00 32.62  ? 363 ILE A O   1 
ATOM   2730  C  CB  . ILE A  1 388 ? 93.563  -30.890 1.716    1.00 31.94  ? 363 ILE A CB  1 
ATOM   2731  C  CG1 . ILE A  1 388 ? 94.639  -30.273 0.813    1.00 31.76  ? 363 ILE A CG1 1 
ATOM   2732  C  CG2 . ILE A  1 388 ? 94.064  -30.997 3.164    1.00 31.00  ? 363 ILE A CG2 1 
ATOM   2733  C  CD1 . ILE A  1 388 ? 94.972  -28.835 1.138    1.00 30.68  ? 363 ILE A CD1 1 
ATOM   2734  N  N   . GLY A  1 389 ? 91.922  -33.636 2.831    1.00 31.96  ? 364 GLY A N   1 
ATOM   2735  C  CA  . GLY A  1 389 ? 90.799  -34.004 3.685    1.00 31.72  ? 364 GLY A CA  1 
ATOM   2736  C  C   . GLY A  1 389 ? 90.471  -32.903 4.682    1.00 31.77  ? 364 GLY A C   1 
ATOM   2737  O  O   . GLY A  1 389 ? 91.328  -32.068 5.012    1.00 31.07  ? 364 GLY A O   1 
ATOM   2738  N  N   . GLY A  1 390 ? 89.226  -32.897 5.155    1.00 30.98  ? 365 GLY A N   1 
ATOM   2739  C  CA  . GLY A  1 390 ? 88.807  -31.946 6.185    1.00 30.36  ? 365 GLY A CA  1 
ATOM   2740  C  C   . GLY A  1 390 ? 89.669  -32.074 7.438    1.00 29.62  ? 365 GLY A C   1 
ATOM   2741  O  O   . GLY A  1 390 ? 89.946  -33.178 7.911    1.00 27.20  ? 365 GLY A O   1 
ATOM   2742  N  N   . CYS A  1 391 ? 90.118  -30.939 7.961    1.00 29.63  ? 366 CYS A N   1 
ATOM   2743  C  CA  . CYS A  1 391 ? 90.892  -30.932 9.194    1.00 29.59  ? 366 CYS A CA  1 
ATOM   2744  C  C   . CYS A  1 391 ? 90.160  -30.128 10.264   1.00 28.22  ? 366 CYS A C   1 
ATOM   2745  O  O   . CYS A  1 391 ? 89.502  -29.117 9.959    1.00 26.37  ? 366 CYS A O   1 
ATOM   2746  C  CB  . CYS A  1 391 ? 92.308  -30.391 8.954    1.00 30.52  ? 366 CYS A CB  1 
ATOM   2747  S  SG  . CYS A  1 391 ? 93.315  -31.443 7.878    1.00 33.41  ? 366 CYS A SG  1 
ATOM   2748  N  N   . LEU A  1 392 ? 90.261  -30.599 11.509   1.00 27.76  ? 367 LEU A N   1 
ATOM   2749  C  CA  . LEU A  1 392 ? 89.703  -29.884 12.655   1.00 27.00  ? 367 LEU A CA  1 
ATOM   2750  C  C   . LEU A  1 392 ? 90.723  -29.863 13.780   1.00 27.37  ? 367 LEU A C   1 
ATOM   2751  O  O   . LEU A  1 392 ? 91.185  -30.917 14.222   1.00 28.34  ? 367 LEU A O   1 
ATOM   2752  C  CB  . LEU A  1 392 ? 88.392  -30.522 13.124   1.00 26.62  ? 367 LEU A CB  1 
ATOM   2753  C  CG  . LEU A  1 392 ? 87.571  -29.842 14.236   1.00 25.67  ? 367 LEU A CG  1 
ATOM   2754  C  CD1 . LEU A  1 392 ? 87.076  -28.471 13.795   1.00 24.09  ? 367 LEU A CD1 1 
ATOM   2755  C  CD2 . LEU A  1 392 ? 86.391  -30.732 14.630   1.00 25.74  ? 367 LEU A CD2 1 
ATOM   2756  N  N   . PHE A  1 393 ? 91.097  -28.657 14.207   1.00 26.16  ? 368 PHE A N   1 
ATOM   2757  C  CA  . PHE A  1 393 ? 91.964  -28.483 15.361   1.00 26.59  ? 368 PHE A CA  1 
ATOM   2758  C  C   . PHE A  1 393 ? 91.125  -28.071 16.564   1.00 28.71  ? 368 PHE A C   1 
ATOM   2759  O  O   . PHE A  1 393 ? 90.214  -27.251 16.428   1.00 29.05  ? 368 PHE A O   1 
ATOM   2760  C  CB  . PHE A  1 393 ? 93.023  -27.410 15.096   1.00 25.28  ? 368 PHE A CB  1 
ATOM   2761  C  CG  . PHE A  1 393 ? 94.207  -27.874 14.283   1.00 25.01  ? 368 PHE A CG  1 
ATOM   2762  C  CD1 . PHE A  1 393 ? 95.212  -28.652 14.857   1.00 25.20  ? 368 PHE A CD1 1 
ATOM   2763  C  CD2 . PHE A  1 393 ? 94.357  -27.465 12.959   1.00 25.06  ? 368 PHE A CD2 1 
ATOM   2764  C  CE1 . PHE A  1 393 ? 96.333  -29.037 14.121   1.00 25.35  ? 368 PHE A CE1 1 
ATOM   2765  C  CE2 . PHE A  1 393 ? 95.476  -27.851 12.219   1.00 25.32  ? 368 PHE A CE2 1 
ATOM   2766  C  CZ  . PHE A  1 393 ? 96.464  -28.640 12.800   1.00 24.89  ? 368 PHE A CZ  1 
ATOM   2767  N  N   . ASP A  1 394 ? 91.431  -28.650 17.727   1.00 31.09  ? 369 ASP A N   1 
ATOM   2768  C  CA  . ASP A  1 394 ? 90.894  -28.228 19.037   1.00 32.43  ? 369 ASP A CA  1 
ATOM   2769  C  C   . ASP A  1 394 ? 92.053  -27.633 19.871   1.00 32.58  ? 369 ASP A C   1 
ATOM   2770  O  O   . ASP A  1 394 ? 93.229  -27.837 19.531   1.00 32.00  ? 369 ASP A O   1 
ATOM   2771  C  CB  . ASP A  1 394 ? 90.250  -29.430 19.761   1.00 34.98  ? 369 ASP A CB  1 
ATOM   2772  C  CG  . ASP A  1 394 ? 89.353  -29.023 20.956   1.00 37.45  ? 369 ASP A CG  1 
ATOM   2773  O  OD1 . ASP A  1 394 ? 89.149  -27.810 21.224   1.00 36.10  ? 369 ASP A OD1 1 
ATOM   2774  O  OD2 . ASP A  1 394 ? 88.834  -29.944 21.629   1.00 39.11  ? 369 ASP A OD2 1 
ATOM   2775  N  N   . ASP A  1 395 ? 91.722  -26.898 20.938   1.00 32.46  ? 370 ASP A N   1 
ATOM   2776  C  CA  . ASP A  1 395 ? 92.710  -26.262 21.839   1.00 33.96  ? 370 ASP A CA  1 
ATOM   2777  C  C   . ASP A  1 395 ? 93.678  -25.310 21.130   1.00 33.55  ? 370 ASP A C   1 
ATOM   2778  O  O   . ASP A  1 395 ? 94.835  -25.162 21.528   1.00 33.94  ? 370 ASP A O   1 
ATOM   2779  C  CB  . ASP A  1 395 ? 93.493  -27.310 22.653   1.00 35.83  ? 370 ASP A CB  1 
ATOM   2780  C  CG  . ASP A  1 395 ? 92.611  -28.096 23.597   1.00 37.94  ? 370 ASP A CG  1 
ATOM   2781  O  OD1 . ASP A  1 395 ? 91.826  -27.477 24.344   1.00 37.90  ? 370 ASP A OD1 1 
ATOM   2782  O  OD2 . ASP A  1 395 ? 92.712  -29.339 23.596   1.00 40.48  ? 370 ASP A OD2 1 
ATOM   2783  N  N   . VAL A  1 396 ? 93.191  -24.674 20.073   1.00 32.38  ? 371 VAL A N   1 
ATOM   2784  C  CA  . VAL A  1 396 ? 93.947  -23.669 19.358   1.00 30.98  ? 371 VAL A CA  1 
ATOM   2785  C  C   . VAL A  1 396 ? 94.063  -22.442 20.267   1.00 30.36  ? 371 VAL A C   1 
ATOM   2786  O  O   . VAL A  1 396 ? 93.123  -22.119 20.979   1.00 31.44  ? 371 VAL A O   1 
ATOM   2787  C  CB  . VAL A  1 396 ? 93.234  -23.321 18.028   1.00 28.78  ? 371 VAL A CB  1 
ATOM   2788  C  CG1 . VAL A  1 396 ? 94.002  -22.261 17.253   1.00 27.87  ? 371 VAL A CG1 1 
ATOM   2789  C  CG2 . VAL A  1 396 ? 93.065  -24.576 17.180   1.00 27.65  ? 371 VAL A CG2 1 
ATOM   2790  N  N   . THR A  1 397 ? 95.217  -21.783 20.257   1.00 30.18  ? 372 THR A N   1 
ATOM   2791  C  CA  . THR A  1 397 ? 95.425  -20.563 21.047   1.00 31.70  ? 372 THR A CA  1 
ATOM   2792  C  C   . THR A  1 397 ? 95.850  -19.410 20.152   1.00 29.85  ? 372 THR A C   1 
ATOM   2793  O  O   . THR A  1 397 ? 96.409  -19.644 19.082   1.00 29.49  ? 372 THR A O   1 
ATOM   2794  C  CB  . THR A  1 397 ? 96.441  -20.759 22.211   1.00 33.99  ? 372 THR A CB  1 
ATOM   2795  O  OG1 . THR A  1 397 ? 97.687  -21.257 21.706   1.00 35.36  ? 372 THR A OG1 1 
ATOM   2796  C  CG2 . THR A  1 397 ? 95.883  -21.717 23.271   1.00 32.76  ? 372 THR A CG2 1 
ATOM   2797  N  N   . PRO A  1 398 ? 95.569  -18.156 20.575   1.00 29.77  ? 373 PRO A N   1 
ATOM   2798  C  CA  . PRO A  1 398 ? 95.804  -16.987 19.716   1.00 29.48  ? 373 PRO A CA  1 
ATOM   2799  C  C   . PRO A  1 398 ? 97.245  -16.750 19.276   1.00 30.01  ? 373 PRO A C   1 
ATOM   2800  O  O   . PRO A  1 398 ? 97.468  -15.973 18.356   1.00 31.07  ? 373 PRO A O   1 
ATOM   2801  C  CB  . PRO A  1 398 ? 95.324  -15.808 20.571   1.00 29.86  ? 373 PRO A CB  1 
ATOM   2802  C  CG  . PRO A  1 398 ? 94.365  -16.407 21.533   1.00 30.16  ? 373 PRO A CG  1 
ATOM   2803  C  CD  . PRO A  1 398 ? 94.904  -17.776 21.834   1.00 29.69  ? 373 PRO A CD  1 
ATOM   2804  N  N   . ASP A  1 399 ? 98.216  -17.401 19.899   1.00 31.50  ? 374 ASP A N   1 
ATOM   2805  C  CA  . ASP A  1 399 ? 99.607  -17.190 19.490   1.00 35.20  ? 374 ASP A CA  1 
ATOM   2806  C  C   . ASP A  1 399 ? 100.092 -18.160 18.408   1.00 33.92  ? 374 ASP A C   1 
ATOM   2807  O  O   . ASP A  1 399 ? 101.209 -18.023 17.916   1.00 34.91  ? 374 ASP A O   1 
ATOM   2808  C  CB  . ASP A  1 399 ? 100.551 -17.178 20.700   1.00 41.38  ? 374 ASP A CB  1 
ATOM   2809  C  CG  . ASP A  1 399 ? 100.185 -18.220 21.736   1.00 52.53  ? 374 ASP A CG  1 
ATOM   2810  O  OD1 . ASP A  1 399 ? 99.932  -19.391 21.363   1.00 54.65  ? 374 ASP A OD1 1 
ATOM   2811  O  OD2 . ASP A  1 399 ? 100.147 -17.861 22.931   1.00 60.86  ? 374 ASP A OD2 1 
HETATM 2812  N  N   . MSE A  1 400 ? 99.252  -19.125 18.038   1.00 31.48  ? 375 MSE A N   1 
HETATM 2813  C  CA  . MSE A  1 400 ? 99.604  -20.116 17.018   1.00 31.79  ? 375 MSE A CA  1 
HETATM 2814  C  C   . MSE A  1 400 ? 99.363  -19.575 15.623   1.00 31.73  ? 375 MSE A C   1 
HETATM 2815  O  O   . MSE A  1 400 ? 98.437  -18.777 15.403   1.00 31.30  ? 375 MSE A O   1 
HETATM 2816  C  CB  . MSE A  1 400 ? 98.721  -21.344 17.194   1.00 32.71  ? 375 MSE A CB  1 
HETATM 2817  C  CG  . MSE A  1 400 ? 98.904  -22.015 18.546   1.00 35.00  ? 375 MSE A CG  1 
HETATM 2818  SE SE  . MSE A  1 400 ? 97.779  -23.635 18.531   1.00 37.96  ? 375 MSE A SE  1 
HETATM 2819  C  CE  . MSE A  1 400 ? 98.278  -24.326 20.316   1.00 36.89  ? 375 MSE A CE  1 
ATOM   2820  N  N   . ASP A  1 401 ? 100.193 -20.004 14.670   1.00 31.80  ? 376 ASP A N   1 
ATOM   2821  C  CA  . ASP A  1 401 ? 100.073 -19.589 13.259   1.00 31.57  ? 376 ASP A CA  1 
ATOM   2822  C  C   . ASP A  1 401 ? 98.739  -19.920 12.617   1.00 29.80  ? 376 ASP A C   1 
ATOM   2823  O  O   . ASP A  1 401 ? 98.220  -19.122 11.850   1.00 29.87  ? 376 ASP A O   1 
ATOM   2824  C  CB  . ASP A  1 401 ? 101.175 -20.223 12.412   1.00 33.80  ? 376 ASP A CB  1 
ATOM   2825  C  CG  . ASP A  1 401 ? 102.540 -19.674 12.733   1.00 35.53  ? 376 ASP A CG  1 
ATOM   2826  O  OD1 . ASP A  1 401 ? 102.639 -18.505 13.164   1.00 35.82  ? 376 ASP A OD1 1 
ATOM   2827  O  OD2 . ASP A  1 401 ? 103.515 -20.420 12.546   1.00 37.81  ? 376 ASP A OD2 1 
ATOM   2828  N  N   . ILE A  1 402 ? 98.193  -21.097 12.931   1.00 29.79  ? 377 ILE A N   1 
ATOM   2829  C  CA  . ILE A  1 402 ? 96.919  -21.546 12.350   1.00 28.52  ? 377 ILE A CA  1 
ATOM   2830  C  C   . ILE A  1 402 ? 95.781  -20.622 12.751   1.00 27.50  ? 377 ILE A C   1 
ATOM   2831  O  O   . ILE A  1 402 ? 94.741  -20.601 12.110   1.00 26.33  ? 377 ILE A O   1 
ATOM   2832  C  CB  . ILE A  1 402 ? 96.558  -23.033 12.671   1.00 27.67  ? 377 ILE A CB  1 
ATOM   2833  C  CG1 . ILE A  1 402 ? 96.647  -23.355 14.170   1.00 27.40  ? 377 ILE A CG1 1 
ATOM   2834  C  CG2 . ILE A  1 402 ? 97.419  -23.982 11.862   1.00 27.28  ? 377 ILE A CG2 1 
ATOM   2835  C  CD1 . ILE A  1 402 ? 95.925  -24.630 14.558   1.00 27.47  ? 377 ILE A CD1 1 
ATOM   2836  N  N   . TYR A  1 403 ? 96.001  -19.861 13.819   1.00 28.06  ? 378 TYR A N   1 
ATOM   2837  C  CA  . TYR A  1 403 ? 95.031  -18.901 14.300   1.00 26.47  ? 378 TYR A CA  1 
ATOM   2838  C  C   . TYR A  1 403 ? 95.257  -17.501 13.711   1.00 25.57  ? 378 TYR A C   1 
ATOM   2839  O  O   . TYR A  1 403 ? 94.293  -16.807 13.365   1.00 23.69  ? 378 TYR A O   1 
ATOM   2840  C  CB  . TYR A  1 403 ? 95.043  -18.831 15.835   1.00 26.46  ? 378 TYR A CB  1 
ATOM   2841  C  CG  . TYR A  1 403 ? 94.127  -17.740 16.347   1.00 24.94  ? 378 TYR A CG  1 
ATOM   2842  C  CD1 . TYR A  1 403 ? 92.766  -17.996 16.552   1.00 24.89  ? 378 TYR A CD1 1 
ATOM   2843  C  CD2 . TYR A  1 403 ? 94.609  -16.437 16.572   1.00 23.97  ? 378 TYR A CD2 1 
ATOM   2844  C  CE1 . TYR A  1 403 ? 91.908  -16.991 16.988   1.00 24.46  ? 378 TYR A CE1 1 
ATOM   2845  C  CE2 . TYR A  1 403 ? 93.763  -15.427 17.011   1.00 23.89  ? 378 TYR A CE2 1 
ATOM   2846  C  CZ  . TYR A  1 403 ? 92.417  -15.711 17.219   1.00 24.13  ? 378 TYR A CZ  1 
ATOM   2847  O  OH  . TYR A  1 403 ? 91.563  -14.728 17.654   1.00 24.24  ? 378 TYR A OH  1 
ATOM   2848  N  N   . LYS A  1 404 ? 96.519  -17.079 13.621   1.00 26.73  ? 379 LYS A N   1 
ATOM   2849  C  CA  . LYS A  1 404 ? 96.834  -15.737 13.123   1.00 27.52  ? 379 LYS A CA  1 
ATOM   2850  C  C   . LYS A  1 404 ? 96.692  -15.636 11.602   1.00 26.64  ? 379 LYS A C   1 
ATOM   2851  O  O   . LYS A  1 404 ? 96.348  -14.587 11.069   1.00 27.45  ? 379 LYS A O   1 
ATOM   2852  C  CB  . LYS A  1 404 ? 98.247  -15.314 13.559   1.00 30.47  ? 379 LYS A CB  1 
ATOM   2853  C  CG  . LYS A  1 404 ? 98.438  -15.239 15.073   1.00 32.99  ? 379 LYS A CG  1 
ATOM   2854  C  CD  . LYS A  1 404 ? 99.876  -14.910 15.455   1.00 35.80  ? 379 LYS A CD  1 
ATOM   2855  C  CE  . LYS A  1 404 ? 100.821 -16.051 15.121   1.00 41.06  ? 379 LYS A CE  1 
ATOM   2856  N  NZ  . LYS A  1 404 ? 102.240 -15.634 15.248   1.00 45.18  ? 379 LYS A NZ  1 
ATOM   2857  N  N   . THR A  1 405 ? 96.941  -16.741 10.908   1.00 26.76  ? 380 THR A N   1 
ATOM   2858  C  CA  . THR A  1 405 ? 97.068  -16.737 9.442    1.00 26.04  ? 380 THR A CA  1 
ATOM   2859  C  C   . THR A  1 405 ? 95.812  -17.235 8.742    1.00 23.64  ? 380 THR A C   1 
ATOM   2860  O  O   . THR A  1 405 ? 95.245  -18.267 9.129    1.00 23.79  ? 380 THR A O   1 
ATOM   2861  C  CB  . THR A  1 405 ? 98.226  -17.668 9.017    1.00 27.68  ? 380 THR A CB  1 
ATOM   2862  O  OG1 . THR A  1 405 ? 99.398  -17.321 9.758    1.00 29.90  ? 380 THR A OG1 1 
ATOM   2863  C  CG2 . THR A  1 405 ? 98.509  -17.602 7.513    1.00 25.79  ? 380 THR A CG2 1 
ATOM   2864  N  N   . GLU A  1 406 ? 95.401  -16.519 7.695    1.00 21.73  ? 381 GLU A N   1 
ATOM   2865  C  CA  . GLU A  1 406 ? 94.331  -16.990 6.844    1.00 21.69  ? 381 GLU A CA  1 
ATOM   2866  C  C   . GLU A  1 406 ? 94.817  -18.232 6.077    1.00 20.28  ? 381 GLU A C   1 
ATOM   2867  O  O   . GLU A  1 406 ? 95.717  -18.127 5.259    1.00 19.49  ? 381 GLU A O   1 
ATOM   2868  C  CB  . GLU A  1 406 ? 93.878  -15.891 5.882    1.00 23.12  ? 381 GLU A CB  1 
ATOM   2869  C  CG  . GLU A  1 406 ? 92.737  -16.322 4.979    1.00 25.89  ? 381 GLU A CG  1 
ATOM   2870  C  CD  . GLU A  1 406 ? 92.293  -15.233 4.029    1.00 30.50  ? 381 GLU A CD  1 
ATOM   2871  O  OE1 . GLU A  1 406 ? 93.166  -14.547 3.464    1.00 34.21  ? 381 GLU A OE1 1 
ATOM   2872  O  OE2 . GLU A  1 406 ? 91.071  -15.068 3.843    1.00 31.75  ? 381 GLU A OE2 1 
ATOM   2873  N  N   . ILE A  1 407 ? 94.225  -19.394 6.374    1.00 20.71  ? 382 ILE A N   1 
ATOM   2874  C  CA  . ILE A  1 407 ? 94.643  -20.679 5.770    1.00 21.58  ? 382 ILE A CA  1 
ATOM   2875  C  C   . ILE A  1 407 ? 94.042  -20.889 4.358    1.00 21.36  ? 382 ILE A C   1 
ATOM   2876  O  O   . ILE A  1 407 ? 94.736  -21.359 3.444    1.00 20.90  ? 382 ILE A O   1 
ATOM   2877  C  CB  . ILE A  1 407 ? 94.357  -21.892 6.689    1.00 21.76  ? 382 ILE A CB  1 
ATOM   2878  C  CG1 . ILE A  1 407 ? 95.072  -21.743 8.041    1.00 21.61  ? 382 ILE A CG1 1 
ATOM   2879  C  CG2 . ILE A  1 407 ? 94.788  -23.206 6.036    1.00 22.43  ? 382 ILE A CG2 1 
ATOM   2880  C  CD1 . ILE A  1 407 ? 94.812  -22.896 8.989    1.00 20.86  ? 382 ILE A CD1 1 
ATOM   2881  N  N   . PHE A  1 408 ? 92.791  -20.534 4.180    1.00 20.84  ? 383 PHE A N   1 
ATOM   2882  C  CA  . PHE A  1 408 ? 92.083  -20.653 2.934    1.00 21.84  ? 383 PHE A CA  1 
ATOM   2883  C  C   . PHE A  1 408 ? 92.008  -22.093 2.461    1.00 23.59  ? 383 PHE A C   1 
ATOM   2884  O  O   . PHE A  1 408 ? 92.084  -22.359 1.311    1.00 23.76  ? 383 PHE A O   1 
ATOM   2885  C  CB  . PHE A  1 408 ? 92.655  -19.726 1.836    1.00 22.08  ? 383 PHE A CB  1 
ATOM   2886  C  CG  . PHE A  1 408 ? 91.619  -18.863 1.151    1.00 22.80  ? 383 PHE A CG  1 
ATOM   2887  C  CD1 . PHE A  1 408 ? 90.854  -17.969 1.861    1.00 23.07  ? 383 PHE A CD1 1 
ATOM   2888  C  CD2 . PHE A  1 408 ? 91.416  -18.937 -0.204   1.00 22.42  ? 383 PHE A CD2 1 
ATOM   2889  C  CE1 . PHE A  1 408 ? 89.929  -17.181 1.237    1.00 23.93  ? 383 PHE A CE1 1 
ATOM   2890  C  CE2 . PHE A  1 408 ? 90.483  -18.147 -0.824   1.00 21.96  ? 383 PHE A CE2 1 
ATOM   2891  C  CZ  . PHE A  1 408 ? 89.740  -17.267 -0.104   1.00 23.27  ? 383 PHE A CZ  1 
ATOM   2892  N  N   . GLY A  1 409 ? 91.881  -23.002 3.412    1.00 23.74  ? 384 GLY A N   1 
ATOM   2893  C  CA  . GLY A  1 409 ? 91.760  -24.421 3.132    1.00 23.81  ? 384 GLY A CA  1 
ATOM   2894  C  C   . GLY A  1 409 ? 90.751  -25.059 4.065    1.00 24.95  ? 384 GLY A C   1 
ATOM   2895  O  O   . GLY A  1 409 ? 90.204  -24.378 4.948    1.00 24.39  ? 384 GLY A O   1 
ATOM   2896  N  N   . PRO A  1 410 ? 90.500  -26.377 3.894    1.00 25.51  ? 385 PRO A N   1 
ATOM   2897  C  CA  . PRO A  1 410 ? 89.488  -27.051 4.711    1.00 25.72  ? 385 PRO A CA  1 
ATOM   2898  C  C   . PRO A  1 410 ? 90.010  -27.320 6.129    1.00 25.39  ? 385 PRO A C   1 
ATOM   2899  O  O   . PRO A  1 410 ? 90.130  -28.478 6.538    1.00 24.84  ? 385 PRO A O   1 
ATOM   2900  C  CB  . PRO A  1 410 ? 89.253  -28.361 3.950    1.00 25.38  ? 385 PRO A CB  1 
ATOM   2901  C  CG  . PRO A  1 410 ? 90.586  -28.650 3.348    1.00 25.73  ? 385 PRO A CG  1 
ATOM   2902  C  CD  . PRO A  1 410 ? 91.141  -27.308 2.943    1.00 25.49  ? 385 PRO A CD  1 
ATOM   2903  N  N   . VAL A  1 411 ? 90.324  -26.246 6.856    1.00 25.73  ? 386 VAL A N   1 
ATOM   2904  C  CA  . VAL A  1 411 ? 90.963  -26.343 8.169    1.00 26.51  ? 386 VAL A CA  1 
ATOM   2905  C  C   . VAL A  1 411 ? 90.267  -25.424 9.164    1.00 26.93  ? 386 VAL A C   1 
ATOM   2906  O  O   . VAL A  1 411 ? 90.396  -24.197 9.086    1.00 27.76  ? 386 VAL A O   1 
ATOM   2907  C  CB  . VAL A  1 411 ? 92.475  -25.996 8.124    1.00 25.36  ? 386 VAL A CB  1 
ATOM   2908  C  CG1 . VAL A  1 411 ? 93.135  -26.359 9.446    1.00 24.15  ? 386 VAL A CG1 1 
ATOM   2909  C  CG2 . VAL A  1 411 ? 93.171  -26.707 6.969    1.00 24.86  ? 386 VAL A CG2 1 
ATOM   2910  N  N   . LEU A  1 412 ? 89.544  -26.029 10.102   1.00 25.83  ? 387 LEU A N   1 
ATOM   2911  C  CA  . LEU A  1 412 ? 88.782  -25.293 11.098   1.00 25.72  ? 387 LEU A CA  1 
ATOM   2912  C  C   . LEU A  1 412 ? 89.425  -25.380 12.482   1.00 26.38  ? 387 LEU A C   1 
ATOM   2913  O  O   . LEU A  1 412 ? 89.765  -26.470 12.947   1.00 27.77  ? 387 LEU A O   1 
ATOM   2914  C  CB  . LEU A  1 412 ? 87.327  -25.800 11.144   1.00 25.27  ? 387 LEU A CB  1 
ATOM   2915  C  CG  . LEU A  1 412 ? 86.334  -25.117 12.105   1.00 24.59  ? 387 LEU A CG  1 
ATOM   2916  C  CD1 . LEU A  1 412 ? 86.144  -23.620 11.836   1.00 23.71  ? 387 LEU A CD1 1 
ATOM   2917  C  CD2 . LEU A  1 412 ? 84.999  -25.835 12.046   1.00 24.90  ? 387 LEU A CD2 1 
ATOM   2918  N  N   . SER A  1 413 ? 89.573  -24.227 13.135   1.00 25.96  ? 388 SER A N   1 
ATOM   2919  C  CA  . SER A  1 413 ? 90.193  -24.139 14.461   1.00 25.54  ? 388 SER A CA  1 
ATOM   2920  C  C   . SER A  1 413 ? 89.178  -23.843 15.565   1.00 23.68  ? 388 SER A C   1 
ATOM   2921  O  O   . SER A  1 413 ? 88.316  -22.989 15.416   1.00 22.23  ? 388 SER A O   1 
ATOM   2922  C  CB  . SER A  1 413 ? 91.285  -23.063 14.468   1.00 26.80  ? 388 SER A CB  1 
ATOM   2923  O  OG  . SER A  1 413 ? 92.299  -23.386 13.546   1.00 27.12  ? 388 SER A OG  1 
ATOM   2924  N  N   . VAL A  1 414 ? 89.297  -24.555 16.678   1.00 24.17  ? 389 VAL A N   1 
ATOM   2925  C  CA  . VAL A  1 414 ? 88.431  -24.336 17.817   1.00 24.14  ? 389 VAL A CA  1 
ATOM   2926  C  C   . VAL A  1 414 ? 89.240  -23.697 18.934   1.00 24.83  ? 389 VAL A C   1 
ATOM   2927  O  O   . VAL A  1 414 ? 90.221  -24.275 19.423   1.00 25.10  ? 389 VAL A O   1 
ATOM   2928  C  CB  . VAL A  1 414 ? 87.753  -25.642 18.299   1.00 25.25  ? 389 VAL A CB  1 
ATOM   2929  C  CG1 . VAL A  1 414 ? 86.735  -25.349 19.396   1.00 25.60  ? 389 VAL A CG1 1 
ATOM   2930  C  CG2 . VAL A  1 414 ? 87.075  -26.354 17.136   1.00 25.32  ? 389 VAL A CG2 1 
ATOM   2931  N  N   . VAL A  1 415 ? 88.841  -22.483 19.300   1.00 24.58  ? 390 VAL A N   1 
ATOM   2932  C  CA  . VAL A  1 415 ? 89.381  -21.806 20.473   1.00 25.29  ? 390 VAL A CA  1 
ATOM   2933  C  C   . VAL A  1 415 ? 88.304  -21.819 21.566   1.00 27.44  ? 390 VAL A C   1 
ATOM   2934  O  O   . VAL A  1 415 ? 87.170  -21.342 21.365   1.00 27.14  ? 390 VAL A O   1 
ATOM   2935  C  CB  . VAL A  1 415 ? 89.871  -20.360 20.165   1.00 23.07  ? 390 VAL A CB  1 
ATOM   2936  C  CG1 . VAL A  1 415 ? 90.383  -19.676 21.436   1.00 22.48  ? 390 VAL A CG1 1 
ATOM   2937  C  CG2 . VAL A  1 415 ? 90.958  -20.382 19.097   1.00 21.68  ? 390 VAL A CG2 1 
ATOM   2938  N  N   . ARG A  1 416 ? 88.665  -22.402 22.707   1.00 29.26  ? 391 ARG A N   1 
ATOM   2939  C  CA  . ARG A  1 416 ? 87.778  -22.501 23.853   1.00 31.63  ? 391 ARG A CA  1 
ATOM   2940  C  C   . ARG A  1 416 ? 87.801  -21.194 24.635   1.00 33.72  ? 391 ARG A C   1 
ATOM   2941  O  O   . ARG A  1 416 ? 88.856  -20.773 25.104   1.00 36.96  ? 391 ARG A O   1 
ATOM   2942  C  CB  . ARG A  1 416 ? 88.183  -23.691 24.730   1.00 31.08  ? 391 ARG A CB  1 
ATOM   2943  C  CG  . ARG A  1 416 ? 87.763  -25.024 24.138   1.00 30.73  ? 391 ARG A CG  1 
ATOM   2944  C  CD  . ARG A  1 416 ? 88.535  -26.208 24.700   1.00 30.90  ? 391 ARG A CD  1 
ATOM   2945  N  NE  . ARG A  1 416 ? 88.100  -27.460 24.064   1.00 30.64  ? 391 ARG A NE  1 
ATOM   2946  C  CZ  . ARG A  1 416 ? 87.281  -28.357 24.620   1.00 30.95  ? 391 ARG A CZ  1 
ATOM   2947  N  NH1 . ARG A  1 416 ? 86.947  -29.448 23.945   1.00 30.52  ? 391 ARG A NH1 1 
ATOM   2948  N  NH2 . ARG A  1 416 ? 86.793  -28.175 25.847   1.00 31.56  ? 391 ARG A NH2 1 
ATOM   2949  N  N   . ALA A  1 417 ? 86.641  -20.547 24.734   1.00 31.93  ? 392 ALA A N   1 
ATOM   2950  C  CA  . ALA A  1 417 ? 86.492  -19.301 25.482   1.00 31.22  ? 392 ALA A CA  1 
ATOM   2951  C  C   . ALA A  1 417 ? 85.855  -19.566 26.848   1.00 33.24  ? 392 ALA A C   1 
ATOM   2952  O  O   . ALA A  1 417 ? 84.935  -20.391 26.970   1.00 32.98  ? 392 ALA A O   1 
ATOM   2953  C  CB  . ALA A  1 417 ? 85.650  -18.314 24.690   1.00 28.90  ? 392 ALA A CB  1 
ATOM   2954  N  N   . ARG A  1 418 ? 86.344  -18.858 27.866   1.00 34.33  ? 393 ARG A N   1 
ATOM   2955  C  CA  . ARG A  1 418 ? 85.916  -19.076 29.258   1.00 37.74  ? 393 ARG A CA  1 
ATOM   2956  C  C   . ARG A  1 418 ? 84.591  -18.369 29.566   1.00 33.94  ? 393 ARG A C   1 
ATOM   2957  O  O   . ARG A  1 418 ? 83.800  -18.852 30.368   1.00 32.92  ? 393 ARG A O   1 
ATOM   2958  C  CB  . ARG A  1 418 ? 87.010  -18.633 30.244   1.00 45.15  ? 393 ARG A CB  1 
ATOM   2959  C  CG  . ARG A  1 418 ? 88.221  -19.562 30.292   1.00 54.84  ? 393 ARG A CG  1 
ATOM   2960  C  CD  . ARG A  1 418 ? 89.499  -18.816 30.670   1.00 64.03  ? 393 ARG A CD  1 
ATOM   2961  N  NE  . ARG A  1 418 ? 90.710  -19.556 30.295   1.00 68.34  ? 393 ARG A NE  1 
ATOM   2962  C  CZ  . ARG A  1 418 ? 91.873  -18.996 29.959   1.00 68.47  ? 393 ARG A CZ  1 
ATOM   2963  N  NH1 . ARG A  1 418 ? 92.010  -17.675 29.930   1.00 66.49  ? 393 ARG A NH1 1 
ATOM   2964  N  NH2 . ARG A  1 418 ? 92.903  -19.764 29.635   1.00 69.49  ? 393 ARG A NH2 1 
ATOM   2965  N  N   . ASN A  1 419 ? 84.365  -17.227 28.920   1.00 31.12  ? 394 ASN A N   1 
ATOM   2966  C  CA  . ASN A  1 419 ? 83.131  -16.470 29.076   1.00 30.57  ? 394 ASN A CA  1 
ATOM   2967  C  C   . ASN A  1 419 ? 82.842  -15.619 27.845   1.00 29.22  ? 394 ASN A C   1 
ATOM   2968  O  O   . ASN A  1 419 ? 83.595  -15.643 26.851   1.00 27.91  ? 394 ASN A O   1 
ATOM   2969  C  CB  . ASN A  1 419 ? 83.201  -15.589 30.330   1.00 33.10  ? 394 ASN A CB  1 
ATOM   2970  C  CG  . ASN A  1 419 ? 84.487  -14.788 30.403   1.00 35.73  ? 394 ASN A CG  1 
ATOM   2971  O  OD1 . ASN A  1 419 ? 84.847  -14.061 29.471   1.00 33.58  ? 394 ASN A OD1 1 
ATOM   2972  N  ND2 . ASN A  1 419 ? 85.198  -14.929 31.509   1.00 39.75  ? 394 ASN A ND2 1 
ATOM   2973  N  N   . TYR A  1 420 ? 81.751  -14.858 27.921   1.00 29.13  ? 395 TYR A N   1 
ATOM   2974  C  CA  . TYR A  1 420 ? 81.304  -14.011 26.818   1.00 27.89  ? 395 TYR A CA  1 
ATOM   2975  C  C   . TYR A  1 420 ? 82.308  -12.924 26.428   1.00 26.35  ? 395 TYR A C   1 
ATOM   2976  O  O   . TYR A  1 420 ? 82.566  -12.729 25.237   1.00 25.21  ? 395 TYR A O   1 
ATOM   2977  C  CB  . TYR A  1 420 ? 79.930  -13.395 27.122   1.00 28.78  ? 395 TYR A CB  1 
ATOM   2978  C  CG  . TYR A  1 420 ? 79.519  -12.296 26.149   1.00 29.79  ? 395 TYR A CG  1 
ATOM   2979  C  CD1 . TYR A  1 420 ? 78.901  -12.606 24.936   1.00 29.06  ? 395 TYR A CD1 1 
ATOM   2980  C  CD2 . TYR A  1 420 ? 79.755  -10.945 26.452   1.00 29.93  ? 395 TYR A CD2 1 
ATOM   2981  C  CE1 . TYR A  1 420 ? 78.528  -11.604 24.055   1.00 29.57  ? 395 TYR A CE1 1 
ATOM   2982  C  CE2 . TYR A  1 420 ? 79.387  -9.939  25.582   1.00 29.64  ? 395 TYR A CE2 1 
ATOM   2983  C  CZ  . TYR A  1 420 ? 78.771  -10.272 24.386   1.00 30.14  ? 395 TYR A CZ  1 
ATOM   2984  O  OH  . TYR A  1 420 ? 78.399  -9.274  23.522   1.00 28.81  ? 395 TYR A OH  1 
ATOM   2985  N  N   . GLU A  1 421 ? 82.842  -12.203 27.415   1.00 26.52  ? 396 GLU A N   1 
ATOM   2986  C  CA  . GLU A  1 421 ? 83.842  -11.161 27.155   1.00 27.24  ? 396 GLU A CA  1 
ATOM   2987  C  C   . GLU A  1 421 ? 85.112  -11.735 26.521   1.00 27.72  ? 396 GLU A C   1 
ATOM   2988  O  O   . GLU A  1 421 ? 85.667  -11.142 25.583   1.00 27.84  ? 396 GLU A O   1 
ATOM   2989  C  CB  . GLU A  1 421 ? 84.202  -10.382 28.426   1.00 28.33  ? 396 GLU A CB  1 
ATOM   2990  C  CG  . GLU A  1 421 ? 83.097  -9.461  28.942   1.00 28.64  ? 396 GLU A CG  1 
ATOM   2991  C  CD  . GLU A  1 421 ? 82.701  -8.372  27.953   1.00 28.81  ? 396 GLU A CD  1 
ATOM   2992  O  OE1 . GLU A  1 421 ? 83.564  -7.868  27.189   1.00 28.14  ? 396 GLU A OE1 1 
ATOM   2993  O  OE2 . GLU A  1 421 ? 81.507  -8.011  27.932   1.00 29.06  ? 396 GLU A OE2 1 
ATOM   2994  N  N   . GLU A  1 422 ? 85.568  -12.883 27.015   1.00 27.23  ? 397 GLU A N   1 
ATOM   2995  C  CA  . GLU A  1 422 ? 86.745  -13.506 26.422   1.00 28.91  ? 397 GLU A CA  1 
ATOM   2996  C  C   . GLU A  1 422 ? 86.471  -13.867 24.949   1.00 28.69  ? 397 GLU A C   1 
ATOM   2997  O  O   . GLU A  1 422 ? 87.267  -13.547 24.078   1.00 29.45  ? 397 GLU A O   1 
ATOM   2998  C  CB  . GLU A  1 422 ? 87.224  -14.705 27.248   1.00 30.74  ? 397 GLU A CB  1 
ATOM   2999  C  CG  . GLU A  1 422 ? 88.077  -15.699 26.475   1.00 32.93  ? 397 GLU A CG  1 
ATOM   3000  C  CD  . GLU A  1 422 ? 88.995  -16.499 27.369   1.00 35.52  ? 397 GLU A CD  1 
ATOM   3001  O  OE1 . GLU A  1 422 ? 88.800  -17.723 27.501   1.00 35.80  ? 397 GLU A OE1 1 
ATOM   3002  O  OE2 . GLU A  1 422 ? 89.914  -15.897 27.947   1.00 38.52  ? 397 GLU A OE2 1 
ATOM   3003  N  N   . ALA A  1 423 ? 85.322  -14.493 24.690   1.00 27.83  ? 398 ALA A N   1 
ATOM   3004  C  CA  . ALA A  1 423 ? 84.894  -14.878 23.345   1.00 25.98  ? 398 ALA A CA  1 
ATOM   3005  C  C   . ALA A  1 423 ? 84.855  -13.680 22.388   1.00 25.24  ? 398 ALA A C   1 
ATOM   3006  O  O   . ALA A  1 423 ? 85.347  -13.756 21.257   1.00 24.41  ? 398 ALA A O   1 
ATOM   3007  C  CB  . ALA A  1 423 ? 83.536  -15.572 23.398   1.00 24.70  ? 398 ALA A CB  1 
ATOM   3008  N  N   . LEU A  1 424 ? 84.276  -12.582 22.858   1.00 24.64  ? 399 LEU A N   1 
ATOM   3009  C  CA  . LEU A  1 424 ? 84.179  -11.357 22.084   1.00 23.13  ? 399 LEU A CA  1 
ATOM   3010  C  C   . LEU A  1 424 ? 85.545  -10.788 21.733   1.00 22.62  ? 399 LEU A C   1 
ATOM   3011  O  O   . LEU A  1 424 ? 85.748  -10.325 20.612   1.00 22.47  ? 399 LEU A O   1 
ATOM   3012  C  CB  . LEU A  1 424 ? 83.354  -10.306 22.838   1.00 22.65  ? 399 LEU A CB  1 
ATOM   3013  C  CG  . LEU A  1 424 ? 83.253  -8.919  22.208   1.00 21.35  ? 399 LEU A CG  1 
ATOM   3014  C  CD1 . LEU A  1 424 ? 82.577  -8.982  20.833   1.00 20.43  ? 399 LEU A CD1 1 
ATOM   3015  C  CD2 . LEU A  1 424 ? 82.495  -8.007  23.153   1.00 21.16  ? 399 LEU A CD2 1 
ATOM   3016  N  N   . SER A  1 425 ? 86.474  -10.829 22.682   1.00 22.60  ? 400 SER A N   1 
ATOM   3017  C  CA  . SER A  1 425 ? 87.791  -10.211 22.492   1.00 23.07  ? 400 SER A CA  1 
ATOM   3018  C  C   . SER A  1 425 ? 88.636  -10.884 21.416   1.00 23.26  ? 400 SER A C   1 
ATOM   3019  O  O   . SER A  1 425 ? 89.554  -10.262 20.889   1.00 23.14  ? 400 SER A O   1 
ATOM   3020  C  CB  . SER A  1 425 ? 88.571  -10.187 23.799   1.00 22.89  ? 400 SER A CB  1 
ATOM   3021  O  OG  . SER A  1 425 ? 88.853  -11.507 24.170   1.00 23.59  ? 400 SER A OG  1 
ATOM   3022  N  N   . LEU A  1 426 ? 88.333  -12.145 21.098   1.00 23.71  ? 401 LEU A N   1 
ATOM   3023  C  CA  . LEU A  1 426 ? 89.071  -12.884 20.054   1.00 24.08  ? 401 LEU A CA  1 
ATOM   3024  C  C   . LEU A  1 426 ? 88.919  -12.257 18.634   1.00 23.86  ? 401 LEU A C   1 
ATOM   3025  O  O   . LEU A  1 426 ? 89.922  -11.819 18.061   1.00 24.77  ? 401 LEU A O   1 
ATOM   3026  C  CB  . LEU A  1 426 ? 88.754  -14.392 20.085   1.00 24.37  ? 401 LEU A CB  1 
ATOM   3027  C  CG  . LEU A  1 426 ? 89.381  -15.150 21.271   1.00 25.56  ? 401 LEU A CG  1 
ATOM   3028  C  CD1 . LEU A  1 426 ? 88.578  -16.379 21.669   1.00 25.88  ? 401 LEU A CD1 1 
ATOM   3029  C  CD2 . LEU A  1 426 ? 90.825  -15.528 20.975   1.00 26.36  ? 401 LEU A CD2 1 
ATOM   3030  N  N   . PRO A  1 427 ? 87.682  -12.191 18.076   1.00 22.14  ? 402 PRO A N   1 
ATOM   3031  C  CA  . PRO A  1 427 ? 87.598  -11.475 16.797   1.00 22.12  ? 402 PRO A CA  1 
ATOM   3032  C  C   . PRO A  1 427 ? 87.910  -9.966  16.933   1.00 21.31  ? 402 PRO A C   1 
ATOM   3033  O  O   . PRO A  1 427 ? 88.420  -9.372  15.989   1.00 20.41  ? 402 PRO A O   1 
ATOM   3034  C  CB  . PRO A  1 427 ? 86.145  -11.712 16.347   1.00 21.77  ? 402 PRO A CB  1 
ATOM   3035  C  CG  . PRO A  1 427 ? 85.401  -12.031 17.605   1.00 21.79  ? 402 PRO A CG  1 
ATOM   3036  C  CD  . PRO A  1 427 ? 86.381  -12.785 18.452   1.00 21.77  ? 402 PRO A CD  1 
HETATM 3037  N  N   . MSE A  1 428 ? 87.642  -9.388  18.106   1.00 21.06  ? 403 MSE A N   1 
HETATM 3038  C  CA  . MSE A  1 428 ? 87.927  -7.969  18.381   1.00 21.25  ? 403 MSE A CA  1 
HETATM 3039  C  C   . MSE A  1 428 ? 89.382  -7.685  18.168   1.00 21.10  ? 403 MSE A C   1 
HETATM 3040  O  O   . MSE A  1 428 ? 89.729  -6.710  17.512   1.00 20.61  ? 403 MSE A O   1 
HETATM 3041  C  CB  . MSE A  1 428 ? 87.504  -7.559  19.802   1.00 22.82  ? 403 MSE A CB  1 
HETATM 3042  C  CG  . MSE A  1 428 ? 87.621  -6.052  20.049   1.00 24.68  ? 403 MSE A CG  1 
HETATM 3043  SE SE  . MSE A  1 428 ? 86.041  -5.081  19.354   1.00 27.87  ? 403 MSE A SE  1 
HETATM 3044  C  CE  . MSE A  1 428 ? 84.860  -5.516  20.883   1.00 28.65  ? 403 MSE A CE  1 
ATOM   3045  N  N   . LYS A  1 429 ? 90.233  -8.564  18.690   1.00 22.21  ? 404 LYS A N   1 
ATOM   3046  C  CA  . LYS A  1 429 ? 91.672  -8.354  18.686   1.00 23.45  ? 404 LYS A CA  1 
ATOM   3047  C  C   . LYS A  1 429 ? 92.375  -8.814  17.419   1.00 23.24  ? 404 LYS A C   1 
ATOM   3048  O  O   . LYS A  1 429 ? 93.538  -8.464  17.214   1.00 23.21  ? 404 LYS A O   1 
ATOM   3049  C  CB  . LYS A  1 429 ? 92.320  -9.052  19.881   1.00 25.06  ? 404 LYS A CB  1 
ATOM   3050  C  CG  . LYS A  1 429 ? 92.217  -8.275  21.184   1.00 28.63  ? 404 LYS A CG  1 
ATOM   3051  C  CD  . LYS A  1 429 ? 92.922  -9.015  22.317   1.00 33.60  ? 404 LYS A CD  1 
ATOM   3052  C  CE  . LYS A  1 429 ? 93.349  -8.045  23.407   1.00 39.90  ? 404 LYS A CE  1 
ATOM   3053  N  NZ  . LYS A  1 429 ? 93.554  -8.759  24.694   1.00 45.27  ? 404 LYS A NZ  1 
ATOM   3054  N  N   . HIS A  1 430 ? 91.729  -9.599  16.585   1.00 22.91  ? 405 HIS A N   1 
ATOM   3055  C  CA  . HIS A  1 430 ? 92.349  -10.111 15.358   1.00 22.77  ? 405 HIS A CA  1 
ATOM   3056  C  C   . HIS A  1 430 ? 92.652  -9.012  14.352   1.00 21.70  ? 405 HIS A C   1 
ATOM   3057  O  O   . HIS A  1 430 ? 91.948  -8.052  14.308   1.00 19.79  ? 405 HIS A O   1 
ATOM   3058  C  CB  . HIS A  1 430 ? 91.476  -11.204 14.720   1.00 22.27  ? 405 HIS A CB  1 
ATOM   3059  C  CG  . HIS A  1 430 ? 92.244  -12.193 13.915   1.00 22.48  ? 405 HIS A CG  1 
ATOM   3060  N  ND1 . HIS A  1 430 ? 92.720  -11.916 12.664   1.00 23.01  ? 405 HIS A ND1 1 
ATOM   3061  C  CD2 . HIS A  1 430 ? 92.640  -13.445 14.195   1.00 22.90  ? 405 HIS A CD2 1 
ATOM   3062  C  CE1 . HIS A  1 430 ? 93.367  -12.954 12.201   1.00 24.23  ? 405 HIS A CE1 1 
ATOM   3063  N  NE2 . HIS A  1 430 ? 93.338  -13.892 13.114   1.00 24.91  ? 405 HIS A NE2 1 
ATOM   3064  N  N   . GLU A  1 431 ? 93.725  -9.179  13.588   1.00 23.63  ? 406 GLU A N   1 
ATOM   3065  C  CA  . GLU A  1 431 ? 94.030  -8.273  12.476   1.00 26.24  ? 406 GLU A CA  1 
ATOM   3066  C  C   . GLU A  1 431 ? 92.843  -8.139  11.511   1.00 25.08  ? 406 GLU A C   1 
ATOM   3067  O  O   . GLU A  1 431 ? 92.565  -7.046  11.005   1.00 23.68  ? 406 GLU A O   1 
ATOM   3068  C  CB  . GLU A  1 431 ? 95.219  -8.791  11.666   1.00 34.49  ? 406 GLU A CB  1 
ATOM   3069  C  CG  . GLU A  1 431 ? 96.563  -8.777  12.371   1.00 46.25  ? 406 GLU A CG  1 
ATOM   3070  C  CD  . GLU A  1 431 ? 97.119  -7.382  12.593   1.00 57.44  ? 406 GLU A CD  1 
ATOM   3071  O  OE1 . GLU A  1 431 ? 96.556  -6.394  12.057   1.00 60.55  ? 406 GLU A OE1 1 
ATOM   3072  O  OE2 . GLU A  1 431 ? 98.137  -7.281  13.311   1.00 62.61  ? 406 GLU A OE2 1 
ATOM   3073  N  N   . TYR A  1 432 ? 92.170  -9.266  11.252   1.00 24.27  ? 407 TYR A N   1 
ATOM   3074  C  CA  . TYR A  1 432 ? 91.100  -9.355  10.260   1.00 23.74  ? 407 TYR A CA  1 
ATOM   3075  C  C   . TYR A  1 432 ? 89.742  -9.010  10.838   1.00 22.72  ? 407 TYR A C   1 
ATOM   3076  O  O   . TYR A  1 432 ? 89.459  -9.317  12.003   1.00 21.97  ? 407 TYR A O   1 
ATOM   3077  C  CB  . TYR A  1 432 ? 91.050  -10.761 9.651    1.00 24.39  ? 407 TYR A CB  1 
ATOM   3078  C  CG  . TYR A  1 432 ? 92.218  -11.075 8.744    1.00 26.79  ? 407 TYR A CG  1 
ATOM   3079  C  CD1 . TYR A  1 432 ? 92.551  -10.230 7.668    1.00 27.14  ? 407 TYR A CD1 1 
ATOM   3080  C  CD2 . TYR A  1 432 ? 92.981  -12.226 8.940    1.00 28.06  ? 407 TYR A CD2 1 
ATOM   3081  C  CE1 . TYR A  1 432 ? 93.619  -10.523 6.829    1.00 28.33  ? 407 TYR A CE1 1 
ATOM   3082  C  CE2 . TYR A  1 432 ? 94.058  -12.529 8.112    1.00 28.92  ? 407 TYR A CE2 1 
ATOM   3083  C  CZ  . TYR A  1 432 ? 94.372  -11.682 7.056    1.00 29.48  ? 407 TYR A CZ  1 
ATOM   3084  O  OH  . TYR A  1 432 ? 95.432  -12.006 6.232    1.00 28.58  ? 407 TYR A OH  1 
ATOM   3085  N  N   . GLY A  1 433 ? 88.903  -8.390  10.008   1.00 22.39  ? 408 GLY A N   1 
ATOM   3086  C  CA  . GLY A  1 433 ? 87.572  -7.945  10.428   1.00 22.57  ? 408 GLY A CA  1 
ATOM   3087  C  C   . GLY A  1 433 ? 86.528  -8.030  9.330    1.00 23.25  ? 408 GLY A C   1 
ATOM   3088  O  O   . GLY A  1 433 ? 85.760  -7.078  9.112    1.00 22.92  ? 408 GLY A O   1 
ATOM   3089  N  N   . ASN A  1 434 ? 86.508  -9.164  8.628    1.00 22.30  ? 409 ASN A N   1 
ATOM   3090  C  CA  . ASN A  1 434 ? 85.633  -9.317  7.478    1.00 21.65  ? 409 ASN A CA  1 
ATOM   3091  C  C   . ASN A  1 434 ? 84.234  -9.695  7.969    1.00 21.13  ? 409 ASN A C   1 
ATOM   3092  O  O   . ASN A  1 434 ? 83.311  -8.870  7.956    1.00 20.73  ? 409 ASN A O   1 
ATOM   3093  C  CB  . ASN A  1 434 ? 86.206  -10.364 6.503    1.00 21.53  ? 409 ASN A CB  1 
ATOM   3094  C  CG  . ASN A  1 434 ? 86.036  -9.977  5.037    1.00 22.57  ? 409 ASN A CG  1 
ATOM   3095  O  OD1 . ASN A  1 434 ? 85.905  -8.791  4.692    1.00 21.98  ? 409 ASN A OD1 1 
ATOM   3096  N  ND2 . ASN A  1 434 ? 86.064  -10.981 4.158    1.00 23.25  ? 409 ASN A ND2 1 
ATOM   3097  N  N   . GLY A  1 435 ? 84.097  -10.936 8.435    1.00 20.37  ? 410 GLY A N   1 
ATOM   3098  C  CA  . GLY A  1 435 ? 82.840  -11.420 8.973    1.00 19.80  ? 410 GLY A CA  1 
ATOM   3099  C  C   . GLY A  1 435 ? 82.983  -12.043 10.346   1.00 19.18  ? 410 GLY A C   1 
ATOM   3100  O  O   . GLY A  1 435 ? 84.069  -12.495 10.727   1.00 19.75  ? 410 GLY A O   1 
ATOM   3101  N  N   . VAL A  1 436 ? 81.875  -12.082 11.077   1.00 18.04  ? 411 VAL A N   1 
ATOM   3102  C  CA  . VAL A  1 436 ? 81.819  -12.685 12.409   1.00 18.21  ? 411 VAL A CA  1 
ATOM   3103  C  C   . VAL A  1 436 ? 80.397  -13.157 12.654   1.00 18.74  ? 411 VAL A C   1 
ATOM   3104  O  O   . VAL A  1 436 ? 79.452  -12.602 12.089   1.00 18.43  ? 411 VAL A O   1 
ATOM   3105  C  CB  . VAL A  1 436 ? 82.265  -11.699 13.519   1.00 18.28  ? 411 VAL A CB  1 
ATOM   3106  C  CG1 . VAL A  1 436 ? 81.271  -10.550 13.679   1.00 17.51  ? 411 VAL A CG1 1 
ATOM   3107  C  CG2 . VAL A  1 436 ? 82.464  -12.424 14.845   1.00 18.21  ? 411 VAL A CG2 1 
ATOM   3108  N  N   . ALA A  1 437 ? 80.245  -14.196 13.473   1.00 19.25  ? 412 ALA A N   1 
ATOM   3109  C  CA  . ALA A  1 437 ? 78.919  -14.704 13.809   1.00 19.35  ? 412 ALA A CA  1 
ATOM   3110  C  C   . ALA A  1 437 ? 78.817  -15.006 15.296   1.00 20.97  ? 412 ALA A C   1 
ATOM   3111  O  O   . ALA A  1 437 ? 79.810  -15.340 15.940   1.00 21.34  ? 412 ALA A O   1 
ATOM   3112  C  CB  . ALA A  1 437 ? 78.594  -15.950 12.987   1.00 18.81  ? 412 ALA A CB  1 
ATOM   3113  N  N   . ILE A  1 438 ? 77.609  -14.862 15.834   1.00 21.48  ? 413 ILE A N   1 
ATOM   3114  C  CA  . ILE A  1 438 ? 77.304  -15.304 17.185   1.00 21.54  ? 413 ILE A CA  1 
ATOM   3115  C  C   . ILE A  1 438 ? 76.052  -16.177 17.136   1.00 21.80  ? 413 ILE A C   1 
ATOM   3116  O  O   . ILE A  1 438 ? 75.046  -15.801 16.527   1.00 22.74  ? 413 ILE A O   1 
ATOM   3117  C  CB  . ILE A  1 438 ? 77.140  -14.123 18.181   1.00 21.01  ? 413 ILE A CB  1 
ATOM   3118  C  CG1 . ILE A  1 438 ? 76.756  -14.660 19.568   1.00 21.63  ? 413 ILE A CG1 1 
ATOM   3119  C  CG2 . ILE A  1 438 ? 76.125  -13.103 17.670   1.00 19.89  ? 413 ILE A CG2 1 
ATOM   3120  C  CD1 . ILE A  1 438 ? 76.957  -13.666 20.699   1.00 22.00  ? 413 ILE A CD1 1 
ATOM   3121  N  N   . TYR A  1 439 ? 76.131  -17.350 17.749   1.00 20.99  ? 414 TYR A N   1 
ATOM   3122  C  CA  . TYR A  1 439 ? 74.973  -18.213 17.883   1.00 21.57  ? 414 TYR A CA  1 
ATOM   3123  C  C   . TYR A  1 439 ? 74.475  -18.183 19.330   1.00 23.01  ? 414 TYR A C   1 
ATOM   3124  O  O   . TYR A  1 439 ? 75.201  -18.557 20.275   1.00 23.00  ? 414 TYR A O   1 
ATOM   3125  C  CB  . TYR A  1 439 ? 75.284  -19.632 17.379   1.00 21.79  ? 414 TYR A CB  1 
ATOM   3126  C  CG  . TYR A  1 439 ? 75.088  -19.786 15.870   1.00 21.07  ? 414 TYR A CG  1 
ATOM   3127  C  CD1 . TYR A  1 439 ? 75.848  -19.044 14.963   1.00 20.15  ? 414 TYR A CD1 1 
ATOM   3128  C  CD2 . TYR A  1 439 ? 74.133  -20.674 15.357   1.00 21.26  ? 414 TYR A CD2 1 
ATOM   3129  C  CE1 . TYR A  1 439 ? 75.662  -19.173 13.590   1.00 20.10  ? 414 TYR A CE1 1 
ATOM   3130  C  CE2 . TYR A  1 439 ? 73.934  -20.814 13.990   1.00 20.86  ? 414 TYR A CE2 1 
ATOM   3131  C  CZ  . TYR A  1 439 ? 74.706  -20.071 13.107   1.00 20.21  ? 414 TYR A CZ  1 
ATOM   3132  O  OH  . TYR A  1 439 ? 74.513  -20.214 11.749   1.00 18.90  ? 414 TYR A OH  1 
ATOM   3133  N  N   . THR A  1 440 ? 73.246  -17.693 19.488   1.00 23.43  ? 415 THR A N   1 
ATOM   3134  C  CA  . THR A  1 440 ? 72.617  -17.530 20.795   1.00 25.05  ? 415 THR A CA  1 
ATOM   3135  C  C   . THR A  1 440 ? 71.111  -17.317 20.645   1.00 26.92  ? 415 THR A C   1 
ATOM   3136  O  O   . THR A  1 440 ? 70.642  -16.831 19.603   1.00 27.95  ? 415 THR A O   1 
ATOM   3137  C  CB  . THR A  1 440 ? 73.184  -16.316 21.562   1.00 23.61  ? 415 THR A CB  1 
ATOM   3138  O  OG1 . THR A  1 440 ? 72.593  -16.277 22.865   1.00 22.97  ? 415 THR A OG1 1 
ATOM   3139  C  CG2 . THR A  1 440 ? 72.903  -14.992 20.817   1.00 22.43  ? 415 THR A CG2 1 
ATOM   3140  N  N   . ARG A  1 441 ? 70.375  -17.662 21.695   1.00 26.17  ? 416 ARG A N   1 
ATOM   3141  C  CA  . ARG A  1 441 ? 68.945  -17.392 21.776   1.00 27.88  ? 416 ARG A CA  1 
ATOM   3142  C  C   . ARG A  1 441 ? 68.680  -16.060 22.465   1.00 28.30  ? 416 ARG A C   1 
ATOM   3143  O  O   . ARG A  1 441 ? 67.552  -15.551 22.439   1.00 26.82  ? 416 ARG A O   1 
ATOM   3144  C  CB  . ARG A  1 441 ? 68.248  -18.494 22.567   1.00 28.30  ? 416 ARG A CB  1 
ATOM   3145  C  CG  . ARG A  1 441 ? 68.149  -19.801 21.817   1.00 29.94  ? 416 ARG A CG  1 
ATOM   3146  C  CD  . ARG A  1 441 ? 67.361  -20.817 22.631   1.00 32.96  ? 416 ARG A CD  1 
ATOM   3147  N  NE  . ARG A  1 441 ? 66.780  -21.834 21.765   1.00 34.38  ? 416 ARG A NE  1 
ATOM   3148  C  CZ  . ARG A  1 441 ? 67.399  -22.955 21.412   1.00 36.85  ? 416 ARG A CZ  1 
ATOM   3149  N  NH1 . ARG A  1 441 ? 68.623  -23.215 21.858   1.00 39.37  ? 416 ARG A NH1 1 
ATOM   3150  N  NH2 . ARG A  1 441 ? 66.792  -23.820 20.614   1.00 36.33  ? 416 ARG A NH2 1 
ATOM   3151  N  N   . ASP A  1 442 ? 69.730  -15.516 23.083   1.00 28.61  ? 417 ASP A N   1 
ATOM   3152  C  CA  . ASP A  1 442 ? 69.609  -14.353 23.959   1.00 29.56  ? 417 ASP A CA  1 
ATOM   3153  C  C   . ASP A  1 442 ? 69.734  -13.054 23.176   1.00 27.08  ? 417 ASP A C   1 
ATOM   3154  O  O   . ASP A  1 442 ? 70.784  -12.775 22.597   1.00 26.09  ? 417 ASP A O   1 
ATOM   3155  C  CB  . ASP A  1 442 ? 70.675  -14.390 25.065   1.00 30.66  ? 417 ASP A CB  1 
ATOM   3156  C  CG  . ASP A  1 442 ? 70.454  -13.314 26.128   1.00 33.40  ? 417 ASP A CG  1 
ATOM   3157  O  OD1 . ASP A  1 442 ? 69.544  -13.474 26.975   1.00 34.47  ? 417 ASP A OD1 1 
ATOM   3158  O  OD2 . ASP A  1 442 ? 71.195  -12.309 26.114   1.00 32.34  ? 417 ASP A OD2 1 
ATOM   3159  N  N   . GLY A  1 443 ? 68.658  -12.268 23.184   1.00 26.02  ? 418 GLY A N   1 
ATOM   3160  C  CA  . GLY A  1 443 ? 68.622  -10.964 22.515   1.00 25.41  ? 418 GLY A CA  1 
ATOM   3161  C  C   . GLY A  1 443 ? 69.675  -9.991  23.019   1.00 25.02  ? 418 GLY A C   1 
ATOM   3162  O  O   . GLY A  1 443 ? 70.281  -9.254  22.233   1.00 23.82  ? 418 GLY A O   1 
ATOM   3163  N  N   . ASP A  1 444 ? 69.913  -10.002 24.327   1.00 26.12  ? 419 ASP A N   1 
ATOM   3164  C  CA  . ASP A  1 444 ? 70.901  -9.109  24.926   1.00 27.28  ? 419 ASP A CA  1 
ATOM   3165  C  C   . ASP A  1 444 ? 72.309  -9.409  24.409   1.00 27.85  ? 419 ASP A C   1 
ATOM   3166  O  O   . ASP A  1 444 ? 73.041  -8.493  24.008   1.00 28.58  ? 419 ASP A O   1 
ATOM   3167  C  CB  . ASP A  1 444 ? 70.853  -9.192  26.455   1.00 29.13  ? 419 ASP A CB  1 
ATOM   3168  C  CG  . ASP A  1 444 ? 71.853  -8.245  27.131   1.00 30.74  ? 419 ASP A CG  1 
ATOM   3169  O  OD1 . ASP A  1 444 ? 71.967  -7.080  26.687   1.00 29.68  ? 419 ASP A OD1 1 
ATOM   3170  O  OD2 . ASP A  1 444 ? 72.521  -8.666  28.106   1.00 31.43  ? 419 ASP A OD2 1 
ATOM   3171  N  N   . ALA A  1 445 ? 72.670  -10.690 24.399   1.00 26.52  ? 420 ALA A N   1 
ATOM   3172  C  CA  . ALA A  1 445 ? 73.983  -11.115 23.930   1.00 25.14  ? 420 ALA A CA  1 
ATOM   3173  C  C   . ALA A  1 445 ? 74.182  -10.766 22.455   1.00 24.09  ? 420 ALA A C   1 
ATOM   3174  O  O   . ALA A  1 445 ? 75.222  -10.219 22.083   1.00 25.00  ? 420 ALA A O   1 
ATOM   3175  C  CB  . ALA A  1 445 ? 74.196  -12.612 24.173   1.00 24.83  ? 420 ALA A CB  1 
ATOM   3176  N  N   . ALA A  1 446 ? 73.190  -11.072 21.621   1.00 22.89  ? 421 ALA A N   1 
ATOM   3177  C  CA  . ALA A  1 446 ? 73.289  -10.783 20.180   1.00 21.96  ? 421 ALA A CA  1 
ATOM   3178  C  C   . ALA A  1 446 ? 73.450  -9.283  19.912   1.00 21.85  ? 421 ALA A C   1 
ATOM   3179  O  O   . ALA A  1 446 ? 74.329  -8.891  19.153   1.00 21.55  ? 421 ALA A O   1 
ATOM   3180  C  CB  . ALA A  1 446 ? 72.088  -11.344 19.423   1.00 21.20  ? 421 ALA A CB  1 
ATOM   3181  N  N   . ARG A  1 447 ? 72.605  -8.462  20.544   1.00 22.28  ? 422 ARG A N   1 
ATOM   3182  C  CA  . ARG A  1 447 ? 72.637  -7.010  20.351   1.00 22.03  ? 422 ARG A CA  1 
ATOM   3183  C  C   . ARG A  1 447 ? 73.995  -6.476  20.780   1.00 21.93  ? 422 ARG A C   1 
ATOM   3184  O  O   . ARG A  1 447 ? 74.682  -5.812  20.009   1.00 21.52  ? 422 ARG A O   1 
ATOM   3185  C  CB  . ARG A  1 447 ? 71.506  -6.313  21.129   1.00 21.44  ? 422 ARG A CB  1 
ATOM   3186  C  CG  . ARG A  1 447 ? 71.302  -4.832  20.783   1.00 21.41  ? 422 ARG A CG  1 
ATOM   3187  C  CD  . ARG A  1 447 ? 72.182  -3.878  21.587   1.00 20.73  ? 422 ARG A CD  1 
ATOM   3188  N  NE  . ARG A  1 447 ? 72.060  -2.490  21.134   1.00 19.70  ? 422 ARG A NE  1 
ATOM   3189  C  CZ  . ARG A  1 447 ? 72.833  -1.493  21.575   1.00 19.72  ? 422 ARG A CZ  1 
ATOM   3190  N  NH1 . ARG A  1 447 ? 73.767  -1.731  22.495   1.00 19.60  ? 422 ARG A NH1 1 
ATOM   3191  N  NH2 . ARG A  1 447 ? 72.677  -0.256  21.106   1.00 19.29  ? 422 ARG A NH2 1 
ATOM   3192  N  N   . ASP A  1 448 ? 74.386  -6.806  22.004   1.00 22.06  ? 423 ASP A N   1 
ATOM   3193  C  CA  . ASP A  1 448 ? 75.613  -6.290  22.578   1.00 22.01  ? 423 ASP A CA  1 
ATOM   3194  C  C   . ASP A  1 448 ? 76.841  -6.667  21.729   1.00 21.29  ? 423 ASP A C   1 
ATOM   3195  O  O   . ASP A  1 448 ? 77.662  -5.814  21.404   1.00 20.72  ? 423 ASP A O   1 
ATOM   3196  C  CB  . ASP A  1 448 ? 75.761  -6.782  24.022   1.00 22.18  ? 423 ASP A CB  1 
ATOM   3197  C  CG  . ASP A  1 448 ? 76.963  -6.160  24.729   1.00 22.25  ? 423 ASP A CG  1 
ATOM   3198  O  OD1 . ASP A  1 448 ? 76.894  -4.969  25.105   1.00 22.30  ? 423 ASP A OD1 1 
ATOM   3199  O  OD2 . ASP A  1 448 ? 77.978  -6.865  24.902   1.00 22.09  ? 423 ASP A OD2 1 
ATOM   3200  N  N   . PHE A  1 449 ? 76.936  -7.946  21.368   1.00 20.68  ? 424 PHE A N   1 
ATOM   3201  C  CA  . PHE A  1 449 ? 78.022  -8.464  20.526   1.00 20.04  ? 424 PHE A CA  1 
ATOM   3202  C  C   . PHE A  1 449 ? 78.079  -7.775  19.152   1.00 19.80  ? 424 PHE A C   1 
ATOM   3203  O  O   . PHE A  1 449 ? 79.153  -7.349  18.699   1.00 19.74  ? 424 PHE A O   1 
ATOM   3204  C  CB  . PHE A  1 449 ? 77.850  -9.983  20.359   1.00 20.60  ? 424 PHE A CB  1 
ATOM   3205  C  CG  . PHE A  1 449 ? 78.967  -10.659 19.610   1.00 21.09  ? 424 PHE A CG  1 
ATOM   3206  C  CD1 . PHE A  1 449 ? 78.987  -10.669 18.212   1.00 20.61  ? 424 PHE A CD1 1 
ATOM   3207  C  CD2 . PHE A  1 449 ? 79.989  -11.307 20.301   1.00 21.57  ? 424 PHE A CD2 1 
ATOM   3208  C  CE1 . PHE A  1 449 ? 80.009  -11.302 17.518   1.00 20.72  ? 424 PHE A CE1 1 
ATOM   3209  C  CE2 . PHE A  1 449 ? 81.018  -11.936 19.614   1.00 22.46  ? 424 PHE A CE2 1 
ATOM   3210  C  CZ  . PHE A  1 449 ? 81.033  -11.929 18.219   1.00 21.52  ? 424 PHE A CZ  1 
ATOM   3211  N  N   . ALA A  1 450 ? 76.930  -7.678  18.485   1.00 18.93  ? 425 ALA A N   1 
ATOM   3212  C  CA  . ALA A  1 450 ? 76.877  -7.049  17.147   1.00 18.46  ? 425 ALA A CA  1 
ATOM   3213  C  C   . ALA A  1 450 ? 77.129  -5.533  17.232   1.00 18.68  ? 425 ALA A C   1 
ATOM   3214  O  O   . ALA A  1 450 ? 77.690  -4.926  16.314   1.00 18.00  ? 425 ALA A O   1 
ATOM   3215  C  CB  . ALA A  1 450 ? 75.561  -7.360  16.438   1.00 17.48  ? 425 ALA A CB  1 
ATOM   3216  N  N   . SER A  1 451 ? 76.776  -4.924  18.352   1.00 19.29  ? 426 SER A N   1 
ATOM   3217  C  CA  . SER A  1 451 ? 77.015  -3.500  18.454   1.00 20.46  ? 426 SER A CA  1 
ATOM   3218  C  C   . SER A  1 451 ? 78.496  -3.191  18.621   1.00 20.82  ? 426 SER A C   1 
ATOM   3219  O  O   . SER A  1 451 ? 79.010  -2.278  17.996   1.00 21.14  ? 426 SER A O   1 
ATOM   3220  C  CB  . SER A  1 451 ? 76.214  -2.867  19.575   1.00 21.59  ? 426 SER A CB  1 
ATOM   3221  O  OG  . SER A  1 451 ? 76.482  -1.487  19.546   1.00 22.75  ? 426 SER A OG  1 
ATOM   3222  N  N   . ARG A  1 452 ? 79.183  -3.997  19.421   1.00 21.59  ? 427 ARG A N   1 
ATOM   3223  C  CA  . ARG A  1 452 ? 80.527  -3.670  19.875   1.00 21.90  ? 427 ARG A CA  1 
ATOM   3224  C  C   . ARG A  1 452 ? 81.648  -4.130  18.935   1.00 21.88  ? 427 ARG A C   1 
ATOM   3225  O  O   . ARG A  1 452 ? 82.688  -3.474  18.829   1.00 22.66  ? 427 ARG A O   1 
ATOM   3226  C  CB  . ARG A  1 452 ? 80.731  -4.239  21.286   1.00 21.97  ? 427 ARG A CB  1 
ATOM   3227  C  CG  . ARG A  1 452 ? 79.913  -3.516  22.361   1.00 21.52  ? 427 ARG A CG  1 
ATOM   3228  C  CD  . ARG A  1 452 ? 79.890  -4.274  23.681   1.00 21.96  ? 427 ARG A CD  1 
ATOM   3229  N  NE  . ARG A  1 452 ? 81.240  -4.509  24.208   1.00 22.63  ? 427 ARG A NE  1 
ATOM   3230  C  CZ  . ARG A  1 452 ? 81.539  -5.377  25.176   1.00 21.93  ? 427 ARG A CZ  1 
ATOM   3231  N  NH1 . ARG A  1 452 ? 82.791  -5.533  25.562   1.00 21.21  ? 427 ARG A NH1 1 
ATOM   3232  N  NH2 . ARG A  1 452 ? 80.596  -6.118  25.739   1.00 21.94  ? 427 ARG A NH2 1 
ATOM   3233  N  N   . ILE A  1 453 ? 81.439  -5.246  18.250   1.00 20.73  ? 428 ILE A N   1 
ATOM   3234  C  CA  . ILE A  1 453 ? 82.514  -5.901  17.479   1.00 20.12  ? 428 ILE A CA  1 
ATOM   3235  C  C   . ILE A  1 453 ? 83.024  -5.013  16.325   1.00 19.02  ? 428 ILE A C   1 
ATOM   3236  O  O   . ILE A  1 453 ? 82.239  -4.315  15.689   1.00 18.07  ? 428 ILE A O   1 
ATOM   3237  C  CB  . ILE A  1 453 ? 82.051  -7.288  16.968   1.00 20.24  ? 428 ILE A CB  1 
ATOM   3238  C  CG1 . ILE A  1 453 ? 83.238  -8.167  16.531   1.00 21.09  ? 428 ILE A CG1 1 
ATOM   3239  C  CG2 . ILE A  1 453 ? 81.020  -7.133  15.847   1.00 18.80  ? 428 ILE A CG2 1 
ATOM   3240  C  CD1 . ILE A  1 453 ? 84.295  -8.414  17.586   1.00 21.98  ? 428 ILE A CD1 1 
ATOM   3241  N  N   . ASN A  1 454 ? 84.338  -5.025  16.090   1.00 18.56  ? 429 ASN A N   1 
ATOM   3242  C  CA  . ASN A  1 454 ? 84.974  -4.131  15.119   1.00 18.24  ? 429 ASN A CA  1 
ATOM   3243  C  C   . ASN A  1 454 ? 85.125  -4.838  13.768   1.00 17.89  ? 429 ASN A C   1 
ATOM   3244  O  O   . ASN A  1 454 ? 86.198  -4.888  13.159   1.00 17.66  ? 429 ASN A O   1 
ATOM   3245  C  CB  . ASN A  1 454 ? 86.307  -3.583  15.665   1.00 18.54  ? 429 ASN A CB  1 
ATOM   3246  C  CG  . ASN A  1 454 ? 87.262  -4.692  16.119   1.00 19.13  ? 429 ASN A CG  1 
ATOM   3247  O  OD1 . ASN A  1 454 ? 86.983  -5.885  15.950   1.00 18.40  ? 429 ASN A OD1 1 
ATOM   3248  N  ND2 . ASN A  1 454 ? 88.404  -4.297  16.688   1.00 19.50  ? 429 ASN A ND2 1 
ATOM   3249  N  N   . ILE A  1 455 ? 84.006  -5.395  13.320   1.00 18.19  ? 430 ILE A N   1 
ATOM   3250  C  CA  . ILE A  1 455 ? 83.948  -6.252  12.162   1.00 18.49  ? 430 ILE A CA  1 
ATOM   3251  C  C   . ILE A  1 455 ? 82.735  -5.801  11.356   1.00 19.01  ? 430 ILE A C   1 
ATOM   3252  O  O   . ILE A  1 455 ? 81.661  -5.550  11.935   1.00 18.67  ? 430 ILE A O   1 
ATOM   3253  C  CB  . ILE A  1 455 ? 83.857  -7.743  12.595   1.00 18.66  ? 430 ILE A CB  1 
ATOM   3254  C  CG1 . ILE A  1 455 ? 85.161  -8.144  13.332   1.00 19.00  ? 430 ILE A CG1 1 
ATOM   3255  C  CG2 . ILE A  1 455 ? 83.537  -8.633  11.400   1.00 18.35  ? 430 ILE A CG2 1 
ATOM   3256  C  CD1 . ILE A  1 455 ? 85.519  -9.613  13.363   1.00 19.20  ? 430 ILE A CD1 1 
ATOM   3257  N  N   . GLY A  1 456 ? 82.919  -5.688  10.036   1.00 18.82  ? 431 GLY A N   1 
ATOM   3258  C  CA  . GLY A  1 456 ? 81.934  -5.066  9.140    1.00 18.35  ? 431 GLY A CA  1 
ATOM   3259  C  C   . GLY A  1 456 ? 80.690  -5.887  8.855    1.00 18.34  ? 431 GLY A C   1 
ATOM   3260  O  O   . GLY A  1 456 ? 79.627  -5.327  8.623    1.00 18.37  ? 431 GLY A O   1 
HETATM 3261  N  N   . MSE A  1 457 ? 80.798  -7.217  8.866    1.00 18.54  ? 432 MSE A N   1 
HETATM 3262  C  CA  . MSE A  1 457 ? 79.631  -8.049  8.514    1.00 18.53  ? 432 MSE A CA  1 
HETATM 3263  C  C   . MSE A  1 457 ? 79.354  -9.030  9.612    1.00 17.94  ? 432 MSE A C   1 
HETATM 3264  O  O   . MSE A  1 457 ? 80.209  -9.855  9.947    1.00 17.55  ? 432 MSE A O   1 
HETATM 3265  C  CB  . MSE A  1 457 ? 79.788  -8.721  7.148    1.00 18.98  ? 432 MSE A CB  1 
HETATM 3266  C  CG  . MSE A  1 457 ? 79.790  -7.632  6.076    1.00 20.62  ? 432 MSE A CG  1 
HETATM 3267  SE SE  . MSE A  1 457 ? 80.541  -8.329  4.391    1.00 23.39  ? 432 MSE A SE  1 
HETATM 3268  C  CE  . MSE A  1 457 ? 82.463  -8.445  4.845    1.00 22.91  ? 432 MSE A CE  1 
ATOM   3269  N  N   . VAL A  1 458 ? 78.152  -8.959  10.181   1.00 17.49  ? 433 VAL A N   1 
ATOM   3270  C  CA  . VAL A  1 458 ? 77.853  -9.707  11.415   1.00 17.25  ? 433 VAL A CA  1 
ATOM   3271  C  C   . VAL A  1 458 ? 76.662  -10.643 11.253   1.00 17.62  ? 433 VAL A C   1 
ATOM   3272  O  O   . VAL A  1 458 ? 75.590  -10.236 10.783   1.00 18.30  ? 433 VAL A O   1 
ATOM   3273  C  CB  . VAL A  1 458 ? 77.591  -8.753  12.603   1.00 16.83  ? 433 VAL A CB  1 
ATOM   3274  C  CG1 . VAL A  1 458 ? 77.310  -9.546  13.879   1.00 17.51  ? 433 VAL A CG1 1 
ATOM   3275  C  CG2 . VAL A  1 458 ? 78.759  -7.780  12.801   1.00 15.99  ? 433 VAL A CG2 1 
ATOM   3276  N  N   . GLY A  1 459 ? 76.847  -11.895 11.658   1.00 17.50  ? 434 GLY A N   1 
ATOM   3277  C  CA  . GLY A  1 459 ? 75.771  -12.884 11.642   1.00 17.29  ? 434 GLY A CA  1 
ATOM   3278  C  C   . GLY A  1 459 ? 75.219  -13.157 13.028   1.00 17.95  ? 434 GLY A C   1 
ATOM   3279  O  O   . GLY A  1 459 ? 75.964  -13.480 13.959   1.00 17.90  ? 434 GLY A O   1 
ATOM   3280  N  N   . VAL A  1 460 ? 73.907  -13.009 13.176   1.00 17.88  ? 435 VAL A N   1 
ATOM   3281  C  CA  . VAL A  1 460 ? 73.252  -13.454 14.378   1.00 18.43  ? 435 VAL A CA  1 
ATOM   3282  C  C   . VAL A  1 460 ? 72.514  -14.730 14.015   1.00 19.08  ? 435 VAL A C   1 
ATOM   3283  O  O   . VAL A  1 460 ? 71.468  -14.702 13.351   1.00 18.60  ? 435 VAL A O   1 
ATOM   3284  C  CB  . VAL A  1 460 ? 72.300  -12.393 14.953   1.00 18.41  ? 435 VAL A CB  1 
ATOM   3285  C  CG1 . VAL A  1 460 ? 71.507  -12.980 16.120   1.00 18.71  ? 435 VAL A CG1 1 
ATOM   3286  C  CG2 . VAL A  1 460 ? 73.086  -11.140 15.368   1.00 17.60  ? 435 VAL A CG2 1 
ATOM   3287  N  N   . ASN A  1 461 ? 73.084  -15.852 14.451   1.00 19.80  ? 436 ASN A N   1 
ATOM   3288  C  CA  . ASN A  1 461 ? 72.585  -17.177 14.094   1.00 20.15  ? 436 ASN A CA  1 
ATOM   3289  C  C   . ASN A  1 461 ? 72.644  -17.358 12.568   1.00 19.95  ? 436 ASN A C   1 
ATOM   3290  O  O   . ASN A  1 461 ? 71.886  -18.113 11.970   1.00 19.27  ? 436 ASN A O   1 
ATOM   3291  C  CB  . ASN A  1 461 ? 71.180  -17.429 14.692   1.00 20.37  ? 436 ASN A CB  1 
ATOM   3292  C  CG  . ASN A  1 461 ? 71.167  -17.347 16.221   1.00 21.98  ? 436 ASN A CG  1 
ATOM   3293  O  OD1 . ASN A  1 461 ? 71.985  -17.981 16.894   1.00 23.28  ? 436 ASN A OD1 1 
ATOM   3294  N  ND2 . ASN A  1 461 ? 70.221  -16.589 16.774   1.00 21.28  ? 436 ASN A ND2 1 
ATOM   3295  N  N   . VAL A  1 462 ? 73.574  -16.636 11.955   1.00 21.48  ? 437 VAL A N   1 
ATOM   3296  C  CA  . VAL A  1 462 ? 73.835  -16.715 10.523   1.00 21.84  ? 437 VAL A CA  1 
ATOM   3297  C  C   . VAL A  1 462 ? 75.349  -16.868 10.380   1.00 22.55  ? 437 VAL A C   1 
ATOM   3298  O  O   . VAL A  1 462 ? 76.102  -16.016 10.863   1.00 22.85  ? 437 VAL A O   1 
ATOM   3299  C  CB  . VAL A  1 462 ? 73.327  -15.441 9.800    1.00 21.25  ? 437 VAL A CB  1 
ATOM   3300  C  CG1 . VAL A  1 462 ? 73.810  -15.386 8.345    1.00 20.84  ? 437 VAL A CG1 1 
ATOM   3301  C  CG2 . VAL A  1 462 ? 71.810  -15.385 9.855    1.00 20.68  ? 437 VAL A CG2 1 
ATOM   3302  N  N   . PRO A  1 463 ? 75.801  -17.955 9.722    1.00 22.96  ? 438 PRO A N   1 
ATOM   3303  C  CA  . PRO A  1 463 ? 77.232  -18.284 9.724    1.00 22.62  ? 438 PRO A CA  1 
ATOM   3304  C  C   . PRO A  1 463 ? 78.058  -17.519 8.696    1.00 22.00  ? 438 PRO A C   1 
ATOM   3305  O  O   . PRO A  1 463 ? 79.230  -17.252 8.928    1.00 20.68  ? 438 PRO A O   1 
ATOM   3306  C  CB  . PRO A  1 463 ? 77.239  -19.782 9.396    1.00 23.08  ? 438 PRO A CB  1 
ATOM   3307  C  CG  . PRO A  1 463 ? 76.034  -19.975 8.522    1.00 22.86  ? 438 PRO A CG  1 
ATOM   3308  C  CD  . PRO A  1 463 ? 75.000  -18.972 8.999    1.00 22.78  ? 438 PRO A CD  1 
ATOM   3309  N  N   . ILE A  1 464 ? 77.455  -17.188 7.557    1.00 24.24  ? 439 ILE A N   1 
ATOM   3310  C  CA  . ILE A  1 464 ? 78.150  -16.450 6.492    1.00 23.58  ? 439 ILE A CA  1 
ATOM   3311  C  C   . ILE A  1 464 ? 77.325  -15.182 6.234    1.00 22.34  ? 439 ILE A C   1 
ATOM   3312  O  O   . ILE A  1 464 ? 76.403  -15.176 5.424    1.00 21.64  ? 439 ILE A O   1 
ATOM   3313  C  CB  . ILE A  1 464 ? 78.380  -17.326 5.227    1.00 24.90  ? 439 ILE A CB  1 
ATOM   3314  C  CG1 . ILE A  1 464 ? 79.203  -18.586 5.582    1.00 26.20  ? 439 ILE A CG1 1 
ATOM   3315  C  CG2 . ILE A  1 464 ? 79.089  -16.542 4.126    1.00 23.45  ? 439 ILE A CG2 1 
ATOM   3316  C  CD1 . ILE A  1 464 ? 79.096  -19.741 4.598    1.00 27.45  ? 439 ILE A CD1 1 
ATOM   3317  N  N   . PRO A  1 465 ? 77.629  -14.106 6.971    1.00 20.97  ? 440 PRO A N   1 
ATOM   3318  C  CA  . PRO A  1 465 ? 76.773  -12.919 6.841    1.00 20.61  ? 440 PRO A CA  1 
ATOM   3319  C  C   . PRO A  1 465 ? 77.111  -11.991 5.654    1.00 19.77  ? 440 PRO A C   1 
ATOM   3320  O  O   . PRO A  1 465 ? 77.280  -10.786 5.859    1.00 20.00  ? 440 PRO A O   1 
ATOM   3321  C  CB  . PRO A  1 465 ? 76.963  -12.209 8.196    1.00 19.98  ? 440 PRO A CB  1 
ATOM   3322  C  CG  . PRO A  1 465 ? 78.347  -12.583 8.603    1.00 19.66  ? 440 PRO A CG  1 
ATOM   3323  C  CD  . PRO A  1 465 ? 78.565  -13.996 8.104    1.00 19.87  ? 440 PRO A CD  1 
ATOM   3324  N  N   . VAL A  1 466 ? 77.200  -12.556 4.439    1.00 19.70  ? 441 VAL A N   1 
ATOM   3325  C  CA  A VAL A  1 466 ? 77.413  -11.774 3.211    0.50 19.26  ? 441 VAL A CA  1 
ATOM   3326  C  CA  B VAL A  1 466 ? 77.408  -11.755 3.218    0.50 19.12  ? 441 VAL A CA  1 
ATOM   3327  C  C   . VAL A  1 466 ? 76.151  -10.959 2.909    1.00 19.09  ? 441 VAL A C   1 
ATOM   3328  O  O   . VAL A  1 466 ? 75.099  -11.533 2.644    1.00 19.29  ? 441 VAL A O   1 
ATOM   3329  C  CB  A VAL A  1 466 ? 77.768  -12.697 2.011    0.50 19.56  ? 441 VAL A CB  1 
ATOM   3330  C  CB  B VAL A  1 466 ? 77.833  -12.575 1.960    0.50 19.10  ? 441 VAL A CB  1 
ATOM   3331  C  CG1 A VAL A  1 466 ? 77.688  -11.961 0.686    0.50 18.74  ? 441 VAL A CG1 1 
ATOM   3332  C  CG1 B VAL A  1 466 ? 79.343  -12.776 1.934    0.50 19.48  ? 441 VAL A CG1 1 
ATOM   3333  C  CG2 A VAL A  1 466 ? 79.152  -13.311 2.188    0.50 20.09  ? 441 VAL A CG2 1 
ATOM   3334  C  CG2 B VAL A  1 466 ? 77.082  -13.906 1.840    0.50 18.66  ? 441 VAL A CG2 1 
ATOM   3335  N  N   . PRO A  1 467 ? 76.248  -9.618  2.961    1.00 19.61  ? 442 PRO A N   1 
ATOM   3336  C  CA  . PRO A  1 467 ? 75.045  -8.846  2.642    1.00 20.76  ? 442 PRO A CA  1 
ATOM   3337  C  C   . PRO A  1 467 ? 74.588  -9.093  1.200    1.00 22.25  ? 442 PRO A C   1 
ATOM   3338  O  O   . PRO A  1 467 ? 75.398  -9.459  0.341    1.00 22.90  ? 442 PRO A O   1 
ATOM   3339  C  CB  . PRO A  1 467 ? 75.492  -7.392  2.828    1.00 20.19  ? 442 PRO A CB  1 
ATOM   3340  C  CG  . PRO A  1 467 ? 76.691  -7.470  3.725    1.00 20.12  ? 442 PRO A CG  1 
ATOM   3341  C  CD  . PRO A  1 467 ? 77.374  -8.746  3.339    1.00 19.49  ? 442 PRO A CD  1 
ATOM   3342  N  N   . LEU A  1 468 ? 73.289  -8.935  0.959    1.00 21.02  ? 443 LEU A N   1 
ATOM   3343  C  CA  . LEU A  1 468 ? 72.717  -9.107  -0.364   1.00 19.84  ? 443 LEU A CA  1 
ATOM   3344  C  C   . LEU A  1 468 ? 73.096  -7.930  -1.267   1.00 19.41  ? 443 LEU A C   1 
ATOM   3345  O  O   . LEU A  1 468 ? 73.565  -6.890  -0.797   1.00 18.91  ? 443 LEU A O   1 
ATOM   3346  C  CB  . LEU A  1 468 ? 71.195  -9.314  -0.266   1.00 19.06  ? 443 LEU A CB  1 
ATOM   3347  C  CG  . LEU A  1 468 ? 70.761  -10.677 0.308    1.00 19.33  ? 443 LEU A CG  1 
ATOM   3348  C  CD1 . LEU A  1 468 ? 69.265  -10.742 0.618    1.00 19.45  ? 443 LEU A CD1 1 
ATOM   3349  C  CD2 . LEU A  1 468 ? 71.169  -11.844 -0.593   1.00 19.10  ? 443 LEU A CD2 1 
ATOM   3350  N  N   . ALA A  1 469 ? 72.904  -8.121  -2.568   1.00 19.45  ? 444 ALA A N   1 
ATOM   3351  C  CA  . ALA A  1 469 ? 73.358  -7.192  -3.610   1.00 18.32  ? 444 ALA A CA  1 
ATOM   3352  C  C   . ALA A  1 469 ? 72.899  -5.738  -3.397   1.00 18.46  ? 444 ALA A C   1 
ATOM   3353  O  O   . ALA A  1 469 ? 73.628  -4.794  -3.753   1.00 18.37  ? 444 ALA A O   1 
ATOM   3354  C  CB  . ALA A  1 469 ? 72.908  -7.708  -4.966   1.00 17.55  ? 444 ALA A CB  1 
ATOM   3355  N  N   . TYR A  1 470 ? 71.714  -5.577  -2.791   1.00 17.77  ? 445 TYR A N   1 
ATOM   3356  C  CA  . TYR A  1 470 ? 71.111  -4.263  -2.508   1.00 17.08  ? 445 TYR A CA  1 
ATOM   3357  C  C   . TYR A  1 470 ? 71.535  -3.596  -1.191   1.00 17.41  ? 445 TYR A C   1 
ATOM   3358  O  O   . TYR A  1 470 ? 71.317  -2.394  -0.992   1.00 17.31  ? 445 TYR A O   1 
ATOM   3359  C  CB  . TYR A  1 470 ? 69.591  -4.331  -2.603   1.00 17.31  ? 445 TYR A CB  1 
ATOM   3360  C  CG  . TYR A  1 470 ? 68.870  -5.379  -1.755   1.00 17.02  ? 445 TYR A CG  1 
ATOM   3361  C  CD1 . TYR A  1 470 ? 68.691  -6.690  -2.215   1.00 17.39  ? 445 TYR A CD1 1 
ATOM   3362  C  CD2 . TYR A  1 470 ? 68.306  -5.038  -0.522   1.00 16.68  ? 445 TYR A CD2 1 
ATOM   3363  C  CE1 . TYR A  1 470 ? 67.984  -7.634  -1.462   1.00 17.50  ? 445 TYR A CE1 1 
ATOM   3364  C  CE2 . TYR A  1 470 ? 67.597  -5.968  0.238    1.00 16.78  ? 445 TYR A CE2 1 
ATOM   3365  C  CZ  . TYR A  1 470 ? 67.435  -7.259  -0.231   1.00 17.85  ? 445 TYR A CZ  1 
ATOM   3366  O  OH  . TYR A  1 470 ? 66.729  -8.188  0.527    1.00 18.30  ? 445 TYR A OH  1 
ATOM   3367  N  N   . HIS A  1 471 ? 72.121  -4.380  -0.288   1.00 17.22  ? 446 HIS A N   1 
ATOM   3368  C  CA  . HIS A  1 471 ? 72.961  -3.818  0.769    1.00 17.39  ? 446 HIS A CA  1 
ATOM   3369  C  C   . HIS A  1 471 ? 74.396  -3.840  0.208    1.00 17.83  ? 446 HIS A C   1 
ATOM   3370  O  O   . HIS A  1 471 ? 74.568  -4.010  -0.985   1.00 18.33  ? 446 HIS A O   1 
ATOM   3371  C  CB  . HIS A  1 471 ? 72.784  -4.584  2.085    1.00 17.08  ? 446 HIS A CB  1 
ATOM   3372  C  CG  . HIS A  1 471 ? 71.421  -4.418  2.675    1.00 17.62  ? 446 HIS A CG  1 
ATOM   3373  N  ND1 . HIS A  1 471 ? 71.123  -3.437  3.597    1.00 18.08  ? 446 HIS A ND1 1 
ATOM   3374  C  CD2 . HIS A  1 471 ? 70.256  -5.059  2.418    1.00 17.73  ? 446 HIS A CD2 1 
ATOM   3375  C  CE1 . HIS A  1 471 ? 69.840  -3.497  3.899    1.00 18.89  ? 446 HIS A CE1 1 
ATOM   3376  N  NE2 . HIS A  1 471 ? 69.291  -4.474  3.198    1.00 18.49  ? 446 HIS A NE2 1 
ATOM   3377  N  N   . SER A  1 472 ? 75.410  -3.656  1.041    1.00 17.44  ? 447 SER A N   1 
ATOM   3378  C  CA  . SER A  1 472 ? 76.761  -3.500  0.534    1.00 17.76  ? 447 SER A CA  1 
ATOM   3379  C  C   . SER A  1 472 ? 77.736  -4.381  1.313    1.00 19.11  ? 447 SER A C   1 
ATOM   3380  O  O   . SER A  1 472 ? 77.476  -4.739  2.463    1.00 20.80  ? 447 SER A O   1 
ATOM   3381  C  CB  . SER A  1 472 ? 77.188  -2.023  0.589    1.00 17.59  ? 447 SER A CB  1 
ATOM   3382  O  OG  . SER A  1 472 ? 77.485  -1.617  1.914    1.00 17.97  ? 447 SER A OG  1 
ATOM   3383  N  N   . PHE A  1 473 ? 78.860  -4.713  0.685    1.00 18.94  ? 448 PHE A N   1 
ATOM   3384  C  CA  . PHE A  1 473 ? 79.814  -5.663  1.247    1.00 19.35  ? 448 PHE A CA  1 
ATOM   3385  C  C   . PHE A  1 473 ? 81.118  -4.966  1.600    1.00 20.21  ? 448 PHE A C   1 
ATOM   3386  O  O   . PHE A  1 473 ? 81.694  -4.267  0.765    1.00 20.46  ? 448 PHE A O   1 
ATOM   3387  C  CB  . PHE A  1 473 ? 80.065  -6.814  0.253    1.00 19.04  ? 448 PHE A CB  1 
ATOM   3388  C  CG  . PHE A  1 473 ? 81.221  -7.713  0.626    1.00 20.18  ? 448 PHE A CG  1 
ATOM   3389  C  CD1 . PHE A  1 473 ? 82.545  -7.260  0.543    1.00 20.14  ? 448 PHE A CD1 1 
ATOM   3390  C  CD2 . PHE A  1 473 ? 80.994  -9.037  1.012    1.00 21.29  ? 448 PHE A CD2 1 
ATOM   3391  C  CE1 . PHE A  1 473 ? 83.610  -8.090  0.885    1.00 20.73  ? 448 PHE A CE1 1 
ATOM   3392  C  CE2 . PHE A  1 473 ? 82.062  -9.871  1.341    1.00 21.30  ? 448 PHE A CE2 1 
ATOM   3393  C  CZ  . PHE A  1 473 ? 83.365  -9.398  1.276    1.00 20.81  ? 448 PHE A CZ  1 
ATOM   3394  N  N   . GLY A  1 474 ? 81.596  -5.178  2.827    1.00 19.61  ? 449 GLY A N   1 
ATOM   3395  C  CA  . GLY A  1 474 ? 82.896  -4.652  3.210    1.00 20.04  ? 449 GLY A CA  1 
ATOM   3396  C  C   . GLY A  1 474 ? 83.305  -5.051  4.611    1.00 20.27  ? 449 GLY A C   1 
ATOM   3397  O  O   . GLY A  1 474 ? 82.494  -5.016  5.545    1.00 19.30  ? 449 GLY A O   1 
ATOM   3398  N  N   . GLY A  1 475 ? 84.563  -5.455  4.743    1.00 20.45  ? 450 GLY A N   1 
ATOM   3399  C  CA  . GLY A  1 475 ? 85.152  -5.734  6.061    1.00 20.91  ? 450 GLY A CA  1 
ATOM   3400  C  C   . GLY A  1 475 ? 85.732  -4.483  6.711    1.00 21.28  ? 450 GLY A C   1 
ATOM   3401  O  O   . GLY A  1 475 ? 85.750  -3.392  6.105    1.00 21.20  ? 450 GLY A O   1 
ATOM   3402  N  N   . TRP A  1 476 ? 86.189  -4.641  7.954    1.00 21.23  ? 451 TRP A N   1 
ATOM   3403  C  CA  . TRP A  1 476 ? 86.879  -3.588  8.689    1.00 19.90  ? 451 TRP A CA  1 
ATOM   3404  C  C   . TRP A  1 476 ? 88.337  -4.003  8.960    1.00 19.81  ? 451 TRP A C   1 
ATOM   3405  O  O   . TRP A  1 476 ? 88.764  -5.094  8.560    1.00 19.91  ? 451 TRP A O   1 
ATOM   3406  C  CB  . TRP A  1 476 ? 86.154  -3.325  10.004   1.00 19.29  ? 451 TRP A CB  1 
ATOM   3407  C  CG  . TRP A  1 476 ? 84.824  -2.641  9.861    1.00 19.15  ? 451 TRP A CG  1 
ATOM   3408  C  CD1 . TRP A  1 476 ? 84.132  -2.391  8.697    1.00 18.42  ? 451 TRP A CD1 1 
ATOM   3409  C  CD2 . TRP A  1 476 ? 84.002  -2.153  10.925   1.00 19.54  ? 451 TRP A CD2 1 
ATOM   3410  N  NE1 . TRP A  1 476 ? 82.951  -1.759  8.977    1.00 18.51  ? 451 TRP A NE1 1 
ATOM   3411  C  CE2 . TRP A  1 476 ? 82.841  -1.599  10.336   1.00 19.47  ? 451 TRP A CE2 1 
ATOM   3412  C  CE3 . TRP A  1 476 ? 84.149  -2.097  12.314   1.00 20.52  ? 451 TRP A CE3 1 
ATOM   3413  C  CZ2 . TRP A  1 476 ? 81.820  -1.021  11.092   1.00 19.52  ? 451 TRP A CZ2 1 
ATOM   3414  C  CZ3 . TRP A  1 476 ? 83.135  -1.505  13.070   1.00 21.73  ? 451 TRP A CZ3 1 
ATOM   3415  C  CH2 . TRP A  1 476 ? 81.986  -0.974  12.452   1.00 20.86  ? 451 TRP A CH2 1 
ATOM   3416  N  N   . LYS A  1 477 ? 89.088  -3.122  9.631    1.00 18.67  ? 452 LYS A N   1 
ATOM   3417  C  CA  . LYS A  1 477 ? 90.476  -3.379  10.005   1.00 19.36  ? 452 LYS A CA  1 
ATOM   3418  C  C   . LYS A  1 477 ? 91.319  -3.708  8.758    1.00 19.61  ? 452 LYS A C   1 
ATOM   3419  O  O   . LYS A  1 477 ? 91.235  -3.000  7.743    1.00 18.78  ? 452 LYS A O   1 
ATOM   3420  C  CB  . LYS A  1 477 ? 90.566  -4.446  11.142   1.00 20.09  ? 452 LYS A CB  1 
ATOM   3421  C  CG  . LYS A  1 477 ? 89.826  -4.024  12.424   1.00 19.60  ? 452 LYS A CG  1 
ATOM   3422  C  CD  . LYS A  1 477 ? 89.991  -4.986  13.607   1.00 19.59  ? 452 LYS A CD  1 
ATOM   3423  C  CE  . LYS A  1 477 ? 89.183  -6.270  13.424   1.00 19.56  ? 452 LYS A CE  1 
ATOM   3424  N  NZ  . LYS A  1 477 ? 89.361  -7.262  14.535   1.00 19.35  ? 452 LYS A NZ  1 
ATOM   3425  N  N   . SER A  1 478 ? 92.113  -4.773  8.803    1.00 20.82  ? 453 SER A N   1 
ATOM   3426  C  CA  . SER A  1 478 ? 92.980  -5.071  7.664    1.00 21.86  ? 453 SER A CA  1 
ATOM   3427  C  C   . SER A  1 478 ? 92.251  -5.800  6.516    1.00 20.78  ? 453 SER A C   1 
ATOM   3428  O  O   . SER A  1 478 ? 92.879  -6.214  5.538    1.00 20.23  ? 453 SER A O   1 
ATOM   3429  C  CB  . SER A  1 478 ? 94.274  -5.773  8.102    1.00 23.77  ? 453 SER A CB  1 
ATOM   3430  O  OG  . SER A  1 478 ? 94.036  -7.139  8.354    1.00 28.38  ? 453 SER A OG  1 
ATOM   3431  N  N   . SER A  1 479 ? 90.926  -5.916  6.629    1.00 20.22  ? 454 SER A N   1 
ATOM   3432  C  CA  . SER A  1 479 ? 90.125  -6.610  5.624    1.00 21.19  ? 454 SER A CA  1 
ATOM   3433  C  C   . SER A  1 479 ? 89.600  -5.702  4.503    1.00 20.80  ? 454 SER A C   1 
ATOM   3434  O  O   . SER A  1 479 ? 89.101  -6.201  3.491    1.00 21.29  ? 454 SER A O   1 
ATOM   3435  C  CB  . SER A  1 479 ? 88.979  -7.378  6.284    1.00 22.33  ? 454 SER A CB  1 
ATOM   3436  O  OG  . SER A  1 479 ? 89.506  -8.466  7.026    1.00 23.48  ? 454 SER A OG  1 
ATOM   3437  N  N   . SER A  1 480 ? 89.713  -4.381  4.672    1.00 19.52  ? 455 SER A N   1 
ATOM   3438  C  CA  . SER A  1 480 ? 89.369  -3.465  3.592    1.00 19.51  ? 455 SER A CA  1 
ATOM   3439  C  C   . SER A  1 480 ? 90.117  -2.147  3.693    1.00 20.39  ? 455 SER A C   1 
ATOM   3440  O  O   . SER A  1 480 ? 90.652  -1.797  4.746    1.00 19.66  ? 455 SER A O   1 
ATOM   3441  C  CB  . SER A  1 480 ? 87.865  -3.192  3.540    1.00 20.07  ? 455 SER A CB  1 
ATOM   3442  O  OG  . SER A  1 480 ? 87.532  -2.229  4.528    1.00 21.71  ? 455 SER A OG  1 
ATOM   3443  N  N   . PHE A  1 481 ? 90.147  -1.437  2.565    1.00 21.04  ? 456 PHE A N   1 
ATOM   3444  C  CA  . PHE A  1 481 ? 90.800  -0.140  2.428    1.00 21.33  ? 456 PHE A CA  1 
ATOM   3445  C  C   . PHE A  1 481 ? 89.933  0.756   1.561    1.00 20.38  ? 456 PHE A C   1 
ATOM   3446  O  O   . PHE A  1 481 ? 89.399  0.307   0.537    1.00 19.83  ? 456 PHE A O   1 
ATOM   3447  C  CB  . PHE A  1 481 ? 92.182  -0.299  1.793    1.00 21.11  ? 456 PHE A CB  1 
ATOM   3448  C  CG  . PHE A  1 481 ? 93.063  -1.267  2.523    1.00 23.70  ? 456 PHE A CG  1 
ATOM   3449  C  CD1 . PHE A  1 481 ? 92.979  -2.641  2.267    1.00 23.41  ? 456 PHE A CD1 1 
ATOM   3450  C  CD2 . PHE A  1 481 ? 93.962  -0.818  3.480    1.00 25.39  ? 456 PHE A CD2 1 
ATOM   3451  C  CE1 . PHE A  1 481 ? 93.775  -3.539  2.953    1.00 24.46  ? 456 PHE A CE1 1 
ATOM   3452  C  CE2 . PHE A  1 481 ? 94.762  -1.721  4.170    1.00 26.78  ? 456 PHE A CE2 1 
ATOM   3453  C  CZ  . PHE A  1 481 ? 94.668  -3.082  3.906    1.00 25.58  ? 456 PHE A CZ  1 
ATOM   3454  N  N   . GLY A  1 482 ? 89.821  2.017   1.972    1.00 19.29  ? 457 GLY A N   1 
ATOM   3455  C  CA  . GLY A  1 482 ? 88.985  2.997   1.295    1.00 18.70  ? 457 GLY A CA  1 
ATOM   3456  C  C   . GLY A  1 482 ? 87.791  3.372   2.164    1.00 18.38  ? 457 GLY A C   1 
ATOM   3457  O  O   . GLY A  1 482 ? 87.779  3.116   3.386    1.00 18.27  ? 457 GLY A O   1 
ATOM   3458  N  N   . ASP A  1 483 ? 86.786  3.985   1.551    1.00 17.15  ? 458 ASP A N   1 
ATOM   3459  C  CA  . ASP A  1 483 ? 85.636  4.420   2.321    1.00 18.20  ? 458 ASP A CA  1 
ATOM   3460  C  C   . ASP A  1 483 ? 84.279  4.079   1.702    1.00 18.14  ? 458 ASP A C   1 
ATOM   3461  O  O   . ASP A  1 483 ? 83.262  4.620   2.111    1.00 19.04  ? 458 ASP A O   1 
ATOM   3462  C  CB  . ASP A  1 483 ? 85.753  5.923   2.619    1.00 18.90  ? 458 ASP A CB  1 
ATOM   3463  C  CG  . ASP A  1 483 ? 85.910  6.755   1.377    1.00 20.17  ? 458 ASP A CG  1 
ATOM   3464  O  OD1 . ASP A  1 483 ? 85.523  6.304   0.276    1.00 18.80  ? 458 ASP A OD1 1 
ATOM   3465  O  OD2 . ASP A  1 483 ? 86.435  7.879   1.500    1.00 23.08  ? 458 ASP A OD2 1 
ATOM   3466  N  N   . LEU A  1 484 ? 84.262  3.197   0.710    1.00 18.09  ? 459 LEU A N   1 
ATOM   3467  C  CA  . LEU A  1 484 ? 83.008  2.805   0.068    1.00 17.81  ? 459 LEU A CA  1 
ATOM   3468  C  C   . LEU A  1 484 ? 82.997  1.307   -0.167   1.00 16.87  ? 459 LEU A C   1 
ATOM   3469  O  O   . LEU A  1 484 ? 84.008  0.742   -0.580   1.00 17.93  ? 459 LEU A O   1 
ATOM   3470  C  CB  . LEU A  1 484 ? 82.814  3.569   -1.249   1.00 18.31  ? 459 LEU A CB  1 
ATOM   3471  C  CG  . LEU A  1 484 ? 82.515  5.075   -1.070   1.00 18.48  ? 459 LEU A CG  1 
ATOM   3472  C  CD1 . LEU A  1 484 ? 82.653  5.801   -2.388   1.00 17.59  ? 459 LEU A CD1 1 
ATOM   3473  C  CD2 . LEU A  1 484 ? 81.129  5.311   -0.465   1.00 18.34  ? 459 LEU A CD2 1 
ATOM   3474  N  N   . ASN A  1 485 ? 81.872  0.664   0.116    1.00 15.44  ? 460 ASN A N   1 
ATOM   3475  C  CA  . ASN A  1 485 ? 81.779  -0.784  -0.005   1.00 15.97  ? 460 ASN A CA  1 
ATOM   3476  C  C   . ASN A  1 485 ? 81.493  -1.267  -1.434   1.00 16.07  ? 460 ASN A C   1 
ATOM   3477  O  O   . ASN A  1 485 ? 81.308  -0.449  -2.343   1.00 15.16  ? 460 ASN A O   1 
ATOM   3478  C  CB  . ASN A  1 485 ? 80.719  -1.332  0.949    1.00 16.29  ? 460 ASN A CB  1 
ATOM   3479  C  CG  . ASN A  1 485 ? 81.248  -1.553  2.359    1.00 17.56  ? 460 ASN A CG  1 
ATOM   3480  O  OD1 . ASN A  1 485 ? 82.462  -1.516  2.599    1.00 17.39  ? 460 ASN A OD1 1 
ATOM   3481  N  ND2 . ASN A  1 485 ? 80.330  -1.813  3.300    1.00 16.97  ? 460 ASN A ND2 1 
ATOM   3482  N  N   . GLN A  1 486 ? 81.477  -2.597  -1.599   1.00 16.90  ? 461 GLN A N   1 
ATOM   3483  C  CA  . GLN A  1 486 ? 81.051  -3.280  -2.830   1.00 18.11  ? 461 GLN A CA  1 
ATOM   3484  C  C   . GLN A  1 486 ? 79.518  -3.357  -2.915   1.00 19.11  ? 461 GLN A C   1 
ATOM   3485  O  O   . GLN A  1 486 ? 78.830  -3.597  -1.912   1.00 18.44  ? 461 GLN A O   1 
ATOM   3486  C  CB  . GLN A  1 486 ? 81.619  -4.712  -2.906   1.00 17.92  ? 461 GLN A CB  1 
ATOM   3487  C  CG  . GLN A  1 486 ? 83.132  -4.821  -3.060   1.00 17.83  ? 461 GLN A CG  1 
ATOM   3488  C  CD  . GLN A  1 486 ? 83.601  -4.618  -4.493   1.00 18.69  ? 461 GLN A CD  1 
ATOM   3489  O  OE1 . GLN A  1 486 ? 82.792  -4.518  -5.418   1.00 18.74  ? 461 GLN A OE1 1 
ATOM   3490  N  NE2 . GLN A  1 486 ? 84.918  -4.554  -4.682   1.00 18.40  ? 461 GLN A NE2 1 
ATOM   3491  N  N   . HIS A  1 487 ? 79.013  -3.183  -4.128   1.00 17.84  ? 462 HIS A N   1 
ATOM   3492  C  CA  . HIS A  1 487 ? 77.595  -3.088  -4.446   1.00 17.50  ? 462 HIS A CA  1 
ATOM   3493  C  C   . HIS A  1 487 ? 76.791  -2.151  -3.553   1.00 17.35  ? 462 HIS A C   1 
ATOM   3494  O  O   . HIS A  1 487 ? 77.340  -1.240  -2.973   1.00 18.23  ? 462 HIS A O   1 
ATOM   3495  C  CB  . HIS A  1 487 ? 76.915  -4.458  -4.685   1.00 18.80  ? 462 HIS A CB  1 
ATOM   3496  C  CG  . HIS A  1 487 ? 77.061  -5.445  -3.567   1.00 20.14  ? 462 HIS A CG  1 
ATOM   3497  N  ND1 . HIS A  1 487 ? 76.259  -5.433  -2.449   1.00 19.15  ? 462 HIS A ND1 1 
ATOM   3498  C  CD2 . HIS A  1 487 ? 77.885  -6.508  -3.422   1.00 20.93  ? 462 HIS A CD2 1 
ATOM   3499  C  CE1 . HIS A  1 487 ? 76.602  -6.424  -1.652   1.00 19.59  ? 462 HIS A CE1 1 
ATOM   3500  N  NE2 . HIS A  1 487 ? 77.581  -7.095  -2.221   1.00 20.10  ? 462 HIS A NE2 1 
ATOM   3501  N  N   . GLY A  1 488 ? 75.484  -2.349  -3.493   1.00 17.12  ? 463 GLY A N   1 
ATOM   3502  C  CA  . GLY A  1 488 ? 74.623  -1.415  -2.753   1.00 17.30  ? 463 GLY A CA  1 
ATOM   3503  C  C   . GLY A  1 488 ? 74.766  0.013   -3.240   1.00 17.87  ? 463 GLY A C   1 
ATOM   3504  O  O   . GLY A  1 488 ? 75.303  0.268   -4.326   1.00 18.42  ? 463 GLY A O   1 
ATOM   3505  N  N   . THR A  1 489 ? 74.283  0.959   -2.446   1.00 18.92  ? 464 THR A N   1 
ATOM   3506  C  CA  . THR A  1 489 ? 74.380  2.385   -2.814   1.00 18.50  ? 464 THR A CA  1 
ATOM   3507  C  C   . THR A  1 489 ? 75.820  2.873   -2.804   1.00 18.85  ? 464 THR A C   1 
ATOM   3508  O  O   . THR A  1 489 ? 76.156  3.808   -3.531   1.00 19.39  ? 464 THR A O   1 
ATOM   3509  C  CB  . THR A  1 489 ? 73.509  3.297   -1.921   1.00 17.90  ? 464 THR A CB  1 
ATOM   3510  O  OG1 . THR A  1 489 ? 73.793  3.039   -0.542   1.00 18.35  ? 464 THR A OG1 1 
ATOM   3511  C  CG2 . THR A  1 489 ? 72.035  3.052   -2.173   1.00 17.25  ? 464 THR A CG2 1 
ATOM   3512  N  N   . ASP A  1 490 ? 76.671  2.244   -1.986   1.00 18.37  ? 465 ASP A N   1 
ATOM   3513  C  CA  . ASP A  1 490 ? 78.081  2.617   -1.929   1.00 18.54  ? 465 ASP A CA  1 
ATOM   3514  C  C   . ASP A  1 490 ? 78.722  2.527   -3.306   1.00 16.89  ? 465 ASP A C   1 
ATOM   3515  O  O   . ASP A  1 490 ? 79.432  3.439   -3.722   1.00 15.87  ? 465 ASP A O   1 
ATOM   3516  C  CB  . ASP A  1 490 ? 78.850  1.744   -0.941   1.00 21.12  ? 465 ASP A CB  1 
ATOM   3517  C  CG  . ASP A  1 490 ? 78.876  2.322   0.471    1.00 23.34  ? 465 ASP A CG  1 
ATOM   3518  O  OD1 . ASP A  1 490 ? 78.026  3.179   0.798    1.00 25.94  ? 465 ASP A OD1 1 
ATOM   3519  O  OD2 . ASP A  1 490 ? 79.753  1.906   1.266    1.00 23.38  ? 465 ASP A OD2 1 
ATOM   3520  N  N   . SER A  1 491 ? 78.439  1.438   -4.019   1.00 16.84  ? 466 SER A N   1 
ATOM   3521  C  CA  . SER A  1 491 ? 78.978  1.242   -5.365   1.00 15.85  ? 466 SER A CA  1 
ATOM   3522  C  C   . SER A  1 491 ? 78.583  2.339   -6.355   1.00 15.57  ? 466 SER A C   1 
ATOM   3523  O  O   . SER A  1 491 ? 79.400  2.745   -7.162   1.00 16.95  ? 466 SER A O   1 
ATOM   3524  C  CB  . SER A  1 491 ? 78.659  -0.164  -5.914   1.00 15.82  ? 466 SER A CB  1 
ATOM   3525  O  OG  . SER A  1 491 ? 77.294  -0.318  -6.279   1.00 15.25  ? 466 SER A OG  1 
ATOM   3526  N  N   . ILE A  1 492 ? 77.349  2.823   -6.285   1.00 15.02  ? 467 ILE A N   1 
ATOM   3527  C  CA  . ILE A  1 492 ? 76.901  3.941   -7.124   1.00 15.06  ? 467 ILE A CA  1 
ATOM   3528  C  C   . ILE A  1 492 ? 77.728  5.201   -6.849   1.00 16.87  ? 467 ILE A C   1 
ATOM   3529  O  O   . ILE A  1 492 ? 78.136  5.902   -7.777   1.00 17.95  ? 467 ILE A O   1 
ATOM   3530  C  CB  . ILE A  1 492 ? 75.387  4.235   -6.958   1.00 14.27  ? 467 ILE A CB  1 
ATOM   3531  C  CG1 . ILE A  1 492 ? 74.547  2.934   -7.008   1.00 14.25  ? 467 ILE A CG1 1 
ATOM   3532  C  CG2 . ILE A  1 492 ? 74.904  5.260   -7.979   1.00 13.69  ? 467 ILE A CG2 1 
ATOM   3533  C  CD1 . ILE A  1 492 ? 74.762  2.036   -8.215   1.00 14.15  ? 467 ILE A CD1 1 
ATOM   3534  N  N   . LYS A  1 493 ? 77.976  5.466   -5.575   1.00 17.42  ? 468 LYS A N   1 
ATOM   3535  C  CA  . LYS A  1 493 ? 78.834  6.546   -5.144   1.00 20.37  ? 468 LYS A CA  1 
ATOM   3536  C  C   . LYS A  1 493 ? 80.259  6.392   -5.691   1.00 19.47  ? 468 LYS A C   1 
ATOM   3537  O  O   . LYS A  1 493 ? 80.851  7.366   -6.173   1.00 18.23  ? 468 LYS A O   1 
ATOM   3538  C  CB  . LYS A  1 493 ? 78.890  6.560   -3.613   1.00 25.46  ? 468 LYS A CB  1 
ATOM   3539  C  CG  . LYS A  1 493 ? 79.241  7.907   -3.027   1.00 32.25  ? 468 LYS A CG  1 
ATOM   3540  C  CD  . LYS A  1 493 ? 78.046  8.835   -3.148   1.00 37.65  ? 468 LYS A CD  1 
ATOM   3541  C  CE  . LYS A  1 493 ? 78.451  10.271  -2.930   1.00 38.18  ? 468 LYS A CE  1 
ATOM   3542  N  NZ  . LYS A  1 493 ? 77.280  11.146  -3.186   1.00 40.11  ? 468 LYS A NZ  1 
ATOM   3543  N  N   . PHE A  1 494 ? 80.806  5.175   -5.604   1.00 18.19  ? 469 PHE A N   1 
ATOM   3544  C  CA  . PHE A  1 494 ? 82.199  4.939   -5.992   1.00 17.22  ? 469 PHE A CA  1 
ATOM   3545  C  C   . PHE A  1 494 ? 82.402  5.164   -7.500   1.00 17.56  ? 469 PHE A C   1 
ATOM   3546  O  O   . PHE A  1 494 ? 83.411  5.723   -7.912   1.00 17.68  ? 469 PHE A O   1 
ATOM   3547  C  CB  . PHE A  1 494 ? 82.702  3.539   -5.588   1.00 16.81  ? 469 PHE A CB  1 
ATOM   3548  C  CG  . PHE A  1 494 ? 84.159  3.309   -5.945   1.00 16.79  ? 469 PHE A CG  1 
ATOM   3549  C  CD1 . PHE A  1 494 ? 85.180  3.788   -5.116   1.00 16.72  ? 469 PHE A CD1 1 
ATOM   3550  C  CD2 . PHE A  1 494 ? 84.510  2.676   -7.139   1.00 16.88  ? 469 PHE A CD2 1 
ATOM   3551  C  CE1 . PHE A  1 494 ? 86.525  3.622   -5.459   1.00 16.78  ? 469 PHE A CE1 1 
ATOM   3552  C  CE2 . PHE A  1 494 ? 85.848  2.515   -7.495   1.00 16.90  ? 469 PHE A CE2 1 
ATOM   3553  C  CZ  . PHE A  1 494 ? 86.854  2.981   -6.655   1.00 17.02  ? 469 PHE A CZ  1 
ATOM   3554  N  N   . TRP A  1 495 ? 81.428  4.743   -8.303   1.00 16.94  ? 470 TRP A N   1 
ATOM   3555  C  CA  . TRP A  1 495 ? 81.503  4.855   -9.751   1.00 17.34  ? 470 TRP A CA  1 
ATOM   3556  C  C   . TRP A  1 495 ? 80.907  6.146   -10.353  1.00 18.39  ? 470 TRP A C   1 
ATOM   3557  O  O   . TRP A  1 495 ? 80.691  6.226   -11.566  1.00 18.43  ? 470 TRP A O   1 
ATOM   3558  C  CB  . TRP A  1 495 ? 80.848  3.635   -10.377  1.00 17.38  ? 470 TRP A CB  1 
ATOM   3559  C  CG  . TRP A  1 495 ? 81.593  2.394   -10.073  1.00 18.45  ? 470 TRP A CG  1 
ATOM   3560  C  CD1 . TRP A  1 495 ? 81.173  1.351   -9.304   1.00 19.31  ? 470 TRP A CD1 1 
ATOM   3561  C  CD2 . TRP A  1 495 ? 82.899  2.060   -10.521  1.00 19.72  ? 470 TRP A CD2 1 
ATOM   3562  N  NE1 . TRP A  1 495 ? 82.132  0.379   -9.259   1.00 19.65  ? 470 TRP A NE1 1 
ATOM   3563  C  CE2 . TRP A  1 495 ? 83.208  0.790   -9.992   1.00 20.90  ? 470 TRP A CE2 1 
ATOM   3564  C  CE3 . TRP A  1 495 ? 83.839  2.705   -11.333  1.00 21.43  ? 470 TRP A CE3 1 
ATOM   3565  C  CZ2 . TRP A  1 495 ? 84.424  0.153   -10.239  1.00 23.19  ? 470 TRP A CZ2 1 
ATOM   3566  C  CZ3 . TRP A  1 495 ? 85.045  2.080   -11.578  1.00 23.15  ? 470 TRP A CZ3 1 
ATOM   3567  C  CH2 . TRP A  1 495 ? 85.332  0.818   -11.033  1.00 23.77  ? 470 TRP A CH2 1 
ATOM   3568  N  N   . THR A  1 496 ? 80.658  7.154   -9.520   1.00 18.17  ? 471 THR A N   1 
ATOM   3569  C  CA  . THR A  1 496 ? 80.171  8.430   -10.028  1.00 19.18  ? 471 THR A CA  1 
ATOM   3570  C  C   . THR A  1 496 ? 80.897  9.577   -9.353   1.00 20.02  ? 471 THR A C   1 
ATOM   3571  O  O   . THR A  1 496 ? 81.315  9.472   -8.195   1.00 21.11  ? 471 THR A O   1 
ATOM   3572  C  CB  . THR A  1 496 ? 78.641  8.620   -9.811   1.00 18.34  ? 471 THR A CB  1 
ATOM   3573  O  OG1 . THR A  1 496 ? 78.323  8.438   -8.422   1.00 17.50  ? 471 THR A OG1 1 
ATOM   3574  C  CG2 . THR A  1 496 ? 77.828  7.636   -10.674  1.00 17.52  ? 471 THR A CG2 1 
ATOM   3575  N  N   . ARG A  1 497 ? 81.051  10.670  -10.085  1.00 19.81  ? 472 ARG A N   1 
ATOM   3576  C  CA  . ARG A  1 497 ? 81.530  11.918  -9.502   1.00 20.73  ? 472 ARG A CA  1 
ATOM   3577  C  C   . ARG A  1 497 ? 80.384  12.911  -9.425   1.00 20.39  ? 472 ARG A C   1 
ATOM   3578  O  O   . ARG A  1 497 ? 79.526  12.977  -10.314  1.00 21.89  ? 472 ARG A O   1 
ATOM   3579  C  CB  . ARG A  1 497 ? 82.754  12.503  -10.247  1.00 23.23  ? 472 ARG A CB  1 
ATOM   3580  C  CG  . ARG A  1 497 ? 82.912  12.081  -11.698  1.00 26.73  ? 472 ARG A CG  1 
ATOM   3581  C  CD  . ARG A  1 497 ? 84.150  12.681  -12.368  1.00 30.44  ? 472 ARG A CD  1 
ATOM   3582  N  NE  . ARG A  1 497 ? 84.081  12.496  -13.825  1.00 32.80  ? 472 ARG A NE  1 
ATOM   3583  C  CZ  . ARG A  1 497 ? 84.896  13.047  -14.728  1.00 33.94  ? 472 ARG A CZ  1 
ATOM   3584  N  NH1 . ARG A  1 497 ? 85.899  13.846  -14.370  1.00 35.72  ? 472 ARG A NH1 1 
ATOM   3585  N  NH2 . ARG A  1 497 ? 84.707  12.788  -16.012  1.00 33.26  ? 472 ARG A NH2 1 
ATOM   3586  N  N   . THR A  1 498 ? 80.389  13.675  -8.349   1.00 18.64  ? 473 THR A N   1 
ATOM   3587  C  CA  . THR A  1 498 ? 79.370  14.648  -8.060   1.00 19.65  ? 473 THR A CA  1 
ATOM   3588  C  C   . THR A  1 498 ? 79.723  15.980  -8.661   1.00 18.82  ? 473 THR A C   1 
ATOM   3589  O  O   . THR A  1 498 ? 80.817  16.497  -8.436   1.00 20.45  ? 473 THR A O   1 
ATOM   3590  C  CB  . THR A  1 498 ? 79.211  14.822  -6.537   1.00 21.51  ? 473 THR A CB  1 
ATOM   3591  O  OG1 . THR A  1 498 ? 78.518  13.687  -6.015   1.00 22.83  ? 473 THR A OG1 1 
ATOM   3592  C  CG2 . THR A  1 498 ? 78.442  16.105  -6.196   1.00 21.43  ? 473 THR A CG2 1 
ATOM   3593  N  N   . LYS A  1 499 ? 78.780  16.527  -9.416   1.00 16.30  ? 474 LYS A N   1 
ATOM   3594  C  CA  . LYS A  1 499 ? 78.842  17.885  -9.902   1.00 15.97  ? 474 LYS A CA  1 
ATOM   3595  C  C   . LYS A  1 499 ? 77.752  18.680  -9.208   1.00 15.05  ? 474 LYS A C   1 
ATOM   3596  O  O   . LYS A  1 499 ? 76.602  18.230  -9.168   1.00 14.57  ? 474 LYS A O   1 
ATOM   3597  C  CB  . LYS A  1 499 ? 78.596  17.897  -11.420  1.00 16.53  ? 474 LYS A CB  1 
ATOM   3598  C  CG  . LYS A  1 499 ? 78.479  19.285  -12.040  1.00 16.98  ? 474 LYS A CG  1 
ATOM   3599  C  CD  . LYS A  1 499 ? 78.375  19.181  -13.561  1.00 16.16  ? 474 LYS A CD  1 
ATOM   3600  C  CE  . LYS A  1 499 ? 79.737  18.963  -14.207  1.00 15.73  ? 474 LYS A CE  1 
ATOM   3601  N  NZ  . LYS A  1 499 ? 79.623  18.638  -15.659  1.00 15.29  ? 474 LYS A NZ  1 
ATOM   3602  N  N   . THR A  1 500 ? 78.086  19.862  -8.684   1.00 14.19  ? 475 THR A N   1 
ATOM   3603  C  CA  . THR A  1 500 ? 77.051  20.712  -8.122   1.00 14.34  ? 475 THR A CA  1 
ATOM   3604  C  C   . THR A  1 500 ? 76.920  22.030  -8.867   1.00 15.55  ? 475 THR A C   1 
ATOM   3605  O  O   . THR A  1 500 ? 77.904  22.730  -9.121   1.00 15.91  ? 475 THR A O   1 
ATOM   3606  C  CB  . THR A  1 500 ? 77.238  20.919  -6.597   1.00 14.65  ? 475 THR A CB  1 
ATOM   3607  O  OG1 . THR A  1 500 ? 77.442  19.634  -5.957   1.00 14.45  ? 475 THR A OG1 1 
ATOM   3608  C  CG2 . THR A  1 500 ? 76.025  21.650  -5.987   1.00 13.60  ? 475 THR A CG2 1 
ATOM   3609  N  N   . ILE A  1 501 ? 75.685  22.346  -9.239   1.00 15.95  ? 476 ILE A N   1 
ATOM   3610  C  CA  . ILE A  1 501 ? 75.371  23.547  -10.016  1.00 16.00  ? 476 ILE A CA  1 
ATOM   3611  C  C   . ILE A  1 501 ? 74.586  24.519  -9.147   1.00 16.14  ? 476 ILE A C   1 
ATOM   3612  O  O   . ILE A  1 501 ? 73.603  24.114  -8.514   1.00 16.24  ? 476 ILE A O   1 
ATOM   3613  C  CB  . ILE A  1 501 ? 74.547  23.192  -11.287  1.00 15.97  ? 476 ILE A CB  1 
ATOM   3614  C  CG1 . ILE A  1 501 ? 75.324  22.172  -12.149  1.00 16.32  ? 476 ILE A CG1 1 
ATOM   3615  C  CG2 . ILE A  1 501 ? 74.152  24.456  -12.058  1.00 15.41  ? 476 ILE A CG2 1 
ATOM   3616  C  CD1 . ILE A  1 501 ? 74.520  21.512  -13.253  1.00 16.68  ? 476 ILE A CD1 1 
ATOM   3617  N  N   . THR A  1 502 ? 75.037  25.779  -9.114   1.00 15.66  ? 477 THR A N   1 
ATOM   3618  C  CA  . THR A  1 502 ? 74.329  26.876  -8.461   1.00 15.32  ? 477 THR A CA  1 
ATOM   3619  C  C   . THR A  1 502 ? 73.922  27.828  -9.571   1.00 16.27  ? 477 THR A C   1 
ATOM   3620  O  O   . THR A  1 502 ? 74.754  28.252  -10.406  1.00 16.03  ? 477 THR A O   1 
ATOM   3621  C  CB  . THR A  1 502 ? 75.201  27.643  -7.437   1.00 15.08  ? 477 THR A CB  1 
ATOM   3622  O  OG1 . THR A  1 502 ? 75.827  26.723  -6.529   1.00 15.04  ? 477 THR A OG1 1 
ATOM   3623  C  CG2 . THR A  1 502 ? 74.353  28.648  -6.638   1.00 14.51  ? 477 THR A CG2 1 
ATOM   3624  N  N   . SER A  1 503 ? 72.641  28.166  -9.581   1.00 16.76  ? 478 SER A N   1 
ATOM   3625  C  CA  . SER A  1 503 ? 72.022  28.700  -10.776  1.00 17.90  ? 478 SER A CA  1 
ATOM   3626  C  C   . SER A  1 503 ? 71.084  29.860  -10.482  1.00 18.56  ? 478 SER A C   1 
ATOM   3627  O  O   . SER A  1 503 ? 70.228  29.765  -9.608   1.00 18.87  ? 478 SER A O   1 
ATOM   3628  C  CB  . SER A  1 503 ? 71.256  27.576  -11.477  1.00 18.54  ? 478 SER A CB  1 
ATOM   3629  O  OG  . SER A  1 503 ? 70.686  28.042  -12.681  1.00 21.24  ? 478 SER A OG  1 
ATOM   3630  N  N   . ARG A  1 504 ? 71.253  30.941  -11.235  1.00 19.11  ? 479 ARG A N   1 
ATOM   3631  C  CA  . ARG A  1 504 ? 70.370  32.101  -11.180  1.00 20.39  ? 479 ARG A CA  1 
ATOM   3632  C  C   . ARG A  1 504 ? 70.340  32.756  -12.563  1.00 19.38  ? 479 ARG A C   1 
ATOM   3633  O  O   . ARG A  1 504 ? 71.182  32.440  -13.415  1.00 18.76  ? 479 ARG A O   1 
ATOM   3634  C  CB  . ARG A  1 504 ? 70.833  33.097  -10.105  1.00 22.02  ? 479 ARG A CB  1 
ATOM   3635  C  CG  . ARG A  1 504 ? 72.000  33.996  -10.500  1.00 25.85  ? 479 ARG A CG  1 
ATOM   3636  C  CD  . ARG A  1 504 ? 72.521  34.857  -9.345   1.00 30.26  ? 479 ARG A CD  1 
ATOM   3637  N  NE  . ARG A  1 504 ? 71.460  35.651  -8.723   1.00 39.60  ? 479 ARG A NE  1 
ATOM   3638  C  CZ  . ARG A  1 504 ? 71.591  36.357  -7.595   1.00 49.32  ? 479 ARG A CZ  1 
ATOM   3639  N  NH1 . ARG A  1 504 ? 72.752  36.393  -6.945   1.00 50.53  ? 479 ARG A NH1 1 
ATOM   3640  N  NH2 . ARG A  1 504 ? 70.554  37.035  -7.109   1.00 50.85  ? 479 ARG A NH2 1 
ATOM   3641  N  N   . TRP A  1 505 ? 69.382  33.654  -12.793  1.00 18.87  ? 480 TRP A N   1 
ATOM   3642  C  CA  . TRP A  1 505 ? 69.278  34.334  -14.090  1.00 19.71  ? 480 TRP A CA  1 
ATOM   3643  C  C   . TRP A  1 505 ? 69.074  35.822  -13.902  1.00 20.81  ? 480 TRP A C   1 
ATOM   3644  O  O   . TRP A  1 505 ? 68.382  36.223  -12.963  1.00 19.34  ? 480 TRP A O   1 
ATOM   3645  C  CB  . TRP A  1 505 ? 68.108  33.785  -14.920  1.00 19.41  ? 480 TRP A CB  1 
ATOM   3646  C  CG  . TRP A  1 505 ? 68.184  32.338  -15.104  1.00 19.54  ? 480 TRP A CG  1 
ATOM   3647  C  CD1 . TRP A  1 505 ? 67.605  31.383  -14.322  1.00 20.02  ? 480 TRP A CD1 1 
ATOM   3648  C  CD2 . TRP A  1 505 ? 68.920  31.644  -16.114  1.00 20.17  ? 480 TRP A CD2 1 
ATOM   3649  N  NE1 . TRP A  1 505 ? 67.926  30.132  -14.790  1.00 20.14  ? 480 TRP A NE1 1 
ATOM   3650  C  CE2 . TRP A  1 505 ? 68.729  30.260  -15.890  1.00 20.56  ? 480 TRP A CE2 1 
ATOM   3651  C  CE3 . TRP A  1 505 ? 69.712  32.056  -17.194  1.00 20.34  ? 480 TRP A CE3 1 
ATOM   3652  C  CZ2 . TRP A  1 505 ? 69.305  29.279  -16.708  1.00 21.36  ? 480 TRP A CZ2 1 
ATOM   3653  C  CZ3 . TRP A  1 505 ? 70.292  31.085  -18.001  1.00 21.48  ? 480 TRP A CZ3 1 
ATOM   3654  C  CH2 . TRP A  1 505 ? 70.080  29.712  -17.758  1.00 21.91  ? 480 TRP A CH2 1 
ATOM   3655  N  N   . PRO A  1 506 ? 69.652  36.641  -14.814  1.00 22.54  ? 481 PRO A N   1 
ATOM   3656  C  CA  . PRO A  1 506 ? 69.338  38.074  -14.790  1.00 23.03  ? 481 PRO A CA  1 
ATOM   3657  C  C   . PRO A  1 506 ? 67.907  38.303  -15.245  1.00 24.02  ? 481 PRO A C   1 
ATOM   3658  O  O   . PRO A  1 506 ? 67.318  37.440  -15.895  1.00 22.98  ? 481 PRO A O   1 
ATOM   3659  C  CB  . PRO A  1 506 ? 70.332  38.695  -15.787  1.00 22.82  ? 481 PRO A CB  1 
ATOM   3660  C  CG  . PRO A  1 506 ? 70.824  37.563  -16.640  1.00 23.01  ? 481 PRO A CG  1 
ATOM   3661  C  CD  . PRO A  1 506 ? 70.642  36.286  -15.859  1.00 22.92  ? 481 PRO A CD  1 
ATOM   3662  N  N   . SER A  1 507 ? 67.346  39.450  -14.898  1.00 27.00  ? 482 SER A N   1 
ATOM   3663  C  CA  . SER A  1 507 ? 66.017  39.801  -15.371  1.00 32.05  ? 482 SER A CA  1 
ATOM   3664  C  C   . SER A  1 507 ? 66.065  40.051  -16.874  1.00 34.60  ? 482 SER A C   1 
ATOM   3665  O  O   . SER A  1 507 ? 66.978  40.707  -17.371  1.00 36.52  ? 482 SER A O   1 
ATOM   3666  C  CB  . SER A  1 507 ? 65.521  41.045  -14.655  1.00 35.74  ? 482 SER A CB  1 
ATOM   3667  O  OG  . SER A  1 507 ? 64.522  41.657  -15.437  1.00 42.14  ? 482 SER A OG  1 
ATOM   3668  N  N   . GLY A  1 508 ? 65.095  39.515  -17.600  1.00 36.35  ? 483 GLY A N   1 
ATOM   3669  C  CA  . GLY A  1 508 ? 65.096  39.620  -19.054  1.00 39.60  ? 483 GLY A CA  1 
ATOM   3670  C  C   . GLY A  1 508 ? 63.716  39.887  -19.622  1.00 42.99  ? 483 GLY A C   1 
ATOM   3671  O  O   . GLY A  1 508 ? 62.953  40.689  -19.073  1.00 44.35  ? 483 GLY A O   1 
ATOM   3672  N  N   . ILE A  1 509 ? 63.395  39.180  -20.705  1.00 43.43  ? 484 ILE A N   1 
ATOM   3673  C  CA  . ILE A  1 509 ? 62.165  39.390  -21.492  1.00 43.81  ? 484 ILE A CA  1 
ATOM   3674  C  C   . ILE A  1 509 ? 60.825  39.171  -20.764  1.00 41.82  ? 484 ILE A C   1 
ATOM   3675  O  O   . ILE A  1 509 ? 59.785  39.638  -21.231  1.00 43.06  ? 484 ILE A O   1 
ATOM   3676  C  CB  . ILE A  1 509 ? 62.191  38.549  -22.783  1.00 46.46  ? 484 ILE A CB  1 
ATOM   3677  C  CG1 . ILE A  1 509 ? 62.413  37.066  -22.445  1.00 45.20  ? 484 ILE A CG1 1 
ATOM   3678  C  CG2 . ILE A  1 509 ? 63.273  39.075  -23.722  1.00 47.27  ? 484 ILE A CG2 1 
ATOM   3679  C  CD1 . ILE A  1 509 ? 61.961  36.113  -23.528  1.00 45.28  ? 484 ILE A CD1 1 
ATOM   3680  N  N   . LYS A  1 510 ? 60.839  38.468  -19.633  1.00 39.08  ? 485 LYS A N   1 
ATOM   3681  C  CA  . LYS A  1 510 ? 59.617  38.289  -18.847  1.00 38.01  ? 485 LYS A CA  1 
ATOM   3682  C  C   . LYS A  1 510 ? 59.150  39.632  -18.255  1.00 42.25  ? 485 LYS A C   1 
ATOM   3683  O  O   . LYS A  1 510 ? 57.986  39.775  -17.850  1.00 40.07  ? 485 LYS A O   1 
ATOM   3684  C  CB  . LYS A  1 510 ? 59.811  37.226  -17.759  1.00 33.78  ? 485 LYS A CB  1 
ATOM   3685  C  CG  . LYS A  1 510 ? 60.503  37.711  -16.497  1.00 32.51  ? 485 LYS A CG  1 
ATOM   3686  C  CD  . LYS A  1 510 ? 60.511  36.628  -15.443  1.00 33.06  ? 485 LYS A CD  1 
ATOM   3687  C  CE  . LYS A  1 510 ? 60.780  37.193  -14.060  1.00 33.16  ? 485 LYS A CE  1 
ATOM   3688  N  NZ  . LYS A  1 510 ? 62.191  37.633  -13.887  1.00 32.29  ? 485 LYS A NZ  1 
ATOM   3689  N  N   . ASP A  1 511 ? 60.082  40.592  -18.219  1.00 46.61  ? 486 ASP A N   1 
ATOM   3690  C  CA  . ASP A  1 511 ? 59.854  41.969  -17.783  1.00 50.21  ? 486 ASP A CA  1 
ATOM   3691  C  C   . ASP A  1 511 ? 60.059  42.876  -18.990  1.00 51.38  ? 486 ASP A C   1 
ATOM   3692  O  O   . ASP A  1 511 ? 59.155  43.594  -19.411  1.00 55.22  ? 486 ASP A O   1 
ATOM   3693  C  CB  . ASP A  1 511 ? 60.860  42.383  -16.690  1.00 53.50  ? 486 ASP A CB  1 
ATOM   3694  C  CG  . ASP A  1 511 ? 61.078  41.307  -15.625  1.00 57.74  ? 486 ASP A CG  1 
ATOM   3695  O  OD1 . ASP A  1 511 ? 60.173  41.083  -14.790  1.00 60.17  ? 486 ASP A OD1 1 
ATOM   3696  O  OD2 . ASP A  1 511 ? 62.173  40.699  -15.600  1.00 56.92  ? 486 ASP A OD2 1 
HETATM 3697  N  N   . MSE B  1 24  ? 104.150 40.226  22.001   1.00 41.03  ? -1  MSE B N   1 
HETATM 3698  C  CA  . MSE B  1 24  ? 104.426 38.885  21.391   1.00 44.90  ? -1  MSE B CA  1 
HETATM 3699  C  C   . MSE B  1 24  ? 103.667 37.806  22.116   1.00 43.38  ? -1  MSE B C   1 
HETATM 3700  O  O   . MSE B  1 24  ? 103.812 37.650  23.331   1.00 46.22  ? -1  MSE B O   1 
HETATM 3701  C  CB  . MSE B  1 24  ? 105.906 38.509  21.481   1.00 51.72  ? -1  MSE B CB  1 
HETATM 3702  C  CG  . MSE B  1 24  ? 106.862 39.485  20.803   1.00 63.42  ? -1  MSE B CG  1 
HETATM 3703  SE SE  . MSE B  1 24  ? 106.758 39.352  18.833   1.00 74.35  ? -1  MSE B SE  1 
HETATM 3704  C  CE  . MSE B  1 24  ? 105.826 41.091  18.648   1.00 68.82  ? -1  MSE B CE  1 
ATOM   3705  N  N   . TYR B  1 25  ? 102.854 37.044  21.388   1.00 37.71  ? 0   TYR B N   1 
ATOM   3706  C  CA  . TYR B  1 25  ? 102.178 35.883  21.979   1.00 34.69  ? 0   TYR B CA  1 
ATOM   3707  C  C   . TYR B  1 25  ? 102.794 34.562  21.504   1.00 33.94  ? 0   TYR B C   1 
ATOM   3708  O  O   . TYR B  1 25  ? 103.489 34.510  20.488   1.00 32.73  ? 0   TYR B O   1 
ATOM   3709  C  CB  . TYR B  1 25  ? 100.655 35.928  21.762   1.00 32.00  ? 0   TYR B CB  1 
ATOM   3710  C  CG  . TYR B  1 25  ? 100.229 36.077  20.317   1.00 30.37  ? 0   TYR B CG  1 
ATOM   3711  C  CD1 . TYR B  1 25  ? 100.151 37.349  19.705   1.00 29.92  ? 0   TYR B CD1 1 
ATOM   3712  C  CD2 . TYR B  1 25  ? 99.891  34.964  19.562   1.00 29.38  ? 0   TYR B CD2 1 
ATOM   3713  C  CE1 . TYR B  1 25  ? 99.766  37.492  18.375   1.00 28.23  ? 0   TYR B CE1 1 
ATOM   3714  C  CE2 . TYR B  1 25  ? 99.500  35.093  18.233   1.00 29.53  ? 0   TYR B CE2 1 
ATOM   3715  C  CZ  . TYR B  1 25  ? 99.434  36.356  17.641   1.00 28.28  ? 0   TYR B CZ  1 
ATOM   3716  O  OH  . TYR B  1 25  ? 99.041  36.460  16.313   1.00 26.36  ? 0   TYR B OH  1 
ATOM   3717  N  N   . GLU B  1 26  ? 102.524 33.501  22.253   1.00 34.96  ? 1   GLU B N   1 
ATOM   3718  C  CA  . GLU B  1 26  ? 103.207 32.228  22.089   1.00 39.09  ? 1   GLU B CA  1 
ATOM   3719  C  C   . GLU B  1 26  ? 102.177 31.097  22.101   1.00 39.27  ? 1   GLU B C   1 
ATOM   3720  O  O   . GLU B  1 26  ? 101.858 30.559  23.169   1.00 41.55  ? 1   GLU B O   1 
ATOM   3721  C  CB  . GLU B  1 26  ? 104.184 32.051  23.256   1.00 42.85  ? 1   GLU B CB  1 
ATOM   3722  C  CG  . GLU B  1 26  ? 105.548 31.485  22.908   1.00 48.49  ? 1   GLU B CG  1 
ATOM   3723  C  CD  . GLU B  1 26  ? 106.600 31.805  23.969   1.00 56.00  ? 1   GLU B CD  1 
ATOM   3724  O  OE1 . GLU B  1 26  ? 106.361 31.555  25.174   1.00 59.46  ? 1   GLU B OE1 1 
ATOM   3725  O  OE2 . GLU B  1 26  ? 107.679 32.306  23.595   1.00 57.46  ? 1   GLU B OE2 1 
ATOM   3726  N  N   . LEU B  1 27  ? 101.650 30.746  20.927   1.00 34.79  ? 2   LEU B N   1 
ATOM   3727  C  CA  . LEU B  1 27  ? 100.659 29.673  20.828   1.00 30.73  ? 2   LEU B CA  1 
ATOM   3728  C  C   . LEU B  1 27  ? 101.294 28.297  20.914   1.00 28.71  ? 2   LEU B C   1 
ATOM   3729  O  O   . LEU B  1 27  ? 102.349 28.051  20.320   1.00 28.11  ? 2   LEU B O   1 
ATOM   3730  C  CB  . LEU B  1 27  ? 99.865  29.779  19.530   1.00 30.54  ? 2   LEU B CB  1 
ATOM   3731  C  CG  . LEU B  1 27  ? 99.107  31.077  19.234   1.00 30.82  ? 2   LEU B CG  1 
ATOM   3732  C  CD1 . LEU B  1 27  ? 98.301  30.896  17.959   1.00 29.35  ? 2   LEU B CD1 1 
ATOM   3733  C  CD2 . LEU B  1 27  ? 98.216  31.500  20.403   1.00 30.07  ? 2   LEU B CD2 1 
ATOM   3734  N  N   . GLY B  1 28  ? 100.643 27.402  21.657   1.00 27.65  ? 3   GLY B N   1 
ATOM   3735  C  CA  . GLY B  1 28  ? 101.073 26.011  21.758   1.00 26.36  ? 3   GLY B CA  1 
ATOM   3736  C  C   . GLY B  1 28  ? 100.119 25.104  21.009   1.00 25.88  ? 3   GLY B C   1 
ATOM   3737  O  O   . GLY B  1 28  ? 99.811  25.345  19.843   1.00 24.42  ? 3   GLY B O   1 
ATOM   3738  N  N   . HIS B  1 29  ? 99.673  24.044  21.682   1.00 26.00  ? 4   HIS B N   1 
ATOM   3739  C  CA  . HIS B  1 29  ? 98.630  23.167  21.163   1.00 26.11  ? 4   HIS B CA  1 
ATOM   3740  C  C   . HIS B  1 29  ? 97.388  23.276  22.049   1.00 25.18  ? 4   HIS B C   1 
ATOM   3741  O  O   . HIS B  1 29  ? 97.395  23.975  23.059   1.00 25.03  ? 4   HIS B O   1 
ATOM   3742  C  CB  . HIS B  1 29  ? 99.116  21.709  21.114   1.00 27.60  ? 4   HIS B CB  1 
ATOM   3743  C  CG  . HIS B  1 29  ? 100.510 21.550  20.586   1.00 29.89  ? 4   HIS B CG  1 
ATOM   3744  N  ND1 . HIS B  1 29  ? 100.853 21.853  19.285   1.00 29.70  ? 4   HIS B ND1 1 
ATOM   3745  C  CD2 . HIS B  1 29  ? 101.648 21.121  21.186   1.00 30.97  ? 4   HIS B CD2 1 
ATOM   3746  C  CE1 . HIS B  1 29  ? 102.143 21.626  19.109   1.00 30.74  ? 4   HIS B CE1 1 
ATOM   3747  N  NE2 . HIS B  1 29  ? 102.649 21.178  20.246   1.00 31.52  ? 4   HIS B NE2 1 
ATOM   3748  N  N   . PHE B  1 30  ? 96.321  22.589  21.658   1.00 24.34  ? 5   PHE B N   1 
ATOM   3749  C  CA  . PHE B  1 30  ? 95.136  22.451  22.503   1.00 23.73  ? 5   PHE B CA  1 
ATOM   3750  C  C   . PHE B  1 30  ? 94.825  20.968  22.637   1.00 23.93  ? 5   PHE B C   1 
ATOM   3751  O  O   . PHE B  1 30  ? 94.292  20.341  21.715   1.00 23.97  ? 5   PHE B O   1 
ATOM   3752  C  CB  . PHE B  1 30  ? 93.937  23.200  21.919   1.00 22.48  ? 5   PHE B CB  1 
ATOM   3753  C  CG  . PHE B  1 30  ? 92.768  23.289  22.860   1.00 22.42  ? 5   PHE B CG  1 
ATOM   3754  C  CD1 . PHE B  1 30  ? 92.655  24.365  23.744   1.00 22.28  ? 5   PHE B CD1 1 
ATOM   3755  C  CD2 . PHE B  1 30  ? 91.776  22.285  22.879   1.00 22.11  ? 5   PHE B CD2 1 
ATOM   3756  C  CE1 . PHE B  1 30  ? 91.572  24.450  24.618   1.00 22.62  ? 5   PHE B CE1 1 
ATOM   3757  C  CE2 . PHE B  1 30  ? 90.696  22.363  23.754   1.00 22.29  ? 5   PHE B CE2 1 
ATOM   3758  C  CZ  . PHE B  1 30  ? 90.593  23.451  24.625   1.00 22.61  ? 5   PHE B CZ  1 
ATOM   3759  N  N   . ILE B  1 31  ? 95.180  20.406  23.783   1.00 24.68  ? 6   ILE B N   1 
ATOM   3760  C  CA  . ILE B  1 31  ? 95.063  18.975  23.988   1.00 24.97  ? 6   ILE B CA  1 
ATOM   3761  C  C   . ILE B  1 31  ? 94.275  18.722  25.271   1.00 25.82  ? 6   ILE B C   1 
ATOM   3762  O  O   . ILE B  1 31  ? 94.574  19.317  26.313   1.00 25.67  ? 6   ILE B O   1 
ATOM   3763  C  CB  . ILE B  1 31  ? 96.458  18.282  24.026   1.00 25.20  ? 6   ILE B CB  1 
ATOM   3764  C  CG1 . ILE B  1 31  ? 97.206  18.495  22.693   1.00 25.04  ? 6   ILE B CG1 1 
ATOM   3765  C  CG2 . ILE B  1 31  ? 96.321  16.791  24.348   1.00 24.34  ? 6   ILE B CG2 1 
ATOM   3766  C  CD1 . ILE B  1 31  ? 98.600  17.905  22.644   1.00 24.82  ? 6   ILE B CD1 1 
ATOM   3767  N  N   . ASP B  1 32  ? 93.268  17.850  25.187   1.00 25.55  ? 7   ASP B N   1 
ATOM   3768  C  CA  . ASP B  1 32  ? 92.519  17.419  26.366   1.00 27.46  ? 7   ASP B CA  1 
ATOM   3769  C  C   . ASP B  1 32  ? 91.877  18.604  27.106   1.00 26.17  ? 7   ASP B C   1 
ATOM   3770  O  O   . ASP B  1 32  ? 91.975  18.724  28.332   1.00 26.49  ? 7   ASP B O   1 
ATOM   3771  C  CB  . ASP B  1 32  ? 93.443  16.626  27.305   1.00 31.40  ? 7   ASP B CB  1 
ATOM   3772  C  CG  . ASP B  1 32  ? 92.710  15.600  28.134   1.00 36.18  ? 7   ASP B CG  1 
ATOM   3773  O  OD1 . ASP B  1 32  ? 91.743  14.972  27.642   1.00 39.36  ? 7   ASP B OD1 1 
ATOM   3774  O  OD2 . ASP B  1 32  ? 93.130  15.397  29.285   1.00 39.78  ? 7   ASP B OD2 1 
ATOM   3775  N  N   . GLY B  1 33  ? 91.252  19.495  26.349   1.00 24.27  ? 8   GLY B N   1 
ATOM   3776  C  CA  . GLY B  1 33  ? 90.445  20.557  26.935   1.00 24.78  ? 8   GLY B CA  1 
ATOM   3777  C  C   . GLY B  1 33  ? 91.195  21.803  27.335   1.00 26.03  ? 8   GLY B C   1 
ATOM   3778  O  O   . GLY B  1 33  ? 90.596  22.750  27.841   1.00 25.73  ? 8   GLY B O   1 
ATOM   3779  N  N   . LYS B  1 34  ? 92.504  21.822  27.097   1.00 28.04  ? 9   LYS B N   1 
ATOM   3780  C  CA  . LYS B  1 34  ? 93.301  22.976  27.490   1.00 29.79  ? 9   LYS B CA  1 
ATOM   3781  C  C   . LYS B  1 34  ? 94.466  23.313  26.558   1.00 28.72  ? 9   LYS B C   1 
ATOM   3782  O  O   . LYS B  1 34  ? 94.943  22.467  25.793   1.00 27.13  ? 9   LYS B O   1 
ATOM   3783  C  CB  . LYS B  1 34  ? 93.765  22.857  28.948   1.00 33.39  ? 9   LYS B CB  1 
ATOM   3784  C  CG  . LYS B  1 34  ? 94.228  21.476  29.373   1.00 38.50  ? 9   LYS B CG  1 
ATOM   3785  C  CD  . LYS B  1 34  ? 94.434  21.422  30.882   1.00 43.43  ? 9   LYS B CD  1 
ATOM   3786  C  CE  . LYS B  1 34  ? 95.244  20.201  31.296   1.00 50.32  ? 9   LYS B CE  1 
ATOM   3787  N  NZ  . LYS B  1 34  ? 96.614  20.169  30.693   1.00 53.97  ? 9   LYS B NZ  1 
ATOM   3788  N  N   . ARG B  1 35  ? 94.887  24.578  26.628   1.00 28.85  ? 10  ARG B N   1 
ATOM   3789  C  CA  . ARG B  1 35  ? 96.068  25.076  25.931   1.00 29.39  ? 10  ARG B CA  1 
ATOM   3790  C  C   . ARG B  1 35  ? 97.314  24.452  26.567   1.00 28.04  ? 10  ARG B C   1 
ATOM   3791  O  O   . ARG B  1 35  ? 97.434  24.432  27.776   1.00 28.36  ? 10  ARG B O   1 
ATOM   3792  C  CB  . ARG B  1 35  ? 96.114  26.617  26.018   1.00 31.48  ? 10  ARG B CB  1 
ATOM   3793  C  CG  . ARG B  1 35  ? 94.860  27.299  25.473   1.00 32.28  ? 10  ARG B CG  1 
ATOM   3794  C  CD  . ARG B  1 35  ? 94.953  28.824  25.497   1.00 33.62  ? 10  ARG B CD  1 
ATOM   3795  N  NE  . ARG B  1 35  ? 93.802  29.431  24.821   1.00 34.68  ? 10  ARG B NE  1 
ATOM   3796  C  CZ  . ARG B  1 35  ? 93.844  30.127  23.678   1.00 34.81  ? 10  ARG B CZ  1 
ATOM   3797  N  NH1 . ARG B  1 35  ? 94.993  30.358  23.052   1.00 34.47  ? 10  ARG B NH1 1 
ATOM   3798  N  NH2 . ARG B  1 35  ? 92.718  30.614  23.157   1.00 33.62  ? 10  ARG B NH2 1 
ATOM   3799  N  N   . VAL B  1 36  ? 98.216  23.901  25.763   1.00 27.76  ? 11  VAL B N   1 
ATOM   3800  C  CA  . VAL B  1 36  ? 99.448  23.299  26.297   1.00 29.24  ? 11  VAL B CA  1 
ATOM   3801  C  C   . VAL B  1 36  ? 100.649 23.697  25.461   1.00 29.28  ? 11  VAL B C   1 
ATOM   3802  O  O   . VAL B  1 36  ? 100.547 23.815  24.241   1.00 30.33  ? 11  VAL B O   1 
ATOM   3803  C  CB  . VAL B  1 36  ? 99.405  21.749  26.415   1.00 30.52  ? 11  VAL B CB  1 
ATOM   3804  C  CG1 . VAL B  1 36  ? 98.365  21.308  27.429   1.00 31.58  ? 11  VAL B CG1 1 
ATOM   3805  C  CG2 . VAL B  1 36  ? 99.175  21.076  25.063   1.00 29.44  ? 11  VAL B CG2 1 
ATOM   3806  N  N   . ALA B  1 37  ? 101.780 23.909  26.124   1.00 28.93  ? 12  ALA B N   1 
ATOM   3807  C  CA  . ALA B  1 37  ? 103.021 24.251  25.442   1.00 29.37  ? 12  ALA B CA  1 
ATOM   3808  C  C   . ALA B  1 37  ? 103.545 23.044  24.675   1.00 29.77  ? 12  ALA B C   1 
ATOM   3809  O  O   . ALA B  1 37  ? 103.417 21.903  25.140   1.00 30.69  ? 12  ALA B O   1 
ATOM   3810  C  CB  . ALA B  1 37  ? 104.057 24.739  26.448   1.00 29.44  ? 12  ALA B CB  1 
ATOM   3811  N  N   . GLY B  1 38  ? 104.124 23.296  23.501   1.00 29.47  ? 13  GLY B N   1 
ATOM   3812  C  CA  . GLY B  1 38  ? 104.777 22.249  22.710   1.00 28.99  ? 13  GLY B CA  1 
ATOM   3813  C  C   . GLY B  1 38  ? 106.009 21.709  23.421   1.00 29.86  ? 13  GLY B C   1 
ATOM   3814  O  O   . GLY B  1 38  ? 106.539 22.344  24.337   1.00 29.45  ? 13  GLY B O   1 
ATOM   3815  N  N   . THR B  1 39  ? 106.462 20.530  23.005   1.00 31.33  ? 14  THR B N   1 
ATOM   3816  C  CA  . THR B  1 39  ? 107.609 19.877  23.645   1.00 33.18  ? 14  THR B CA  1 
ATOM   3817  C  C   . THR B  1 39  ? 108.760 19.628  22.664   1.00 33.81  ? 14  THR B C   1 
ATOM   3818  O  O   . THR B  1 39  ? 109.730 18.953  23.008   1.00 35.13  ? 14  THR B O   1 
ATOM   3819  C  CB  . THR B  1 39  ? 107.214 18.536  24.334   1.00 34.06  ? 14  THR B CB  1 
ATOM   3820  O  OG1 . THR B  1 39  ? 106.513 17.688  23.409   1.00 34.74  ? 14  THR B OG1 1 
ATOM   3821  C  CG2 . THR B  1 39  ? 106.343 18.780  25.572   1.00 32.91  ? 14  THR B CG2 1 
ATOM   3822  N  N   . SER B  1 40  ? 108.653 20.162  21.447   1.00 32.70  ? 15  SER B N   1 
ATOM   3823  C  CA  . SER B  1 40  ? 109.677 19.929  20.424   1.00 31.43  ? 15  SER B CA  1 
ATOM   3824  C  C   . SER B  1 40  ? 110.852 20.902  20.519   1.00 32.10  ? 15  SER B C   1 
ATOM   3825  O  O   . SER B  1 40  ? 111.962 20.562  20.127   1.00 32.65  ? 15  SER B O   1 
ATOM   3826  C  CB  . SER B  1 40  ? 109.080 19.933  19.005   1.00 29.99  ? 15  SER B CB  1 
ATOM   3827  O  OG  . SER B  1 40  ? 108.944 21.246  18.481   1.00 29.48  ? 15  SER B OG  1 
ATOM   3828  N  N   . GLY B  1 41  ? 110.608 22.103  21.040   1.00 31.62  ? 16  GLY B N   1 
ATOM   3829  C  CA  . GLY B  1 41  ? 111.649 23.120  21.143   1.00 31.15  ? 16  GLY B CA  1 
ATOM   3830  C  C   . GLY B  1 41  ? 111.771 23.965  19.883   1.00 31.27  ? 16  GLY B C   1 
ATOM   3831  O  O   . GLY B  1 41  ? 112.660 24.814  19.786   1.00 33.36  ? 16  GLY B O   1 
ATOM   3832  N  N   . ARG B  1 42  ? 110.898 23.711  18.909   1.00 28.67  ? 17  ARG B N   1 
ATOM   3833  C  CA  A ARG B  1 42  ? 110.864 24.449  17.642   0.50 28.27  ? 17  ARG B CA  1 
ATOM   3834  C  CA  B ARG B  1 42  ? 110.891 24.494  17.683   0.50 28.37  ? 17  ARG B CA  1 
ATOM   3835  C  C   . ARG B  1 42  ? 109.571 25.250  17.546   1.00 27.97  ? 17  ARG B C   1 
ATOM   3836  O  O   . ARG B  1 42  ? 108.507 24.755  17.919   1.00 27.43  ? 17  ARG B O   1 
ATOM   3837  C  CB  A ARG B  1 42  ? 110.919 23.481  16.455   0.50 27.88  ? 17  ARG B CB  1 
ATOM   3838  C  CB  B ARG B  1 42  ? 111.140 23.605  16.465   0.50 28.25  ? 17  ARG B CB  1 
ATOM   3839  C  CG  A ARG B  1 42  ? 112.265 22.811  16.226   0.50 28.17  ? 17  ARG B CG  1 
ATOM   3840  C  CG  B ARG B  1 42  ? 112.454 22.829  16.505   0.50 28.52  ? 17  ARG B CG  1 
ATOM   3841  C  CD  A ARG B  1 42  ? 112.177 21.762  15.128   0.50 27.46  ? 17  ARG B CD  1 
ATOM   3842  C  CD  B ARG B  1 42  ? 113.687 23.715  16.358   0.50 28.62  ? 17  ARG B CD  1 
ATOM   3843  N  NE  A ARG B  1 42  ? 112.072 22.335  13.786   0.50 26.44  ? 17  ARG B NE  1 
ATOM   3844  N  NE  B ARG B  1 42  ? 114.746 22.953  15.705   0.50 29.17  ? 17  ARG B NE  1 
ATOM   3845  C  CZ  A ARG B  1 42  ? 111.086 22.081  12.931   0.50 25.16  ? 17  ARG B CZ  1 
ATOM   3846  C  CZ  B ARG B  1 42  ? 115.711 22.297  16.338   0.50 29.41  ? 17  ARG B CZ  1 
ATOM   3847  N  NH1 A ARG B  1 42  ? 110.097 21.266  13.260   0.50 24.10  ? 17  ARG B NH1 1 
ATOM   3848  N  NH1 B ARG B  1 42  ? 115.794 22.333  17.663   0.50 29.68  ? 17  ARG B NH1 1 
ATOM   3849  N  NH2 A ARG B  1 42  ? 111.093 22.646  11.736   0.50 25.55  ? 17  ARG B NH2 1 
ATOM   3850  N  NH2 B ARG B  1 42  ? 116.604 21.613  15.639   0.50 29.56  ? 17  ARG B NH2 1 
ATOM   3851  N  N   . VAL B  1 43  ? 109.661 26.474  17.039   1.00 27.66  ? 18  VAL B N   1 
ATOM   3852  C  CA  . VAL B  1 43  ? 108.486 27.304  16.813   1.00 27.53  ? 18  VAL B CA  1 
ATOM   3853  C  C   . VAL B  1 43  ? 108.588 27.863  15.399   1.00 28.35  ? 18  VAL B C   1 
ATOM   3854  O  O   . VAL B  1 43  ? 109.654 27.815  14.798   1.00 28.11  ? 18  VAL B O   1 
ATOM   3855  C  CB  . VAL B  1 43  ? 108.355 28.452  17.850   1.00 26.90  ? 18  VAL B CB  1 
ATOM   3856  C  CG1 . VAL B  1 43  ? 108.179 27.889  19.261   1.00 25.88  ? 18  VAL B CG1 1 
ATOM   3857  C  CG2 . VAL B  1 43  ? 109.556 29.399  17.777   1.00 27.06  ? 18  VAL B CG2 1 
ATOM   3858  N  N   . SER B  1 44  ? 107.469 28.353  14.868   1.00 29.27  ? 19  SER B N   1 
ATOM   3859  C  CA  . SER B  1 44  ? 107.458 29.120  13.622   1.00 29.78  ? 19  SER B CA  1 
ATOM   3860  C  C   . SER B  1 44  ? 106.900 30.512  13.911   1.00 28.47  ? 19  SER B C   1 
ATOM   3861  O  O   . SER B  1 44  ? 106.161 30.703  14.881   1.00 27.88  ? 19  SER B O   1 
ATOM   3862  C  CB  . SER B  1 44  ? 106.610 28.417  12.564   1.00 32.46  ? 19  SER B CB  1 
ATOM   3863  O  OG  . SER B  1 44  ? 106.713 29.085  11.318   1.00 35.51  ? 19  SER B OG  1 
ATOM   3864  N  N   . ASN B  1 45  ? 107.270 31.479  13.076   1.00 28.85  ? 20  ASN B N   1 
ATOM   3865  C  CA  . ASN B  1 45  ? 106.903 32.885  13.277   1.00 28.05  ? 20  ASN B CA  1 
ATOM   3866  C  C   . ASN B  1 45  ? 105.527 33.194  12.710   1.00 25.81  ? 20  ASN B C   1 
ATOM   3867  O  O   . ASN B  1 45  ? 105.194 32.773  11.598   1.00 25.50  ? 20  ASN B O   1 
ATOM   3868  C  CB  . ASN B  1 45  ? 107.935 33.814  12.627   1.00 28.74  ? 20  ASN B CB  1 
ATOM   3869  C  CG  . ASN B  1 45  ? 109.201 33.957  13.443   1.00 31.80  ? 20  ASN B CG  1 
ATOM   3870  O  OD1 . ASN B  1 45  ? 109.191 33.838  14.674   1.00 34.16  ? 20  ASN B OD1 1 
ATOM   3871  N  ND2 . ASN B  1 45  ? 110.310 34.228  12.759   1.00 31.41  ? 20  ASN B ND2 1 
ATOM   3872  N  N   . ILE B  1 46  ? 104.741 33.935  13.476   1.00 25.23  ? 21  ILE B N   1 
ATOM   3873  C  CA  . ILE B  1 46  ? 103.450 34.443  13.014   1.00 24.68  ? 21  ILE B CA  1 
ATOM   3874  C  C   . ILE B  1 46  ? 103.607 35.936  12.707   1.00 25.49  ? 21  ILE B C   1 
ATOM   3875  O  O   . ILE B  1 46  ? 103.965 36.729  13.586   1.00 26.03  ? 21  ILE B O   1 
ATOM   3876  C  CB  . ILE B  1 46  ? 102.327 34.246  14.065   1.00 23.47  ? 21  ILE B CB  1 
ATOM   3877  C  CG1 . ILE B  1 46  ? 102.201 32.767  14.479   1.00 22.45  ? 21  ILE B CG1 1 
ATOM   3878  C  CG2 . ILE B  1 46  ? 101.004 34.796  13.534   1.00 22.93  ? 21  ILE B CG2 1 
ATOM   3879  C  CD1 . ILE B  1 46  ? 101.242 32.502  15.627   1.00 21.39  ? 21  ILE B CD1 1 
ATOM   3880  N  N   . PHE B  1 47  ? 103.339 36.304  11.459   1.00 25.90  ? 22  PHE B N   1 
ATOM   3881  C  CA  . PHE B  1 47  ? 103.433 37.693  11.004   1.00 27.29  ? 22  PHE B CA  1 
ATOM   3882  C  C   . PHE B  1 47  ? 102.091 38.416  11.086   1.00 27.20  ? 22  PHE B C   1 
ATOM   3883  O  O   . PHE B  1 47  ? 101.028 37.783  11.010   1.00 26.21  ? 22  PHE B O   1 
ATOM   3884  C  CB  . PHE B  1 47  ? 103.949 37.747  9.555    1.00 28.37  ? 22  PHE B CB  1 
ATOM   3885  C  CG  . PHE B  1 47  ? 105.378 37.293  9.401    1.00 29.78  ? 22  PHE B CG  1 
ATOM   3886  C  CD1 . PHE B  1 47  ? 105.688 35.929  9.263    1.00 30.27  ? 22  PHE B CD1 1 
ATOM   3887  C  CD2 . PHE B  1 47  ? 106.420 38.220  9.398    1.00 30.72  ? 22  PHE B CD2 1 
ATOM   3888  C  CE1 . PHE B  1 47  ? 107.009 35.503  9.130    1.00 30.49  ? 22  PHE B CE1 1 
ATOM   3889  C  CE2 . PHE B  1 47  ? 107.743 37.801  9.264    1.00 31.27  ? 22  PHE B CE2 1 
ATOM   3890  C  CZ  . PHE B  1 47  ? 108.037 36.441  9.131    1.00 31.76  ? 22  PHE B CZ  1 
ATOM   3891  N  N   . ASN B  1 48  ? 102.142 39.738  11.261   1.00 27.23  ? 23  ASN B N   1 
ATOM   3892  C  CA  . ASN B  1 48  ? 101.031 40.579  10.849   1.00 27.51  ? 23  ASN B CA  1 
ATOM   3893  C  C   . ASN B  1 48  ? 101.354 41.020  9.430    1.00 27.58  ? 23  ASN B C   1 
ATOM   3894  O  O   . ASN B  1 48  ? 102.257 41.844  9.235    1.00 28.06  ? 23  ASN B O   1 
ATOM   3895  C  CB  . ASN B  1 48  ? 100.844 41.796  11.757   1.00 28.92  ? 23  ASN B CB  1 
ATOM   3896  C  CG  . ASN B  1 48  ? 99.712  42.710  11.290   1.00 29.67  ? 23  ASN B CG  1 
ATOM   3897  O  OD1 . ASN B  1 48  ? 99.226  42.606  10.165   1.00 29.47  ? 23  ASN B OD1 1 
ATOM   3898  N  ND2 . ASN B  1 48  ? 99.287  43.608  12.163   1.00 30.61  ? 23  ASN B ND2 1 
ATOM   3899  N  N   . PRO B  1 49  ? 100.630 40.466  8.430    1.00 26.05  ? 24  PRO B N   1 
ATOM   3900  C  CA  . PRO B  1 49  ? 100.920 40.735  7.008    1.00 24.98  ? 24  PRO B CA  1 
ATOM   3901  C  C   . PRO B  1 49  ? 100.755 42.196  6.575    1.00 24.96  ? 24  PRO B C   1 
ATOM   3902  O  O   . PRO B  1 49  ? 101.338 42.587  5.561    1.00 25.05  ? 24  PRO B O   1 
ATOM   3903  C  CB  . PRO B  1 49  ? 99.917  39.845  6.265    1.00 23.89  ? 24  PRO B CB  1 
ATOM   3904  C  CG  . PRO B  1 49  ? 98.804  39.663  7.245    1.00 23.81  ? 24  PRO B CG  1 
ATOM   3905  C  CD  . PRO B  1 49  ? 99.482  39.555  8.581    1.00 24.85  ? 24  PRO B CD  1 
ATOM   3906  N  N   . ALA B  1 50  ? 99.956  42.979  7.306    1.00 25.05  ? 25  ALA B N   1 
ATOM   3907  C  CA  . ALA B  1 50  ? 99.806  44.412  7.009    1.00 26.56  ? 25  ALA B CA  1 
ATOM   3908  C  C   . ALA B  1 50  ? 101.033 45.279  7.393    1.00 29.00  ? 25  ALA B C   1 
ATOM   3909  O  O   . ALA B  1 50  ? 101.250 46.338  6.799    1.00 31.24  ? 25  ALA B O   1 
ATOM   3910  C  CB  . ALA B  1 50  ? 98.536  44.958  7.641    1.00 26.31  ? 25  ALA B CB  1 
ATOM   3911  N  N   . THR B  1 51  ? 101.817 44.851  8.386    1.00 28.37  ? 26  THR B N   1 
ATOM   3912  C  CA  . THR B  1 51  ? 103.040 45.576  8.763    1.00 29.20  ? 26  THR B CA  1 
ATOM   3913  C  C   . THR B  1 51  ? 104.287 44.810  8.328    1.00 29.43  ? 26  THR B C   1 
ATOM   3914  O  O   . THR B  1 51  ? 105.352 45.388  8.134    1.00 29.23  ? 26  THR B O   1 
ATOM   3915  C  CB  . THR B  1 51  ? 103.134 45.832  10.281   1.00 28.89  ? 26  THR B CB  1 
ATOM   3916  O  OG1 . THR B  1 51  ? 103.097 44.581  10.982   1.00 28.64  ? 26  THR B OG1 1 
ATOM   3917  C  CG2 . THR B  1 51  ? 101.992 46.724  10.752   1.00 28.92  ? 26  THR B CG2 1 
ATOM   3918  N  N   . GLY B  1 52  ? 104.146 43.498  8.198    1.00 29.79  ? 27  GLY B N   1 
ATOM   3919  C  CA  . GLY B  1 52  ? 105.240 42.649  7.772    1.00 30.76  ? 27  GLY B CA  1 
ATOM   3920  C  C   . GLY B  1 52  ? 106.131 42.213  8.912    1.00 32.23  ? 27  GLY B C   1 
ATOM   3921  O  O   . GLY B  1 52  ? 107.159 41.590  8.682    1.00 34.08  ? 27  GLY B O   1 
ATOM   3922  N  N   . GLU B  1 53  ? 105.749 42.528  10.144   1.00 32.70  ? 28  GLU B N   1 
ATOM   3923  C  CA  . GLU B  1 53  ? 106.550 42.106  11.291   1.00 35.44  ? 28  GLU B CA  1 
ATOM   3924  C  C   . GLU B  1 53  ? 105.975 40.911  12.063   1.00 33.34  ? 28  GLU B C   1 
ATOM   3925  O  O   . GLU B  1 53  ? 104.795 40.572  11.929   1.00 31.97  ? 28  GLU B O   1 
ATOM   3926  C  CB  . GLU B  1 53  ? 106.870 43.288  12.216   1.00 40.74  ? 28  GLU B CB  1 
ATOM   3927  C  CG  . GLU B  1 53  ? 105.679 44.071  12.729   1.00 46.25  ? 28  GLU B CG  1 
ATOM   3928  C  CD  . GLU B  1 53  ? 106.085 45.434  13.277   1.00 56.16  ? 28  GLU B CD  1 
ATOM   3929  O  OE1 . GLU B  1 53  ? 107.051 46.027  12.739   1.00 60.06  ? 28  GLU B OE1 1 
ATOM   3930  O  OE2 . GLU B  1 53  ? 105.446 45.918  14.243   1.00 57.54  ? 28  GLU B OE2 1 
ATOM   3931  N  N   . VAL B  1 54  ? 106.837 40.268  12.847   1.00 31.92  ? 29  VAL B N   1 
ATOM   3932  C  CA  . VAL B  1 54  ? 106.453 39.111  13.641   1.00 30.76  ? 29  VAL B CA  1 
ATOM   3933  C  C   . VAL B  1 54  ? 105.610 39.584  14.823   1.00 30.16  ? 29  VAL B C   1 
ATOM   3934  O  O   . VAL B  1 54  ? 105.972 40.540  15.508   1.00 30.91  ? 29  VAL B O   1 
ATOM   3935  C  CB  . VAL B  1 54  ? 107.701 38.329  14.116   1.00 31.03  ? 29  VAL B CB  1 
ATOM   3936  C  CG1 . VAL B  1 54  ? 107.320 37.204  15.072   1.00 30.35  ? 29  VAL B CG1 1 
ATOM   3937  C  CG2 . VAL B  1 54  ? 108.474 37.779  12.920   1.00 30.61  ? 29  VAL B CG2 1 
ATOM   3938  N  N   . GLN B  1 55  ? 104.474 38.933  15.050   1.00 28.97  ? 30  GLN B N   1 
ATOM   3939  C  CA  . GLN B  1 55  ? 103.616 39.282  16.187   1.00 28.22  ? 30  GLN B CA  1 
ATOM   3940  C  C   . GLN B  1 55  ? 103.511 38.170  17.226   1.00 28.24  ? 30  GLN B C   1 
ATOM   3941  O  O   . GLN B  1 55  ? 103.025 38.393  18.331   1.00 28.59  ? 30  GLN B O   1 
ATOM   3942  C  CB  . GLN B  1 55  ? 102.223 39.701  15.713   1.00 28.06  ? 30  GLN B CB  1 
ATOM   3943  C  CG  . GLN B  1 55  ? 101.435 38.590  15.042   1.00 28.45  ? 30  GLN B CG  1 
ATOM   3944  C  CD  . GLN B  1 55  ? 100.057 39.044  14.600   1.00 29.10  ? 30  GLN B CD  1 
ATOM   3945  O  OE1 . GLN B  1 55  ? 99.331  39.682  15.362   1.00 30.30  ? 30  GLN B OE1 1 
ATOM   3946  N  NE2 . GLN B  1 55  ? 99.689  38.712  13.365   1.00 27.80  ? 30  GLN B NE2 1 
ATOM   3947  N  N   . GLY B  1 56  ? 103.951 36.967  16.866   1.00 28.19  ? 31  GLY B N   1 
ATOM   3948  C  CA  . GLY B  1 56  ? 103.913 35.839  17.788   1.00 27.98  ? 31  GLY B CA  1 
ATOM   3949  C  C   . GLY B  1 56  ? 104.529 34.590  17.186   1.00 29.03  ? 31  GLY B C   1 
ATOM   3950  O  O   . GLY B  1 56  ? 105.047 34.613  16.056   1.00 29.14  ? 31  GLY B O   1 
ATOM   3951  N  N   . THR B  1 57  ? 104.475 33.495  17.940   1.00 27.77  ? 32  THR B N   1 
ATOM   3952  C  CA  . THR B  1 57  ? 105.026 32.229  17.480   1.00 26.28  ? 32  THR B CA  1 
ATOM   3953  C  C   . THR B  1 57  ? 104.023 31.114  17.705   1.00 25.06  ? 32  THR B C   1 
ATOM   3954  O  O   . THR B  1 57  ? 103.081 31.254  18.486   1.00 24.59  ? 32  THR B O   1 
ATOM   3955  C  CB  . THR B  1 57  ? 106.370 31.862  18.184   1.00 26.39  ? 32  THR B CB  1 
ATOM   3956  O  OG1 . THR B  1 57  ? 106.160 31.711  19.593   1.00 26.25  ? 32  THR B OG1 1 
ATOM   3957  C  CG2 . THR B  1 57  ? 107.492 32.918  17.920   1.00 26.48  ? 32  THR B CG2 1 
ATOM   3958  N  N   . VAL B  1 58  ? 104.243 29.998  17.020   1.00 24.89  ? 33  VAL B N   1 
ATOM   3959  C  CA  . VAL B  1 58  ? 103.425 28.815  17.205   1.00 24.68  ? 33  VAL B CA  1 
ATOM   3960  C  C   . VAL B  1 58  ? 104.337 27.597  17.254   1.00 25.36  ? 33  VAL B C   1 
ATOM   3961  O  O   . VAL B  1 58  ? 105.235 27.467  16.432   1.00 26.61  ? 33  VAL B O   1 
ATOM   3962  C  CB  . VAL B  1 58  ? 102.338 28.666  16.103   1.00 23.56  ? 33  VAL B CB  1 
ATOM   3963  C  CG1 . VAL B  1 58  ? 102.948 28.598  14.706   1.00 23.16  ? 33  VAL B CG1 1 
ATOM   3964  C  CG2 . VAL B  1 58  ? 101.485 27.430  16.357   1.00 23.42  ? 33  VAL B CG2 1 
ATOM   3965  N  N   . ALA B  1 59  ? 104.088 26.718  18.222   1.00 25.39  ? 34  ALA B N   1 
ATOM   3966  C  CA  . ALA B  1 59  ? 104.882 25.511  18.436   1.00 25.06  ? 34  ALA B CA  1 
ATOM   3967  C  C   . ALA B  1 59  ? 104.715 24.533  17.284   1.00 23.39  ? 34  ALA B C   1 
ATOM   3968  O  O   . ALA B  1 59  ? 103.630 24.382  16.738   1.00 22.21  ? 34  ALA B O   1 
ATOM   3969  C  CB  . ALA B  1 59  ? 104.480 24.840  19.742   1.00 24.57  ? 34  ALA B CB  1 
ATOM   3970  N  N   . LEU B  1 60  ? 105.795 23.859  16.929   1.00 23.61  ? 35  LEU B N   1 
ATOM   3971  C  CA  . LEU B  1 60  ? 105.724 22.848  15.873   1.00 24.22  ? 35  LEU B CA  1 
ATOM   3972  C  C   . LEU B  1 60  ? 105.755 21.485  16.544   1.00 24.92  ? 35  LEU B C   1 
ATOM   3973  O  O   . LEU B  1 60  ? 106.780 21.075  17.096   1.00 25.39  ? 35  LEU B O   1 
ATOM   3974  C  CB  . LEU B  1 60  ? 106.871 23.018  14.860   1.00 24.24  ? 35  LEU B CB  1 
ATOM   3975  C  CG  . LEU B  1 60  ? 107.147 24.442  14.341   1.00 24.20  ? 35  LEU B CG  1 
ATOM   3976  C  CD1 . LEU B  1 60  ? 108.395 24.486  13.456   1.00 23.42  ? 35  LEU B CD1 1 
ATOM   3977  C  CD2 . LEU B  1 60  ? 105.924 24.984  13.601   1.00 23.83  ? 35  LEU B CD2 1 
ATOM   3978  N  N   . ALA B  1 61  ? 104.621 20.793  16.500   1.00 24.88  ? 36  ALA B N   1 
ATOM   3979  C  CA  . ALA B  1 61  ? 104.424 19.581  17.281   1.00 24.76  ? 36  ALA B CA  1 
ATOM   3980  C  C   . ALA B  1 61  ? 105.531 18.583  17.077   1.00 26.13  ? 36  ALA B C   1 
ATOM   3981  O  O   . ALA B  1 61  ? 106.008 18.381  15.966   1.00 26.22  ? 36  ALA B O   1 
ATOM   3982  C  CB  . ALA B  1 61  ? 103.099 18.936  16.950   1.00 23.35  ? 36  ALA B CB  1 
ATOM   3983  N  N   . SER B  1 62  ? 105.922 17.967  18.177   1.00 27.58  ? 37  SER B N   1 
ATOM   3984  C  CA  . SER B  1 62  ? 106.764 16.805  18.156   1.00 29.37  ? 37  SER B CA  1 
ATOM   3985  C  C   . SER B  1 62  ? 105.876 15.579  18.013   1.00 29.95  ? 37  SER B C   1 
ATOM   3986  O  O   . SER B  1 62  ? 104.641 15.695  17.969   1.00 29.19  ? 37  SER B O   1 
ATOM   3987  C  CB  . SER B  1 62  ? 107.497 16.723  19.494   1.00 29.89  ? 37  SER B CB  1 
ATOM   3988  O  OG  . SER B  1 62  ? 106.560 16.627  20.557   1.00 29.61  ? 37  SER B OG  1 
ATOM   3989  N  N   . ASP B  1 63  ? 106.517 14.411  17.995   1.00 31.48  ? 38  ASP B N   1 
ATOM   3990  C  CA  . ASP B  1 63  ? 105.844 13.115  18.133   1.00 32.82  ? 38  ASP B CA  1 
ATOM   3991  C  C   . ASP B  1 63  ? 105.161 12.931  19.491   1.00 30.74  ? 38  ASP B C   1 
ATOM   3992  O  O   . ASP B  1 63  ? 104.074 12.364  19.545   1.00 31.43  ? 38  ASP B O   1 
ATOM   3993  C  CB  . ASP B  1 63  ? 106.832 11.965  17.910   1.00 37.64  ? 38  ASP B CB  1 
ATOM   3994  C  CG  . ASP B  1 63  ? 107.477 11.996  16.526   1.00 42.31  ? 38  ASP B CG  1 
ATOM   3995  O  OD1 . ASP B  1 63  ? 106.894 12.579  15.576   1.00 42.10  ? 38  ASP B OD1 1 
ATOM   3996  O  OD2 . ASP B  1 63  ? 108.583 11.428  16.403   1.00 46.07  ? 38  ASP B OD2 1 
ATOM   3997  N  N   . ALA B  1 64  ? 105.794 13.387  20.574   1.00 28.16  ? 39  ALA B N   1 
ATOM   3998  C  CA  . ALA B  1 64  ? 105.165 13.365  21.896   1.00 28.01  ? 39  ALA B CA  1 
ATOM   3999  C  C   . ALA B  1 64  ? 103.840 14.149  21.898   1.00 28.70  ? 39  ALA B C   1 
ATOM   4000  O  O   . ALA B  1 64  ? 102.835 13.660  22.424   1.00 29.88  ? 39  ALA B O   1 
ATOM   4001  C  CB  . ALA B  1 64  ? 106.108 13.900  22.964   1.00 27.61  ? 39  ALA B CB  1 
ATOM   4002  N  N   . ASP B  1 65  ? 103.840 15.342  21.289   1.00 27.77  ? 40  ASP B N   1 
ATOM   4003  C  CA  . ASP B  1 65  ? 102.624 16.170  21.162   1.00 26.73  ? 40  ASP B CA  1 
ATOM   4004  C  C   . ASP B  1 65  ? 101.487 15.453  20.419   1.00 24.74  ? 40  ASP B C   1 
ATOM   4005  O  O   . ASP B  1 65  ? 100.386 15.368  20.953   1.00 24.36  ? 40  ASP B O   1 
ATOM   4006  C  CB  . ASP B  1 65  ? 102.924 17.528  20.509   1.00 27.54  ? 40  ASP B CB  1 
ATOM   4007  C  CG  . ASP B  1 65  ? 103.918 18.356  21.301   1.00 30.49  ? 40  ASP B CG  1 
ATOM   4008  O  OD1 . ASP B  1 65  ? 104.021 18.173  22.528   1.00 31.92  ? 40  ASP B OD1 1 
ATOM   4009  O  OD2 . ASP B  1 65  ? 104.606 19.202  20.695   1.00 32.17  ? 40  ASP B OD2 1 
ATOM   4010  N  N   . LEU B  1 66  ? 101.767 14.900  19.244   1.00 24.25  ? 41  LEU B N   1 
ATOM   4011  C  CA  . LEU B  1 66  ? 100.773 14.127  18.527   1.00 24.47  ? 41  LEU B CA  1 
ATOM   4012  C  C   . LEU B  1 66  ? 100.320 12.919  19.304   1.00 24.61  ? 41  LEU B C   1 
ATOM   4013  O  O   . LEU B  1 66  ? 99.165  12.690  19.385   1.00 24.31  ? 41  LEU B O   1 
ATOM   4014  C  CB  . LEU B  1 66  ? 101.215 13.651  17.136   1.00 25.07  ? 41  LEU B CB  1 
ATOM   4015  C  CG  . LEU B  1 66  ? 100.085 12.920  16.402   1.00 25.25  ? 41  LEU B CG  1 
ATOM   4016  C  CD1 . LEU B  1 66  ? 98.991  13.833  15.976   1.00 24.58  ? 41  LEU B CD1 1 
ATOM   4017  C  CD2 . LEU B  1 66  ? 100.441 12.002  15.283   1.00 26.26  ? 41  LEU B CD2 1 
ATOM   4018  N  N   . ALA B  1 67  ? 101.259 12.195  19.899   1.00 24.71  ? 42  ALA B N   1 
ATOM   4019  C  CA  . ALA B  1 67  ? 100.958 11.027  20.740   1.00 25.09  ? 42  ALA B CA  1 
ATOM   4020  C  C   . ALA B  1 67  ? 100.013 11.384  21.894   1.00 25.38  ? 42  ALA B C   1 
ATOM   4021  O  O   . ALA B  1 67  ? 98.998  10.710  22.095   1.00 26.19  ? 42  ALA B O   1 
ATOM   4022  C  CB  . ALA B  1 67  ? 102.233 10.364  21.258   1.00 25.03  ? 42  ALA B CB  1 
ATOM   4023  N  N   . ALA B  1 68  ? 100.319 12.462  22.618   1.00 24.65  ? 43  ALA B N   1 
ATOM   4024  C  CA  . ALA B  1 68  ? 99.414  12.955  23.667   1.00 24.39  ? 43  ALA B CA  1 
ATOM   4025  C  C   . ALA B  1 68  ? 98.013  13.317  23.140   1.00 23.27  ? 43  ALA B C   1 
ATOM   4026  O  O   . ALA B  1 68  ? 97.009  13.041  23.815   1.00 23.67  ? 43  ALA B O   1 
ATOM   4027  C  CB  . ALA B  1 68  ? 100.029 14.133  24.416   1.00 24.70  ? 43  ALA B CB  1 
ATOM   4028  N  N   . ALA B  1 69  ? 97.947  13.926  21.955   1.00 21.33  ? 44  ALA B N   1 
ATOM   4029  C  CA  . ALA B  1 69  ? 96.655  14.236  21.324   1.00 20.56  ? 44  ALA B CA  1 
ATOM   4030  C  C   . ALA B  1 69  ? 95.877  12.960  20.959   1.00 20.49  ? 44  ALA B C   1 
ATOM   4031  O  O   . ALA B  1 69  ? 94.658  12.897  21.150   1.00 19.85  ? 44  ALA B O   1 
ATOM   4032  C  CB  . ALA B  1 69  ? 96.842  15.125  20.101   1.00 19.54  ? 44  ALA B CB  1 
ATOM   4033  N  N   . VAL B  1 70  ? 96.582  11.953  20.439   1.00 21.27  ? 45  VAL B N   1 
ATOM   4034  C  CA  . VAL B  1 70  ? 95.984  10.640  20.095   1.00 21.55  ? 45  VAL B CA  1 
ATOM   4035  C  C   . VAL B  1 70  ? 95.502  9.884   21.353   1.00 22.22  ? 45  VAL B C   1 
ATOM   4036  O  O   . VAL B  1 70  ? 94.386  9.354   21.373   1.00 21.43  ? 45  VAL B O   1 
ATOM   4037  C  CB  . VAL B  1 70  ? 96.947  9.767   19.227   1.00 21.82  ? 45  VAL B CB  1 
ATOM   4038  C  CG1 . VAL B  1 70  ? 96.571  8.288   19.233   1.00 20.95  ? 45  VAL B CG1 1 
ATOM   4039  C  CG2 . VAL B  1 70  ? 96.978  10.275  17.790   1.00 22.10  ? 45  VAL B CG2 1 
ATOM   4040  N  N   . GLU B  1 71  ? 96.340  9.848   22.391   1.00 23.52  ? 46  GLU B N   1 
ATOM   4041  C  CA  . GLU B  1 71  ? 95.971  9.218   23.668   1.00 26.14  ? 46  GLU B CA  1 
ATOM   4042  C  C   . GLU B  1 71  ? 94.772  9.897   24.317   1.00 25.93  ? 46  GLU B C   1 
ATOM   4043  O  O   . GLU B  1 71  ? 93.869  9.221   24.842   1.00 26.61  ? 46  GLU B O   1 
ATOM   4044  C  CB  . GLU B  1 71  ? 97.156  9.187   24.649   1.00 29.25  ? 46  GLU B CB  1 
ATOM   4045  C  CG  . GLU B  1 71  ? 98.191  8.119   24.312   1.00 33.79  ? 46  GLU B CG  1 
ATOM   4046  C  CD  . GLU B  1 71  ? 97.575  6.729   24.100   1.00 36.83  ? 46  GLU B CD  1 
ATOM   4047  O  OE1 . GLU B  1 71  ? 97.032  6.160   25.074   1.00 39.06  ? 46  GLU B OE1 1 
ATOM   4048  O  OE2 . GLU B  1 71  ? 97.633  6.201   22.964   1.00 35.34  ? 46  GLU B OE2 1 
ATOM   4049  N  N   . SER B  1 72  ? 94.782  11.229  24.296   1.00 24.06  ? 47  SER B N   1 
ATOM   4050  C  CA  . SER B  1 72  ? 93.656  12.021  24.766   1.00 23.65  ? 47  SER B CA  1 
ATOM   4051  C  C   . SER B  1 72  ? 92.368  11.677  23.973   1.00 22.56  ? 47  SER B C   1 
ATOM   4052  O  O   . SER B  1 72  ? 91.308  11.446  24.571   1.00 22.13  ? 47  SER B O   1 
ATOM   4053  C  CB  . SER B  1 72  ? 94.021  13.507  24.696   1.00 24.31  ? 47  SER B CB  1 
ATOM   4054  O  OG  . SER B  1 72  ? 92.884  14.329  24.601   1.00 26.06  ? 47  SER B OG  1 
ATOM   4055  N  N   . ALA B  1 73  ? 92.475  11.613  22.641   1.00 21.68  ? 48  ALA B N   1 
ATOM   4056  C  CA  . ALA B  1 73  ? 91.355  11.206  21.785   1.00 21.66  ? 48  ALA B CA  1 
ATOM   4057  C  C   . ALA B  1 73  ? 90.858  9.789   22.097   1.00 22.51  ? 48  ALA B C   1 
ATOM   4058  O  O   . ALA B  1 73  ? 89.656  9.566   22.169   1.00 22.01  ? 48  ALA B O   1 
ATOM   4059  C  CB  . ALA B  1 73  ? 91.721  11.321  20.309   1.00 21.38  ? 48  ALA B CB  1 
ATOM   4060  N  N   . LYS B  1 74  ? 91.781  8.842   22.274   1.00 23.93  ? 49  LYS B N   1 
ATOM   4061  C  CA  . LYS B  1 74  ? 91.423  7.454   22.599   1.00 25.07  ? 49  LYS B CA  1 
ATOM   4062  C  C   . LYS B  1 74  ? 90.678  7.331   23.920   1.00 26.51  ? 49  LYS B C   1 
ATOM   4063  O  O   . LYS B  1 74  ? 89.724  6.552   24.027   1.00 27.46  ? 49  LYS B O   1 
ATOM   4064  C  CB  . LYS B  1 74  ? 92.662  6.576   22.683   1.00 25.59  ? 49  LYS B CB  1 
ATOM   4065  C  CG  . LYS B  1 74  ? 93.117  5.977   21.371   1.00 26.45  ? 49  LYS B CG  1 
ATOM   4066  C  CD  . LYS B  1 74  ? 94.614  5.761   21.486   1.00 28.78  ? 49  LYS B CD  1 
ATOM   4067  C  CE  . LYS B  1 74  ? 95.044  4.404   20.987   1.00 29.88  ? 49  LYS B CE  1 
ATOM   4068  N  NZ  . LYS B  1 74  ? 96.480  4.185   21.307   1.00 30.37  ? 49  LYS B NZ  1 
ATOM   4069  N  N   . ALA B  1 75  ? 91.128  8.077   24.929   1.00 25.75  ? 50  ALA B N   1 
ATOM   4070  C  CA  . ALA B  1 75  ? 90.469  8.048   26.236   1.00 25.55  ? 50  ALA B CA  1 
ATOM   4071  C  C   . ALA B  1 75  ? 89.021  8.560   26.154   1.00 24.66  ? 50  ALA B C   1 
ATOM   4072  O  O   . ALA B  1 75  ? 88.159  8.045   26.862   1.00 25.09  ? 50  ALA B O   1 
ATOM   4073  C  CB  . ALA B  1 75  ? 91.274  8.810   27.297   1.00 24.40  ? 50  ALA B CB  1 
ATOM   4074  N  N   . ALA B  1 76  ? 88.755  9.533   25.274   1.00 23.08  ? 51  ALA B N   1 
ATOM   4075  C  CA  . ALA B  1 76  ? 87.446  10.206  25.242   1.00 22.35  ? 51  ALA B CA  1 
ATOM   4076  C  C   . ALA B  1 76  ? 86.425  9.700   24.203   1.00 21.21  ? 51  ALA B C   1 
ATOM   4077  O  O   . ALA B  1 76  ? 85.225  9.759   24.429   1.00 20.45  ? 51  ALA B O   1 
ATOM   4078  C  CB  . ALA B  1 76  ? 87.630  11.711  25.104   1.00 22.43  ? 51  ALA B CB  1 
ATOM   4079  N  N   . GLN B  1 77  ? 86.898  9.230   23.056   1.00 21.42  ? 52  GLN B N   1 
ATOM   4080  C  CA  . GLN B  1 77  ? 85.996  8.863   21.968   1.00 21.42  ? 52  GLN B CA  1 
ATOM   4081  C  C   . GLN B  1 77  ? 84.883  7.833   22.336   1.00 22.92  ? 52  GLN B C   1 
ATOM   4082  O  O   . GLN B  1 77  ? 83.734  8.018   21.930   1.00 23.17  ? 52  GLN B O   1 
ATOM   4083  C  CB  . GLN B  1 77  ? 86.808  8.464   20.725   1.00 20.33  ? 52  GLN B CB  1 
ATOM   4084  C  CG  . GLN B  1 77  ? 86.003  8.213   19.464   1.00 19.53  ? 52  GLN B CG  1 
ATOM   4085  C  CD  . GLN B  1 77  ? 85.478  6.794   19.415   1.00 20.41  ? 52  GLN B CD  1 
ATOM   4086  O  OE1 . GLN B  1 77  ? 86.077  5.894   20.008   1.00 21.93  ? 52  GLN B OE1 1 
ATOM   4087  N  NE2 . GLN B  1 77  ? 84.335  6.586   18.742   1.00 19.16  ? 52  GLN B NE2 1 
ATOM   4088  N  N   . PRO B  1 78  ? 85.210  6.761   23.097   1.00 24.26  ? 53  PRO B N   1 
ATOM   4089  C  CA  . PRO B  1 78  ? 84.146  5.777   23.404   1.00 25.52  ? 53  PRO B CA  1 
ATOM   4090  C  C   . PRO B  1 78  ? 82.912  6.354   24.115   1.00 24.87  ? 53  PRO B C   1 
ATOM   4091  O  O   . PRO B  1 78  ? 81.802  6.142   23.651   1.00 24.38  ? 53  PRO B O   1 
ATOM   4092  C  CB  . PRO B  1 78  ? 84.866  4.730   24.281   1.00 26.97  ? 53  PRO B CB  1 
ATOM   4093  C  CG  . PRO B  1 78  ? 86.302  4.821   23.854   1.00 26.19  ? 53  PRO B CG  1 
ATOM   4094  C  CD  . PRO B  1 78  ? 86.535  6.284   23.544   1.00 24.85  ? 53  PRO B CD  1 
ATOM   4095  N  N   . LYS B  1 79  ? 83.103  7.099   25.202   1.00 25.54  ? 54  LYS B N   1 
ATOM   4096  C  CA  . LYS B  1 79  ? 81.981  7.772   25.872   1.00 26.36  ? 54  LYS B CA  1 
ATOM   4097  C  C   . LYS B  1 79  ? 81.271  8.789   24.988   1.00 23.89  ? 54  LYS B C   1 
ATOM   4098  O  O   . LYS B  1 79  ? 80.052  8.960   25.105   1.00 22.93  ? 54  LYS B O   1 
ATOM   4099  C  CB  . LYS B  1 79  ? 82.416  8.444   27.179   1.00 29.80  ? 54  LYS B CB  1 
ATOM   4100  C  CG  . LYS B  1 79  ? 82.476  7.495   28.366   1.00 35.98  ? 54  LYS B CG  1 
ATOM   4101  C  CD  . LYS B  1 79  ? 82.847  8.230   29.650   1.00 43.68  ? 54  LYS B CD  1 
ATOM   4102  C  CE  . LYS B  1 79  ? 83.156  7.250   30.779   1.00 54.16  ? 54  LYS B CE  1 
ATOM   4103  N  NZ  . LYS B  1 79  ? 83.270  7.899   32.122   1.00 59.49  ? 54  LYS B NZ  1 
ATOM   4104  N  N   . TRP B  1 80  ? 82.024  9.477   24.124   1.00 22.71  ? 55  TRP B N   1 
ATOM   4105  C  CA  . TRP B  1 80  ? 81.404  10.409  23.170   1.00 21.98  ? 55  TRP B CA  1 
ATOM   4106  C  C   . TRP B  1 80  ? 80.511  9.657   22.172   1.00 21.34  ? 55  TRP B C   1 
ATOM   4107  O  O   . TRP B  1 80  ? 79.352  10.039  21.976   1.00 21.70  ? 55  TRP B O   1 
ATOM   4108  C  CB  . TRP B  1 80  ? 82.456  11.302  22.478   1.00 21.10  ? 55  TRP B CB  1 
ATOM   4109  C  CG  . TRP B  1 80  ? 81.919  12.256  21.436   1.00 20.31  ? 55  TRP B CG  1 
ATOM   4110  C  CD1 . TRP B  1 80  ? 82.225  12.254  20.093   1.00 20.02  ? 55  TRP B CD1 1 
ATOM   4111  C  CD2 . TRP B  1 80  ? 81.000  13.354  21.633   1.00 19.92  ? 55  TRP B CD2 1 
ATOM   4112  N  NE1 . TRP B  1 80  ? 81.549  13.268  19.449   1.00 20.05  ? 55  TRP B NE1 1 
ATOM   4113  C  CE2 . TRP B  1 80  ? 80.797  13.961  20.369   1.00 20.19  ? 55  TRP B CE2 1 
ATOM   4114  C  CE3 . TRP B  1 80  ? 80.335  13.879  22.746   1.00 20.24  ? 55  TRP B CE3 1 
ATOM   4115  C  CZ2 . TRP B  1 80  ? 79.942  15.060  20.191   1.00 20.39  ? 55  TRP B CZ2 1 
ATOM   4116  C  CZ3 . TRP B  1 80  ? 79.493  14.977  22.572   1.00 21.20  ? 55  TRP B CZ3 1 
ATOM   4117  C  CH2 . TRP B  1 80  ? 79.308  15.556  21.302   1.00 21.65  ? 55  TRP B CH2 1 
ATOM   4118  N  N   . ALA B  1 81  ? 81.033  8.577   21.579   1.00 20.39  ? 56  ALA B N   1 
ATOM   4119  C  CA  . ALA B  1 81  ? 80.260  7.756   20.630   1.00 19.65  ? 56  ALA B CA  1 
ATOM   4120  C  C   . ALA B  1 81  ? 79.048  7.096   21.292   1.00 20.82  ? 56  ALA B C   1 
ATOM   4121  O  O   . ALA B  1 81  ? 78.043  6.836   20.621   1.00 20.59  ? 56  ALA B O   1 
ATOM   4122  C  CB  . ALA B  1 81  ? 81.134  6.696   19.966   1.00 18.74  ? 56  ALA B CB  1 
ATOM   4123  N  N   . ALA B  1 82  ? 79.150  6.823   22.598   1.00 20.78  ? 57  ALA B N   1 
ATOM   4124  C  CA  . ALA B  1 82  ? 78.049  6.251   23.372   1.00 20.37  ? 57  ALA B CA  1 
ATOM   4125  C  C   . ALA B  1 82  ? 76.979  7.297   23.797   1.00 21.08  ? 57  ALA B C   1 
ATOM   4126  O  O   . ALA B  1 82  ? 75.937  6.942   24.370   1.00 22.40  ? 57  ALA B O   1 
ATOM   4127  C  CB  . ALA B  1 82  ? 78.594  5.501   24.581   1.00 20.86  ? 57  ALA B CB  1 
ATOM   4128  N  N   . THR B  1 83  ? 77.238  8.576   23.531   1.00 20.16  ? 58  THR B N   1 
ATOM   4129  C  CA  . THR B  1 83  ? 76.258  9.629   23.770   1.00 19.90  ? 58  THR B CA  1 
ATOM   4130  C  C   . THR B  1 83  ? 75.260  9.632   22.608   1.00 20.24  ? 58  THR B C   1 
ATOM   4131  O  O   . THR B  1 83  ? 75.662  9.557   21.444   1.00 19.60  ? 58  THR B O   1 
ATOM   4132  C  CB  . THR B  1 83  ? 76.949  11.003  23.862   1.00 19.89  ? 58  THR B CB  1 
ATOM   4133  O  OG1 . THR B  1 83  ? 78.010  10.929  24.816   1.00 21.24  ? 58  THR B OG1 1 
ATOM   4134  C  CG2 . THR B  1 83  ? 75.980  12.095  24.266   1.00 18.34  ? 58  THR B CG2 1 
ATOM   4135  N  N   . ASN B  1 84  ? 73.964  9.716   22.914   1.00 20.37  ? 59  ASN B N   1 
ATOM   4136  C  CA  . ASN B  1 84  ? 72.950  9.664   21.859   1.00 19.77  ? 59  ASN B CA  1 
ATOM   4137  C  C   . ASN B  1 84  ? 73.050  10.837  20.864   1.00 18.75  ? 59  ASN B C   1 
ATOM   4138  O  O   . ASN B  1 84  ? 73.547  11.904  21.214   1.00 19.42  ? 59  ASN B O   1 
ATOM   4139  C  CB  . ASN B  1 84  ? 71.533  9.493   22.439   1.00 20.17  ? 59  ASN B CB  1 
ATOM   4140  C  CG  . ASN B  1 84  ? 70.921  10.798  22.906   1.00 21.87  ? 59  ASN B CG  1 
ATOM   4141  O  OD1 . ASN B  1 84  ? 70.824  11.765  22.153   1.00 21.94  ? 59  ASN B OD1 1 
ATOM   4142  N  ND2 . ASN B  1 84  ? 70.483  10.825  24.157   1.00 23.47  ? 59  ASN B ND2 1 
ATOM   4143  N  N   . PRO B  1 85  ? 72.582  10.632  19.620   1.00 17.82  ? 60  PRO B N   1 
ATOM   4144  C  CA  . PRO B  1 85  ? 72.713  11.610  18.535   1.00 17.49  ? 60  PRO B CA  1 
ATOM   4145  C  C   . PRO B  1 85  ? 72.118  12.980  18.838   1.00 18.50  ? 60  PRO B C   1 
ATOM   4146  O  O   . PRO B  1 85  ? 72.697  13.983  18.425   1.00 18.45  ? 60  PRO B O   1 
ATOM   4147  C  CB  . PRO B  1 85  ? 71.942  10.964  17.377   1.00 17.02  ? 60  PRO B CB  1 
ATOM   4148  C  CG  . PRO B  1 85  ? 71.889  9.511   17.700   1.00 16.91  ? 60  PRO B CG  1 
ATOM   4149  C  CD  . PRO B  1 85  ? 71.879  9.408   19.187   1.00 17.21  ? 60  PRO B CD  1 
ATOM   4150  N  N   . GLN B  1 86  ? 70.976  13.026  19.532   1.00 19.63  ? 61  GLN B N   1 
ATOM   4151  C  CA  . GLN B  1 86  ? 70.329  14.300  19.874   1.00 21.32  ? 61  GLN B CA  1 
ATOM   4152  C  C   . GLN B  1 86  ? 71.155  15.104  20.856   1.00 22.94  ? 61  GLN B C   1 
ATOM   4153  O  O   . GLN B  1 86  ? 71.228  16.329  20.743   1.00 21.86  ? 61  GLN B O   1 
ATOM   4154  C  CB  . GLN B  1 86  ? 68.938  14.088  20.469   1.00 22.14  ? 61  GLN B CB  1 
ATOM   4155  C  CG  . GLN B  1 86  ? 67.870  13.693  19.475   1.00 22.03  ? 61  GLN B CG  1 
ATOM   4156  C  CD  . GLN B  1 86  ? 66.641  13.192  20.182   1.00 22.43  ? 61  GLN B CD  1 
ATOM   4157  O  OE1 . GLN B  1 86  ? 66.736  12.306  21.017   1.00 22.97  ? 61  GLN B OE1 1 
ATOM   4158  N  NE2 . GLN B  1 86  ? 65.475  13.746  19.844   1.00 22.01  ? 61  GLN B NE2 1 
ATOM   4159  N  N   . ARG B  1 87  ? 71.752  14.409  21.827   1.00 24.59  ? 62  ARG B N   1 
ATOM   4160  C  CA  . ARG B  1 87  ? 72.650  15.045  22.796   1.00 26.59  ? 62  ARG B CA  1 
ATOM   4161  C  C   . ARG B  1 87  ? 73.933  15.544  22.124   1.00 24.31  ? 62  ARG B C   1 
ATOM   4162  O  O   . ARG B  1 87  ? 74.387  16.653  22.418   1.00 24.41  ? 62  ARG B O   1 
ATOM   4163  C  CB  . ARG B  1 87  ? 72.971  14.110  23.971   1.00 30.07  ? 62  ARG B CB  1 
ATOM   4164  C  CG  . ARG B  1 87  ? 71.799  13.894  24.921   1.00 36.34  ? 62  ARG B CG  1 
ATOM   4165  C  CD  . ARG B  1 87  ? 72.214  13.124  26.165   1.00 41.48  ? 62  ARG B CD  1 
ATOM   4166  N  NE  . ARG B  1 87  ? 73.245  13.832  26.920   1.00 46.10  ? 62  ARG B NE  1 
ATOM   4167  C  CZ  . ARG B  1 87  ? 74.088  13.252  27.770   1.00 50.03  ? 62  ARG B CZ  1 
ATOM   4168  N  NH1 . ARG B  1 87  ? 74.039  11.941  27.975   1.00 51.75  ? 62  ARG B NH1 1 
ATOM   4169  N  NH2 . ARG B  1 87  ? 74.992  13.983  28.408   1.00 49.13  ? 62  ARG B NH2 1 
ATOM   4170  N  N   . ARG B  1 88  ? 74.492  14.750  21.204   1.00 22.12  ? 63  ARG B N   1 
ATOM   4171  C  CA  . ARG B  1 88  ? 75.660  15.200  20.448   1.00 21.00  ? 63  ARG B CA  1 
ATOM   4172  C  C   . ARG B  1 88  ? 75.316  16.463  19.657   1.00 20.50  ? 63  ARG B C   1 
ATOM   4173  O  O   . ARG B  1 88  ? 76.077  17.438  19.672   1.00 19.63  ? 63  ARG B O   1 
ATOM   4174  C  CB  . ARG B  1 88  ? 76.219  14.102  19.523   1.00 20.70  ? 63  ARG B CB  1 
ATOM   4175  C  CG  . ARG B  1 88  ? 76.648  12.849  20.258   1.00 21.57  ? 63  ARG B CG  1 
ATOM   4176  C  CD  . ARG B  1 88  ? 77.670  12.028  19.487   1.00 22.40  ? 63  ARG B CD  1 
ATOM   4177  N  NE  . ARG B  1 88  ? 77.251  11.667  18.132   1.00 23.69  ? 63  ARG B NE  1 
ATOM   4178  C  CZ  . ARG B  1 88  ? 76.558  10.579  17.789   1.00 23.23  ? 63  ARG B CZ  1 
ATOM   4179  N  NH1 . ARG B  1 88  ? 76.134  9.701   18.701   1.00 23.46  ? 63  ARG B NH1 1 
ATOM   4180  N  NH2 . ARG B  1 88  ? 76.268  10.376  16.512   1.00 20.80  ? 63  ARG B NH2 1 
ATOM   4181  N  N   . ALA B  1 89  ? 74.155  16.429  18.992   1.00 19.61  ? 64  ALA B N   1 
ATOM   4182  C  CA  . ALA B  1 89  ? 73.628  17.564  18.246   1.00 19.22  ? 64  ALA B CA  1 
ATOM   4183  C  C   . ALA B  1 89  ? 73.514  18.831  19.096   1.00 19.15  ? 64  ALA B C   1 
ATOM   4184  O  O   . ALA B  1 89  ? 73.785  19.929  18.596   1.00 18.94  ? 64  ALA B O   1 
ATOM   4185  C  CB  . ALA B  1 89  ? 72.271  17.218  17.629   1.00 18.81  ? 64  ALA B CB  1 
ATOM   4186  N  N   . ARG B  1 90  ? 73.100  18.687  20.356   1.00 19.11  ? 65  ARG B N   1 
ATOM   4187  C  CA  . ARG B  1 90  ? 72.902  19.854  21.239   1.00 20.74  ? 65  ARG B CA  1 
ATOM   4188  C  C   . ARG B  1 90  ? 74.207  20.621  21.500   1.00 20.50  ? 65  ARG B C   1 
ATOM   4189  O  O   . ARG B  1 90  ? 74.196  21.837  21.691   1.00 20.54  ? 65  ARG B O   1 
ATOM   4190  C  CB  . ARG B  1 90  ? 72.211  19.454  22.554   1.00 22.22  ? 65  ARG B CB  1 
ATOM   4191  C  CG  . ARG B  1 90  ? 70.702  19.471  22.425   1.00 23.68  ? 65  ARG B CG  1 
ATOM   4192  C  CD  . ARG B  1 90  ? 70.006  18.640  23.489   1.00 24.94  ? 65  ARG B CD  1 
ATOM   4193  N  NE  . ARG B  1 90  ? 68.693  18.252  22.982   1.00 25.59  ? 65  ARG B NE  1 
ATOM   4194  C  CZ  . ARG B  1 90  ? 68.057  17.129  23.296   1.00 26.31  ? 65  ARG B CZ  1 
ATOM   4195  N  NH1 . ARG B  1 90  ? 68.594  16.256  24.151   1.00 25.58  ? 65  ARG B NH1 1 
ATOM   4196  N  NH2 . ARG B  1 90  ? 66.880  16.875  22.740   1.00 26.43  ? 65  ARG B NH2 1 
ATOM   4197  N  N   . VAL B  1 91  ? 75.330  19.906  21.474   1.00 20.15  ? 66  VAL B N   1 
ATOM   4198  C  CA  . VAL B  1 91  ? 76.640  20.538  21.578   1.00 20.83  ? 66  VAL B CA  1 
ATOM   4199  C  C   . VAL B  1 91  ? 76.837  21.515  20.415   1.00 21.95  ? 66  VAL B C   1 
ATOM   4200  O  O   . VAL B  1 91  ? 77.261  22.658  20.623   1.00 23.29  ? 66  VAL B O   1 
ATOM   4201  C  CB  . VAL B  1 91  ? 77.784  19.495  21.653   1.00 21.77  ? 66  VAL B CB  1 
ATOM   4202  C  CG1 . VAL B  1 91  ? 79.146  20.167  21.470   1.00 21.69  ? 66  VAL B CG1 1 
ATOM   4203  C  CG2 . VAL B  1 91  ? 77.723  18.723  22.984   1.00 21.10  ? 66  VAL B CG2 1 
ATOM   4204  N  N   . PHE B  1 92  ? 76.485  21.093  19.199   1.00 20.68  ? 67  PHE B N   1 
ATOM   4205  C  CA  . PHE B  1 92  ? 76.656  21.962  18.034   1.00 20.32  ? 67  PHE B CA  1 
ATOM   4206  C  C   . PHE B  1 92  ? 75.694  23.147  18.040   1.00 20.94  ? 67  PHE B C   1 
ATOM   4207  O  O   . PHE B  1 92  ? 76.047  24.219  17.557   1.00 20.41  ? 67  PHE B O   1 
ATOM   4208  C  CB  . PHE B  1 92  ? 76.588  21.171  16.731   1.00 20.64  ? 67  PHE B CB  1 
ATOM   4209  C  CG  . PHE B  1 92  ? 77.819  20.345  16.469   1.00 21.03  ? 67  PHE B CG  1 
ATOM   4210  C  CD1 . PHE B  1 92  ? 78.958  20.928  15.946   1.00 21.07  ? 67  PHE B CD1 1 
ATOM   4211  C  CD2 . PHE B  1 92  ? 77.837  18.988  16.763   1.00 22.55  ? 67  PHE B CD2 1 
ATOM   4212  C  CE1 . PHE B  1 92  ? 80.096  20.176  15.704   1.00 22.06  ? 67  PHE B CE1 1 
ATOM   4213  C  CE2 . PHE B  1 92  ? 78.970  18.222  16.518   1.00 23.88  ? 67  PHE B CE2 1 
ATOM   4214  C  CZ  . PHE B  1 92  ? 80.106  18.817  15.989   1.00 22.80  ? 67  PHE B CZ  1 
HETATM 4215  N  N   . MSE B  1 93  ? 74.486  22.860  18.491   1.00 22.27  ? 68  MSE B N   1 
HETATM 4216  C  CA  A MSE B  1 93  ? 73.638  23.956  18.900   0.50 24.41  ? 68  MSE B CA  1 
HETATM 4217  C  CA  B MSE B  1 93  ? 73.640  23.959  18.902   0.50 23.27  ? 68  MSE B CA  1 
HETATM 4218  C  C   . MSE B  1 93  ? 74.035  25.214  19.761   1.00 23.66  ? 68  MSE B C   1 
HETATM 4219  O  O   . MSE B  1 93  ? 74.013  26.495  19.623   1.00 23.59  ? 68  MSE B O   1 
HETATM 4220  C  CB  A MSE B  1 93  ? 72.355  23.390  19.475   0.50 27.77  ? 68  MSE B CB  1 
HETATM 4221  C  CB  B MSE B  1 93  ? 72.364  23.406  19.505   0.50 23.99  ? 68  MSE B CB  1 
HETATM 4222  C  CG  A MSE B  1 93  ? 71.272  23.367  18.419   0.50 31.80  ? 68  MSE B CG  1 
HETATM 4223  C  CG  B MSE B  1 93  ? 71.368  23.058  18.421   0.50 24.79  ? 68  MSE B CG  1 
HETATM 4224  SE SE  A MSE B  1 93  ? 69.596  22.744  19.221   0.50 36.74  ? 68  MSE B SE  1 
HETATM 4225  SE SE  B MSE B  1 93  ? 69.694  22.469  19.248   0.50 27.20  ? 68  MSE B SE  1 
HETATM 4226  C  CE  A MSE B  1 93  ? 69.856  20.824  19.164   0.50 37.38  ? 68  MSE B CE  1 
HETATM 4227  C  CE  B MSE B  1 93  ? 69.024  24.293  19.211   0.50 28.04  ? 68  MSE B CE  1 
ATOM   4228  N  N   . LYS B  1 94  ? 74.731  24.660  20.759   1.00 24.74  ? 69  LYS B N   1 
ATOM   4229  C  CA  . LYS B  1 94  ? 75.346  25.606  21.685   1.00 26.07  ? 69  LYS B CA  1 
ATOM   4230  C  C   . LYS B  1 94  ? 76.549  26.302  21.017   1.00 23.27  ? 69  LYS B C   1 
ATOM   4231  O  O   . LYS B  1 94  ? 76.727  27.525  21.132   1.00 21.42  ? 69  LYS B O   1 
ATOM   4232  C  CB  . LYS B  1 94  ? 75.753  24.907  22.990   1.00 29.97  ? 69  LYS B CB  1 
ATOM   4233  C  CG  . LYS B  1 94  ? 76.015  25.855  24.161   1.00 38.52  ? 69  LYS B CG  1 
ATOM   4234  C  CD  . LYS B  1 94  ? 74.828  26.782  24.418   1.00 45.20  ? 69  LYS B CD  1 
ATOM   4235  C  CE  . LYS B  1 94  ? 75.267  28.143  24.934   1.00 53.80  ? 69  LYS B CE  1 
ATOM   4236  N  NZ  . LYS B  1 94  ? 75.540  28.110  26.402   1.00 59.43  ? 69  LYS B NZ  1 
ATOM   4237  N  N   . PHE B  1 95  ? 77.345  25.515  20.296   1.00 21.57  ? 70  PHE B N   1 
ATOM   4238  C  CA  . PHE B  1 95  ? 78.568  26.012  19.667   1.00 21.06  ? 70  PHE B CA  1 
ATOM   4239  C  C   . PHE B  1 95  ? 78.254  27.129  18.672   1.00 20.99  ? 70  PHE B C   1 
ATOM   4240  O  O   . PHE B  1 95  ? 78.959  28.140  18.634   1.00 21.48  ? 70  PHE B O   1 
ATOM   4241  C  CB  . PHE B  1 95  ? 79.330  24.862  18.982   1.00 20.39  ? 70  PHE B CB  1 
ATOM   4242  C  CG  . PHE B  1 95  ? 80.637  25.276  18.365   1.00 19.80  ? 70  PHE B CG  1 
ATOM   4243  C  CD1 . PHE B  1 95  ? 81.693  25.691  19.158   1.00 19.42  ? 70  PHE B CD1 1 
ATOM   4244  C  CD2 . PHE B  1 95  ? 80.812  25.224  16.980   1.00 19.97  ? 70  PHE B CD2 1 
ATOM   4245  C  CE1 . PHE B  1 95  ? 82.898  26.066  18.588   1.00 19.93  ? 70  PHE B CE1 1 
ATOM   4246  C  CE2 . PHE B  1 95  ? 82.020  25.587  16.404   1.00 20.37  ? 70  PHE B CE2 1 
ATOM   4247  C  CZ  . PHE B  1 95  ? 83.066  26.012  17.215   1.00 20.03  ? 70  PHE B CZ  1 
ATOM   4248  N  N   . VAL B  1 96  ? 77.174  26.952  17.909   1.00 20.52  ? 71  VAL B N   1 
ATOM   4249  C  CA  . VAL B  1 96  ? 76.706  27.949  16.940   1.00 21.10  ? 71  VAL B CA  1 
ATOM   4250  C  C   . VAL B  1 96  ? 76.384  29.291  17.608   1.00 22.31  ? 71  VAL B C   1 
ATOM   4251  O  O   . VAL B  1 96  ? 76.788  30.361  17.115   1.00 22.45  ? 71  VAL B O   1 
ATOM   4252  C  CB  . VAL B  1 96  ? 75.510  27.414  16.121   1.00 20.53  ? 71  VAL B CB  1 
ATOM   4253  C  CG1 . VAL B  1 96  ? 74.741  28.555  15.451   1.00 20.14  ? 71  VAL B CG1 1 
ATOM   4254  C  CG2 . VAL B  1 96  ? 75.991  26.376  15.104   1.00 19.25  ? 71  VAL B CG2 1 
ATOM   4255  N  N   . GLN B  1 97  ? 75.681  29.227  18.735   1.00 23.23  ? 72  GLN B N   1 
ATOM   4256  C  CA  . GLN B  1 97  ? 75.422  30.419  19.558   1.00 25.48  ? 72  GLN B CA  1 
ATOM   4257  C  C   . GLN B  1 97  ? 76.711  31.082  20.075   1.00 24.07  ? 72  GLN B C   1 
ATOM   4258  O  O   . GLN B  1 97  ? 76.843  32.316  20.093   1.00 23.16  ? 72  GLN B O   1 
ATOM   4259  C  CB  . GLN B  1 97  ? 74.518  30.061  20.740   1.00 28.57  ? 72  GLN B CB  1 
ATOM   4260  C  CG  . GLN B  1 97  ? 74.010  31.280  21.497   1.00 34.04  ? 72  GLN B CG  1 
ATOM   4261  C  CD  . GLN B  1 97  ? 73.399  32.329  20.577   1.00 39.28  ? 72  GLN B CD  1 
ATOM   4262  O  OE1 . GLN B  1 97  ? 72.490  32.033  19.792   1.00 43.27  ? 72  GLN B OE1 1 
ATOM   4263  N  NE2 . GLN B  1 97  ? 73.893  33.567  20.672   1.00 37.03  ? 72  GLN B NE2 1 
ATOM   4264  N  N   . LEU B  1 98  ? 77.650  30.250  20.513   1.00 23.95  ? 73  LEU B N   1 
ATOM   4265  C  CA  . LEU B  1 98  ? 78.945  30.742  20.984   1.00 23.69  ? 73  LEU B CA  1 
ATOM   4266  C  C   . LEU B  1 98  ? 79.751  31.421  19.859   1.00 23.44  ? 73  LEU B C   1 
ATOM   4267  O  O   . LEU B  1 98  ? 80.442  32.407  20.103   1.00 23.96  ? 73  LEU B O   1 
ATOM   4268  C  CB  . LEU B  1 98  ? 79.737  29.620  21.666   1.00 22.18  ? 73  LEU B CB  1 
ATOM   4269  C  CG  . LEU B  1 98  ? 79.199  29.143  23.023   1.00 21.59  ? 73  LEU B CG  1 
ATOM   4270  C  CD1 . LEU B  1 98  ? 80.013  27.959  23.524   1.00 21.62  ? 73  LEU B CD1 1 
ATOM   4271  C  CD2 . LEU B  1 98  ? 79.228  30.269  24.054   1.00 21.78  ? 73  LEU B CD2 1 
ATOM   4272  N  N   . LEU B  1 99  ? 79.628  30.911  18.631   1.00 22.93  ? 74  LEU B N   1 
ATOM   4273  C  CA  . LEU B  1 99  ? 80.288  31.521  17.470   1.00 23.37  ? 74  LEU B CA  1 
ATOM   4274  C  C   . LEU B  1 99  ? 79.724  32.918  17.200   1.00 24.75  ? 74  LEU B C   1 
ATOM   4275  O  O   . LEU B  1 99  ? 80.490  33.860  16.960   1.00 25.04  ? 74  LEU B O   1 
ATOM   4276  C  CB  . LEU B  1 99  ? 80.152  30.636  16.220   1.00 21.89  ? 74  LEU B CB  1 
ATOM   4277  C  CG  . LEU B  1 99  ? 80.867  29.264  16.225   1.00 22.45  ? 74  LEU B CG  1 
ATOM   4278  C  CD1 . LEU B  1 99  ? 80.666  28.552  14.882   1.00 22.42  ? 74  LEU B CD1 1 
ATOM   4279  C  CD2 . LEU B  1 99  ? 82.359  29.382  16.531   1.00 21.81  ? 74  LEU B CD2 1 
ATOM   4280  N  N   . ASN B  1 100 ? 78.394  33.046  17.258   1.00 24.74  ? 75  ASN B N   1 
ATOM   4281  C  CA  . ASN B  1 100 ? 77.732  34.339  17.117   1.00 27.26  ? 75  ASN B CA  1 
ATOM   4282  C  C   . ASN B  1 100 ? 78.189  35.315  18.188   1.00 27.88  ? 75  ASN B C   1 
ATOM   4283  O  O   . ASN B  1 100 ? 78.521  36.446  17.878   1.00 29.07  ? 75  ASN B O   1 
ATOM   4284  C  CB  . ASN B  1 100 ? 76.211  34.189  17.165   1.00 31.31  ? 75  ASN B CB  1 
ATOM   4285  C  CG  . ASN B  1 100 ? 75.665  33.384  15.995   1.00 37.96  ? 75  ASN B CG  1 
ATOM   4286  O  OD1 . ASN B  1 100 ? 75.955  33.674  14.835   1.00 39.46  ? 75  ASN B OD1 1 
ATOM   4287  N  ND2 . ASN B  1 100 ? 74.873  32.359  16.299   1.00 41.66  ? 75  ASN B ND2 1 
ATOM   4288  N  N   . ASP B  1 101 ? 78.226  34.867  19.441   1.00 27.54  ? 76  ASP B N   1 
ATOM   4289  C  CA  . ASP B  1 101 ? 78.589  35.736  20.564   1.00 29.61  ? 76  ASP B CA  1 
ATOM   4290  C  C   . ASP B  1 101 ? 80.030  36.205  20.500   1.00 30.04  ? 76  ASP B C   1 
ATOM   4291  O  O   . ASP B  1 101 ? 80.365  37.269  21.010   1.00 28.92  ? 76  ASP B O   1 
ATOM   4292  C  CB  . ASP B  1 101 ? 78.404  35.000  21.885   1.00 32.09  ? 76  ASP B CB  1 
ATOM   4293  C  CG  . ASP B  1 101 ? 76.967  34.635  22.155   1.00 34.76  ? 76  ASP B CG  1 
ATOM   4294  O  OD1 . ASP B  1 101 ? 76.061  35.244  21.534   1.00 33.37  ? 76  ASP B OD1 1 
ATOM   4295  O  OD2 . ASP B  1 101 ? 76.757  33.730  22.998   1.00 37.84  ? 76  ASP B OD2 1 
ATOM   4296  N  N   . ASN B  1 102 ? 80.880  35.382  19.894   1.00 30.23  ? 77  ASN B N   1 
ATOM   4297  C  CA  . ASN B  1 102 ? 82.306  35.657  19.818   1.00 30.64  ? 77  ASN B CA  1 
ATOM   4298  C  C   . ASN B  1 102 ? 82.763  36.108  18.435   1.00 28.93  ? 77  ASN B C   1 
ATOM   4299  O  O   . ASN B  1 102 ? 83.963  36.091  18.149   1.00 28.17  ? 77  ASN B O   1 
ATOM   4300  C  CB  . ASN B  1 102 ? 83.089  34.411  20.243   1.00 31.31  ? 77  ASN B CB  1 
ATOM   4301  C  CG  . ASN B  1 102 ? 83.029  34.178  21.727   1.00 32.78  ? 77  ASN B CG  1 
ATOM   4302  O  OD1 . ASN B  1 102 ? 83.884  34.663  22.452   1.00 37.89  ? 77  ASN B OD1 1 
ATOM   4303  N  ND2 . ASN B  1 102 ? 82.009  33.453  22.194   1.00 29.40  ? 77  ASN B ND2 1 
HETATM 4304  N  N   . MSE B  1 103 ? 81.809  36.521  17.597   1.00 28.59  ? 78  MSE B N   1 
HETATM 4305  C  CA  . MSE B  1 103 ? 82.057  36.814  16.179   1.00 29.53  ? 78  MSE B CA  1 
HETATM 4306  C  C   . MSE B  1 103 ? 83.112  37.889  16.003   1.00 29.98  ? 78  MSE B C   1 
HETATM 4307  O  O   . MSE B  1 103 ? 84.058  37.703  15.224   1.00 30.32  ? 78  MSE B O   1 
HETATM 4308  C  CB  . MSE B  1 103 ? 80.727  37.150  15.492   1.00 30.54  ? 78  MSE B CB  1 
HETATM 4309  C  CG  . MSE B  1 103 ? 80.817  37.449  13.992   1.00 33.97  ? 78  MSE B CG  1 
HETATM 4310  SE SE  . MSE B  1 103 ? 81.378  35.867  12.925   1.00 37.05  ? 78  MSE B SE  1 
HETATM 4311  C  CE  . MSE B  1 103 ? 79.843  34.673  13.310   1.00 36.68  ? 78  MSE B CE  1 
ATOM   4312  N  N   . ASN B  1 104 ? 82.979  39.000  16.729   1.00 29.00  ? 79  ASN B N   1 
ATOM   4313  C  CA  . ASN B  1 104 ? 83.946  40.104  16.637   1.00 30.51  ? 79  ASN B CA  1 
ATOM   4314  C  C   . ASN B  1 104 ? 85.367  39.705  16.989   1.00 30.03  ? 79  ASN B C   1 
ATOM   4315  O  O   . ASN B  1 104 ? 86.288  39.999  16.239   1.00 31.23  ? 79  ASN B O   1 
ATOM   4316  C  CB  . ASN B  1 104 ? 83.519  41.303  17.492   1.00 29.94  ? 79  ASN B CB  1 
ATOM   4317  C  CG  . ASN B  1 104 ? 82.257  41.967  16.977   1.00 32.69  ? 79  ASN B CG  1 
ATOM   4318  O  OD1 . ASN B  1 104 ? 81.574  42.670  17.718   1.00 37.25  ? 79  ASN B OD1 1 
ATOM   4319  N  ND2 . ASN B  1 104 ? 81.943  41.756  15.708   1.00 31.33  ? 79  ASN B ND2 1 
ATOM   4320  N  N   . GLU B  1 105 ? 85.520  39.023  18.120   1.00 29.65  ? 80  GLU B N   1 
ATOM   4321  C  CA  . GLU B  1 105 ? 86.815  38.568  18.612   1.00 31.71  ? 80  GLU B CA  1 
ATOM   4322  C  C   . GLU B  1 105 ? 87.471  37.608  17.618   1.00 28.49  ? 80  GLU B C   1 
ATOM   4323  O  O   . GLU B  1 105 ? 88.668  37.719  17.346   1.00 29.33  ? 80  GLU B O   1 
ATOM   4324  C  CB  . GLU B  1 105 ? 86.639  37.897  19.982   1.00 39.74  ? 80  GLU B CB  1 
ATOM   4325  C  CG  . GLU B  1 105 ? 87.923  37.477  20.694   1.00 50.02  ? 80  GLU B CG  1 
ATOM   4326  C  CD  . GLU B  1 105 ? 87.728  36.309  21.667   1.00 57.49  ? 80  GLU B CD  1 
ATOM   4327  O  OE1 . GLU B  1 105 ? 88.254  36.398  22.798   1.00 58.58  ? 80  GLU B OE1 1 
ATOM   4328  O  OE2 . GLU B  1 105 ? 87.064  35.297  21.309   1.00 56.39  ? 80  GLU B OE2 1 
ATOM   4329  N  N   . LEU B  1 106 ? 86.677  36.673  17.088   1.00 24.51  ? 81  LEU B N   1 
ATOM   4330  C  CA  . LEU B  1 106 ? 87.153  35.656  16.142   1.00 23.36  ? 81  LEU B CA  1 
ATOM   4331  C  C   . LEU B  1 106 ? 87.622  36.295  14.839   1.00 21.76  ? 81  LEU B C   1 
ATOM   4332  O  O   . LEU B  1 106 ? 88.714  35.988  14.369   1.00 21.51  ? 81  LEU B O   1 
ATOM   4333  C  CB  . LEU B  1 106 ? 86.070  34.587  15.851   1.00 22.63  ? 81  LEU B CB  1 
ATOM   4334  C  CG  . LEU B  1 106 ? 85.890  33.455  16.872   1.00 23.27  ? 81  LEU B CG  1 
ATOM   4335  C  CD1 . LEU B  1 106 ? 84.616  32.669  16.579   1.00 22.55  ? 81  LEU B CD1 1 
ATOM   4336  C  CD2 . LEU B  1 106 ? 87.109  32.528  16.933   1.00 23.54  ? 81  LEU B CD2 1 
ATOM   4337  N  N   . ALA B  1 107 ? 86.797  37.189  14.285   1.00 21.13  ? 82  ALA B N   1 
ATOM   4338  C  CA  . ALA B  1 107 ? 87.155  37.980  13.099   1.00 22.26  ? 82  ALA B CA  1 
ATOM   4339  C  C   . ALA B  1 107 ? 88.446  38.774  13.289   1.00 22.81  ? 82  ALA B C   1 
ATOM   4340  O  O   . ALA B  1 107 ? 89.276  38.821  12.383   1.00 23.46  ? 82  ALA B O   1 
ATOM   4341  C  CB  . ALA B  1 107 ? 86.014  38.910  12.700   1.00 22.46  ? 82  ALA B CB  1 
ATOM   4342  N  N   . GLU B  1 108 ? 88.616  39.385  14.460   1.00 23.54  ? 83  GLU B N   1 
ATOM   4343  C  CA  . GLU B  1 108 ? 89.789  40.226  14.724   1.00 24.96  ? 83  GLU B CA  1 
ATOM   4344  C  C   . GLU B  1 108 ? 91.084  39.405  14.657   1.00 24.50  ? 83  GLU B C   1 
ATOM   4345  O  O   . GLU B  1 108 ? 92.050  39.815  14.002   1.00 23.62  ? 83  GLU B O   1 
ATOM   4346  C  CB  . GLU B  1 108 ? 89.663  40.945  16.083   1.00 26.63  ? 83  GLU B CB  1 
ATOM   4347  C  CG  . GLU B  1 108 ? 90.675  42.070  16.327   1.00 29.66  ? 83  GLU B CG  1 
ATOM   4348  C  CD  . GLU B  1 108 ? 92.020  41.586  16.884   1.00 33.41  ? 83  GLU B CD  1 
ATOM   4349  O  OE1 . GLU B  1 108 ? 92.094  40.459  17.420   1.00 34.49  ? 83  GLU B OE1 1 
ATOM   4350  O  OE2 . GLU B  1 108 ? 93.019  42.338  16.802   1.00 36.30  ? 83  GLU B OE2 1 
HETATM 4351  N  N   . MSE B  1 109 ? 91.103  38.250  15.327   1.00 24.31  ? 84  MSE B N   1 
HETATM 4352  C  CA  . MSE B  1 109 ? 92.332  37.440  15.402   1.00 25.13  ? 84  MSE B CA  1 
HETATM 4353  C  C   . MSE B  1 109 ? 92.619  36.789  14.068   1.00 24.01  ? 84  MSE B C   1 
HETATM 4354  O  O   . MSE B  1 109 ? 93.791  36.610  13.694   1.00 24.83  ? 84  MSE B O   1 
HETATM 4355  C  CB  . MSE B  1 109 ? 92.327  36.436  16.557   1.00 26.64  ? 84  MSE B CB  1 
HETATM 4356  C  CG  . MSE B  1 109 ? 91.355  35.279  16.329   1.00 28.70  ? 84  MSE B CG  1 
HETATM 4357  SE SE  . MSE B  1 109 ? 91.191  34.130  17.925   1.00 32.56  ? 84  MSE B SE  1 
HETATM 4358  C  CE  . MSE B  1 109 ? 90.573  35.437  19.265   1.00 31.39  ? 84  MSE B CE  1 
ATOM   4359  N  N   . LEU B  1 110 ? 91.557  36.451  13.339   1.00 22.53  ? 85  LEU B N   1 
ATOM   4360  C  CA  . LEU B  1 110 ? 91.685  35.899  11.993   1.00 23.15  ? 85  LEU B CA  1 
ATOM   4361  C  C   . LEU B  1 110 ? 92.368  36.928  11.068   1.00 23.67  ? 85  LEU B C   1 
ATOM   4362  O  O   . LEU B  1 110 ? 93.452  36.675  10.527   1.00 23.32  ? 85  LEU B O   1 
ATOM   4363  C  CB  . LEU B  1 110 ? 90.307  35.471  11.453   1.00 21.86  ? 85  LEU B CB  1 
ATOM   4364  C  CG  . LEU B  1 110 ? 90.291  34.307  10.447   1.00 21.71  ? 85  LEU B CG  1 
ATOM   4365  C  CD1 . LEU B  1 110 ? 88.895  33.689  10.311   1.00 21.17  ? 85  LEU B CD1 1 
ATOM   4366  C  CD2 . LEU B  1 110 ? 90.845  34.742  9.089    1.00 20.55  ? 85  LEU B CD2 1 
ATOM   4367  N  N   . SER B  1 111 ? 91.747  38.097  10.934   1.00 24.03  ? 86  SER B N   1 
ATOM   4368  C  CA  . SER B  1 111 ? 92.262  39.176  10.079   1.00 24.76  ? 86  SER B CA  1 
ATOM   4369  C  C   . SER B  1 111 ? 93.693  39.598  10.418   1.00 23.68  ? 86  SER B C   1 
ATOM   4370  O  O   . SER B  1 111 ? 94.516  39.858  9.510    1.00 22.20  ? 86  SER B O   1 
ATOM   4371  C  CB  . SER B  1 111 ? 91.327  40.388  10.161   1.00 25.67  ? 86  SER B CB  1 
ATOM   4372  O  OG  . SER B  1 111 ? 90.072  40.075  9.574    1.00 26.30  ? 86  SER B OG  1 
ATOM   4373  N  N   . ARG B  1 112 ? 93.989  39.655  11.719   1.00 23.46  ? 87  ARG B N   1 
ATOM   4374  C  CA  . ARG B  1 112 ? 95.282  40.140  12.185   1.00 24.28  ? 87  ARG B CA  1 
ATOM   4375  C  C   . ARG B  1 112 ? 96.424  39.257  11.683   1.00 24.70  ? 87  ARG B C   1 
ATOM   4376  O  O   . ARG B  1 112 ? 97.505  39.761  11.358   1.00 26.68  ? 87  ARG B O   1 
ATOM   4377  C  CB  . ARG B  1 112 ? 95.308  40.303  13.718   1.00 25.23  ? 87  ARG B CB  1 
ATOM   4378  C  CG  . ARG B  1 112 ? 96.556  41.009  14.256   1.00 27.08  ? 87  ARG B CG  1 
ATOM   4379  C  CD  . ARG B  1 112 ? 96.486  41.408  15.732   1.00 28.48  ? 87  ARG B CD  1 
ATOM   4380  N  NE  . ARG B  1 112 ? 95.541  40.586  16.489   1.00 30.35  ? 87  ARG B NE  1 
ATOM   4381  C  CZ  . ARG B  1 112 ? 95.792  39.375  16.987   1.00 30.40  ? 87  ARG B CZ  1 
ATOM   4382  N  NH1 . ARG B  1 112 ? 96.985  38.810  16.838   1.00 30.36  ? 87  ARG B NH1 1 
ATOM   4383  N  NH2 . ARG B  1 112 ? 94.830  38.727  17.636   1.00 29.70  ? 87  ARG B NH2 1 
ATOM   4384  N  N   . GLU B  1 113 ? 96.167  37.954  11.602   1.00 23.23  ? 88  GLU B N   1 
ATOM   4385  C  CA  . GLU B  1 113 ? 97.161  36.963  11.163   1.00 22.91  ? 88  GLU B CA  1 
ATOM   4386  C  C   . GLU B  1 113 ? 97.104  36.689  9.649    1.00 22.73  ? 88  GLU B C   1 
ATOM   4387  O  O   . GLU B  1 113 ? 98.140  36.486  9.017    1.00 21.64  ? 88  GLU B O   1 
ATOM   4388  C  CB  . GLU B  1 113 ? 96.976  35.639  11.927   1.00 21.97  ? 88  GLU B CB  1 
ATOM   4389  C  CG  . GLU B  1 113 ? 97.258  35.730  13.429   1.00 21.38  ? 88  GLU B CG  1 
ATOM   4390  C  CD  . GLU B  1 113 ? 97.094  34.402  14.172   1.00 21.25  ? 88  GLU B CD  1 
ATOM   4391  O  OE1 . GLU B  1 113 ? 96.316  33.526  13.743   1.00 20.55  ? 88  GLU B OE1 1 
ATOM   4392  O  OE2 . GLU B  1 113 ? 97.739  34.237  15.222   1.00 21.99  ? 88  GLU B OE2 1 
ATOM   4393  N  N   . HIS B  1 114 ? 95.893  36.687  9.088    1.00 22.81  ? 89  HIS B N   1 
ATOM   4394  C  CA  . HIS B  1 114 ? 95.672  36.336  7.675    1.00 23.31  ? 89  HIS B CA  1 
ATOM   4395  C  C   . HIS B  1 114 ? 95.953  37.525  6.750    1.00 23.01  ? 89  HIS B C   1 
ATOM   4396  O  O   . HIS B  1 114 ? 96.666  37.392  5.734    1.00 22.61  ? 89  HIS B O   1 
ATOM   4397  C  CB  . HIS B  1 114 ? 94.237  35.831  7.458    1.00 22.99  ? 89  HIS B CB  1 
ATOM   4398  C  CG  . HIS B  1 114 ? 93.951  35.389  6.053    1.00 24.02  ? 89  HIS B CG  1 
ATOM   4399  N  ND1 . HIS B  1 114 ? 93.919  36.262  4.985    1.00 24.17  ? 89  HIS B ND1 1 
ATOM   4400  C  CD2 . HIS B  1 114 ? 93.666  34.164  5.545    1.00 24.04  ? 89  HIS B CD2 1 
ATOM   4401  C  CE1 . HIS B  1 114 ? 93.645  35.592  3.880    1.00 24.29  ? 89  HIS B CE1 1 
ATOM   4402  N  NE2 . HIS B  1 114 ? 93.479  34.318  4.194    1.00 24.16  ? 89  HIS B NE2 1 
ATOM   4403  N  N   . GLY B  1 115 ? 95.378  38.676  7.110    1.00 22.18  ? 90  GLY B N   1 
ATOM   4404  C  CA  . GLY B  1 115 ? 95.471  39.888  6.310    1.00 22.29  ? 90  GLY B CA  1 
ATOM   4405  C  C   . GLY B  1 115 ? 94.122  40.363  5.814    1.00 22.81  ? 90  GLY B C   1 
ATOM   4406  O  O   . GLY B  1 115 ? 93.929  41.563  5.630    1.00 22.91  ? 90  GLY B O   1 
ATOM   4407  N  N   . LYS B  1 116 ? 93.185  39.427  5.609    1.00 22.79  ? 91  LYS B N   1 
ATOM   4408  C  CA  . LYS B  1 116 ? 91.913  39.739  4.940    1.00 22.69  ? 91  LYS B CA  1 
ATOM   4409  C  C   . LYS B  1 116 ? 91.029  40.642  5.786    1.00 23.13  ? 91  LYS B C   1 
ATOM   4410  O  O   . LYS B  1 116 ? 91.232  40.748  6.998    1.00 24.14  ? 91  LYS B O   1 
ATOM   4411  C  CB  . LYS B  1 116 ? 91.186  38.466  4.492    1.00 23.45  ? 91  LYS B CB  1 
ATOM   4412  C  CG  . LYS B  1 116 ? 90.628  37.543  5.577    1.00 24.91  ? 91  LYS B CG  1 
ATOM   4413  C  CD  . LYS B  1 116 ? 90.037  36.309  4.867    1.00 26.91  ? 91  LYS B CD  1 
ATOM   4414  C  CE  . LYS B  1 116 ? 89.692  35.142  5.773    1.00 25.22  ? 91  LYS B CE  1 
ATOM   4415  N  NZ  . LYS B  1 116 ? 89.319  33.911  5.009    1.00 24.14  ? 91  LYS B NZ  1 
ATOM   4416  N  N   . THR B  1 117 ? 90.074  41.317  5.151    1.00 22.99  ? 92  THR B N   1 
ATOM   4417  C  CA  . THR B  1 117 ? 89.227  42.302  5.850    1.00 23.12  ? 92  THR B CA  1 
ATOM   4418  C  C   . THR B  1 117 ? 88.372  41.623  6.920    1.00 23.13  ? 92  THR B C   1 
ATOM   4419  O  O   . THR B  1 117 ? 88.119  40.425  6.838    1.00 23.54  ? 92  THR B O   1 
ATOM   4420  C  CB  . THR B  1 117 ? 88.278  43.033  4.882    1.00 23.30  ? 92  THR B CB  1 
ATOM   4421  O  OG1 . THR B  1 117 ? 87.210  42.150  4.507    1.00 23.12  ? 92  THR B OG1 1 
ATOM   4422  C  CG2 . THR B  1 117 ? 89.016  43.515  3.636    1.00 22.55  ? 92  THR B CG2 1 
ATOM   4423  N  N   . ILE B  1 118 ? 87.950  42.390  7.926    1.00 22.98  ? 93  ILE B N   1 
ATOM   4424  C  CA  . ILE B  1 118 ? 87.070  41.903  8.984    1.00 23.18  ? 93  ILE B CA  1 
ATOM   4425  C  C   . ILE B  1 118 ? 85.787  41.270  8.409    1.00 23.78  ? 93  ILE B C   1 
ATOM   4426  O  O   . ILE B  1 118 ? 85.357  40.200  8.847    1.00 22.80  ? 93  ILE B O   1 
ATOM   4427  C  CB  . ILE B  1 118 ? 86.748  43.031  9.989    1.00 22.91  ? 93  ILE B CB  1 
ATOM   4428  C  CG1 . ILE B  1 118 ? 87.959  43.312  10.897   1.00 23.17  ? 93  ILE B CG1 1 
ATOM   4429  C  CG2 . ILE B  1 118 ? 85.502  42.713  10.806   1.00 22.63  ? 93  ILE B CG2 1 
ATOM   4430  C  CD1 . ILE B  1 118 ? 88.389  42.156  11.790   1.00 23.02  ? 93  ILE B CD1 1 
ATOM   4431  N  N   . ASP B  1 119 ? 85.218  41.920  7.399    1.00 25.18  ? 94  ASP B N   1 
ATOM   4432  C  CA  . ASP B  1 119 ? 84.069  41.395  6.680    1.00 27.44  ? 94  ASP B CA  1 
ATOM   4433  C  C   . ASP B  1 119 ? 84.332  40.005  6.066    1.00 26.70  ? 94  ASP B C   1 
ATOM   4434  O  O   . ASP B  1 119 ? 83.491  39.106  6.186    1.00 26.11  ? 94  ASP B O   1 
ATOM   4435  C  CB  . ASP B  1 119 ? 83.646  42.382  5.595    1.00 30.07  ? 94  ASP B CB  1 
ATOM   4436  C  CG  . ASP B  1 119 ? 82.249  42.122  5.101    1.00 34.96  ? 94  ASP B CG  1 
ATOM   4437  O  OD1 . ASP B  1 119 ? 81.322  42.221  5.935    1.00 37.93  ? 94  ASP B OD1 1 
ATOM   4438  O  OD2 . ASP B  1 119 ? 82.077  41.817  3.894    1.00 35.14  ? 94  ASP B OD2 1 
ATOM   4439  N  N   . ASP B  1 120 ? 85.478  39.847  5.397    1.00 26.62  ? 95  ASP B N   1 
ATOM   4440  C  CA  . ASP B  1 120 ? 85.934  38.547  4.883    1.00 27.69  ? 95  ASP B CA  1 
ATOM   4441  C  C   . ASP B  1 120 ? 86.092  37.532  6.035    1.00 25.52  ? 95  ASP B C   1 
ATOM   4442  O  O   . ASP B  1 120 ? 85.673  36.400  5.914    1.00 24.15  ? 95  ASP B O   1 
ATOM   4443  C  CB  . ASP B  1 120 ? 87.291  38.654  4.170    1.00 33.72  ? 95  ASP B CB  1 
ATOM   4444  C  CG  . ASP B  1 120 ? 87.260  39.513  2.902    1.00 44.38  ? 95  ASP B CG  1 
ATOM   4445  O  OD1 . ASP B  1 120 ? 86.201  39.594  2.233    1.00 46.73  ? 95  ASP B OD1 1 
ATOM   4446  O  OD2 . ASP B  1 120 ? 88.334  40.099  2.570    1.00 46.42  ? 95  ASP B OD2 1 
ATOM   4447  N  N   . ALA B  1 121 ? 86.707  37.945  7.143    1.00 24.44  ? 96  ALA B N   1 
ATOM   4448  C  CA  . ALA B  1 121 ? 86.906  37.038  8.280    1.00 23.53  ? 96  ALA B CA  1 
ATOM   4449  C  C   . ALA B  1 121 ? 85.574  36.573  8.877    1.00 23.06  ? 96  ALA B C   1 
ATOM   4450  O  O   . ALA B  1 121 ? 85.446  35.401  9.243    1.00 22.63  ? 96  ALA B O   1 
ATOM   4451  C  CB  . ALA B  1 121 ? 87.804  37.652  9.348    1.00 23.19  ? 96  ALA B CB  1 
ATOM   4452  N  N   . LYS B  1 122 ? 84.581  37.465  8.951    1.00 23.23  ? 97  LYS B N   1 
ATOM   4453  C  CA  . LYS B  1 122 ? 83.220  37.050  9.358    1.00 23.23  ? 97  LYS B CA  1 
ATOM   4454  C  C   . LYS B  1 122 ? 82.605  36.023  8.393    1.00 22.55  ? 97  LYS B C   1 
ATOM   4455  O  O   . LYS B  1 122 ? 82.121  34.960  8.828    1.00 22.97  ? 97  LYS B O   1 
ATOM   4456  C  CB  . LYS B  1 122 ? 82.303  38.257  9.567    1.00 23.88  ? 97  LYS B CB  1 
ATOM   4457  C  CG  . LYS B  1 122 ? 82.658  39.010  10.830   1.00 25.39  ? 97  LYS B CG  1 
ATOM   4458  C  CD  . LYS B  1 122 ? 81.862  40.286  11.018   1.00 27.67  ? 97  LYS B CD  1 
ATOM   4459  C  CE  . LYS B  1 122 ? 82.506  41.091  12.140   1.00 31.16  ? 97  LYS B CE  1 
ATOM   4460  N  NZ  . LYS B  1 122 ? 81.618  42.141  12.696   1.00 33.56  ? 97  LYS B NZ  1 
ATOM   4461  N  N   . GLY B  1 123 ? 82.665  36.315  7.095    1.00 21.56  ? 98  GLY B N   1 
ATOM   4462  C  CA  . GLY B  1 123 ? 82.275  35.342  6.080    1.00 21.28  ? 98  GLY B CA  1 
ATOM   4463  C  C   . GLY B  1 123 ? 82.933  33.976  6.295    1.00 21.84  ? 98  GLY B C   1 
ATOM   4464  O  O   . GLY B  1 123 ? 82.254  32.953  6.249    1.00 21.11  ? 98  GLY B O   1 
ATOM   4465  N  N   . ASP B  1 124 ? 84.256  33.970  6.514    1.00 22.85  ? 99  ASP B N   1 
ATOM   4466  C  CA  . ASP B  1 124 ? 85.066  32.752  6.790    1.00 22.79  ? 99  ASP B CA  1 
ATOM   4467  C  C   . ASP B  1 124 ? 84.406  31.981  7.945    1.00 22.68  ? 99  ASP B C   1 
ATOM   4468  O  O   . ASP B  1 124 ? 84.030  30.821  7.783    1.00 22.08  ? 99  ASP B O   1 
ATOM   4469  C  CB  . ASP B  1 124 ? 86.535  33.172  7.096    1.00 23.40  ? 99  ASP B CB  1 
ATOM   4470  C  CG  . ASP B  1 124 ? 87.512  31.980  7.382    1.00 23.85  ? 99  ASP B CG  1 
ATOM   4471  O  OD1 . ASP B  1 124 ? 87.102  30.895  7.867    1.00 22.84  ? 99  ASP B OD1 1 
ATOM   4472  O  OD2 . ASP B  1 124 ? 88.737  32.168  7.139    1.00 23.23  ? 99  ASP B OD2 1 
ATOM   4473  N  N   . ILE B  1 125 ? 84.224  32.643  9.089    1.00 23.36  ? 100 ILE B N   1 
ATOM   4474  C  CA  . ILE B  1 125 ? 83.572  32.019  10.264   1.00 22.86  ? 100 ILE B CA  1 
ATOM   4475  C  C   . ILE B  1 125 ? 82.140  31.526  9.981    1.00 22.79  ? 100 ILE B C   1 
ATOM   4476  O  O   . ILE B  1 125 ? 81.776  30.393  10.341   1.00 23.43  ? 100 ILE B O   1 
ATOM   4477  C  CB  . ILE B  1 125 ? 83.532  32.983  11.479   1.00 22.83  ? 100 ILE B CB  1 
ATOM   4478  C  CG1 . ILE B  1 125 ? 84.934  33.496  11.844   1.00 23.60  ? 100 ILE B CG1 1 
ATOM   4479  C  CG2 . ILE B  1 125 ? 82.863  32.324  12.688   1.00 23.18  ? 100 ILE B CG2 1 
ATOM   4480  C  CD1 . ILE B  1 125 ? 85.926  32.410  12.215   1.00 24.45  ? 100 ILE B CD1 1 
ATOM   4481  N  N   . VAL B  1 126 ? 81.323  32.376  9.358    1.00 21.67  ? 101 VAL B N   1 
ATOM   4482  C  CA  . VAL B  1 126 ? 79.910  32.043  9.148    1.00 21.32  ? 101 VAL B CA  1 
ATOM   4483  C  C   . VAL B  1 126 ? 79.730  30.781  8.282    1.00 20.84  ? 101 VAL B C   1 
ATOM   4484  O  O   . VAL B  1 126 ? 78.864  29.948  8.555    1.00 21.48  ? 101 VAL B O   1 
ATOM   4485  C  CB  . VAL B  1 126 ? 79.094  33.255  8.617    1.00 20.02  ? 101 VAL B CB  1 
ATOM   4486  C  CG1 . VAL B  1 126 ? 77.690  32.831  8.188    1.00 18.16  ? 101 VAL B CG1 1 
ATOM   4487  C  CG2 . VAL B  1 126 ? 79.019  34.329  9.701    1.00 19.75  ? 101 VAL B CG2 1 
ATOM   4488  N  N   . ARG B  1 127 ? 80.555  30.633  7.261    1.00 21.15  ? 102 ARG B N   1 
ATOM   4489  C  CA  . ARG B  1 127 ? 80.477  29.448  6.409    1.00 23.42  ? 102 ARG B CA  1 
ATOM   4490  C  C   . ARG B  1 127 ? 80.878  28.173  7.173    1.00 22.03  ? 102 ARG B C   1 
ATOM   4491  O  O   . ARG B  1 127 ? 80.379  27.088  6.884    1.00 21.98  ? 102 ARG B O   1 
ATOM   4492  C  CB  . ARG B  1 127 ? 81.285  29.628  5.115    1.00 27.36  ? 102 ARG B CB  1 
ATOM   4493  C  CG  . ARG B  1 127 ? 80.919  30.877  4.331    1.00 32.99  ? 102 ARG B CG  1 
ATOM   4494  C  CD  . ARG B  1 127 ? 80.545  30.568  2.899    1.00 45.32  ? 102 ARG B CD  1 
ATOM   4495  N  NE  . ARG B  1 127 ? 81.611  29.905  2.143    1.00 59.08  ? 102 ARG B NE  1 
ATOM   4496  C  CZ  . ARG B  1 127 ? 82.539  30.534  1.419    1.00 67.19  ? 102 ARG B CZ  1 
ATOM   4497  N  NH1 . ARG B  1 127 ? 83.459  29.826  0.765    1.00 64.66  ? 102 ARG B NH1 1 
ATOM   4498  N  NH2 . ARG B  1 127 ? 82.558  31.863  1.349    1.00 70.65  ? 102 ARG B NH2 1 
ATOM   4499  N  N   . GLY B  1 128 ? 81.763  28.315  8.157    1.00 21.33  ? 103 GLY B N   1 
ATOM   4500  C  CA  . GLY B  1 128 ? 82.046  27.219  9.099    1.00 21.57  ? 103 GLY B CA  1 
ATOM   4501  C  C   . GLY B  1 128 ? 80.829  26.965  9.972    1.00 19.98  ? 103 GLY B C   1 
ATOM   4502  O  O   . GLY B  1 128 ? 80.424  25.828  10.203   1.00 19.65  ? 103 GLY B O   1 
ATOM   4503  N  N   . LEU B  1 129 ? 80.221  28.045  10.431   1.00 19.29  ? 104 LEU B N   1 
ATOM   4504  C  CA  . LEU B  1 129 ? 79.077  27.965  11.299   1.00 18.32  ? 104 LEU B CA  1 
ATOM   4505  C  C   . LEU B  1 129 ? 77.949  27.148  10.639   1.00 18.52  ? 104 LEU B C   1 
ATOM   4506  O  O   . LEU B  1 129 ? 77.258  26.366  11.300   1.00 19.32  ? 104 LEU B O   1 
ATOM   4507  C  CB  . LEU B  1 129 ? 78.629  29.381  11.653   1.00 17.09  ? 104 LEU B CB  1 
ATOM   4508  C  CG  . LEU B  1 129 ? 77.400  29.576  12.523   1.00 16.59  ? 104 LEU B CG  1 
ATOM   4509  C  CD1 . LEU B  1 129 ? 77.538  30.877  13.301   1.00 16.60  ? 104 LEU B CD1 1 
ATOM   4510  C  CD2 . LEU B  1 129 ? 76.153  29.589  11.649   1.00 16.05  ? 104 LEU B CD2 1 
ATOM   4511  N  N   . GLU B  1 130 ? 77.787  27.315  9.336    1.00 18.09  ? 105 GLU B N   1 
ATOM   4512  C  CA  . GLU B  1 130 ? 76.705  26.654  8.624    1.00 17.90  ? 105 GLU B CA  1 
ATOM   4513  C  C   . GLU B  1 130 ? 76.885  25.132  8.505    1.00 17.81  ? 105 GLU B C   1 
ATOM   4514  O  O   . GLU B  1 130 ? 75.884  24.407  8.406    1.00 18.16  ? 105 GLU B O   1 
ATOM   4515  C  CB  . GLU B  1 130 ? 76.461  27.321  7.269    1.00 18.49  ? 105 GLU B CB  1 
ATOM   4516  C  CG  . GLU B  1 130 ? 75.850  28.716  7.405    1.00 20.08  ? 105 GLU B CG  1 
ATOM   4517  C  CD  . GLU B  1 130 ? 75.688  29.468  6.082    1.00 22.57  ? 105 GLU B CD  1 
ATOM   4518  O  OE1 . GLU B  1 130 ? 76.045  28.935  5.004    1.00 24.21  ? 105 GLU B OE1 1 
ATOM   4519  O  OE2 . GLU B  1 130 ? 75.179  30.610  6.116    1.00 23.55  ? 105 GLU B OE2 1 
ATOM   4520  N  N   . VAL B  1 131 ? 78.132  24.646  8.530    1.00 16.47  ? 106 VAL B N   1 
ATOM   4521  C  CA  . VAL B  1 131 ? 78.366  23.194  8.653    1.00 16.22  ? 106 VAL B CA  1 
ATOM   4522  C  C   . VAL B  1 131 ? 77.940  22.693  10.039   1.00 17.22  ? 106 VAL B C   1 
ATOM   4523  O  O   . VAL B  1 131 ? 77.294  21.641  10.161   1.00 17.48  ? 106 VAL B O   1 
ATOM   4524  C  CB  . VAL B  1 131 ? 79.828  22.786  8.368    1.00 15.78  ? 106 VAL B CB  1 
ATOM   4525  C  CG1 . VAL B  1 131 ? 79.981  21.256  8.397    1.00 15.12  ? 106 VAL B CG1 1 
ATOM   4526  C  CG2 . VAL B  1 131 ? 80.270  23.328  7.018    1.00 16.00  ? 106 VAL B CG2 1 
ATOM   4527  N  N   . CYS B  1 132 ? 78.302  23.450  11.075   1.00 17.91  ? 107 CYS B N   1 
ATOM   4528  C  CA  . CYS B  1 132 ? 77.807  23.196  12.433   1.00 19.07  ? 107 CYS B CA  1 
ATOM   4529  C  C   . CYS B  1 132 ? 76.272  23.129  12.502   1.00 19.55  ? 107 CYS B C   1 
ATOM   4530  O  O   . CYS B  1 132 ? 75.748  22.251  13.169   1.00 20.23  ? 107 CYS B O   1 
ATOM   4531  C  CB  . CYS B  1 132 ? 78.384  24.211  13.426   1.00 19.20  ? 107 CYS B CB  1 
ATOM   4532  S  SG  . CYS B  1 132 ? 80.198  24.124  13.537   1.00 21.28  ? 107 CYS B SG  1 
ATOM   4533  N  N   . GLU B  1 133 ? 75.559  24.015  11.792   1.00 19.30  ? 108 GLU B N   1 
ATOM   4534  C  CA  . GLU B  1 133 ? 74.082  23.943  11.715   1.00 18.50  ? 108 GLU B CA  1 
ATOM   4535  C  C   . GLU B  1 133 ? 73.632  22.669  11.004   1.00 18.73  ? 108 GLU B C   1 
ATOM   4536  O  O   . GLU B  1 133 ? 72.711  21.996  11.453   1.00 20.49  ? 108 GLU B O   1 
ATOM   4537  C  CB  . GLU B  1 133 ? 73.464  25.163  11.003   1.00 18.70  ? 108 GLU B CB  1 
ATOM   4538  C  CG  . GLU B  1 133 ? 73.619  26.493  11.735   1.00 20.84  ? 108 GLU B CG  1 
ATOM   4539  C  CD  . GLU B  1 133 ? 73.161  27.703  10.908   1.00 23.48  ? 108 GLU B CD  1 
ATOM   4540  O  OE1 . GLU B  1 133 ? 73.279  27.699  9.650    1.00 25.79  ? 108 GLU B OE1 1 
ATOM   4541  O  OE2 . GLU B  1 133 ? 72.695  28.684  11.524   1.00 22.88  ? 108 GLU B OE2 1 
ATOM   4542  N  N   . PHE B  1 134 ? 74.289  22.336  9.902    1.00 17.81  ? 109 PHE B N   1 
ATOM   4543  C  CA  . PHE B  1 134 ? 73.943  21.139  9.130    1.00 17.35  ? 109 PHE B CA  1 
ATOM   4544  C  C   . PHE B  1 134 ? 74.000  19.869  10.007   1.00 18.47  ? 109 PHE B C   1 
ATOM   4545  O  O   . PHE B  1 134 ? 73.070  19.045  9.970    1.00 19.24  ? 109 PHE B O   1 
ATOM   4546  C  CB  . PHE B  1 134 ? 74.827  21.033  7.876    1.00 15.47  ? 109 PHE B CB  1 
ATOM   4547  C  CG  . PHE B  1 134 ? 74.727  19.713  7.154    1.00 14.63  ? 109 PHE B CG  1 
ATOM   4548  C  CD1 . PHE B  1 134 ? 73.560  19.338  6.500    1.00 13.57  ? 109 PHE B CD1 1 
ATOM   4549  C  CD2 . PHE B  1 134 ? 75.825  18.852  7.100    1.00 14.91  ? 109 PHE B CD2 1 
ATOM   4550  C  CE1 . PHE B  1 134 ? 73.480  18.128  5.827    1.00 13.62  ? 109 PHE B CE1 1 
ATOM   4551  C  CE2 . PHE B  1 134 ? 75.757  17.638  6.417    1.00 14.68  ? 109 PHE B CE2 1 
ATOM   4552  C  CZ  . PHE B  1 134 ? 74.579  17.276  5.779    1.00 14.21  ? 109 PHE B CZ  1 
ATOM   4553  N  N   . VAL B  1 135 ? 75.050  19.745  10.823   1.00 17.32  ? 110 VAL B N   1 
ATOM   4554  C  CA  . VAL B  1 135 ? 75.254  18.544  11.628   1.00 16.80  ? 110 VAL B CA  1 
ATOM   4555  C  C   . VAL B  1 135 ? 74.372  18.483  12.872   1.00 17.40  ? 110 VAL B C   1 
ATOM   4556  O  O   . VAL B  1 135 ? 74.318  17.443  13.524   1.00 17.25  ? 110 VAL B O   1 
ATOM   4557  C  CB  . VAL B  1 135 ? 76.739  18.276  12.032   1.00 16.27  ? 110 VAL B CB  1 
ATOM   4558  C  CG1 . VAL B  1 135 ? 77.623  18.079  10.802   1.00 15.91  ? 110 VAL B CG1 1 
ATOM   4559  C  CG2 . VAL B  1 135 ? 77.276  19.347  12.980   1.00 15.71  ? 110 VAL B CG2 1 
ATOM   4560  N  N   . ILE B  1 136 ? 73.703  19.585  13.210   1.00 17.25  ? 111 ILE B N   1 
ATOM   4561  C  CA  . ILE B  1 136 ? 72.575  19.500  14.148   1.00 17.42  ? 111 ILE B CA  1 
ATOM   4562  C  C   . ILE B  1 136 ? 71.610  18.364  13.711   1.00 17.56  ? 111 ILE B C   1 
ATOM   4563  O  O   . ILE B  1 136 ? 71.047  17.674  14.550   1.00 18.38  ? 111 ILE B O   1 
ATOM   4564  C  CB  . ILE B  1 136 ? 71.863  20.866  14.312   1.00 17.13  ? 111 ILE B CB  1 
ATOM   4565  C  CG1 . ILE B  1 136 ? 72.791  21.855  15.041   1.00 17.53  ? 111 ILE B CG1 1 
ATOM   4566  C  CG2 . ILE B  1 136 ? 70.573  20.732  15.095   1.00 17.30  ? 111 ILE B CG2 1 
ATOM   4567  C  CD1 . ILE B  1 136 ? 72.255  23.278  15.130   1.00 17.76  ? 111 ILE B CD1 1 
ATOM   4568  N  N   . GLY B  1 137 ? 71.484  18.127  12.402   1.00 17.20  ? 112 GLY B N   1 
ATOM   4569  C  CA  . GLY B  1 137 ? 70.625  17.058  11.870   1.00 16.93  ? 112 GLY B CA  1 
ATOM   4570  C  C   . GLY B  1 137 ? 71.213  15.645  11.936   1.00 17.58  ? 112 GLY B C   1 
ATOM   4571  O  O   . GLY B  1 137 ? 70.670  14.711  11.323   1.00 18.50  ? 112 GLY B O   1 
ATOM   4572  N  N   . ILE B  1 138 ? 72.237  15.451  12.751   1.00 16.89  ? 113 ILE B N   1 
ATOM   4573  C  CA  . ILE B  1 138 ? 72.967  14.222  12.793   1.00 16.94  ? 113 ILE B CA  1 
ATOM   4574  C  C   . ILE B  1 138 ? 72.073  13.024  13.131   1.00 17.64  ? 113 ILE B C   1 
ATOM   4575  O  O   . ILE B  1 138 ? 72.280  12.007  12.589   1.00 17.03  ? 113 ILE B O   1 
ATOM   4576  C  CB  . ILE B  1 138 ? 74.281  14.292  13.615   1.00 16.63  ? 113 ILE B CB  1 
ATOM   4577  C  CG1 . ILE B  1 138 ? 75.110  13.036  13.471   1.00 16.97  ? 113 ILE B CG1 1 
ATOM   4578  C  CG2 . ILE B  1 138 ? 74.041  14.477  15.075   1.00 16.74  ? 113 ILE B CG2 1 
ATOM   4579  C  CD1 . ILE B  1 138 ? 75.797  12.876  12.166   1.00 16.75  ? 113 ILE B CD1 1 
ATOM   4580  N  N   . PRO B  1 139 ? 71.078  13.166  14.000   1.00 18.36  ? 114 PRO B N   1 
ATOM   4581  C  CA  . PRO B  1 139 ? 70.229  11.991  14.226   1.00 18.70  ? 114 PRO B CA  1 
ATOM   4582  C  C   . PRO B  1 139 ? 69.617  11.464  12.913   1.00 19.00  ? 114 PRO B C   1 
ATOM   4583  O  O   . PRO B  1 139 ? 69.709  10.263  12.623   1.00 18.73  ? 114 PRO B O   1 
ATOM   4584  C  CB  . PRO B  1 139 ? 69.156  12.514  15.196   1.00 18.38  ? 114 PRO B CB  1 
ATOM   4585  C  CG  . PRO B  1 139 ? 69.758  13.723  15.831   1.00 17.56  ? 114 PRO B CG  1 
ATOM   4586  C  CD  . PRO B  1 139 ? 70.572  14.342  14.734   1.00 17.57  ? 114 PRO B CD  1 
ATOM   4587  N  N   . HIS B  1 140 ? 69.051  12.351  12.100   1.00 19.98  ? 115 HIS B N   1 
ATOM   4588  C  CA  . HIS B  1 140 ? 68.527  11.927  10.802   1.00 20.19  ? 115 HIS B CA  1 
ATOM   4589  C  C   . HIS B  1 140 ? 69.650  11.508  9.856    1.00 19.97  ? 115 HIS B C   1 
ATOM   4590  O  O   . HIS B  1 140 ? 69.572  10.437  9.221    1.00 20.83  ? 115 HIS B O   1 
ATOM   4591  C  CB  . HIS B  1 140 ? 67.648  13.013  10.185   1.00 21.72  ? 115 HIS B CB  1 
ATOM   4592  C  CG  . HIS B  1 140 ? 67.166  12.688  8.805    1.00 23.55  ? 115 HIS B CG  1 
ATOM   4593  N  ND1 . HIS B  1 140 ? 67.708  13.259  7.672    1.00 24.14  ? 115 HIS B ND1 1 
ATOM   4594  C  CD2 . HIS B  1 140 ? 66.204  11.840  8.373    1.00 23.34  ? 115 HIS B CD2 1 
ATOM   4595  C  CE1 . HIS B  1 140 ? 67.095  12.782  6.603    1.00 24.04  ? 115 HIS B CE1 1 
ATOM   4596  N  NE2 . HIS B  1 140 ? 66.177  11.920  7.002    1.00 23.80  ? 115 HIS B NE2 1 
ATOM   4597  N  N   . LEU B  1 141 ? 70.714  12.318  9.793    1.00 18.57  ? 116 LEU B N   1 
ATOM   4598  C  CA  . LEU B  1 141 ? 71.825  12.069  8.845    1.00 17.17  ? 116 LEU B CA  1 
ATOM   4599  C  C   . LEU B  1 141 ? 72.515  10.722  9.025    1.00 17.43  ? 116 LEU B C   1 
ATOM   4600  O  O   . LEU B  1 141 ? 72.995  10.116  8.044    1.00 16.03  ? 116 LEU B O   1 
ATOM   4601  C  CB  . LEU B  1 141 ? 72.865  13.193  8.883    1.00 15.60  ? 116 LEU B CB  1 
ATOM   4602  C  CG  . LEU B  1 141 ? 72.325  14.571  8.471    1.00 15.24  ? 116 LEU B CG  1 
ATOM   4603  C  CD1 . LEU B  1 141 ? 73.252  15.684  8.919    1.00 15.45  ? 116 LEU B CD1 1 
ATOM   4604  C  CD2 . LEU B  1 141 ? 72.094  14.648  6.969    1.00 15.07  ? 116 LEU B CD2 1 
ATOM   4605  N  N   . GLN B  1 142 ? 72.569  10.248  10.268   1.00 17.96  ? 117 GLN B N   1 
ATOM   4606  C  CA  . GLN B  1 142 ? 73.306  9.020   10.543   1.00 18.59  ? 117 GLN B CA  1 
ATOM   4607  C  C   . GLN B  1 142 ? 72.460  7.758   10.407   1.00 17.28  ? 117 GLN B C   1 
ATOM   4608  O  O   . GLN B  1 142 ? 72.951  6.668   10.666   1.00 17.68  ? 117 GLN B O   1 
ATOM   4609  C  CB  . GLN B  1 142 ? 74.013  9.081   11.913   1.00 22.46  ? 117 GLN B CB  1 
ATOM   4610  C  CG  . GLN B  1 142 ? 75.331  8.296   11.956   1.00 25.97  ? 117 GLN B CG  1 
ATOM   4611  C  CD  . GLN B  1 142 ? 76.230  8.667   13.132   1.00 29.05  ? 117 GLN B CD  1 
ATOM   4612  O  OE1 . GLN B  1 142 ? 76.092  9.734   13.729   1.00 29.64  ? 117 GLN B OE1 1 
ATOM   4613  N  NE2 . GLN B  1 142 ? 77.180  7.793   13.445   1.00 29.90  ? 117 GLN B NE2 1 
ATOM   4614  N  N   . LYS B  1 143 ? 71.200  7.885   9.993    1.00 16.77  ? 118 LYS B N   1 
ATOM   4615  C  CA  . LYS B  1 143 ? 70.357  6.699   9.854    1.00 16.93  ? 118 LYS B CA  1 
ATOM   4616  C  C   . LYS B  1 143 ? 70.948  5.695   8.868    1.00 17.26  ? 118 LYS B C   1 
ATOM   4617  O  O   . LYS B  1 143 ? 71.618  6.069   7.909    1.00 16.17  ? 118 LYS B O   1 
ATOM   4618  C  CB  . LYS B  1 143 ? 68.950  7.052   9.399    1.00 17.11  ? 118 LYS B CB  1 
ATOM   4619  C  CG  . LYS B  1 143 ? 68.080  7.774   10.420   1.00 17.77  ? 118 LYS B CG  1 
ATOM   4620  C  CD  . LYS B  1 143 ? 66.917  8.409   9.660    1.00 17.78  ? 118 LYS B CD  1 
ATOM   4621  C  CE  . LYS B  1 143 ? 65.778  8.841   10.561   1.00 18.18  ? 118 LYS B CE  1 
ATOM   4622  N  NZ  . LYS B  1 143 ? 64.824  9.690   9.796    1.00 17.52  ? 118 LYS B NZ  1 
ATOM   4623  N  N   . SER B  1 144 ? 70.685  4.418   9.121    1.00 18.08  ? 119 SER B N   1 
ATOM   4624  C  CA  . SER B  1 144 ? 71.082  3.345   8.206    1.00 19.02  ? 119 SER B CA  1 
ATOM   4625  C  C   . SER B  1 144 ? 69.827  2.627   7.672    1.00 18.83  ? 119 SER B C   1 
ATOM   4626  O  O   . SER B  1 144 ? 68.719  3.120   7.840    1.00 18.54  ? 119 SER B O   1 
ATOM   4627  C  CB  . SER B  1 144 ? 72.043  2.376   8.906    1.00 18.97  ? 119 SER B CB  1 
ATOM   4628  O  OG  . SER B  1 144 ? 71.587  2.045   10.219   1.00 19.43  ? 119 SER B OG  1 
ATOM   4629  N  N   . GLU B  1 145 ? 70.001  1.468   7.050    1.00 18.94  ? 120 GLU B N   1 
ATOM   4630  C  CA  . GLU B  1 145 ? 68.934  0.867   6.270    1.00 19.82  ? 120 GLU B CA  1 
ATOM   4631  C  C   . GLU B  1 145 ? 68.506  -0.472  6.856    1.00 19.38  ? 120 GLU B C   1 
ATOM   4632  O  O   . GLU B  1 145 ? 69.344  -1.254  7.297    1.00 19.26  ? 120 GLU B O   1 
ATOM   4633  C  CB  . GLU B  1 145 ? 69.390  0.668   4.815    1.00 21.46  ? 120 GLU B CB  1 
ATOM   4634  C  CG  . GLU B  1 145 ? 69.987  1.884   4.093    1.00 23.89  ? 120 GLU B CG  1 
ATOM   4635  C  CD  . GLU B  1 145 ? 70.540  1.500   2.711    1.00 28.29  ? 120 GLU B CD  1 
ATOM   4636  O  OE1 . GLU B  1 145 ? 71.430  0.625   2.622    1.00 30.61  ? 120 GLU B OE1 1 
ATOM   4637  O  OE2 . GLU B  1 145 ? 70.070  2.039   1.688    1.00 29.39  ? 120 GLU B OE2 1 
ATOM   4638  N  N   . PHE B  1 146 ? 67.205  -0.742  6.838    1.00 18.20  ? 121 PHE B N   1 
ATOM   4639  C  CA  . PHE B  1 146 ? 66.676  -1.993  7.382    1.00 17.39  ? 121 PHE B CA  1 
ATOM   4640  C  C   . PHE B  1 146 ? 65.853  -2.697  6.312    1.00 17.24  ? 121 PHE B C   1 
ATOM   4641  O  O   . PHE B  1 146 ? 65.071  -2.053  5.595    1.00 17.30  ? 121 PHE B O   1 
ATOM   4642  C  CB  . PHE B  1 146 ? 65.832  -1.708  8.623    1.00 16.83  ? 121 PHE B CB  1 
ATOM   4643  C  CG  . PHE B  1 146 ? 65.331  -2.945  9.345    1.00 18.40  ? 121 PHE B CG  1 
ATOM   4644  C  CD1 . PHE B  1 146 ? 64.203  -3.636  8.898    1.00 18.97  ? 121 PHE B CD1 1 
ATOM   4645  C  CD2 . PHE B  1 146 ? 65.960  -3.391  10.509   1.00 18.84  ? 121 PHE B CD2 1 
ATOM   4646  C  CE1 . PHE B  1 146 ? 63.735  -4.764  9.575    1.00 20.02  ? 121 PHE B CE1 1 
ATOM   4647  C  CE2 . PHE B  1 146 ? 65.500  -4.511  11.192   1.00 19.52  ? 121 PHE B CE2 1 
ATOM   4648  C  CZ  . PHE B  1 146 ? 64.385  -5.201  10.732   1.00 20.09  ? 121 PHE B CZ  1 
ATOM   4649  N  N   . THR B  1 147 ? 66.044  -4.011  6.203    1.00 16.71  ? 122 THR B N   1 
ATOM   4650  C  CA  . THR B  1 147 ? 65.220  -4.866  5.369    1.00 16.77  ? 122 THR B CA  1 
ATOM   4651  C  C   . THR B  1 147 ? 64.671  -5.998  6.236    1.00 17.72  ? 122 THR B C   1 
ATOM   4652  O  O   . THR B  1 147 ? 65.439  -6.682  6.878    1.00 17.47  ? 122 THR B O   1 
ATOM   4653  C  CB  . THR B  1 147 ? 66.052  -5.486  4.213    1.00 16.65  ? 122 THR B CB  1 
ATOM   4654  O  OG1 . THR B  1 147 ? 66.510  -4.452  3.342    1.00 16.51  ? 122 THR B OG1 1 
ATOM   4655  C  CG2 . THR B  1 147 ? 65.240  -6.526  3.401    1.00 16.05  ? 122 THR B CG2 1 
ATOM   4656  N  N   . GLU B  1 148 ? 63.349  -6.178  6.258    1.00 19.22  ? 123 GLU B N   1 
ATOM   4657  C  CA  . GLU B  1 148 ? 62.734  -7.340  6.902    1.00 21.66  ? 123 GLU B CA  1 
ATOM   4658  C  C   . GLU B  1 148 ? 62.531  -8.455  5.877    1.00 22.34  ? 123 GLU B C   1 
ATOM   4659  O  O   . GLU B  1 148 ? 62.032  -8.214  4.776    1.00 22.49  ? 123 GLU B O   1 
ATOM   4660  C  CB  . GLU B  1 148 ? 61.387  -6.988  7.558    1.00 22.93  ? 123 GLU B CB  1 
ATOM   4661  C  CG  . GLU B  1 148 ? 60.577  -8.212  7.997    1.00 25.57  ? 123 GLU B CG  1 
ATOM   4662  C  CD  . GLU B  1 148 ? 59.217  -7.873  8.603    1.00 28.72  ? 123 GLU B CD  1 
ATOM   4663  O  OE1 . GLU B  1 148 ? 58.313  -7.423  7.862    1.00 29.84  ? 123 GLU B OE1 1 
ATOM   4664  O  OE2 . GLU B  1 148 ? 59.044  -8.077  9.826    1.00 28.89  ? 123 GLU B OE2 1 
ATOM   4665  N  N   . GLY B  1 149 ? 62.906  -9.673  6.253    1.00 22.56  ? 124 GLY B N   1 
ATOM   4666  C  CA  . GLY B  1 149 ? 62.656  -10.843 5.416    1.00 23.49  ? 124 GLY B CA  1 
ATOM   4667  C  C   . GLY B  1 149 ? 63.474  -10.901 4.133    1.00 22.25  ? 124 GLY B C   1 
ATOM   4668  O  O   . GLY B  1 149 ? 62.987  -11.405 3.111    1.00 21.47  ? 124 GLY B O   1 
ATOM   4669  N  N   . ALA B  1 150 ? 64.694  -10.354 4.188    1.00 21.48  ? 125 ALA B N   1 
ATOM   4670  C  CA  . ALA B  1 150 ? 65.716  -10.551 3.163    1.00 19.80  ? 125 ALA B CA  1 
ATOM   4671  C  C   . ALA B  1 150 ? 65.760  -12.035 2.806    1.00 21.24  ? 125 ALA B C   1 
ATOM   4672  O  O   . ALA B  1 150 ? 65.809  -12.385 1.641    1.00 21.09  ? 125 ALA B O   1 
ATOM   4673  C  CB  . ALA B  1 150 ? 67.069  -10.098 3.675    1.00 18.94  ? 125 ALA B CB  1 
ATOM   4674  N  N   . GLY B  1 151 ? 65.727  -12.895 3.824    1.00 23.41  ? 126 GLY B N   1 
ATOM   4675  C  CA  . GLY B  1 151 ? 65.484  -14.334 3.643    1.00 25.24  ? 126 GLY B CA  1 
ATOM   4676  C  C   . GLY B  1 151 ? 64.335  -14.771 4.537    1.00 27.71  ? 126 GLY B C   1 
ATOM   4677  O  O   . GLY B  1 151 ? 63.727  -13.928 5.202    1.00 26.69  ? 126 GLY B O   1 
ATOM   4678  N  N   . PRO B  1 152 ? 64.018  -16.088 4.556    1.00 30.51  ? 127 PRO B N   1 
ATOM   4679  C  CA  . PRO B  1 152 ? 62.956  -16.641 5.415    1.00 30.28  ? 127 PRO B CA  1 
ATOM   4680  C  C   . PRO B  1 152 ? 63.267  -16.498 6.910    1.00 26.50  ? 127 PRO B C   1 
ATOM   4681  O  O   . PRO B  1 152 ? 64.168  -17.153 7.413    1.00 26.09  ? 127 PRO B O   1 
ATOM   4682  C  CB  . PRO B  1 152 ? 62.926  -18.131 5.024    1.00 33.80  ? 127 PRO B CB  1 
ATOM   4683  C  CG  . PRO B  1 152 ? 63.576  -18.199 3.678    1.00 33.66  ? 127 PRO B CG  1 
ATOM   4684  C  CD  . PRO B  1 152 ? 64.616  -17.122 3.691    1.00 32.46  ? 127 PRO B CD  1 
ATOM   4685  N  N   . GLY B  1 153 ? 62.530  -15.638 7.604    1.00 24.79  ? 128 GLY B N   1 
ATOM   4686  C  CA  . GLY B  1 153 ? 62.816  -15.322 9.009    1.00 24.07  ? 128 GLY B CA  1 
ATOM   4687  C  C   . GLY B  1 153 ? 64.097  -14.521 9.246    1.00 23.10  ? 128 GLY B C   1 
ATOM   4688  O  O   . GLY B  1 153 ? 64.529  -14.366 10.380   1.00 23.26  ? 128 GLY B O   1 
ATOM   4689  N  N   . ILE B  1 154 ? 64.699  -14.016 8.175    1.00 21.53  ? 129 ILE B N   1 
ATOM   4690  C  CA  . ILE B  1 154 ? 65.979  -13.326 8.248    1.00 21.61  ? 129 ILE B CA  1 
ATOM   4691  C  C   . ILE B  1 154 ? 65.823  -11.832 7.981    1.00 20.91  ? 129 ILE B C   1 
ATOM   4692  O  O   . ILE B  1 154 ? 65.258  -11.443 6.957    1.00 21.32  ? 129 ILE B O   1 
ATOM   4693  C  CB  . ILE B  1 154 ? 66.983  -13.892 7.215    1.00 21.86  ? 129 ILE B CB  1 
ATOM   4694  C  CG1 . ILE B  1 154 ? 67.319  -15.367 7.527    1.00 22.31  ? 129 ILE B CG1 1 
ATOM   4695  C  CG2 . ILE B  1 154 ? 68.232  -13.022 7.187    1.00 21.09  ? 129 ILE B CG2 1 
ATOM   4696  C  CD1 . ILE B  1 154 ? 67.571  -16.251 6.319    1.00 22.54  ? 129 ILE B CD1 1 
ATOM   4697  N  N   . ASP B  1 155 ? 66.330  -11.008 8.898    1.00 20.95  ? 130 ASP B N   1 
ATOM   4698  C  CA  . ASP B  1 155 ? 66.361  -9.547  8.729    1.00 20.70  ? 130 ASP B CA  1 
ATOM   4699  C  C   . ASP B  1 155 ? 67.790  -9.054  8.476    1.00 21.00  ? 130 ASP B C   1 
ATOM   4700  O  O   . ASP B  1 155 ? 68.754  -9.651  8.953    1.00 21.79  ? 130 ASP B O   1 
ATOM   4701  C  CB  . ASP B  1 155 ? 65.739  -8.852  9.943    1.00 21.29  ? 130 ASP B CB  1 
ATOM   4702  C  CG  . ASP B  1 155 ? 64.268  -9.238  10.143   1.00 22.21  ? 130 ASP B CG  1 
ATOM   4703  O  OD1 . ASP B  1 155 ? 63.603  -9.592  9.151    1.00 20.39  ? 130 ASP B OD1 1 
ATOM   4704  O  OD2 . ASP B  1 155 ? 63.778  -9.190  11.294   1.00 24.18  ? 130 ASP B OD2 1 
HETATM 4705  N  N   . MSE B  1 156 ? 67.927  -7.971  7.719    1.00 19.88  ? 131 MSE B N   1 
HETATM 4706  C  CA  . MSE B  1 156 ? 69.244  -7.520  7.283    1.00 20.56  ? 131 MSE B CA  1 
HETATM 4707  C  C   . MSE B  1 156 ? 69.254  -6.034  7.421    1.00 20.05  ? 131 MSE B C   1 
HETATM 4708  O  O   . MSE B  1 156 ? 68.359  -5.347  6.925    1.00 21.59  ? 131 MSE B O   1 
HETATM 4709  C  CB  . MSE B  1 156 ? 69.491  -7.970  5.834    1.00 21.45  ? 131 MSE B CB  1 
HETATM 4710  C  CG  . MSE B  1 156 ? 70.842  -7.541  5.246    1.00 23.83  ? 131 MSE B CG  1 
HETATM 4711  SE SE  . MSE B  1 156 ? 71.056  -8.391  3.474    1.00 28.02  ? 131 MSE B SE  1 
HETATM 4712  C  CE  . MSE B  1 156 ? 71.377  -10.237 4.114    1.00 27.22  ? 131 MSE B CE  1 
ATOM   4713  N  N   . TYR B  1 157 ? 70.274  -5.516  8.090    1.00 18.66  ? 132 TYR B N   1 
ATOM   4714  C  CA  . TYR B  1 157 ? 70.298  -4.103  8.417    1.00 17.93  ? 132 TYR B CA  1 
ATOM   4715  C  C   . TYR B  1 157 ? 71.688  -3.613  8.697    1.00 17.99  ? 132 TYR B C   1 
ATOM   4716  O  O   . TYR B  1 157 ? 72.530  -4.337  9.230    1.00 18.86  ? 132 TYR B O   1 
ATOM   4717  C  CB  . TYR B  1 157 ? 69.361  -3.789  9.596    1.00 18.18  ? 132 TYR B CB  1 
ATOM   4718  C  CG  . TYR B  1 157 ? 69.630  -4.528  10.901   1.00 18.64  ? 132 TYR B CG  1 
ATOM   4719  C  CD1 . TYR B  1 157 ? 69.175  -5.838  11.095   1.00 19.87  ? 132 TYR B CD1 1 
ATOM   4720  C  CD2 . TYR B  1 157 ? 70.292  -3.896  11.962   1.00 19.03  ? 132 TYR B CD2 1 
ATOM   4721  C  CE1 . TYR B  1 157 ? 69.393  -6.510  12.297   1.00 20.69  ? 132 TYR B CE1 1 
ATOM   4722  C  CE2 . TYR B  1 157 ? 70.514  -4.560  13.173   1.00 20.70  ? 132 TYR B CE2 1 
ATOM   4723  C  CZ  . TYR B  1 157 ? 70.064  -5.863  13.338   1.00 21.40  ? 132 TYR B CZ  1 
ATOM   4724  O  OH  . TYR B  1 157 ? 70.278  -6.533  14.537   1.00 22.72  ? 132 TYR B OH  1 
ATOM   4725  N  N   . SER B  1 158 ? 71.930  -2.371  8.336    1.00 18.05  ? 133 SER B N   1 
ATOM   4726  C  CA  . SER B  1 158 ? 73.239  -1.790  8.530    1.00 18.64  ? 133 SER B CA  1 
ATOM   4727  C  C   . SER B  1 158 ? 73.174  -0.818  9.674    1.00 19.32  ? 133 SER B C   1 
ATOM   4728  O  O   . SER B  1 158 ? 72.078  -0.436  10.113   1.00 19.42  ? 133 SER B O   1 
ATOM   4729  C  CB  . SER B  1 158 ? 73.750  -1.128  7.239    1.00 18.06  ? 133 SER B CB  1 
ATOM   4730  O  OG  . SER B  1 158 ? 72.774  -0.275  6.663    1.00 18.04  ? 133 SER B OG  1 
ATOM   4731  N  N   . ILE B  1 159 ? 74.353  -0.483  10.196   1.00 19.89  ? 134 ILE B N   1 
ATOM   4732  C  CA  . ILE B  1 159 ? 74.537  0.563   11.199   1.00 19.82  ? 134 ILE B CA  1 
ATOM   4733  C  C   . ILE B  1 159 ? 75.745  1.364   10.763   1.00 20.65  ? 134 ILE B C   1 
ATOM   4734  O  O   . ILE B  1 159 ? 76.765  0.786   10.341   1.00 21.68  ? 134 ILE B O   1 
ATOM   4735  C  CB  . ILE B  1 159 ? 74.798  0.002   12.628   1.00 19.81  ? 134 ILE B CB  1 
ATOM   4736  C  CG1 . ILE B  1 159 ? 73.795  -1.114  12.976   1.00 19.81  ? 134 ILE B CG1 1 
ATOM   4737  C  CG2 . ILE B  1 159 ? 74.757  1.124   13.661   1.00 18.58  ? 134 ILE B CG2 1 
ATOM   4738  C  CD1 . ILE B  1 159 ? 74.054  -1.793  14.293   1.00 19.60  ? 134 ILE B CD1 1 
ATOM   4739  N  N   . ARG B  1 160 ? 75.643  2.683   10.860   1.00 20.77  ? 135 ARG B N   1 
ATOM   4740  C  CA  . ARG B  1 160 ? 76.776  3.537   10.540   1.00 22.88  ? 135 ARG B CA  1 
ATOM   4741  C  C   . ARG B  1 160 ? 77.473  3.967   11.816   1.00 24.50  ? 135 ARG B C   1 
ATOM   4742  O  O   . ARG B  1 160 ? 76.959  4.804   12.551   1.00 27.60  ? 135 ARG B O   1 
ATOM   4743  C  CB  . ARG B  1 160 ? 76.320  4.733   9.711    1.00 24.73  ? 135 ARG B CB  1 
ATOM   4744  C  CG  . ARG B  1 160 ? 75.833  4.272   8.351    1.00 29.61  ? 135 ARG B CG  1 
ATOM   4745  C  CD  . ARG B  1 160 ? 74.953  5.288   7.664    1.00 34.69  ? 135 ARG B CD  1 
ATOM   4746  N  NE  . ARG B  1 160 ? 75.742  6.281   6.950    1.00 40.86  ? 135 ARG B NE  1 
ATOM   4747  C  CZ  . ARG B  1 160 ? 75.254  7.425   6.485    1.00 42.15  ? 135 ARG B CZ  1 
ATOM   4748  N  NH1 . ARG B  1 160 ? 73.975  7.727   6.668    1.00 40.31  ? 135 ARG B NH1 1 
ATOM   4749  N  NH2 . ARG B  1 160 ? 76.051  8.267   5.841    1.00 41.68  ? 135 ARG B NH2 1 
ATOM   4750  N  N   . GLN B  1 161 ? 78.643  3.385   12.076   1.00 22.89  ? 136 GLN B N   1 
ATOM   4751  C  CA  . GLN B  1 161 ? 79.377  3.623   13.333   1.00 22.70  ? 136 GLN B CA  1 
ATOM   4752  C  C   . GLN B  1 161 ? 80.582  4.546   13.106   1.00 22.18  ? 136 GLN B C   1 
ATOM   4753  O  O   . GLN B  1 161 ? 81.002  4.732   11.968   1.00 22.97  ? 136 GLN B O   1 
ATOM   4754  C  CB  . GLN B  1 161 ? 79.800  2.281   13.969   1.00 22.22  ? 136 GLN B CB  1 
ATOM   4755  C  CG  . GLN B  1 161 ? 78.615  1.388   14.342   1.00 22.81  ? 136 GLN B CG  1 
ATOM   4756  C  CD  . GLN B  1 161 ? 78.987  0.168   15.168   1.00 24.89  ? 136 GLN B CD  1 
ATOM   4757  O  OE1 . GLN B  1 161 ? 79.937  -0.576  14.861   1.00 23.44  ? 136 GLN B OE1 1 
ATOM   4758  N  NE2 . GLN B  1 161 ? 78.215  -0.060  16.225   1.00 26.81  ? 136 GLN B NE2 1 
ATOM   4759  N  N   . PRO B  1 162 ? 81.141  5.131   14.179   1.00 21.62  ? 137 PRO B N   1 
ATOM   4760  C  CA  . PRO B  1 162 ? 82.310  5.995   13.982   1.00 21.30  ? 137 PRO B CA  1 
ATOM   4761  C  C   . PRO B  1 162 ? 83.512  5.229   13.403   1.00 21.45  ? 137 PRO B C   1 
ATOM   4762  O  O   . PRO B  1 162 ? 83.656  4.016   13.630   1.00 21.63  ? 137 PRO B O   1 
ATOM   4763  C  CB  . PRO B  1 162 ? 82.634  6.481   15.408   1.00 22.05  ? 137 PRO B CB  1 
ATOM   4764  C  CG  . PRO B  1 162 ? 81.372  6.268   16.212   1.00 21.80  ? 137 PRO B CG  1 
ATOM   4765  C  CD  . PRO B  1 162 ? 80.748  5.043   15.605   1.00 22.35  ? 137 PRO B CD  1 
ATOM   4766  N  N   . VAL B  1 163 ? 84.361  5.916   12.646   1.00 20.47  ? 138 VAL B N   1 
ATOM   4767  C  CA  . VAL B  1 163 ? 85.630  5.316   12.231   1.00 21.19  ? 138 VAL B CA  1 
ATOM   4768  C  C   . VAL B  1 163 ? 86.609  5.267   13.405   1.00 22.62  ? 138 VAL B C   1 
ATOM   4769  O  O   . VAL B  1 163 ? 87.555  4.494   13.379   1.00 24.83  ? 138 VAL B O   1 
ATOM   4770  C  CB  . VAL B  1 163 ? 86.294  6.047   11.035   1.00 20.75  ? 138 VAL B CB  1 
ATOM   4771  C  CG1 . VAL B  1 163 ? 85.478  5.857   9.760    1.00 20.26  ? 138 VAL B CG1 1 
ATOM   4772  C  CG2 . VAL B  1 163 ? 86.520  7.526   11.346   1.00 20.40  ? 138 VAL B CG2 1 
ATOM   4773  N  N   . GLY B  1 164 ? 86.380  6.101   14.424   1.00 21.72  ? 139 GLY B N   1 
ATOM   4774  C  CA  . GLY B  1 164 ? 87.275  6.189   15.585   1.00 20.99  ? 139 GLY B CA  1 
ATOM   4775  C  C   . GLY B  1 164 ? 87.924  7.560   15.721   1.00 20.80  ? 139 GLY B C   1 
ATOM   4776  O  O   . GLY B  1 164 ? 87.295  8.523   16.194   1.00 20.55  ? 139 GLY B O   1 
ATOM   4777  N  N   . ILE B  1 165 ? 89.190  7.652   15.331   1.00 19.82  ? 140 ILE B N   1 
ATOM   4778  C  CA  . ILE B  1 165 ? 89.917  8.916   15.427   1.00 19.67  ? 140 ILE B CA  1 
ATOM   4779  C  C   . ILE B  1 165 ? 90.277  9.384   14.028   1.00 19.89  ? 140 ILE B C   1 
ATOM   4780  O  O   . ILE B  1 165 ? 90.873  8.628   13.245   1.00 19.18  ? 140 ILE B O   1 
ATOM   4781  C  CB  . ILE B  1 165 ? 91.205  8.797   16.271   1.00 19.01  ? 140 ILE B CB  1 
ATOM   4782  C  CG1 . ILE B  1 165 ? 90.864  8.309   17.682   1.00 19.12  ? 140 ILE B CG1 1 
ATOM   4783  C  CG2 . ILE B  1 165 ? 91.969  10.129  16.280   1.00 17.97  ? 140 ILE B CG2 1 
ATOM   4784  C  CD1 . ILE B  1 165 ? 92.064  7.833   18.473   1.00 19.91  ? 140 ILE B CD1 1 
ATOM   4785  N  N   . GLY B  1 166 ? 89.907  10.629  13.727   1.00 19.12  ? 141 GLY B N   1 
ATOM   4786  C  CA  . GLY B  1 166 ? 90.216  11.219  12.434   1.00 18.87  ? 141 GLY B CA  1 
ATOM   4787  C  C   . GLY B  1 166 ? 91.098  12.430  12.584   1.00 19.01  ? 141 GLY B C   1 
ATOM   4788  O  O   . GLY B  1 166 ? 91.234  12.974  13.684   1.00 19.43  ? 141 GLY B O   1 
ATOM   4789  N  N   . ALA B  1 167 ? 91.712  12.844  11.480   1.00 18.36  ? 142 ALA B N   1 
ATOM   4790  C  CA  . ALA B  1 167 ? 92.569  14.019  11.470   1.00 17.86  ? 142 ALA B CA  1 
ATOM   4791  C  C   . ALA B  1 167 ? 92.275  14.895  10.252   1.00 17.43  ? 142 ALA B C   1 
ATOM   4792  O  O   . ALA B  1 167 ? 91.828  14.402  9.205    1.00 17.59  ? 142 ALA B O   1 
ATOM   4793  C  CB  . ALA B  1 167 ? 94.043  13.611  11.509   1.00 17.90  ? 142 ALA B CB  1 
ATOM   4794  N  N   . GLY B  1 168 ? 92.533  16.192  10.393   1.00 17.32  ? 143 GLY B N   1 
ATOM   4795  C  CA  . GLY B  1 168 ? 92.239  17.164  9.348    1.00 17.55  ? 143 GLY B CA  1 
ATOM   4796  C  C   . GLY B  1 168 ? 93.400  18.109  9.202    1.00 18.88  ? 143 GLY B C   1 
ATOM   4797  O  O   . GLY B  1 168 ? 93.944  18.566  10.195   1.00 19.53  ? 143 GLY B O   1 
ATOM   4798  N  N   . ILE B  1 169 ? 93.808  18.371  7.960    1.00 19.48  ? 144 ILE B N   1 
ATOM   4799  C  CA  . ILE B  1 169 ? 94.955  19.241  7.680    1.00 19.75  ? 144 ILE B CA  1 
ATOM   4800  C  C   . ILE B  1 169 ? 94.472  20.412  6.807    1.00 20.22  ? 144 ILE B C   1 
ATOM   4801  O  O   . ILE B  1 169 ? 93.953  20.196  5.702    1.00 20.69  ? 144 ILE B O   1 
ATOM   4802  C  CB  . ILE B  1 169 ? 96.106  18.448  7.025    1.00 19.52  ? 144 ILE B CB  1 
ATOM   4803  C  CG1 . ILE B  1 169 ? 96.527  17.289  7.936    1.00 20.06  ? 144 ILE B CG1 1 
ATOM   4804  C  CG2 . ILE B  1 169 ? 97.290  19.364  6.717    1.00 18.72  ? 144 ILE B CG2 1 
ATOM   4805  C  CD1 . ILE B  1 169 ? 97.083  16.077  7.203    1.00 20.40  ? 144 ILE B CD1 1 
ATOM   4806  N  N   . THR B  1 170 ? 94.613  21.642  7.316    1.00 19.06  ? 145 THR B N   1 
ATOM   4807  C  CA  . THR B  1 170 ? 93.918  22.797  6.721    1.00 18.09  ? 145 THR B CA  1 
ATOM   4808  C  C   . THR B  1 170 ? 94.892  23.887  6.261    1.00 17.25  ? 145 THR B C   1 
ATOM   4809  O  O   . THR B  1 170 ? 96.054  23.870  6.667    1.00 16.81  ? 145 THR B O   1 
ATOM   4810  C  CB  . THR B  1 170 ? 92.840  23.357  7.680    1.00 17.86  ? 145 THR B CB  1 
ATOM   4811  O  OG1 . THR B  1 170 ? 93.452  23.756  8.911    1.00 18.07  ? 145 THR B OG1 1 
ATOM   4812  C  CG2 . THR B  1 170 ? 91.800  22.277  7.977    1.00 17.63  ? 145 THR B CG2 1 
ATOM   4813  N  N   . PRO B  1 171 ? 94.441  24.794  5.364    1.00 16.79  ? 146 PRO B N   1 
ATOM   4814  C  CA  . PRO B  1 171 ? 95.344  25.774  4.767    1.00 16.92  ? 146 PRO B CA  1 
ATOM   4815  C  C   . PRO B  1 171 ? 95.204  27.166  5.407    1.00 18.11  ? 146 PRO B C   1 
ATOM   4816  O  O   . PRO B  1 171 ? 94.320  27.379  6.266    1.00 17.35  ? 146 PRO B O   1 
ATOM   4817  C  CB  . PRO B  1 171 ? 94.888  25.802  3.303    1.00 16.35  ? 146 PRO B CB  1 
ATOM   4818  C  CG  . PRO B  1 171 ? 93.410  25.568  3.378    1.00 15.84  ? 146 PRO B CG  1 
ATOM   4819  C  CD  . PRO B  1 171 ? 93.154  24.749  4.636    1.00 16.21  ? 146 PRO B CD  1 
ATOM   4820  N  N   . PHE B  1 172 ? 96.077  28.094  4.998    1.00 19.21  ? 147 PHE B N   1 
ATOM   4821  C  CA  . PHE B  1 172 ? 96.106  29.441  5.595    1.00 19.32  ? 147 PHE B CA  1 
ATOM   4822  C  C   . PHE B  1 172 ? 94.831  30.241  5.334    1.00 18.91  ? 147 PHE B C   1 
ATOM   4823  O  O   . PHE B  1 172 ? 94.409  31.021  6.177    1.00 18.65  ? 147 PHE B O   1 
ATOM   4824  C  CB  . PHE B  1 172 ? 97.358  30.244  5.156    1.00 19.94  ? 147 PHE B CB  1 
ATOM   4825  C  CG  . PHE B  1 172 ? 97.214  30.957  3.822    1.00 20.31  ? 147 PHE B CG  1 
ATOM   4826  C  CD1 . PHE B  1 172 ? 96.592  32.220  3.741    1.00 21.20  ? 147 PHE B CD1 1 
ATOM   4827  C  CD2 . PHE B  1 172 ? 97.717  30.387  2.651    1.00 19.89  ? 147 PHE B CD2 1 
ATOM   4828  C  CE1 . PHE B  1 172 ? 96.463  32.883  2.518    1.00 20.73  ? 147 PHE B CE1 1 
ATOM   4829  C  CE2 . PHE B  1 172 ? 97.597  31.048  1.434    1.00 20.47  ? 147 PHE B CE2 1 
ATOM   4830  C  CZ  . PHE B  1 172 ? 96.969  32.290  1.364    1.00 20.52  ? 147 PHE B CZ  1 
ATOM   4831  N  N   . ASN B  1 173 ? 94.219  30.035  4.173    1.00 18.97  ? 148 ASN B N   1 
ATOM   4832  C  CA  . ASN B  1 173 ? 93.248  30.993  3.662    1.00 20.84  ? 148 ASN B CA  1 
ATOM   4833  C  C   . ASN B  1 173 ? 91.869  30.985  4.327    1.00 22.42  ? 148 ASN B C   1 
ATOM   4834  O  O   . ASN B  1 173 ? 91.182  32.017  4.330    1.00 23.09  ? 148 ASN B O   1 
ATOM   4835  C  CB  . ASN B  1 173 ? 93.179  30.961  2.119    1.00 22.01  ? 148 ASN B CB  1 
ATOM   4836  C  CG  . ASN B  1 173 ? 92.528  29.696  1.561    1.00 23.16  ? 148 ASN B CG  1 
ATOM   4837  O  OD1 . ASN B  1 173 ? 92.538  28.623  2.181    1.00 22.65  ? 148 ASN B OD1 1 
ATOM   4838  N  ND2 . ASN B  1 173 ? 91.965  29.823  0.367    1.00 23.10  ? 148 ASN B ND2 1 
ATOM   4839  N  N   . PHE B  1 174 ? 91.476  29.848  4.910    1.00 22.47  ? 149 PHE B N   1 
ATOM   4840  C  CA  . PHE B  1 174 ? 90.225  29.785  5.694    1.00 22.71  ? 149 PHE B CA  1 
ATOM   4841  C  C   . PHE B  1 174 ? 90.395  28.999  7.013    1.00 23.02  ? 149 PHE B C   1 
ATOM   4842  O  O   . PHE B  1 174 ? 89.916  27.865  7.121    1.00 22.05  ? 149 PHE B O   1 
ATOM   4843  C  CB  . PHE B  1 174 ? 89.090  29.159  4.871    1.00 22.12  ? 149 PHE B CB  1 
ATOM   4844  C  CG  . PHE B  1 174 ? 88.548  30.033  3.772    1.00 21.75  ? 149 PHE B CG  1 
ATOM   4845  C  CD1 . PHE B  1 174 ? 87.552  30.973  4.031    1.00 22.54  ? 149 PHE B CD1 1 
ATOM   4846  C  CD2 . PHE B  1 174 ? 88.963  29.852  2.454    1.00 22.43  ? 149 PHE B CD2 1 
ATOM   4847  C  CE1 . PHE B  1 174 ? 87.023  31.754  3.006    1.00 23.67  ? 149 PHE B CE1 1 
ATOM   4848  C  CE2 . PHE B  1 174 ? 88.443  30.634  1.419    1.00 22.71  ? 149 PHE B CE2 1 
ATOM   4849  C  CZ  . PHE B  1 174 ? 87.463  31.576  1.693    1.00 23.69  ? 149 PHE B CZ  1 
ATOM   4850  N  N   . PRO B  1 175 ? 91.057  29.600  8.033    1.00 24.03  ? 150 PRO B N   1 
ATOM   4851  C  CA  . PRO B  1 175 ? 91.339  28.859  9.292    1.00 23.72  ? 150 PRO B CA  1 
ATOM   4852  C  C   . PRO B  1 175 ? 90.145  28.726  10.268   1.00 23.50  ? 150 PRO B C   1 
ATOM   4853  O  O   . PRO B  1 175 ? 90.279  28.152  11.360   1.00 24.27  ? 150 PRO B O   1 
ATOM   4854  C  CB  . PRO B  1 175 ? 92.486  29.660  9.913    1.00 23.93  ? 150 PRO B CB  1 
ATOM   4855  C  CG  . PRO B  1 175 ? 92.291  31.056  9.391    1.00 24.06  ? 150 PRO B CG  1 
ATOM   4856  C  CD  . PRO B  1 175 ? 91.642  30.958  8.044    1.00 23.88  ? 150 PRO B CD  1 
ATOM   4857  N  N   . GLY B  1 176 ? 88.991  29.253  9.878    1.00 22.14  ? 151 GLY B N   1 
ATOM   4858  C  CA  . GLY B  1 176 ? 87.748  28.987  10.589   1.00 21.26  ? 151 GLY B CA  1 
ATOM   4859  C  C   . GLY B  1 176 ? 86.917  27.977  9.807    1.00 21.21  ? 151 GLY B C   1 
ATOM   4860  O  O   . GLY B  1 176 ? 86.606  26.876  10.306   1.00 22.34  ? 151 GLY B O   1 
HETATM 4861  N  N   . MSE B  1 177 ? 86.584  28.338  8.573    1.00 19.69  ? 152 MSE B N   1 
HETATM 4862  C  CA  . MSE B  1 177 ? 85.664  27.564  7.759    1.00 19.42  ? 152 MSE B CA  1 
HETATM 4863  C  C   . MSE B  1 177 ? 86.088  26.128  7.581    1.00 17.77  ? 152 MSE B C   1 
HETATM 4864  O  O   . MSE B  1 177 ? 85.308  25.212  7.831    1.00 17.11  ? 152 MSE B O   1 
HETATM 4865  C  CB  . MSE B  1 177 ? 85.572  28.200  6.381    1.00 21.15  ? 152 MSE B CB  1 
HETATM 4866  C  CG  . MSE B  1 177 ? 84.586  27.398  5.524    1.00 23.50  ? 152 MSE B CG  1 
HETATM 4867  SE SE  . MSE B  1 177 ? 84.333  28.315  3.786    1.00 28.55  ? 152 MSE B SE  1 
HETATM 4868  C  CE  . MSE B  1 177 ? 86.021  27.741  2.937    1.00 24.44  ? 152 MSE B CE  1 
ATOM   4869  N  N   . ILE B  1 178 ? 87.315  25.934  7.114    1.00 17.60  ? 153 ILE B N   1 
ATOM   4870  C  CA  . ILE B  1 178 ? 87.793  24.620  6.688    1.00 18.25  ? 153 ILE B CA  1 
ATOM   4871  C  C   . ILE B  1 178 ? 88.028  23.640  7.857    1.00 18.37  ? 153 ILE B C   1 
ATOM   4872  O  O   . ILE B  1 178 ? 87.650  22.477  7.766    1.00 18.21  ? 153 ILE B O   1 
ATOM   4873  C  CB  . ILE B  1 178 ? 89.021  24.745  5.746    1.00 18.68  ? 153 ILE B CB  1 
ATOM   4874  C  CG1 . ILE B  1 178 ? 88.609  25.474  4.463    1.00 19.40  ? 153 ILE B CG1 1 
ATOM   4875  C  CG2 . ILE B  1 178 ? 89.578  23.368  5.401    1.00 18.81  ? 153 ILE B CG2 1 
ATOM   4876  C  CD1 . ILE B  1 178 ? 89.753  25.808  3.518    1.00 20.35  ? 153 ILE B CD1 1 
ATOM   4877  N  N   . PRO B  1 179 ? 88.666  24.103  8.953    1.00 19.14  ? 154 PRO B N   1 
ATOM   4878  C  CA  . PRO B  1 179 ? 88.598  23.304  10.173   1.00 19.55  ? 154 PRO B CA  1 
ATOM   4879  C  C   . PRO B  1 179 ? 87.164  22.865  10.490   1.00 19.56  ? 154 PRO B C   1 
ATOM   4880  O  O   . PRO B  1 179 ? 86.939  21.677  10.742   1.00 19.25  ? 154 PRO B O   1 
ATOM   4881  C  CB  . PRO B  1 179 ? 89.128  24.270  11.232   1.00 20.40  ? 154 PRO B CB  1 
ATOM   4882  C  CG  . PRO B  1 179 ? 90.190  25.019  10.477   1.00 19.87  ? 154 PRO B CG  1 
ATOM   4883  C  CD  . PRO B  1 179 ? 89.600  25.239  9.107    1.00 19.00  ? 154 PRO B CD  1 
HETATM 4884  N  N   . MSE B  1 180 ? 86.208  23.796  10.442   1.00 18.75  ? 155 MSE B N   1 
HETATM 4885  C  CA  . MSE B  1 180 ? 84.814  23.450  10.744   1.00 20.01  ? 155 MSE B CA  1 
HETATM 4886  C  C   . MSE B  1 180 ? 84.200  22.483  9.758    1.00 19.27  ? 155 MSE B C   1 
HETATM 4887  O  O   . MSE B  1 180 ? 83.511  21.557  10.181   1.00 20.25  ? 155 MSE B O   1 
HETATM 4888  C  CB  . MSE B  1 180 ? 83.936  24.676  10.948   1.00 20.82  ? 155 MSE B CB  1 
HETATM 4889  C  CG  . MSE B  1 180 ? 84.385  25.355  12.239   1.00 22.44  ? 155 MSE B CG  1 
HETATM 4890  SE SE  . MSE B  1 180 ? 83.145  26.811  12.733   1.00 25.07  ? 155 MSE B SE  1 
HETATM 4891  C  CE  . MSE B  1 180 ? 84.159  28.358  12.029   1.00 24.87  ? 155 MSE B CE  1 
ATOM   4892  N  N   . TRP B  1 181 ? 84.434  22.682  8.459    1.00 17.18  ? 156 TRP B N   1 
ATOM   4893  C  CA  . TRP B  1 181 ? 84.047  21.710  7.435    1.00 17.32  ? 156 TRP B CA  1 
ATOM   4894  C  C   . TRP B  1 181 ? 84.317  20.274  7.878    1.00 17.60  ? 156 TRP B C   1 
ATOM   4895  O  O   . TRP B  1 181 ? 83.456  19.413  7.742    1.00 17.28  ? 156 TRP B O   1 
ATOM   4896  C  CB  . TRP B  1 181 ? 84.873  21.905  6.161    1.00 18.30  ? 156 TRP B CB  1 
ATOM   4897  C  CG  . TRP B  1 181 ? 84.402  22.907  5.154    1.00 18.85  ? 156 TRP B CG  1 
ATOM   4898  C  CD1 . TRP B  1 181 ? 83.389  23.833  5.287    1.00 19.00  ? 156 TRP B CD1 1 
ATOM   4899  C  CD2 . TRP B  1 181 ? 84.971  23.117  3.862    1.00 19.38  ? 156 TRP B CD2 1 
ATOM   4900  N  NE1 . TRP B  1 181 ? 83.290  24.583  4.136    1.00 19.59  ? 156 TRP B NE1 1 
ATOM   4901  C  CE2 . TRP B  1 181 ? 84.248  24.168  3.248    1.00 20.10  ? 156 TRP B CE2 1 
ATOM   4902  C  CE3 . TRP B  1 181 ? 86.022  22.511  3.154    1.00 20.19  ? 156 TRP B CE3 1 
ATOM   4903  C  CZ2 . TRP B  1 181 ? 84.538  24.620  1.949    1.00 21.33  ? 156 TRP B CZ2 1 
ATOM   4904  C  CZ3 . TRP B  1 181 ? 86.318  22.970  1.860    1.00 20.21  ? 156 TRP B CZ3 1 
ATOM   4905  C  CH2 . TRP B  1 181 ? 85.576  24.011  1.276    1.00 20.17  ? 156 TRP B CH2 1 
HETATM 4906  N  N   . MSE B  1 182 ? 85.524  20.024  8.390    1.00 17.85  ? 157 MSE B N   1 
HETATM 4907  C  CA  . MSE B  1 182 ? 85.954  18.657  8.718    1.00 18.73  ? 157 MSE B CA  1 
HETATM 4908  C  C   . MSE B  1 182 ? 85.506  18.224  10.087   1.00 17.96  ? 157 MSE B C   1 
HETATM 4909  O  O   . MSE B  1 182 ? 84.935  17.131  10.228   1.00 17.66  ? 157 MSE B O   1 
HETATM 4910  C  CB  . MSE B  1 182 ? 87.462  18.496  8.631    1.00 20.00  ? 157 MSE B CB  1 
HETATM 4911  C  CG  . MSE B  1 182 ? 88.019  18.945  7.278    1.00 21.26  ? 157 MSE B CG  1 
HETATM 4912  SE SE  . MSE B  1 182 ? 89.975  19.155  7.444    1.00 24.81  ? 157 MSE B SE  1 
HETATM 4913  C  CE  . MSE B  1 182 ? 90.401  19.450  5.543    1.00 21.71  ? 157 MSE B CE  1 
ATOM   4914  N  N   . PHE B  1 183 ? 85.750  19.034  11.103   1.00 17.10  ? 158 PHE B N   1 
ATOM   4915  C  CA  . PHE B  1 183 ? 85.483  18.567  12.453   1.00 18.06  ? 158 PHE B CA  1 
ATOM   4916  C  C   . PHE B  1 183 ? 84.003  18.505  12.856   1.00 17.28  ? 158 PHE B C   1 
ATOM   4917  O  O   . PHE B  1 183 ? 83.638  17.696  13.677   1.00 17.38  ? 158 PHE B O   1 
ATOM   4918  C  CB  . PHE B  1 183 ? 86.411  19.207  13.509   1.00 18.13  ? 158 PHE B CB  1 
ATOM   4919  C  CG  . PHE B  1 183 ? 85.973  20.549  14.002   1.00 18.62  ? 158 PHE B CG  1 
ATOM   4920  C  CD1 . PHE B  1 183 ? 84.802  20.694  14.707   1.00 18.77  ? 158 PHE B CD1 1 
ATOM   4921  C  CD2 . PHE B  1 183 ? 86.756  21.667  13.777   1.00 18.51  ? 158 PHE B CD2 1 
ATOM   4922  C  CE1 . PHE B  1 183 ? 84.415  21.928  15.175   1.00 19.42  ? 158 PHE B CE1 1 
ATOM   4923  C  CE2 . PHE B  1 183 ? 86.372  22.899  14.241   1.00 18.56  ? 158 PHE B CE2 1 
ATOM   4924  C  CZ  . PHE B  1 183 ? 85.198  23.030  14.941   1.00 19.21  ? 158 PHE B CZ  1 
ATOM   4925  N  N   . ALA B  1 184 ? 83.151  19.314  12.248   1.00 16.13  ? 159 ALA B N   1 
ATOM   4926  C  CA  . ALA B  1 184 ? 81.743  19.250  12.612   1.00 16.75  ? 159 ALA B CA  1 
ATOM   4927  C  C   . ALA B  1 184 ? 81.151  17.882  12.272   1.00 16.87  ? 159 ALA B C   1 
ATOM   4928  O  O   . ALA B  1 184 ? 80.611  17.223  13.152   1.00 17.14  ? 159 ALA B O   1 
ATOM   4929  C  CB  . ALA B  1 184 ? 80.935  20.386  11.998   1.00 16.56  ? 159 ALA B CB  1 
ATOM   4930  N  N   . PRO B  1 185 ? 81.241  17.445  11.009   1.00 17.19  ? 160 PRO B N   1 
ATOM   4931  C  CA  . PRO B  1 185 ? 80.697  16.102  10.771   1.00 18.16  ? 160 PRO B CA  1 
ATOM   4932  C  C   . PRO B  1 185 ? 81.495  14.991  11.446   1.00 18.92  ? 160 PRO B C   1 
ATOM   4933  O  O   . PRO B  1 185 ? 80.890  14.022  11.911   1.00 19.84  ? 160 PRO B O   1 
ATOM   4934  C  CB  . PRO B  1 185 ? 80.764  15.944  9.243    1.00 17.98  ? 160 PRO B CB  1 
ATOM   4935  C  CG  . PRO B  1 185 ? 81.787  16.950  8.803    1.00 18.02  ? 160 PRO B CG  1 
ATOM   4936  C  CD  . PRO B  1 185 ? 81.616  18.109  9.746    1.00 17.43  ? 160 PRO B CD  1 
ATOM   4937  N  N   . ALA B  1 186 ? 82.821  15.125  11.515   1.00 19.33  ? 161 ALA B N   1 
ATOM   4938  C  CA  . ALA B  1 186 ? 83.648  14.088  12.146   1.00 19.90  ? 161 ALA B CA  1 
ATOM   4939  C  C   . ALA B  1 186 ? 83.207  13.838  13.595   1.00 18.57  ? 161 ALA B C   1 
ATOM   4940  O  O   . ALA B  1 186 ? 83.013  12.703  14.002   1.00 18.34  ? 161 ALA B O   1 
ATOM   4941  C  CB  . ALA B  1 186 ? 85.134  14.433  12.066   1.00 20.55  ? 161 ALA B CB  1 
ATOM   4942  N  N   . ILE B  1 187 ? 83.004  14.915  14.341   1.00 17.79  ? 162 ILE B N   1 
ATOM   4943  C  CA  . ILE B  1 187 ? 82.615  14.849  15.746   1.00 17.04  ? 162 ILE B CA  1 
ATOM   4944  C  C   . ILE B  1 187 ? 81.115  14.501  15.916   1.00 17.19  ? 162 ILE B C   1 
ATOM   4945  O  O   . ILE B  1 187 ? 80.747  13.698  16.792   1.00 16.98  ? 162 ILE B O   1 
ATOM   4946  C  CB  . ILE B  1 187 ? 83.022  16.156  16.468   1.00 16.66  ? 162 ILE B CB  1 
ATOM   4947  C  CG1 . ILE B  1 187 ? 84.548  16.192  16.635   1.00 16.11  ? 162 ILE B CG1 1 
ATOM   4948  C  CG2 . ILE B  1 187 ? 82.324  16.321  17.819   1.00 16.32  ? 162 ILE B CG2 1 
ATOM   4949  C  CD1 . ILE B  1 187 ? 85.086  17.563  16.991   1.00 16.17  ? 162 ILE B CD1 1 
ATOM   4950  N  N   . ALA B  1 188 ? 80.261  15.050  15.055   1.00 16.66  ? 163 ALA B N   1 
ATOM   4951  C  CA  . ALA B  1 188 ? 78.837  14.748  15.131   1.00 16.42  ? 163 ALA B CA  1 
ATOM   4952  C  C   . ALA B  1 188 ? 78.595  13.253  14.932   1.00 17.64  ? 163 ALA B C   1 
ATOM   4953  O  O   . ALA B  1 188 ? 77.684  12.678  15.538   1.00 18.36  ? 163 ALA B O   1 
ATOM   4954  C  CB  . ALA B  1 188 ? 78.066  15.551  14.119   1.00 15.65  ? 163 ALA B CB  1 
ATOM   4955  N  N   . CYS B  1 189 ? 79.429  12.637  14.095   1.00 17.64  ? 164 CYS B N   1 
ATOM   4956  C  CA  . CYS B  1 189 ? 79.364  11.200  13.802   1.00 18.53  ? 164 CYS B CA  1 
ATOM   4957  C  C   . CYS B  1 189 ? 79.880  10.314  14.937   1.00 20.35  ? 164 CYS B C   1 
ATOM   4958  O  O   . CYS B  1 189 ? 79.852  9.078   14.831   1.00 21.85  ? 164 CYS B O   1 
ATOM   4959  C  CB  . CYS B  1 189 ? 80.105  10.873  12.496   1.00 17.93  ? 164 CYS B CB  1 
ATOM   4960  S  SG  . CYS B  1 189 ? 79.212  11.347  10.996   1.00 17.73  ? 164 CYS B SG  1 
ATOM   4961  N  N   . GLY B  1 190 ? 80.342  10.934  16.021   1.00 19.81  ? 165 GLY B N   1 
ATOM   4962  C  CA  . GLY B  1 190 ? 80.819  10.174  17.169   1.00 19.28  ? 165 GLY B CA  1 
ATOM   4963  C  C   . GLY B  1 190 ? 82.314  9.897   17.160   1.00 18.76  ? 165 GLY B C   1 
ATOM   4964  O  O   . GLY B  1 190 ? 82.809  9.115   17.979   1.00 18.88  ? 165 GLY B O   1 
ATOM   4965  N  N   . ASN B  1 191 ? 83.042  10.547  16.253   1.00 18.75  ? 166 ASN B N   1 
ATOM   4966  C  CA  . ASN B  1 191 ? 84.498  10.421  16.212   1.00 19.36  ? 166 ASN B CA  1 
ATOM   4967  C  C   . ASN B  1 191 ? 85.206  11.441  17.133   1.00 21.47  ? 166 ASN B C   1 
ATOM   4968  O  O   . ASN B  1 191 ? 84.604  12.446  17.559   1.00 20.58  ? 166 ASN B O   1 
ATOM   4969  C  CB  . ASN B  1 191 ? 85.017  10.574  14.788   1.00 18.35  ? 166 ASN B CB  1 
ATOM   4970  C  CG  . ASN B  1 191 ? 84.415  9.551   13.835   1.00 18.72  ? 166 ASN B CG  1 
ATOM   4971  O  OD1 . ASN B  1 191 ? 84.741  8.367   13.896   1.00 19.20  ? 166 ASN B OD1 1 
ATOM   4972  N  ND2 . ASN B  1 191 ? 83.521  10.008  12.955   1.00 17.28  ? 166 ASN B ND2 1 
ATOM   4973  N  N   . ALA B  1 192 ? 86.476  11.157  17.439   1.00 21.28  ? 167 ALA B N   1 
ATOM   4974  C  CA  . ALA B  1 192 ? 87.391  12.163  17.957   1.00 21.36  ? 167 ALA B CA  1 
ATOM   4975  C  C   . ALA B  1 192 ? 88.186  12.695  16.757   1.00 20.16  ? 167 ALA B C   1 
ATOM   4976  O  O   . ALA B  1 192 ? 88.378  11.983  15.764   1.00 18.80  ? 167 ALA B O   1 
ATOM   4977  C  CB  . ALA B  1 192 ? 88.314  11.572  19.021   1.00 21.71  ? 167 ALA B CB  1 
ATOM   4978  N  N   . PHE B  1 193 ? 88.617  13.952  16.857   1.00 19.72  ? 168 PHE B N   1 
ATOM   4979  C  CA  . PHE B  1 193 ? 89.223  14.658  15.749   1.00 19.11  ? 168 PHE B CA  1 
ATOM   4980  C  C   . PHE B  1 193 ? 90.475  15.420  16.172   1.00 19.36  ? 168 PHE B C   1 
ATOM   4981  O  O   . PHE B  1 193 ? 90.454  16.168  17.162   1.00 19.23  ? 168 PHE B O   1 
ATOM   4982  C  CB  . PHE B  1 193 ? 88.206  15.621  15.122   1.00 18.86  ? 168 PHE B CB  1 
ATOM   4983  C  CG  . PHE B  1 193 ? 88.679  16.249  13.843   1.00 19.20  ? 168 PHE B CG  1 
ATOM   4984  C  CD1 . PHE B  1 193 ? 88.561  15.564  12.628   1.00 20.11  ? 168 PHE B CD1 1 
ATOM   4985  C  CD2 . PHE B  1 193 ? 89.261  17.516  13.846   1.00 19.01  ? 168 PHE B CD2 1 
ATOM   4986  C  CE1 . PHE B  1 193 ? 89.002  16.139  11.447   1.00 19.85  ? 168 PHE B CE1 1 
ATOM   4987  C  CE2 . PHE B  1 193 ? 89.684  18.101  12.670   1.00 19.33  ? 168 PHE B CE2 1 
ATOM   4988  C  CZ  . PHE B  1 193 ? 89.566  17.413  11.473   1.00 19.63  ? 168 PHE B CZ  1 
ATOM   4989  N  N   . ILE B  1 194 ? 91.559  15.226  15.415   1.00 18.95  ? 169 ILE B N   1 
ATOM   4990  C  CA  . ILE B  1 194 ? 92.808  15.960  15.631   1.00 19.27  ? 169 ILE B CA  1 
ATOM   4991  C  C   . ILE B  1 194 ? 93.022  16.951  14.475   1.00 19.21  ? 169 ILE B C   1 
ATOM   4992  O  O   . ILE B  1 194 ? 93.188  16.554  13.310   1.00 19.70  ? 169 ILE B O   1 
ATOM   4993  C  CB  . ILE B  1 194 ? 94.020  15.010  15.774   1.00 20.34  ? 169 ILE B CB  1 
ATOM   4994  C  CG1 . ILE B  1 194 ? 93.794  14.013  16.920   1.00 21.11  ? 169 ILE B CG1 1 
ATOM   4995  C  CG2 . ILE B  1 194 ? 95.293  15.799  16.041   1.00 21.22  ? 169 ILE B CG2 1 
ATOM   4996  C  CD1 . ILE B  1 194 ? 94.819  12.900  16.993   1.00 20.81  ? 169 ILE B CD1 1 
ATOM   4997  N  N   . LEU B  1 195 ? 92.986  18.238  14.801   1.00 18.60  ? 170 LEU B N   1 
ATOM   4998  C  CA  . LEU B  1 195 ? 93.167  19.314  13.825   1.00 18.21  ? 170 LEU B CA  1 
ATOM   4999  C  C   . LEU B  1 195 ? 94.642  19.743  13.695   1.00 18.53  ? 170 LEU B C   1 
ATOM   5000  O  O   . LEU B  1 195 ? 95.282  20.117  14.682   1.00 18.35  ? 170 LEU B O   1 
ATOM   5001  C  CB  . LEU B  1 195 ? 92.308  20.519  14.219   1.00 17.62  ? 170 LEU B CB  1 
ATOM   5002  C  CG  . LEU B  1 195 ? 92.346  21.761  13.324   1.00 18.03  ? 170 LEU B CG  1 
ATOM   5003  C  CD1 . LEU B  1 195 ? 91.672  21.513  11.971   1.00 18.02  ? 170 LEU B CD1 1 
ATOM   5004  C  CD2 . LEU B  1 195 ? 91.670  22.931  14.036   1.00 18.11  ? 170 LEU B CD2 1 
ATOM   5005  N  N   . LYS B  1 196 ? 95.175  19.748  12.500   1.00 18.26  ? 171 LYS B N   1 
ATOM   5006  C  CA  . LYS B  1 196 ? 96.482  20.287  12.256   1.00 17.83  ? 171 LYS B CA  1 
ATOM   5007  C  C   . LYS B  1 196 ? 96.317  21.489  11.326   1.00 17.54  ? 171 LYS B C   1 
ATOM   5008  O  O   . LYS B  1 196 ? 96.431  21.355  10.136   1.00 18.37  ? 171 LYS B O   1 
ATOM   5009  C  CB  . LYS B  1 196 ? 97.365  19.225  11.632   1.00 17.67  ? 171 LYS B CB  1 
ATOM   5010  C  CG  . LYS B  1 196 ? 98.869  19.375  11.729   1.00 18.68  ? 171 LYS B CG  1 
ATOM   5011  C  CD  . LYS B  1 196 ? 99.414  20.759  11.455   1.00 18.77  ? 171 LYS B CD  1 
ATOM   5012  C  CE  . LYS B  1 196 ? 99.577  20.985  9.972    1.00 19.04  ? 171 LYS B CE  1 
ATOM   5013  N  NZ  . LYS B  1 196 ? 100.012 22.314  9.559    1.00 18.73  ? 171 LYS B NZ  1 
ATOM   5014  N  N   . PRO B  1 197 ? 96.082  22.675  11.872   1.00 16.53  ? 172 PRO B N   1 
ATOM   5015  C  CA  . PRO B  1 197 ? 95.791  23.820  11.016   1.00 16.77  ? 172 PRO B CA  1 
ATOM   5016  C  C   . PRO B  1 197 ? 97.066  24.429  10.443   1.00 18.53  ? 172 PRO B C   1 
ATOM   5017  O  O   . PRO B  1 197 ? 98.180  24.047  10.848   1.00 17.77  ? 172 PRO B O   1 
ATOM   5018  C  CB  . PRO B  1 197 ? 95.117  24.803  11.962   1.00 15.97  ? 172 PRO B CB  1 
ATOM   5019  C  CG  . PRO B  1 197 ? 95.691  24.498  13.283   1.00 16.43  ? 172 PRO B CG  1 
ATOM   5020  C  CD  . PRO B  1 197 ? 96.042  23.033  13.297   1.00 16.65  ? 172 PRO B CD  1 
ATOM   5021  N  N   . SER B  1 198 ? 96.890  25.366  9.506    1.00 19.93  ? 173 SER B N   1 
ATOM   5022  C  CA  . SER B  1 198 ? 98.012  26.124  8.956    1.00 20.71  ? 173 SER B CA  1 
ATOM   5023  C  C   . SER B  1 198 ? 98.740  26.903  10.045   1.00 21.99  ? 173 SER B C   1 
ATOM   5024  O  O   . SER B  1 198 ? 98.126  27.633  10.834   1.00 21.40  ? 173 SER B O   1 
ATOM   5025  C  CB  . SER B  1 198 ? 97.528  27.093  7.877    1.00 19.73  ? 173 SER B CB  1 
ATOM   5026  O  OG  . SER B  1 198 ? 98.576  27.952  7.491    1.00 19.03  ? 173 SER B OG  1 
ATOM   5027  N  N   . GLU B  1 199 ? 100.057 26.746  10.066   1.00 23.92  ? 174 GLU B N   1 
ATOM   5028  C  CA  . GLU B  1 199 ? 100.898 27.446  11.021   1.00 27.01  ? 174 GLU B CA  1 
ATOM   5029  C  C   . GLU B  1 199 ? 101.015 28.962  10.727   1.00 26.42  ? 174 GLU B C   1 
ATOM   5030  O  O   . GLU B  1 199 ? 101.454 29.713  11.594   1.00 27.68  ? 174 GLU B O   1 
ATOM   5031  C  CB  . GLU B  1 199 ? 102.270 26.758  11.129   1.00 30.25  ? 174 GLU B CB  1 
ATOM   5032  C  CG  . GLU B  1 199 ? 103.117 26.846  9.874    1.00 34.33  ? 174 GLU B CG  1 
ATOM   5033  C  CD  . GLU B  1 199 ? 102.915 25.703  8.888    1.00 39.88  ? 174 GLU B CD  1 
ATOM   5034  O  OE1 . GLU B  1 199 ? 103.943 25.157  8.439    1.00 43.97  ? 174 GLU B OE1 1 
ATOM   5035  O  OE2 . GLU B  1 199 ? 101.762 25.356  8.535    1.00 39.37  ? 174 GLU B OE2 1 
ATOM   5036  N  N   . ARG B  1 200 ? 100.597 29.400  9.532    1.00 25.00  ? 175 ARG B N   1 
ATOM   5037  C  CA  . ARG B  1 200 ? 100.521 30.837  9.177    1.00 25.32  ? 175 ARG B CA  1 
ATOM   5038  C  C   . ARG B  1 200 ? 99.581  31.636  10.079   1.00 24.44  ? 175 ARG B C   1 
ATOM   5039  O  O   . ARG B  1 200 ? 99.873  32.767  10.449   1.00 24.16  ? 175 ARG B O   1 
ATOM   5040  C  CB  . ARG B  1 200 ? 100.041 31.051  7.728    1.00 26.95  ? 175 ARG B CB  1 
ATOM   5041  C  CG  . ARG B  1 200 ? 100.841 30.362  6.632    1.00 29.57  ? 175 ARG B CG  1 
ATOM   5042  C  CD  . ARG B  1 200 ? 102.167 31.057  6.372    1.00 32.31  ? 175 ARG B CD  1 
ATOM   5043  N  NE  . ARG B  1 200 ? 103.157 30.715  7.384    1.00 34.40  ? 175 ARG B NE  1 
ATOM   5044  C  CZ  . ARG B  1 200 ? 103.932 29.636  7.340    1.00 38.45  ? 175 ARG B CZ  1 
ATOM   5045  N  NH1 . ARG B  1 200 ? 104.810 29.410  8.308    1.00 40.15  ? 175 ARG B NH1 1 
ATOM   5046  N  NH2 . ARG B  1 200 ? 103.837 28.784  6.326    1.00 40.08  ? 175 ARG B NH2 1 
ATOM   5047  N  N   . ASP B  1 201 ? 98.428  31.059  10.391   1.00 23.92  ? 176 ASP B N   1 
ATOM   5048  C  CA  . ASP B  1 201 ? 97.404  31.774  11.160   1.00 23.30  ? 176 ASP B CA  1 
ATOM   5049  C  C   . ASP B  1 201 ? 96.626  30.835  12.087   1.00 22.57  ? 176 ASP B C   1 
ATOM   5050  O  O   . ASP B  1 201 ? 95.462  30.507  11.812   1.00 21.89  ? 176 ASP B O   1 
ATOM   5051  C  CB  . ASP B  1 201 ? 96.462  32.526  10.219   1.00 22.91  ? 176 ASP B CB  1 
ATOM   5052  C  CG  . ASP B  1 201 ? 95.959  31.663  9.068    1.00 23.16  ? 176 ASP B CG  1 
ATOM   5053  O  OD1 . ASP B  1 201 ? 96.336  30.467  8.970    1.00 21.67  ? 176 ASP B OD1 1 
ATOM   5054  O  OD2 . ASP B  1 201 ? 95.173  32.205  8.260    1.00 24.15  ? 176 ASP B OD2 1 
ATOM   5055  N  N   . PRO B  1 202 ? 97.268  30.401  13.196   1.00 22.67  ? 177 PRO B N   1 
ATOM   5056  C  CA  . PRO B  1 202 ? 96.691  29.370  14.050   1.00 21.90  ? 177 PRO B CA  1 
ATOM   5057  C  C   . PRO B  1 202 ? 95.864  29.865  15.249   1.00 21.17  ? 177 PRO B C   1 
ATOM   5058  O  O   . PRO B  1 202 ? 95.381  29.035  16.016   1.00 21.24  ? 177 PRO B O   1 
ATOM   5059  C  CB  . PRO B  1 202 ? 97.929  28.607  14.542   1.00 22.67  ? 177 PRO B CB  1 
ATOM   5060  C  CG  . PRO B  1 202 ? 99.062  29.588  14.454   1.00 23.20  ? 177 PRO B CG  1 
ATOM   5061  C  CD  . PRO B  1 202 ? 98.605  30.795  13.675   1.00 23.09  ? 177 PRO B CD  1 
ATOM   5062  N  N   . SER B  1 203 ? 95.683  31.177  15.417   1.00 20.96  ? 178 SER B N   1 
ATOM   5063  C  CA  . SER B  1 203 ? 94.890  31.682  16.556   1.00 20.84  ? 178 SER B CA  1 
ATOM   5064  C  C   . SER B  1 203 ? 93.428  31.206  16.577   1.00 20.39  ? 178 SER B C   1 
ATOM   5065  O  O   . SER B  1 203 ? 92.944  30.728  17.611   1.00 20.48  ? 178 SER B O   1 
ATOM   5066  C  CB  . SER B  1 203 ? 94.956  33.207  16.677   1.00 20.84  ? 178 SER B CB  1 
ATOM   5067  O  OG  . SER B  1 203 ? 96.226  33.606  17.182   1.00 21.62  ? 178 SER B OG  1 
ATOM   5068  N  N   . VAL B  1 204 ? 92.734  31.336  15.449   1.00 19.84  ? 179 VAL B N   1 
ATOM   5069  C  CA  . VAL B  1 204 ? 91.318  30.945  15.357   1.00 19.84  ? 179 VAL B CA  1 
ATOM   5070  C  C   . VAL B  1 204 ? 91.074  29.464  15.722   1.00 19.40  ? 179 VAL B C   1 
ATOM   5071  O  O   . VAL B  1 204 ? 90.223  29.183  16.569   1.00 18.95  ? 179 VAL B O   1 
ATOM   5072  C  CB  . VAL B  1 204 ? 90.717  31.338  13.986   1.00 20.31  ? 179 VAL B CB  1 
ATOM   5073  C  CG1 . VAL B  1 204 ? 89.476  30.515  13.640   1.00 20.37  ? 179 VAL B CG1 1 
ATOM   5074  C  CG2 . VAL B  1 204 ? 90.386  32.816  13.992   1.00 20.68  ? 179 VAL B CG2 1 
ATOM   5075  N  N   . PRO B  1 205 ? 91.845  28.525  15.116   1.00 19.90  ? 180 PRO B N   1 
ATOM   5076  C  CA  . PRO B  1 205 ? 91.700  27.095  15.431   1.00 19.89  ? 180 PRO B CA  1 
ATOM   5077  C  C   . PRO B  1 205 ? 91.753  26.755  16.932   1.00 20.89  ? 180 PRO B C   1 
ATOM   5078  O  O   . PRO B  1 205 ? 90.929  25.957  17.403   1.00 20.17  ? 180 PRO B O   1 
ATOM   5079  C  CB  . PRO B  1 205 ? 92.878  26.464  14.696   1.00 20.05  ? 180 PRO B CB  1 
ATOM   5080  C  CG  . PRO B  1 205 ? 93.041  27.328  13.499   1.00 20.51  ? 180 PRO B CG  1 
ATOM   5081  C  CD  . PRO B  1 205 ? 92.797  28.730  14.002   1.00 19.61  ? 180 PRO B CD  1 
ATOM   5082  N  N   . ILE B  1 206 ? 92.696  27.335  17.676   1.00 21.67  ? 181 ILE B N   1 
ATOM   5083  C  CA  . ILE B  1 206 ? 92.751  27.067  19.124   1.00 23.66  ? 181 ILE B CA  1 
ATOM   5084  C  C   . ILE B  1 206 ? 91.481  27.598  19.812   1.00 23.44  ? 181 ILE B C   1 
ATOM   5085  O  O   . ILE B  1 206 ? 90.859  26.893  20.621   1.00 23.47  ? 181 ILE B O   1 
ATOM   5086  C  CB  . ILE B  1 206 ? 94.035  27.603  19.800   1.00 24.89  ? 181 ILE B CB  1 
ATOM   5087  C  CG1 . ILE B  1 206 ? 95.233  26.734  19.419   1.00 25.67  ? 181 ILE B CG1 1 
ATOM   5088  C  CG2 . ILE B  1 206 ? 93.895  27.588  21.321   1.00 25.96  ? 181 ILE B CG2 1 
ATOM   5089  C  CD1 . ILE B  1 206 ? 96.570  27.403  19.667   1.00 27.03  ? 181 ILE B CD1 1 
ATOM   5090  N  N   . ARG B  1 207 ? 91.087  28.822  19.459   1.00 22.73  ? 182 ARG B N   1 
ATOM   5091  C  CA  . ARG B  1 207 ? 89.903  29.437  20.035   1.00 22.15  ? 182 ARG B CA  1 
ATOM   5092  C  C   . ARG B  1 207 ? 88.619  28.645  19.746   1.00 21.17  ? 182 ARG B C   1 
ATOM   5093  O  O   . ARG B  1 207 ? 87.743  28.545  20.603   1.00 21.84  ? 182 ARG B O   1 
ATOM   5094  C  CB  . ARG B  1 207 ? 89.772  30.875  19.559   1.00 23.40  ? 182 ARG B CB  1 
ATOM   5095  C  CG  . ARG B  1 207 ? 88.639  31.618  20.233   1.00 24.69  ? 182 ARG B CG  1 
ATOM   5096  C  CD  . ARG B  1 207 ? 89.000  31.931  21.679   1.00 26.89  ? 182 ARG B CD  1 
ATOM   5097  N  NE  . ARG B  1 207 ? 87.906  32.633  22.338   1.00 28.56  ? 182 ARG B NE  1 
ATOM   5098  C  CZ  . ARG B  1 207 ? 87.249  32.193  23.403   1.00 30.41  ? 182 ARG B CZ  1 
ATOM   5099  N  NH1 . ARG B  1 207 ? 86.262  32.929  23.908   1.00 29.52  ? 182 ARG B NH1 1 
ATOM   5100  N  NH2 . ARG B  1 207 ? 87.582  31.040  23.977   1.00 31.46  ? 182 ARG B NH2 1 
ATOM   5101  N  N   . LEU B  1 208 ? 88.516  28.075  18.546   1.00 20.10  ? 183 LEU B N   1 
ATOM   5102  C  CA  . LEU B  1 208 ? 87.394  27.186  18.214   1.00 19.79  ? 183 LEU B CA  1 
ATOM   5103  C  C   . LEU B  1 208 ? 87.339  25.951  19.112   1.00 19.96  ? 183 LEU B C   1 
ATOM   5104  O  O   . LEU B  1 208 ? 86.263  25.576  19.575   1.00 20.04  ? 183 LEU B O   1 
ATOM   5105  C  CB  . LEU B  1 208 ? 87.429  26.752  16.737   1.00 18.91  ? 183 LEU B CB  1 
ATOM   5106  C  CG  . LEU B  1 208 ? 87.288  27.840  15.663   1.00 18.55  ? 183 LEU B CG  1 
ATOM   5107  C  CD1 . LEU B  1 208 ? 87.363  27.226  14.268   1.00 17.47  ? 183 LEU B CD1 1 
ATOM   5108  C  CD2 . LEU B  1 208 ? 86.012  28.668  15.843   1.00 17.98  ? 183 LEU B CD2 1 
ATOM   5109  N  N   . ALA B  1 209 ? 88.493  25.320  19.343   1.00 20.36  ? 184 ALA B N   1 
ATOM   5110  C  CA  . ALA B  1 209 ? 88.570  24.137  20.202   1.00 20.75  ? 184 ALA B CA  1 
ATOM   5111  C  C   . ALA B  1 209 ? 88.158  24.515  21.625   1.00 21.52  ? 184 ALA B C   1 
ATOM   5112  O  O   . ALA B  1 209 ? 87.477  23.750  22.316   1.00 21.48  ? 184 ALA B O   1 
ATOM   5113  C  CB  . ALA B  1 209 ? 89.974  23.538  20.176   1.00 19.99  ? 184 ALA B CB  1 
ATOM   5114  N  N   . GLU B  1 210 ? 88.555  25.714  22.037   1.00 22.28  ? 185 GLU B N   1 
ATOM   5115  C  CA  . GLU B  1 210 ? 88.197  26.248  23.343   1.00 24.17  ? 185 GLU B CA  1 
ATOM   5116  C  C   . GLU B  1 210 ? 86.683  26.459  23.466   1.00 23.74  ? 185 GLU B C   1 
ATOM   5117  O  O   . GLU B  1 210 ? 86.084  26.148  24.502   1.00 25.68  ? 185 GLU B O   1 
ATOM   5118  C  CB  . GLU B  1 210 ? 88.906  27.571  23.537   1.00 26.93  ? 185 GLU B CB  1 
ATOM   5119  C  CG  . GLU B  1 210 ? 89.312  27.856  24.963   1.00 30.31  ? 185 GLU B CG  1 
ATOM   5120  C  CD  . GLU B  1 210 ? 90.309  28.991  25.038   1.00 32.19  ? 185 GLU B CD  1 
ATOM   5121  O  OE1 . GLU B  1 210 ? 90.045  30.073  24.466   1.00 31.56  ? 185 GLU B OE1 1 
ATOM   5122  O  OE2 . GLU B  1 210 ? 91.362  28.799  25.674   1.00 35.27  ? 185 GLU B OE2 1 
ATOM   5123  N  N   . LEU B  1 211 ? 86.066  26.979  22.410   1.00 21.38  ? 186 LEU B N   1 
ATOM   5124  C  CA  . LEU B  1 211 ? 84.612  27.194  22.395   1.00 21.06  ? 186 LEU B CA  1 
ATOM   5125  C  C   . LEU B  1 211 ? 83.810  25.892  22.304   1.00 21.08  ? 186 LEU B C   1 
ATOM   5126  O  O   . LEU B  1 211 ? 82.685  25.819  22.805   1.00 21.05  ? 186 LEU B O   1 
ATOM   5127  C  CB  . LEU B  1 211 ? 84.211  28.166  21.276   1.00 20.46  ? 186 LEU B CB  1 
ATOM   5128  C  CG  . LEU B  1 211 ? 84.706  29.601  21.466   1.00 21.43  ? 186 LEU B CG  1 
ATOM   5129  C  CD1 . LEU B  1 211 ? 84.775  30.349  20.137   1.00 21.43  ? 186 LEU B CD1 1 
ATOM   5130  C  CD2 . LEU B  1 211 ? 83.854  30.348  22.496   1.00 21.20  ? 186 LEU B CD2 1 
HETATM 5131  N  N   . MSE B  1 212 ? 84.387  24.857  21.699   1.00 22.08  ? 187 MSE B N   1 
HETATM 5132  C  CA  . MSE B  1 212 ? 83.754  23.527  21.726   1.00 23.66  ? 187 MSE B CA  1 
HETATM 5133  C  C   . MSE B  1 212 ? 83.667  23.025  23.159   1.00 24.71  ? 187 MSE B C   1 
HETATM 5134  O  O   . MSE B  1 212 ? 82.617  22.502  23.568   1.00 25.37  ? 187 MSE B O   1 
HETATM 5135  C  CB  . MSE B  1 212 ? 84.440  22.517  20.807   1.00 25.18  ? 187 MSE B CB  1 
HETATM 5136  C  CG  . MSE B  1 212 ? 84.088  22.725  19.330   1.00 28.94  ? 187 MSE B CG  1 
HETATM 5137  SE SE  . MSE B  1 212 ? 82.180  22.321  18.919   1.00 35.16  ? 187 MSE B SE  1 
HETATM 5138  C  CE  . MSE B  1 212 ? 82.271  20.366  18.624   1.00 36.84  ? 187 MSE B CE  1 
ATOM   5139  N  N   . ILE B  1 213 ? 84.747  23.193  23.937   1.00 24.66  ? 188 ILE B N   1 
ATOM   5140  C  CA  . ILE B  1 213 ? 84.729  22.864  25.373   1.00 25.23  ? 188 ILE B CA  1 
ATOM   5141  C  C   . ILE B  1 213 ? 83.609  23.634  26.070   1.00 26.06  ? 188 ILE B C   1 
ATOM   5142  O  O   . ILE B  1 213 ? 82.806  23.042  26.781   1.00 26.43  ? 188 ILE B O   1 
ATOM   5143  C  CB  . ILE B  1 213 ? 86.080  23.143  26.091   1.00 25.30  ? 188 ILE B CB  1 
ATOM   5144  C  CG1 . ILE B  1 213 ? 87.209  22.291  25.500   1.00 25.73  ? 188 ILE B CG1 1 
ATOM   5145  C  CG2 . ILE B  1 213 ? 85.963  22.899  27.601   1.00 25.09  ? 188 ILE B CG2 1 
ATOM   5146  C  CD1 . ILE B  1 213 ? 87.042  20.793  25.699   1.00 26.32  ? 188 ILE B CD1 1 
ATOM   5147  N  N   . GLU B  1 214 ? 83.543  24.948  25.846   1.00 25.89  ? 189 GLU B N   1 
ATOM   5148  C  CA  . GLU B  1 214 ? 82.485  25.767  26.439   1.00 24.71  ? 189 GLU B CA  1 
ATOM   5149  C  C   . GLU B  1 214 ? 81.083  25.346  25.977   1.00 23.43  ? 189 GLU B C   1 
ATOM   5150  O  O   . GLU B  1 214 ? 80.120  25.502  26.721   1.00 22.78  ? 189 GLU B O   1 
ATOM   5151  C  CB  . GLU B  1 214 ? 82.715  27.240  26.131   1.00 26.81  ? 189 GLU B CB  1 
ATOM   5152  C  CG  . GLU B  1 214 ? 81.749  28.141  26.871   1.00 30.34  ? 189 GLU B CG  1 
ATOM   5153  C  CD  . GLU B  1 214 ? 82.006  29.615  26.660   1.00 35.49  ? 189 GLU B CD  1 
ATOM   5154  O  OE1 . GLU B  1 214 ? 83.101  29.991  26.187   1.00 36.02  ? 189 GLU B OE1 1 
ATOM   5155  O  OE2 . GLU B  1 214 ? 81.095  30.403  26.986   1.00 40.66  ? 189 GLU B OE2 1 
ATOM   5156  N  N   . ALA B  1 215 ? 80.971  24.823  24.754   1.00 22.50  ? 190 ALA B N   1 
ATOM   5157  C  CA  . ALA B  1 215 ? 79.695  24.304  24.251   1.00 22.59  ? 190 ALA B CA  1 
ATOM   5158  C  C   . ALA B  1 215 ? 79.257  22.976  24.900   1.00 23.58  ? 190 ALA B C   1 
ATOM   5159  O  O   . ALA B  1 215 ? 78.119  22.534  24.702   1.00 24.93  ? 190 ALA B O   1 
ATOM   5160  C  CB  . ALA B  1 215 ? 79.714  24.176  22.731   1.00 21.31  ? 190 ALA B CB  1 
ATOM   5161  N  N   . GLY B  1 216 ? 80.142  22.355  25.674   1.00 23.05  ? 191 GLY B N   1 
ATOM   5162  C  CA  . GLY B  1 216 ? 79.841  21.084  26.327   1.00 22.75  ? 191 GLY B CA  1 
ATOM   5163  C  C   . GLY B  1 216 ? 80.447  19.872  25.635   1.00 23.70  ? 191 GLY B C   1 
ATOM   5164  O  O   . GLY B  1 216 ? 80.041  18.737  25.900   1.00 25.36  ? 191 GLY B O   1 
ATOM   5165  N  N   . LEU B  1 217 ? 81.408  20.094  24.737   1.00 22.22  ? 192 LEU B N   1 
ATOM   5166  C  CA  . LEU B  1 217 ? 82.160  18.982  24.155   1.00 21.33  ? 192 LEU B CA  1 
ATOM   5167  C  C   . LEU B  1 217 ? 83.117  18.443  25.203   1.00 20.50  ? 192 LEU B C   1 
ATOM   5168  O  O   . LEU B  1 217 ? 83.806  19.234  25.858   1.00 20.68  ? 192 LEU B O   1 
ATOM   5169  C  CB  . LEU B  1 217 ? 82.923  19.413  22.883   1.00 21.91  ? 192 LEU B CB  1 
ATOM   5170  C  CG  . LEU B  1 217 ? 83.486  18.286  21.998   1.00 22.67  ? 192 LEU B CG  1 
ATOM   5171  C  CD1 . LEU B  1 217 ? 82.394  17.619  21.160   1.00 21.95  ? 192 LEU B CD1 1 
ATOM   5172  C  CD2 . LEU B  1 217 ? 84.635  18.766  21.116   1.00 21.55  ? 192 LEU B CD2 1 
ATOM   5173  N  N   . PRO B  1 218 ? 83.146  17.099  25.390   1.00 20.50  ? 193 PRO B N   1 
ATOM   5174  C  CA  . PRO B  1 218 ? 84.122  16.485  26.294   1.00 20.60  ? 193 PRO B CA  1 
ATOM   5175  C  C   . PRO B  1 218 ? 85.560  16.783  25.885   1.00 21.06  ? 193 PRO B C   1 
ATOM   5176  O  O   . PRO B  1 218 ? 85.859  16.899  24.689   1.00 21.57  ? 193 PRO B O   1 
ATOM   5177  C  CB  . PRO B  1 218 ? 83.837  14.977  26.161   1.00 20.56  ? 193 PRO B CB  1 
ATOM   5178  C  CG  . PRO B  1 218 ? 82.403  14.901  25.748   1.00 20.02  ? 193 PRO B CG  1 
ATOM   5179  C  CD  . PRO B  1 218 ? 82.174  16.107  24.875   1.00 19.31  ? 193 PRO B CD  1 
ATOM   5180  N  N   . ALA B  1 219 ? 86.434  16.923  26.878   1.00 21.42  ? 194 ALA B N   1 
ATOM   5181  C  CA  . ALA B  1 219 ? 87.869  17.086  26.655   1.00 21.46  ? 194 ALA B CA  1 
ATOM   5182  C  C   . ALA B  1 219 ? 88.390  15.894  25.854   1.00 21.21  ? 194 ALA B C   1 
ATOM   5183  O  O   . ALA B  1 219 ? 87.962  14.756  26.074   1.00 20.97  ? 194 ALA B O   1 
ATOM   5184  C  CB  . ALA B  1 219 ? 88.606  17.192  27.993   1.00 21.75  ? 194 ALA B CB  1 
ATOM   5185  N  N   . GLY B  1 220 ? 89.296  16.158  24.916   1.00 21.21  ? 195 GLY B N   1 
ATOM   5186  C  CA  . GLY B  1 220 ? 89.908  15.093  24.126   1.00 21.35  ? 195 GLY B CA  1 
ATOM   5187  C  C   . GLY B  1 220 ? 89.219  14.792  22.807   1.00 21.34  ? 195 GLY B C   1 
ATOM   5188  O  O   . GLY B  1 220 ? 89.779  14.092  21.966   1.00 21.12  ? 195 GLY B O   1 
ATOM   5189  N  N   . ILE B  1 221 ? 88.007  15.311  22.617   1.00 20.65  ? 196 ILE B N   1 
ATOM   5190  C  CA  . ILE B  1 221 ? 87.251  15.038  21.391   1.00 19.90  ? 196 ILE B CA  1 
ATOM   5191  C  C   . ILE B  1 221 ? 87.685  15.926  20.200   1.00 19.62  ? 196 ILE B C   1 
ATOM   5192  O  O   . ILE B  1 221 ? 87.776  15.454  19.050   1.00 19.99  ? 196 ILE B O   1 
ATOM   5193  C  CB  . ILE B  1 221 ? 85.718  15.091  21.648   1.00 19.31  ? 196 ILE B CB  1 
ATOM   5194  C  CG1 . ILE B  1 221 ? 85.292  14.008  22.675   1.00 19.00  ? 196 ILE B CG1 1 
ATOM   5195  C  CG2 . ILE B  1 221 ? 84.932  14.949  20.347   1.00 18.50  ? 196 ILE B CG2 1 
ATOM   5196  C  CD1 . ILE B  1 221 ? 85.769  12.591  22.371   1.00 18.15  ? 196 ILE B CD1 1 
ATOM   5197  N  N   . LEU B  1 222 ? 87.918  17.209  20.471   1.00 18.62  ? 197 LEU B N   1 
ATOM   5198  C  CA  . LEU B  1 222 ? 88.578  18.083  19.508   1.00 18.26  ? 197 LEU B CA  1 
ATOM   5199  C  C   . LEU B  1 222 ? 89.932  18.536  20.073   1.00 19.13  ? 197 LEU B C   1 
ATOM   5200  O  O   . LEU B  1 222 ? 89.999  19.303  21.045   1.00 19.50  ? 197 LEU B O   1 
ATOM   5201  C  CB  . LEU B  1 222 ? 87.698  19.282  19.126   1.00 17.65  ? 197 LEU B CB  1 
ATOM   5202  C  CG  . LEU B  1 222 ? 88.292  20.327  18.172   1.00 17.33  ? 197 LEU B CG  1 
ATOM   5203  C  CD1 . LEU B  1 222 ? 88.855  19.710  16.891   1.00 17.04  ? 197 LEU B CD1 1 
ATOM   5204  C  CD2 . LEU B  1 222 ? 87.259  21.401  17.857   1.00 16.82  ? 197 LEU B CD2 1 
ATOM   5205  N  N   . ASN B  1 223 ? 90.991  18.020  19.465   1.00 19.52  ? 198 ASN B N   1 
ATOM   5206  C  CA  . ASN B  1 223 ? 92.368  18.391  19.783   1.00 21.12  ? 198 ASN B CA  1 
ATOM   5207  C  C   . ASN B  1 223 ? 93.004  19.167  18.623   1.00 21.00  ? 198 ASN B C   1 
ATOM   5208  O  O   . ASN B  1 223 ? 92.734  18.871  17.461   1.00 19.81  ? 198 ASN B O   1 
ATOM   5209  C  CB  . ASN B  1 223 ? 93.195  17.141  20.117   1.00 21.34  ? 198 ASN B CB  1 
ATOM   5210  C  CG  . ASN B  1 223 ? 92.921  16.616  21.521   1.00 22.55  ? 198 ASN B CG  1 
ATOM   5211  O  OD1 . ASN B  1 223 ? 92.637  17.382  22.441   1.00 22.67  ? 198 ASN B OD1 1 
ATOM   5212  N  ND2 . ASN B  1 223 ? 92.999  15.302  21.687   1.00 23.88  ? 198 ASN B ND2 1 
ATOM   5213  N  N   . VAL B  1 224 ? 93.816  20.176  18.953   1.00 21.61  ? 199 VAL B N   1 
ATOM   5214  C  CA  . VAL B  1 224 ? 94.549  20.952  17.954   1.00 21.28  ? 199 VAL B CA  1 
ATOM   5215  C  C   . VAL B  1 224 ? 96.066  20.768  18.159   1.00 23.04  ? 199 VAL B C   1 
ATOM   5216  O  O   . VAL B  1 224 ? 96.612  21.078  19.226   1.00 22.84  ? 199 VAL B O   1 
ATOM   5217  C  CB  . VAL B  1 224 ? 94.178  22.449  17.994   1.00 20.69  ? 199 VAL B CB  1 
ATOM   5218  C  CG1 . VAL B  1 224 ? 94.939  23.221  16.926   1.00 19.81  ? 199 VAL B CG1 1 
ATOM   5219  C  CG2 . VAL B  1 224 ? 92.662  22.650  17.855   1.00 20.06  ? 199 VAL B CG2 1 
ATOM   5220  N  N   . VAL B  1 225 ? 96.724  20.231  17.131   1.00 22.40  ? 200 VAL B N   1 
ATOM   5221  C  CA  . VAL B  1 225 ? 98.169  20.014  17.138   1.00 22.04  ? 200 VAL B CA  1 
ATOM   5222  C  C   . VAL B  1 225 ? 98.747  20.920  16.054   1.00 21.34  ? 200 VAL B C   1 
ATOM   5223  O  O   . VAL B  1 225 ? 98.578  20.662  14.852   1.00 21.39  ? 200 VAL B O   1 
ATOM   5224  C  CB  . VAL B  1 225 ? 98.516  18.522  16.872   1.00 21.98  ? 200 VAL B CB  1 
ATOM   5225  C  CG1 . VAL B  1 225 ? 100.017 18.285  16.845   1.00 22.86  ? 200 VAL B CG1 1 
ATOM   5226  C  CG2 . VAL B  1 225 ? 97.917  17.646  17.950   1.00 22.51  ? 200 VAL B CG2 1 
ATOM   5227  N  N   . ASN B  1 226 ? 99.390  22.002  16.464   1.00 20.53  ? 201 ASN B N   1 
ATOM   5228  C  CA  . ASN B  1 226 ? 100.043 22.890  15.499   1.00 20.28  ? 201 ASN B CA  1 
ATOM   5229  C  C   . ASN B  1 226 ? 101.374 22.323  15.001   1.00 20.99  ? 201 ASN B C   1 
ATOM   5230  O  O   . ASN B  1 226 ? 102.046 21.575  15.740   1.00 20.90  ? 201 ASN B O   1 
ATOM   5231  C  CB  . ASN B  1 226 ? 100.206 24.278  16.102   1.00 19.70  ? 201 ASN B CB  1 
ATOM   5232  C  CG  . ASN B  1 226 ? 98.901  25.046  16.103   1.00 18.79  ? 201 ASN B CG  1 
ATOM   5233  O  OD1 . ASN B  1 226 ? 98.298  25.225  15.054   1.00 18.79  ? 201 ASN B OD1 1 
ATOM   5234  N  ND2 . ASN B  1 226 ? 98.454  25.485  17.272   1.00 17.81  ? 201 ASN B ND2 1 
ATOM   5235  N  N   . GLY B  1 227 ? 101.742 22.657  13.757   1.00 21.05  ? 202 GLY B N   1 
ATOM   5236  C  CA  . GLY B  1 227 ? 103.012 22.209  13.179   1.00 22.11  ? 202 GLY B CA  1 
ATOM   5237  C  C   . GLY B  1 227 ? 103.141 22.323  11.669   1.00 23.49  ? 202 GLY B C   1 
ATOM   5238  O  O   . GLY B  1 227 ? 102.268 22.876  11.000   1.00 22.53  ? 202 GLY B O   1 
ATOM   5239  N  N   . ASP B  1 228 ? 104.246 21.796  11.135   1.00 25.68  ? 203 ASP B N   1 
ATOM   5240  C  CA  . ASP B  1 228 ? 104.507 21.814  9.692    1.00 27.55  ? 203 ASP B CA  1 
ATOM   5241  C  C   . ASP B  1 228 ? 104.506 20.389  9.096    1.00 28.61  ? 203 ASP B C   1 
ATOM   5242  O  O   . ASP B  1 228 ? 103.721 19.537  9.538    1.00 29.34  ? 203 ASP B O   1 
ATOM   5243  C  CB  . ASP B  1 228 ? 105.813 22.575  9.396    1.00 29.72  ? 203 ASP B CB  1 
ATOM   5244  C  CG  . ASP B  1 228 ? 107.023 21.991  10.115   1.00 31.90  ? 203 ASP B CG  1 
ATOM   5245  O  OD1 . ASP B  1 228 ? 106.936 20.887  10.696   1.00 33.18  ? 203 ASP B OD1 1 
ATOM   5246  O  OD2 . ASP B  1 228 ? 108.082 22.648  10.103   1.00 34.50  ? 203 ASP B OD2 1 
ATOM   5247  N  N   . LYS B  1 229 ? 105.363 20.131  8.102    1.00 29.14  ? 204 LYS B N   1 
ATOM   5248  C  CA  . LYS B  1 229 ? 105.510 18.792  7.511    1.00 30.44  ? 204 LYS B CA  1 
ATOM   5249  C  C   . LYS B  1 229 ? 105.744 17.707  8.574    1.00 30.97  ? 204 LYS B C   1 
ATOM   5250  O  O   . LYS B  1 229 ? 105.259 16.570  8.435    1.00 32.14  ? 204 LYS B O   1 
ATOM   5251  C  CB  . LYS B  1 229 ? 106.643 18.785  6.482    1.00 34.75  ? 204 LYS B CB  1 
ATOM   5252  C  CG  . LYS B  1 229 ? 106.903 17.434  5.837    1.00 39.04  ? 204 LYS B CG  1 
ATOM   5253  C  CD  . LYS B  1 229 ? 107.891 17.528  4.683    1.00 42.71  ? 204 LYS B CD  1 
ATOM   5254  C  CE  . LYS B  1 229 ? 108.255 16.145  4.156    1.00 45.92  ? 204 LYS B CE  1 
ATOM   5255  N  NZ  . LYS B  1 229 ? 107.053 15.304  3.884    1.00 46.93  ? 204 LYS B NZ  1 
ATOM   5256  N  N   . GLY B  1 230 ? 106.475 18.067  9.632    1.00 29.63  ? 205 GLY B N   1 
ATOM   5257  C  CA  . GLY B  1 230 ? 106.739 17.173  10.762   1.00 29.33  ? 205 GLY B CA  1 
ATOM   5258  C  C   . GLY B  1 230 ? 105.482 16.574  11.371   1.00 28.83  ? 205 GLY B C   1 
ATOM   5259  O  O   . GLY B  1 230 ? 105.333 15.355  11.419   1.00 29.67  ? 205 GLY B O   1 
ATOM   5260  N  N   . ALA B  1 231 ? 104.579 17.442  11.830   1.00 27.44  ? 206 ALA B N   1 
ATOM   5261  C  CA  . ALA B  1 231 ? 103.274 17.044  12.363   1.00 24.96  ? 206 ALA B CA  1 
ATOM   5262  C  C   . ALA B  1 231 ? 102.451 16.224  11.370   1.00 22.68  ? 206 ALA B C   1 
ATOM   5263  O  O   . ALA B  1 231 ? 101.862 15.216  11.740   1.00 22.11  ? 206 ALA B O   1 
ATOM   5264  C  CB  . ALA B  1 231 ? 102.486 18.278  12.792   1.00 24.30  ? 206 ALA B CB  1 
ATOM   5265  N  N   . VAL B  1 232 ? 102.396 16.667  10.116   1.00 21.68  ? 207 VAL B N   1 
ATOM   5266  C  CA  . VAL B  1 232 ? 101.610 15.969  9.093    1.00 21.21  ? 207 VAL B CA  1 
ATOM   5267  C  C   . VAL B  1 232 ? 102.094 14.515  8.893    1.00 21.78  ? 207 VAL B C   1 
ATOM   5268  O  O   . VAL B  1 232 ? 101.283 13.574  8.856    1.00 20.73  ? 207 VAL B O   1 
ATOM   5269  C  CB  . VAL B  1 232 ? 101.605 16.738  7.755    1.00 20.67  ? 207 VAL B CB  1 
ATOM   5270  C  CG1 . VAL B  1 232 ? 100.937 15.911  6.650    1.00 20.43  ? 207 VAL B CG1 1 
ATOM   5271  C  CG2 . VAL B  1 232 ? 100.923 18.087  7.929    1.00 20.21  ? 207 VAL B CG2 1 
ATOM   5272  N  N   . ASP B  1 233 ? 103.413 14.344  8.798    1.00 23.23  ? 208 ASP B N   1 
ATOM   5273  C  CA  . ASP B  1 233 ? 104.010 13.018  8.606    1.00 25.68  ? 208 ASP B CA  1 
ATOM   5274  C  C   . ASP B  1 233 ? 103.723 12.133  9.807    1.00 25.81  ? 208 ASP B C   1 
ATOM   5275  O  O   . ASP B  1 233 ? 103.364 10.976  9.646    1.00 26.19  ? 208 ASP B O   1 
ATOM   5276  C  CB  . ASP B  1 233 ? 105.515 13.117  8.305    1.00 29.83  ? 208 ASP B CB  1 
ATOM   5277  C  CG  . ASP B  1 233 ? 105.803 13.573  6.862    1.00 35.66  ? 208 ASP B CG  1 
ATOM   5278  O  OD1 . ASP B  1 233 ? 104.915 13.441  5.981    1.00 37.24  ? 208 ASP B OD1 1 
ATOM   5279  O  OD2 . ASP B  1 233 ? 106.926 14.059  6.597    1.00 39.73  ? 208 ASP B OD2 1 
ATOM   5280  N  N   . ALA B  1 234 ? 103.834 12.697  11.009   1.00 25.18  ? 209 ALA B N   1 
ATOM   5281  C  CA  . ALA B  1 234 ? 103.431 11.992  12.221   1.00 24.77  ? 209 ALA B CA  1 
ATOM   5282  C  C   . ALA B  1 234 ? 101.969 11.532  12.141   1.00 24.45  ? 209 ALA B C   1 
ATOM   5283  O  O   . ALA B  1 234 ? 101.641 10.400  12.503   1.00 24.83  ? 209 ALA B O   1 
ATOM   5284  C  CB  . ALA B  1 234 ? 103.656 12.878  13.448   1.00 24.63  ? 209 ALA B CB  1 
ATOM   5285  N  N   . ILE B  1 235 ? 101.094 12.417  11.667   1.00 24.03  ? 210 ILE B N   1 
ATOM   5286  C  CA  . ILE B  1 235 ? 99.669  12.111  11.548   1.00 23.09  ? 210 ILE B CA  1 
ATOM   5287  C  C   . ILE B  1 235 ? 99.454  10.980  10.545   1.00 23.67  ? 210 ILE B C   1 
ATOM   5288  O  O   . ILE B  1 235 ? 98.677  10.049  10.801   1.00 23.53  ? 210 ILE B O   1 
ATOM   5289  C  CB  . ILE B  1 235 ? 98.837  13.350  11.123   1.00 21.13  ? 210 ILE B CB  1 
ATOM   5290  C  CG1 . ILE B  1 235 ? 98.636  14.294  12.310   1.00 21.70  ? 210 ILE B CG1 1 
ATOM   5291  C  CG2 . ILE B  1 235 ? 97.471  12.933  10.581   1.00 19.42  ? 210 ILE B CG2 1 
ATOM   5292  C  CD1 . ILE B  1 235 ? 98.123  15.670  11.926   1.00 21.21  ? 210 ILE B CD1 1 
ATOM   5293  N  N   . LEU B  1 236 ? 100.137 11.082  9.405    1.00 24.25  ? 211 LEU B N   1 
ATOM   5294  C  CA  . LEU B  1 236 ? 99.976  10.127  8.310    1.00 25.24  ? 211 LEU B CA  1 
ATOM   5295  C  C   . LEU B  1 236 ? 100.455 8.724   8.665    1.00 26.81  ? 211 LEU B C   1 
ATOM   5296  O  O   . LEU B  1 236 ? 99.943  7.738   8.134    1.00 28.40  ? 211 LEU B O   1 
ATOM   5297  C  CB  . LEU B  1 236 ? 100.676 10.625  7.042    1.00 24.55  ? 211 LEU B CB  1 
ATOM   5298  C  CG  . LEU B  1 236 ? 100.118 11.920  6.445    1.00 23.56  ? 211 LEU B CG  1 
ATOM   5299  C  CD1 . LEU B  1 236 ? 100.909 12.397  5.230    1.00 23.15  ? 211 LEU B CD1 1 
ATOM   5300  C  CD2 . LEU B  1 236 ? 98.642  11.775  6.110    1.00 23.62  ? 211 LEU B CD2 1 
ATOM   5301  N  N   . THR B  1 237 ? 101.413 8.636   9.580    1.00 25.78  ? 212 THR B N   1 
ATOM   5302  C  CA  . THR B  1 237 ? 102.021 7.350   9.901    1.00 26.85  ? 212 THR B CA  1 
ATOM   5303  C  C   . THR B  1 237 ? 101.590 6.819   11.267   1.00 27.12  ? 212 THR B C   1 
ATOM   5304  O  O   . THR B  1 237 ? 102.005 5.733   11.664   1.00 27.80  ? 212 THR B O   1 
ATOM   5305  C  CB  . THR B  1 237 ? 103.562 7.404   9.837    1.00 27.70  ? 212 THR B CB  1 
ATOM   5306  O  OG1 . THR B  1 237 ? 104.032 8.408   10.738   1.00 28.64  ? 212 THR B OG1 1 
ATOM   5307  C  CG2 . THR B  1 237 ? 104.052 7.715   8.418    1.00 27.16  ? 212 THR B CG2 1 
ATOM   5308  N  N   . HIS B  1 238 ? 100.760 7.576   11.983   1.00 26.06  ? 213 HIS B N   1 
ATOM   5309  C  CA  . HIS B  1 238 ? 100.240 7.099   13.258   1.00 25.36  ? 213 HIS B CA  1 
ATOM   5310  C  C   . HIS B  1 238 ? 99.157  6.026   13.077   1.00 24.78  ? 213 HIS B C   1 
ATOM   5311  O  O   . HIS B  1 238 ? 98.100  6.300   12.485   1.00 23.34  ? 213 HIS B O   1 
ATOM   5312  C  CB  . HIS B  1 238 ? 99.708  8.239   14.106   1.00 24.70  ? 213 HIS B CB  1 
ATOM   5313  C  CG  . HIS B  1 238 ? 99.603  7.885   15.552   1.00 26.25  ? 213 HIS B CG  1 
ATOM   5314  N  ND1 . HIS B  1 238 ? 98.729  6.928   16.017   1.00 26.98  ? 213 HIS B ND1 1 
ATOM   5315  C  CD2 . HIS B  1 238 ? 100.280 8.334   16.636   1.00 28.00  ? 213 HIS B CD2 1 
ATOM   5316  C  CE1 . HIS B  1 238 ? 98.857  6.813   17.328   1.00 27.84  ? 213 HIS B CE1 1 
ATOM   5317  N  NE2 . HIS B  1 238 ? 99.781  7.665   17.730   1.00 28.63  ? 213 HIS B NE2 1 
ATOM   5318  N  N   . PRO B  1 239 ? 99.413  4.805   13.599   1.00 24.91  ? 214 PRO B N   1 
ATOM   5319  C  CA  . PRO B  1 239 ? 98.539  3.647   13.343   1.00 24.91  ? 214 PRO B CA  1 
ATOM   5320  C  C   . PRO B  1 239 ? 97.108  3.803   13.860   1.00 25.48  ? 214 PRO B C   1 
ATOM   5321  O  O   . PRO B  1 239 ? 96.215  3.128   13.353   1.00 25.96  ? 214 PRO B O   1 
ATOM   5322  C  CB  . PRO B  1 239 ? 99.250  2.479   14.065   1.00 25.65  ? 214 PRO B CB  1 
ATOM   5323  C  CG  . PRO B  1 239 ? 100.169 3.126   15.045   1.00 26.11  ? 214 PRO B CG  1 
ATOM   5324  C  CD  . PRO B  1 239 ? 100.583 4.439   14.421   1.00 25.83  ? 214 PRO B CD  1 
ATOM   5325  N  N   . ASP B  1 240 ? 96.895  4.693   14.831   1.00 25.11  ? 215 ASP B N   1 
ATOM   5326  C  CA  . ASP B  1 240 ? 95.581  4.874   15.472   1.00 26.18  ? 215 ASP B CA  1 
ATOM   5327  C  C   . ASP B  1 240 ? 94.679  5.947   14.856   1.00 24.68  ? 215 ASP B C   1 
ATOM   5328  O  O   . ASP B  1 240 ? 93.568  6.152   15.336   1.00 24.34  ? 215 ASP B O   1 
ATOM   5329  C  CB  . ASP B  1 240 ? 95.731  5.162   16.976   1.00 28.74  ? 215 ASP B CB  1 
ATOM   5330  C  CG  . ASP B  1 240 ? 96.394  4.026   17.726   1.00 32.09  ? 215 ASP B CG  1 
ATOM   5331  O  OD1 . ASP B  1 240 ? 96.110  2.851   17.411   1.00 34.70  ? 215 ASP B OD1 1 
ATOM   5332  O  OD2 . ASP B  1 240 ? 97.202  4.308   18.633   1.00 31.96  ? 215 ASP B OD2 1 
ATOM   5333  N  N   . ILE B  1 241 ? 95.148  6.641   13.821   1.00 23.31  ? 216 ILE B N   1 
ATOM   5334  C  CA  . ILE B  1 241 ? 94.292  7.585   13.093   1.00 22.21  ? 216 ILE B CA  1 
ATOM   5335  C  C   . ILE B  1 241 ? 93.756  6.878   11.833   1.00 23.39  ? 216 ILE B C   1 
ATOM   5336  O  O   . ILE B  1 241 ? 94.531  6.418   10.988   1.00 23.29  ? 216 ILE B O   1 
ATOM   5337  C  CB  . ILE B  1 241 ? 95.053  8.885   12.754   1.00 20.75  ? 216 ILE B CB  1 
ATOM   5338  C  CG1 . ILE B  1 241 ? 95.454  9.611   14.043   1.00 19.66  ? 216 ILE B CG1 1 
ATOM   5339  C  CG2 . ILE B  1 241 ? 94.229  9.787   11.840   1.00 19.82  ? 216 ILE B CG2 1 
ATOM   5340  C  CD1 . ILE B  1 241 ? 96.627  10.552  13.865   1.00 19.15  ? 216 ILE B CD1 1 
ATOM   5341  N  N   . ALA B  1 242 ? 92.430  6.784   11.721   1.00 23.50  ? 217 ALA B N   1 
ATOM   5342  C  CA  . ALA B  1 242 ? 91.784  5.975   10.687   1.00 22.02  ? 217 ALA B CA  1 
ATOM   5343  C  C   . ALA B  1 242 ? 91.555  6.748   9.390    1.00 21.22  ? 217 ALA B C   1 
ATOM   5344  O  O   . ALA B  1 242 ? 91.523  6.163   8.299    1.00 20.58  ? 217 ALA B O   1 
ATOM   5345  C  CB  . ALA B  1 242 ? 90.464  5.423   11.207   1.00 21.88  ? 217 ALA B CB  1 
ATOM   5346  N  N   . ALA B  1 243 ? 91.415  8.064   9.511    1.00 20.45  ? 218 ALA B N   1 
ATOM   5347  C  CA  . ALA B  1 243 ? 90.934  8.879   8.407    1.00 19.67  ? 218 ALA B CA  1 
ATOM   5348  C  C   . ALA B  1 243 ? 91.561  10.280  8.405    1.00 19.77  ? 218 ALA B C   1 
ATOM   5349  O  O   . ALA B  1 243 ? 91.801  10.879  9.464    1.00 19.18  ? 218 ALA B O   1 
ATOM   5350  C  CB  . ALA B  1 243 ? 89.411  8.955   8.455    1.00 18.80  ? 218 ALA B CB  1 
ATOM   5351  N  N   . VAL B  1 244 ? 91.830  10.782  7.202    1.00 19.76  ? 219 VAL B N   1 
ATOM   5352  C  CA  . VAL B  1 244 ? 92.560  12.029  7.013    1.00 20.88  ? 219 VAL B CA  1 
ATOM   5353  C  C   . VAL B  1 244 ? 91.863  12.854  5.944    1.00 19.42  ? 219 VAL B C   1 
ATOM   5354  O  O   . VAL B  1 244 ? 91.579  12.367  4.833    1.00 18.65  ? 219 VAL B O   1 
ATOM   5355  C  CB  . VAL B  1 244 ? 94.044  11.776  6.606    1.00 25.61  ? 219 VAL B CB  1 
ATOM   5356  C  CG1 . VAL B  1 244 ? 94.756  13.082  6.253    1.00 26.99  ? 219 VAL B CG1 1 
ATOM   5357  C  CG2 . VAL B  1 244 ? 94.813  11.051  7.714    1.00 27.08  ? 219 VAL B CG2 1 
ATOM   5358  N  N   . SER B  1 245 ? 91.579  14.103  6.291    1.00 18.67  ? 220 SER B N   1 
ATOM   5359  C  CA  . SER B  1 245 ? 90.979  15.041  5.355    1.00 18.24  ? 220 SER B CA  1 
ATOM   5360  C  C   . SER B  1 245 ? 91.956  16.189  5.181    1.00 18.54  ? 220 SER B C   1 
ATOM   5361  O  O   . SER B  1 245 ? 92.547  16.673  6.156    1.00 18.36  ? 220 SER B O   1 
ATOM   5362  C  CB  . SER B  1 245 ? 89.625  15.540  5.880    1.00 17.88  ? 220 SER B CB  1 
ATOM   5363  O  OG  . SER B  1 245 ? 88.913  16.276  4.902    1.00 17.55  ? 220 SER B OG  1 
ATOM   5364  N  N   . PHE B  1 246 ? 92.150  16.601  3.933    1.00 18.49  ? 221 PHE B N   1 
ATOM   5365  C  CA  . PHE B  1 246 ? 93.151  17.614  3.618    1.00 19.22  ? 221 PHE B CA  1 
ATOM   5366  C  C   . PHE B  1 246 ? 92.592  18.665  2.653    1.00 20.09  ? 221 PHE B C   1 
ATOM   5367  O  O   . PHE B  1 246 ? 91.947  18.328  1.640    1.00 20.66  ? 221 PHE B O   1 
ATOM   5368  C  CB  . PHE B  1 246 ? 94.426  16.957  3.045    1.00 19.47  ? 221 PHE B CB  1 
ATOM   5369  C  CG  . PHE B  1 246 ? 95.469  17.951  2.546    1.00 18.83  ? 221 PHE B CG  1 
ATOM   5370  C  CD1 . PHE B  1 246 ? 95.333  18.564  1.294    1.00 18.34  ? 221 PHE B CD1 1 
ATOM   5371  C  CD2 . PHE B  1 246 ? 96.592  18.254  3.320    1.00 18.70  ? 221 PHE B CD2 1 
ATOM   5372  C  CE1 . PHE B  1 246 ? 96.290  19.473  0.839    1.00 19.03  ? 221 PHE B CE1 1 
ATOM   5373  C  CE2 . PHE B  1 246 ? 97.553  19.162  2.868    1.00 19.38  ? 221 PHE B CE2 1 
ATOM   5374  C  CZ  . PHE B  1 246 ? 97.398  19.781  1.627    1.00 19.05  ? 221 PHE B CZ  1 
ATOM   5375  N  N   . VAL B  1 247 ? 92.832  19.934  2.985    1.00 18.82  ? 222 VAL B N   1 
ATOM   5376  C  CA  . VAL B  1 247 ? 92.624  21.017  2.043    1.00 17.90  ? 222 VAL B CA  1 
ATOM   5377  C  C   . VAL B  1 247 ? 93.923  21.844  1.941    1.00 18.76  ? 222 VAL B C   1 
ATOM   5378  O  O   . VAL B  1 247 ? 94.534  22.194  2.956    1.00 19.63  ? 222 VAL B O   1 
ATOM   5379  C  CB  . VAL B  1 247 ? 91.405  21.867  2.443    1.00 17.54  ? 222 VAL B CB  1 
ATOM   5380  C  CG1 . VAL B  1 247 ? 91.230  23.017  1.483    1.00 17.70  ? 222 VAL B CG1 1 
ATOM   5381  C  CG2 . VAL B  1 247 ? 90.126  21.029  2.431    1.00 16.59  ? 222 VAL B CG2 1 
ATOM   5382  N  N   . GLY B  1 248 ? 94.355  22.143  0.719    1.00 18.36  ? 223 GLY B N   1 
ATOM   5383  C  CA  . GLY B  1 248 ? 95.600  22.878  0.482    1.00 18.43  ? 223 GLY B CA  1 
ATOM   5384  C  C   . GLY B  1 248 ? 95.999  22.851  -0.994   1.00 19.44  ? 223 GLY B C   1 
ATOM   5385  O  O   . GLY B  1 248 ? 95.145  22.650  -1.861   1.00 18.95  ? 223 GLY B O   1 
ATOM   5386  N  N   . SER B  1 249 ? 97.280  23.083  -1.292   1.00 19.61  ? 224 SER B N   1 
ATOM   5387  C  CA  . SER B  1 249 ? 97.749  23.077  -2.682   1.00 20.99  ? 224 SER B CA  1 
ATOM   5388  C  C   . SER B  1 249 ? 97.704  21.653  -3.263   1.00 21.23  ? 224 SER B C   1 
ATOM   5389  O  O   . SER B  1 249 ? 97.788  20.674  -2.511   1.00 20.43  ? 224 SER B O   1 
ATOM   5390  C  CB  . SER B  1 249 ? 99.169  23.653  -2.787   1.00 21.87  ? 224 SER B CB  1 
ATOM   5391  O  OG  . SER B  1 249 ? 100.093 22.851  -2.071   1.00 22.27  ? 224 SER B OG  1 
ATOM   5392  N  N   . THR B  1 250 ? 97.565  21.565  -4.589   1.00 21.16  ? 225 THR B N   1 
ATOM   5393  C  CA  . THR B  1 250 ? 97.551  20.288  -5.310   1.00 22.91  ? 225 THR B CA  1 
ATOM   5394  C  C   . THR B  1 250 ? 98.770  19.393  -5.024   1.00 24.53  ? 225 THR B C   1 
ATOM   5395  O  O   . THR B  1 250 ? 98.597  18.209  -4.737   1.00 25.15  ? 225 THR B O   1 
ATOM   5396  C  CB  . THR B  1 250 ? 97.333  20.478  -6.844   1.00 23.42  ? 225 THR B CB  1 
ATOM   5397  O  OG1 . THR B  1 250 ? 95.965  20.832  -7.084   1.00 24.61  ? 225 THR B OG1 1 
ATOM   5398  C  CG2 . THR B  1 250 ? 97.645  19.198  -7.633   1.00 21.96  ? 225 THR B CG2 1 
ATOM   5399  N  N   . PRO B  1 251 ? 99.997  19.947  -5.090   1.00 25.04  ? 226 PRO B N   1 
ATOM   5400  C  CA  . PRO B  1 251 ? 101.146 19.069  -4.822   1.00 24.95  ? 226 PRO B CA  1 
ATOM   5401  C  C   . PRO B  1 251 ? 101.074 18.401  -3.449   1.00 23.54  ? 226 PRO B C   1 
ATOM   5402  O  O   . PRO B  1 251 ? 101.293 17.198  -3.345   1.00 24.30  ? 226 PRO B O   1 
ATOM   5403  C  CB  . PRO B  1 251 ? 102.352 20.021  -4.907   1.00 26.00  ? 226 PRO B CB  1 
ATOM   5404  C  CG  . PRO B  1 251 ? 101.893 21.115  -5.816   1.00 27.07  ? 226 PRO B CG  1 
ATOM   5405  C  CD  . PRO B  1 251 ? 100.426 21.303  -5.484   1.00 25.63  ? 226 PRO B CD  1 
ATOM   5406  N  N   . ILE B  1 252 ? 100.747 19.162  -2.413   1.00 21.90  ? 227 ILE B N   1 
ATOM   5407  C  CA  . ILE B  1 252 ? 100.694 18.601  -1.068   1.00 22.59  ? 227 ILE B CA  1 
ATOM   5408  C  C   . ILE B  1 252 ? 99.499  17.674  -0.874   1.00 22.23  ? 227 ILE B C   1 
ATOM   5409  O  O   . ILE B  1 252 ? 99.588  16.677  -0.140   1.00 22.50  ? 227 ILE B O   1 
ATOM   5410  C  CB  . ILE B  1 252 ? 100.740 19.707  0.020    1.00 23.21  ? 227 ILE B CB  1 
ATOM   5411  C  CG1 . ILE B  1 252 ? 101.931 20.657  -0.213   1.00 23.15  ? 227 ILE B CG1 1 
ATOM   5412  C  CG2 . ILE B  1 252 ? 100.819 19.094  1.411    1.00 22.89  ? 227 ILE B CG2 1 
ATOM   5413  C  CD1 . ILE B  1 252 ? 103.287 19.976  -0.352   1.00 22.65  ? 227 ILE B CD1 1 
ATOM   5414  N  N   . ALA B  1 253 ? 98.394  17.996  -1.543   1.00 21.86  ? 228 ALA B N   1 
ATOM   5415  C  CA  . ALA B  1 253 ? 97.223  17.125  -1.568   1.00 22.17  ? 228 ALA B CA  1 
ATOM   5416  C  C   . ALA B  1 253 ? 97.590  15.747  -2.164   1.00 23.86  ? 228 ALA B C   1 
ATOM   5417  O  O   . ALA B  1 253 ? 97.228  14.701  -1.599   1.00 23.07  ? 228 ALA B O   1 
ATOM   5418  C  CB  . ALA B  1 253 ? 96.095  17.784  -2.347   1.00 20.04  ? 228 ALA B CB  1 
ATOM   5419  N  N   . ARG B  1 254 ? 98.342  15.761  -3.272   1.00 24.80  ? 229 ARG B N   1 
ATOM   5420  C  CA  . ARG B  1 254 ? 98.839  14.534  -3.916   1.00 26.71  ? 229 ARG B CA  1 
ATOM   5421  C  C   . ARG B  1 254 ? 99.636  13.691  -2.935   1.00 26.80  ? 229 ARG B C   1 
ATOM   5422  O  O   . ARG B  1 254 ? 99.476  12.462  -2.860   1.00 26.74  ? 229 ARG B O   1 
ATOM   5423  C  CB  . ARG B  1 254 ? 99.769  14.865  -5.079   1.00 27.59  ? 229 ARG B CB  1 
ATOM   5424  C  CG  . ARG B  1 254 ? 99.064  15.257  -6.341   1.00 29.78  ? 229 ARG B CG  1 
ATOM   5425  C  CD  . ARG B  1 254 ? 100.017 15.237  -7.526   1.00 33.12  ? 229 ARG B CD  1 
ATOM   5426  N  NE  . ARG B  1 254 ? 99.328  15.795  -8.676   1.00 32.28  ? 229 ARG B NE  1 
ATOM   5427  C  CZ  . ARG B  1 254 ? 98.451  15.125  -9.411   1.00 33.04  ? 229 ARG B CZ  1 
ATOM   5428  N  NH1 . ARG B  1 254 ? 98.174  13.845  -9.133   1.00 32.11  ? 229 ARG B NH1 1 
ATOM   5429  N  NH2 . ARG B  1 254 ? 97.854  15.737  -10.433  1.00 33.46  ? 229 ARG B NH2 1 
ATOM   5430  N  N   . TYR B  1 255 ? 100.520 14.379  -2.213   1.00 25.52  ? 230 TYR B N   1 
ATOM   5431  C  CA  . TYR B  1 255 ? 101.407 13.752  -1.251   1.00 24.32  ? 230 TYR B CA  1 
ATOM   5432  C  C   . TYR B  1 255 ? 100.598 13.149  -0.110   1.00 22.36  ? 230 TYR B C   1 
ATOM   5433  O  O   . TYR B  1 255 ? 100.738 11.969  0.177    1.00 22.51  ? 230 TYR B O   1 
ATOM   5434  C  CB  . TYR B  1 255 ? 102.438 14.761  -0.720   1.00 25.27  ? 230 TYR B CB  1 
ATOM   5435  C  CG  . TYR B  1 255 ? 103.269 14.209  0.413    1.00 26.40  ? 230 TYR B CG  1 
ATOM   5436  C  CD1 . TYR B  1 255 ? 104.329 13.339  0.167    1.00 28.05  ? 230 TYR B CD1 1 
ATOM   5437  C  CD2 . TYR B  1 255 ? 102.968 14.525  1.731    1.00 27.27  ? 230 TYR B CD2 1 
ATOM   5438  C  CE1 . TYR B  1 255 ? 105.078 12.812  1.209    1.00 29.39  ? 230 TYR B CE1 1 
ATOM   5439  C  CE2 . TYR B  1 255 ? 103.707 14.004  2.781    1.00 28.97  ? 230 TYR B CE2 1 
ATOM   5440  C  CZ  . TYR B  1 255 ? 104.764 13.157  2.515    1.00 29.99  ? 230 TYR B CZ  1 
ATOM   5441  O  OH  . TYR B  1 255 ? 105.495 12.651  3.563    1.00 31.84  ? 230 TYR B OH  1 
ATOM   5442  N  N   . VAL B  1 256 ? 99.759  13.962  0.532    1.00 20.85  ? 231 VAL B N   1 
ATOM   5443  C  CA  . VAL B  1 256 ? 98.947  13.493  1.646    1.00 20.65  ? 231 VAL B CA  1 
ATOM   5444  C  C   . VAL B  1 256 ? 98.068  12.308  1.226    1.00 21.18  ? 231 VAL B C   1 
ATOM   5445  O  O   . VAL B  1 256 ? 98.064  11.269  1.892    1.00 21.07  ? 231 VAL B O   1 
ATOM   5446  C  CB  . VAL B  1 256 ? 98.087  14.631  2.251    1.00 19.88  ? 231 VAL B CB  1 
ATOM   5447  C  CG1 . VAL B  1 256 ? 97.059  14.077  3.229    1.00 18.96  ? 231 VAL B CG1 1 
ATOM   5448  C  CG2 . VAL B  1 256 ? 98.982  15.653  2.939    1.00 20.15  ? 231 VAL B CG2 1 
ATOM   5449  N  N   . TYR B  1 257 ? 97.335  12.473  0.122    1.00 20.63  ? 232 TYR B N   1 
ATOM   5450  C  CA  . TYR B  1 257 ? 96.473  11.419  -0.395   1.00 20.51  ? 232 TYR B CA  1 
ATOM   5451  C  C   . TYR B  1 257 ? 97.232  10.097  -0.566   1.00 20.96  ? 232 TYR B C   1 
ATOM   5452  O  O   . TYR B  1 257 ? 96.806  9.059   -0.054   1.00 20.06  ? 232 TYR B O   1 
ATOM   5453  C  CB  . TYR B  1 257 ? 95.814  11.855  -1.712   1.00 20.36  ? 232 TYR B CB  1 
ATOM   5454  C  CG  . TYR B  1 257 ? 94.800  10.883  -2.260   1.00 20.16  ? 232 TYR B CG  1 
ATOM   5455  C  CD1 . TYR B  1 257 ? 93.561  10.693  -1.625   1.00 20.71  ? 232 TYR B CD1 1 
ATOM   5456  C  CD2 . TYR B  1 257 ? 95.060  10.167  -3.426   1.00 20.44  ? 232 TYR B CD2 1 
ATOM   5457  C  CE1 . TYR B  1 257 ? 92.615  9.806   -2.135   1.00 20.15  ? 232 TYR B CE1 1 
ATOM   5458  C  CE2 . TYR B  1 257 ? 94.118  9.282   -3.944   1.00 20.92  ? 232 TYR B CE2 1 
ATOM   5459  C  CZ  . TYR B  1 257 ? 92.901  9.101   -3.295   1.00 20.97  ? 232 TYR B CZ  1 
ATOM   5460  O  OH  . TYR B  1 257 ? 91.980  8.208   -3.812   1.00 22.59  ? 232 TYR B OH  1 
ATOM   5461  N  N   . GLY B  1 258 ? 98.368  10.153  -1.256   1.00 21.89  ? 233 GLY B N   1 
ATOM   5462  C  CA  . GLY B  1 258 ? 99.195  8.969   -1.468   1.00 22.97  ? 233 GLY B CA  1 
ATOM   5463  C  C   . GLY B  1 258 ? 99.775  8.373   -0.193   1.00 22.91  ? 233 GLY B C   1 
ATOM   5464  O  O   . GLY B  1 258 ? 99.763  7.146   0.000    1.00 22.33  ? 233 GLY B O   1 
ATOM   5465  N  N   . THR B  1 259 ? 100.287 9.232   0.682    1.00 22.31  ? 234 THR B N   1 
ATOM   5466  C  CA  . THR B  1 259 ? 100.936 8.736   1.894    1.00 21.74  ? 234 THR B CA  1 
ATOM   5467  C  C   . THR B  1 259 ? 99.921  8.162   2.881    1.00 20.93  ? 234 THR B C   1 
ATOM   5468  O  O   . THR B  1 259 ? 100.171 7.109   3.496    1.00 21.76  ? 234 THR B O   1 
ATOM   5469  C  CB  . THR B  1 259 ? 101.820 9.804   2.559    1.00 21.58  ? 234 THR B CB  1 
ATOM   5470  O  OG1 . THR B  1 259 ? 102.706 10.353  1.580    1.00 20.79  ? 234 THR B OG1 1 
ATOM   5471  C  CG2 . THR B  1 259 ? 102.644 9.195   3.742    1.00 21.65  ? 234 THR B CG2 1 
ATOM   5472  N  N   . ALA B  1 260 ? 98.775  8.829   3.011    1.00 19.79  ? 235 ALA B N   1 
ATOM   5473  C  CA  . ALA B  1 260 ? 97.728  8.337   3.887    1.00 19.75  ? 235 ALA B CA  1 
ATOM   5474  C  C   . ALA B  1 260 ? 97.326  6.937   3.413    1.00 20.51  ? 235 ALA B C   1 
ATOM   5475  O  O   . ALA B  1 260 ? 97.154  6.020   4.221    1.00 20.08  ? 235 ALA B O   1 
ATOM   5476  C  CB  . ALA B  1 260 ? 96.537  9.275   3.904    1.00 18.52  ? 235 ALA B CB  1 
ATOM   5477  N  N   . ALA B  1 261 ? 97.220  6.782   2.095    1.00 20.64  ? 236 ALA B N   1 
ATOM   5478  C  CA  . ALA B  1 261 ? 96.750  5.538   1.521    1.00 21.88  ? 236 ALA B CA  1 
ATOM   5479  C  C   . ALA B  1 261 ? 97.798  4.438   1.650    1.00 22.59  ? 236 ALA B C   1 
ATOM   5480  O  O   . ALA B  1 261 ? 97.443  3.301   1.940    1.00 24.26  ? 236 ALA B O   1 
ATOM   5481  C  CB  . ALA B  1 261 ? 96.311  5.732   0.066    1.00 21.43  ? 236 ALA B CB  1 
HETATM 5482  N  N   . MSE B  1 262 ? 99.070  4.782   1.453    1.00 22.68  ? 237 MSE B N   1 
HETATM 5483  C  CA  . MSE B  1 262 ? 100.188 3.849   1.658    1.00 25.76  ? 237 MSE B CA  1 
HETATM 5484  C  C   . MSE B  1 262 ? 100.193 3.293   3.067    1.00 25.12  ? 237 MSE B C   1 
HETATM 5485  O  O   . MSE B  1 262 ? 100.690 2.199   3.295    1.00 24.96  ? 237 MSE B O   1 
HETATM 5486  C  CB  . MSE B  1 262 ? 101.554 4.512   1.411    1.00 30.50  ? 237 MSE B CB  1 
HETATM 5487  C  CG  . MSE B  1 262 ? 102.033 4.548   -0.047   1.00 39.47  ? 237 MSE B CG  1 
HETATM 5488  SE SE  . MSE B  1 262 ? 102.038 2.780   -0.962   1.00 52.49  ? 237 MSE B SE  1 
HETATM 5489  C  CE  . MSE B  1 262 ? 102.699 1.570   0.457    1.00 54.37  ? 237 MSE B CE  1 
ATOM   5490  N  N   . ASN B  1 263 ? 99.649  4.058   4.018    1.00 24.62  ? 238 ASN B N   1 
ATOM   5491  C  CA  . ASN B  1 263 ? 99.510  3.653   5.420    1.00 23.74  ? 238 ASN B CA  1 
ATOM   5492  C  C   . ASN B  1 263 ? 98.156  3.013   5.735    1.00 22.98  ? 238 ASN B C   1 
ATOM   5493  O  O   . ASN B  1 263 ? 97.841  2.734   6.907    1.00 22.69  ? 238 ASN B O   1 
ATOM   5494  C  CB  . ASN B  1 263 ? 99.737  4.865   6.332    1.00 24.94  ? 238 ASN B CB  1 
ATOM   5495  C  CG  . ASN B  1 263 ? 101.191 5.273   6.399    1.00 27.82  ? 238 ASN B CG  1 
ATOM   5496  O  OD1 . ASN B  1 263 ? 101.900 4.879   7.311    1.00 29.53  ? 238 ASN B OD1 1 
ATOM   5497  N  ND2 . ASN B  1 263 ? 101.647 6.046   5.419    1.00 29.33  ? 238 ASN B ND2 1 
ATOM   5498  N  N   . GLY B  1 264 ? 97.342  2.819   4.695    1.00 21.92  ? 239 GLY B N   1 
ATOM   5499  C  CA  . GLY B  1 264 ? 96.049  2.135   4.832    1.00 21.63  ? 239 GLY B CA  1 
ATOM   5500  C  C   . GLY B  1 264 ? 94.867  2.981   5.297    1.00 21.68  ? 239 GLY B C   1 
ATOM   5501  O  O   . GLY B  1 264 ? 93.768  2.444   5.525    1.00 22.77  ? 239 GLY B O   1 
ATOM   5502  N  N   . LYS B  1 265 ? 95.072  4.290   5.448    1.00 20.22  ? 240 LYS B N   1 
ATOM   5503  C  CA  . LYS B  1 265 ? 94.008  5.187   5.923    1.00 19.16  ? 240 LYS B CA  1 
ATOM   5504  C  C   . LYS B  1 265 ? 93.022  5.533   4.807    1.00 18.73  ? 240 LYS B C   1 
ATOM   5505  O  O   . LYS B  1 265 ? 93.387  5.530   3.621    1.00 18.57  ? 240 LYS B O   1 
ATOM   5506  C  CB  . LYS B  1 265 ? 94.615  6.479   6.479    1.00 18.66  ? 240 LYS B CB  1 
ATOM   5507  C  CG  . LYS B  1 265 ? 95.541  6.268   7.666    1.00 19.46  ? 240 LYS B CG  1 
ATOM   5508  C  CD  . LYS B  1 265 ? 96.413  7.501   7.874    1.00 20.23  ? 240 LYS B CD  1 
ATOM   5509  C  CE  . LYS B  1 265 ? 96.845  7.666   9.314    1.00 20.71  ? 240 LYS B CE  1 
ATOM   5510  N  NZ  . LYS B  1 265 ? 97.560  6.474   9.837    1.00 21.34  ? 240 LYS B NZ  1 
ATOM   5511  N  N   . ARG B  1 266 ? 91.778  5.838   5.172    1.00 17.84  ? 241 ARG B N   1 
ATOM   5512  C  CA  . ARG B  1 266 ? 90.912  6.501   4.225    1.00 18.91  ? 241 ARG B CA  1 
ATOM   5513  C  C   . ARG B  1 266 ? 91.355  7.967   4.125    1.00 19.94  ? 241 ARG B C   1 
ATOM   5514  O  O   . ARG B  1 266 ? 91.949  8.521   5.068    1.00 20.78  ? 241 ARG B O   1 
ATOM   5515  C  CB  . ARG B  1 266 ? 89.410  6.314   4.542    1.00 20.16  ? 241 ARG B CB  1 
ATOM   5516  C  CG  . ARG B  1 266 ? 88.914  6.857   5.871    1.00 20.51  ? 241 ARG B CG  1 
ATOM   5517  C  CD  . ARG B  1 266 ? 87.395  6.747   5.987    1.00 21.22  ? 241 ARG B CD  1 
ATOM   5518  N  NE  . ARG B  1 266 ? 86.921  5.359   6.025    1.00 20.40  ? 241 ARG B NE  1 
ATOM   5519  C  CZ  . ARG B  1 266 ? 85.647  4.984   6.125    1.00 19.25  ? 241 ARG B CZ  1 
ATOM   5520  N  NH1 . ARG B  1 266 ? 84.660  5.877   6.208    1.00 17.10  ? 241 ARG B NH1 1 
ATOM   5521  N  NH2 . ARG B  1 266 ? 85.356  3.687   6.152    1.00 20.43  ? 241 ARG B NH2 1 
ATOM   5522  N  N   . ALA B  1 267 ? 91.130  8.568   2.959    1.00 19.34  ? 242 ALA B N   1 
ATOM   5523  C  CA  . ALA B  1 267 ? 91.593  9.922   2.698    1.00 18.62  ? 242 ALA B CA  1 
ATOM   5524  C  C   . ALA B  1 267 ? 90.704  10.661  1.710    1.00 17.43  ? 242 ALA B C   1 
ATOM   5525  O  O   . ALA B  1 267 ? 90.114  10.065  0.813    1.00 16.39  ? 242 ALA B O   1 
ATOM   5526  C  CB  . ALA B  1 267 ? 93.029  9.902   2.202    1.00 19.01  ? 242 ALA B CB  1 
ATOM   5527  N  N   . GLN B  1 268 ? 90.610  11.968  1.910    1.00 17.83  ? 243 GLN B N   1 
ATOM   5528  C  CA  . GLN B  1 268 ? 89.963  12.856  0.976    1.00 18.92  ? 243 GLN B CA  1 
ATOM   5529  C  C   . GLN B  1 268 ? 90.783  14.130  0.965    1.00 20.47  ? 243 GLN B C   1 
ATOM   5530  O  O   . GLN B  1 268 ? 91.021  14.730  2.013    1.00 19.89  ? 243 GLN B O   1 
ATOM   5531  C  CB  . GLN B  1 268 ? 88.513  13.127  1.374    1.00 19.41  ? 243 GLN B CB  1 
ATOM   5532  C  CG  . GLN B  1 268 ? 88.369  13.956  2.637    1.00 20.42  ? 243 GLN B CG  1 
ATOM   5533  C  CD  . GLN B  1 268 ? 86.945  14.339  2.983    1.00 21.49  ? 243 GLN B CD  1 
ATOM   5534  O  OE1 . GLN B  1 268 ? 86.702  14.855  4.065    1.00 23.08  ? 243 GLN B OE1 1 
ATOM   5535  N  NE2 . GLN B  1 268 ? 86.003  14.100  2.074    1.00 21.95  ? 243 GLN B NE2 1 
ATOM   5536  N  N   . CYS B  1 269 ? 91.243  14.512  -0.228   1.00 21.85  ? 244 CYS B N   1 
ATOM   5537  C  CA  . CYS B  1 269 ? 92.132  15.658  -0.389   1.00 22.98  ? 244 CYS B CA  1 
ATOM   5538  C  C   . CYS B  1 269 ? 91.655  16.616  -1.482   1.00 23.07  ? 244 CYS B C   1 
ATOM   5539  O  O   . CYS B  1 269 ? 91.182  16.187  -2.550   1.00 23.25  ? 244 CYS B O   1 
ATOM   5540  C  CB  . CYS B  1 269 ? 93.561  15.184  -0.660   1.00 23.25  ? 244 CYS B CB  1 
ATOM   5541  S  SG  . CYS B  1 269 ? 94.109  14.019  0.603    1.00 24.83  ? 244 CYS B SG  1 
ATOM   5542  N  N   . PHE B  1 270 ? 91.795  17.911  -1.201   1.00 21.94  ? 245 PHE B N   1 
ATOM   5543  C  CA  . PHE B  1 270 ? 91.268  18.960  -2.066   1.00 23.17  ? 245 PHE B CA  1 
ATOM   5544  C  C   . PHE B  1 270 ? 92.348  19.995  -2.328   1.00 25.29  ? 245 PHE B C   1 
ATOM   5545  O  O   . PHE B  1 270 ? 93.004  20.471  -1.400   1.00 25.49  ? 245 PHE B O   1 
ATOM   5546  C  CB  . PHE B  1 270 ? 89.984  19.544  -1.458   1.00 22.02  ? 245 PHE B CB  1 
ATOM   5547  C  CG  . PHE B  1 270 ? 88.952  18.479  -1.168   1.00 22.44  ? 245 PHE B CG  1 
ATOM   5548  C  CD1 . PHE B  1 270 ? 89.017  17.726  0.007    1.00 22.20  ? 245 PHE B CD1 1 
ATOM   5549  C  CD2 . PHE B  1 270 ? 87.970  18.161  -2.108   1.00 22.92  ? 245 PHE B CD2 1 
ATOM   5550  C  CE1 . PHE B  1 270 ? 88.102  16.708  0.260    1.00 22.17  ? 245 PHE B CE1 1 
ATOM   5551  C  CE2 . PHE B  1 270 ? 87.048  17.144  -1.861   1.00 22.18  ? 245 PHE B CE2 1 
ATOM   5552  C  CZ  . PHE B  1 270 ? 87.113  16.417  -0.672   1.00 22.09  ? 245 PHE B CZ  1 
ATOM   5553  N  N   . GLY B  1 271 ? 92.535  20.313  -3.607   1.00 25.59  ? 246 GLY B N   1 
ATOM   5554  C  CA  . GLY B  1 271 ? 93.712  21.047  -4.064   1.00 25.65  ? 246 GLY B CA  1 
ATOM   5555  C  C   . GLY B  1 271 ? 93.469  22.404  -4.696   1.00 24.52  ? 246 GLY B C   1 
ATOM   5556  O  O   . GLY B  1 271 ? 92.566  23.152  -4.295   1.00 23.84  ? 246 GLY B O   1 
ATOM   5557  N  N   . GLY B  1 272 ? 94.304  22.711  -5.683   1.00 24.54  ? 247 GLY B N   1 
ATOM   5558  C  CA  . GLY B  1 272 ? 94.363  24.027  -6.296   1.00 23.86  ? 247 GLY B CA  1 
ATOM   5559  C  C   . GLY B  1 272 ? 93.306  24.254  -7.358   1.00 22.88  ? 247 GLY B C   1 
ATOM   5560  O  O   . GLY B  1 272 ? 92.478  23.380  -7.650   1.00 21.58  ? 247 GLY B O   1 
ATOM   5561  N  N   . ALA B  1 273 ? 93.376  25.440  -7.954   1.00 22.63  ? 248 ALA B N   1 
ATOM   5562  C  CA  . ALA B  1 273 ? 92.342  25.956  -8.841   1.00 20.62  ? 248 ALA B CA  1 
ATOM   5563  C  C   . ALA B  1 273 ? 92.928  26.886  -9.901   1.00 19.34  ? 248 ALA B C   1 
ATOM   5564  O  O   . ALA B  1 273 ? 93.968  27.515  -9.684   1.00 18.22  ? 248 ALA B O   1 
ATOM   5565  C  CB  . ALA B  1 273 ? 91.299  26.705  -8.019   1.00 19.19  ? 248 ALA B CB  1 
ATOM   5566  N  N   . LYS B  1 274 ? 92.250  26.947  -11.044  1.00 19.09  ? 249 LYS B N   1 
ATOM   5567  C  CA  . LYS B  1 274 ? 92.345  28.081  -11.971  1.00 19.05  ? 249 LYS B CA  1 
ATOM   5568  C  C   . LYS B  1 274 ? 90.931  28.287  -12.518  1.00 17.88  ? 249 LYS B C   1 
ATOM   5569  O  O   . LYS B  1 274 ? 90.635  27.889  -13.648  1.00 17.37  ? 249 LYS B O   1 
ATOM   5570  C  CB  . LYS B  1 274 ? 93.345  27.820  -13.111  1.00 19.93  ? 249 LYS B CB  1 
ATOM   5571  C  CG  . LYS B  1 274 ? 93.720  29.054  -13.939  1.00 20.47  ? 249 LYS B CG  1 
ATOM   5572  C  CD  . LYS B  1 274 ? 94.716  29.944  -13.180  1.00 21.85  ? 249 LYS B CD  1 
ATOM   5573  C  CE  . LYS B  1 274 ? 94.920  31.305  -13.844  1.00 23.12  ? 249 LYS B CE  1 
ATOM   5574  N  NZ  . LYS B  1 274 ? 96.026  32.093  -13.232  1.00 24.47  ? 249 LYS B NZ  1 
ATOM   5575  N  N   . ASN B  1 275 ? 90.055  28.884  -11.705  1.00 17.01  ? 250 ASN B N   1 
ATOM   5576  C  CA  . ASN B  1 275 ? 88.639  29.016  -12.080  1.00 16.79  ? 250 ASN B CA  1 
ATOM   5577  C  C   . ASN B  1 275 ? 88.407  30.060  -13.194  1.00 16.12  ? 250 ASN B C   1 
ATOM   5578  O  O   . ASN B  1 275 ? 88.834  31.233  -13.066  1.00 14.92  ? 250 ASN B O   1 
ATOM   5579  C  CB  . ASN B  1 275 ? 87.763  29.343  -10.865  1.00 17.57  ? 250 ASN B CB  1 
ATOM   5580  C  CG  . ASN B  1 275 ? 87.635  28.179  -9.887   1.00 19.40  ? 250 ASN B CG  1 
ATOM   5581  O  OD1 . ASN B  1 275 ? 88.357  27.183  -9.977   1.00 18.72  ? 250 ASN B OD1 1 
ATOM   5582  N  ND2 . ASN B  1 275 ? 86.683  28.298  -8.945   1.00 20.16  ? 250 ASN B ND2 1 
ATOM   5583  N  N   . HIS B  1 276 ? 87.713  29.612  -14.250  1.00 16.27  ? 251 HIS B N   1 
ATOM   5584  C  CA  . HIS B  1 276 ? 87.337  30.445  -15.424  1.00 17.29  ? 251 HIS B CA  1 
ATOM   5585  C  C   . HIS B  1 276 ? 85.864  30.894  -15.318  1.00 17.02  ? 251 HIS B C   1 
ATOM   5586  O  O   . HIS B  1 276 ? 84.993  30.118  -14.879  1.00 15.75  ? 251 HIS B O   1 
ATOM   5587  C  CB  . HIS B  1 276 ? 87.452  29.656  -16.754  1.00 16.97  ? 251 HIS B CB  1 
ATOM   5588  C  CG  . HIS B  1 276 ? 88.836  29.196  -17.109  1.00 17.55  ? 251 HIS B CG  1 
ATOM   5589  N  ND1 . HIS B  1 276 ? 89.646  28.494  -16.240  1.00 17.61  ? 251 HIS B ND1 1 
ATOM   5590  C  CD2 . HIS B  1 276 ? 89.519  29.272  -18.280  1.00 17.66  ? 251 HIS B CD2 1 
ATOM   5591  C  CE1 . HIS B  1 276 ? 90.784  28.196  -16.847  1.00 18.18  ? 251 HIS B CE1 1 
ATOM   5592  N  NE2 . HIS B  1 276 ? 90.731  28.656  -18.085  1.00 18.01  ? 251 HIS B NE2 1 
HETATM 5593  N  N   . MSE B  1 277 ? 85.595  32.116  -15.773  1.00 17.73  ? 252 MSE B N   1 
HETATM 5594  C  CA  . MSE B  1 277 ? 84.231  32.588  -16.004  1.00 19.16  ? 252 MSE B CA  1 
HETATM 5595  C  C   . MSE B  1 277 ? 84.109  32.805  -17.500  1.00 19.23  ? 252 MSE B C   1 
HETATM 5596  O  O   . MSE B  1 277 ? 84.857  33.602  -18.068  1.00 19.60  ? 252 MSE B O   1 
HETATM 5597  C  CB  . MSE B  1 277 ? 83.933  33.898  -15.258  1.00 21.30  ? 252 MSE B CB  1 
HETATM 5598  C  CG  . MSE B  1 277 ? 82.503  34.367  -15.533  1.00 26.32  ? 252 MSE B CG  1 
HETATM 5599  SE SE  . MSE B  1 277 ? 82.143  36.233  -14.952  1.00 33.44  ? 252 MSE B SE  1 
HETATM 5600  C  CE  . MSE B  1 277 ? 82.206  35.777  -13.041  1.00 24.61  ? 252 MSE B CE  1 
ATOM   5601  N  N   . ILE B  1 278 ? 83.170  32.105  -18.143  1.00 17.61  ? 253 ILE B N   1 
ATOM   5602  C  CA  . ILE B  1 278 ? 82.827  32.347  -19.548  1.00 17.26  ? 253 ILE B CA  1 
ATOM   5603  C  C   . ILE B  1 278 ? 81.688  33.368  -19.596  1.00 18.33  ? 253 ILE B C   1 
ATOM   5604  O  O   . ILE B  1 278 ? 80.701  33.248  -18.857  1.00 18.90  ? 253 ILE B O   1 
ATOM   5605  C  CB  . ILE B  1 278 ? 82.466  31.027  -20.297  1.00 16.58  ? 253 ILE B CB  1 
ATOM   5606  C  CG1 . ILE B  1 278 ? 83.722  30.188  -20.605  1.00 15.93  ? 253 ILE B CG1 1 
ATOM   5607  C  CG2 . ILE B  1 278 ? 81.773  31.314  -21.627  1.00 16.96  ? 253 ILE B CG2 1 
ATOM   5608  C  CD1 . ILE B  1 278 ? 84.544  29.745  -19.398  1.00 15.41  ? 253 ILE B CD1 1 
ATOM   5609  N  N   . ILE B  1 279 ? 81.841  34.401  -20.421  1.00 18.61  ? 254 ILE B N   1 
ATOM   5610  C  CA  . ILE B  1 279 ? 80.806  35.429  -20.541  1.00 19.53  ? 254 ILE B CA  1 
ATOM   5611  C  C   . ILE B  1 279 ? 80.251  35.425  -21.981  1.00 20.38  ? 254 ILE B C   1 
ATOM   5612  O  O   . ILE B  1 279 ? 80.935  35.872  -22.906  1.00 20.73  ? 254 ILE B O   1 
ATOM   5613  C  CB  . ILE B  1 279 ? 81.336  36.842  -20.138  1.00 20.03  ? 254 ILE B CB  1 
ATOM   5614  C  CG1 . ILE B  1 279 ? 82.038  36.831  -18.766  1.00 19.73  ? 254 ILE B CG1 1 
ATOM   5615  C  CG2 . ILE B  1 279 ? 80.208  37.869  -20.134  1.00 20.37  ? 254 ILE B CG2 1 
ATOM   5616  C  CD1 . ILE B  1 279 ? 83.559  36.817  -18.825  1.00 19.72  ? 254 ILE B CD1 1 
HETATM 5617  N  N   . MSE B  1 280 ? 79.030  34.910  -22.170  1.00 20.49  ? 255 MSE B N   1 
HETATM 5618  C  CA  . MSE B  1 280 ? 78.383  34.890  -23.499  1.00 21.33  ? 255 MSE B CA  1 
HETATM 5619  C  C   . MSE B  1 280 ? 77.933  36.286  -23.859  1.00 21.61  ? 255 MSE B C   1 
HETATM 5620  O  O   . MSE B  1 280 ? 77.727  37.129  -22.970  1.00 20.40  ? 255 MSE B O   1 
HETATM 5621  C  CB  . MSE B  1 280 ? 77.191  33.930  -23.573  1.00 22.93  ? 255 MSE B CB  1 
HETATM 5622  C  CG  . MSE B  1 280 ? 77.576  32.484  -23.261  1.00 27.26  ? 255 MSE B CG  1 
HETATM 5623  SE SE  . MSE B  1 280 ? 78.662  31.708  -24.729  1.00 34.03  ? 255 MSE B SE  1 
HETATM 5624  C  CE  . MSE B  1 280 ? 77.290  31.584  -26.146  1.00 31.45  ? 255 MSE B CE  1 
ATOM   5625  N  N   . PRO B  1 281 ? 77.782  36.562  -25.174  1.00 22.59  ? 256 PRO B N   1 
ATOM   5626  C  CA  . PRO B  1 281 ? 77.463  37.919  -25.647  1.00 23.30  ? 256 PRO B CA  1 
ATOM   5627  C  C   . PRO B  1 281 ? 76.101  38.424  -25.193  1.00 23.42  ? 256 PRO B C   1 
ATOM   5628  O  O   . PRO B  1 281 ? 75.859  39.611  -25.213  1.00 24.30  ? 256 PRO B O   1 
ATOM   5629  C  CB  . PRO B  1 281 ? 77.481  37.780  -27.183  1.00 23.44  ? 256 PRO B CB  1 
ATOM   5630  C  CG  . PRO B  1 281 ? 78.217  36.499  -27.455  1.00 23.36  ? 256 PRO B CG  1 
ATOM   5631  C  CD  . PRO B  1 281 ? 77.903  35.609  -26.292  1.00 22.64  ? 256 PRO B CD  1 
ATOM   5632  N  N   . ASP B  1 282 ? 75.223  37.520  -24.784  1.00 23.73  ? 257 ASP B N   1 
ATOM   5633  C  CA  . ASP B  1 282 ? 73.882  37.895  -24.360  1.00 24.25  ? 257 ASP B CA  1 
ATOM   5634  C  C   . ASP B  1 282 ? 73.824  38.098  -22.846  1.00 24.59  ? 257 ASP B C   1 
ATOM   5635  O  O   . ASP B  1 282 ? 72.774  38.411  -22.300  1.00 24.82  ? 257 ASP B O   1 
ATOM   5636  C  CB  . ASP B  1 282 ? 72.891  36.813  -24.781  1.00 24.68  ? 257 ASP B CB  1 
ATOM   5637  C  CG  . ASP B  1 282 ? 73.130  35.478  -24.063  1.00 25.33  ? 257 ASP B CG  1 
ATOM   5638  O  OD1 . ASP B  1 282 ? 74.268  35.213  -23.615  1.00 25.76  ? 257 ASP B OD1 1 
ATOM   5639  O  OD2 . ASP B  1 282 ? 72.172  34.687  -23.947  1.00 25.05  ? 257 ASP B OD2 1 
ATOM   5640  N  N   . ALA B  1 283 ? 74.956  37.916  -22.174  1.00 24.43  ? 258 ALA B N   1 
ATOM   5641  C  CA  . ALA B  1 283 ? 75.009  38.001  -20.710  1.00 23.77  ? 258 ALA B CA  1 
ATOM   5642  C  C   . ALA B  1 283 ? 74.659  39.412  -20.194  1.00 23.67  ? 258 ALA B C   1 
ATOM   5643  O  O   . ALA B  1 283 ? 74.803  40.396  -20.916  1.00 23.51  ? 258 ALA B O   1 
ATOM   5644  C  CB  . ALA B  1 283 ? 76.393  37.602  -20.228  1.00 22.23  ? 258 ALA B CB  1 
ATOM   5645  N  N   . ASP B  1 284 ? 74.212  39.499  -18.946  1.00 24.10  ? 259 ASP B N   1 
ATOM   5646  C  CA  . ASP B  1 284 ? 74.138  40.785  -18.242  1.00 27.67  ? 259 ASP B CA  1 
ATOM   5647  C  C   . ASP B  1 284 ? 75.574  41.217  -17.885  1.00 28.28  ? 259 ASP B C   1 
ATOM   5648  O  O   . ASP B  1 284 ? 76.159  40.765  -16.881  1.00 26.82  ? 259 ASP B O   1 
ATOM   5649  C  CB  . ASP B  1 284 ? 73.262  40.664  -16.988  1.00 29.42  ? 259 ASP B CB  1 
ATOM   5650  C  CG  . ASP B  1 284 ? 72.955  42.004  -16.344  1.00 32.78  ? 259 ASP B CG  1 
ATOM   5651  O  OD1 . ASP B  1 284 ? 73.804  42.922  -16.398  1.00 32.62  ? 259 ASP B OD1 1 
ATOM   5652  O  OD2 . ASP B  1 284 ? 71.856  42.129  -15.758  1.00 36.37  ? 259 ASP B OD2 1 
ATOM   5653  N  N   . LEU B  1 285 ? 76.143  42.083  -18.722  1.00 28.90  ? 260 LEU B N   1 
ATOM   5654  C  CA  . LEU B  1 285 ? 77.559  42.432  -18.612  1.00 29.16  ? 260 LEU B CA  1 
ATOM   5655  C  C   . LEU B  1 285 ? 77.899  43.229  -17.353  1.00 28.60  ? 260 LEU B C   1 
ATOM   5656  O  O   . LEU B  1 285 ? 79.005  43.100  -16.825  1.00 27.88  ? 260 LEU B O   1 
ATOM   5657  C  CB  . LEU B  1 285 ? 78.037  43.169  -19.858  1.00 30.81  ? 260 LEU B CB  1 
ATOM   5658  C  CG  . LEU B  1 285 ? 77.956  42.430  -21.193  1.00 31.53  ? 260 LEU B CG  1 
ATOM   5659  C  CD1 . LEU B  1 285 ? 78.471  43.348  -22.292  1.00 31.75  ? 260 LEU B CD1 1 
ATOM   5660  C  CD2 . LEU B  1 285 ? 78.753  41.131  -21.145  1.00 30.83  ? 260 LEU B CD2 1 
ATOM   5661  N  N   . ASP B  1 286 ? 76.950  44.037  -16.879  1.00 28.41  ? 261 ASP B N   1 
ATOM   5662  C  CA  . ASP B  1 286 ? 77.097  44.775  -15.614  1.00 27.95  ? 261 ASP B CA  1 
ATOM   5663  C  C   . ASP B  1 286 ? 77.314  43.832  -14.450  1.00 25.30  ? 261 ASP B C   1 
ATOM   5664  O  O   . ASP B  1 286 ? 78.253  44.002  -13.659  1.00 24.31  ? 261 ASP B O   1 
ATOM   5665  C  CB  . ASP B  1 286 ? 75.859  45.627  -15.372  1.00 29.61  ? 261 ASP B CB  1 
ATOM   5666  C  CG  . ASP B  1 286 ? 75.623  46.591  -16.488  1.00 32.57  ? 261 ASP B CG  1 
ATOM   5667  O  OD1 . ASP B  1 286 ? 76.577  47.333  -16.810  1.00 34.84  ? 261 ASP B OD1 1 
ATOM   5668  O  OD2 . ASP B  1 286 ? 74.514  46.590  -17.060  1.00 33.13  ? 261 ASP B OD2 1 
ATOM   5669  N  N   . GLN B  1 287 ? 76.454  42.821  -14.378  1.00 23.59  ? 262 GLN B N   1 
ATOM   5670  C  CA  . GLN B  1 287 ? 76.571  41.775  -13.371  1.00 23.49  ? 262 GLN B CA  1 
ATOM   5671  C  C   . GLN B  1 287 ? 77.808  40.888  -13.531  1.00 21.55  ? 262 GLN B C   1 
ATOM   5672  O  O   . GLN B  1 287 ? 78.450  40.562  -12.532  1.00 21.49  ? 262 GLN B O   1 
ATOM   5673  C  CB  . GLN B  1 287 ? 75.275  40.953  -13.291  1.00 24.61  ? 262 GLN B CB  1 
ATOM   5674  C  CG  . GLN B  1 287 ? 74.083  41.848  -12.942  1.00 26.59  ? 262 GLN B CG  1 
ATOM   5675  C  CD  . GLN B  1 287 ? 72.778  41.103  -12.739  1.00 28.54  ? 262 GLN B CD  1 
ATOM   5676  O  OE1 . GLN B  1 287 ? 72.570  39.998  -13.258  1.00 28.65  ? 262 GLN B OE1 1 
ATOM   5677  N  NE2 . GLN B  1 287 ? 71.878  41.716  -11.976  1.00 28.67  ? 262 GLN B NE2 1 
ATOM   5678  N  N   . ALA B  1 288 ? 78.146  40.502  -14.761  1.00 19.62  ? 263 ALA B N   1 
ATOM   5679  C  CA  . ALA B  1 288 ? 79.402  39.784  -14.994  1.00 19.18  ? 263 ALA B CA  1 
ATOM   5680  C  C   . ALA B  1 288 ? 80.615  40.583  -14.483  1.00 19.48  ? 263 ALA B C   1 
ATOM   5681  O  O   . ALA B  1 288 ? 81.514  40.017  -13.863  1.00 19.79  ? 263 ALA B O   1 
ATOM   5682  C  CB  . ALA B  1 288 ? 79.580  39.420  -16.470  1.00 18.40  ? 263 ALA B CB  1 
ATOM   5683  N  N   . ALA B  1 289 ? 80.625  41.891  -14.733  1.00 19.30  ? 264 ALA B N   1 
ATOM   5684  C  CA  . ALA B  1 289 ? 81.768  42.726  -14.366  1.00 20.23  ? 264 ALA B CA  1 
ATOM   5685  C  C   . ALA B  1 289 ? 81.876  42.888  -12.843  1.00 20.80  ? 264 ALA B C   1 
ATOM   5686  O  O   . ALA B  1 289 ? 82.958  42.716  -12.289  1.00 21.36  ? 264 ALA B O   1 
ATOM   5687  C  CB  . ALA B  1 289 ? 81.711  44.080  -15.070  1.00 20.36  ? 264 ALA B CB  1 
ATOM   5688  N  N   . ASN B  1 290 ? 80.760  43.183  -12.179  1.00 20.94  ? 265 ASN B N   1 
ATOM   5689  C  CA  . ASN B  1 290 ? 80.716  43.214  -10.711  1.00 22.69  ? 265 ASN B CA  1 
ATOM   5690  C  C   . ASN B  1 290 ? 81.185  41.912  -10.082  1.00 22.25  ? 265 ASN B C   1 
ATOM   5691  O  O   . ASN B  1 290 ? 81.986  41.927  -9.155   1.00 22.75  ? 265 ASN B O   1 
ATOM   5692  C  CB  . ASN B  1 290 ? 79.318  43.581  -10.193  1.00 23.42  ? 265 ASN B CB  1 
ATOM   5693  C  CG  . ASN B  1 290 ? 79.078  45.072  -10.235  1.00 26.24  ? 265 ASN B CG  1 
ATOM   5694  O  OD1 . ASN B  1 290 ? 80.029  45.850  -10.273  1.00 26.76  ? 265 ASN B OD1 1 
ATOM   5695  N  ND2 . ASN B  1 290 ? 77.817  45.481  -10.252  1.00 26.66  ? 265 ASN B ND2 1 
ATOM   5696  N  N   . ALA B  1 291 ? 80.710  40.798  -10.628  1.00 21.75  ? 266 ALA B N   1 
ATOM   5697  C  CA  . ALA B  1 291 ? 81.083  39.472  -10.146  1.00 23.15  ? 266 ALA B CA  1 
ATOM   5698  C  C   . ALA B  1 291 ? 82.586  39.224  -10.312  1.00 25.09  ? 266 ALA B C   1 
ATOM   5699  O  O   . ALA B  1 291 ? 83.210  38.592  -9.465   1.00 26.84  ? 266 ALA B O   1 
ATOM   5700  C  CB  . ALA B  1 291 ? 80.272  38.399  -10.863  1.00 21.84  ? 266 ALA B CB  1 
ATOM   5701  N  N   . LEU B  1 292 ? 83.160  39.738  -11.399  1.00 24.79  ? 267 LEU B N   1 
ATOM   5702  C  CA  . LEU B  1 292 ? 84.594  39.620  -11.643  1.00 23.70  ? 267 LEU B CA  1 
ATOM   5703  C  C   . LEU B  1 292 ? 85.423  40.431  -10.664  1.00 23.92  ? 267 LEU B C   1 
ATOM   5704  O  O   . LEU B  1 292 ? 86.502  39.997  -10.289  1.00 23.84  ? 267 LEU B O   1 
ATOM   5705  C  CB  . LEU B  1 292 ? 84.945  39.990  -13.081  1.00 23.28  ? 267 LEU B CB  1 
ATOM   5706  C  CG  . LEU B  1 292 ? 84.591  38.920  -14.117  1.00 24.72  ? 267 LEU B CG  1 
ATOM   5707  C  CD1 . LEU B  1 292 ? 84.752  39.442  -15.552  1.00 25.02  ? 267 LEU B CD1 1 
ATOM   5708  C  CD2 . LEU B  1 292 ? 85.395  37.636  -13.868  1.00 23.93  ? 267 LEU B CD2 1 
ATOM   5709  N  N   . ILE B  1 293 ? 84.913  41.595  -10.249  1.00 24.63  ? 268 ILE B N   1 
ATOM   5710  C  CA  . ILE B  1 293 ? 85.584  42.410  -9.233   1.00 25.31  ? 268 ILE B CA  1 
ATOM   5711  C  C   . ILE B  1 293 ? 85.575  41.645  -7.910   1.00 24.18  ? 268 ILE B C   1 
ATOM   5712  O  O   . ILE B  1 293 ? 86.626  41.464  -7.302   1.00 23.24  ? 268 ILE B O   1 
ATOM   5713  C  CB  . ILE B  1 293 ? 84.956  43.835  -9.090   1.00 25.90  ? 268 ILE B CB  1 
ATOM   5714  C  CG1 . ILE B  1 293 ? 85.162  44.667  -10.371  1.00 25.80  ? 268 ILE B CG1 1 
ATOM   5715  C  CG2 . ILE B  1 293 ? 85.511  44.583  -7.881   1.00 25.72  ? 268 ILE B CG2 1 
ATOM   5716  C  CD1 . ILE B  1 293 ? 86.614  44.853  -10.793  1.00 26.25  ? 268 ILE B CD1 1 
ATOM   5717  N  N   . GLY B  1 294 ? 84.389  41.180  -7.499   1.00 23.94  ? 269 GLY B N   1 
ATOM   5718  C  CA  . GLY B  1 294 ? 84.234  40.425  -6.254   1.00 23.05  ? 269 GLY B CA  1 
ATOM   5719  C  C   . GLY B  1 294 ? 85.091  39.167  -6.257   1.00 22.80  ? 269 GLY B C   1 
ATOM   5720  O  O   . GLY B  1 294 ? 85.903  38.947  -5.339   1.00 22.94  ? 269 GLY B O   1 
ATOM   5721  N  N   . ALA B  1 295 ? 84.934  38.353  -7.298   1.00 21.53  ? 270 ALA B N   1 
ATOM   5722  C  CA  . ALA B  1 295 ? 85.555  37.020  -7.329   1.00 21.66  ? 270 ALA B CA  1 
ATOM   5723  C  C   . ALA B  1 295 ? 87.044  37.057  -7.687   1.00 21.98  ? 270 ALA B C   1 
ATOM   5724  O  O   . ALA B  1 295 ? 87.823  36.236  -7.208   1.00 22.12  ? 270 ALA B O   1 
ATOM   5725  C  CB  . ALA B  1 295 ? 84.790  36.081  -8.259   1.00 21.56  ? 270 ALA B CB  1 
ATOM   5726  N  N   . GLY B  1 296 ? 87.437  38.020  -8.516   1.00 22.26  ? 271 GLY B N   1 
ATOM   5727  C  CA  . GLY B  1 296 ? 88.835  38.170  -8.899   1.00 21.65  ? 271 GLY B CA  1 
ATOM   5728  C  C   . GLY B  1 296 ? 89.718  38.751  -7.806   1.00 21.44  ? 271 GLY B C   1 
ATOM   5729  O  O   . GLY B  1 296 ? 90.850  38.302  -7.614   1.00 22.57  ? 271 GLY B O   1 
ATOM   5730  N  N   . TYR B  1 297 ? 89.206  39.744  -7.091   1.00 20.25  ? 272 TYR B N   1 
ATOM   5731  C  CA  . TYR B  1 297 ? 90.043  40.527  -6.171   1.00 21.42  ? 272 TYR B CA  1 
ATOM   5732  C  C   . TYR B  1 297 ? 89.699  40.410  -4.680   1.00 21.28  ? 272 TYR B C   1 
ATOM   5733  O  O   . TYR B  1 297 ? 90.491  40.821  -3.836   1.00 21.52  ? 272 TYR B O   1 
ATOM   5734  C  CB  . TYR B  1 297 ? 90.091  41.995  -6.620   1.00 21.42  ? 272 TYR B CB  1 
ATOM   5735  C  CG  . TYR B  1 297 ? 90.597  42.138  -8.044   1.00 22.18  ? 272 TYR B CG  1 
ATOM   5736  C  CD1 . TYR B  1 297 ? 91.978  42.238  -8.317   1.00 22.80  ? 272 TYR B CD1 1 
ATOM   5737  C  CD2 . TYR B  1 297 ? 89.706  42.138  -9.127   1.00 21.93  ? 272 TYR B CD2 1 
ATOM   5738  C  CE1 . TYR B  1 297 ? 92.445  42.367  -9.629   1.00 22.79  ? 272 TYR B CE1 1 
ATOM   5739  C  CE2 . TYR B  1 297 ? 90.164  42.253  -10.433  1.00 22.79  ? 272 TYR B CE2 1 
ATOM   5740  C  CZ  . TYR B  1 297 ? 91.531  42.369  -10.685  1.00 22.66  ? 272 TYR B CZ  1 
ATOM   5741  O  OH  . TYR B  1 297 ? 91.968  42.493  -11.986  1.00 22.17  ? 272 TYR B OH  1 
ATOM   5742  N  N   . GLY B  1 298 ? 88.538  39.835  -4.363   1.00 20.65  ? 273 GLY B N   1 
ATOM   5743  C  CA  . GLY B  1 298 ? 88.178  39.546  -2.970   1.00 21.54  ? 273 GLY B CA  1 
ATOM   5744  C  C   . GLY B  1 298 ? 89.217  38.633  -2.334   1.00 22.25  ? 273 GLY B C   1 
ATOM   5745  O  O   . GLY B  1 298 ? 89.707  37.687  -2.979   1.00 21.78  ? 273 GLY B O   1 
ATOM   5746  N  N   . SER B  1 299 ? 89.567  38.935  -1.082   1.00 23.02  ? 274 SER B N   1 
ATOM   5747  C  CA  . SER B  1 299 ? 90.642  38.241  -0.334   1.00 24.61  ? 274 SER B CA  1 
ATOM   5748  C  C   . SER B  1 299 ? 92.002  38.337  -1.024   1.00 25.32  ? 274 SER B C   1 
ATOM   5749  O  O   . SER B  1 299 ? 92.842  37.453  -0.868   1.00 25.89  ? 274 SER B O   1 
ATOM   5750  C  CB  . SER B  1 299 ? 90.283  36.766  -0.089   1.00 25.06  ? 274 SER B CB  1 
ATOM   5751  O  OG  . SER B  1 299 ? 89.216  36.647  0.826    1.00 25.84  ? 274 SER B OG  1 
ATOM   5752  N  N   . ALA B  1 300 ? 92.205  39.422  -1.772   1.00 26.02  ? 275 ALA B N   1 
ATOM   5753  C  CA  . ALA B  1 300 ? 93.394  39.640  -2.609   1.00 25.61  ? 275 ALA B CA  1 
ATOM   5754  C  C   . ALA B  1 300 ? 93.628  38.443  -3.533   1.00 24.93  ? 275 ALA B C   1 
ATOM   5755  O  O   . ALA B  1 300 ? 94.770  38.141  -3.894   1.00 24.70  ? 275 ALA B O   1 
ATOM   5756  C  CB  . ALA B  1 300 ? 94.629  39.948  -1.762   1.00 25.42  ? 275 ALA B CB  1 
ATOM   5757  N  N   . GLY B  1 301 ? 92.526  37.782  -3.905   1.00 23.63  ? 276 GLY B N   1 
ATOM   5758  C  CA  . GLY B  1 301 ? 92.548  36.626  -4.788   1.00 23.35  ? 276 GLY B CA  1 
ATOM   5759  C  C   . GLY B  1 301 ? 93.036  35.328  -4.153   1.00 24.31  ? 276 GLY B C   1 
ATOM   5760  O  O   . GLY B  1 301 ? 93.303  34.350  -4.859   1.00 25.32  ? 276 GLY B O   1 
ATOM   5761  N  N   . GLU B  1 302 ? 93.157  35.297  -2.828   1.00 22.87  ? 277 GLU B N   1 
ATOM   5762  C  CA  . GLU B  1 302 ? 93.703  34.117  -2.150   1.00 22.71  ? 277 GLU B CA  1 
ATOM   5763  C  C   . GLU B  1 302 ? 92.631  33.066  -1.850   1.00 23.69  ? 277 GLU B C   1 
ATOM   5764  O  O   . GLU B  1 302 ? 92.365  32.740  -0.685   1.00 23.05  ? 277 GLU B O   1 
ATOM   5765  C  CB  . GLU B  1 302 ? 94.427  34.524  -0.871   1.00 22.78  ? 277 GLU B CB  1 
ATOM   5766  C  CG  . GLU B  1 302 ? 95.632  35.432  -1.106   1.00 24.19  ? 277 GLU B CG  1 
ATOM   5767  C  CD  . GLU B  1 302 ? 96.261  35.883  0.193    1.00 25.01  ? 277 GLU B CD  1 
ATOM   5768  O  OE1 . GLU B  1 302 ? 97.489  35.716  0.353    1.00 26.08  ? 277 GLU B OE1 1 
ATOM   5769  O  OE2 . GLU B  1 302 ? 95.522  36.387  1.066    1.00 24.87  ? 277 GLU B OE2 1 
ATOM   5770  N  N   . ARG B  1 303 ? 92.025  32.530  -2.909   1.00 24.39  ? 278 ARG B N   1 
ATOM   5771  C  CA  . ARG B  1 303 ? 90.902  31.603  -2.774   1.00 24.94  ? 278 ARG B CA  1 
ATOM   5772  C  C   . ARG B  1 303 ? 90.989  30.540  -3.845   1.00 26.88  ? 278 ARG B C   1 
ATOM   5773  O  O   . ARG B  1 303 ? 91.288  30.850  -5.007   1.00 26.63  ? 278 ARG B O   1 
ATOM   5774  C  CB  . ARG B  1 303 ? 89.577  32.346  -2.939   1.00 24.58  ? 278 ARG B CB  1 
ATOM   5775  C  CG  . ARG B  1 303 ? 89.287  33.377  -1.858   1.00 26.52  ? 278 ARG B CG  1 
ATOM   5776  C  CD  . ARG B  1 303 ? 87.855  33.870  -1.925   1.00 26.87  ? 278 ARG B CD  1 
ATOM   5777  N  NE  . ARG B  1 303 ? 86.940  32.740  -1.803   1.00 28.60  ? 278 ARG B NE  1 
ATOM   5778  C  CZ  . ARG B  1 303 ? 85.618  32.839  -1.737   1.00 26.48  ? 278 ARG B CZ  1 
ATOM   5779  N  NH1 . ARG B  1 303 ? 84.893  31.738  -1.626   1.00 24.85  ? 278 ARG B NH1 1 
ATOM   5780  N  NH2 . ARG B  1 303 ? 85.029  34.033  -1.777   1.00 26.33  ? 278 ARG B NH2 1 
ATOM   5781  N  N   . CYS B  1 304 ? 90.702  29.294  -3.477   1.00 28.08  ? 279 CYS B N   1 
ATOM   5782  C  CA  . CYS B  1 304 ? 90.607  28.218  -4.480   1.00 29.33  ? 279 CYS B CA  1 
ATOM   5783  C  C   . CYS B  1 304 ? 89.304  28.298  -5.284   1.00 25.82  ? 279 CYS B C   1 
ATOM   5784  O  O   . CYS B  1 304 ? 89.090  27.491  -6.198   1.00 25.87  ? 279 CYS B O   1 
ATOM   5785  C  CB  . CYS B  1 304 ? 90.733  26.829  -3.850   1.00 32.32  ? 279 CYS B CB  1 
ATOM   5786  S  SG  . CYS B  1 304 ? 89.212  26.271  -3.042   1.00 37.51  ? 279 CYS B SG  1 
HETATM 5787  N  N   . MSE B  1 305 ? 88.430  29.241  -4.926   1.00 22.50  ? 280 MSE B N   1 
HETATM 5788  C  CA  . MSE B  1 305 ? 87.250  29.532  -5.741   1.00 20.84  ? 280 MSE B CA  1 
HETATM 5789  C  C   . MSE B  1 305 ? 87.279  30.970  -6.220   1.00 19.24  ? 280 MSE B C   1 
HETATM 5790  O  O   . MSE B  1 305 ? 86.249  31.520  -6.612   1.00 19.24  ? 280 MSE B O   1 
HETATM 5791  C  CB  . MSE B  1 305 ? 85.932  29.201  -5.010   1.00 22.73  ? 280 MSE B CB  1 
HETATM 5792  C  CG  . MSE B  1 305 ? 85.835  27.726  -4.604   1.00 24.00  ? 280 MSE B CG  1 
HETATM 5793  SE SE  . MSE B  1 305 ? 85.660  26.564  -6.198   1.00 27.27  ? 280 MSE B SE  1 
HETATM 5794  C  CE  . MSE B  1 305 ? 83.707  26.847  -6.370   1.00 25.01  ? 280 MSE B CE  1 
ATOM   5795  N  N   . ALA B  1 306 ? 88.447  31.600  -6.213   1.00 18.53  ? 281 ALA B N   1 
ATOM   5796  C  CA  . ALA B  1 306 ? 88.588  32.913  -6.879   1.00 18.87  ? 281 ALA B CA  1 
ATOM   5797  C  C   . ALA B  1 306 ? 88.438  32.701  -8.395   1.00 18.61  ? 281 ALA B C   1 
ATOM   5798  O  O   . ALA B  1 306 ? 88.832  31.650  -8.903   1.00 18.80  ? 281 ALA B O   1 
ATOM   5799  C  CB  . ALA B  1 306 ? 89.953  33.542  -6.571   1.00 18.58  ? 281 ALA B CB  1 
ATOM   5800  N  N   . ILE B  1 307 ? 87.859  33.665  -9.109   1.00 18.11  ? 282 ILE B N   1 
ATOM   5801  C  CA  . ILE B  1 307 ? 87.939  33.647  -10.576  1.00 18.10  ? 282 ILE B CA  1 
ATOM   5802  C  C   . ILE B  1 307 ? 89.256  34.297  -10.996  1.00 18.82  ? 282 ILE B C   1 
ATOM   5803  O  O   . ILE B  1 307 ? 89.514  35.465  -10.684  1.00 19.57  ? 282 ILE B O   1 
ATOM   5804  C  CB  . ILE B  1 307 ? 86.761  34.357  -11.279  1.00 17.76  ? 282 ILE B CB  1 
ATOM   5805  C  CG1 . ILE B  1 307 ? 85.428  33.641  -10.993  1.00 18.02  ? 282 ILE B CG1 1 
ATOM   5806  C  CG2 . ILE B  1 307 ? 87.030  34.502  -12.784  1.00 17.31  ? 282 ILE B CG2 1 
ATOM   5807  C  CD1 . ILE B  1 307 ? 85.314  32.220  -11.522  1.00 18.32  ? 282 ILE B CD1 1 
ATOM   5808  N  N   . SER B  1 308 ? 90.084  33.534  -11.702  1.00 18.26  ? 283 SER B N   1 
ATOM   5809  C  CA  . SER B  1 308 ? 91.376  34.045  -12.149  1.00 18.64  ? 283 SER B CA  1 
ATOM   5810  C  C   . SER B  1 308 ? 91.496  34.144  -13.678  1.00 18.77  ? 283 SER B C   1 
ATOM   5811  O  O   . SER B  1 308 ? 92.487  34.673  -14.174  1.00 19.33  ? 283 SER B O   1 
ATOM   5812  C  CB  . SER B  1 308 ? 92.504  33.189  -11.566  1.00 18.82  ? 283 SER B CB  1 
ATOM   5813  O  OG  . SER B  1 308 ? 92.246  31.817  -11.787  1.00 18.44  ? 283 SER B OG  1 
ATOM   5814  N  N   . VAL B  1 309 ? 90.508  33.617  -14.412  1.00 17.81  ? 284 VAL B N   1 
ATOM   5815  C  CA  . VAL B  1 309 ? 90.430  33.793  -15.869  1.00 18.69  ? 284 VAL B CA  1 
ATOM   5816  C  C   . VAL B  1 309 ? 89.011  34.240  -16.272  1.00 19.15  ? 284 VAL B C   1 
ATOM   5817  O  O   . VAL B  1 309 ? 88.016  33.588  -15.906  1.00 18.36  ? 284 VAL B O   1 
ATOM   5818  C  CB  . VAL B  1 309 ? 90.820  32.510  -16.666  1.00 18.61  ? 284 VAL B CB  1 
ATOM   5819  C  CG1 . VAL B  1 309 ? 91.038  32.848  -18.131  1.00 18.78  ? 284 VAL B CG1 1 
ATOM   5820  C  CG2 . VAL B  1 309 ? 92.084  31.857  -16.111  1.00 18.16  ? 284 VAL B CG2 1 
ATOM   5821  N  N   . ALA B  1 310 ? 88.927  35.356  -16.996  1.00 19.60  ? 285 ALA B N   1 
ATOM   5822  C  CA  . ALA B  1 310 ? 87.662  35.803  -17.597  1.00 20.20  ? 285 ALA B CA  1 
ATOM   5823  C  C   . ALA B  1 310 ? 87.729  35.488  -19.087  1.00 21.39  ? 285 ALA B C   1 
ATOM   5824  O  O   . ALA B  1 310 ? 88.686  35.891  -19.772  1.00 21.92  ? 285 ALA B O   1 
ATOM   5825  C  CB  . ALA B  1 310 ? 87.434  37.299  -17.361  1.00 19.95  ? 285 ALA B CB  1 
ATOM   5826  N  N   . VAL B  1 311 ? 86.727  34.754  -19.580  1.00 21.11  ? 286 VAL B N   1 
ATOM   5827  C  CA  . VAL B  1 311 ? 86.685  34.279  -20.970  1.00 21.60  ? 286 VAL B CA  1 
ATOM   5828  C  C   . VAL B  1 311 ? 85.456  34.892  -21.679  1.00 21.81  ? 286 VAL B C   1 
ATOM   5829  O  O   . VAL B  1 311 ? 84.406  34.250  -21.794  1.00 21.35  ? 286 VAL B O   1 
ATOM   5830  C  CB  . VAL B  1 311 ? 86.688  32.715  -21.045  1.00 21.74  ? 286 VAL B CB  1 
ATOM   5831  C  CG1 . VAL B  1 311 ? 86.712  32.208  -22.490  1.00 21.02  ? 286 VAL B CG1 1 
ATOM   5832  C  CG2 . VAL B  1 311 ? 87.864  32.135  -20.267  1.00 21.63  ? 286 VAL B CG2 1 
ATOM   5833  N  N   . PRO B  1 312 ? 85.569  36.157  -22.122  1.00 21.73  ? 287 PRO B N   1 
ATOM   5834  C  CA  . PRO B  1 312 ? 84.461  36.730  -22.879  1.00 22.13  ? 287 PRO B CA  1 
ATOM   5835  C  C   . PRO B  1 312 ? 84.411  36.122  -24.298  1.00 22.87  ? 287 PRO B C   1 
ATOM   5836  O  O   . PRO B  1 312 ? 85.461  35.809  -24.884  1.00 22.72  ? 287 PRO B O   1 
ATOM   5837  C  CB  . PRO B  1 312 ? 84.812  38.227  -22.929  1.00 22.32  ? 287 PRO B CB  1 
ATOM   5838  C  CG  . PRO B  1 312 ? 86.311  38.259  -22.847  1.00 21.78  ? 287 PRO B CG  1 
ATOM   5839  C  CD  . PRO B  1 312 ? 86.676  37.120  -21.936  1.00 21.49  ? 287 PRO B CD  1 
ATOM   5840  N  N   . VAL B  1 313 ? 83.202  35.955  -24.829  1.00 22.34  ? 288 VAL B N   1 
ATOM   5841  C  CA  . VAL B  1 313 ? 83.013  35.386  -26.156  1.00 22.67  ? 288 VAL B CA  1 
ATOM   5842  C  C   . VAL B  1 313 ? 82.663  36.522  -27.110  1.00 23.27  ? 288 VAL B C   1 
ATOM   5843  O  O   . VAL B  1 313 ? 81.656  37.216  -26.921  1.00 23.35  ? 288 VAL B O   1 
ATOM   5844  C  CB  . VAL B  1 313 ? 81.899  34.301  -26.147  1.00 21.96  ? 288 VAL B CB  1 
ATOM   5845  C  CG1 . VAL B  1 313 ? 81.788  33.598  -27.498  1.00 21.07  ? 288 VAL B CG1 1 
ATOM   5846  C  CG2 . VAL B  1 313 ? 82.151  33.296  -25.031  1.00 21.82  ? 288 VAL B CG2 1 
ATOM   5847  N  N   . GLY B  1 314 ? 83.503  36.707  -28.123  1.00 24.27  ? 289 GLY B N   1 
ATOM   5848  C  CA  . GLY B  1 314 ? 83.318  37.763  -29.106  1.00 26.47  ? 289 GLY B CA  1 
ATOM   5849  C  C   . GLY B  1 314 ? 84.082  39.023  -28.726  1.00 29.64  ? 289 GLY B C   1 
ATOM   5850  O  O   . GLY B  1 314 ? 84.336  39.284  -27.537  1.00 28.99  ? 289 GLY B O   1 
ATOM   5851  N  N   . GLU B  1 315 ? 84.439  39.809  -29.738  1.00 32.30  ? 290 GLU B N   1 
ATOM   5852  C  CA  . GLU B  1 315 ? 85.220  41.022  -29.542  1.00 35.07  ? 290 GLU B CA  1 
ATOM   5853  C  C   . GLU B  1 315 ? 84.469  42.094  -28.766  1.00 34.03  ? 290 GLU B C   1 
ATOM   5854  O  O   . GLU B  1 315 ? 85.037  42.730  -27.867  1.00 33.31  ? 290 GLU B O   1 
ATOM   5855  C  CB  . GLU B  1 315 ? 85.695  41.580  -30.885  1.00 39.05  ? 290 GLU B CB  1 
ATOM   5856  C  CG  . GLU B  1 315 ? 86.975  40.929  -31.391  1.00 45.71  ? 290 GLU B CG  1 
ATOM   5857  C  CD  . GLU B  1 315 ? 88.157  41.158  -30.458  1.00 51.01  ? 290 GLU B CD  1 
ATOM   5858  O  OE1 . GLU B  1 315 ? 88.739  42.264  -30.517  1.00 56.05  ? 290 GLU B OE1 1 
ATOM   5859  O  OE2 . GLU B  1 315 ? 88.508  40.236  -29.675  1.00 47.43  ? 290 GLU B OE2 1 
ATOM   5860  N  N   . GLU B  1 316 ? 83.203  42.290  -29.117  1.00 32.93  ? 291 GLU B N   1 
ATOM   5861  C  CA  . GLU B  1 316 ? 82.424  43.362  -28.533  1.00 35.53  ? 291 GLU B CA  1 
ATOM   5862  C  C   . GLU B  1 316 ? 82.187  43.097  -27.037  1.00 33.84  ? 291 GLU B C   1 
ATOM   5863  O  O   . GLU B  1 316 ? 82.291  44.013  -26.216  1.00 33.89  ? 291 GLU B O   1 
ATOM   5864  C  CB  . GLU B  1 316 ? 81.110  43.559  -29.287  1.00 37.44  ? 291 GLU B CB  1 
ATOM   5865  C  CG  . GLU B  1 316 ? 80.469  44.911  -29.022  1.00 42.69  ? 291 GLU B CG  1 
ATOM   5866  C  CD  . GLU B  1 316 ? 78.970  44.914  -29.268  1.00 51.30  ? 291 GLU B CD  1 
ATOM   5867  O  OE1 . GLU B  1 316 ? 78.377  46.010  -29.297  1.00 56.36  ? 291 GLU B OE1 1 
ATOM   5868  O  OE2 . GLU B  1 316 ? 78.373  43.827  -29.431  1.00 53.78  ? 291 GLU B OE2 1 
ATOM   5869  N  N   . THR B  1 317 ? 81.897  41.838  -26.698  1.00 30.33  ? 292 THR B N   1 
ATOM   5870  C  CA  . THR B  1 317 ? 81.804  41.402  -25.294  1.00 26.84  ? 292 THR B CA  1 
ATOM   5871  C  C   . THR B  1 317 ? 83.120  41.635  -24.542  1.00 24.52  ? 292 THR B C   1 
ATOM   5872  O  O   . THR B  1 317 ? 83.105  42.175  -23.438  1.00 23.41  ? 292 THR B O   1 
ATOM   5873  C  CB  . THR B  1 317 ? 81.407  39.916  -25.165  1.00 25.97  ? 292 THR B CB  1 
ATOM   5874  O  OG1 . THR B  1 317 ? 80.243  39.663  -25.953  1.00 26.69  ? 292 THR B OG1 1 
ATOM   5875  C  CG2 . THR B  1 317 ? 81.125  39.543  -23.712  1.00 25.64  ? 292 THR B CG2 1 
ATOM   5876  N  N   . ALA B  1 318 ? 84.244  41.227  -25.139  1.00 23.67  ? 293 ALA B N   1 
ATOM   5877  C  CA  . ALA B  1 318 ? 85.560  41.444  -24.523  1.00 24.49  ? 293 ALA B CA  1 
ATOM   5878  C  C   . ALA B  1 318 ? 85.875  42.944  -24.289  1.00 25.95  ? 293 ALA B C   1 
ATOM   5879  O  O   . ALA B  1 318 ? 86.278  43.344  -23.187  1.00 25.61  ? 293 ALA B O   1 
ATOM   5880  C  CB  . ALA B  1 318 ? 86.655  40.786  -25.347  1.00 24.28  ? 293 ALA B CB  1 
ATOM   5881  N  N   . ASN B  1 319 ? 85.663  43.759  -25.316  1.00 26.49  ? 294 ASN B N   1 
ATOM   5882  C  CA  . ASN B  1 319 ? 85.974  45.186  -25.237  1.00 28.55  ? 294 ASN B CA  1 
ATOM   5883  C  C   . ASN B  1 319 ? 85.087  45.921  -24.228  1.00 28.41  ? 294 ASN B C   1 
ATOM   5884  O  O   . ASN B  1 319 ? 85.595  46.706  -23.429  1.00 27.79  ? 294 ASN B O   1 
ATOM   5885  C  CB  . ASN B  1 319 ? 85.938  45.849  -26.628  1.00 29.05  ? 294 ASN B CB  1 
ATOM   5886  C  CG  . ASN B  1 319 ? 87.001  45.299  -27.567  1.00 29.16  ? 294 ASN B CG  1 
ATOM   5887  O  OD1 . ASN B  1 319 ? 88.006  44.742  -27.137  1.00 28.12  ? 294 ASN B OD1 1 
ATOM   5888  N  ND2 . ASN B  1 319 ? 86.778  45.456  -28.859  1.00 30.60  ? 294 ASN B ND2 1 
ATOM   5889  N  N   . ARG B  1 320 ? 83.782  45.644  -24.239  1.00 27.78  ? 295 ARG B N   1 
ATOM   5890  C  CA  . ARG B  1 320 ? 82.878  46.253  -23.256  1.00 27.88  ? 295 ARG B CA  1 
ATOM   5891  C  C   . ARG B  1 320 ? 83.191  45.831  -21.815  1.00 28.42  ? 295 ARG B C   1 
ATOM   5892  O  O   . ARG B  1 320 ? 83.207  46.671  -20.897  1.00 28.01  ? 295 ARG B O   1 
ATOM   5893  C  CB  . ARG B  1 320 ? 81.426  45.988  -23.615  1.00 28.44  ? 295 ARG B CB  1 
ATOM   5894  C  CG  . ARG B  1 320 ? 81.009  46.722  -24.881  1.00 30.50  ? 295 ARG B CG  1 
ATOM   5895  C  CD  . ARG B  1 320 ? 79.545  46.508  -25.182  1.00 31.65  ? 295 ARG B CD  1 
ATOM   5896  N  NE  . ARG B  1 320 ? 78.711  46.982  -24.083  1.00 33.07  ? 295 ARG B NE  1 
ATOM   5897  C  CZ  . ARG B  1 320 ? 77.504  46.501  -23.793  1.00 34.74  ? 295 ARG B CZ  1 
ATOM   5898  N  NH1 . ARG B  1 320 ? 76.961  45.535  -24.533  1.00 34.43  ? 295 ARG B NH1 1 
ATOM   5899  N  NH2 . ARG B  1 320 ? 76.831  46.991  -22.761  1.00 34.27  ? 295 ARG B NH2 1 
ATOM   5900  N  N   . LEU B  1 321 ? 83.469  44.539  -21.631  1.00 27.61  ? 296 LEU B N   1 
ATOM   5901  C  CA  . LEU B  1 321 ? 83.941  44.028  -20.343  1.00 27.87  ? 296 LEU B CA  1 
ATOM   5902  C  C   . LEU B  1 321 ? 85.211  44.730  -19.830  1.00 27.27  ? 296 LEU B C   1 
ATOM   5903  O  O   . LEU B  1 321 ? 85.287  45.081  -18.653  1.00 26.32  ? 296 LEU B O   1 
ATOM   5904  C  CB  . LEU B  1 321 ? 84.167  42.519  -20.418  1.00 28.91  ? 296 LEU B CB  1 
ATOM   5905  C  CG  . LEU B  1 321 ? 84.049  41.795  -19.080  1.00 31.89  ? 296 LEU B CG  1 
ATOM   5906  C  CD1 . LEU B  1 321 ? 82.644  41.962  -18.500  1.00 30.37  ? 296 LEU B CD1 1 
ATOM   5907  C  CD2 . LEU B  1 321 ? 84.400  40.324  -19.263  1.00 33.93  ? 296 LEU B CD2 1 
ATOM   5908  N  N   . ILE B  1 322 ? 86.197  44.928  -20.710  1.00 27.45  ? 297 ILE B N   1 
ATOM   5909  C  CA  . ILE B  1 322 ? 87.420  45.666  -20.365  1.00 28.24  ? 297 ILE B CA  1 
ATOM   5910  C  C   . ILE B  1 322 ? 87.063  47.121  -20.001  1.00 29.49  ? 297 ILE B C   1 
ATOM   5911  O  O   . ILE B  1 322 ? 87.600  47.664  -19.035  1.00 30.23  ? 297 ILE B O   1 
ATOM   5912  C  CB  . ILE B  1 322 ? 88.509  45.599  -21.493  1.00 29.12  ? 297 ILE B CB  1 
ATOM   5913  C  CG1 . ILE B  1 322 ? 89.028  44.160  -21.712  1.00 29.61  ? 297 ILE B CG1 1 
ATOM   5914  C  CG2 . ILE B  1 322 ? 89.677  46.557  -21.231  1.00 28.58  ? 297 ILE B CG2 1 
ATOM   5915  C  CD1 . ILE B  1 322 ? 89.894  43.587  -20.603  1.00 29.92  ? 297 ILE B CD1 1 
ATOM   5916  N  N   . ASP B  1 323 ? 86.143  47.731  -20.752  1.00 30.17  ? 298 ASP B N   1 
ATOM   5917  C  CA  . ASP B  1 323 ? 85.659  49.087  -20.461  1.00 31.74  ? 298 ASP B CA  1 
ATOM   5918  C  C   . ASP B  1 323 ? 85.093  49.210  -19.035  1.00 30.24  ? 298 ASP B C   1 
ATOM   5919  O  O   . ASP B  1 323 ? 85.309  50.208  -18.353  1.00 31.22  ? 298 ASP B O   1 
ATOM   5920  C  CB  . ASP B  1 323 ? 84.609  49.513  -21.491  1.00 37.03  ? 298 ASP B CB  1 
ATOM   5921  C  CG  . ASP B  1 323 ? 84.747  50.978  -21.905  1.00 45.57  ? 298 ASP B CG  1 
ATOM   5922  O  OD1 . ASP B  1 323 ? 85.899  51.414  -22.122  1.00 47.83  ? 298 ASP B OD1 1 
ATOM   5923  O  OD2 . ASP B  1 323 ? 83.712  51.695  -22.015  1.00 48.50  ? 298 ASP B OD2 1 
ATOM   5924  N  N   . LYS B  1 324 ? 84.389  48.181  -18.579  1.00 28.29  ? 299 LYS B N   1 
ATOM   5925  C  CA  . LYS B  1 324 ? 83.769  48.201  -17.262  1.00 28.23  ? 299 LYS B CA  1 
ATOM   5926  C  C   . LYS B  1 324 ? 84.746  47.868  -16.137  1.00 27.76  ? 299 LYS B C   1 
ATOM   5927  O  O   . LYS B  1 324 ? 84.699  48.475  -15.074  1.00 28.12  ? 299 LYS B O   1 
ATOM   5928  C  CB  . LYS B  1 324 ? 82.573  47.245  -17.233  1.00 29.24  ? 299 LYS B CB  1 
ATOM   5929  C  CG  . LYS B  1 324 ? 81.539  47.573  -18.297  1.00 29.47  ? 299 LYS B CG  1 
ATOM   5930  C  CD  . LYS B  1 324 ? 80.704  46.364  -18.690  1.00 30.66  ? 299 LYS B CD  1 
ATOM   5931  C  CE  . LYS B  1 324 ? 79.242  46.539  -18.317  1.00 31.14  ? 299 LYS B CE  1 
ATOM   5932  N  NZ  . LYS B  1 324 ? 78.616  47.778  -18.881  1.00 32.05  ? 299 LYS B NZ  1 
ATOM   5933  N  N   . LEU B  1 325 ? 85.640  46.912  -16.380  1.00 26.87  ? 300 LEU B N   1 
ATOM   5934  C  CA  . LEU B  1 325 ? 86.551  46.430  -15.339  1.00 25.72  ? 300 LEU B CA  1 
ATOM   5935  C  C   . LEU B  1 325 ? 87.655  47.410  -14.978  1.00 27.00  ? 300 LEU B C   1 
ATOM   5936  O  O   . LEU B  1 325 ? 87.980  47.557  -13.790  1.00 27.13  ? 300 LEU B O   1 
ATOM   5937  C  CB  . LEU B  1 325 ? 87.182  45.080  -15.718  1.00 24.45  ? 300 LEU B CB  1 
ATOM   5938  C  CG  . LEU B  1 325 ? 86.277  43.844  -15.820  1.00 23.33  ? 300 LEU B CG  1 
ATOM   5939  C  CD1 . LEU B  1 325 ? 87.000  42.735  -16.577  1.00 23.11  ? 300 LEU B CD1 1 
ATOM   5940  C  CD2 . LEU B  1 325 ? 85.866  43.375  -14.436  1.00 22.98  ? 300 LEU B CD2 1 
ATOM   5941  N  N   . VAL B  1 326 ? 88.235  48.067  -15.987  1.00 26.76  ? 301 VAL B N   1 
ATOM   5942  C  CA  . VAL B  1 326 ? 89.400  48.930  -15.758  1.00 27.53  ? 301 VAL B CA  1 
ATOM   5943  C  C   . VAL B  1 326 ? 89.180  49.957  -14.616  1.00 29.03  ? 301 VAL B C   1 
ATOM   5944  O  O   . VAL B  1 326 ? 89.969  49.969  -13.664  1.00 29.22  ? 301 VAL B O   1 
ATOM   5945  C  CB  . VAL B  1 326 ? 89.955  49.567  -17.066  1.00 26.80  ? 301 VAL B CB  1 
ATOM   5946  C  CG1 . VAL B  1 326 ? 90.983  50.657  -16.763  1.00 26.49  ? 301 VAL B CG1 1 
ATOM   5947  C  CG2 . VAL B  1 326 ? 90.583  48.493  -17.946  1.00 26.59  ? 301 VAL B CG2 1 
ATOM   5948  N  N   . PRO B  1 327 ? 88.106  50.789  -14.684  1.00 29.27  ? 302 PRO B N   1 
ATOM   5949  C  CA  . PRO B  1 327 ? 87.963  51.780  -13.601  1.00 29.60  ? 302 PRO B CA  1 
ATOM   5950  C  C   . PRO B  1 327 ? 87.740  51.167  -12.213  1.00 30.57  ? 302 PRO B C   1 
ATOM   5951  O  O   . PRO B  1 327 ? 88.193  51.725  -11.213  1.00 31.77  ? 302 PRO B O   1 
ATOM   5952  C  CB  . PRO B  1 327 ? 86.753  52.621  -14.031  1.00 28.29  ? 302 PRO B CB  1 
ATOM   5953  C  CG  . PRO B  1 327 ? 86.056  51.831  -15.078  1.00 28.19  ? 302 PRO B CG  1 
ATOM   5954  C  CD  . PRO B  1 327 ? 87.096  50.983  -15.742  1.00 28.49  ? 302 PRO B CD  1 
HETATM 5955  N  N   . MSE B  1 328 ? 87.071  50.020  -12.159  1.00 30.15  ? 303 MSE B N   1 
HETATM 5956  C  CA  . MSE B  1 328 ? 86.751  49.374  -10.881  1.00 29.70  ? 303 MSE B CA  1 
HETATM 5957  C  C   . MSE B  1 328 ? 87.938  48.657  -10.253  1.00 29.13  ? 303 MSE B C   1 
HETATM 5958  O  O   . MSE B  1 328 ? 88.024  48.590  -9.024   1.00 28.17  ? 303 MSE B O   1 
HETATM 5959  C  CB  . MSE B  1 328 ? 85.544  48.451  -11.055  1.00 29.51  ? 303 MSE B CB  1 
HETATM 5960  C  CG  . MSE B  1 328 ? 84.246  49.196  -11.367  1.00 32.30  ? 303 MSE B CG  1 
HETATM 5961  SE SE  . MSE B  1 328 ? 82.687  48.014  -11.064  1.00 35.39  ? 303 MSE B SE  1 
HETATM 5962  C  CE  . MSE B  1 328 ? 82.944  46.821  -12.622  1.00 31.21  ? 303 MSE B CE  1 
ATOM   5963  N  N   . VAL B  1 329 ? 88.853  48.113  -11.072  1.00 28.93  ? 304 VAL B N   1 
ATOM   5964  C  CA  . VAL B  1 329 ? 90.086  47.462  -10.562  1.00 28.38  ? 304 VAL B CA  1 
ATOM   5965  C  C   . VAL B  1 329 ? 91.021  48.555  -10.046  1.00 29.28  ? 304 VAL B C   1 
ATOM   5966  O  O   . VAL B  1 329 ? 91.699  48.394  -9.017   1.00 28.86  ? 304 VAL B O   1 
ATOM   5967  C  CB  . VAL B  1 329 ? 90.811  46.582  -11.629  1.00 27.48  ? 304 VAL B CB  1 
ATOM   5968  C  CG1 . VAL B  1 329 ? 92.169  46.104  -11.128  1.00 28.17  ? 304 VAL B CG1 1 
ATOM   5969  C  CG2 . VAL B  1 329 ? 89.969  45.380  -12.032  1.00 26.11  ? 304 VAL B CG2 1 
ATOM   5970  N  N   . GLU B  1 330 ? 91.041  49.670  -10.771  1.00 29.70  ? 305 GLU B N   1 
ATOM   5971  C  CA  . GLU B  1 330 ? 91.864  50.819  -10.413  1.00 31.40  ? 305 GLU B CA  1 
ATOM   5972  C  C   . GLU B  1 330 ? 91.440  51.439  -9.080   1.00 31.78  ? 305 GLU B C   1 
ATOM   5973  O  O   . GLU B  1 330 ? 92.280  51.965  -8.355   1.00 31.59  ? 305 GLU B O   1 
ATOM   5974  C  CB  . GLU B  1 330 ? 91.812  51.878  -11.516  1.00 32.17  ? 305 GLU B CB  1 
ATOM   5975  C  CG  . GLU B  1 330 ? 92.677  51.556  -12.723  1.00 33.43  ? 305 GLU B CG  1 
ATOM   5976  C  CD  . GLU B  1 330 ? 92.601  52.605  -13.831  1.00 35.61  ? 305 GLU B CD  1 
ATOM   5977  O  OE1 . GLU B  1 330 ? 91.758  53.535  -13.776  1.00 34.30  ? 305 GLU B OE1 1 
ATOM   5978  O  OE2 . GLU B  1 330 ? 93.392  52.487  -14.787  1.00 37.72  ? 305 GLU B OE2 1 
ATOM   5979  N  N   . SER B  1 331 ? 90.147  51.353  -8.756   1.00 31.37  ? 306 SER B N   1 
ATOM   5980  C  CA  . SER B  1 331 ? 89.603  52.058  -7.600   1.00 32.17  ? 306 SER B CA  1 
ATOM   5981  C  C   . SER B  1 331 ? 89.375  51.181  -6.354   1.00 30.78  ? 306 SER B C   1 
ATOM   5982  O  O   . SER B  1 331 ? 88.854  51.658  -5.330   1.00 28.91  ? 306 SER B O   1 
ATOM   5983  C  CB  . SER B  1 331 ? 88.345  52.837  -7.988   1.00 34.41  ? 306 SER B CB  1 
ATOM   5984  O  OG  . SER B  1 331 ? 87.278  51.960  -8.241   1.00 37.91  ? 306 SER B OG  1 
ATOM   5985  N  N   . LEU B  1 332 ? 89.781  49.909  -6.443   1.00 29.07  ? 307 LEU B N   1 
ATOM   5986  C  CA  . LEU B  1 332 ? 89.866  49.046  -5.266   1.00 28.51  ? 307 LEU B CA  1 
ATOM   5987  C  C   . LEU B  1 332 ? 90.628  49.748  -4.140   1.00 30.25  ? 307 LEU B C   1 
ATOM   5988  O  O   . LEU B  1 332 ? 91.747  50.238  -4.333   1.00 31.12  ? 307 LEU B O   1 
ATOM   5989  C  CB  . LEU B  1 332 ? 90.537  47.704  -5.598   1.00 26.90  ? 307 LEU B CB  1 
ATOM   5990  C  CG  . LEU B  1 332 ? 89.733  46.711  -6.450   1.00 25.60  ? 307 LEU B CG  1 
ATOM   5991  C  CD1 . LEU B  1 332 ? 90.651  45.675  -7.090   1.00 25.56  ? 307 LEU B CD1 1 
ATOM   5992  C  CD2 . LEU B  1 332 ? 88.611  46.059  -5.655   1.00 24.08  ? 307 LEU B CD2 1 
ATOM   5993  N  N   . ARG B  1 333 ? 90.001  49.820  -2.973   1.00 30.80  ? 308 ARG B N   1 
ATOM   5994  C  CA  . ARG B  1 333 ? 90.638  50.395  -1.802   1.00 31.80  ? 308 ARG B CA  1 
ATOM   5995  C  C   . ARG B  1 333 ? 91.392  49.285  -1.084   1.00 28.22  ? 308 ARG B C   1 
ATOM   5996  O  O   . ARG B  1 333 ? 90.816  48.235  -0.768   1.00 27.55  ? 308 ARG B O   1 
ATOM   5997  C  CB  . ARG B  1 333 ? 89.606  51.042  -0.879   1.00 37.13  ? 308 ARG B CB  1 
ATOM   5998  C  CG  . ARG B  1 333 ? 90.218  52.081  0.044    1.00 46.64  ? 308 ARG B CG  1 
ATOM   5999  C  CD  . ARG B  1 333 ? 89.514  52.087  1.386    1.00 53.96  ? 308 ARG B CD  1 
ATOM   6000  N  NE  . ARG B  1 333 ? 90.219  52.864  2.407    1.00 60.04  ? 308 ARG B NE  1 
ATOM   6001  C  CZ  . ARG B  1 333 ? 89.814  54.049  2.870    1.00 68.38  ? 308 ARG B CZ  1 
ATOM   6002  N  NH1 . ARG B  1 333 ? 88.703  54.618  2.403    1.00 68.65  ? 308 ARG B NH1 1 
ATOM   6003  N  NH2 . ARG B  1 333 ? 90.523  54.672  3.805    1.00 69.44  ? 308 ARG B NH2 1 
ATOM   6004  N  N   . ILE B  1 334 ? 92.676  49.527  -0.832   1.00 25.97  ? 309 ILE B N   1 
ATOM   6005  C  CA  . ILE B  1 334 ? 93.596  48.500  -0.323   1.00 25.28  ? 309 ILE B CA  1 
ATOM   6006  C  C   . ILE B  1 334 ? 94.116  48.945  1.039    1.00 25.41  ? 309 ILE B C   1 
ATOM   6007  O  O   . ILE B  1 334 ? 94.481  50.103  1.212    1.00 27.25  ? 309 ILE B O   1 
ATOM   6008  C  CB  . ILE B  1 334 ? 94.792  48.263  -1.293   1.00 24.49  ? 309 ILE B CB  1 
ATOM   6009  C  CG1 . ILE B  1 334 ? 94.312  47.991  -2.719   1.00 24.33  ? 309 ILE B CG1 1 
ATOM   6010  C  CG2 . ILE B  1 334 ? 95.673  47.110  -0.821   1.00 23.74  ? 309 ILE B CG2 1 
ATOM   6011  C  CD1 . ILE B  1 334 ? 95.386  48.189  -3.774   1.00 25.16  ? 309 ILE B CD1 1 
ATOM   6012  N  N   . GLY B  1 335 ? 94.148  48.047  2.014    1.00 24.94  ? 310 GLY B N   1 
ATOM   6013  C  CA  . GLY B  1 335 ? 94.516  48.469  3.365    1.00 25.23  ? 310 GLY B CA  1 
ATOM   6014  C  C   . GLY B  1 335 ? 94.524  47.365  4.406    1.00 25.59  ? 310 GLY B C   1 
ATOM   6015  O  O   . GLY B  1 335 ? 94.108  46.228  4.109    1.00 24.68  ? 310 GLY B O   1 
ATOM   6016  N  N   . PRO B  1 336 ? 94.979  47.699  5.643    1.00 25.80  ? 311 PRO B N   1 
ATOM   6017  C  CA  . PRO B  1 336 ? 95.013  46.734  6.747    1.00 25.29  ? 311 PRO B CA  1 
ATOM   6018  C  C   . PRO B  1 336 ? 93.588  46.440  7.225    1.00 24.36  ? 311 PRO B C   1 
ATOM   6019  O  O   . PRO B  1 336 ? 92.668  47.215  6.914    1.00 23.42  ? 311 PRO B O   1 
ATOM   6020  C  CB  . PRO B  1 336 ? 95.810  47.480  7.834    1.00 26.15  ? 311 PRO B CB  1 
ATOM   6021  C  CG  . PRO B  1 336 ? 95.506  48.924  7.591    1.00 26.64  ? 311 PRO B CG  1 
ATOM   6022  C  CD  . PRO B  1 336 ? 95.283  49.074  6.105    1.00 26.31  ? 311 PRO B CD  1 
ATOM   6023  N  N   . TYR B  1 337 ? 93.405  45.348  7.972    1.00 24.72  ? 312 TYR B N   1 
ATOM   6024  C  CA  . TYR B  1 337 ? 92.070  44.970  8.504    1.00 24.53  ? 312 TYR B CA  1 
ATOM   6025  C  C   . TYR B  1 337 ? 91.421  46.052  9.428    1.00 25.61  ? 312 TYR B C   1 
ATOM   6026  O  O   . TYR B  1 337 ? 90.197  46.111  9.583    1.00 25.90  ? 312 TYR B O   1 
ATOM   6027  C  CB  . TYR B  1 337 ? 92.144  43.605  9.211    1.00 23.31  ? 312 TYR B CB  1 
ATOM   6028  C  CG  . TYR B  1 337 ? 92.825  43.680  10.551   1.00 24.16  ? 312 TYR B CG  1 
ATOM   6029  C  CD1 . TYR B  1 337 ? 94.213  43.548  10.664   1.00 24.91  ? 312 TYR B CD1 1 
ATOM   6030  C  CD2 . TYR B  1 337 ? 92.086  43.909  11.711   1.00 24.09  ? 312 TYR B CD2 1 
ATOM   6031  C  CE1 . TYR B  1 337 ? 94.837  43.650  11.901   1.00 25.39  ? 312 TYR B CE1 1 
ATOM   6032  C  CE2 . TYR B  1 337 ? 92.704  44.020  12.946   1.00 25.12  ? 312 TYR B CE2 1 
ATOM   6033  C  CZ  . TYR B  1 337 ? 94.072  43.889  13.037   1.00 25.53  ? 312 TYR B CZ  1 
ATOM   6034  O  OH  . TYR B  1 337 ? 94.663  43.986  14.272   1.00 27.03  ? 312 TYR B OH  1 
ATOM   6035  N  N   . THR B  1 338 ? 92.242  46.897  10.038   1.00 26.68  ? 313 THR B N   1 
ATOM   6036  C  CA  . THR B  1 338 ? 91.738  47.997  10.867   1.00 28.46  ? 313 THR B CA  1 
ATOM   6037  C  C   . THR B  1 338 ? 91.038  49.085  10.030   1.00 31.32  ? 313 THR B C   1 
ATOM   6038  O  O   . THR B  1 338 ? 90.284  49.902  10.573   1.00 33.47  ? 313 THR B O   1 
ATOM   6039  C  CB  . THR B  1 338 ? 92.850  48.614  11.737   1.00 28.43  ? 313 THR B CB  1 
ATOM   6040  O  OG1 . THR B  1 338 ? 94.026  48.810  10.942   1.00 28.16  ? 313 THR B OG1 1 
ATOM   6041  C  CG2 . THR B  1 338 ? 93.198  47.686  12.898   1.00 28.35  ? 313 THR B CG2 1 
ATOM   6042  N  N   . ASP B  1 339 ? 91.280  49.075  8.716    1.00 29.97  ? 314 ASP B N   1 
ATOM   6043  C  CA  . ASP B  1 339 ? 90.610  49.977  7.777    1.00 28.90  ? 314 ASP B CA  1 
ATOM   6044  C  C   . ASP B  1 339 ? 89.406  49.272  7.160    1.00 28.88  ? 314 ASP B C   1 
ATOM   6045  O  O   . ASP B  1 339 ? 89.550  48.472  6.231    1.00 28.12  ? 314 ASP B O   1 
ATOM   6046  C  CB  . ASP B  1 339 ? 91.593  50.458  6.693    1.00 28.77  ? 314 ASP B CB  1 
ATOM   6047  C  CG  . ASP B  1 339 ? 90.927  51.321  5.625    1.00 30.88  ? 314 ASP B CG  1 
ATOM   6048  O  OD1 . ASP B  1 339 ? 89.822  51.852  5.870    1.00 31.65  ? 314 ASP B OD1 1 
ATOM   6049  O  OD2 . ASP B  1 339 ? 91.504  51.472  4.524    1.00 32.12  ? 314 ASP B OD2 1 
ATOM   6050  N  N   . GLU B  1 340 ? 88.211  49.589  7.653    1.00 30.79  ? 315 GLU B N   1 
ATOM   6051  C  CA  . GLU B  1 340 ? 87.017  48.808  7.294    1.00 33.44  ? 315 GLU B CA  1 
ATOM   6052  C  C   . GLU B  1 340 ? 86.374  49.211  5.971    1.00 34.23  ? 315 GLU B C   1 
ATOM   6053  O  O   . GLU B  1 340 ? 85.402  48.589  5.538    1.00 34.65  ? 315 GLU B O   1 
ATOM   6054  C  CB  . GLU B  1 340 ? 86.002  48.784  8.438    1.00 36.75  ? 315 GLU B CB  1 
ATOM   6055  C  CG  . GLU B  1 340 ? 86.516  48.051  9.670    1.00 42.07  ? 315 GLU B CG  1 
ATOM   6056  C  CD  . GLU B  1 340 ? 85.445  47.841  10.721   1.00 49.90  ? 315 GLU B CD  1 
ATOM   6057  O  OE1 . GLU B  1 340 ? 85.184  48.773  11.513   1.00 54.12  ? 315 GLU B OE1 1 
ATOM   6058  O  OE2 . GLU B  1 340 ? 84.866  46.739  10.760   1.00 55.15  ? 315 GLU B OE2 1 
ATOM   6059  N  N   . LYS B  1 341 ? 86.927  50.240  5.330    1.00 34.35  ? 316 LYS B N   1 
ATOM   6060  C  CA  . LYS B  1 341 ? 86.516  50.626  3.981    1.00 34.13  ? 316 LYS B CA  1 
ATOM   6061  C  C   . LYS B  1 341 ? 87.281  49.834  2.916    1.00 32.74  ? 316 LYS B C   1 
ATOM   6062  O  O   . LYS B  1 341 ? 86.878  49.809  1.744    1.00 32.52  ? 316 LYS B O   1 
ATOM   6063  C  CB  . LYS B  1 341 ? 86.747  52.124  3.752    1.00 37.52  ? 316 LYS B CB  1 
ATOM   6064  C  CG  . LYS B  1 341 ? 85.895  53.069  4.584    1.00 40.85  ? 316 LYS B CG  1 
ATOM   6065  C  CD  . LYS B  1 341 ? 84.515  53.220  3.970    1.00 45.25  ? 316 LYS B CD  1 
ATOM   6066  C  CE  . LYS B  1 341 ? 83.779  54.388  4.596    1.00 47.98  ? 316 LYS B CE  1 
ATOM   6067  N  NZ  . LYS B  1 341 ? 82.310  54.165  4.579    1.00 49.72  ? 316 LYS B NZ  1 
ATOM   6068  N  N   . ALA B  1 342 ? 88.396  49.212  3.314    1.00 30.72  ? 317 ALA B N   1 
ATOM   6069  C  CA  . ALA B  1 342 ? 89.261  48.495  2.373    1.00 30.44  ? 317 ALA B CA  1 
ATOM   6070  C  C   . ALA B  1 342 ? 88.495  47.373  1.683    1.00 28.55  ? 317 ALA B C   1 
ATOM   6071  O  O   . ALA B  1 342 ? 87.746  46.641  2.337    1.00 28.06  ? 317 ALA B O   1 
ATOM   6072  C  CB  . ALA B  1 342 ? 90.496  47.939  3.080    1.00 32.04  ? 317 ALA B CB  1 
ATOM   6073  N  N   . ASP B  1 343 ? 88.660  47.273  0.363    1.00 28.06  ? 318 ASP B N   1 
ATOM   6074  C  CA  . ASP B  1 343 ? 88.119  46.157  -0.421   1.00 27.76  ? 318 ASP B CA  1 
ATOM   6075  C  C   . ASP B  1 343 ? 89.024  44.942  -0.283   1.00 29.10  ? 318 ASP B C   1 
ATOM   6076  O  O   . ASP B  1 343 ? 88.582  43.818  -0.480   1.00 28.88  ? 318 ASP B O   1 
ATOM   6077  C  CB  . ASP B  1 343 ? 88.039  46.521  -1.900   1.00 29.20  ? 318 ASP B CB  1 
ATOM   6078  C  CG  . ASP B  1 343 ? 87.068  47.657  -2.176   1.00 32.02  ? 318 ASP B CG  1 
ATOM   6079  O  OD1 . ASP B  1 343 ? 85.891  47.540  -1.779   1.00 33.08  ? 318 ASP B OD1 1 
ATOM   6080  O  OD2 . ASP B  1 343 ? 87.483  48.657  -2.806   1.00 31.72  ? 318 ASP B OD2 1 
HETATM 6081  N  N   . MSE B  1 344 ? 90.291  45.182  0.061    1.00 30.01  ? 319 MSE B N   1 
HETATM 6082  C  CA  . MSE B  1 344 ? 91.339  44.166  -0.026   1.00 31.82  ? 319 MSE B CA  1 
HETATM 6083  C  C   . MSE B  1 344 ? 92.468  44.503  0.915    1.00 28.85  ? 319 MSE B C   1 
HETATM 6084  O  O   . MSE B  1 344 ? 92.749  45.682  1.184    1.00 28.21  ? 319 MSE B O   1 
HETATM 6085  C  CB  . MSE B  1 344 ? 91.765  44.228  -1.492   1.00 34.39  ? 319 MSE B CB  1 
HETATM 6086  C  CG  . MSE B  1 344 ? 93.055  43.529  -1.862   1.00 37.92  ? 319 MSE B CG  1 
HETATM 6087  SE SE  . MSE B  1 344 ? 92.950  43.254  -3.810   1.00 41.92  ? 319 MSE B SE  1 
HETATM 6088  C  CE  . MSE B  1 344 ? 94.116  44.715  -4.443   1.00 41.54  ? 319 MSE B CE  1 
ATOM   6089  N  N   . GLY B  1 345 ? 93.110  43.460  1.434    1.00 25.91  ? 320 GLY B N   1 
ATOM   6090  C  CA  . GLY B  1 345 ? 94.268  43.611  2.295    1.00 24.00  ? 320 GLY B CA  1 
ATOM   6091  C  C   . GLY B  1 345 ? 95.528  43.054  1.668    1.00 23.07  ? 320 GLY B C   1 
ATOM   6092  O  O   . GLY B  1 345 ? 95.581  42.807  0.456    1.00 21.62  ? 320 GLY B O   1 
ATOM   6093  N  N   . PRO B  1 346 ? 96.556  42.825  2.498    1.00 23.32  ? 321 PRO B N   1 
ATOM   6094  C  CA  . PRO B  1 346 ? 97.817  42.330  1.985    1.00 23.44  ? 321 PRO B CA  1 
ATOM   6095  C  C   . PRO B  1 346 ? 97.746  40.825  1.758    1.00 23.36  ? 321 PRO B C   1 
ATOM   6096  O  O   . PRO B  1 346 ? 96.783  40.169  2.192    1.00 21.92  ? 321 PRO B O   1 
ATOM   6097  C  CB  . PRO B  1 346 ? 98.783  42.640  3.116    1.00 23.53  ? 321 PRO B CB  1 
ATOM   6098  C  CG  . PRO B  1 346 ? 97.945  42.487  4.347    1.00 23.97  ? 321 PRO B CG  1 
ATOM   6099  C  CD  . PRO B  1 346 ? 96.541  42.880  3.972    1.00 23.58  ? 321 PRO B CD  1 
ATOM   6100  N  N   . VAL B  1 347 ? 98.747  40.299  1.053    1.00 23.84  ? 322 VAL B N   1 
ATOM   6101  C  CA  . VAL B  1 347 ? 98.915  38.860  0.940    1.00 24.17  ? 322 VAL B CA  1 
ATOM   6102  C  C   . VAL B  1 347 ? 99.594  38.304  2.212    1.00 25.06  ? 322 VAL B C   1 
ATOM   6103  O  O   . VAL B  1 347 ? 100.189 39.061  2.998    1.00 25.00  ? 322 VAL B O   1 
ATOM   6104  C  CB  . VAL B  1 347 ? 99.572  38.427  -0.407   1.00 24.39  ? 322 VAL B CB  1 
ATOM   6105  C  CG1 . VAL B  1 347 ? 98.638  38.752  -1.579   1.00 23.63  ? 322 VAL B CG1 1 
ATOM   6106  C  CG2 . VAL B  1 347 ? 100.967 39.029  -0.599   1.00 23.85  ? 322 VAL B CG2 1 
ATOM   6107  N  N   . VAL B  1 348 ? 99.464  36.991  2.414    1.00 25.63  ? 323 VAL B N   1 
ATOM   6108  C  CA  . VAL B  1 348 ? 99.788  36.325  3.697    1.00 25.24  ? 323 VAL B CA  1 
ATOM   6109  C  C   . VAL B  1 348 ? 101.267 36.391  4.127    1.00 26.20  ? 323 VAL B C   1 
ATOM   6110  O  O   . VAL B  1 348 ? 101.553 36.558  5.317    1.00 27.24  ? 323 VAL B O   1 
ATOM   6111  C  CB  . VAL B  1 348 ? 99.237  34.851  3.736    1.00 23.35  ? 323 VAL B CB  1 
ATOM   6112  C  CG1 . VAL B  1 348 ? 99.931  33.959  2.708    1.00 22.76  ? 323 VAL B CG1 1 
ATOM   6113  C  CG2 . VAL B  1 348 ? 99.325  34.249  5.135    1.00 22.91  ? 323 VAL B CG2 1 
ATOM   6114  N  N   . THR B  1 349 ? 102.196 36.244  3.177    1.00 26.05  ? 324 THR B N   1 
ATOM   6115  C  CA  . THR B  1 349 ? 103.641 36.293  3.488    1.00 26.08  ? 324 THR B CA  1 
ATOM   6116  C  C   . THR B  1 349 ? 104.438 37.038  2.431    1.00 27.63  ? 324 THR B C   1 
ATOM   6117  O  O   . THR B  1 349 ? 103.997 37.177  1.280    1.00 26.19  ? 324 THR B O   1 
ATOM   6118  C  CB  . THR B  1 349 ? 104.289 34.892  3.572    1.00 24.55  ? 324 THR B CB  1 
ATOM   6119  O  OG1 . THR B  1 349 ? 104.109 34.216  2.322    1.00 23.01  ? 324 THR B OG1 1 
ATOM   6120  C  CG2 . THR B  1 349 ? 103.724 34.052  4.730    1.00 24.12  ? 324 THR B CG2 1 
ATOM   6121  N  N   . LYS B  1 350 ? 105.633 37.471  2.828    1.00 30.04  ? 325 LYS B N   1 
ATOM   6122  C  CA  . LYS B  1 350 ? 106.649 37.947  1.893    1.00 33.74  ? 325 LYS B CA  1 
ATOM   6123  C  C   . LYS B  1 350 ? 106.900 36.945  0.758    1.00 33.12  ? 325 LYS B C   1 
ATOM   6124  O  O   . LYS B  1 350 ? 107.058 37.353  -0.396   1.00 34.06  ? 325 LYS B O   1 
ATOM   6125  C  CB  . LYS B  1 350 ? 107.961 38.235  2.633    1.00 40.01  ? 325 LYS B CB  1 
ATOM   6126  C  CG  . LYS B  1 350 ? 108.950 39.097  1.858    1.00 50.17  ? 325 LYS B CG  1 
ATOM   6127  C  CD  . LYS B  1 350 ? 108.637 40.588  1.966    1.00 59.04  ? 325 LYS B CD  1 
ATOM   6128  C  CE  . LYS B  1 350 ? 109.642 41.423  1.184    1.00 63.85  ? 325 LYS B CE  1 
ATOM   6129  N  NZ  . LYS B  1 350 ? 109.516 42.876  1.485    1.00 66.72  ? 325 LYS B NZ  1 
ATOM   6130  N  N   . GLU B  1 351 ? 106.929 35.649  1.078    1.00 32.00  ? 326 GLU B N   1 
ATOM   6131  C  CA  . GLU B  1 351 ? 107.159 34.601  0.069    1.00 33.70  ? 326 GLU B CA  1 
ATOM   6132  C  C   . GLU B  1 351 ? 106.051 34.584  -0.975   1.00 32.27  ? 326 GLU B C   1 
ATOM   6133  O  O   . GLU B  1 351 ? 106.329 34.509  -2.173   1.00 31.52  ? 326 GLU B O   1 
ATOM   6134  C  CB  . GLU B  1 351 ? 107.277 33.202  0.693    1.00 36.19  ? 326 GLU B CB  1 
ATOM   6135  C  CG  . GLU B  1 351 ? 108.548 32.961  1.499    1.00 40.77  ? 326 GLU B CG  1 
ATOM   6136  C  CD  . GLU B  1 351 ? 108.575 33.711  2.830    1.00 43.84  ? 326 GLU B CD  1 
ATOM   6137  O  OE1 . GLU B  1 351 ? 107.498 33.992  3.407    1.00 41.28  ? 326 GLU B OE1 1 
ATOM   6138  O  OE2 . GLU B  1 351 ? 109.685 34.027  3.304    1.00 47.15  ? 326 GLU B OE2 1 
ATOM   6139  N  N   . ALA B  1 352 ? 104.801 34.647  -0.508   1.00 30.49  ? 327 ALA B N   1 
ATOM   6140  C  CA  . ALA B  1 352 ? 103.645 34.694  -1.392   1.00 28.05  ? 327 ALA B CA  1 
ATOM   6141  C  C   . ALA B  1 352 ? 103.738 35.927  -2.286   1.00 27.40  ? 327 ALA B C   1 
ATOM   6142  O  O   . ALA B  1 352 ? 103.604 35.820  -3.516   1.00 26.71  ? 327 ALA B O   1 
ATOM   6143  C  CB  . ALA B  1 352 ? 102.348 34.687  -0.590   1.00 26.97  ? 327 ALA B CB  1 
ATOM   6144  N  N   . GLU B  1 353 ? 104.009 37.083  -1.679   1.00 27.54  ? 328 GLU B N   1 
ATOM   6145  C  CA  . GLU B  1 353 ? 104.145 38.332  -2.436   1.00 29.06  ? 328 GLU B CA  1 
ATOM   6146  C  C   . GLU B  1 353 ? 105.189 38.246  -3.557   1.00 31.01  ? 328 GLU B C   1 
ATOM   6147  O  O   . GLU B  1 353 ? 104.915 38.633  -4.703   1.00 31.08  ? 328 GLU B O   1 
ATOM   6148  C  CB  . GLU B  1 353 ? 104.477 39.494  -1.515   1.00 29.70  ? 328 GLU B CB  1 
ATOM   6149  C  CG  . GLU B  1 353 ? 104.617 40.815  -2.257   1.00 30.06  ? 328 GLU B CG  1 
ATOM   6150  C  CD  . GLU B  1 353 ? 105.037 41.957  -1.355   1.00 30.45  ? 328 GLU B CD  1 
ATOM   6151  O  OE1 . GLU B  1 353 ? 105.174 41.759  -0.127   1.00 29.61  ? 328 GLU B OE1 1 
ATOM   6152  O  OE2 . GLU B  1 353 ? 105.230 43.063  -1.890   1.00 31.88  ? 328 GLU B OE2 1 
ATOM   6153  N  N   . GLN B  1 354 ? 106.374 37.738  -3.222   1.00 32.27  ? 329 GLN B N   1 
ATOM   6154  C  CA  . GLN B  1 354 ? 107.440 37.563  -4.212   1.00 36.57  ? 329 GLN B CA  1 
ATOM   6155  C  C   . GLN B  1 354 ? 107.052 36.589  -5.327   1.00 33.79  ? 329 GLN B C   1 
ATOM   6156  O  O   . GLN B  1 354 ? 107.409 36.793  -6.481   1.00 33.92  ? 329 GLN B O   1 
ATOM   6157  C  CB  . GLN B  1 354 ? 108.781 37.164  -3.558   1.00 42.85  ? 329 GLN B CB  1 
ATOM   6158  C  CG  . GLN B  1 354 ? 109.443 38.264  -2.717   1.00 52.47  ? 329 GLN B CG  1 
ATOM   6159  C  CD  . GLN B  1 354 ? 109.187 39.691  -3.228   1.00 62.27  ? 329 GLN B CD  1 
ATOM   6160  O  OE1 . GLN B  1 354 ? 108.517 40.492  -2.558   1.00 62.40  ? 329 GLN B OE1 1 
ATOM   6161  N  NE2 . GLN B  1 354 ? 109.721 40.015  -4.413   1.00 65.04  ? 329 GLN B NE2 1 
ATOM   6162  N  N   . ARG B  1 355 ? 106.318 35.540  -4.972   1.00 31.63  ? 330 ARG B N   1 
ATOM   6163  C  CA  . ARG B  1 355 ? 105.852 34.567  -5.947   1.00 31.55  ? 330 ARG B CA  1 
ATOM   6164  C  C   . ARG B  1 355 ? 104.876 35.210  -6.946   1.00 31.03  ? 330 ARG B C   1 
ATOM   6165  O  O   . ARG B  1 355 ? 104.986 34.983  -8.158   1.00 31.64  ? 330 ARG B O   1 
ATOM   6166  C  CB  . ARG B  1 355 ? 105.218 33.372  -5.242   1.00 32.27  ? 330 ARG B CB  1 
ATOM   6167  C  CG  . ARG B  1 355 ? 105.013 32.179  -6.150   1.00 36.10  ? 330 ARG B CG  1 
ATOM   6168  C  CD  . ARG B  1 355 ? 104.274 31.049  -5.456   1.00 40.18  ? 330 ARG B CD  1 
ATOM   6169  N  NE  . ARG B  1 355 ? 103.638 30.185  -6.449   1.00 44.33  ? 330 ARG B NE  1 
ATOM   6170  C  CZ  . ARG B  1 355 ? 102.410 30.365  -6.940   1.00 45.00  ? 330 ARG B CZ  1 
ATOM   6171  N  NH1 . ARG B  1 355 ? 101.949 29.522  -7.854   1.00 47.38  ? 330 ARG B NH1 1 
ATOM   6172  N  NH2 . ARG B  1 355 ? 101.647 31.377  -6.526   1.00 41.42  ? 330 ARG B NH2 1 
ATOM   6173  N  N   . ILE B  1 356 ? 103.956 36.027  -6.425   1.00 28.52  ? 331 ILE B N   1 
ATOM   6174  C  CA  . ILE B  1 356 ? 102.956 36.743  -7.231   1.00 26.85  ? 331 ILE B CA  1 
ATOM   6175  C  C   . ILE B  1 356 ? 103.602 37.768  -8.168   1.00 27.42  ? 331 ILE B C   1 
ATOM   6176  O  O   . ILE B  1 356 ? 103.311 37.789  -9.380   1.00 27.25  ? 331 ILE B O   1 
ATOM   6177  C  CB  . ILE B  1 356 ? 101.897 37.440  -6.339   1.00 25.34  ? 331 ILE B CB  1 
ATOM   6178  C  CG1 . ILE B  1 356 ? 101.036 36.402  -5.613   1.00 23.98  ? 331 ILE B CG1 1 
ATOM   6179  C  CG2 . ILE B  1 356 ? 101.015 38.377  -7.156   1.00 25.49  ? 331 ILE B CG2 1 
ATOM   6180  C  CD1 . ILE B  1 356 ? 100.631 36.838  -4.217   1.00 24.37  ? 331 ILE B CD1 1 
ATOM   6181  N  N   . ARG B  1 357 ? 104.471 38.607  -7.605   1.00 27.09  ? 332 ARG B N   1 
ATOM   6182  C  CA  . ARG B  1 357 ? 105.193 39.620  -8.373   1.00 27.08  ? 332 ARG B CA  1 
ATOM   6183  C  C   . ARG B  1 357 ? 106.039 38.996  -9.490   1.00 27.19  ? 332 ARG B C   1 
ATOM   6184  O  O   . ARG B  1 357 ? 106.146 39.552  -10.587  1.00 26.90  ? 332 ARG B O   1 
ATOM   6185  C  CB  . ARG B  1 357 ? 106.072 40.471  -7.451   1.00 27.85  ? 332 ARG B CB  1 
ATOM   6186  C  CG  . ARG B  1 357 ? 105.306 41.295  -6.437   1.00 27.44  ? 332 ARG B CG  1 
ATOM   6187  C  CD  . ARG B  1 357 ? 106.235 42.193  -5.631   1.00 28.74  ? 332 ARG B CD  1 
ATOM   6188  N  NE  . ARG B  1 357 ? 105.480 43.067  -4.730   1.00 29.40  ? 332 ARG B NE  1 
ATOM   6189  C  CZ  . ARG B  1 357 ? 104.820 44.163  -5.118   1.00 30.27  ? 332 ARG B CZ  1 
ATOM   6190  N  NH1 . ARG B  1 357 ? 104.818 44.531  -6.398   1.00 30.90  ? 332 ARG B NH1 1 
ATOM   6191  N  NH2 . ARG B  1 357 ? 104.150 44.889  -4.230   1.00 29.23  ? 332 ARG B NH2 1 
ATOM   6192  N  N   . SER B  1 358 ? 106.625 37.835  -9.209   1.00 27.41  ? 333 SER B N   1 
ATOM   6193  C  CA  . SER B  1 358 ? 107.392 37.103  -10.215  1.00 30.01  ? 333 SER B CA  1 
ATOM   6194  C  C   . SER B  1 358 ? 106.532 36.615  -11.401  1.00 28.71  ? 333 SER B C   1 
ATOM   6195  O  O   . SER B  1 358 ? 106.973 36.653  -12.562  1.00 28.71  ? 333 SER B O   1 
ATOM   6196  C  CB  . SER B  1 358 ? 108.116 35.923  -9.571   1.00 32.91  ? 333 SER B CB  1 
ATOM   6197  O  OG  . SER B  1 358 ? 108.834 35.204  -10.550  1.00 36.13  ? 333 SER B OG  1 
ATOM   6198  N  N   . LEU B  1 359 ? 105.318 36.160  -11.092  1.00 27.01  ? 334 LEU B N   1 
ATOM   6199  C  CA  . LEU B  1 359 ? 104.362 35.699  -12.096  1.00 27.16  ? 334 LEU B CA  1 
ATOM   6200  C  C   . LEU B  1 359 ? 103.789 36.844  -12.932  1.00 27.10  ? 334 LEU B C   1 
ATOM   6201  O  O   . LEU B  1 359 ? 103.611 36.688  -14.141  1.00 27.87  ? 334 LEU B O   1 
ATOM   6202  C  CB  . LEU B  1 359 ? 103.238 34.897  -11.430  1.00 27.19  ? 334 LEU B CB  1 
ATOM   6203  C  CG  . LEU B  1 359 ? 103.562 33.439  -11.109  1.00 26.81  ? 334 LEU B CG  1 
ATOM   6204  C  CD1 . LEU B  1 359 ? 102.727 32.944  -9.928   1.00 25.71  ? 334 LEU B CD1 1 
ATOM   6205  C  CD2 . LEU B  1 359 ? 103.353 32.577  -12.349  1.00 26.27  ? 334 LEU B CD2 1 
ATOM   6206  N  N   . ILE B  1 360 ? 103.513 37.985  -12.292  1.00 26.98  ? 335 ILE B N   1 
ATOM   6207  C  CA  . ILE B  1 360 ? 103.100 39.200  -12.995  1.00 27.65  ? 335 ILE B CA  1 
ATOM   6208  C  C   . ILE B  1 360 ? 104.147 39.571  -14.059  1.00 29.33  ? 335 ILE B C   1 
ATOM   6209  O  O   . ILE B  1 360 ? 103.795 39.807  -15.212  1.00 27.63  ? 335 ILE B O   1 
ATOM   6210  C  CB  . ILE B  1 360 ? 102.853 40.398  -12.039  1.00 26.87  ? 335 ILE B CB  1 
ATOM   6211  C  CG1 . ILE B  1 360 ? 101.636 40.139  -11.132  1.00 25.13  ? 335 ILE B CG1 1 
ATOM   6212  C  CG2 . ILE B  1 360 ? 102.630 41.680  -12.836  1.00 26.54  ? 335 ILE B CG2 1 
ATOM   6213  C  CD1 . ILE B  1 360 ? 101.508 41.111  -9.973   1.00 24.11  ? 335 ILE B CD1 1 
ATOM   6214  N  N   . ASP B  1 361 ? 105.425 39.594  -13.667  1.00 33.13  ? 336 ASP B N   1 
ATOM   6215  C  CA  . ASP B  1 361 ? 106.533 39.903  -14.592  1.00 36.26  ? 336 ASP B CA  1 
ATOM   6216  C  C   . ASP B  1 361 ? 106.559 38.984  -15.806  1.00 34.38  ? 336 ASP B C   1 
ATOM   6217  O  O   . ASP B  1 361 ? 106.784 39.444  -16.923  1.00 34.95  ? 336 ASP B O   1 
ATOM   6218  C  CB  . ASP B  1 361 ? 107.893 39.820  -13.891  1.00 41.73  ? 336 ASP B CB  1 
ATOM   6219  C  CG  . ASP B  1 361 ? 108.254 41.090  -13.145  1.00 49.45  ? 336 ASP B CG  1 
ATOM   6220  O  OD1 . ASP B  1 361 ? 107.602 42.145  -13.353  1.00 51.16  ? 336 ASP B OD1 1 
ATOM   6221  O  OD2 . ASP B  1 361 ? 109.210 41.025  -12.339  1.00 53.18  ? 336 ASP B OD2 1 
ATOM   6222  N  N   . SER B  1 362 ? 106.335 37.689  -15.583  1.00 32.52  ? 337 SER B N   1 
ATOM   6223  C  CA  . SER B  1 362 ? 106.332 36.715  -16.677  1.00 32.30  ? 337 SER B CA  1 
ATOM   6224  C  C   . SER B  1 362 ? 105.179 36.958  -17.672  1.00 32.05  ? 337 SER B C   1 
ATOM   6225  O  O   . SER B  1 362 ? 105.333 36.742  -18.875  1.00 32.49  ? 337 SER B O   1 
ATOM   6226  C  CB  . SER B  1 362 ? 106.308 35.287  -16.128  1.00 30.64  ? 337 SER B CB  1 
ATOM   6227  O  OG  . SER B  1 362 ? 105.008 34.938  -15.708  1.00 30.82  ? 337 SER B OG  1 
ATOM   6228  N  N   . GLY B  1 363 ? 104.037 37.413  -17.157  1.00 31.89  ? 338 GLY B N   1 
ATOM   6229  C  CA  . GLY B  1 363 ? 102.919 37.861  -17.991  1.00 31.86  ? 338 GLY B CA  1 
ATOM   6230  C  C   . GLY B  1 363 ? 103.342 38.946  -18.966  1.00 32.41  ? 338 GLY B C   1 
ATOM   6231  O  O   . GLY B  1 363 ? 103.130 38.816  -20.180  1.00 32.71  ? 338 GLY B O   1 
ATOM   6232  N  N   . ILE B  1 364 ? 103.956 40.008  -18.439  1.00 31.88  ? 339 ILE B N   1 
ATOM   6233  C  CA  . ILE B  1 364 ? 104.509 41.079  -19.284  1.00 31.84  ? 339 ILE B CA  1 
ATOM   6234  C  C   . ILE B  1 364 ? 105.556 40.530  -20.274  1.00 32.68  ? 339 ILE B C   1 
ATOM   6235  O  O   . ILE B  1 364 ? 105.488 40.816  -21.468  1.00 31.98  ? 339 ILE B O   1 
ATOM   6236  C  CB  . ILE B  1 364 ? 105.123 42.217  -18.442  1.00 31.56  ? 339 ILE B CB  1 
ATOM   6237  C  CG1 . ILE B  1 364 ? 104.063 42.853  -17.536  1.00 30.98  ? 339 ILE B CG1 1 
ATOM   6238  C  CG2 . ILE B  1 364 ? 105.774 43.270  -19.337  1.00 31.73  ? 339 ILE B CG2 1 
ATOM   6239  C  CD1 . ILE B  1 364 ? 104.650 43.599  -16.360  1.00 30.55  ? 339 ILE B CD1 1 
ATOM   6240  N  N   . GLU B  1 365 ? 106.501 39.728  -19.779  1.00 33.78  ? 340 GLU B N   1 
ATOM   6241  C  CA  . GLU B  1 365 ? 107.580 39.198  -20.617  1.00 37.63  ? 340 GLU B CA  1 
ATOM   6242  C  C   . GLU B  1 365 ? 107.043 38.350  -21.759  1.00 36.14  ? 340 GLU B C   1 
ATOM   6243  O  O   . GLU B  1 365 ? 107.582 38.403  -22.862  1.00 35.70  ? 340 GLU B O   1 
ATOM   6244  C  CB  . GLU B  1 365 ? 108.615 38.392  -19.804  1.00 44.13  ? 340 GLU B CB  1 
ATOM   6245  C  CG  . GLU B  1 365 ? 109.469 39.199  -18.825  1.00 51.64  ? 340 GLU B CG  1 
ATOM   6246  C  CD  . GLU B  1 365 ? 110.228 40.360  -19.466  1.00 61.86  ? 340 GLU B CD  1 
ATOM   6247  O  OE1 . GLU B  1 365 ? 111.110 40.118  -20.317  1.00 69.76  ? 340 GLU B OE1 1 
ATOM   6248  O  OE2 . GLU B  1 365 ? 109.960 41.527  -19.103  1.00 63.69  ? 340 GLU B OE2 1 
ATOM   6249  N  N   . GLN B  1 366 ? 105.977 37.590  -21.486  1.00 34.27  ? 341 GLN B N   1 
ATOM   6250  C  CA  . GLN B  1 366 ? 105.386 36.652  -22.453  1.00 33.07  ? 341 GLN B CA  1 
ATOM   6251  C  C   . GLN B  1 366 ? 104.333 37.262  -23.405  1.00 32.86  ? 341 GLN B C   1 
ATOM   6252  O  O   . GLN B  1 366 ? 103.725 36.551  -24.187  1.00 33.22  ? 341 GLN B O   1 
ATOM   6253  C  CB  . GLN B  1 366 ? 104.821 35.423  -21.721  1.00 31.81  ? 341 GLN B CB  1 
ATOM   6254  C  CG  . GLN B  1 366 ? 105.888 34.439  -21.271  1.00 32.88  ? 341 GLN B CG  1 
ATOM   6255  C  CD  . GLN B  1 366 ? 105.419 33.478  -20.189  1.00 35.97  ? 341 GLN B CD  1 
ATOM   6256  O  OE1 . GLN B  1 366 ? 104.224 33.233  -20.012  1.00 36.25  ? 341 GLN B OE1 1 
ATOM   6257  N  NE2 . GLN B  1 366 ? 106.368 32.922  -19.457  1.00 38.29  ? 341 GLN B NE2 1 
ATOM   6258  N  N   . GLY B  1 367 ? 104.108 38.570  -23.322  1.00 33.25  ? 342 GLY B N   1 
ATOM   6259  C  CA  . GLY B  1 367 ? 103.274 39.260  -24.305  1.00 32.73  ? 342 GLY B CA  1 
ATOM   6260  C  C   . GLY B  1 367 ? 101.875 39.704  -23.906  1.00 32.12  ? 342 GLY B C   1 
ATOM   6261  O  O   . GLY B  1 367 ? 101.205 40.364  -24.689  1.00 32.31  ? 342 GLY B O   1 
ATOM   6262  N  N   . ALA B  1 368 ? 101.418 39.351  -22.706  1.00 31.64  ? 343 ALA B N   1 
ATOM   6263  C  CA  . ALA B  1 368 ? 100.074 39.754  -22.263  1.00 31.43  ? 343 ALA B CA  1 
ATOM   6264  C  C   . ALA B  1 368 ? 100.027 41.257  -21.967  1.00 31.84  ? 343 ALA B C   1 
ATOM   6265  O  O   . ALA B  1 368 ? 101.053 41.872  -21.685  1.00 31.77  ? 343 ALA B O   1 
ATOM   6266  C  CB  . ALA B  1 368 ? 99.617  38.934  -21.061  1.00 29.92  ? 343 ALA B CB  1 
ATOM   6267  N  N   . LYS B  1 369 ? 98.840  41.842  -22.058  1.00 31.91  ? 344 LYS B N   1 
ATOM   6268  C  CA  . LYS B  1 369 ? 98.689  43.282  -21.965  1.00 33.36  ? 344 LYS B CA  1 
ATOM   6269  C  C   . LYS B  1 369 ? 98.220  43.647  -20.564  1.00 32.42  ? 344 LYS B C   1 
ATOM   6270  O  O   . LYS B  1 369 ? 97.067  43.418  -20.216  1.00 32.72  ? 344 LYS B O   1 
ATOM   6271  C  CB  . LYS B  1 369 ? 97.693  43.759  -23.023  1.00 36.38  ? 344 LYS B CB  1 
ATOM   6272  C  CG  . LYS B  1 369 ? 97.359  45.241  -22.983  1.00 42.20  ? 344 LYS B CG  1 
ATOM   6273  C  CD  . LYS B  1 369 ? 96.380  45.619  -24.090  1.00 48.13  ? 344 LYS B CD  1 
ATOM   6274  C  CE  . LYS B  1 369 ? 97.005  45.433  -25.467  1.00 53.53  ? 344 LYS B CE  1 
ATOM   6275  N  NZ  . LYS B  1 369 ? 96.123  45.847  -26.595  1.00 55.27  ? 344 LYS B NZ  1 
ATOM   6276  N  N   . LEU B  1 370 ? 99.123  44.201  -19.761  1.00 31.21  ? 345 LEU B N   1 
ATOM   6277  C  CA  . LEU B  1 370 ? 98.798  44.597  -18.388  1.00 30.91  ? 345 LEU B CA  1 
ATOM   6278  C  C   . LEU B  1 370 ? 97.986  45.899  -18.355  1.00 31.90  ? 345 LEU B C   1 
ATOM   6279  O  O   . LEU B  1 370 ? 98.546  46.972  -18.181  1.00 33.14  ? 345 LEU B O   1 
ATOM   6280  C  CB  . LEU B  1 370 ? 100.081 44.738  -17.551  1.00 29.52  ? 345 LEU B CB  1 
ATOM   6281  C  CG  . LEU B  1 370 ? 99.909  44.872  -16.028  1.00 29.19  ? 345 LEU B CG  1 
ATOM   6282  C  CD1 . LEU B  1 370 ? 99.034  43.758  -15.447  1.00 27.71  ? 345 LEU B CD1 1 
ATOM   6283  C  CD2 . LEU B  1 370 ? 101.274 44.921  -15.340  1.00 29.48  ? 345 LEU B CD2 1 
ATOM   6284  N  N   . VAL B  1 371 ? 96.670  45.809  -18.530  1.00 31.90  ? 346 VAL B N   1 
ATOM   6285  C  CA  . VAL B  1 371 ? 95.857  47.032  -18.674  1.00 31.72  ? 346 VAL B CA  1 
ATOM   6286  C  C   . VAL B  1 371 ? 95.650  47.797  -17.355  1.00 31.26  ? 346 VAL B C   1 
ATOM   6287  O  O   . VAL B  1 371 ? 95.422  49.004  -17.373  1.00 31.98  ? 346 VAL B O   1 
ATOM   6288  C  CB  . VAL B  1 371 ? 94.519  46.790  -19.416  1.00 31.40  ? 346 VAL B CB  1 
ATOM   6289  C  CG1 . VAL B  1 371 ? 94.786  46.310  -20.830  1.00 30.76  ? 346 VAL B CG1 1 
ATOM   6290  C  CG2 . VAL B  1 371 ? 93.631  45.809  -18.660  1.00 32.10  ? 346 VAL B CG2 1 
ATOM   6291  N  N   . VAL B  1 372 ? 95.734  47.098  -16.225  1.00 30.30  ? 347 VAL B N   1 
ATOM   6292  C  CA  . VAL B  1 372 ? 95.787  47.748  -14.911  1.00 30.70  ? 347 VAL B CA  1 
ATOM   6293  C  C   . VAL B  1 372 ? 96.996  47.195  -14.152  1.00 31.17  ? 347 VAL B C   1 
ATOM   6294  O  O   . VAL B  1 372 ? 97.050  46.000  -13.829  1.00 30.59  ? 347 VAL B O   1 
ATOM   6295  C  CB  . VAL B  1 372 ? 94.497  47.536  -14.075  1.00 31.37  ? 347 VAL B CB  1 
ATOM   6296  C  CG1 . VAL B  1 372 ? 94.625  48.200  -12.704  1.00 30.97  ? 347 VAL B CG1 1 
ATOM   6297  C  CG2 . VAL B  1 372 ? 93.265  48.057  -14.809  1.00 30.93  ? 347 VAL B CG2 1 
ATOM   6298  N  N   . ASP B  1 373 ? 97.953  48.077  -13.868  1.00 31.87  ? 348 ASP B N   1 
ATOM   6299  C  CA  . ASP B  1 373 ? 99.239  47.719  -13.260  1.00 32.98  ? 348 ASP B CA  1 
ATOM   6300  C  C   . ASP B  1 373 ? 99.284  48.092  -11.764  1.00 32.95  ? 348 ASP B C   1 
ATOM   6301  O  O   . ASP B  1 373 ? 99.345  49.263  -11.404  1.00 33.33  ? 348 ASP B O   1 
ATOM   6302  C  CB  . ASP B  1 373 ? 100.380 48.415  -14.033  1.00 33.74  ? 348 ASP B CB  1 
ATOM   6303  C  CG  . ASP B  1 373 ? 101.784 47.993  -13.570  1.00 34.62  ? 348 ASP B CG  1 
ATOM   6304  O  OD1 . ASP B  1 373 ? 101.935 47.258  -12.565  1.00 33.88  ? 348 ASP B OD1 1 
ATOM   6305  O  OD2 . ASP B  1 373 ? 102.755 48.413  -14.233  1.00 35.76  ? 348 ASP B OD2 1 
ATOM   6306  N  N   . GLY B  1 374 ? 99.263  47.085  -10.899  1.00 32.18  ? 349 GLY B N   1 
ATOM   6307  C  CA  . GLY B  1 374 ? 99.319  47.326  -9.462   1.00 31.05  ? 349 GLY B CA  1 
ATOM   6308  C  C   . GLY B  1 374 ? 100.684 47.142  -8.818   1.00 30.73  ? 349 GLY B C   1 
ATOM   6309  O  O   . GLY B  1 374 ? 100.796 47.222  -7.598   1.00 31.20  ? 349 GLY B O   1 
ATOM   6310  N  N   . ARG B  1 375 ? 101.714 46.890  -9.625   1.00 30.51  ? 350 ARG B N   1 
ATOM   6311  C  CA  . ARG B  1 375 ? 103.064 46.628  -9.104   1.00 32.94  ? 350 ARG B CA  1 
ATOM   6312  C  C   . ARG B  1 375 ? 103.618 47.756  -8.228   1.00 35.48  ? 350 ARG B C   1 
ATOM   6313  O  O   . ARG B  1 375 ? 104.320 47.488  -7.257   1.00 35.70  ? 350 ARG B O   1 
ATOM   6314  C  CB  . ARG B  1 375 ? 104.051 46.299  -10.242  1.00 32.31  ? 350 ARG B CB  1 
ATOM   6315  C  CG  . ARG B  1 375 ? 103.904 44.889  -10.813  1.00 31.64  ? 350 ARG B CG  1 
ATOM   6316  C  CD  . ARG B  1 375 ? 104.767 44.703  -12.054  1.00 31.68  ? 350 ARG B CD  1 
ATOM   6317  N  NE  . ARG B  1 375 ? 104.545 45.786  -13.010  1.00 31.77  ? 350 ARG B NE  1 
ATOM   6318  C  CZ  . ARG B  1 375 ? 105.335 46.065  -14.042  1.00 33.01  ? 350 ARG B CZ  1 
ATOM   6319  N  NH1 . ARG B  1 375 ? 105.038 47.081  -14.834  1.00 32.27  ? 350 ARG B NH1 1 
ATOM   6320  N  NH2 . ARG B  1 375 ? 106.420 45.335  -14.289  1.00 34.54  ? 350 ARG B NH2 1 
ATOM   6321  N  N   . ASP B  1 376 ? 103.283 49.001  -8.577   1.00 38.75  ? 351 ASP B N   1 
ATOM   6322  C  CA  . ASP B  1 376 ? 103.788 50.211  -7.906   1.00 41.60  ? 351 ASP B CA  1 
ATOM   6323  C  C   . ASP B  1 376 ? 103.145 50.510  -6.560   1.00 38.89  ? 351 ASP B C   1 
ATOM   6324  O  O   . ASP B  1 376 ? 103.692 51.294  -5.778   1.00 38.20  ? 351 ASP B O   1 
ATOM   6325  C  CB  . ASP B  1 376 ? 103.582 51.444  -8.797   1.00 48.09  ? 351 ASP B CB  1 
ATOM   6326  C  CG  . ASP B  1 376 ? 104.622 51.567  -9.898   1.00 58.58  ? 351 ASP B CG  1 
ATOM   6327  O  OD1 . ASP B  1 376 ? 105.674 50.891  -9.832   1.00 60.97  ? 351 ASP B OD1 1 
ATOM   6328  O  OD2 . ASP B  1 376 ? 104.385 52.361  -10.836  1.00 64.88  ? 351 ASP B OD2 1 
ATOM   6329  N  N   . PHE B  1 377 ? 101.988 49.908  -6.289   1.00 37.01  ? 352 PHE B N   1 
ATOM   6330  C  CA  . PHE B  1 377 ? 101.215 50.270  -5.099   1.00 35.54  ? 352 PHE B CA  1 
ATOM   6331  C  C   . PHE B  1 377 ? 101.995 50.167  -3.786   1.00 34.48  ? 352 PHE B C   1 
ATOM   6332  O  O   . PHE B  1 377 ? 102.615 49.145  -3.500   1.00 33.56  ? 352 PHE B O   1 
ATOM   6333  C  CB  . PHE B  1 377 ? 99.919  49.461  -4.980   1.00 34.87  ? 352 PHE B CB  1 
ATOM   6334  C  CG  . PHE B  1 377 ? 99.129  49.797  -3.746   1.00 34.48  ? 352 PHE B CG  1 
ATOM   6335  C  CD1 . PHE B  1 377 ? 98.264  50.899  -3.736   1.00 34.17  ? 352 PHE B CD1 1 
ATOM   6336  C  CD2 . PHE B  1 377 ? 99.291  49.053  -2.569   1.00 32.97  ? 352 PHE B CD2 1 
ATOM   6337  C  CE1 . PHE B  1 377 ? 97.553  51.230  -2.587   1.00 33.23  ? 352 PHE B CE1 1 
ATOM   6338  C  CE2 . PHE B  1 377 ? 98.584  49.385  -1.423   1.00 32.39  ? 352 PHE B CE2 1 
ATOM   6339  C  CZ  . PHE B  1 377 ? 97.715  50.473  -1.432   1.00 32.33  ? 352 PHE B CZ  1 
ATOM   6340  N  N   . LYS B  1 378 ? 101.925 51.237  -3.002   1.00 35.25  ? 353 LYS B N   1 
ATOM   6341  C  CA  . LYS B  1 378 ? 102.503 51.312  -1.664   1.00 38.78  ? 353 LYS B CA  1 
ATOM   6342  C  C   . LYS B  1 378 ? 101.481 51.917  -0.725   1.00 37.64  ? 353 LYS B C   1 
ATOM   6343  O  O   . LYS B  1 378 ? 100.738 52.822  -1.102   1.00 37.44  ? 353 LYS B O   1 
ATOM   6344  C  CB  . LYS B  1 378 ? 103.738 52.210  -1.645   1.00 44.55  ? 353 LYS B CB  1 
ATOM   6345  C  CG  . LYS B  1 378 ? 104.983 51.597  -2.248   1.00 51.63  ? 353 LYS B CG  1 
ATOM   6346  C  CD  . LYS B  1 378 ? 106.213 52.441  -1.940   1.00 62.54  ? 353 LYS B CD  1 
ATOM   6347  C  CE  . LYS B  1 378 ? 106.525 52.463  -0.447   1.00 70.71  ? 353 LYS B CE  1 
ATOM   6348  N  NZ  . LYS B  1 378 ? 106.309 51.125  0.184    1.00 74.96  ? 353 LYS B NZ  1 
ATOM   6349  N  N   . LEU B  1 379 ? 101.450 51.426  0.504    1.00 37.33  ? 354 LEU B N   1 
ATOM   6350  C  CA  . LEU B  1 379 ? 100.597 52.019  1.518    1.00 37.70  ? 354 LEU B CA  1 
ATOM   6351  C  C   . LEU B  1 379 ? 101.460 52.690  2.587    1.00 38.34  ? 354 LEU B C   1 
ATOM   6352  O  O   . LEU B  1 379 ? 102.312 52.054  3.221    1.00 37.94  ? 354 LEU B O   1 
ATOM   6353  C  CB  . LEU B  1 379 ? 99.636  50.980  2.114    1.00 37.17  ? 354 LEU B CB  1 
ATOM   6354  C  CG  . LEU B  1 379 ? 98.525  51.484  3.055    1.00 36.71  ? 354 LEU B CG  1 
ATOM   6355  C  CD1 . LEU B  1 379 ? 97.606  52.516  2.396    1.00 36.39  ? 354 LEU B CD1 1 
ATOM   6356  C  CD2 . LEU B  1 379 ? 97.728  50.311  3.609    1.00 33.54  ? 354 LEU B CD2 1 
ATOM   6357  N  N   . GLN B  1 380 ? 101.248 53.991  2.749    1.00 39.06  ? 355 GLN B N   1 
ATOM   6358  C  CA  . GLN B  1 380 ? 102.018 54.794  3.681    1.00 40.99  ? 355 GLN B CA  1 
ATOM   6359  C  C   . GLN B  1 380 ? 101.723 54.333  5.103    1.00 36.45  ? 355 GLN B C   1 
ATOM   6360  O  O   . GLN B  1 380 ? 100.571 54.086  5.453    1.00 34.57  ? 355 GLN B O   1 
ATOM   6361  C  CB  . GLN B  1 380 ? 101.662 56.268  3.507    1.00 48.69  ? 355 GLN B CB  1 
ATOM   6362  C  CG  . GLN B  1 380 ? 102.531 57.218  4.307    1.00 57.87  ? 355 GLN B CG  1 
ATOM   6363  C  CD  . GLN B  1 380 ? 101.704 58.224  5.076    1.00 65.98  ? 355 GLN B CD  1 
ATOM   6364  O  OE1 . GLN B  1 380 ? 100.605 58.596  4.656    1.00 67.79  ? 355 GLN B OE1 1 
ATOM   6365  N  NE2 . GLN B  1 380 ? 102.221 58.661  6.217    1.00 70.48  ? 355 GLN B NE2 1 
ATOM   6366  N  N   . GLY B  1 381 ? 102.774 54.220  5.909    1.00 35.42  ? 356 GLY B N   1 
ATOM   6367  C  CA  . GLY B  1 381 ? 102.677 53.613  7.231    1.00 36.11  ? 356 GLY B CA  1 
ATOM   6368  C  C   . GLY B  1 381 ? 102.787 52.091  7.192    1.00 36.03  ? 356 GLY B C   1 
ATOM   6369  O  O   . GLY B  1 381 ? 103.035 51.461  8.218    1.00 37.87  ? 356 GLY B O   1 
ATOM   6370  N  N   . TYR B  1 382 ? 102.614 51.496  6.012    1.00 35.11  ? 357 TYR B N   1 
ATOM   6371  C  CA  . TYR B  1 382 ? 102.607 50.030  5.869    1.00 34.26  ? 357 TYR B CA  1 
ATOM   6372  C  C   . TYR B  1 382 ? 103.534 49.604  4.745    1.00 35.33  ? 357 TYR B C   1 
ATOM   6373  O  O   . TYR B  1 382 ? 103.214 48.704  3.971    1.00 34.38  ? 357 TYR B O   1 
ATOM   6374  C  CB  . TYR B  1 382 ? 101.183 49.519  5.602    1.00 32.71  ? 357 TYR B CB  1 
ATOM   6375  C  CG  . TYR B  1 382 ? 100.241 49.839  6.721    1.00 33.21  ? 357 TYR B CG  1 
ATOM   6376  C  CD1 . TYR B  1 382 ? 100.154 49.016  7.843    1.00 32.61  ? 357 TYR B CD1 1 
ATOM   6377  C  CD2 . TYR B  1 382 ? 99.463  50.992  6.682    1.00 35.14  ? 357 TYR B CD2 1 
ATOM   6378  C  CE1 . TYR B  1 382 ? 99.301  49.323  8.886    1.00 33.04  ? 357 TYR B CE1 1 
ATOM   6379  C  CE2 . TYR B  1 382 ? 98.605  51.312  7.723    1.00 35.20  ? 357 TYR B CE2 1 
ATOM   6380  C  CZ  . TYR B  1 382 ? 98.532  50.478  8.820    1.00 34.56  ? 357 TYR B CZ  1 
ATOM   6381  O  OH  . TYR B  1 382 ? 97.676  50.803  9.839    1.00 35.24  ? 357 TYR B OH  1 
ATOM   6382  N  N   . GLU B  1 383 ? 104.691 50.251  4.668    1.00 37.39  ? 358 GLU B N   1 
ATOM   6383  C  CA  . GLU B  1 383 ? 105.623 50.031  3.566    1.00 40.25  ? 358 GLU B CA  1 
ATOM   6384  C  C   . GLU B  1 383 ? 106.250 48.630  3.552    1.00 39.12  ? 358 GLU B C   1 
ATOM   6385  O  O   . GLU B  1 383 ? 106.720 48.169  2.509    1.00 39.26  ? 358 GLU B O   1 
ATOM   6386  C  CB  . GLU B  1 383 ? 106.704 51.118  3.549    1.00 44.88  ? 358 GLU B CB  1 
ATOM   6387  C  CG  . GLU B  1 383 ? 106.181 52.515  3.208    1.00 49.74  ? 358 GLU B CG  1 
ATOM   6388  C  CD  . GLU B  1 383 ? 105.723 53.316  4.421    1.00 52.45  ? 358 GLU B CD  1 
ATOM   6389  O  OE1 . GLU B  1 383 ? 105.900 52.839  5.568    1.00 52.29  ? 358 GLU B OE1 1 
ATOM   6390  O  OE2 . GLU B  1 383 ? 105.192 54.435  4.224    1.00 53.29  ? 358 GLU B OE2 1 
ATOM   6391  N  N   . ASN B  1 384 ? 106.248 47.959  4.703    1.00 37.58  ? 359 ASN B N   1 
ATOM   6392  C  CA  . ASN B  1 384 ? 106.759 46.591  4.802    1.00 36.62  ? 359 ASN B CA  1 
ATOM   6393  C  C   . ASN B  1 384 ? 105.676 45.512  4.801    1.00 33.36  ? 359 ASN B C   1 
ATOM   6394  O  O   . ASN B  1 384 ? 105.991 44.321  4.849    1.00 32.38  ? 359 ASN B O   1 
ATOM   6395  C  CB  . ASN B  1 384 ? 107.650 46.434  6.031    1.00 40.19  ? 359 ASN B CB  1 
ATOM   6396  C  CG  . ASN B  1 384 ? 108.944 47.206  5.910    1.00 47.25  ? 359 ASN B CG  1 
ATOM   6397  O  OD1 . ASN B  1 384 ? 109.727 46.991  4.981    1.00 50.82  ? 359 ASN B OD1 1 
ATOM   6398  N  ND2 . ASN B  1 384 ? 109.179 48.113  6.853    1.00 49.83  ? 359 ASN B ND2 1 
ATOM   6399  N  N   . GLY B  1 385 ? 104.410 45.925  4.738    1.00 31.72  ? 360 GLY B N   1 
ATOM   6400  C  CA  . GLY B  1 385 ? 103.289 44.976  4.594    1.00 31.07  ? 360 GLY B CA  1 
ATOM   6401  C  C   . GLY B  1 385 ? 103.289 44.347  3.214    1.00 30.60  ? 360 GLY B C   1 
ATOM   6402  O  O   . GLY B  1 385 ? 103.910 44.888  2.294    1.00 31.78  ? 360 GLY B O   1 
ATOM   6403  N  N   . HIS B  1 386 ? 102.610 43.212  3.051    1.00 28.88  ? 361 HIS B N   1 
ATOM   6404  C  CA  . HIS B  1 386 ? 102.670 42.493  1.773    1.00 28.84  ? 361 HIS B CA  1 
ATOM   6405  C  C   . HIS B  1 386 ? 101.575 42.937  0.796    1.00 28.64  ? 361 HIS B C   1 
ATOM   6406  O  O   . HIS B  1 386 ? 100.766 42.127  0.340    1.00 28.19  ? 361 HIS B O   1 
ATOM   6407  C  CB  . HIS B  1 386 ? 102.671 40.977  1.978    1.00 28.89  ? 361 HIS B CB  1 
ATOM   6408  C  CG  . HIS B  1 386 ? 103.387 40.543  3.213    1.00 29.90  ? 361 HIS B CG  1 
ATOM   6409  N  ND1 . HIS B  1 386 ? 102.830 39.674  4.128    1.00 29.56  ? 361 HIS B ND1 1 
ATOM   6410  C  CD2 . HIS B  1 386 ? 104.601 40.890  3.708    1.00 30.44  ? 361 HIS B CD2 1 
ATOM   6411  C  CE1 . HIS B  1 386 ? 103.676 39.494  5.130    1.00 30.22  ? 361 HIS B CE1 1 
ATOM   6412  N  NE2 . HIS B  1 386 ? 104.757 40.221  4.900    1.00 31.22  ? 361 HIS B NE2 1 
ATOM   6413  N  N   . PHE B  1 387 ? 101.593 44.226  0.462    1.00 28.04  ? 362 PHE B N   1 
ATOM   6414  C  CA  . PHE B  1 387 ? 100.573 44.840  -0.376   1.00 28.05  ? 362 PHE B CA  1 
ATOM   6415  C  C   . PHE B  1 387 ? 100.924 44.819  -1.867   1.00 28.44  ? 362 PHE B C   1 
ATOM   6416  O  O   . PHE B  1 387 ? 102.006 45.242  -2.284   1.00 28.53  ? 362 PHE B O   1 
ATOM   6417  C  CB  . PHE B  1 387 ? 100.253 46.269  0.101    1.00 26.13  ? 362 PHE B CB  1 
ATOM   6418  C  CG  . PHE B  1 387 ? 99.553  46.320  1.429    1.00 25.20  ? 362 PHE B CG  1 
ATOM   6419  C  CD1 . PHE B  1 387 ? 98.206  46.009  1.531    1.00 24.54  ? 362 PHE B CD1 1 
ATOM   6420  C  CD2 . PHE B  1 387 ? 100.248 46.670  2.585    1.00 25.56  ? 362 PHE B CD2 1 
ATOM   6421  C  CE1 . PHE B  1 387 ? 97.554  46.060  2.763    1.00 25.13  ? 362 PHE B CE1 1 
ATOM   6422  C  CE2 . PHE B  1 387 ? 99.612  46.722  3.816    1.00 25.26  ? 362 PHE B CE2 1 
ATOM   6423  C  CZ  . PHE B  1 387 ? 98.260  46.415  3.909    1.00 25.58  ? 362 PHE B CZ  1 
ATOM   6424  N  N   . ILE B  1 388 ? 99.992  44.301  -2.658   1.00 28.35  ? 363 ILE B N   1 
ATOM   6425  C  CA  . ILE B  1 388 ? 100.099 44.341  -4.113   1.00 28.60  ? 363 ILE B CA  1 
ATOM   6426  C  C   . ILE B  1 388 ? 98.802  44.951  -4.599   1.00 27.37  ? 363 ILE B C   1 
ATOM   6427  O  O   . ILE B  1 388 ? 97.731  44.555  -4.152   1.00 27.03  ? 363 ILE B O   1 
ATOM   6428  C  CB  . ILE B  1 388 ? 100.285 42.931  -4.725   1.00 29.41  ? 363 ILE B CB  1 
ATOM   6429  C  CG1 . ILE B  1 388 ? 101.421 42.170  -4.015   1.00 31.88  ? 363 ILE B CG1 1 
ATOM   6430  C  CG2 . ILE B  1 388 ? 100.552 43.026  -6.225   1.00 29.18  ? 363 ILE B CG2 1 
ATOM   6431  C  CD1 . ILE B  1 388 ? 101.378 40.656  -4.175   1.00 31.99  ? 363 ILE B CD1 1 
ATOM   6432  N  N   . GLY B  1 389 ? 98.902  45.939  -5.480   1.00 26.63  ? 364 GLY B N   1 
ATOM   6433  C  CA  . GLY B  1 389 ? 97.731  46.525  -6.121   1.00 26.38  ? 364 GLY B CA  1 
ATOM   6434  C  C   . GLY B  1 389 ? 97.085  45.561  -7.109   1.00 26.44  ? 364 GLY B C   1 
ATOM   6435  O  O   . GLY B  1 389 ? 97.726  44.609  -7.575   1.00 25.47  ? 364 GLY B O   1 
ATOM   6436  N  N   . GLY B  1 390 ? 95.815  45.805  -7.424   1.00 26.83  ? 365 GLY B N   1 
ATOM   6437  C  CA  . GLY B  1 390 ? 95.079  44.972  -8.373   1.00 26.84  ? 365 GLY B CA  1 
ATOM   6438  C  C   . GLY B  1 390 ? 95.725  44.986  -9.754   1.00 26.85  ? 365 GLY B C   1 
ATOM   6439  O  O   . GLY B  1 390 ? 96.160  46.037  -10.247  1.00 26.23  ? 365 GLY B O   1 
ATOM   6440  N  N   . CYS B  1 391 ? 95.793  43.804  -10.365  1.00 27.18  ? 366 CYS B N   1 
ATOM   6441  C  CA  . CYS B  1 391 ? 96.346  43.646  -11.698  1.00 27.67  ? 366 CYS B CA  1 
ATOM   6442  C  C   . CYS B  1 391 ? 95.306  43.041  -12.644  1.00 27.69  ? 366 CYS B C   1 
ATOM   6443  O  O   . CYS B  1 391 ? 94.559  42.134  -12.256  1.00 27.28  ? 366 CYS B O   1 
ATOM   6444  C  CB  . CYS B  1 391 ? 97.604  42.769  -11.661  1.00 29.11  ? 366 CYS B CB  1 
ATOM   6445  S  SG  . CYS B  1 391 ? 99.066  43.492  -10.866  1.00 31.17  ? 366 CYS B SG  1 
ATOM   6446  N  N   . LEU B  1 392 ? 95.276  43.547  -13.884  1.00 26.69  ? 367 LEU B N   1 
ATOM   6447  C  CA  . LEU B  1 392 ? 94.410  43.026  -14.940  1.00 23.92  ? 367 LEU B CA  1 
ATOM   6448  C  C   . LEU B  1 392 ? 95.186  42.844  -16.248  1.00 23.61  ? 367 LEU B C   1 
ATOM   6449  O  O   . LEU B  1 392 ? 95.742  43.807  -16.801  1.00 23.20  ? 367 LEU B O   1 
ATOM   6450  C  CB  . LEU B  1 392 ? 93.182  43.933  -15.130  1.00 23.64  ? 367 LEU B CB  1 
ATOM   6451  C  CG  . LEU B  1 392 ? 92.018  43.481  -16.034  1.00 23.38  ? 367 LEU B CG  1 
ATOM   6452  C  CD1 . LEU B  1 392 ? 91.383  42.173  -15.557  1.00 22.04  ? 367 LEU B CD1 1 
ATOM   6453  C  CD2 . LEU B  1 392 ? 90.978  44.595  -16.119  1.00 23.44  ? 367 LEU B CD2 1 
ATOM   6454  N  N   . PHE B  1 393 ? 95.242  41.593  -16.714  1.00 23.52  ? 368 PHE B N   1 
ATOM   6455  C  CA  . PHE B  1 393 ? 95.871  41.246  -17.990  1.00 25.05  ? 368 PHE B CA  1 
ATOM   6456  C  C   . PHE B  1 393 ? 94.807  40.983  -19.049  1.00 26.10  ? 368 PHE B C   1 
ATOM   6457  O  O   . PHE B  1 393 ? 93.807  40.303  -18.793  1.00 25.90  ? 368 PHE B O   1 
ATOM   6458  C  CB  . PHE B  1 393 ? 96.720  39.967  -17.873  1.00 25.01  ? 368 PHE B CB  1 
ATOM   6459  C  CG  . PHE B  1 393 ? 98.089  40.165  -17.281  1.00 26.06  ? 368 PHE B CG  1 
ATOM   6460  C  CD1 . PHE B  1 393 ? 99.113  40.731  -18.029  1.00 26.78  ? 368 PHE B CD1 1 
ATOM   6461  C  CD2 . PHE B  1 393 ? 98.367  39.729  -15.984  1.00 25.92  ? 368 PHE B CD2 1 
ATOM   6462  C  CE1 . PHE B  1 393 ? 100.382 40.892  -17.494  1.00 27.74  ? 368 PHE B CE1 1 
ATOM   6463  C  CE2 . PHE B  1 393 ? 99.632  39.888  -15.440  1.00 26.83  ? 368 PHE B CE2 1 
ATOM   6464  C  CZ  . PHE B  1 393 ? 100.644 40.471  -16.199  1.00 27.95  ? 368 PHE B CZ  1 
ATOM   6465  N  N   . ASP B  1 394 ? 95.046  41.508  -20.245  1.00 26.99  ? 369 ASP B N   1 
ATOM   6466  C  CA  . ASP B  1 394 ? 94.247  41.206  -21.428  1.00 27.41  ? 369 ASP B CA  1 
ATOM   6467  C  C   . ASP B  1 394 ? 95.153  40.473  -22.422  1.00 28.56  ? 369 ASP B C   1 
ATOM   6468  O  O   . ASP B  1 394 ? 96.388  40.460  -22.270  1.00 29.29  ? 369 ASP B O   1 
ATOM   6469  C  CB  . ASP B  1 394 ? 93.737  42.517  -22.041  1.00 27.94  ? 369 ASP B CB  1 
ATOM   6470  C  CG  . ASP B  1 394 ? 92.612  42.311  -23.048  1.00 27.76  ? 369 ASP B CG  1 
ATOM   6471  O  OD1 . ASP B  1 394 ? 92.178  41.160  -23.285  1.00 27.42  ? 369 ASP B OD1 1 
ATOM   6472  O  OD2 . ASP B  1 394 ? 92.147  43.325  -23.596  1.00 27.68  ? 369 ASP B OD2 1 
ATOM   6473  N  N   . ASP B  1 395 ? 94.545  39.860  -23.431  1.00 28.88  ? 370 ASP B N   1 
ATOM   6474  C  CA  . ASP B  1 395 ? 95.279  39.111  -24.456  1.00 30.61  ? 370 ASP B CA  1 
ATOM   6475  C  C   . ASP B  1 395 ? 96.137  37.988  -23.874  1.00 29.71  ? 370 ASP B C   1 
ATOM   6476  O  O   . ASP B  1 395 ? 97.263  37.753  -24.316  1.00 31.59  ? 370 ASP B O   1 
ATOM   6477  C  CB  . ASP B  1 395 ? 96.113  40.061  -25.334  1.00 32.94  ? 370 ASP B CB  1 
ATOM   6478  C  CG  . ASP B  1 395 ? 95.260  41.101  -26.044  1.00 35.77  ? 370 ASP B CG  1 
ATOM   6479  O  OD1 . ASP B  1 395 ? 94.181  40.746  -26.565  1.00 37.83  ? 370 ASP B OD1 1 
ATOM   6480  O  OD2 . ASP B  1 395 ? 95.661  42.277  -26.080  1.00 37.38  ? 370 ASP B OD2 1 
ATOM   6481  N  N   . VAL B  1 396 ? 95.599  37.290  -22.881  1.00 27.29  ? 371 VAL B N   1 
ATOM   6482  C  CA  . VAL B  1 396 ? 96.299  36.155  -22.290  1.00 26.54  ? 371 VAL B CA  1 
ATOM   6483  C  C   . VAL B  1 396 ? 96.013  34.952  -23.171  1.00 26.15  ? 371 VAL B C   1 
ATOM   6484  O  O   . VAL B  1 396 ? 94.914  34.817  -23.701  1.00 24.86  ? 371 VAL B O   1 
ATOM   6485  C  CB  . VAL B  1 396 ? 95.848  35.912  -20.826  1.00 26.60  ? 371 VAL B CB  1 
ATOM   6486  C  CG1 . VAL B  1 396 ? 96.507  34.677  -20.221  1.00 25.92  ? 371 VAL B CG1 1 
ATOM   6487  C  CG2 . VAL B  1 396 ? 96.142  37.148  -19.981  1.00 25.84  ? 371 VAL B CG2 1 
ATOM   6488  N  N   . THR B  1 397 ? 97.016  34.099  -23.353  1.00 27.74  ? 372 THR B N   1 
ATOM   6489  C  CA  . THR B  1 397 ? 96.856  32.863  -24.120  1.00 28.69  ? 372 THR B CA  1 
ATOM   6490  C  C   . THR B  1 397 ? 97.215  31.660  -23.238  1.00 29.01  ? 372 THR B C   1 
ATOM   6491  O  O   . THR B  1 397 ? 97.908  31.823  -22.233  1.00 29.03  ? 372 THR B O   1 
ATOM   6492  C  CB  . THR B  1 397 ? 97.706  32.876  -25.407  1.00 30.10  ? 372 THR B CB  1 
ATOM   6493  O  OG1 . THR B  1 397 ? 99.095  33.003  -25.067  1.00 30.61  ? 372 THR B OG1 1 
ATOM   6494  C  CG2 . THR B  1 397 ? 97.277  34.043  -26.336  1.00 30.86  ? 372 THR B CG2 1 
ATOM   6495  N  N   . PRO B  1 398 ? 96.734  30.451  -23.599  1.00 29.31  ? 373 PRO B N   1 
ATOM   6496  C  CA  . PRO B  1 398 ? 96.928  29.293  -22.717  1.00 30.00  ? 373 PRO B CA  1 
ATOM   6497  C  C   . PRO B  1 398 ? 98.375  28.787  -22.549  1.00 30.32  ? 373 PRO B C   1 
ATOM   6498  O  O   . PRO B  1 398 ? 98.626  27.979  -21.648  1.00 29.40  ? 373 PRO B O   1 
ATOM   6499  C  CB  . PRO B  1 398 ? 96.028  28.209  -23.339  1.00 30.05  ? 373 PRO B CB  1 
ATOM   6500  C  CG  . PRO B  1 398 ? 95.084  28.944  -24.227  1.00 29.63  ? 373 PRO B CG  1 
ATOM   6501  C  CD  . PRO B  1 398 ? 95.863  30.117  -24.741  1.00 29.71  ? 373 PRO B CD  1 
ATOM   6502  N  N   . ASP B  1 399 ? 99.311  29.267  -23.371  1.00 31.78  ? 374 ASP B N   1 
ATOM   6503  C  CA  . ASP B  1 399 ? 100.734 28.906  -23.200  1.00 33.78  ? 374 ASP B CA  1 
ATOM   6504  C  C   . ASP B  1 399 ? 101.504 29.780  -22.187  1.00 32.53  ? 374 ASP B C   1 
ATOM   6505  O  O   . ASP B  1 399 ? 102.671 29.513  -21.894  1.00 34.45  ? 374 ASP B O   1 
ATOM   6506  C  CB  . ASP B  1 399 ? 101.477 28.810  -24.547  1.00 38.71  ? 374 ASP B CB  1 
ATOM   6507  C  CG  . ASP B  1 399 ? 101.105 29.929  -25.522  1.00 46.81  ? 374 ASP B CG  1 
ATOM   6508  O  OD1 . ASP B  1 399 ? 100.667 31.016  -25.078  1.00 45.40  ? 374 ASP B OD1 1 
ATOM   6509  O  OD2 . ASP B  1 399 ? 101.256 29.709  -26.748  1.00 52.26  ? 374 ASP B OD2 1 
HETATM 6510  N  N   . MSE B  1 400 ? 100.845 30.801  -21.643  1.00 28.94  ? 375 MSE B N   1 
HETATM 6511  C  CA  . MSE B  1 400 ? 101.457 31.674  -20.641  1.00 28.40  ? 375 MSE B CA  1 
HETATM 6512  C  C   . MSE B  1 400 ? 101.406 31.131  -19.239  1.00 27.24  ? 375 MSE B C   1 
HETATM 6513  O  O   . MSE B  1 400 ? 100.424 30.487  -18.833  1.00 24.80  ? 375 MSE B O   1 
HETATM 6514  C  CB  . MSE B  1 400 ? 100.710 32.992  -20.632  1.00 29.42  ? 375 MSE B CB  1 
HETATM 6515  C  CG  . MSE B  1 400 ? 100.953 33.680  -21.964  1.00 32.07  ? 375 MSE B CG  1 
HETATM 6516  SE SE  . MSE B  1 400 ? 100.148 35.463  -21.831  1.00 34.40  ? 375 MSE B SE  1 
HETATM 6517  C  CE  . MSE B  1 400 ? 100.251 36.014  -23.725  1.00 33.47  ? 375 MSE B CE  1 
ATOM   6518  N  N   . ASP B  1 401 ? 102.473 31.410  -18.487  1.00 28.83  ? 376 ASP B N   1 
ATOM   6519  C  CA  . ASP B  1 401 ? 102.594 31.025  -17.072  1.00 30.20  ? 376 ASP B CA  1 
ATOM   6520  C  C   . ASP B  1 401 ? 101.456 31.541  -16.210  1.00 27.98  ? 376 ASP B C   1 
ATOM   6521  O  O   . ASP B  1 401 ? 100.966 30.802  -15.364  1.00 27.44  ? 376 ASP B O   1 
ATOM   6522  C  CB  . ASP B  1 401 ? 103.924 31.499  -16.481  1.00 33.31  ? 376 ASP B CB  1 
ATOM   6523  C  CG  . ASP B  1 401 ? 105.092 30.660  -16.932  1.00 38.11  ? 376 ASP B CG  1 
ATOM   6524  O  OD1 . ASP B  1 401 ? 104.876 29.556  -17.468  1.00 40.89  ? 376 ASP B OD1 1 
ATOM   6525  O  OD2 . ASP B  1 401 ? 106.236 31.107  -16.744  1.00 42.73  ? 376 ASP B OD2 1 
ATOM   6526  N  N   . ILE B  1 402 ? 101.044 32.797  -16.433  1.00 26.96  ? 377 ILE B N   1 
ATOM   6527  C  CA  . ILE B  1 402 ? 99.888  33.398  -15.721  1.00 26.11  ? 377 ILE B CA  1 
ATOM   6528  C  C   . ILE B  1 402 ? 98.554  32.678  -15.995  1.00 26.25  ? 377 ILE B C   1 
ATOM   6529  O  O   . ILE B  1 402 ? 97.586  32.845  -15.247  1.00 26.11  ? 377 ILE B O   1 
ATOM   6530  C  CB  . ILE B  1 402 ? 99.717  34.925  -15.986  1.00 25.71  ? 377 ILE B CB  1 
ATOM   6531  C  CG1 . ILE B  1 402 ? 99.404  35.212  -17.458  1.00 26.21  ? 377 ILE B CG1 1 
ATOM   6532  C  CG2 . ILE B  1 402 ? 100.937 35.717  -15.520  1.00 25.90  ? 377 ILE B CG2 1 
ATOM   6533  C  CD1 . ILE B  1 402 ? 99.019  36.654  -17.725  1.00 25.96  ? 377 ILE B CD1 1 
ATOM   6534  N  N   . TYR B  1 403 ? 98.501  31.896  -17.072  1.00 25.80  ? 378 TYR B N   1 
ATOM   6535  C  CA  . TYR B  1 403 ? 97.316  31.109  -17.374  1.00 25.42  ? 378 TYR B CA  1 
ATOM   6536  C  C   . TYR B  1 403 ? 97.377  29.697  -16.763  1.00 25.68  ? 378 TYR B C   1 
ATOM   6537  O  O   . TYR B  1 403 ? 96.391  29.221  -16.194  1.00 25.98  ? 378 TYR B O   1 
ATOM   6538  C  CB  . TYR B  1 403 ? 97.060  31.041  -18.883  1.00 25.02  ? 378 TYR B CB  1 
ATOM   6539  C  CG  . TYR B  1 403 ? 95.842  30.201  -19.202  1.00 23.70  ? 378 TYR B CG  1 
ATOM   6540  C  CD1 . TYR B  1 403 ? 94.567  30.775  -19.225  1.00 22.58  ? 378 TYR B CD1 1 
ATOM   6541  C  CD2 . TYR B  1 403 ? 95.961  28.826  -19.441  1.00 23.37  ? 378 TYR B CD2 1 
ATOM   6542  C  CE1 . TYR B  1 403 ? 93.447  30.009  -19.494  1.00 22.26  ? 378 TYR B CE1 1 
ATOM   6543  C  CE2 . TYR B  1 403 ? 94.843  28.045  -19.706  1.00 22.87  ? 378 TYR B CE2 1 
ATOM   6544  C  CZ  . TYR B  1 403 ? 93.589  28.642  -19.729  1.00 21.98  ? 378 TYR B CZ  1 
ATOM   6545  O  OH  . TYR B  1 403 ? 92.477  27.876  -19.984  1.00 20.86  ? 378 TYR B OH  1 
ATOM   6546  N  N   . LYS B  1 404 ? 98.530  29.043  -16.883  1.00 26.64  ? 379 LYS B N   1 
ATOM   6547  C  CA  . LYS B  1 404 ? 98.721  27.664  -16.420  1.00 28.39  ? 379 LYS B CA  1 
ATOM   6548  C  C   . LYS B  1 404 ? 98.867  27.560  -14.897  1.00 27.55  ? 379 LYS B C   1 
ATOM   6549  O  O   . LYS B  1 404 ? 98.476  26.555  -14.294  1.00 28.30  ? 379 LYS B O   1 
ATOM   6550  C  CB  . LYS B  1 404 ? 99.949  27.044  -17.103  1.00 32.72  ? 379 LYS B CB  1 
ATOM   6551  C  CG  . LYS B  1 404 ? 99.756  26.790  -18.598  1.00 36.95  ? 379 LYS B CG  1 
ATOM   6552  C  CD  . LYS B  1 404 ? 100.982 26.154  -19.234  1.00 40.82  ? 379 LYS B CD  1 
ATOM   6553  C  CE  . LYS B  1 404 ? 102.050 27.199  -19.520  1.00 46.26  ? 379 LYS B CE  1 
ATOM   6554  N  NZ  . LYS B  1 404 ? 103.242 26.635  -20.214  1.00 49.86  ? 379 LYS B NZ  1 
ATOM   6555  N  N   . THR B  1 405 ? 99.427  28.596  -14.278  1.00 25.27  ? 380 THR B N   1 
ATOM   6556  C  CA  . THR B  1 405 ? 99.774  28.540  -12.853  1.00 24.49  ? 380 THR B CA  1 
ATOM   6557  C  C   . THR B  1 405 ? 98.713  29.244  -12.011  1.00 24.38  ? 380 THR B C   1 
ATOM   6558  O  O   . THR B  1 405 ? 98.259  30.342  -12.354  1.00 24.64  ? 380 THR B O   1 
ATOM   6559  C  CB  . THR B  1 405 ? 101.186 29.148  -12.598  1.00 24.70  ? 380 THR B CB  1 
ATOM   6560  O  OG1 . THR B  1 405 ? 102.149 28.473  -13.417  1.00 25.68  ? 380 THR B OG1 1 
ATOM   6561  C  CG2 . THR B  1 405 ? 101.620 29.037  -11.138  1.00 24.31  ? 380 THR B CG2 1 
ATOM   6562  N  N   . GLU B  1 406 ? 98.321  28.600  -10.915  1.00 25.12  ? 381 GLU B N   1 
ATOM   6563  C  CA  . GLU B  1 406 ? 97.523  29.258  -9.884   1.00 26.26  ? 381 GLU B CA  1 
ATOM   6564  C  C   . GLU B  1 406 ? 98.382  30.328  -9.201   1.00 27.10  ? 381 GLU B C   1 
ATOM   6565  O  O   . GLU B  1 406 ? 99.373  30.009  -8.553   1.00 27.74  ? 381 GLU B O   1 
ATOM   6566  C  CB  . GLU B  1 406 ? 97.002  28.239  -8.859   1.00 27.10  ? 381 GLU B CB  1 
ATOM   6567  C  CG  . GLU B  1 406 ? 96.133  28.855  -7.765   1.00 29.79  ? 381 GLU B CG  1 
ATOM   6568  C  CD  . GLU B  1 406 ? 95.546  27.831  -6.800   1.00 32.18  ? 381 GLU B CD  1 
ATOM   6569  O  OE1 . GLU B  1 406 ? 96.305  26.970  -6.294   1.00 34.73  ? 381 GLU B OE1 1 
ATOM   6570  O  OE2 . GLU B  1 406 ? 94.326  27.903  -6.531   1.00 31.21  ? 381 GLU B OE2 1 
ATOM   6571  N  N   . ILE B  1 407 ? 98.000  31.595  -9.366   1.00 27.39  ? 382 ILE B N   1 
ATOM   6572  C  CA  . ILE B  1 407 ? 98.738  32.735  -8.796   1.00 24.97  ? 382 ILE B CA  1 
ATOM   6573  C  C   . ILE B  1 407 ? 98.390  32.999  -7.318   1.00 24.65  ? 382 ILE B C   1 
ATOM   6574  O  O   . ILE B  1 407 ? 99.268  33.371  -6.527   1.00 23.77  ? 382 ILE B O   1 
ATOM   6575  C  CB  . ILE B  1 407 ? 98.536  34.017  -9.642   1.00 23.63  ? 382 ILE B CB  1 
ATOM   6576  C  CG1 . ILE B  1 407 ? 98.913  33.751  -11.112  1.00 23.54  ? 382 ILE B CG1 1 
ATOM   6577  C  CG2 . ILE B  1 407 ? 99.353  35.192  -9.084   1.00 22.97  ? 382 ILE B CG2 1 
ATOM   6578  C  CD1 . ILE B  1 407 ? 98.338  34.764  -12.086  1.00 23.53  ? 382 ILE B CD1 1 
ATOM   6579  N  N   . PHE B  1 408 ? 97.139  32.781  -6.919   1.00 24.34  ? 383 PHE B N   1 
ATOM   6580  C  CA  . PHE B  1 408 ? 96.681  33.034  -5.548   1.00 23.48  ? 383 PHE B CA  1 
ATOM   6581  C  C   . PHE B  1 408 ? 96.944  34.479  -5.096   1.00 23.65  ? 383 PHE B C   1 
ATOM   6582  O  O   . PHE B  1 408 ? 97.419  34.716  -4.046   1.00 23.76  ? 383 PHE B O   1 
ATOM   6583  C  CB  . PHE B  1 408 ? 97.281  32.028  -4.556   1.00 23.85  ? 383 PHE B CB  1 
ATOM   6584  C  CG  . PHE B  1 408 ? 96.275  31.337  -3.679   1.00 24.34  ? 383 PHE B CG  1 
ATOM   6585  C  CD1 . PHE B  1 408 ? 95.264  30.571  -4.228   1.00 24.45  ? 383 PHE B CD1 1 
ATOM   6586  C  CD2 . PHE B  1 408 ? 96.339  31.428  -2.316   1.00 24.30  ? 383 PHE B CD2 1 
ATOM   6587  C  CE1 . PHE B  1 408 ? 94.350  29.933  -3.435   1.00 24.38  ? 383 PHE B CE1 1 
ATOM   6588  C  CE2 . PHE B  1 408 ? 95.429  30.782  -1.513   1.00 23.70  ? 383 PHE B CE2 1 
ATOM   6589  C  CZ  . PHE B  1 408 ? 94.438  30.030  -2.080   1.00 24.73  ? 383 PHE B CZ  1 
ATOM   6590  N  N   . GLY B  1 409 ? 96.664  35.424  -5.969   1.00 24.41  ? 384 GLY B N   1 
ATOM   6591  C  CA  . GLY B  1 409 ? 96.894  36.835  -5.721   1.00 23.40  ? 384 GLY B CA  1 
ATOM   6592  C  C   . GLY B  1 409 ? 95.952  37.643  -6.600   1.00 22.54  ? 384 GLY B C   1 
ATOM   6593  O  O   . GLY B  1 409 ? 95.220  37.058  -7.399   1.00 20.99  ? 384 GLY B O   1 
ATOM   6594  N  N   . PRO B  1 410 ? 95.982  38.991  -6.464   1.00 22.17  ? 385 PRO B N   1 
ATOM   6595  C  CA  . PRO B  1 410 ? 95.055  39.917  -7.104   1.00 21.97  ? 385 PRO B CA  1 
ATOM   6596  C  C   . PRO B  1 410 ? 95.429  40.183  -8.581   1.00 22.73  ? 385 PRO B C   1 
ATOM   6597  O  O   . PRO B  1 410 ? 95.722  41.335  -8.968   1.00 23.42  ? 385 PRO B O   1 
ATOM   6598  C  CB  . PRO B  1 410 ? 95.202  41.184  -6.249   1.00 21.98  ? 385 PRO B CB  1 
ATOM   6599  C  CG  . PRO B  1 410 ? 96.631  41.163  -5.815   1.00 22.45  ? 385 PRO B CG  1 
ATOM   6600  C  CD  . PRO B  1 410 ? 97.086  39.715  -5.799   1.00 22.29  ? 385 PRO B CD  1 
ATOM   6601  N  N   . VAL B  1 411 ? 95.414  39.110  -9.374   1.00 22.40  ? 386 VAL B N   1 
ATOM   6602  C  CA  . VAL B  1 411 ? 95.793  39.125  -10.788  1.00 23.88  ? 386 VAL B CA  1 
ATOM   6603  C  C   . VAL B  1 411 ? 94.723  38.390  -11.622  1.00 24.99  ? 386 VAL B C   1 
ATOM   6604  O  O   . VAL B  1 411 ? 94.612  37.156  -11.561  1.00 24.80  ? 386 VAL B O   1 
ATOM   6605  C  CB  . VAL B  1 411 ? 97.173  38.447  -10.992  1.00 23.36  ? 386 VAL B CB  1 
ATOM   6606  C  CG1 . VAL B  1 411 ? 97.633  38.541  -12.445  1.00 22.59  ? 386 VAL B CG1 1 
ATOM   6607  C  CG2 . VAL B  1 411 ? 98.215  39.045  -10.056  1.00 23.76  ? 386 VAL B CG2 1 
ATOM   6608  N  N   . LEU B  1 412 ? 93.926  39.152  -12.371  1.00 24.88  ? 387 LEU B N   1 
ATOM   6609  C  CA  . LEU B  1 412 ? 92.885  38.584  -13.239  1.00 23.68  ? 387 LEU B CA  1 
ATOM   6610  C  C   . LEU B  1 412 ? 93.326  38.624  -14.703  1.00 25.08  ? 387 LEU B C   1 
ATOM   6611  O  O   . LEU B  1 412 ? 93.789  39.657  -15.195  1.00 25.42  ? 387 LEU B O   1 
ATOM   6612  C  CB  . LEU B  1 412 ? 91.552  39.317  -13.048  1.00 22.32  ? 387 LEU B CB  1 
ATOM   6613  C  CG  . LEU B  1 412 ? 90.337  38.924  -13.906  1.00 21.68  ? 387 LEU B CG  1 
ATOM   6614  C  CD1 . LEU B  1 412 ? 89.933  37.461  -13.721  1.00 19.95  ? 387 LEU B CD1 1 
ATOM   6615  C  CD2 . LEU B  1 412 ? 89.164  39.858  -13.615  1.00 21.84  ? 387 LEU B CD2 1 
ATOM   6616  N  N   . SER B  1 413 ? 93.196  37.485  -15.381  1.00 24.79  ? 388 SER B N   1 
ATOM   6617  C  CA  . SER B  1 413 ? 93.630  37.323  -16.774  1.00 23.72  ? 388 SER B CA  1 
ATOM   6618  C  C   . SER B  1 413 ? 92.421  37.197  -17.678  1.00 22.73  ? 388 SER B C   1 
ATOM   6619  O  O   . SER B  1 413 ? 91.492  36.448  -17.368  1.00 21.95  ? 388 SER B O   1 
ATOM   6620  C  CB  . SER B  1 413 ? 94.472  36.047  -16.939  1.00 23.43  ? 388 SER B CB  1 
ATOM   6621  O  OG  . SER B  1 413 ? 95.667  36.098  -16.180  1.00 23.91  ? 388 SER B OG  1 
ATOM   6622  N  N   . VAL B  1 414 ? 92.436  37.928  -18.792  1.00 22.65  ? 389 VAL B N   1 
ATOM   6623  C  CA  . VAL B  1 414 ? 91.351  37.872  -19.783  1.00 21.82  ? 389 VAL B CA  1 
ATOM   6624  C  C   . VAL B  1 414 ? 91.860  37.150  -21.036  1.00 22.19  ? 389 VAL B C   1 
ATOM   6625  O  O   . VAL B  1 414 ? 92.853  37.558  -21.659  1.00 22.05  ? 389 VAL B O   1 
ATOM   6626  C  CB  . VAL B  1 414 ? 90.767  39.278  -20.123  1.00 21.01  ? 389 VAL B CB  1 
ATOM   6627  C  CG1 . VAL B  1 414 ? 89.607  39.168  -21.124  1.00 19.71  ? 389 VAL B CG1 1 
ATOM   6628  C  CG2 . VAL B  1 414 ? 90.335  40.007  -18.844  1.00 20.43  ? 389 VAL B CG2 1 
ATOM   6629  N  N   . VAL B  1 415 ? 91.184  36.052  -21.358  1.00 22.70  ? 390 VAL B N   1 
ATOM   6630  C  CA  . VAL B  1 415 ? 91.459  35.253  -22.536  1.00 23.45  ? 390 VAL B CA  1 
ATOM   6631  C  C   . VAL B  1 415 ? 90.272  35.411  -23.472  1.00 24.56  ? 390 VAL B C   1 
ATOM   6632  O  O   . VAL B  1 415 ? 89.154  35.007  -23.136  1.00 24.79  ? 390 VAL B O   1 
ATOM   6633  C  CB  . VAL B  1 415 ? 91.653  33.759  -22.183  1.00 22.59  ? 390 VAL B CB  1 
ATOM   6634  C  CG1 . VAL B  1 415 ? 91.923  32.943  -23.448  1.00 22.17  ? 390 VAL B CG1 1 
ATOM   6635  C  CG2 . VAL B  1 415 ? 92.793  33.595  -21.182  1.00 22.19  ? 390 VAL B CG2 1 
ATOM   6636  N  N   . ARG B  1 416 ? 90.530  36.009  -24.633  1.00 25.51  ? 391 ARG B N   1 
ATOM   6637  C  CA  . ARG B  1 416 ? 89.510  36.282  -25.654  1.00 26.38  ? 391 ARG B CA  1 
ATOM   6638  C  C   . ARG B  1 416 ? 89.208  35.040  -26.513  1.00 26.63  ? 391 ARG B C   1 
ATOM   6639  O  O   . ARG B  1 416 ? 90.049  34.590  -27.291  1.00 28.43  ? 391 ARG B O   1 
ATOM   6640  C  CB  . ARG B  1 416 ? 89.931  37.479  -26.528  1.00 26.96  ? 391 ARG B CB  1 
ATOM   6641  C  CG  . ARG B  1 416 ? 90.009  38.806  -25.764  1.00 27.27  ? 391 ARG B CG  1 
ATOM   6642  C  CD  . ARG B  1 416 ? 90.760  39.879  -26.535  1.00 27.19  ? 391 ARG B CD  1 
ATOM   6643  N  NE  . ARG B  1 416 ? 90.684  41.187  -25.880  1.00 27.92  ? 391 ARG B NE  1 
ATOM   6644  C  CZ  . ARG B  1 416 ? 89.914  42.207  -26.276  1.00 27.23  ? 391 ARG B CZ  1 
ATOM   6645  N  NH1 . ARG B  1 416 ? 89.930  43.349  -25.599  1.00 26.00  ? 391 ARG B NH1 1 
ATOM   6646  N  NH2 . ARG B  1 416 ? 89.127  42.097  -27.345  1.00 27.30  ? 391 ARG B NH2 1 
ATOM   6647  N  N   . ALA B  1 417 ? 88.006  34.492  -26.339  1.00 25.81  ? 392 ALA B N   1 
ATOM   6648  C  CA  . ALA B  1 417 ? 87.500  33.371  -27.142  1.00 27.12  ? 392 ALA B CA  1 
ATOM   6649  C  C   . ALA B  1 417 ? 86.593  33.875  -28.265  1.00 28.89  ? 392 ALA B C   1 
ATOM   6650  O  O   . ALA B  1 417 ? 85.849  34.837  -28.081  1.00 29.15  ? 392 ALA B O   1 
ATOM   6651  C  CB  . ALA B  1 417 ? 86.741  32.385  -26.265  1.00 25.84  ? 392 ALA B CB  1 
ATOM   6652  N  N   . ARG B  1 418 ? 86.654  33.214  -29.417  1.00 29.83  ? 393 ARG B N   1 
ATOM   6653  C  CA  . ARG B  1 418 ? 85.887  33.620  -30.596  1.00 31.46  ? 393 ARG B CA  1 
ATOM   6654  C  C   . ARG B  1 418 ? 84.448  33.068  -30.619  1.00 30.28  ? 393 ARG B C   1 
ATOM   6655  O  O   . ARG B  1 418 ? 83.559  33.658  -31.235  1.00 30.66  ? 393 ARG B O   1 
ATOM   6656  C  CB  . ARG B  1 418 ? 86.655  33.257  -31.873  1.00 35.41  ? 393 ARG B CB  1 
ATOM   6657  C  CG  . ARG B  1 418 ? 87.920  34.095  -32.072  1.00 43.44  ? 393 ARG B CG  1 
ATOM   6658  C  CD  . ARG B  1 418 ? 88.728  33.664  -33.290  1.00 52.26  ? 393 ARG B CD  1 
ATOM   6659  N  NE  . ARG B  1 418 ? 89.482  32.434  -33.039  1.00 59.53  ? 393 ARG B NE  1 
ATOM   6660  C  CZ  . ARG B  1 418 ? 90.018  31.659  -33.981  1.00 65.58  ? 393 ARG B CZ  1 
ATOM   6661  N  NH1 . ARG B  1 418 ? 89.896  31.960  -35.270  1.00 68.08  ? 393 ARG B NH1 1 
ATOM   6662  N  NH2 . ARG B  1 418 ? 90.681  30.568  -33.628  1.00 67.67  ? 393 ARG B NH2 1 
ATOM   6663  N  N   . ASN B  1 419 ? 84.215  31.953  -29.927  1.00 27.76  ? 394 ASN B N   1 
ATOM   6664  C  CA  . ASN B  1 419 ? 82.899  31.295  -29.948  1.00 25.76  ? 394 ASN B CA  1 
ATOM   6665  C  C   . ASN B  1 419 ? 82.688  30.391  -28.722  1.00 25.01  ? 394 ASN B C   1 
ATOM   6666  O  O   . ASN B  1 419 ? 83.623  30.166  -27.929  1.00 23.58  ? 394 ASN B O   1 
ATOM   6667  C  CB  . ASN B  1 419 ? 82.707  30.514  -31.262  1.00 23.90  ? 394 ASN B CB  1 
ATOM   6668  C  CG  . ASN B  1 419 ? 83.783  29.459  -31.469  1.00 24.53  ? 394 ASN B CG  1 
ATOM   6669  O  OD1 . ASN B  1 419 ? 84.107  28.713  -30.550  1.00 24.65  ? 394 ASN B OD1 1 
ATOM   6670  N  ND2 . ASN B  1 419 ? 84.352  29.401  -32.671  1.00 24.88  ? 394 ASN B ND2 1 
ATOM   6671  N  N   . TYR B  1 420 ? 81.467  29.876  -28.576  1.00 24.82  ? 395 TYR B N   1 
ATOM   6672  C  CA  . TYR B  1 420 ? 81.117  29.032  -27.439  1.00 23.56  ? 395 TYR B CA  1 
ATOM   6673  C  C   . TYR B  1 420 ? 82.084  27.855  -27.279  1.00 23.65  ? 395 TYR B C   1 
ATOM   6674  O  O   . TYR B  1 420 ? 82.578  27.617  -26.172  1.00 23.58  ? 395 TYR B O   1 
ATOM   6675  C  CB  . TYR B  1 420 ? 79.661  28.551  -27.548  1.00 23.35  ? 395 TYR B CB  1 
ATOM   6676  C  CG  . TYR B  1 420 ? 79.230  27.489  -26.533  1.00 22.54  ? 395 TYR B CG  1 
ATOM   6677  C  CD1 . TYR B  1 420 ? 78.745  27.848  -25.273  1.00 21.47  ? 395 TYR B CD1 1 
ATOM   6678  C  CD2 . TYR B  1 420 ? 79.277  26.126  -26.857  1.00 22.51  ? 395 TYR B CD2 1 
ATOM   6679  C  CE1 . TYR B  1 420 ? 78.330  26.879  -24.352  1.00 20.83  ? 395 TYR B CE1 1 
ATOM   6680  C  CE2 . TYR B  1 420 ? 78.865  25.155  -25.953  1.00 22.15  ? 395 TYR B CE2 1 
ATOM   6681  C  CZ  . TYR B  1 420 ? 78.404  25.540  -24.698  1.00 21.24  ? 395 TYR B CZ  1 
ATOM   6682  O  OH  . TYR B  1 420 ? 78.002  24.577  -23.813  1.00 20.23  ? 395 TYR B OH  1 
ATOM   6683  N  N   . GLU B  1 421 ? 82.357  27.130  -28.367  1.00 23.77  ? 396 GLU B N   1 
ATOM   6684  C  CA  . GLU B  1 421 ? 83.174  25.895  -28.280  1.00 24.16  ? 396 GLU B CA  1 
ATOM   6685  C  C   . GLU B  1 421 ? 84.635  26.176  -27.908  1.00 23.71  ? 396 GLU B C   1 
ATOM   6686  O  O   . GLU B  1 421 ? 85.222  25.451  -27.120  1.00 22.38  ? 396 GLU B O   1 
ATOM   6687  C  CB  . GLU B  1 421 ? 83.096  25.054  -29.569  1.00 24.97  ? 396 GLU B CB  1 
ATOM   6688  C  CG  . GLU B  1 421 ? 81.729  24.415  -29.825  1.00 25.06  ? 396 GLU B CG  1 
ATOM   6689  C  CD  . GLU B  1 421 ? 81.365  23.314  -28.833  1.00 24.94  ? 396 GLU B CD  1 
ATOM   6690  O  OE1 . GLU B  1 421 ? 82.257  22.569  -28.375  1.00 25.68  ? 396 GLU B OE1 1 
ATOM   6691  O  OE2 . GLU B  1 421 ? 80.170  23.177  -28.516  1.00 24.65  ? 396 GLU B OE2 1 
ATOM   6692  N  N   . GLU B  1 422 ? 85.216  27.231  -28.472  1.00 24.87  ? 397 GLU B N   1 
ATOM   6693  C  CA  . GLU B  1 422 ? 86.540  27.692  -28.026  1.00 26.44  ? 397 GLU B CA  1 
ATOM   6694  C  C   . GLU B  1 422 ? 86.533  28.046  -26.519  1.00 23.41  ? 397 GLU B C   1 
ATOM   6695  O  O   . GLU B  1 422 ? 87.449  27.665  -25.792  1.00 21.87  ? 397 GLU B O   1 
ATOM   6696  C  CB  . GLU B  1 422 ? 87.041  28.874  -28.875  1.00 29.41  ? 397 GLU B CB  1 
ATOM   6697  C  CG  . GLU B  1 422 ? 88.453  29.320  -28.526  1.00 35.39  ? 397 GLU B CG  1 
ATOM   6698  C  CD  . GLU B  1 422 ? 89.072  30.265  -29.552  1.00 41.43  ? 397 GLU B CD  1 
ATOM   6699  O  OE1 . GLU B  1 422 ? 88.583  31.406  -29.710  1.00 40.35  ? 397 GLU B OE1 1 
ATOM   6700  O  OE2 . GLU B  1 422 ? 90.075  29.869  -30.189  1.00 48.25  ? 397 GLU B OE2 1 
ATOM   6701  N  N   . ALA B  1 423 ? 85.482  28.739  -26.067  1.00 22.64  ? 398 ALA B N   1 
ATOM   6702  C  CA  . ALA B  1 423 ? 85.383  29.191  -24.666  1.00 21.91  ? 398 ALA B CA  1 
ATOM   6703  C  C   . ALA B  1 423 ? 85.297  28.001  -23.705  1.00 21.50  ? 398 ALA B C   1 
ATOM   6704  O  O   . ALA B  1 423 ? 85.958  27.978  -22.667  1.00 23.33  ? 398 ALA B O   1 
ATOM   6705  C  CB  . ALA B  1 423 ? 84.186  30.117  -24.474  1.00 21.38  ? 398 ALA B CB  1 
ATOM   6706  N  N   . LEU B  1 424 ? 84.480  27.022  -24.059  1.00 20.41  ? 399 LEU B N   1 
ATOM   6707  C  CA  . LEU B  1 424 ? 84.268  25.850  -23.217  1.00 20.00  ? 399 LEU B CA  1 
ATOM   6708  C  C   . LEU B  1 424 ? 85.553  25.014  -23.116  1.00 19.17  ? 399 LEU B C   1 
ATOM   6709  O  O   . LEU B  1 424 ? 85.842  24.441  -22.063  1.00 18.39  ? 399 LEU B O   1 
ATOM   6710  C  CB  . LEU B  1 424 ? 83.110  24.993  -23.760  1.00 19.37  ? 399 LEU B CB  1 
ATOM   6711  C  CG  . LEU B  1 424 ? 82.915  23.579  -23.184  1.00 19.51  ? 399 LEU B CG  1 
ATOM   6712  C  CD1 . LEU B  1 424 ? 82.492  23.618  -21.721  1.00 19.63  ? 399 LEU B CD1 1 
ATOM   6713  C  CD2 . LEU B  1 424 ? 81.912  22.758  -23.988  1.00 19.36  ? 399 LEU B CD2 1 
ATOM   6714  N  N   . SER B  1 425 ? 86.312  24.942  -24.210  1.00 19.06  ? 400 SER B N   1 
ATOM   6715  C  CA  . SER B  1 425 ? 87.518  24.111  -24.229  1.00 20.09  ? 400 SER B CA  1 
ATOM   6716  C  C   . SER B  1 425 ? 88.607  24.624  -23.291  1.00 18.28  ? 400 SER B C   1 
ATOM   6717  O  O   . SER B  1 425 ? 89.491  23.865  -22.897  1.00 17.41  ? 400 SER B O   1 
ATOM   6718  C  CB  . SER B  1 425 ? 88.073  23.942  -25.651  1.00 21.86  ? 400 SER B CB  1 
ATOM   6719  O  OG  . SER B  1 425 ? 88.662  25.150  -26.067  1.00 24.68  ? 400 SER B OG  1 
ATOM   6720  N  N   . LEU B  1 426 ? 88.536  25.898  -22.920  1.00 18.21  ? 401 LEU B N   1 
ATOM   6721  C  CA  . LEU B  1 426 ? 89.547  26.450  -22.027  1.00 18.65  ? 401 LEU B CA  1 
ATOM   6722  C  C   . LEU B  1 426 ? 89.452  25.814  -20.619  1.00 18.37  ? 401 LEU B C   1 
ATOM   6723  O  O   . LEU B  1 426 ? 90.394  25.146  -20.194  1.00 18.20  ? 401 LEU B O   1 
ATOM   6724  C  CB  . LEU B  1 426 ? 89.529  27.990  -22.015  1.00 18.97  ? 401 LEU B CB  1 
ATOM   6725  C  CG  . LEU B  1 426 ? 90.028  28.632  -23.332  1.00 19.76  ? 401 LEU B CG  1 
ATOM   6726  C  CD1 . LEU B  1 426 ? 89.577  30.084  -23.451  1.00 19.15  ? 401 LEU B CD1 1 
ATOM   6727  C  CD2 . LEU B  1 426 ? 91.548  28.552  -23.432  1.00 19.95  ? 401 LEU B CD2 1 
ATOM   6728  N  N   . PRO B  1 427 ? 88.318  25.983  -19.904  1.00 17.54  ? 402 PRO B N   1 
ATOM   6729  C  CA  . PRO B  1 427 ? 88.356  25.306  -18.612  1.00 17.52  ? 402 PRO B CA  1 
ATOM   6730  C  C   . PRO B  1 427 ? 88.404  23.786  -18.770  1.00 18.37  ? 402 PRO B C   1 
ATOM   6731  O  O   . PRO B  1 427 ? 88.889  23.101  -17.872  1.00 19.15  ? 402 PRO B O   1 
ATOM   6732  C  CB  . PRO B  1 427 ? 87.061  25.763  -17.925  1.00 15.91  ? 402 PRO B CB  1 
ATOM   6733  C  CG  . PRO B  1 427 ? 86.188  26.270  -19.029  1.00 15.86  ? 402 PRO B CG  1 
ATOM   6734  C  CD  . PRO B  1 427 ? 87.145  26.864  -20.015  1.00 16.87  ? 402 PRO B CD  1 
HETATM 6735  N  N   . MSE B  1 428 ? 87.943  23.267  -19.906  1.00 18.75  ? 403 MSE B N   1 
HETATM 6736  C  CA  . MSE B  1 428 ? 87.900  21.807  -20.124  1.00 19.67  ? 403 MSE B CA  1 
HETATM 6737  C  C   . MSE B  1 428 ? 89.295  21.219  -20.203  1.00 19.52  ? 403 MSE B C   1 
HETATM 6738  O  O   . MSE B  1 428 ? 89.564  20.148  -19.662  1.00 18.50  ? 403 MSE B O   1 
HETATM 6739  C  CB  . MSE B  1 428 ? 87.085  21.513  -21.381  1.00 20.91  ? 403 MSE B CB  1 
HETATM 6740  C  CG  . MSE B  1 428 ? 86.917  20.036  -21.733  1.00 22.62  ? 403 MSE B CG  1 
HETATM 6741  SE SE  . MSE B  1 428 ? 85.349  19.257  -20.798  1.00 25.39  ? 403 MSE B SE  1 
HETATM 6742  C  CE  . MSE B  1 428 ? 83.903  20.069  -21.876  1.00 23.55  ? 403 MSE B CE  1 
ATOM   6743  N  N   . LYS B  1 429 ? 90.193  21.921  -20.870  1.00 21.19  ? 404 LYS B N   1 
ATOM   6744  C  CA  . LYS B  1 429 ? 91.551  21.423  -21.072  1.00 22.88  ? 404 LYS B CA  1 
ATOM   6745  C  C   . LYS B  1 429 ? 92.459  21.774  -19.895  1.00 22.76  ? 404 LYS B C   1 
ATOM   6746  O  O   . LYS B  1 429 ? 93.536  21.201  -19.756  1.00 23.48  ? 404 LYS B O   1 
ATOM   6747  C  CB  . LYS B  1 429 ? 92.137  21.964  -22.374  1.00 25.05  ? 404 LYS B CB  1 
ATOM   6748  C  CG  . LYS B  1 429 ? 91.585  21.281  -23.616  1.00 28.70  ? 404 LYS B CG  1 
ATOM   6749  C  CD  . LYS B  1 429 ? 92.309  21.740  -24.874  1.00 32.79  ? 404 LYS B CD  1 
ATOM   6750  C  CE  . LYS B  1 429 ? 92.078  20.723  -25.981  1.00 36.54  ? 404 LYS B CE  1 
ATOM   6751  N  NZ  . LYS B  1 429 ? 92.607  21.175  -27.293  1.00 39.82  ? 404 LYS B NZ  1 
ATOM   6752  N  N   . HIS B  1 430 ? 92.034  22.702  -19.040  1.00 22.05  ? 405 HIS B N   1 
ATOM   6753  C  CA  . HIS B  1 430 ? 92.854  23.024  -17.871  1.00 23.83  ? 405 HIS B CA  1 
ATOM   6754  C  C   . HIS B  1 430 ? 93.107  21.826  -16.931  1.00 23.52  ? 405 HIS B C   1 
ATOM   6755  O  O   . HIS B  1 430 ? 92.265  20.934  -16.780  1.00 21.19  ? 405 HIS B O   1 
ATOM   6756  C  CB  . HIS B  1 430 ? 92.341  24.235  -17.083  1.00 23.85  ? 405 HIS B CB  1 
ATOM   6757  C  CG  . HIS B  1 430 ? 93.450  25.040  -16.480  1.00 24.40  ? 405 HIS B CG  1 
ATOM   6758  N  ND1 . HIS B  1 430 ? 94.111  24.654  -15.333  1.00 24.57  ? 405 HIS B ND1 1 
ATOM   6759  C  CD2 . HIS B  1 430 ? 94.066  26.166  -16.909  1.00 24.40  ? 405 HIS B CD2 1 
ATOM   6760  C  CE1 . HIS B  1 430 ? 95.068  25.524  -15.066  1.00 24.94  ? 405 HIS B CE1 1 
ATOM   6761  N  NE2 . HIS B  1 430 ? 95.060  26.453  -16.007  1.00 25.21  ? 405 HIS B NE2 1 
ATOM   6762  N  N   . GLU B  1 431 ? 94.312  21.811  -16.369  1.00 25.26  ? 406 GLU B N   1 
ATOM   6763  C  CA  . GLU B  1 431 ? 94.761  20.844  -15.370  1.00 26.39  ? 406 GLU B CA  1 
ATOM   6764  C  C   . GLU B  1 431 ? 93.851  20.883  -14.136  1.00 22.87  ? 406 GLU B C   1 
ATOM   6765  O  O   . GLU B  1 431 ? 93.523  19.843  -13.552  1.00 21.92  ? 406 GLU B O   1 
ATOM   6766  C  CB  . GLU B  1 431 ? 96.207  21.215  -15.018  1.00 33.33  ? 406 GLU B CB  1 
ATOM   6767  C  CG  . GLU B  1 431 ? 96.889  20.487  -13.871  1.00 43.47  ? 406 GLU B CG  1 
ATOM   6768  C  CD  . GLU B  1 431 ? 98.239  21.123  -13.521  1.00 51.82  ? 406 GLU B CD  1 
ATOM   6769  O  OE1 . GLU B  1 431 ? 98.288  22.340  -13.228  1.00 50.77  ? 406 GLU B OE1 1 
ATOM   6770  O  OE2 . GLU B  1 431 ? 99.264  20.410  -13.540  1.00 56.54  ? 406 GLU B OE2 1 
ATOM   6771  N  N   . TYR B  1 432 ? 93.432  22.085  -13.749  1.00 21.86  ? 407 TYR B N   1 
ATOM   6772  C  CA  . TYR B  1 432 ? 92.563  22.255  -12.589  1.00 21.66  ? 407 TYR B CA  1 
ATOM   6773  C  C   . TYR B  1 432 ? 91.101  22.205  -12.966  1.00 20.79  ? 407 TYR B C   1 
ATOM   6774  O  O   . TYR B  1 432 ? 90.717  22.564  -14.085  1.00 21.23  ? 407 TYR B O   1 
ATOM   6775  C  CB  . TYR B  1 432 ? 92.837  23.581  -11.902  1.00 23.68  ? 407 TYR B CB  1 
ATOM   6776  C  CG  . TYR B  1 432 ? 94.190  23.686  -11.245  1.00 25.85  ? 407 TYR B CG  1 
ATOM   6777  C  CD1 . TYR B  1 432 ? 94.572  22.805  -10.229  1.00 26.65  ? 407 TYR B CD1 1 
ATOM   6778  C  CD2 . TYR B  1 432 ? 95.084  24.684  -11.627  1.00 26.66  ? 407 TYR B CD2 1 
ATOM   6779  C  CE1 . TYR B  1 432 ? 95.814  22.918  -9.611   1.00 26.94  ? 407 TYR B CE1 1 
ATOM   6780  C  CE2 . TYR B  1 432 ? 96.317  24.808  -11.015  1.00 28.05  ? 407 TYR B CE2 1 
ATOM   6781  C  CZ  . TYR B  1 432 ? 96.674  23.923  -10.011  1.00 27.82  ? 407 TYR B CZ  1 
ATOM   6782  O  OH  . TYR B  1 432 ? 97.897  24.057  -9.412   1.00 29.99  ? 407 TYR B OH  1 
ATOM   6783  N  N   . GLY B  1 433 ? 90.278  21.758  -12.028  1.00 19.34  ? 408 GLY B N   1 
ATOM   6784  C  CA  . GLY B  1 433 ? 88.853  21.705  -12.264  1.00 18.63  ? 408 GLY B CA  1 
ATOM   6785  C  C   . GLY B  1 433 ? 88.046  21.861  -11.000  1.00 17.87  ? 408 GLY B C   1 
ATOM   6786  O  O   . GLY B  1 433 ? 87.199  21.014  -10.686  1.00 16.96  ? 408 GLY B O   1 
ATOM   6787  N  N   . ASN B  1 434 ? 88.322  22.946  -10.287  1.00 17.85  ? 409 ASN B N   1 
ATOM   6788  C  CA  . ASN B  1 434 ? 87.643  23.253  -9.037   1.00 17.80  ? 409 ASN B CA  1 
ATOM   6789  C  C   . ASN B  1 434 ? 86.252  23.857  -9.281   1.00 17.65  ? 409 ASN B C   1 
ATOM   6790  O  O   . ASN B  1 434 ? 85.248  23.187  -9.090   1.00 17.14  ? 409 ASN B O   1 
ATOM   6791  C  CB  . ASN B  1 434 ? 88.514  24.144  -8.143   1.00 17.39  ? 409 ASN B CB  1 
ATOM   6792  C  CG  . ASN B  1 434 ? 88.464  23.725  -6.685   1.00 18.04  ? 409 ASN B CG  1 
ATOM   6793  O  OD1 . ASN B  1 434 ? 88.128  22.580  -6.367   1.00 18.36  ? 409 ASN B OD1 1 
ATOM   6794  N  ND2 . ASN B  1 434 ? 88.787  24.646  -5.792   1.00 17.98  ? 409 ASN B ND2 1 
ATOM   6795  N  N   . GLY B  1 435 ? 86.209  25.107  -9.725   1.00 17.86  ? 410 GLY B N   1 
ATOM   6796  C  CA  . GLY B  1 435 ? 84.962  25.774  -10.056  1.00 17.28  ? 410 GLY B CA  1 
ATOM   6797  C  C   . GLY B  1 435 ? 85.038  26.360  -11.458  1.00 17.98  ? 410 GLY B C   1 
ATOM   6798  O  O   . GLY B  1 435 ? 86.119  26.488  -12.041  1.00 16.86  ? 410 GLY B O   1 
ATOM   6799  N  N   . VAL B  1 436 ? 83.872  26.706  -11.995  1.00 18.75  ? 411 VAL B N   1 
ATOM   6800  C  CA  . VAL B  1 436 ? 83.749  27.336  -13.300  1.00 18.52  ? 411 VAL B CA  1 
ATOM   6801  C  C   . VAL B  1 436 ? 82.421  28.096  -13.312  1.00 18.42  ? 411 VAL B C   1 
ATOM   6802  O  O   . VAL B  1 436 ? 81.493  27.726  -12.604  1.00 19.70  ? 411 VAL B O   1 
ATOM   6803  C  CB  . VAL B  1 436 ? 83.796  26.275  -14.438  1.00 17.98  ? 411 VAL B CB  1 
ATOM   6804  C  CG1 . VAL B  1 436 ? 82.576  25.345  -14.399  1.00 16.64  ? 411 VAL B CG1 1 
ATOM   6805  C  CG2 . VAL B  1 436 ? 83.947  26.949  -15.806  1.00 18.07  ? 411 VAL B CG2 1 
ATOM   6806  N  N   . ALA B  1 437 ? 82.334  29.172  -14.083  1.00 17.95  ? 412 ALA B N   1 
ATOM   6807  C  CA  . ALA B  1 437 ? 81.070  29.893  -14.202  1.00 17.11  ? 412 ALA B CA  1 
ATOM   6808  C  C   . ALA B  1 437 ? 80.809  30.221  -15.662  1.00 17.19  ? 412 ALA B C   1 
ATOM   6809  O  O   . ALA B  1 437 ? 81.753  30.392  -16.449  1.00 16.57  ? 412 ALA B O   1 
ATOM   6810  C  CB  . ALA B  1 437 ? 81.070  31.159  -13.344  1.00 15.94  ? 412 ALA B CB  1 
ATOM   6811  N  N   . ILE B  1 438 ? 79.526  30.273  -16.016  1.00 17.71  ? 413 ILE B N   1 
ATOM   6812  C  CA  . ILE B  1 438 ? 79.078  30.783  -17.316  1.00 18.69  ? 413 ILE B CA  1 
ATOM   6813  C  C   . ILE B  1 438 ? 77.966  31.820  -17.123  1.00 19.11  ? 413 ILE B C   1 
ATOM   6814  O  O   . ILE B  1 438 ? 76.997  31.579  -16.388  1.00 18.27  ? 413 ILE B O   1 
ATOM   6815  C  CB  . ILE B  1 438 ? 78.647  29.671  -18.331  1.00 18.99  ? 413 ILE B CB  1 
ATOM   6816  C  CG1 . ILE B  1 438 ? 78.272  30.305  -19.694  1.00 19.27  ? 413 ILE B CG1 1 
ATOM   6817  C  CG2 . ILE B  1 438 ? 77.502  28.805  -17.792  1.00 18.13  ? 413 ILE B CG2 1 
ATOM   6818  C  CD1 . ILE B  1 438 ? 77.860  29.303  -20.751  1.00 18.72  ? 413 ILE B CD1 1 
ATOM   6819  N  N   . TYR B  1 439 ? 78.137  32.968  -17.778  1.00 19.47  ? 414 TYR B N   1 
ATOM   6820  C  CA  . TYR B  1 439 ? 77.165  34.038  -17.750  1.00 20.70  ? 414 TYR B CA  1 
ATOM   6821  C  C   . TYR B  1 439 ? 76.495  34.152  -19.112  1.00 21.35  ? 414 TYR B C   1 
ATOM   6822  O  O   . TYR B  1 439 ? 77.163  34.346  -20.143  1.00 21.82  ? 414 TYR B O   1 
ATOM   6823  C  CB  . TYR B  1 439 ? 77.834  35.361  -17.334  1.00 22.00  ? 414 TYR B CB  1 
ATOM   6824  C  CG  . TYR B  1 439 ? 77.922  35.524  -15.818  1.00 22.56  ? 414 TYR B CG  1 
ATOM   6825  C  CD1 . TYR B  1 439 ? 78.633  34.600  -15.032  1.00 22.75  ? 414 TYR B CD1 1 
ATOM   6826  C  CD2 . TYR B  1 439 ? 77.275  36.590  -15.168  1.00 21.92  ? 414 TYR B CD2 1 
ATOM   6827  C  CE1 . TYR B  1 439 ? 78.698  34.737  -13.646  1.00 22.82  ? 414 TYR B CE1 1 
ATOM   6828  C  CE2 . TYR B  1 439 ? 77.339  36.736  -13.792  1.00 22.00  ? 414 TYR B CE2 1 
ATOM   6829  C  CZ  . TYR B  1 439 ? 78.052  35.810  -13.037  1.00 22.27  ? 414 TYR B CZ  1 
ATOM   6830  O  OH  . TYR B  1 439 ? 78.112  35.939  -11.666  1.00 22.44  ? 414 TYR B OH  1 
ATOM   6831  N  N   . THR B  1 440 ? 75.170  34.027  -19.103  1.00 20.27  ? 415 THR B N   1 
ATOM   6832  C  CA  . THR B  1 440 ? 74.369  33.969  -20.320  1.00 19.37  ? 415 THR B CA  1 
ATOM   6833  C  C   . THR B  1 440 ? 72.897  34.076  -19.942  1.00 19.74  ? 415 THR B C   1 
ATOM   6834  O  O   . THR B  1 440 ? 72.532  33.748  -18.817  1.00 19.09  ? 415 THR B O   1 
ATOM   6835  C  CB  . THR B  1 440 ? 74.614  32.637  -21.076  1.00 18.04  ? 415 THR B CB  1 
ATOM   6836  O  OG1 . THR B  1 440 ? 73.993  32.685  -22.370  1.00 17.60  ? 415 THR B OG1 1 
ATOM   6837  C  CG2 . THR B  1 440 ? 74.092  31.413  -20.277  1.00 16.80  ? 415 THR B CG2 1 
ATOM   6838  N  N   . ARG B  1 441 ? 72.050  34.545  -20.853  1.00 20.44  ? 416 ARG B N   1 
ATOM   6839  C  CA  A ARG B  1 441 ? 70.609  34.513  -20.605  0.50 21.34  ? 416 ARG B CA  1 
ATOM   6840  C  CA  B ARG B  1 441 ? 70.609  34.514  -20.604  0.50 20.99  ? 416 ARG B CA  1 
ATOM   6841  C  C   . ARG B  1 441 ? 69.992  33.257  -21.222  1.00 21.12  ? 416 ARG B C   1 
ATOM   6842  O  O   . ARG B  1 441 ? 68.832  32.925  -20.968  1.00 21.23  ? 416 ARG B O   1 
ATOM   6843  C  CB  A ARG B  1 441 ? 69.935  35.765  -21.154  0.50 22.29  ? 416 ARG B CB  1 
ATOM   6844  C  CB  B ARG B  1 441 ? 69.934  35.766  -21.155  0.50 21.23  ? 416 ARG B CB  1 
ATOM   6845  C  CG  A ARG B  1 441 ? 70.169  37.021  -20.327  0.50 23.02  ? 416 ARG B CG  1 
ATOM   6846  C  CG  B ARG B  1 441 ? 70.389  37.067  -20.508  0.50 21.24  ? 416 ARG B CG  1 
ATOM   6847  C  CD  A ARG B  1 441 ? 69.438  38.210  -20.942  0.50 23.80  ? 416 ARG B CD  1 
ATOM   6848  C  CD  B ARG B  1 441 ? 69.752  38.265  -21.205  0.50 21.47  ? 416 ARG B CD  1 
ATOM   6849  N  NE  A ARG B  1 441 ? 69.250  39.307  -19.996  0.50 24.23  ? 416 ARG B NE  1 
ATOM   6850  N  NE  B ARG B  1 441 ? 70.286  39.533  -20.717  0.50 21.46  ? 416 ARG B NE  1 
ATOM   6851  C  CZ  A ARG B  1 441 ? 70.148  40.264  -19.771  0.50 24.77  ? 416 ARG B CZ  1 
ATOM   6852  C  CZ  B ARG B  1 441 ? 69.773  40.213  -19.696  0.50 21.21  ? 416 ARG B CZ  1 
ATOM   6853  N  NH1 A ARG B  1 441 ? 71.305  40.260  -20.419  0.50 25.17  ? 416 ARG B NH1 1 
ATOM   6854  N  NH1 B ARG B  1 441 ? 68.709  39.745  -19.058  0.50 20.72  ? 416 ARG B NH1 1 
ATOM   6855  N  NH2 A ARG B  1 441 ? 69.891  41.223  -18.894  0.50 24.46  ? 416 ARG B NH2 1 
ATOM   6856  N  NH2 B ARG B  1 441 ? 70.323  41.357  -19.311  0.50 21.20  ? 416 ARG B NH2 1 
ATOM   6857  N  N   . ASP B  1 442 ? 70.790  32.561  -22.023  1.00 20.75  ? 417 ASP B N   1 
ATOM   6858  C  CA  . ASP B  1 442 ? 70.330  31.441  -22.839  1.00 21.09  ? 417 ASP B CA  1 
ATOM   6859  C  C   . ASP B  1 442 ? 70.341  30.112  -22.057  1.00 20.10  ? 417 ASP B C   1 
ATOM   6860  O  O   . ASP B  1 442 ? 71.409  29.648  -21.601  1.00 18.95  ? 417 ASP B O   1 
ATOM   6861  C  CB  . ASP B  1 442 ? 71.227  31.356  -24.085  1.00 21.88  ? 417 ASP B CB  1 
ATOM   6862  C  CG  . ASP B  1 442 ? 70.700  30.392  -25.145  1.00 22.85  ? 417 ASP B CG  1 
ATOM   6863  O  OD1 . ASP B  1 442 ? 69.665  30.702  -25.758  1.00 23.56  ? 417 ASP B OD1 1 
ATOM   6864  O  OD2 . ASP B  1 442 ? 71.343  29.342  -25.392  1.00 22.43  ? 417 ASP B OD2 1 
ATOM   6865  N  N   . GLY B  1 443 ? 69.155  29.505  -21.916  1.00 19.27  ? 418 GLY B N   1 
ATOM   6866  C  CA  . GLY B  1 443 ? 69.018  28.214  -21.246  1.00 18.22  ? 418 GLY B CA  1 
ATOM   6867  C  C   . GLY B  1 443 ? 69.812  27.087  -21.906  1.00 18.30  ? 418 GLY B C   1 
ATOM   6868  O  O   . GLY B  1 443 ? 70.420  26.272  -21.209  1.00 18.56  ? 418 GLY B O   1 
ATOM   6869  N  N   . ASP B  1 444 ? 69.831  27.043  -23.242  1.00 17.38  ? 419 ASP B N   1 
ATOM   6870  C  CA  . ASP B  1 444 ? 70.592  26.018  -23.980  1.00 16.93  ? 419 ASP B CA  1 
ATOM   6871  C  C   . ASP B  1 444 ? 72.101  26.080  -23.681  1.00 16.82  ? 419 ASP B C   1 
ATOM   6872  O  O   . ASP B  1 444 ? 72.726  25.060  -23.321  1.00 16.28  ? 419 ASP B O   1 
ATOM   6873  C  CB  . ASP B  1 444 ? 70.318  26.137  -25.489  1.00 18.06  ? 419 ASP B CB  1 
ATOM   6874  C  CG  . ASP B  1 444 ? 71.076  25.111  -26.315  1.00 20.01  ? 419 ASP B CG  1 
ATOM   6875  O  OD1 . ASP B  1 444 ? 70.978  23.893  -26.036  1.00 19.92  ? 419 ASP B OD1 1 
ATOM   6876  O  OD2 . ASP B  1 444 ? 71.764  25.525  -27.276  1.00 21.52  ? 419 ASP B OD2 1 
ATOM   6877  N  N   . ALA B  1 445 ? 72.676  27.280  -23.795  1.00 17.00  ? 420 ALA B N   1 
ATOM   6878  C  CA  . ALA B  1 445 ? 74.095  27.486  -23.494  1.00 17.17  ? 420 ALA B CA  1 
ATOM   6879  C  C   . ALA B  1 445 ? 74.428  27.065  -22.057  1.00 16.85  ? 420 ALA B C   1 
ATOM   6880  O  O   . ALA B  1 445 ? 75.395  26.309  -21.833  1.00 16.11  ? 420 ALA B O   1 
ATOM   6881  C  CB  . ALA B  1 445 ? 74.492  28.936  -23.729  1.00 17.83  ? 420 ALA B CB  1 
ATOM   6882  N  N   . ALA B  1 446 ? 73.616  27.527  -21.098  1.00 16.43  ? 421 ALA B N   1 
ATOM   6883  C  CA  . ALA B  1 446 ? 73.846  27.205  -19.680  1.00 16.65  ? 421 ALA B CA  1 
ATOM   6884  C  C   . ALA B  1 446 ? 73.830  25.691  -19.429  1.00 17.22  ? 421 ALA B C   1 
ATOM   6885  O  O   . ALA B  1 446 ? 74.819  25.134  -18.931  1.00 17.19  ? 421 ALA B O   1 
ATOM   6886  C  CB  . ALA B  1 446 ? 72.834  27.909  -18.801  1.00 16.34  ? 421 ALA B CB  1 
ATOM   6887  N  N   . ARG B  1 447 ? 72.724  25.042  -19.819  1.00 17.47  ? 422 ARG B N   1 
ATOM   6888  C  CA  . ARG B  1 447 ? 72.511  23.609  -19.620  1.00 17.35  ? 422 ARG B CA  1 
ATOM   6889  C  C   . ARG B  1 447 ? 73.631  22.796  -20.274  1.00 18.02  ? 422 ARG B C   1 
ATOM   6890  O  O   . ARG B  1 447 ? 74.207  21.880  -19.659  1.00 17.76  ? 422 ARG B O   1 
ATOM   6891  C  CB  . ARG B  1 447 ? 71.138  23.195  -20.180  1.00 16.96  ? 422 ARG B CB  1 
ATOM   6892  C  CG  . ARG B  1 447 ? 70.681  21.773  -19.867  1.00 16.69  ? 422 ARG B CG  1 
ATOM   6893  C  CD  . ARG B  1 447 ? 71.268  20.715  -20.795  1.00 17.25  ? 422 ARG B CD  1 
ATOM   6894  N  NE  . ARG B  1 447 ? 70.907  19.350  -20.398  1.00 16.95  ? 422 ARG B NE  1 
ATOM   6895  C  CZ  . ARG B  1 447 ? 71.380  18.252  -20.980  1.00 18.11  ? 422 ARG B CZ  1 
ATOM   6896  N  NH1 . ARG B  1 447 ? 72.246  18.342  -21.993  1.00 18.11  ? 422 ARG B NH1 1 
ATOM   6897  N  NH2 . ARG B  1 447 ? 70.990  17.051  -20.554  1.00 18.38  ? 422 ARG B NH2 1 
ATOM   6898  N  N   . ASP B  1 448 ? 73.930  23.136  -21.525  1.00 19.21  ? 423 ASP B N   1 
ATOM   6899  C  CA  . ASP B  1 448 ? 74.932  22.415  -22.292  1.00 18.85  ? 423 ASP B CA  1 
ATOM   6900  C  C   . ASP B  1 448 ? 76.316  22.516  -21.645  1.00 18.24  ? 423 ASP B C   1 
ATOM   6901  O  O   . ASP B  1 448 ? 77.033  21.506  -21.521  1.00 17.80  ? 423 ASP B O   1 
ATOM   6902  C  CB  . ASP B  1 448 ? 74.982  22.905  -23.737  1.00 19.54  ? 423 ASP B CB  1 
ATOM   6903  C  CG  . ASP B  1 448 ? 75.806  21.984  -24.616  1.00 20.37  ? 423 ASP B CG  1 
ATOM   6904  O  OD1 . ASP B  1 448 ? 75.295  20.911  -24.974  1.00 20.45  ? 423 ASP B OD1 1 
ATOM   6905  O  OD2 . ASP B  1 448 ? 76.977  22.309  -24.911  1.00 20.72  ? 423 ASP B OD2 1 
ATOM   6906  N  N   . PHE B  1 449 ? 76.664  23.732  -21.221  1.00 17.15  ? 424 PHE B N   1 
ATOM   6907  C  CA  . PHE B  1 449 ? 77.941  24.018  -20.584  1.00 17.48  ? 424 PHE B CA  1 
ATOM   6908  C  C   . PHE B  1 449 ? 78.111  23.277  -19.255  1.00 17.76  ? 424 PHE B C   1 
ATOM   6909  O  O   . PHE B  1 449 ? 79.136  22.609  -19.026  1.00 17.88  ? 424 PHE B O   1 
ATOM   6910  C  CB  . PHE B  1 449 ? 78.065  25.527  -20.344  1.00 17.77  ? 424 PHE B CB  1 
ATOM   6911  C  CG  . PHE B  1 449 ? 79.427  25.964  -19.914  1.00 17.82  ? 424 PHE B CG  1 
ATOM   6912  C  CD1 . PHE B  1 449 ? 79.783  25.964  -18.567  1.00 17.51  ? 424 PHE B CD1 1 
ATOM   6913  C  CD2 . PHE B  1 449 ? 80.363  26.393  -20.857  1.00 18.44  ? 424 PHE B CD2 1 
ATOM   6914  C  CE1 . PHE B  1 449 ? 81.052  26.371  -18.161  1.00 17.34  ? 424 PHE B CE1 1 
ATOM   6915  C  CE2 . PHE B  1 449 ? 81.622  26.812  -20.455  1.00 18.41  ? 424 PHE B CE2 1 
ATOM   6916  C  CZ  . PHE B  1 449 ? 81.962  26.806  -19.101  1.00 17.70  ? 424 PHE B CZ  1 
ATOM   6917  N  N   . ALA B  1 450 ? 77.113  23.426  -18.382  1.00 16.79  ? 425 ALA B N   1 
ATOM   6918  C  CA  . ALA B  1 450 ? 77.111  22.800  -17.075  1.00 16.33  ? 425 ALA B CA  1 
ATOM   6919  C  C   . ALA B  1 450 ? 77.197  21.275  -17.190  1.00 17.58  ? 425 ALA B C   1 
ATOM   6920  O  O   . ALA B  1 450 ? 77.862  20.605  -16.370  1.00 17.04  ? 425 ALA B O   1 
ATOM   6921  C  CB  . ALA B  1 450 ? 75.861  23.194  -16.317  1.00 15.78  ? 425 ALA B CB  1 
ATOM   6922  N  N   . SER B  1 451 ? 76.547  20.736  -18.218  1.00 17.44  ? 426 SER B N   1 
ATOM   6923  C  CA  . SER B  1 451 ? 76.480  19.296  -18.384  1.00 18.54  ? 426 SER B CA  1 
ATOM   6924  C  C   . SER B  1 451 ? 77.826  18.719  -18.854  1.00 18.50  ? 426 SER B C   1 
ATOM   6925  O  O   . SER B  1 451 ? 78.284  17.697  -18.336  1.00 18.14  ? 426 SER B O   1 
ATOM   6926  C  CB  . SER B  1 451 ? 75.371  18.947  -19.368  1.00 20.38  ? 426 SER B CB  1 
ATOM   6927  O  OG  . SER B  1 451 ? 75.259  17.552  -19.502  1.00 22.33  ? 426 SER B OG  1 
ATOM   6928  N  N   . ARG B  1 452 ? 78.464  19.399  -19.810  1.00 18.17  ? 427 ARG B N   1 
ATOM   6929  C  CA  . ARG B  1 452 ? 79.685  18.904  -20.457  1.00 18.32  ? 427 ARG B CA  1 
ATOM   6930  C  C   . ARG B  1 452 ? 80.973  19.159  -19.667  1.00 18.82  ? 427 ARG B C   1 
ATOM   6931  O  O   . ARG B  1 452 ? 81.877  18.340  -19.692  1.00 19.46  ? 427 ARG B O   1 
ATOM   6932  C  CB  . ARG B  1 452 ? 79.817  19.498  -21.867  1.00 18.79  ? 427 ARG B CB  1 
ATOM   6933  C  CG  . ARG B  1 452 ? 78.800  18.944  -22.876  1.00 19.02  ? 427 ARG B CG  1 
ATOM   6934  C  CD  . ARG B  1 452 ? 78.774  19.780  -24.153  1.00 19.38  ? 427 ARG B CD  1 
ATOM   6935  N  NE  . ARG B  1 452 ? 80.031  19.686  -24.899  1.00 20.46  ? 427 ARG B NE  1 
ATOM   6936  C  CZ  . ARG B  1 452 ? 80.371  20.476  -25.924  1.00 21.33  ? 427 ARG B CZ  1 
ATOM   6937  N  NH1 . ARG B  1 452 ? 79.565  21.454  -26.333  1.00 19.94  ? 427 ARG B NH1 1 
ATOM   6938  N  NH2 . ARG B  1 452 ? 81.539  20.299  -26.535  1.00 21.88  ? 427 ARG B NH2 1 
ATOM   6939  N  N   . ILE B  1 453 ? 81.066  20.292  -18.978  1.00 18.61  ? 428 ILE B N   1 
ATOM   6940  C  CA  . ILE B  1 453 ? 82.350  20.708  -18.416  1.00 18.67  ? 428 ILE B CA  1 
ATOM   6941  C  C   . ILE B  1 453 ? 82.853  19.712  -17.368  1.00 19.18  ? 428 ILE B C   1 
ATOM   6942  O  O   . ILE B  1 453 ? 82.078  19.222  -16.564  1.00 18.66  ? 428 ILE B O   1 
ATOM   6943  C  CB  . ILE B  1 453 ? 82.315  22.164  -17.859  1.00 16.78  ? 428 ILE B CB  1 
ATOM   6944  C  CG1 . ILE B  1 453 ? 83.736  22.642  -17.509  1.00 16.73  ? 428 ILE B CG1 1 
ATOM   6945  C  CG2 . ILE B  1 453 ? 81.372  22.282  -16.667  1.00 14.76  ? 428 ILE B CG2 1 
ATOM   6946  C  CD1 . ILE B  1 453 ? 84.681  22.798  -18.688  1.00 16.05  ? 428 ILE B CD1 1 
ATOM   6947  N  N   . ASN B  1 454 ? 84.148  19.403  -17.411  1.00 19.88  ? 429 ASN B N   1 
ATOM   6948  C  CA  . ASN B  1 454 ? 84.730  18.411  -16.509  1.00 19.71  ? 429 ASN B CA  1 
ATOM   6949  C  C   . ASN B  1 454 ? 85.183  19.027  -15.192  1.00 19.58  ? 429 ASN B C   1 
ATOM   6950  O  O   . ASN B  1 454 ? 86.323  18.830  -14.747  1.00 19.83  ? 429 ASN B O   1 
ATOM   6951  C  CB  . ASN B  1 454 ? 85.870  17.645  -17.196  1.00 19.89  ? 429 ASN B CB  1 
ATOM   6952  C  CG  . ASN B  1 454 ? 86.924  18.559  -17.791  1.00 21.13  ? 429 ASN B CG  1 
ATOM   6953  O  OD1 . ASN B  1 454 ? 86.984  19.758  -17.487  1.00 21.56  ? 429 ASN B OD1 1 
ATOM   6954  N  ND2 . ASN B  1 454 ? 87.775  17.989  -18.651  1.00 20.65  ? 429 ASN B ND2 1 
ATOM   6955  N  N   . ILE B  1 455 ? 84.273  19.783  -14.579  1.00 19.38  ? 430 ILE B N   1 
ATOM   6956  C  CA  . ILE B  1 455 ? 84.573  20.565  -13.385  1.00 18.80  ? 430 ILE B CA  1 
ATOM   6957  C  C   . ILE B  1 455 ? 83.490  20.338  -12.329  1.00 18.00  ? 430 ILE B C   1 
ATOM   6958  O  O   . ILE B  1 455 ? 82.317  20.308  -12.655  1.00 17.98  ? 430 ILE B O   1 
ATOM   6959  C  CB  . ILE B  1 455 ? 84.749  22.057  -13.741  1.00 18.49  ? 430 ILE B CB  1 
ATOM   6960  C  CG1 . ILE B  1 455 ? 86.087  22.228  -14.479  1.00 19.47  ? 430 ILE B CG1 1 
ATOM   6961  C  CG2 . ILE B  1 455 ? 84.663  22.938  -12.491  1.00 17.06  ? 430 ILE B CG2 1 
ATOM   6962  C  CD1 . ILE B  1 455 ? 86.378  23.627  -14.995  1.00 19.43  ? 430 ILE B CD1 1 
ATOM   6963  N  N   . GLY B  1 456 ? 83.896  20.170  -11.072  1.00 18.25  ? 431 GLY B N   1 
ATOM   6964  C  CA  . GLY B  1 456 ? 82.977  19.748  -9.995   1.00 17.16  ? 431 GLY B CA  1 
ATOM   6965  C  C   . GLY B  1 456 ? 81.890  20.725  -9.559   1.00 16.84  ? 431 GLY B C   1 
ATOM   6966  O  O   . GLY B  1 456 ? 80.803  20.295  -9.126   1.00 16.63  ? 431 GLY B O   1 
HETATM 6967  N  N   . MSE B  1 457 ? 82.165  22.027  -9.659   1.00 16.03  ? 432 MSE B N   1 
HETATM 6968  C  CA  . MSE B  1 457 ? 81.248  23.046  -9.111   1.00 16.45  ? 432 MSE B CA  1 
HETATM 6969  C  C   . MSE B  1 457 ? 81.041  24.079  -10.163  1.00 15.06  ? 432 MSE B C   1 
HETATM 6970  O  O   . MSE B  1 457 ? 81.976  24.724  -10.603  1.00 14.13  ? 432 MSE B O   1 
HETATM 6971  C  CB  . MSE B  1 457 ? 81.792  23.647  -7.799   1.00 17.80  ? 432 MSE B CB  1 
HETATM 6972  C  CG  . MSE B  1 457 ? 81.828  22.551  -6.726   1.00 19.46  ? 432 MSE B CG  1 
HETATM 6973  SE SE  . MSE B  1 457 ? 82.824  23.122  -5.122   1.00 22.86  ? 432 MSE B SE  1 
HETATM 6974  C  CE  . MSE B  1 457 ? 84.680  22.929  -5.806   1.00 21.42  ? 432 MSE B CE  1 
ATOM   6975  N  N   . VAL B  1 458 ? 79.797  24.222  -10.598  1.00 15.12  ? 433 VAL B N   1 
ATOM   6976  C  CA  . VAL B  1 458 ? 79.494  25.036  -11.770  1.00 15.03  ? 433 VAL B CA  1 
ATOM   6977  C  C   . VAL B  1 458 ? 78.521  26.135  -11.389  1.00 14.82  ? 433 VAL B C   1 
ATOM   6978  O  O   . VAL B  1 458 ? 77.505  25.851  -10.766  1.00 14.97  ? 433 VAL B O   1 
ATOM   6979  C  CB  . VAL B  1 458 ? 78.829  24.193  -12.878  1.00 14.73  ? 433 VAL B CB  1 
ATOM   6980  C  CG1 . VAL B  1 458 ? 78.420  25.073  -14.060  1.00 14.30  ? 433 VAL B CG1 1 
ATOM   6981  C  CG2 . VAL B  1 458 ? 79.746  23.047  -13.309  1.00 15.06  ? 433 VAL B CG2 1 
ATOM   6982  N  N   . GLY B  1 459 ? 78.810  27.365  -11.804  1.00 14.05  ? 434 GLY B N   1 
ATOM   6983  C  CA  . GLY B  1 459 ? 77.880  28.477  -11.611  1.00 14.25  ? 434 GLY B CA  1 
ATOM   6984  C  C   . GLY B  1 459 ? 77.264  28.962  -12.915  1.00 15.04  ? 434 GLY B C   1 
ATOM   6985  O  O   . GLY B  1 459 ? 77.956  29.151  -13.931  1.00 15.69  ? 434 GLY B O   1 
ATOM   6986  N  N   . VAL B  1 460 ? 75.947  29.119  -12.887  1.00 14.50  ? 435 VAL B N   1 
ATOM   6987  C  CA  . VAL B  1 460 ? 75.201  29.703  -13.967  1.00 14.48  ? 435 VAL B CA  1 
ATOM   6988  C  C   . VAL B  1 460 ? 74.780  31.087  -13.482  1.00 15.32  ? 435 VAL B C   1 
ATOM   6989  O  O   . VAL B  1 460 ? 73.876  31.207  -12.656  1.00 14.11  ? 435 VAL B O   1 
ATOM   6990  C  CB  . VAL B  1 460 ? 74.007  28.811  -14.368  1.00 13.76  ? 435 VAL B CB  1 
ATOM   6991  C  CG1 . VAL B  1 460 ? 73.162  29.477  -15.460  1.00 13.97  ? 435 VAL B CG1 1 
ATOM   6992  C  CG2 . VAL B  1 460 ? 74.515  27.445  -14.829  1.00 12.41  ? 435 VAL B CG2 1 
ATOM   6993  N  N   . ASN B  1 461 ? 75.491  32.115  -13.979  1.00 16.92  ? 436 ASN B N   1 
ATOM   6994  C  CA  . ASN B  1 461 ? 75.342  33.513  -13.529  1.00 17.72  ? 436 ASN B CA  1 
ATOM   6995  C  C   . ASN B  1 461 ? 75.610  33.689  -12.028  1.00 18.49  ? 436 ASN B C   1 
ATOM   6996  O  O   . ASN B  1 461 ? 75.056  34.568  -11.365  1.00 17.90  ? 436 ASN B O   1 
ATOM   6997  C  CB  . ASN B  1 461 ? 73.979  34.083  -13.945  1.00 17.36  ? 436 ASN B CB  1 
ATOM   6998  C  CG  . ASN B  1 461 ? 73.741  33.968  -15.437  1.00 17.77  ? 436 ASN B CG  1 
ATOM   6999  O  OD1 . ASN B  1 461 ? 74.502  34.513  -16.251  1.00 17.87  ? 436 ASN B OD1 1 
ATOM   7000  N  ND2 . ASN B  1 461 ? 72.687  33.237  -15.811  1.00 17.17  ? 436 ASN B ND2 1 
ATOM   7001  N  N   . VAL B  1 462 ? 76.495  32.835  -11.525  1.00 19.80  ? 437 VAL B N   1 
ATOM   7002  C  CA  . VAL B  1 462 ? 76.975  32.859  -10.148  1.00 20.94  ? 437 VAL B CA  1 
ATOM   7003  C  C   . VAL B  1 462 ? 78.502  32.791  -10.240  1.00 21.70  ? 437 VAL B C   1 
ATOM   7004  O  O   . VAL B  1 462 ? 79.030  31.918  -10.929  1.00 22.38  ? 437 VAL B O   1 
ATOM   7005  C  CB  . VAL B  1 462 ? 76.426  31.653  -9.353   1.00 20.97  ? 437 VAL B CB  1 
ATOM   7006  C  CG1 . VAL B  1 462 ? 77.257  31.394  -8.105   1.00 20.94  ? 437 VAL B CG1 1 
ATOM   7007  C  CG2 . VAL B  1 462 ? 74.956  31.885  -8.999   1.00 21.17  ? 437 VAL B CG2 1 
ATOM   7008  N  N   . PRO B  1 463 ? 79.215  33.722  -9.574   1.00 20.99  ? 438 PRO B N   1 
ATOM   7009  C  CA  . PRO B  1 463 ? 80.669  33.728  -9.795   1.00 21.67  ? 438 PRO B CA  1 
ATOM   7010  C  C   . PRO B  1 463 ? 81.432  32.698  -8.949   1.00 23.04  ? 438 PRO B C   1 
ATOM   7011  O  O   . PRO B  1 463 ? 82.475  32.192  -9.386   1.00 22.17  ? 438 PRO B O   1 
ATOM   7012  C  CB  . PRO B  1 463 ? 81.081  35.158  -9.411   1.00 19.92  ? 438 PRO B CB  1 
ATOM   7013  C  CG  . PRO B  1 463 ? 80.047  35.596  -8.416   1.00 20.05  ? 438 PRO B CG  1 
ATOM   7014  C  CD  . PRO B  1 463 ? 78.758  34.868  -8.754   1.00 19.95  ? 438 PRO B CD  1 
ATOM   7015  N  N   . ILE B  1 464 ? 80.934  32.415  -7.745   1.00 23.43  ? 439 ILE B N   1 
ATOM   7016  C  CA  . ILE B  1 464 ? 81.623  31.501  -6.835   1.00 24.16  ? 439 ILE B CA  1 
ATOM   7017  C  C   . ILE B  1 464 ? 80.640  30.410  -6.409   1.00 23.48  ? 439 ILE B C   1 
ATOM   7018  O  O   . ILE B  1 464 ? 79.969  30.528  -5.379   1.00 23.67  ? 439 ILE B O   1 
ATOM   7019  C  CB  . ILE B  1 464 ? 82.259  32.245  -5.633   1.00 25.76  ? 439 ILE B CB  1 
ATOM   7020  C  CG1 . ILE B  1 464 ? 83.136  33.413  -6.128   1.00 28.18  ? 439 ILE B CG1 1 
ATOM   7021  C  CG2 . ILE B  1 464 ? 83.103  31.286  -4.801   1.00 25.44  ? 439 ILE B CG2 1 
ATOM   7022  C  CD1 . ILE B  1 464 ? 83.516  34.426  -5.063   1.00 30.28  ? 439 ILE B CD1 1 
ATOM   7023  N  N   . PRO B  1 465 ? 80.543  29.340  -7.218   1.00 22.90  ? 440 PRO B N   1 
ATOM   7024  C  CA  . PRO B  1 465 ? 79.540  28.309  -6.974   1.00 22.70  ? 440 PRO B CA  1 
ATOM   7025  C  C   . PRO B  1 465 ? 79.967  27.306  -5.893   1.00 21.85  ? 440 PRO B C   1 
ATOM   7026  O  O   . PRO B  1 465 ? 79.908  26.097  -6.104   1.00 22.25  ? 440 PRO B O   1 
ATOM   7027  C  CB  . PRO B  1 465 ? 79.415  27.631  -8.342   1.00 23.73  ? 440 PRO B CB  1 
ATOM   7028  C  CG  . PRO B  1 465 ? 80.772  27.747  -8.935   1.00 23.15  ? 440 PRO B CG  1 
ATOM   7029  C  CD  . PRO B  1 465 ? 81.332  29.061  -8.435   1.00 22.91  ? 440 PRO B CD  1 
ATOM   7030  N  N   . VAL B  1 466 ? 80.401  27.822  -4.749   1.00 21.47  ? 441 VAL B N   1 
ATOM   7031  C  CA  . VAL B  1 466 ? 80.621  27.022  -3.553   1.00 22.14  ? 441 VAL B CA  1 
ATOM   7032  C  C   . VAL B  1 466 ? 79.248  26.547  -3.046   1.00 20.68  ? 441 VAL B C   1 
ATOM   7033  O  O   . VAL B  1 466 ? 78.401  27.364  -2.711   1.00 20.67  ? 441 VAL B O   1 
ATOM   7034  C  CB  . VAL B  1 466 ? 81.352  27.855  -2.475   1.00 24.51  ? 441 VAL B CB  1 
ATOM   7035  C  CG1 . VAL B  1 466 ? 81.337  27.149  -1.131   1.00 27.77  ? 441 VAL B CG1 1 
ATOM   7036  C  CG2 . VAL B  1 466 ? 82.789  28.124  -2.898   1.00 23.37  ? 441 VAL B CG2 1 
ATOM   7037  N  N   . PRO B  1 467 ? 78.999  25.225  -3.048   1.00 20.13  ? 442 PRO B N   1 
ATOM   7038  C  CA  . PRO B  1 467 ? 77.711  24.731  -2.532   1.00 19.98  ? 442 PRO B CA  1 
ATOM   7039  C  C   . PRO B  1 467 ? 77.570  25.038  -1.039   1.00 18.80  ? 442 PRO B C   1 
ATOM   7040  O  O   . PRO B  1 467 ? 78.577  25.185  -0.324   1.00 18.06  ? 442 PRO B O   1 
ATOM   7041  C  CB  . PRO B  1 467 ? 77.807  23.212  -2.741   1.00 19.80  ? 442 PRO B CB  1 
ATOM   7042  C  CG  . PRO B  1 467 ? 78.774  23.051  -3.867   1.00 20.86  ? 442 PRO B CG  1 
ATOM   7043  C  CD  . PRO B  1 467 ? 79.798  24.141  -3.645   1.00 21.04  ? 442 PRO B CD  1 
ATOM   7044  N  N   . LEU B  1 468 ? 76.335  25.137  -0.572   1.00 17.38  ? 443 LEU B N   1 
ATOM   7045  C  CA  . LEU B  1 468 ? 76.093  25.362  0.849    1.00 16.66  ? 443 LEU B CA  1 
ATOM   7046  C  C   . LEU B  1 468 ? 76.382  24.095  1.662    1.00 16.60  ? 443 LEU B C   1 
ATOM   7047  O  O   . LEU B  1 468 ? 76.583  23.003  1.099    1.00 15.77  ? 443 LEU B O   1 
ATOM   7048  C  CB  . LEU B  1 468 ? 74.679  25.888  1.061    1.00 16.13  ? 443 LEU B CB  1 
ATOM   7049  C  CG  . LEU B  1 468 ? 74.459  27.248  0.368    1.00 15.87  ? 443 LEU B CG  1 
ATOM   7050  C  CD1 . LEU B  1 468 ? 72.977  27.535  0.203    1.00 16.24  ? 443 LEU B CD1 1 
ATOM   7051  C  CD2 . LEU B  1 468 ? 75.125  28.382  1.138    1.00 15.73  ? 443 LEU B CD2 1 
ATOM   7052  N  N   . ALA B  1 469 ? 76.419  24.257  2.983    1.00 17.10  ? 444 ALA B N   1 
ATOM   7053  C  CA  . ALA B  1 469 ? 76.837  23.205  3.911    1.00 17.15  ? 444 ALA B CA  1 
ATOM   7054  C  C   . ALA B  1 469 ? 76.054  21.898  3.740    1.00 17.47  ? 444 ALA B C   1 
ATOM   7055  O  O   . ALA B  1 469 ? 76.595  20.795  3.947    1.00 16.82  ? 444 ALA B O   1 
ATOM   7056  C  CB  . ALA B  1 469 ? 76.731  23.707  5.340    1.00 16.79  ? 444 ALA B CB  1 
ATOM   7057  N  N   . TYR B  1 470 ? 74.787  22.033  3.352    1.00 17.37  ? 445 TYR B N   1 
ATOM   7058  C  CA  . TYR B  1 470 ? 73.905  20.874  3.178    1.00 16.85  ? 445 TYR B CA  1 
ATOM   7059  C  C   . TYR B  1 470 ? 74.023  20.185  1.806    1.00 16.35  ? 445 TYR B C   1 
ATOM   7060  O  O   . TYR B  1 470 ? 73.565  19.050  1.632    1.00 15.79  ? 445 TYR B O   1 
ATOM   7061  C  CB  . TYR B  1 470 ? 72.458  21.208  3.552    1.00 16.40  ? 445 TYR B CB  1 
ATOM   7062  C  CG  . TYR B  1 470 ? 71.836  22.384  2.834    1.00 17.06  ? 445 TYR B CG  1 
ATOM   7063  C  CD1 . TYR B  1 470 ? 72.085  23.704  3.243    1.00 16.91  ? 445 TYR B CD1 1 
ATOM   7064  C  CD2 . TYR B  1 470 ? 70.950  22.175  1.775    1.00 17.50  ? 445 TYR B CD2 1 
ATOM   7065  C  CE1 . TYR B  1 470 ? 71.483  24.778  2.600    1.00 17.12  ? 445 TYR B CE1 1 
ATOM   7066  C  CE2 . TYR B  1 470 ? 70.336  23.238  1.132    1.00 18.38  ? 445 TYR B CE2 1 
ATOM   7067  C  CZ  . TYR B  1 470 ? 70.609  24.537  1.545    1.00 18.04  ? 445 TYR B CZ  1 
ATOM   7068  O  OH  . TYR B  1 470 ? 69.998  25.570  0.886    1.00 17.27  ? 445 TYR B OH  1 
ATOM   7069  N  N   . HIS B  1 471 ? 74.661  20.855  0.849    1.00 16.56  ? 446 HIS B N   1 
ATOM   7070  C  CA  . HIS B  1 471 ? 75.140  20.164  -0.352   1.00 17.08  ? 446 HIS B CA  1 
ATOM   7071  C  C   . HIS B  1 471 ? 76.610  19.830  -0.103   1.00 18.05  ? 446 HIS B C   1 
ATOM   7072  O  O   . HIS B  1 471 ? 77.036  19.870  1.055    1.00 18.33  ? 446 HIS B O   1 
ATOM   7073  C  CB  . HIS B  1 471 ? 74.878  20.992  -1.611   1.00 16.86  ? 446 HIS B CB  1 
ATOM   7074  C  CG  . HIS B  1 471 ? 73.428  21.050  -1.983   1.00 16.49  ? 446 HIS B CG  1 
ATOM   7075  N  ND1 . HIS B  1 471 ? 72.839  20.126  -2.822   1.00 17.27  ? 446 HIS B ND1 1 
ATOM   7076  C  CD2 . HIS B  1 471 ? 72.436  21.888  -1.589   1.00 15.61  ? 446 HIS B CD2 1 
ATOM   7077  C  CE1 . HIS B  1 471 ? 71.551  20.411  -2.949   1.00 17.08  ? 446 HIS B CE1 1 
ATOM   7078  N  NE2 . HIS B  1 471 ? 71.284  21.477  -2.209   1.00 15.66  ? 446 HIS B NE2 1 
ATOM   7079  N  N   . SER B  1 472 ? 77.381  19.489  -1.136   1.00 17.60  ? 447 SER B N   1 
ATOM   7080  C  CA  . SER B  1 472 ? 78.769  19.074  -0.907   1.00 17.23  ? 447 SER B CA  1 
ATOM   7081  C  C   . SER B  1 472 ? 79.770  19.799  -1.779   1.00 17.66  ? 447 SER B C   1 
ATOM   7082  O  O   . SER B  1 472 ? 79.443  20.202  -2.901   1.00 18.54  ? 447 SER B O   1 
ATOM   7083  C  CB  . SER B  1 472 ? 78.929  17.562  -1.091   1.00 17.33  ? 447 SER B CB  1 
ATOM   7084  O  OG  . SER B  1 472 ? 78.834  17.176  -2.454   1.00 17.60  ? 447 SER B OG  1 
ATOM   7085  N  N   . PHE B  1 473 ? 80.996  19.925  -1.268   1.00 16.70  ? 448 PHE B N   1 
ATOM   7086  C  CA  . PHE B  1 473 ? 82.067  20.668  -1.935   1.00 17.16  ? 448 PHE B CA  1 
ATOM   7087  C  C   . PHE B  1 473 ? 83.146  19.713  -2.469   1.00 16.58  ? 448 PHE B C   1 
ATOM   7088  O  O   . PHE B  1 473 ? 83.586  18.779  -1.762   1.00 15.51  ? 448 PHE B O   1 
ATOM   7089  C  CB  . PHE B  1 473 ? 82.675  21.687  -0.954   1.00 17.78  ? 448 PHE B CB  1 
ATOM   7090  C  CG  . PHE B  1 473 ? 83.913  22.389  -1.469   1.00 19.63  ? 448 PHE B CG  1 
ATOM   7091  C  CD1 . PHE B  1 473 ? 85.149  21.730  -1.512   1.00 21.58  ? 448 PHE B CD1 1 
ATOM   7092  C  CD2 . PHE B  1 473 ? 83.857  23.731  -1.866   1.00 19.78  ? 448 PHE B CD2 1 
ATOM   7093  C  CE1 . PHE B  1 473 ? 86.293  22.382  -1.978   1.00 22.24  ? 448 PHE B CE1 1 
ATOM   7094  C  CE2 . PHE B  1 473 ? 84.993  24.388  -2.322   1.00 20.46  ? 448 PHE B CE2 1 
ATOM   7095  C  CZ  . PHE B  1 473 ? 86.209  23.717  -2.379   1.00 21.78  ? 448 PHE B CZ  1 
ATOM   7096  N  N   . GLY B  1 474 ? 83.574  19.950  -3.707   1.00 16.34  ? 449 GLY B N   1 
ATOM   7097  C  CA  . GLY B  1 474 ? 84.706  19.206  -4.262   1.00 16.60  ? 449 GLY B CA  1 
ATOM   7098  C  C   . GLY B  1 474 ? 84.927  19.438  -5.745   1.00 16.26  ? 449 GLY B C   1 
ATOM   7099  O  O   . GLY B  1 474 ? 83.975  19.480  -6.505   1.00 15.55  ? 449 GLY B O   1 
ATOM   7100  N  N   . GLY B  1 475 ? 86.189  19.602  -6.138   1.00 16.78  ? 450 GLY B N   1 
ATOM   7101  C  CA  . GLY B  1 475 ? 86.557  19.812  -7.541   1.00 17.67  ? 450 GLY B CA  1 
ATOM   7102  C  C   . GLY B  1 475 ? 86.845  18.500  -8.249   1.00 18.43  ? 450 GLY B C   1 
ATOM   7103  O  O   . GLY B  1 475 ? 86.761  17.434  -7.632   1.00 19.00  ? 450 GLY B O   1 
ATOM   7104  N  N   . TRP B  1 476 ? 87.157  18.581  -9.544   1.00 18.74  ? 451 TRP B N   1 
ATOM   7105  C  CA  . TRP B  1 476 ? 87.493  17.408  -10.372  1.00 18.42  ? 451 TRP B CA  1 
ATOM   7106  C  C   . TRP B  1 476 ? 88.915  17.555  -10.877  1.00 18.38  ? 451 TRP B C   1 
ATOM   7107  O  O   . TRP B  1 476 ? 89.601  18.530  -10.558  1.00 17.84  ? 451 TRP B O   1 
ATOM   7108  C  CB  . TRP B  1 476 ? 86.540  17.264  -11.568  1.00 18.62  ? 451 TRP B CB  1 
ATOM   7109  C  CG  . TRP B  1 476 ? 85.103  16.844  -11.222  1.00 19.21  ? 451 TRP B CG  1 
ATOM   7110  C  CD1 . TRP B  1 476 ? 84.548  16.736  -9.978   1.00 19.60  ? 451 TRP B CD1 1 
ATOM   7111  C  CD2 . TRP B  1 476 ? 84.062  16.501  -12.153  1.00 17.93  ? 451 TRP B CD2 1 
ATOM   7112  N  NE1 . TRP B  1 476 ? 83.231  16.347  -10.075  1.00 19.12  ? 451 TRP B NE1 1 
ATOM   7113  C  CE2 . TRP B  1 476 ? 82.910  16.193  -11.397  1.00 18.02  ? 451 TRP B CE2 1 
ATOM   7114  C  CE3 . TRP B  1 476 ? 84.002  16.415  -13.555  1.00 17.16  ? 451 TRP B CE3 1 
ATOM   7115  C  CZ2 . TRP B  1 476 ? 81.706  15.799  -11.989  1.00 17.23  ? 451 TRP B CZ2 1 
ATOM   7116  C  CZ3 . TRP B  1 476 ? 82.809  16.039  -14.152  1.00 17.24  ? 451 TRP B CZ3 1 
ATOM   7117  C  CH2 . TRP B  1 476 ? 81.670  15.734  -13.366  1.00 17.38  ? 451 TRP B CH2 1 
ATOM   7118  N  N   . LYS B  1 477 ? 89.353  16.582  -11.673  1.00 19.72  ? 452 LYS B N   1 
ATOM   7119  C  CA  . LYS B  1 477 ? 90.715  16.564  -12.236  1.00 20.13  ? 452 LYS B CA  1 
ATOM   7120  C  C   . LYS B  1 477 ? 91.758  16.727  -11.108  1.00 20.18  ? 452 LYS B C   1 
ATOM   7121  O  O   . LYS B  1 477 ? 91.647  16.072  -10.061  1.00 19.83  ? 452 LYS B O   1 
ATOM   7122  C  CB  . LYS B  1 477 ? 90.854  17.606  -13.361  1.00 19.38  ? 452 LYS B CB  1 
ATOM   7123  C  CG  . LYS B  1 477 ? 89.849  17.412  -14.504  1.00 18.29  ? 452 LYS B CG  1 
ATOM   7124  C  CD  . LYS B  1 477 ? 90.042  18.388  -15.667  1.00 17.31  ? 452 LYS B CD  1 
ATOM   7125  C  CE  . LYS B  1 477 ? 89.513  19.787  -15.326  1.00 16.33  ? 452 LYS B CE  1 
ATOM   7126  N  NZ  . LYS B  1 477 ? 89.521  20.718  -16.490  1.00 15.80  ? 452 LYS B NZ  1 
ATOM   7127  N  N   . SER B  1 478 ? 92.738  17.601  -11.289  1.00 19.89  ? 453 SER B N   1 
ATOM   7128  C  CA  . SER B  1 478 ? 93.794  17.718  -10.291  1.00 22.18  ? 453 SER B CA  1 
ATOM   7129  C  C   . SER B  1 478 ? 93.360  18.486  -9.035   1.00 22.03  ? 453 SER B C   1 
ATOM   7130  O  O   . SER B  1 478 ? 94.165  18.718  -8.135   1.00 22.73  ? 453 SER B O   1 
ATOM   7131  C  CB  . SER B  1 478 ? 95.061  18.329  -10.905  1.00 24.92  ? 453 SER B CB  1 
ATOM   7132  O  OG  . SER B  1 478 ? 94.875  19.719  -11.115  1.00 27.41  ? 453 SER B OG  1 
ATOM   7133  N  N   . SER B  1 479 ? 92.086  18.857  -8.967   1.00 21.44  ? 454 SER B N   1 
ATOM   7134  C  CA  . SER B  1 479 ? 91.580  19.653  -7.847   1.00 20.35  ? 454 SER B CA  1 
ATOM   7135  C  C   . SER B  1 479 ? 91.056  18.859  -6.636   1.00 20.03  ? 454 SER B C   1 
ATOM   7136  O  O   . SER B  1 479 ? 90.733  19.450  -5.595   1.00 20.97  ? 454 SER B O   1 
ATOM   7137  C  CB  . SER B  1 479 ? 90.544  20.669  -8.348   1.00 19.53  ? 454 SER B CB  1 
ATOM   7138  O  OG  . SER B  1 479 ? 91.196  21.724  -9.042   1.00 18.89  ? 454 SER B OG  1 
ATOM   7139  N  N   . SER B  1 480 ? 90.983  17.533  -6.758   1.00 17.82  ? 455 SER B N   1 
ATOM   7140  C  CA  . SER B  1 480 ? 90.638  16.691  -5.614   1.00 18.62  ? 455 SER B CA  1 
ATOM   7141  C  C   . SER B  1 480 ? 91.091  15.239  -5.769   1.00 20.12  ? 455 SER B C   1 
ATOM   7142  O  O   . SER B  1 480 ? 91.420  14.777  -6.871   1.00 21.08  ? 455 SER B O   1 
ATOM   7143  C  CB  . SER B  1 480 ? 89.134  16.703  -5.363   1.00 17.66  ? 455 SER B CB  1 
ATOM   7144  O  OG  . SER B  1 480 ? 88.479  15.890  -6.313   1.00 16.68  ? 455 SER B OG  1 
ATOM   7145  N  N   . PHE B  1 481 ? 91.081  14.519  -4.655   1.00 19.15  ? 456 PHE B N   1 
ATOM   7146  C  CA  . PHE B  1 481 ? 91.525  13.142  -4.625   1.00 19.30  ? 456 PHE B CA  1 
ATOM   7147  C  C   . PHE B  1 481 ? 90.645  12.354  -3.666   1.00 19.15  ? 456 PHE B C   1 
ATOM   7148  O  O   . PHE B  1 481 ? 90.298  12.847  -2.592   1.00 18.11  ? 456 PHE B O   1 
ATOM   7149  C  CB  . PHE B  1 481 ? 93.009  13.083  -4.210   1.00 20.93  ? 456 PHE B CB  1 
ATOM   7150  C  CG  . PHE B  1 481 ? 93.913  13.874  -5.124   1.00 22.41  ? 456 PHE B CG  1 
ATOM   7151  C  CD1 . PHE B  1 481 ? 94.109  15.250  -4.923   1.00 22.32  ? 456 PHE B CD1 1 
ATOM   7152  C  CD2 . PHE B  1 481 ? 94.511  13.262  -6.234   1.00 23.69  ? 456 PHE B CD2 1 
ATOM   7153  C  CE1 . PHE B  1 481 ? 94.896  15.991  -5.799   1.00 24.12  ? 456 PHE B CE1 1 
ATOM   7154  C  CE2 . PHE B  1 481 ? 95.320  13.996  -7.100   1.00 25.26  ? 456 PHE B CE2 1 
ATOM   7155  C  CZ  . PHE B  1 481 ? 95.512  15.362  -6.883   1.00 24.70  ? 456 PHE B CZ  1 
ATOM   7156  N  N   . GLY B  1 482 ? 90.292  11.132  -4.065   1.00 18.93  ? 457 GLY B N   1 
ATOM   7157  C  CA  . GLY B  1 482 ? 89.381  10.301  -3.289   1.00 18.84  ? 457 GLY B CA  1 
ATOM   7158  C  C   . GLY B  1 482 ? 88.026  10.213  -3.954   1.00 19.04  ? 457 GLY B C   1 
ATOM   7159  O  O   . GLY B  1 482 ? 87.897  10.485  -5.143   1.00 19.34  ? 457 GLY B O   1 
ATOM   7160  N  N   . ASP B  1 483 ? 87.008  9.834   -3.190   1.00 19.72  ? 458 ASP B N   1 
ATOM   7161  C  CA  . ASP B  1 483 ? 85.683  9.613   -3.777   1.00 20.63  ? 458 ASP B CA  1 
ATOM   7162  C  C   . ASP B  1 483 ? 84.549  10.238  -2.977   1.00 19.62  ? 458 ASP B C   1 
ATOM   7163  O  O   . ASP B  1 483 ? 83.376  9.986   -3.261   1.00 20.42  ? 458 ASP B O   1 
ATOM   7164  C  CB  . ASP B  1 483 ? 85.441  8.105   -4.010   1.00 22.02  ? 458 ASP B CB  1 
ATOM   7165  C  CG  . ASP B  1 483 ? 85.744  7.265   -2.778   1.00 22.46  ? 458 ASP B CG  1 
ATOM   7166  O  OD1 . ASP B  1 483 ? 85.652  7.802   -1.650   1.00 23.52  ? 458 ASP B OD1 1 
ATOM   7167  O  OD2 . ASP B  1 483 ? 86.077  6.070   -2.935   1.00 21.65  ? 458 ASP B OD2 1 
ATOM   7168  N  N   . LEU B  1 484 ? 84.893  11.051  -1.979   1.00 18.75  ? 459 LEU B N   1 
ATOM   7169  C  CA  . LEU B  1 484 ? 83.875  11.713  -1.160   1.00 17.79  ? 459 LEU B CA  1 
ATOM   7170  C  C   . LEU B  1 484 ? 84.229  13.195  -0.999   1.00 17.32  ? 459 LEU B C   1 
ATOM   7171  O  O   . LEU B  1 484 ? 85.392  13.527  -0.802   1.00 18.08  ? 459 LEU B O   1 
ATOM   7172  C  CB  . LEU B  1 484 ? 83.696  10.998  0.199    1.00 17.04  ? 459 LEU B CB  1 
ATOM   7173  C  CG  . LEU B  1 484 ? 83.059  9.591   0.168    1.00 16.59  ? 459 LEU B CG  1 
ATOM   7174  C  CD1 . LEU B  1 484 ? 83.221  8.891   1.506    1.00 16.00  ? 459 LEU B CD1 1 
ATOM   7175  C  CD2 . LEU B  1 484 ? 81.577  9.614   -0.245   1.00 15.51  ? 459 LEU B CD2 1 
ATOM   7176  N  N   . ASN B  1 485 ? 83.221  14.065  -1.112   1.00 15.42  ? 460 ASN B N   1 
ATOM   7177  C  CA  . ASN B  1 485 ? 83.375  15.517  -1.020   1.00 15.11  ? 460 ASN B CA  1 
ATOM   7178  C  C   . ASN B  1 485 ? 83.398  16.021  0.417    1.00 16.13  ? 460 ASN B C   1 
ATOM   7179  O  O   . ASN B  1 485 ? 83.274  15.233  1.371    1.00 16.40  ? 460 ASN B O   1 
ATOM   7180  C  CB  . ASN B  1 485 ? 82.195  16.189  -1.729   1.00 15.43  ? 460 ASN B CB  1 
ATOM   7181  C  CG  . ASN B  1 485 ? 82.381  16.297  -3.239   1.00 16.05  ? 460 ASN B CG  1 
ATOM   7182  O  OD1 . ASN B  1 485 ? 83.474  16.078  -3.780   1.00 15.78  ? 460 ASN B OD1 1 
ATOM   7183  N  ND2 . ASN B  1 485 ? 81.307  16.676  -3.926   1.00 15.94  ? 460 ASN B ND2 1 
ATOM   7184  N  N   . GLN B  1 486 ? 83.517  17.337  0.575    1.00 17.16  ? 461 GLN B N   1 
ATOM   7185  C  CA  . GLN B  1 486 ? 83.459  17.975  1.889    1.00 18.34  ? 461 GLN B CA  1 
ATOM   7186  C  C   . GLN B  1 486 ? 82.021  18.301  2.255    1.00 19.10  ? 461 GLN B C   1 
ATOM   7187  O  O   . GLN B  1 486 ? 81.205  18.610  1.383    1.00 20.06  ? 461 GLN B O   1 
ATOM   7188  C  CB  . GLN B  1 486 ? 84.322  19.245  1.943    1.00 19.10  ? 461 GLN B CB  1 
ATOM   7189  C  CG  . GLN B  1 486 ? 85.823  18.990  1.883    1.00 20.17  ? 461 GLN B CG  1 
ATOM   7190  C  CD  . GLN B  1 486 ? 86.465  18.675  3.229    1.00 21.94  ? 461 GLN B CD  1 
ATOM   7191  O  OE1 . GLN B  1 486 ? 85.826  18.726  4.282    1.00 23.22  ? 461 GLN B OE1 1 
ATOM   7192  N  NE2 . GLN B  1 486 ? 87.747  18.350  3.198    1.00 22.45  ? 461 GLN B NE2 1 
ATOM   7193  N  N   . HIS B  1 487 ? 81.713  18.243  3.542    1.00 18.43  ? 462 HIS B N   1 
ATOM   7194  C  CA  . HIS B  1 487 ? 80.363  18.419  4.080    1.00 18.32  ? 462 HIS B CA  1 
ATOM   7195  C  C   . HIS B  1 487 ? 79.242  17.687  3.327    1.00 17.15  ? 462 HIS B C   1 
ATOM   7196  O  O   . HIS B  1 487 ? 79.507  16.700  2.663    1.00 17.78  ? 462 HIS B O   1 
ATOM   7197  C  CB  . HIS B  1 487 ? 80.009  19.885  4.366    1.00 18.36  ? 462 HIS B CB  1 
ATOM   7198  C  CG  . HIS B  1 487 ? 80.154  20.804  3.202    1.00 18.41  ? 462 HIS B CG  1 
ATOM   7199  N  ND1 . HIS B  1 487 ? 79.189  20.940  2.234    1.00 18.20  ? 462 HIS B ND1 1 
ATOM   7200  C  CD2 . HIS B  1 487 ? 81.132  21.677  2.879    1.00 18.60  ? 462 HIS B CD2 1 
ATOM   7201  C  CE1 . HIS B  1 487 ? 79.576  21.837  1.352    1.00 17.88  ? 462 HIS B CE1 1 
ATOM   7202  N  NE2 . HIS B  1 487 ? 80.749  22.302  1.723    1.00 18.28  ? 462 HIS B NE2 1 
ATOM   7203  N  N   . GLY B  1 488 ? 78.002  18.153  3.467    1.00 15.86  ? 463 GLY B N   1 
ATOM   7204  C  CA  . GLY B  1 488 ? 76.849  17.431  2.883    1.00 16.24  ? 463 GLY B CA  1 
ATOM   7205  C  C   . GLY B  1 488 ? 76.790  15.997  3.371    1.00 17.21  ? 463 GLY B C   1 
ATOM   7206  O  O   . GLY B  1 488 ? 77.422  15.658  4.357    1.00 19.46  ? 463 GLY B O   1 
ATOM   7207  N  N   . THR B  1 489 ? 76.039  15.146  2.692    1.00 17.43  ? 464 THR B N   1 
ATOM   7208  C  CA  . THR B  1 489 ? 75.921  13.746  3.100    1.00 18.18  ? 464 THR B CA  1 
ATOM   7209  C  C   . THR B  1 489 ? 77.214  12.967  2.831    1.00 18.12  ? 464 THR B C   1 
ATOM   7210  O  O   . THR B  1 489 ? 77.467  11.950  3.480    1.00 17.90  ? 464 THR B O   1 
ATOM   7211  C  CB  . THR B  1 489 ? 74.775  13.018  2.368    1.00 18.02  ? 464 THR B CB  1 
ATOM   7212  O  OG1 . THR B  1 489 ? 75.010  13.089  0.958    1.00 18.10  ? 464 THR B OG1 1 
ATOM   7213  C  CG2 . THR B  1 489 ? 73.437  13.639  2.682    1.00 18.00  ? 464 THR B CG2 1 
ATOM   7214  N  N   . ASP B  1 490 ? 78.003  13.420  1.852    1.00 18.27  ? 465 ASP B N   1 
ATOM   7215  C  CA  . ASP B  1 490 ? 79.326  12.839  1.594    1.00 18.96  ? 465 ASP B CA  1 
ATOM   7216  C  C   . ASP B  1 490 ? 80.165  12.790  2.873    1.00 18.10  ? 465 ASP B C   1 
ATOM   7217  O  O   . ASP B  1 490 ? 80.745  11.741  3.196    1.00 18.49  ? 465 ASP B O   1 
ATOM   7218  C  CB  . ASP B  1 490 ? 80.086  13.595  0.488    1.00 20.31  ? 465 ASP B CB  1 
ATOM   7219  C  CG  . ASP B  1 490 ? 79.854  13.008  -0.901   1.00 22.22  ? 465 ASP B CG  1 
ATOM   7220  O  OD1 . ASP B  1 490 ? 78.827  12.345  -1.138   1.00 21.05  ? 465 ASP B OD1 1 
ATOM   7221  O  OD2 . ASP B  1 490 ? 80.704  13.218  -1.786   1.00 26.85  ? 465 ASP B OD2 1 
ATOM   7222  N  N   . SER B  1 491 ? 80.197  13.902  3.606    1.00 16.36  ? 466 SER B N   1 
ATOM   7223  C  CA  . SER B  1 491 ? 81.021  13.989  4.816    1.00 16.28  ? 466 SER B CA  1 
ATOM   7224  C  C   . SER B  1 491 ? 80.608  12.944  5.831    1.00 16.33  ? 466 SER B C   1 
ATOM   7225  O  O   . SER B  1 491 ? 81.454  12.381  6.509    1.00 16.91  ? 466 SER B O   1 
ATOM   7226  C  CB  . SER B  1 491 ? 80.963  15.386  5.459    1.00 15.77  ? 466 SER B CB  1 
ATOM   7227  O  OG  . SER B  1 491 ? 79.645  15.718  5.862    1.00 14.99  ? 466 SER B OG  1 
ATOM   7228  N  N   . ILE B  1 492 ? 79.313  12.682  5.922    1.00 16.20  ? 467 ILE B N   1 
ATOM   7229  C  CA  . ILE B  1 492 ? 78.785  11.709  6.891    1.00 17.31  ? 467 ILE B CA  1 
ATOM   7230  C  C   . ILE B  1 492 ? 79.237  10.284  6.523    1.00 18.30  ? 467 ILE B C   1 
ATOM   7231  O  O   . ILE B  1 492 ? 79.533  9.457   7.390    1.00 17.47  ? 467 ILE B O   1 
ATOM   7232  C  CB  . ILE B  1 492 ? 77.242  11.805  6.986    1.00 17.23  ? 467 ILE B CB  1 
ATOM   7233  C  CG1 . ILE B  1 492 ? 76.810  13.263  7.213    1.00 17.45  ? 467 ILE B CG1 1 
ATOM   7234  C  CG2 . ILE B  1 492 ? 76.689  10.905  8.097    1.00 17.32  ? 467 ILE B CG2 1 
ATOM   7235  C  CD1 . ILE B  1 492 ? 77.289  13.866  8.526    1.00 16.65  ? 467 ILE B CD1 1 
ATOM   7236  N  N   . LYS B  1 493 ? 79.290  10.015  5.220    1.00 19.25  ? 468 LYS B N   1 
ATOM   7237  C  CA  . LYS B  1 493 ? 79.799  8.755   4.696    1.00 19.11  ? 468 LYS B CA  1 
ATOM   7238  C  C   . LYS B  1 493 ? 81.298  8.624   5.029    1.00 18.39  ? 468 LYS B C   1 
ATOM   7239  O  O   . LYS B  1 493 ? 81.774  7.536   5.388    1.00 17.87  ? 468 LYS B O   1 
ATOM   7240  C  CB  . LYS B  1 493 ? 79.581  8.731   3.183    1.00 21.66  ? 468 LYS B CB  1 
ATOM   7241  C  CG  . LYS B  1 493 ? 79.507  7.346   2.594    1.00 25.86  ? 468 LYS B CG  1 
ATOM   7242  C  CD  . LYS B  1 493 ? 78.153  6.735   2.900    1.00 28.20  ? 468 LYS B CD  1 
ATOM   7243  C  CE  . LYS B  1 493 ? 78.216  5.227   2.761    1.00 30.24  ? 468 LYS B CE  1 
ATOM   7244  N  NZ  . LYS B  1 493 ? 77.091  4.585   3.494    1.00 31.82  ? 468 LYS B NZ  1 
ATOM   7245  N  N   . PHE B  1 494 ? 82.031  9.739   4.943    1.00 17.00  ? 469 PHE B N   1 
ATOM   7246  C  CA  . PHE B  1 494 ? 83.485  9.703   5.146    1.00 16.71  ? 469 PHE B CA  1 
ATOM   7247  C  C   . PHE B  1 494 ? 83.839  9.442   6.609    1.00 17.41  ? 469 PHE B C   1 
ATOM   7248  O  O   . PHE B  1 494 ? 84.792  8.733   6.885    1.00 17.41  ? 469 PHE B O   1 
ATOM   7249  C  CB  . PHE B  1 494 ? 84.163  10.982  4.654    1.00 16.34  ? 469 PHE B CB  1 
ATOM   7250  C  CG  . PHE B  1 494 ? 85.664  10.901  4.664    1.00 16.47  ? 469 PHE B CG  1 
ATOM   7251  C  CD1 . PHE B  1 494 ? 86.345  10.164  3.688    1.00 15.80  ? 469 PHE B CD1 1 
ATOM   7252  C  CD2 . PHE B  1 494 ? 86.410  11.546  5.663    1.00 16.74  ? 469 PHE B CD2 1 
ATOM   7253  C  CE1 . PHE B  1 494 ? 87.726  10.066  3.721    1.00 15.72  ? 469 PHE B CE1 1 
ATOM   7254  C  CE2 . PHE B  1 494 ? 87.805  11.461  5.679    1.00 16.38  ? 469 PHE B CE2 1 
ATOM   7255  C  CZ  . PHE B  1 494 ? 88.455  10.719  4.715    1.00 16.16  ? 469 PHE B CZ  1 
ATOM   7256  N  N   . TRP B  1 495 ? 83.028  9.978   7.522    1.00 17.52  ? 470 TRP B N   1 
ATOM   7257  C  CA  . TRP B  1 495 ? 83.280  9.878   8.959    1.00 18.75  ? 470 TRP B CA  1 
ATOM   7258  C  C   . TRP B  1 495 ? 82.594  8.703   9.648    1.00 18.63  ? 470 TRP B C   1 
ATOM   7259  O  O   . TRP B  1 495 ? 82.591  8.621   10.868   1.00 19.24  ? 470 TRP B O   1 
ATOM   7260  C  CB  . TRP B  1 495 ? 82.959  11.219  9.653    1.00 18.39  ? 470 TRP B CB  1 
ATOM   7261  C  CG  . TRP B  1 495 ? 83.891  12.282  9.165    1.00 18.04  ? 470 TRP B CG  1 
ATOM   7262  C  CD1 . TRP B  1 495 ? 83.577  13.356  8.391    1.00 17.58  ? 470 TRP B CD1 1 
ATOM   7263  C  CD2 . TRP B  1 495 ? 85.315  12.324  9.353    1.00 19.11  ? 470 TRP B CD2 1 
ATOM   7264  N  NE1 . TRP B  1 495 ? 84.706  14.086  8.106    1.00 18.15  ? 470 TRP B NE1 1 
ATOM   7265  C  CE2 . TRP B  1 495 ? 85.789  13.476  8.681    1.00 18.86  ? 470 TRP B CE2 1 
ATOM   7266  C  CE3 . TRP B  1 495 ? 86.231  11.512  10.046   1.00 21.28  ? 470 TRP B CE3 1 
ATOM   7267  C  CZ2 . TRP B  1 495 ? 87.137  13.841  8.671    1.00 19.73  ? 470 TRP B CZ2 1 
ATOM   7268  C  CZ3 . TRP B  1 495 ? 87.596  11.869  10.023   1.00 22.19  ? 470 TRP B CZ3 1 
ATOM   7269  C  CH2 . TRP B  1 495 ? 88.027  13.032  9.346    1.00 21.13  ? 470 TRP B CH2 1 
ATOM   7270  N  N   . THR B  1 496 ? 82.037  7.782   8.868    1.00 17.98  ? 471 THR B N   1 
ATOM   7271  C  CA  . THR B  1 496 ? 81.420  6.592   9.439    1.00 18.70  ? 471 THR B CA  1 
ATOM   7272  C  C   . THR B  1 496 ? 81.860  5.338   8.694    1.00 20.08  ? 471 THR B C   1 
ATOM   7273  O  O   . THR B  1 496 ? 82.277  5.402   7.537    1.00 21.90  ? 471 THR B O   1 
ATOM   7274  C  CB  . THR B  1 496 ? 79.867  6.667   9.440    1.00 18.55  ? 471 THR B CB  1 
ATOM   7275  O  OG1 . THR B  1 496 ? 79.382  6.841   8.105    1.00 18.24  ? 471 THR B OG1 1 
ATOM   7276  C  CG2 . THR B  1 496 ? 79.350  7.812   10.313   1.00 18.52  ? 471 THR B CG2 1 
ATOM   7277  N  N   . ARG B  1 497 ? 81.794  4.200   9.365    1.00 20.30  ? 472 ARG B N   1 
ATOM   7278  C  CA  . ARG B  1 497 ? 81.945  2.914   8.685    1.00 21.18  ? 472 ARG B CA  1 
ATOM   7279  C  C   . ARG B  1 497 ? 80.646  2.111   8.793    1.00 21.00  ? 472 ARG B C   1 
ATOM   7280  O  O   . ARG B  1 497 ? 79.910  2.222   9.769    1.00 23.03  ? 472 ARG B O   1 
ATOM   7281  C  CB  . ARG B  1 497 ? 83.195  2.126   9.142    1.00 23.19  ? 472 ARG B CB  1 
ATOM   7282  C  CG  . ARG B  1 497 ? 83.469  2.066   10.635   1.00 25.29  ? 472 ARG B CG  1 
ATOM   7283  C  CD  . ARG B  1 497 ? 84.773  1.340   10.974   1.00 26.49  ? 472 ARG B CD  1 
ATOM   7284  N  NE  . ARG B  1 497 ? 85.034  1.414   12.416   1.00 29.42  ? 472 ARG B NE  1 
ATOM   7285  C  CZ  . ARG B  1 497 ? 85.982  0.747   13.079   1.00 31.88  ? 472 ARG B CZ  1 
ATOM   7286  N  NH1 . ARG B  1 497 ? 86.806  -0.087  12.453   1.00 36.24  ? 472 ARG B NH1 1 
ATOM   7287  N  NH2 . ARG B  1 497 ? 86.112  0.913   14.388   1.00 29.52  ? 472 ARG B NH2 1 
ATOM   7288  N  N   . THR B  1 498 ? 80.357  1.337   7.763    1.00 19.68  ? 473 THR B N   1 
ATOM   7289  C  CA  . THR B  1 498 ? 79.132  0.563   7.683    1.00 19.92  ? 473 THR B CA  1 
ATOM   7290  C  C   . THR B  1 498 ? 79.308  -0.851  8.216    1.00 19.11  ? 473 THR B C   1 
ATOM   7291  O  O   . THR B  1 498 ? 80.217  -1.587  7.810    1.00 19.48  ? 473 THR B O   1 
ATOM   7292  C  CB  . THR B  1 498 ? 78.625  0.483   6.235    1.00 20.62  ? 473 THR B CB  1 
ATOM   7293  O  OG1 . THR B  1 498 ? 78.525  1.810   5.710    1.00 21.47  ? 473 THR B OG1 1 
ATOM   7294  C  CG2 . THR B  1 498 ? 77.264  -0.206  6.164    1.00 20.68  ? 473 THR B CG2 1 
ATOM   7295  N  N   . LYS B  1 499 ? 78.421  -1.211  9.133    1.00 18.31  ? 474 LYS B N   1 
ATOM   7296  C  CA  . LYS B  1 499 ? 78.342  -2.550  9.674    1.00 18.09  ? 474 LYS B CA  1 
ATOM   7297  C  C   . LYS B  1 499 ? 77.008  -3.061  9.187    1.00 17.64  ? 474 LYS B C   1 
ATOM   7298  O  O   . LYS B  1 499 ? 76.029  -2.345  9.263    1.00 16.75  ? 474 LYS B O   1 
ATOM   7299  C  CB  . LYS B  1 499 ? 78.385  -2.496  11.201   1.00 18.66  ? 474 LYS B CB  1 
ATOM   7300  C  CG  . LYS B  1 499 ? 77.974  -3.784  11.907   1.00 19.66  ? 474 LYS B CG  1 
ATOM   7301  C  CD  . LYS B  1 499 ? 78.138  -3.659  13.411   1.00 19.31  ? 474 LYS B CD  1 
ATOM   7302  C  CE  . LYS B  1 499 ? 79.600  -3.751  13.824   1.00 18.71  ? 474 LYS B CE  1 
ATOM   7303  N  NZ  . LYS B  1 499 ? 79.779  -3.353  15.244   1.00 19.04  ? 474 LYS B NZ  1 
ATOM   7304  N  N   . THR B  1 500 ? 76.985  -4.270  8.637    1.00 18.23  ? 475 THR B N   1 
ATOM   7305  C  CA  . THR B  1 500 ? 75.740  -4.881  8.203    1.00 17.96  ? 475 THR B CA  1 
ATOM   7306  C  C   . THR B  1 500 ? 75.545  -6.152  9.004    1.00 18.11  ? 475 THR B C   1 
ATOM   7307  O  O   . THR B  1 500 ? 76.431  -7.012  9.048    1.00 18.18  ? 475 THR B O   1 
ATOM   7308  C  CB  . THR B  1 500 ? 75.722  -5.177  6.685    1.00 17.61  ? 475 THR B CB  1 
ATOM   7309  O  OG1 . THR B  1 500 ? 75.999  -3.972  5.952    1.00 17.44  ? 475 THR B OG1 1 
ATOM   7310  C  CG2 . THR B  1 500 ? 74.355  -5.742  6.229    1.00 17.49  ? 475 THR B CG2 1 
ATOM   7311  N  N   . ILE B  1 501 ? 74.379  -6.247  9.638    1.00 17.60  ? 476 ILE B N   1 
ATOM   7312  C  CA  . ILE B  1 501 ? 74.009  -7.399  10.425   1.00 18.62  ? 476 ILE B CA  1 
ATOM   7313  C  C   . ILE B  1 501 ? 72.996  -8.231  9.655    1.00 19.11  ? 476 ILE B C   1 
ATOM   7314  O  O   . ILE B  1 501 ? 72.058  -7.697  9.077    1.00 19.98  ? 476 ILE B O   1 
ATOM   7315  C  CB  . ILE B  1 501 ? 73.429  -6.971  11.789   1.00 19.35  ? 476 ILE B CB  1 
ATOM   7316  C  CG1 . ILE B  1 501 ? 74.466  -6.126  12.539   1.00 20.26  ? 476 ILE B CG1 1 
ATOM   7317  C  CG2 . ILE B  1 501 ? 73.007  -8.194  12.599   1.00 20.18  ? 476 ILE B CG2 1 
ATOM   7318  C  CD1 . ILE B  1 501 ? 73.915  -5.297  13.681   1.00 21.53  ? 476 ILE B CD1 1 
ATOM   7319  N  N   . THR B  1 502 ? 73.205  -9.537  9.630    1.00 19.19  ? 477 THR B N   1 
ATOM   7320  C  CA  . THR B  1 502 ? 72.201  -10.462 9.128    1.00 19.33  ? 477 THR B CA  1 
ATOM   7321  C  C   . THR B  1 502 ? 71.735  -11.321 10.298   1.00 20.54  ? 477 THR B C   1 
ATOM   7322  O  O   . THR B  1 502 ? 72.555  -11.940 10.980   1.00 22.21  ? 477 THR B O   1 
ATOM   7323  C  CB  . THR B  1 502 ? 72.755  -11.337 7.994    1.00 18.90  ? 477 THR B CB  1 
ATOM   7324  O  OG1 . THR B  1 502 ? 73.293  -10.496 6.963    1.00 17.63  ? 477 THR B OG1 1 
ATOM   7325  C  CG2 . THR B  1 502 ? 71.646  -12.236 7.417    1.00 19.29  ? 477 THR B CG2 1 
ATOM   7326  N  N   . SER B  1 503 ? 70.420  -11.382 10.510   1.00 20.13  ? 478 SER B N   1 
ATOM   7327  C  CA  . SER B  1 503 ? 69.875  -11.860 11.768   1.00 21.11  ? 478 SER B CA  1 
ATOM   7328  C  C   . SER B  1 503 ? 68.673  -12.807 11.650   1.00 23.44  ? 478 SER B C   1 
ATOM   7329  O  O   . SER B  1 503 ? 67.714  -12.546 10.900   1.00 25.03  ? 478 SER B O   1 
ATOM   7330  C  CB  . SER B  1 503 ? 69.464  -10.660 12.604   1.00 19.82  ? 478 SER B CB  1 
ATOM   7331  O  OG  . SER B  1 503 ? 69.000  -11.097 13.855   1.00 20.40  ? 478 SER B OG  1 
ATOM   7332  N  N   . ARG B  1 504 ? 68.728  -13.888 12.418   1.00 23.05  ? 479 ARG B N   1 
ATOM   7333  C  CA  . ARG B  1 504 ? 67.624  -14.848 12.525   1.00 24.23  ? 479 ARG B CA  1 
ATOM   7334  C  C   . ARG B  1 504 ? 67.698  -15.550 13.892   1.00 22.68  ? 479 ARG B C   1 
ATOM   7335  O  O   . ARG B  1 504 ? 68.638  -15.331 14.656   1.00 21.72  ? 479 ARG B O   1 
ATOM   7336  C  CB  . ARG B  1 504 ? 67.630  -15.851 11.353   1.00 26.50  ? 479 ARG B CB  1 
ATOM   7337  C  CG  . ARG B  1 504 ? 68.704  -16.924 11.449   1.00 31.03  ? 479 ARG B CG  1 
ATOM   7338  C  CD  . ARG B  1 504 ? 68.835  -17.707 10.159   1.00 36.00  ? 479 ARG B CD  1 
ATOM   7339  N  NE  . ARG B  1 504 ? 67.697  -18.592 9.932    1.00 41.34  ? 479 ARG B NE  1 
ATOM   7340  C  CZ  . ARG B  1 504 ? 67.570  -19.395 8.876    1.00 48.67  ? 479 ARG B CZ  1 
ATOM   7341  N  NH1 . ARG B  1 504 ? 68.515  -19.436 7.935    1.00 48.30  ? 479 ARG B NH1 1 
ATOM   7342  N  NH2 . ARG B  1 504 ? 66.493  -20.159 8.759    1.00 49.90  ? 479 ARG B NH2 1 
ATOM   7343  N  N   . TRP B  1 505 ? 66.695  -16.362 14.206   1.00 23.06  ? 480 TRP B N   1 
ATOM   7344  C  CA  . TRP B  1 505 ? 66.606  -16.978 15.525   1.00 24.12  ? 480 TRP B CA  1 
ATOM   7345  C  C   . TRP B  1 505 ? 66.098  -18.402 15.446   1.00 26.25  ? 480 TRP B C   1 
ATOM   7346  O  O   . TRP B  1 505 ? 65.215  -18.696 14.641   1.00 26.00  ? 480 TRP B O   1 
ATOM   7347  C  CB  . TRP B  1 505 ? 65.677  -16.167 16.427   1.00 23.05  ? 480 TRP B CB  1 
ATOM   7348  C  CG  . TRP B  1 505 ? 66.123  -14.755 16.568   1.00 21.82  ? 480 TRP B CG  1 
ATOM   7349  C  CD1 . TRP B  1 505 ? 65.683  -13.678 15.846   1.00 20.39  ? 480 TRP B CD1 1 
ATOM   7350  C  CD2 . TRP B  1 505 ? 67.130  -14.263 17.456   1.00 21.28  ? 480 TRP B CD2 1 
ATOM   7351  N  NE1 . TRP B  1 505 ? 66.346  -12.544 16.246   1.00 20.09  ? 480 TRP B NE1 1 
ATOM   7352  C  CE2 . TRP B  1 505 ? 67.237  -12.871 17.235   1.00 20.40  ? 480 TRP B CE2 1 
ATOM   7353  C  CE3 . TRP B  1 505 ? 67.943  -14.859 18.432   1.00 21.58  ? 480 TRP B CE3 1 
ATOM   7354  C  CZ2 . TRP B  1 505 ? 68.140  -12.063 17.946   1.00 20.09  ? 480 TRP B CZ2 1 
ATOM   7355  C  CZ3 . TRP B  1 505 ? 68.839  -14.046 19.148   1.00 21.04  ? 480 TRP B CZ3 1 
ATOM   7356  C  CH2 . TRP B  1 505 ? 68.925  -12.674 18.899   1.00 20.56  ? 480 TRP B CH2 1 
ATOM   7357  N  N   . PRO B  1 506 ? 66.646  -19.291 16.289   1.00 28.03  ? 481 PRO B N   1 
ATOM   7358  C  CA  . PRO B  1 506 ? 66.105  -20.634 16.327   1.00 30.59  ? 481 PRO B CA  1 
ATOM   7359  C  C   . PRO B  1 506 ? 64.792  -20.657 17.104   1.00 35.67  ? 481 PRO B C   1 
ATOM   7360  O  O   . PRO B  1 506 ? 64.564  -19.822 17.995   1.00 33.88  ? 481 PRO B O   1 
ATOM   7361  C  CB  . PRO B  1 506 ? 67.178  -21.416 17.085   1.00 29.73  ? 481 PRO B CB  1 
ATOM   7362  C  CG  . PRO B  1 506 ? 67.800  -20.400 17.988   1.00 29.37  ? 481 PRO B CG  1 
ATOM   7363  C  CD  . PRO B  1 506 ? 67.830  -19.147 17.158   1.00 28.84  ? 481 PRO B CD  1 
ATOM   7364  N  N   . SER B  1 507 ? 63.938  -21.608 16.747   1.00 40.52  ? 482 SER B N   1 
ATOM   7365  C  CA  . SER B  1 507 ? 62.757  -21.923 17.520   1.00 45.05  ? 482 SER B CA  1 
ATOM   7366  C  C   . SER B  1 507 ? 63.119  -22.024 19.011   1.00 49.37  ? 482 SER B C   1 
ATOM   7367  O  O   . SER B  1 507 ? 64.154  -22.589 19.368   1.00 50.98  ? 482 SER B O   1 
ATOM   7368  C  CB  . SER B  1 507 ? 62.176  -23.240 17.013   1.00 48.12  ? 482 SER B CB  1 
ATOM   7369  O  OG  . SER B  1 507 ? 60.978  -23.564 17.688   1.00 54.98  ? 482 SER B OG  1 
ATOM   7370  N  N   . GLY B  1 508 ? 62.284  -21.450 19.875   1.00 52.03  ? 483 GLY B N   1 
ATOM   7371  C  CA  . GLY B  1 508 ? 62.531  -21.474 21.318   1.00 50.41  ? 483 GLY B CA  1 
ATOM   7372  C  C   . GLY B  1 508 ? 61.271  -21.449 22.156   1.00 49.60  ? 483 GLY B C   1 
ATOM   7373  O  O   . GLY B  1 508 ? 60.278  -22.095 21.811   1.00 47.99  ? 483 GLY B O   1 
ATOM   7374  N  N   . ILE B  1 509 ? 61.315  -20.676 23.246   1.00 51.93  ? 484 ILE B N   1 
ATOM   7375  C  CA  . ILE B  1 509 ? 60.224  -20.608 24.243   1.00 55.24  ? 484 ILE B CA  1 
ATOM   7376  C  C   . ILE B  1 509 ? 58.858  -20.191 23.688   1.00 54.32  ? 484 ILE B C   1 
ATOM   7377  O  O   . ILE B  1 509 ? 57.829  -20.525 24.273   1.00 58.15  ? 484 ILE B O   1 
ATOM   7378  C  CB  . ILE B  1 509 ? 60.570  -19.715 25.474   1.00 57.67  ? 484 ILE B CB  1 
ATOM   7379  C  CG1 . ILE B  1 509 ? 60.953  -18.292 25.048   1.00 56.83  ? 484 ILE B CG1 1 
ATOM   7380  C  CG2 . ILE B  1 509 ? 61.667  -20.352 26.325   1.00 58.49  ? 484 ILE B CG2 1 
ATOM   7381  C  CD1 . ILE B  1 509 ? 60.574  -17.232 26.055   1.00 56.42  ? 484 ILE B CD1 1 
ATOM   7382  N  N   . LYS B  1 510 ? 58.845  -19.468 22.568   1.00 51.32  ? 485 LYS B N   1 
ATOM   7383  C  CA  . LYS B  1 510 ? 57.587  -19.064 21.945   1.00 48.68  ? 485 LYS B CA  1 
ATOM   7384  C  C   . LYS B  1 510 ? 56.828  -20.280 21.402   1.00 54.05  ? 485 LYS B C   1 
ATOM   7385  O  O   . LYS B  1 510 ? 55.618  -20.208 21.173   1.00 54.36  ? 485 LYS B O   1 
ATOM   7386  C  CB  . LYS B  1 510 ? 57.818  -18.016 20.848   1.00 44.15  ? 485 LYS B CB  1 
ATOM   7387  C  CG  . LYS B  1 510 ? 58.028  -18.575 19.449   1.00 42.40  ? 485 LYS B CG  1 
ATOM   7388  C  CD  . LYS B  1 510 ? 58.180  -17.457 18.436   1.00 40.09  ? 485 LYS B CD  1 
ATOM   7389  C  CE  . LYS B  1 510 ? 57.922  -17.947 17.023   1.00 38.93  ? 485 LYS B CE  1 
ATOM   7390  N  NZ  . LYS B  1 510 ? 58.931  -18.924 16.546   1.00 39.36  ? 485 LYS B NZ  1 
ATOM   7391  N  N   . ASP B  1 511 ? 57.546  -21.391 21.218   1.00 58.32  ? 486 ASP B N   1 
ATOM   7392  C  CA  . ASP B  1 511 ? 56.982  -22.609 20.630   1.00 60.62  ? 486 ASP B CA  1 
ATOM   7393  C  C   . ASP B  1 511 ? 56.700  -23.669 21.682   1.00 60.88  ? 486 ASP B C   1 
ATOM   7394  O  O   . ASP B  1 511 ? 55.548  -24.001 21.931   1.00 61.93  ? 486 ASP B O   1 
ATOM   7395  C  CB  . ASP B  1 511 ? 57.922  -23.166 19.556   1.00 60.13  ? 486 ASP B CB  1 
ATOM   7396  C  CG  . ASP B  1 511 ? 58.055  -22.237 18.356   1.00 60.67  ? 486 ASP B CG  1 
ATOM   7397  O  OD1 . ASP B  1 511 ? 57.019  -21.882 17.752   1.00 61.57  ? 486 ASP B OD1 1 
ATOM   7398  O  OD2 . ASP B  1 511 ? 59.195  -21.861 18.008   1.00 58.20  ? 486 ASP B OD2 1 
ATOM   7399  N  N   . GLN C  1 21  ? 26.058  -7.146  -35.565  1.00 88.20  ? -4  GLN C N   1 
ATOM   7400  C  CA  . GLN C  1 21  ? 27.131  -6.924  -34.637  1.00 84.52  ? -4  GLN C CA  1 
ATOM   7401  C  C   . GLN C  1 21  ? 28.208  -8.020  -34.832  1.00 91.92  ? -4  GLN C C   1 
ATOM   7402  O  O   . GLN C  1 21  ? 29.318  -7.877  -34.352  1.00 92.11  ? -4  GLN C O   1 
ATOM   7403  C  CB  . GLN C  1 21  ? 26.535  -6.818  -33.224  1.00 77.78  ? -4  GLN C CB  1 
ATOM   7404  C  CG  . GLN C  1 21  ? 25.226  -6.017  -33.198  1.00 73.92  ? -4  GLN C CG  1 
ATOM   7405  C  CD  . GLN C  1 21  ? 24.550  -5.846  -31.841  1.00 72.21  ? -4  GLN C CD  1 
ATOM   7406  O  OE1 . GLN C  1 21  ? 24.864  -6.511  -30.869  1.00 70.18  ? -4  GLN C OE1 1 
ATOM   7407  N  NE2 . GLN C  1 21  ? 23.608  -4.930  -31.779  1.00 71.59  ? -4  GLN C NE2 1 
ATOM   7408  N  N   . SER C  1 22  ? 27.847  -9.098  -35.536  1.00 98.58  ? -3  SER C N   1 
ATOM   7409  C  CA  . SER C  1 22  ? 28.774  -10.162 -35.969  1.00 101.90 ? -3  SER C CA  1 
ATOM   7410  C  C   . SER C  1 22  ? 28.928  -11.352 -35.009  1.00 97.16  ? -3  SER C C   1 
ATOM   7411  O  O   . SER C  1 22  ? 27.937  -11.970 -34.634  1.00 89.53  ? -3  SER C O   1 
ATOM   7412  C  CB  . SER C  1 22  ? 30.139  -9.582  -36.356  1.00 108.73 ? -3  SER C CB  1 
ATOM   7413  O  OG  . SER C  1 22  ? 30.697  -10.284 -37.451  1.00 113.98 ? -3  SER C OG  1 
HETATM 7414  N  N   . MSE C  1 23  ? 30.166  -11.691 -34.644  1.00 102.47 ? -2  MSE C N   1 
HETATM 7415  C  CA  . MSE C  1 23  ? 30.420  -12.616 -33.521  1.00 96.97  ? -2  MSE C CA  1 
HETATM 7416  C  C   . MSE C  1 23  ? 31.078  -11.946 -32.325  1.00 77.56  ? -2  MSE C C   1 
HETATM 7417  O  O   . MSE C  1 23  ? 32.314  -11.800 -32.300  1.00 74.93  ? -2  MSE C O   1 
HETATM 7418  C  CB  . MSE C  1 23  ? 31.289  -13.815 -33.896  1.00 108.53 ? -2  MSE C CB  1 
HETATM 7419  C  CG  . MSE C  1 23  ? 31.424  -14.757 -32.688  1.00 128.52 ? -2  MSE C CG  1 
HETATM 7420  SE SE  . MSE C  1 23  ? 32.455  -16.433 -32.887  1.00 155.40 ? -2  MSE C SE  1 
HETATM 7421  C  CE  . MSE C  1 23  ? 31.305  -17.179 -34.287  1.00 146.78 ? -2  MSE C CE  1 
HETATM 7422  N  N   . MSE C  1 24  ? 30.298  -11.666 -31.293  1.00 65.20  ? -1  MSE C N   1 
HETATM 7423  C  CA  . MSE C  1 24  ? 30.772  -11.018 -30.115  1.00 56.94  ? -1  MSE C CA  1 
HETATM 7424  C  C   . MSE C  1 24  ? 31.496  -11.886 -29.167  1.00 48.25  ? -1  MSE C C   1 
HETATM 7425  O  O   . MSE C  1 24  ? 31.260  -13.058 -29.093  1.00 50.00  ? -1  MSE C O   1 
HETATM 7426  C  CB  . MSE C  1 24  ? 29.642  -10.526 -29.255  1.00 60.74  ? -1  MSE C CB  1 
HETATM 7427  C  CG  . MSE C  1 24  ? 28.340  -10.328 -29.950  1.00 68.05  ? -1  MSE C CG  1 
HETATM 7428  SE SE  . MSE C  1 24  ? 28.360  -8.518  -30.604  1.00 72.57  ? -1  MSE C SE  1 
HETATM 7429  C  CE  . MSE C  1 24  ? 26.651  -8.239  -29.807  1.00 68.76  ? -1  MSE C CE  1 
ATOM   7430  N  N   . TYR C  1 25  ? 32.363  -11.272 -28.396  1.00 40.91  ? 0   TYR C N   1 
ATOM   7431  C  CA  . TYR C  1 25  ? 33.076  -11.906 -27.288  1.00 35.78  ? 0   TYR C CA  1 
ATOM   7432  C  C   . TYR C  1 25  ? 32.500  -11.408 -25.960  1.00 35.07  ? 0   TYR C C   1 
ATOM   7433  O  O   . TYR C  1 25  ? 31.849  -10.366 -25.917  1.00 34.34  ? 0   TYR C O   1 
ATOM   7434  C  CB  . TYR C  1 25  ? 34.589  -11.682 -27.385  1.00 31.79  ? 0   TYR C CB  1 
ATOM   7435  C  CG  . TYR C  1 25  ? 35.053  -10.230 -27.438  1.00 28.64  ? 0   TYR C CG  1 
ATOM   7436  C  CD1 . TYR C  1 25  ? 35.315  -9.508  -26.262  1.00 26.88  ? 0   TYR C CD1 1 
ATOM   7437  C  CD2 . TYR C  1 25  ? 35.265  -9.591  -28.658  1.00 27.61  ? 0   TYR C CD2 1 
ATOM   7438  C  CE1 . TYR C  1 25  ? 35.752  -8.184  -26.302  1.00 25.67  ? 0   TYR C CE1 1 
ATOM   7439  C  CE2 . TYR C  1 25  ? 35.695  -8.271  -28.714  1.00 26.92  ? 0   TYR C CE2 1 
ATOM   7440  C  CZ  . TYR C  1 25  ? 35.944  -7.570  -27.533  1.00 26.48  ? 0   TYR C CZ  1 
ATOM   7441  O  OH  . TYR C  1 25  ? 36.382  -6.257  -27.599  1.00 26.48  ? 0   TYR C OH  1 
ATOM   7442  N  N   . GLU C  1 26  ? 32.702  -12.168 -24.886  1.00 35.43  ? 1   GLU C N   1 
ATOM   7443  C  CA  . GLU C  1 26  ? 32.125  -11.824 -23.589  1.00 36.00  ? 1   GLU C CA  1 
ATOM   7444  C  C   . GLU C  1 26  ? 33.193  -11.870 -22.521  1.00 34.20  ? 1   GLU C C   1 
ATOM   7445  O  O   . GLU C  1 26  ? 33.801  -12.913 -22.292  1.00 36.36  ? 1   GLU C O   1 
ATOM   7446  C  CB  . GLU C  1 26  ? 31.010  -12.799 -23.216  1.00 39.12  ? 1   GLU C CB  1 
ATOM   7447  C  CG  . GLU C  1 26  ? 29.863  -12.860 -24.204  1.00 42.14  ? 1   GLU C CG  1 
ATOM   7448  C  CD  . GLU C  1 26  ? 28.934  -14.019 -23.915  1.00 46.26  ? 1   GLU C CD  1 
ATOM   7449  O  OE1 . GLU C  1 26  ? 28.539  -14.189 -22.739  1.00 51.79  ? 1   GLU C OE1 1 
ATOM   7450  O  OE2 . GLU C  1 26  ? 28.604  -14.760 -24.857  1.00 45.02  ? 1   GLU C OE2 1 
ATOM   7451  N  N   . LEU C  1 27  ? 33.430  -10.741 -21.869  1.00 31.09  ? 2   LEU C N   1 
ATOM   7452  C  CA  . LEU C  1 27  ? 34.435  -10.692 -20.823  1.00 28.41  ? 2   LEU C CA  1 
ATOM   7453  C  C   . LEU C  1 27  ? 33.732  -10.791 -19.497  1.00 27.46  ? 2   LEU C C   1 
ATOM   7454  O  O   . LEU C  1 27  ? 32.700  -10.162 -19.298  1.00 27.92  ? 2   LEU C O   1 
ATOM   7455  C  CB  . LEU C  1 27  ? 35.245  -9.393  -20.885  1.00 27.46  ? 2   LEU C CB  1 
ATOM   7456  C  CG  . LEU C  1 27  ? 36.001  -9.037  -22.172  1.00 28.38  ? 2   LEU C CG  1 
ATOM   7457  C  CD1 . LEU C  1 27  ? 36.686  -7.693  -22.019  1.00 27.30  ? 2   LEU C CD1 1 
ATOM   7458  C  CD2 . LEU C  1 27  ? 37.007  -10.109 -22.582  1.00 28.89  ? 2   LEU C CD2 1 
ATOM   7459  N  N   . GLY C  1 28  ? 34.292  -11.584 -18.596  1.00 27.03  ? 3   GLY C N   1 
ATOM   7460  C  CA  . GLY C  1 28  ? 33.854  -11.586 -17.209  1.00 27.62  ? 3   GLY C CA  1 
ATOM   7461  C  C   . GLY C  1 28  ? 34.890  -10.916 -16.318  1.00 26.81  ? 3   GLY C C   1 
ATOM   7462  O  O   . GLY C  1 28  ? 35.324  -9.790  -16.586  1.00 25.53  ? 3   GLY C O   1 
ATOM   7463  N  N   . HIS C  1 29  ? 35.264  -11.613 -15.246  1.00 26.55  ? 4   HIS C N   1 
ATOM   7464  C  CA  . HIS C  1 29  ? 36.252  -11.134 -14.287  1.00 26.08  ? 4   HIS C CA  1 
ATOM   7465  C  C   . HIS C  1 29  ? 37.443  -12.076 -14.310  1.00 26.89  ? 4   HIS C C   1 
ATOM   7466  O  O   . HIS C  1 29  ? 37.399  -13.125 -14.958  1.00 27.52  ? 4   HIS C O   1 
ATOM   7467  C  CB  . HIS C  1 29  ? 35.663  -11.085 -12.877  1.00 25.37  ? 4   HIS C CB  1 
ATOM   7468  C  CG  . HIS C  1 29  ? 34.312  -10.457 -12.819  1.00 25.18  ? 4   HIS C CG  1 
ATOM   7469  N  ND1 . HIS C  1 29  ? 34.104  -9.120  -13.073  1.00 24.32  ? 4   HIS C ND1 1 
ATOM   7470  C  CD2 . HIS C  1 29  ? 33.091  -10.988 -12.561  1.00 26.22  ? 4   HIS C CD2 1 
ATOM   7471  C  CE1 . HIS C  1 29  ? 32.815  -8.849  -12.963  1.00 25.26  ? 4   HIS C CE1 1 
ATOM   7472  N  NE2 . HIS C  1 29  ? 32.178  -9.965  -12.651  1.00 26.19  ? 4   HIS C NE2 1 
ATOM   7473  N  N   . PHE C  1 30  ? 38.512  -11.674 -13.635  1.00 26.24  ? 5   PHE C N   1 
ATOM   7474  C  CA  . PHE C  1 30  ? 39.668  -12.524 -13.461  1.00 26.27  ? 5   PHE C CA  1 
ATOM   7475  C  C   . PHE C  1 30  ? 39.884  -12.634 -11.972  1.00 26.15  ? 5   PHE C C   1 
ATOM   7476  O  O   . PHE C  1 30  ? 40.231  -11.653 -11.309  1.00 23.92  ? 5   PHE C O   1 
ATOM   7477  C  CB  . PHE C  1 30  ? 40.904  -11.928 -14.118  1.00 25.76  ? 5   PHE C CB  1 
ATOM   7478  C  CG  . PHE C  1 30  ? 42.040  -12.896 -14.243  1.00 26.36  ? 5   PHE C CG  1 
ATOM   7479  C  CD1 . PHE C  1 30  ? 42.974  -13.029 -13.221  1.00 25.68  ? 5   PHE C CD1 1 
ATOM   7480  C  CD2 . PHE C  1 30  ? 42.178  -13.679 -15.391  1.00 27.43  ? 5   PHE C CD2 1 
ATOM   7481  C  CE1 . PHE C  1 30  ? 44.025  -13.921 -13.333  1.00 25.75  ? 5   PHE C CE1 1 
ATOM   7482  C  CE2 . PHE C  1 30  ? 43.225  -14.582 -15.508  1.00 27.51  ? 5   PHE C CE2 1 
ATOM   7483  C  CZ  . PHE C  1 30  ? 44.150  -14.701 -14.474  1.00 26.73  ? 5   PHE C CZ  1 
ATOM   7484  N  N   . ILE C  1 31  ? 39.642  -13.827 -11.449  1.00 27.71  ? 6   ILE C N   1 
ATOM   7485  C  CA  . ILE C  1 31  ? 39.757  -14.066 -10.017  1.00 28.97  ? 6   ILE C CA  1 
ATOM   7486  C  C   . ILE C  1 31  ? 40.450  -15.392 -9.794   1.00 30.61  ? 6   ILE C C   1 
ATOM   7487  O  O   . ILE C  1 31  ? 40.060  -16.413 -10.379  1.00 30.63  ? 6   ILE C O   1 
ATOM   7488  C  CB  . ILE C  1 31  ? 38.387  -14.084 -9.321   1.00 29.72  ? 6   ILE C CB  1 
ATOM   7489  C  CG1 . ILE C  1 31  ? 37.700  -12.722 -9.467   1.00 29.93  ? 6   ILE C CG1 1 
ATOM   7490  C  CG2 . ILE C  1 31  ? 38.554  -14.416 -7.845   1.00 30.23  ? 6   ILE C CG2 1 
ATOM   7491  C  CD1 . ILE C  1 31  ? 36.205  -12.743 -9.234   1.00 30.54  ? 6   ILE C CD1 1 
ATOM   7492  N  N   . ASP C  1 32  ? 41.447  -15.392 -8.931   1.00 30.57  ? 7   ASP C N   1 
ATOM   7493  C  CA  . ASP C  1 32  ? 42.175  -16.560 -8.545   1.00 31.79  ? 7   ASP C CA  1 
ATOM   7494  C  C   . ASP C  1 32  ? 42.798  -17.292 -9.692   1.00 31.63  ? 7   ASP C C   1 
ATOM   7495  O  O   . ASP C  1 32  ? 42.748  -18.488 -9.735   1.00 30.99  ? 7   ASP C O   1 
ATOM   7496  C  CB  . ASP C  1 32  ? 41.324  -17.493 -7.664   1.00 35.46  ? 7   ASP C CB  1 
ATOM   7497  C  CG  . ASP C  1 32  ? 42.033  -17.890 -6.400   1.00 39.75  ? 7   ASP C CG  1 
ATOM   7498  O  OD1 . ASP C  1 32  ? 42.349  -17.055 -5.559   1.00 38.52  ? 7   ASP C OD1 1 
ATOM   7499  O  OD2 . ASP C  1 32  ? 42.338  -19.061 -6.255   1.00 45.58  ? 7   ASP C OD2 1 
ATOM   7500  N  N   . GLY C  1 33  ? 43.389  -16.538 -10.617  1.00 30.41  ? 8   GLY C N   1 
ATOM   7501  C  CA  . GLY C  1 33  ? 44.177  -17.116 -11.694  1.00 30.30  ? 8   GLY C CA  1 
ATOM   7502  C  C   . GLY C  1 33  ? 43.357  -17.606 -12.867  1.00 31.53  ? 8   GLY C C   1 
ATOM   7503  O  O   . GLY C  1 33  ? 43.885  -18.254 -13.751  1.00 31.78  ? 8   GLY C O   1 
ATOM   7504  N  N   . LYS C  1 34  ? 42.068  -17.279 -12.883  1.00 33.04  ? 9   LYS C N   1 
ATOM   7505  C  CA  . LYS C  1 34  ? 41.178  -17.725 -13.945  1.00 35.71  ? 9   LYS C CA  1 
ATOM   7506  C  C   . LYS C  1 34  ? 40.184  -16.665 -14.393  1.00 34.12  ? 9   LYS C C   1 
ATOM   7507  O  O   . LYS C  1 34  ? 39.734  -15.844 -13.597  1.00 32.84  ? 9   LYS C O   1 
ATOM   7508  C  CB  . LYS C  1 34  ? 40.412  -18.965 -13.487  1.00 40.41  ? 9   LYS C CB  1 
ATOM   7509  C  CG  . LYS C  1 34  ? 41.133  -20.262 -13.794  1.00 47.46  ? 9   LYS C CG  1 
ATOM   7510  C  CD  . LYS C  1 34  ? 40.686  -21.367 -12.858  1.00 55.84  ? 9   LYS C CD  1 
ATOM   7511  C  CE  . LYS C  1 34  ? 41.513  -22.626 -13.069  1.00 63.42  ? 9   LYS C CE  1 
ATOM   7512  N  NZ  . LYS C  1 34  ? 41.129  -23.689 -12.097  1.00 66.00  ? 9   LYS C NZ  1 
ATOM   7513  N  N   . ARG C  1 35  ? 39.833  -16.704 -15.674  1.00 34.11  ? 10  ARG C N   1 
ATOM   7514  C  CA  . ARG C  1 35  ? 38.673  -15.972 -16.170  1.00 34.29  ? 10  ARG C CA  1 
ATOM   7515  C  C   . ARG C  1 35  ? 37.409  -16.613 -15.595  1.00 33.96  ? 10  ARG C C   1 
ATOM   7516  O  O   . ARG C  1 35  ? 37.257  -17.827 -15.618  1.00 34.95  ? 10  ARG C O   1 
ATOM   7517  C  CB  . ARG C  1 35  ? 38.635  -15.984 -17.705  1.00 35.77  ? 10  ARG C CB  1 
ATOM   7518  C  CG  . ARG C  1 35  ? 39.712  -15.145 -18.381  1.00 34.94  ? 10  ARG C CG  1 
ATOM   7519  C  CD  . ARG C  1 35  ? 39.780  -15.451 -19.872  1.00 35.57  ? 10  ARG C CD  1 
ATOM   7520  N  NE  . ARG C  1 35  ? 40.990  -14.927 -20.505  1.00 34.59  ? 10  ARG C NE  1 
ATOM   7521  C  CZ  . ARG C  1 35  ? 41.068  -13.776 -21.168  1.00 34.39  ? 10  ARG C CZ  1 
ATOM   7522  N  NH1 . ARG C  1 35  ? 40.004  -12.996 -21.299  1.00 33.55  ? 10  ARG C NH1 1 
ATOM   7523  N  NH2 . ARG C  1 35  ? 42.225  -13.395 -21.697  1.00 34.40  ? 10  ARG C NH2 1 
ATOM   7524  N  N   . VAL C  1 36  ? 36.518  -15.801 -15.042  1.00 33.43  ? 11  VAL C N   1 
ATOM   7525  C  CA  . VAL C  1 36  ? 35.265  -16.307 -14.478  1.00 33.96  ? 11  VAL C CA  1 
ATOM   7526  C  C   . VAL C  1 36  ? 34.143  -15.408 -14.956  1.00 34.49  ? 11  VAL C C   1 
ATOM   7527  O  O   . VAL C  1 36  ? 34.384  -14.241 -15.294  1.00 33.18  ? 11  VAL C O   1 
ATOM   7528  C  CB  . VAL C  1 36  ? 35.277  -16.330 -12.928  1.00 33.17  ? 11  VAL C CB  1 
ATOM   7529  C  CG1 . VAL C  1 36  ? 36.229  -17.400 -12.407  1.00 32.68  ? 11  VAL C CG1 1 
ATOM   7530  C  CG2 . VAL C  1 36  ? 35.641  -14.960 -12.365  1.00 31.53  ? 11  VAL C CG2 1 
ATOM   7531  N  N   . ALA C  1 37  ? 32.928  -15.951 -14.993  1.00 35.10  ? 12  ALA C N   1 
ATOM   7532  C  CA  . ALA C  1 37  ? 31.752  -15.204 -15.433  1.00 35.13  ? 12  ALA C CA  1 
ATOM   7533  C  C   . ALA C  1 37  ? 31.195  -14.368 -14.292  1.00 35.96  ? 12  ALA C C   1 
ATOM   7534  O  O   . ALA C  1 37  ? 31.413  -14.684 -13.121  1.00 35.77  ? 12  ALA C O   1 
ATOM   7535  C  CB  . ALA C  1 37  ? 30.690  -16.159 -15.960  1.00 35.94  ? 12  ALA C CB  1 
ATOM   7536  N  N   . GLY C  1 38  ? 30.480  -13.297 -14.628  1.00 39.25  ? 13  GLY C N   1 
ATOM   7537  C  CA  . GLY C  1 38  ? 29.741  -12.520 -13.614  1.00 43.24  ? 13  GLY C CA  1 
ATOM   7538  C  C   . GLY C  1 38  ? 28.492  -13.262 -13.150  1.00 46.16  ? 13  GLY C C   1 
ATOM   7539  O  O   . GLY C  1 38  ? 27.829  -13.918 -13.954  1.00 47.43  ? 13  GLY C O   1 
ATOM   7540  N  N   . THR C  1 39  ? 28.173  -13.170 -11.857  1.00 46.07  ? 14  THR C N   1 
ATOM   7541  C  CA  . THR C  1 39  ? 26.960  -13.800 -11.318  1.00 47.17  ? 14  THR C CA  1 
ATOM   7542  C  C   . THR C  1 39  ? 25.768  -12.844 -11.290  1.00 48.02  ? 14  THR C C   1 
ATOM   7543  O  O   . THR C  1 39  ? 24.735  -13.158 -10.699  1.00 48.58  ? 14  THR C O   1 
ATOM   7544  C  CB  . THR C  1 39  ? 27.159  -14.383 -9.897   1.00 46.39  ? 14  THR C CB  1 
ATOM   7545  O  OG1 . THR C  1 39  ? 27.669  -13.366 -9.016   1.00 44.73  ? 14  THR C OG1 1 
ATOM   7546  C  CG2 . THR C  1 39  ? 28.091  -15.602 -9.921   1.00 46.08  ? 14  THR C CG2 1 
ATOM   7547  N  N   . SER C  1 40  ? 25.906  -11.685 -11.926  1.00 47.72  ? 15  SER C N   1 
ATOM   7548  C  CA  . SER C  1 40  ? 24.834  -10.686 -11.905  1.00 49.52  ? 15  SER C CA  1 
ATOM   7549  C  C   . SER C  1 40  ? 23.964  -10.729 -13.165  1.00 51.25  ? 15  SER C C   1 
ATOM   7550  O  O   . SER C  1 40  ? 22.849  -10.208 -13.163  1.00 50.55  ? 15  SER C O   1 
ATOM   7551  C  CB  . SER C  1 40  ? 25.398  -9.276  -11.713  1.00 46.91  ? 15  SER C CB  1 
ATOM   7552  O  OG  . SER C  1 40  ? 25.870  -8.757  -12.944  1.00 45.52  ? 15  SER C OG  1 
ATOM   7553  N  N   . GLY C  1 41  ? 24.478  -11.329 -14.239  1.00 52.18  ? 16  GLY C N   1 
ATOM   7554  C  CA  . GLY C  1 41  ? 23.770  -11.345 -15.524  1.00 54.27  ? 16  GLY C CA  1 
ATOM   7555  C  C   . GLY C  1 41  ? 23.423  -9.958  -16.053  1.00 54.16  ? 16  GLY C C   1 
ATOM   7556  O  O   . GLY C  1 41  ? 22.493  -9.795  -16.847  1.00 56.76  ? 16  GLY C O   1 
ATOM   7557  N  N   . ARG C  1 42  ? 24.155  -8.956  -15.571  1.00 49.77  ? 17  ARG C N   1 
ATOM   7558  C  CA  . ARG C  1 42  ? 24.118  -7.613  -16.122  1.00 44.08  ? 17  ARG C CA  1 
ATOM   7559  C  C   . ARG C  1 42  ? 25.423  -7.439  -16.887  1.00 39.89  ? 17  ARG C C   1 
ATOM   7560  O  O   . ARG C  1 42  ? 26.489  -7.829  -16.409  1.00 38.24  ? 17  ARG C O   1 
ATOM   7561  C  CB  . ARG C  1 42  ? 24.016  -6.564  -15.014  1.00 42.90  ? 17  ARG C CB  1 
ATOM   7562  C  CG  . ARG C  1 42  ? 22.647  -6.434  -14.367  1.00 44.52  ? 17  ARG C CG  1 
ATOM   7563  C  CD  . ARG C  1 42  ? 22.677  -5.453  -13.195  1.00 46.57  ? 17  ARG C CD  1 
ATOM   7564  N  NE  . ARG C  1 42  ? 23.082  -4.096  -13.588  1.00 48.01  ? 17  ARG C NE  1 
ATOM   7565  C  CZ  . ARG C  1 42  ? 24.155  -3.451  -13.129  1.00 49.30  ? 17  ARG C CZ  1 
ATOM   7566  N  NH1 . ARG C  1 42  ? 24.961  -4.018  -12.237  1.00 48.76  ? 17  ARG C NH1 1 
ATOM   7567  N  NH2 . ARG C  1 42  ? 24.426  -2.226  -13.562  1.00 50.46  ? 17  ARG C NH2 1 
ATOM   7568  N  N   . VAL C  1 43  ? 25.327  -6.889  -18.090  1.00 38.06  ? 18  VAL C N   1 
ATOM   7569  C  CA  . VAL C  1 43  ? 26.501  -6.626  -18.905  1.00 36.34  ? 18  VAL C CA  1 
ATOM   7570  C  C   . VAL C  1 43  ? 26.499  -5.192  -19.418  1.00 35.64  ? 18  VAL C C   1 
ATOM   7571  O  O   . VAL C  1 43  ? 25.494  -4.478  -19.350  1.00 35.59  ? 18  VAL C O   1 
ATOM   7572  C  CB  . VAL C  1 43  ? 26.660  -7.611  -20.094  1.00 36.72  ? 18  VAL C CB  1 
ATOM   7573  C  CG1 . VAL C  1 43  ? 26.975  -9.015  -19.594  1.00 36.62  ? 18  VAL C CG1 1 
ATOM   7574  C  CG2 . VAL C  1 43  ? 25.430  -7.602  -21.003  1.00 37.72  ? 18  VAL C CG2 1 
ATOM   7575  N  N   . SER C  1 44  ? 27.656  -4.783  -19.915  1.00 34.10  ? 19  SER C N   1 
ATOM   7576  C  CA  . SER C  1 44  ? 27.805  -3.512  -20.571  1.00 32.68  ? 19  SER C CA  1 
ATOM   7577  C  C   . SER C  1 44  ? 28.379  -3.792  -21.953  1.00 31.55  ? 19  SER C C   1 
ATOM   7578  O  O   . SER C  1 44  ? 29.223  -4.681  -22.115  1.00 31.48  ? 19  SER C O   1 
ATOM   7579  C  CB  . SER C  1 44  ? 28.753  -2.640  -19.760  1.00 32.12  ? 19  SER C CB  1 
ATOM   7580  O  OG  . SER C  1 44  ? 28.490  -1.291  -20.014  1.00 33.25  ? 19  SER C OG  1 
ATOM   7581  N  N   . ASN C  1 45  ? 27.923  -3.040  -22.946  1.00 30.42  ? 20  ASN C N   1 
ATOM   7582  C  CA  . ASN C  1 45  ? 28.378  -3.249  -24.311  1.00 29.57  ? 20  ASN C CA  1 
ATOM   7583  C  C   . ASN C  1 45  ? 29.777  -2.700  -24.571  1.00 28.38  ? 20  ASN C C   1 
ATOM   7584  O  O   . ASN C  1 45  ? 30.090  -1.587  -24.158  1.00 28.06  ? 20  ASN C O   1 
ATOM   7585  C  CB  . ASN C  1 45  ? 27.382  -2.644  -25.291  1.00 30.00  ? 20  ASN C CB  1 
ATOM   7586  C  CG  . ASN C  1 45  ? 26.167  -3.513  -25.479  1.00 31.57  ? 20  ASN C CG  1 
ATOM   7587  O  OD1 . ASN C  1 45  ? 26.259  -4.745  -25.461  1.00 32.50  ? 20  ASN C OD1 1 
ATOM   7588  N  ND2 . ASN C  1 45  ? 25.017  -2.882  -25.659  1.00 31.85  ? 20  ASN C ND2 1 
ATOM   7589  N  N   . ILE C  1 46  ? 30.611  -3.490  -25.246  1.00 27.29  ? 21  ILE C N   1 
ATOM   7590  C  CA  . ILE C  1 46  ? 31.914  -3.018  -25.702  1.00 26.06  ? 21  ILE C CA  1 
ATOM   7591  C  C   . ILE C  1 46  ? 31.824  -2.703  -27.184  1.00 26.89  ? 21  ILE C C   1 
ATOM   7592  O  O   . ILE C  1 46  ? 31.422  -3.555  -27.990  1.00 28.32  ? 21  ILE C O   1 
ATOM   7593  C  CB  . ILE C  1 46  ? 33.038  -4.049  -25.474  1.00 25.21  ? 21  ILE C CB  1 
ATOM   7594  C  CG1 . ILE C  1 46  ? 33.124  -4.455  -24.000  1.00 25.09  ? 21  ILE C CG1 1 
ATOM   7595  C  CG2 . ILE C  1 46  ? 34.380  -3.488  -25.937  1.00 24.02  ? 21  ILE C CG2 1 
ATOM   7596  C  CD1 . ILE C  1 46  ? 33.840  -5.774  -23.798  1.00 25.04  ? 21  ILE C CD1 1 
ATOM   7597  N  N   . PHE C  1 47  ? 32.205  -1.481  -27.545  1.00 26.74  ? 22  PHE C N   1 
ATOM   7598  C  CA  . PHE C  1 47  ? 32.107  -1.028  -28.930  1.00 27.08  ? 22  PHE C CA  1 
ATOM   7599  C  C   . PHE C  1 47  ? 33.432  -1.114  -29.691  1.00 25.34  ? 22  PHE C C   1 
ATOM   7600  O  O   . PHE C  1 47  ? 34.501  -1.158  -29.091  1.00 23.78  ? 22  PHE C O   1 
ATOM   7601  C  CB  . PHE C  1 47  ? 31.588  0.414   -28.961  1.00 28.09  ? 22  PHE C CB  1 
ATOM   7602  C  CG  . PHE C  1 47  ? 30.124  0.540   -28.624  1.00 29.23  ? 22  PHE C CG  1 
ATOM   7603  C  CD1 . PHE C  1 47  ? 29.708  0.683   -27.295  1.00 29.02  ? 22  PHE C CD1 1 
ATOM   7604  C  CD2 . PHE C  1 47  ? 29.160  0.527   -29.634  1.00 29.92  ? 22  PHE C CD2 1 
ATOM   7605  C  CE1 . PHE C  1 47  ? 28.353  0.806   -26.990  1.00 30.41  ? 22  PHE C CE1 1 
ATOM   7606  C  CE2 . PHE C  1 47  ? 27.806  0.652   -29.337  1.00 30.87  ? 22  PHE C CE2 1 
ATOM   7607  C  CZ  . PHE C  1 47  ? 27.401  0.787   -28.012  1.00 31.07  ? 22  PHE C CZ  1 
ATOM   7608  N  N   . ASN C  1 48  ? 33.341  -1.174  -31.016  1.00 25.56  ? 23  ASN C N   1 
ATOM   7609  C  CA  . ASN C  1 48  ? 34.456  -0.812  -31.872  1.00 25.00  ? 23  ASN C CA  1 
ATOM   7610  C  C   . ASN C  1 48  ? 34.175  0.599   -32.343  1.00 24.43  ? 23  ASN C C   1 
ATOM   7611  O  O   . ASN C  1 48  ? 33.274  0.815   -33.155  1.00 25.22  ? 23  ASN C O   1 
ATOM   7612  C  CB  . ASN C  1 48  ? 34.585  -1.753  -33.062  1.00 26.02  ? 23  ASN C CB  1 
ATOM   7613  C  CG  . ASN C  1 48  ? 35.795  -1.440  -33.927  1.00 26.79  ? 23  ASN C CG  1 
ATOM   7614  O  OD1 . ASN C  1 48  ? 36.320  -0.317  -33.928  1.00 26.81  ? 23  ASN C OD1 1 
ATOM   7615  N  ND2 . ASN C  1 48  ? 36.244  -2.435  -34.674  1.00 26.98  ? 23  ASN C ND2 1 
ATOM   7616  N  N   . PRO C  1 49  ? 34.936  1.576   -31.824  1.00 23.00  ? 24  PRO C N   1 
ATOM   7617  C  CA  . PRO C  1 49  ? 34.601  2.973   -32.092  1.00 23.11  ? 24  PRO C CA  1 
ATOM   7618  C  C   . PRO C  1 49  ? 34.868  3.398   -33.538  1.00 24.07  ? 24  PRO C C   1 
ATOM   7619  O  O   . PRO C  1 49  ? 34.363  4.425   -33.968  1.00 24.74  ? 24  PRO C O   1 
ATOM   7620  C  CB  . PRO C  1 49  ? 35.486  3.747   -31.097  1.00 21.72  ? 24  PRO C CB  1 
ATOM   7621  C  CG  . PRO C  1 49  ? 36.625  2.831   -30.819  1.00 20.98  ? 24  PRO C CG  1 
ATOM   7622  C  CD  . PRO C  1 49  ? 36.048  1.447   -30.865  1.00 21.70  ? 24  PRO C CD  1 
ATOM   7623  N  N   . ALA C  1 50  ? 35.630  2.605   -34.283  1.00 24.92  ? 25  ALA C N   1 
ATOM   7624  C  CA  . ALA C  1 50  ? 35.870  2.899   -35.698  1.00 26.87  ? 25  ALA C CA  1 
ATOM   7625  C  C   . ALA C  1 50  ? 34.616  2.664   -36.523  1.00 29.54  ? 25  ALA C C   1 
ATOM   7626  O  O   . ALA C  1 50  ? 34.394  3.353   -37.527  1.00 30.79  ? 25  ALA C O   1 
ATOM   7627  C  CB  . ALA C  1 50  ? 37.029  2.069   -36.245  1.00 25.90  ? 25  ALA C CB  1 
ATOM   7628  N  N   . THR C  1 51  ? 33.802  1.699   -36.093  1.00 30.30  ? 26  THR C N   1 
ATOM   7629  C  CA  . THR C  1 51  ? 32.612  1.287   -36.851  1.00 31.58  ? 26  THR C CA  1 
ATOM   7630  C  C   . THR C  1 51  ? 31.336  1.718   -36.160  1.00 32.36  ? 26  THR C C   1 
ATOM   7631  O  O   . THR C  1 51  ? 30.309  1.898   -36.806  1.00 33.14  ? 26  THR C O   1 
ATOM   7632  C  CB  . THR C  1 51  ? 32.555  -0.238  -37.094  1.00 31.40  ? 26  THR C CB  1 
ATOM   7633  O  OG1 . THR C  1 51  ? 32.554  -0.929  -35.839  1.00 30.96  ? 26  THR C OG1 1 
ATOM   7634  C  CG2 . THR C  1 51  ? 33.740  -0.696  -37.929  1.00 30.76  ? 26  THR C CG2 1 
ATOM   7635  N  N   . GLY C  1 52  ? 31.411  1.892   -34.844  1.00 32.71  ? 27  GLY C N   1 
ATOM   7636  C  CA  . GLY C  1 52  ? 30.253  2.298   -34.062  1.00 32.68  ? 27  GLY C CA  1 
ATOM   7637  C  C   . GLY C  1 52  ? 29.409  1.106   -33.647  1.00 31.96  ? 27  GLY C C   1 
ATOM   7638  O  O   . GLY C  1 52  ? 28.394  1.272   -32.978  1.00 31.74  ? 27  GLY C O   1 
ATOM   7639  N  N   . GLU C  1 53  ? 29.851  -0.093  -34.025  1.00 31.37  ? 28  GLU C N   1 
ATOM   7640  C  CA  . GLU C  1 53  ? 29.138  -1.329  -33.719  1.00 32.56  ? 28  GLU C CA  1 
ATOM   7641  C  C   . GLU C  1 53  ? 29.608  -1.960  -32.422  1.00 30.81  ? 28  GLU C C   1 
ATOM   7642  O  O   . GLU C  1 53  ? 30.775  -1.847  -32.054  1.00 28.87  ? 28  GLU C O   1 
ATOM   7643  C  CB  . GLU C  1 53  ? 29.325  -2.337  -34.851  1.00 36.26  ? 28  GLU C CB  1 
ATOM   7644  C  CG  . GLU C  1 53  ? 28.717  -1.895  -36.174  1.00 42.05  ? 28  GLU C CG  1 
ATOM   7645  C  CD  . GLU C  1 53  ? 28.887  -2.924  -37.274  1.00 49.92  ? 28  GLU C CD  1 
ATOM   7646  O  OE1 . GLU C  1 53  ? 27.907  -3.160  -38.014  1.00 56.36  ? 28  GLU C OE1 1 
ATOM   7647  O  OE2 . GLU C  1 53  ? 29.993  -3.500  -37.403  1.00 50.65  ? 28  GLU C OE2 1 
ATOM   7648  N  N   . VAL C  1 54  ? 28.687  -2.631  -31.740  1.00 31.55  ? 29  VAL C N   1 
ATOM   7649  C  CA  . VAL C  1 54  ? 29.021  -3.470  -30.597  1.00 30.88  ? 29  VAL C CA  1 
ATOM   7650  C  C   . VAL C  1 54  ? 29.877  -4.652  -31.087  1.00 30.35  ? 29  VAL C C   1 
ATOM   7651  O  O   . VAL C  1 54  ? 29.545  -5.289  -32.080  1.00 30.24  ? 29  VAL C O   1 
ATOM   7652  C  CB  . VAL C  1 54  ? 27.741  -3.977  -29.890  1.00 31.14  ? 29  VAL C CB  1 
ATOM   7653  C  CG1 . VAL C  1 54  ? 28.083  -4.902  -28.722  1.00 30.87  ? 29  VAL C CG1 1 
ATOM   7654  C  CG2 . VAL C  1 54  ? 26.899  -2.803  -29.411  1.00 30.77  ? 29  VAL C CG2 1 
ATOM   7655  N  N   . GLN C  1 55  ? 30.989  -4.917  -30.402  1.00 29.96  ? 30  GLN C N   1 
ATOM   7656  C  CA  . GLN C  1 55  ? 31.851  -6.057  -30.743  1.00 29.90  ? 30  GLN C CA  1 
ATOM   7657  C  C   . GLN C  1 55  ? 31.894  -7.107  -29.640  1.00 30.03  ? 30  GLN C C   1 
ATOM   7658  O  O   . GLN C  1 55  ? 32.354  -8.224  -29.872  1.00 31.00  ? 30  GLN C O   1 
ATOM   7659  C  CB  . GLN C  1 55  ? 33.271  -5.606  -31.084  1.00 28.87  ? 30  GLN C CB  1 
ATOM   7660  C  CG  . GLN C  1 55  ? 33.993  -4.867  -29.966  1.00 28.66  ? 30  GLN C CG  1 
ATOM   7661  C  CD  . GLN C  1 55  ? 35.442  -4.580  -30.307  1.00 28.64  ? 30  GLN C CD  1 
ATOM   7662  O  OE1 . GLN C  1 55  ? 36.127  -5.421  -30.888  1.00 29.53  ? 30  GLN C OE1 1 
ATOM   7663  N  NE2 . GLN C  1 55  ? 35.922  -3.397  -29.931  1.00 27.38  ? 30  GLN C NE2 1 
ATOM   7664  N  N   . GLY C  1 56  ? 31.430  -6.737  -28.446  1.00 29.21  ? 31  GLY C N   1 
ATOM   7665  C  CA  . GLY C  1 56  ? 31.417  -7.640  -27.290  1.00 28.58  ? 31  GLY C CA  1 
ATOM   7666  C  C   . GLY C  1 56  ? 30.714  -7.043  -26.080  1.00 28.30  ? 31  GLY C C   1 
ATOM   7667  O  O   . GLY C  1 56  ? 30.134  -5.949  -26.153  1.00 28.37  ? 31  GLY C O   1 
ATOM   7668  N  N   . THR C  1 57  ? 30.752  -7.756  -24.958  1.00 27.85  ? 32  THR C N   1 
ATOM   7669  C  CA  . THR C  1 57  ? 30.149  -7.253  -23.721  1.00 27.39  ? 32  THR C CA  1 
ATOM   7670  C  C   . THR C  1 57  ? 31.060  -7.571  -22.554  1.00 27.47  ? 32  THR C C   1 
ATOM   7671  O  O   . THR C  1 57  ? 31.896  -8.470  -22.642  1.00 28.68  ? 32  THR C O   1 
ATOM   7672  C  CB  . THR C  1 57  ? 28.774  -7.894  -23.424  1.00 27.58  ? 32  THR C CB  1 
ATOM   7673  O  OG1 . THR C  1 57  ? 28.949  -9.302  -23.289  1.00 27.59  ? 32  THR C OG1 1 
ATOM   7674  C  CG2 . THR C  1 57  ? 27.752  -7.611  -24.534  1.00 28.06  ? 32  THR C CG2 1 
ATOM   7675  N  N   . VAL C  1 58  ? 30.889  -6.834  -21.464  1.00 26.81  ? 33  VAL C N   1 
ATOM   7676  C  CA  . VAL C  1 58  ? 31.645  -7.063  -20.236  1.00 26.98  ? 33  VAL C CA  1 
ATOM   7677  C  C   . VAL C  1 58  ? 30.674  -7.161  -19.056  1.00 28.14  ? 33  VAL C C   1 
ATOM   7678  O  O   . VAL C  1 58  ? 29.710  -6.389  -18.966  1.00 28.25  ? 33  VAL C O   1 
ATOM   7679  C  CB  . VAL C  1 58  ? 32.715  -5.963  -19.981  1.00 24.94  ? 33  VAL C CB  1 
ATOM   7680  C  CG1 . VAL C  1 58  ? 32.087  -4.570  -19.868  1.00 23.89  ? 33  VAL C CG1 1 
ATOM   7681  C  CG2 . VAL C  1 58  ? 33.552  -6.293  -18.747  1.00 24.15  ? 33  VAL C CG2 1 
ATOM   7682  N  N   . ALA C  1 59  ? 30.939  -8.123  -18.174  1.00 28.90  ? 34  ALA C N   1 
ATOM   7683  C  CA  . ALA C  1 59  ? 30.121  -8.373  -16.989  1.00 29.29  ? 34  ALA C CA  1 
ATOM   7684  C  C   . ALA C  1 59  ? 30.253  -7.211  -16.009  1.00 29.41  ? 34  ALA C C   1 
ATOM   7685  O  O   . ALA C  1 59  ? 31.347  -6.660  -15.845  1.00 28.18  ? 34  ALA C O   1 
ATOM   7686  C  CB  . ALA C  1 59  ? 30.550  -9.674  -16.324  1.00 28.46  ? 34  ALA C CB  1 
ATOM   7687  N  N   . LEU C  1 60  ? 29.143  -6.846  -15.365  1.00 29.51  ? 35  LEU C N   1 
ATOM   7688  C  CA  . LEU C  1 60  ? 29.162  -5.819  -14.329  1.00 28.93  ? 35  LEU C CA  1 
ATOM   7689  C  C   . LEU C  1 60  ? 29.039  -6.484  -12.963  1.00 30.19  ? 35  LEU C C   1 
ATOM   7690  O  O   . LEU C  1 60  ? 28.010  -7.102  -12.649  1.00 31.44  ? 35  LEU C O   1 
ATOM   7691  C  CB  . LEU C  1 60  ? 28.057  -4.776  -14.557  1.00 29.13  ? 35  LEU C CB  1 
ATOM   7692  C  CG  . LEU C  1 60  ? 27.946  -4.112  -15.943  1.00 29.02  ? 35  LEU C CG  1 
ATOM   7693  C  CD1 . LEU C  1 60  ? 26.684  -3.273  -16.065  1.00 29.47  ? 35  LEU C CD1 1 
ATOM   7694  C  CD2 . LEU C  1 60  ? 29.176  -3.282  -16.279  1.00 28.23  ? 35  LEU C CD2 1 
ATOM   7695  N  N   . ALA C  1 61  ? 30.095  -6.366  -12.160  1.00 29.50  ? 36  ALA C N   1 
ATOM   7696  C  CA  . ALA C  1 61  ? 30.199  -7.097  -10.893  1.00 30.38  ? 36  ALA C CA  1 
ATOM   7697  C  C   . ALA C  1 61  ? 29.092  -6.778  -9.914   1.00 31.47  ? 36  ALA C C   1 
ATOM   7698  O  O   . ALA C  1 61  ? 28.769  -5.608  -9.689   1.00 31.47  ? 36  ALA C O   1 
ATOM   7699  C  CB  . ALA C  1 61  ? 31.535  -6.837  -10.224  1.00 29.07  ? 36  ALA C CB  1 
ATOM   7700  N  N   . SER C  1 62  ? 28.533  -7.843  -9.343   1.00 31.99  ? 37  SER C N   1 
ATOM   7701  C  CA  . SER C  1 62  ? 27.686  -7.790  -8.170   1.00 33.19  ? 37  SER C CA  1 
ATOM   7702  C  C   . SER C  1 62  ? 28.570  -7.643  -6.940   1.00 32.80  ? 37  SER C C   1 
ATOM   7703  O  O   . SER C  1 62  ? 29.791  -7.761  -7.023   1.00 30.62  ? 37  SER C O   1 
ATOM   7704  C  CB  . SER C  1 62  ? 26.905  -9.101  -8.054   1.00 35.24  ? 37  SER C CB  1 
ATOM   7705  O  OG  . SER C  1 62  ? 27.794  -10.191 -7.850   1.00 35.47  ? 37  SER C OG  1 
ATOM   7706  N  N   . ASP C  1 63  ? 27.945  -7.413  -5.789   1.00 35.35  ? 38  ASP C N   1 
ATOM   7707  C  CA  . ASP C  1 63  ? 28.667  -7.375  -4.516   1.00 35.38  ? 38  ASP C CA  1 
ATOM   7708  C  C   . ASP C  1 63  ? 29.356  -8.716  -4.242   1.00 33.27  ? 38  ASP C C   1 
ATOM   7709  O  O   . ASP C  1 63  ? 30.471  -8.746  -3.742   1.00 31.96  ? 38  ASP C O   1 
ATOM   7710  C  CB  . ASP C  1 63  ? 27.717  -7.008  -3.362   1.00 37.16  ? 38  ASP C CB  1 
ATOM   7711  C  CG  . ASP C  1 63  ? 27.294  -5.539  -3.384   1.00 39.57  ? 38  ASP C CG  1 
ATOM   7712  O  OD1 . ASP C  1 63  ? 27.643  -4.810  -4.339   1.00 38.56  ? 38  ASP C OD1 1 
ATOM   7713  O  OD2 . ASP C  1 63  ? 26.601  -5.110  -2.437   1.00 41.93  ? 38  ASP C OD2 1 
ATOM   7714  N  N   . ALA C  1 64  ? 28.673  -9.811  -4.582   1.00 33.02  ? 39  ALA C N   1 
ATOM   7715  C  CA  . ALA C  1 64  ? 29.199  -11.168 -4.407   1.00 31.89  ? 39  ALA C CA  1 
ATOM   7716  C  C   . ALA C  1 64  ? 30.458  -11.431 -5.255   1.00 30.48  ? 39  ALA C C   1 
ATOM   7717  O  O   . ALA C  1 64  ? 31.384  -12.097 -4.798   1.00 30.57  ? 39  ALA C O   1 
ATOM   7718  C  CB  . ALA C  1 64  ? 28.117  -12.190 -4.723   1.00 31.62  ? 39  ALA C CB  1 
ATOM   7719  N  N   . ASP C  1 65  ? 30.469  -10.921 -6.486   1.00 29.36  ? 40  ASP C N   1 
ATOM   7720  C  CA  . ASP C  1 65  ? 31.638  -11.020 -7.366   1.00 28.59  ? 40  ASP C CA  1 
ATOM   7721  C  C   . ASP C  1 65  ? 32.854  -10.316 -6.736   1.00 28.48  ? 40  ASP C C   1 
ATOM   7722  O  O   . ASP C  1 65  ? 33.970  -10.863 -6.743   1.00 28.09  ? 40  ASP C O   1 
ATOM   7723  C  CB  . ASP C  1 65  ? 31.361  -10.404 -8.748   1.00 27.48  ? 40  ASP C CB  1 
ATOM   7724  C  CG  . ASP C  1 65  ? 30.351  -11.187 -9.581   1.00 28.87  ? 40  ASP C CG  1 
ATOM   7725  O  OD1 . ASP C  1 65  ? 30.264  -12.434 -9.485   1.00 29.51  ? 40  ASP C OD1 1 
ATOM   7726  O  OD2 . ASP C  1 65  ? 29.645  -10.541 -10.381  1.00 30.02  ? 40  ASP C OD2 1 
ATOM   7727  N  N   . LEU C  1 66  ? 32.655  -9.119  -6.195   1.00 27.34  ? 41  LEU C N   1 
ATOM   7728  C  CA  . LEU C  1 66  ? 33.689  -8.404  -5.489   1.00 26.00  ? 41  LEU C CA  1 
ATOM   7729  C  C   . LEU C  1 66  ? 34.144  -9.095  -4.245   1.00 25.72  ? 41  LEU C C   1 
ATOM   7730  O  O   . LEU C  1 66  ? 35.302  -9.216  -4.017   1.00 24.78  ? 41  LEU C O   1 
ATOM   7731  C  CB  . LEU C  1 66  ? 33.259  -6.981  -5.190   1.00 26.28  ? 41  LEU C CB  1 
ATOM   7732  C  CG  . LEU C  1 66  ? 34.274  -5.937  -4.715   1.00 26.13  ? 41  LEU C CG  1 
ATOM   7733  C  CD1 . LEU C  1 66  ? 34.414  -5.827  -3.220   1.00 26.93  ? 41  LEU C CD1 1 
ATOM   7734  C  CD2 . LEU C  1 66  ? 35.614  -6.009  -5.363   1.00 25.92  ? 41  LEU C CD2 1 
ATOM   7735  N  N   . ALA C  1 67  ? 33.189  -9.593  -3.495   1.00 26.66  ? 42  ALA C N   1 
ATOM   7736  C  CA  . ALA C  1 67  ? 33.444  -10.360 -2.266   1.00 27.78  ? 42  ALA C CA  1 
ATOM   7737  C  C   . ALA C  1 67  ? 34.327  -11.581 -2.551   1.00 27.96  ? 42  ALA C C   1 
ATOM   7738  O  O   . ALA C  1 67  ? 35.293  -11.834 -1.834   1.00 27.57  ? 42  ALA C O   1 
ATOM   7739  C  CB  . ALA C  1 67  ? 32.127  -10.784 -1.616   1.00 28.34  ? 42  ALA C CB  1 
ATOM   7740  N  N   . ALA C  1 68  ? 33.995  -12.319 -3.611   1.00 29.06  ? 43  ALA C N   1 
ATOM   7741  C  CA  . ALA C  1 68  ? 34.825  -13.436 -4.078   1.00 29.28  ? 43  ALA C CA  1 
ATOM   7742  C  C   . ALA C  1 68  ? 36.264  -13.000 -4.379   1.00 28.52  ? 43  ALA C C   1 
ATOM   7743  O  O   . ALA C  1 68  ? 37.209  -13.681 -3.985   1.00 29.51  ? 43  ALA C O   1 
ATOM   7744  C  CB  . ALA C  1 68  ? 34.202  -14.103 -5.290   1.00 29.23  ? 43  ALA C CB  1 
ATOM   7745  N  N   . ALA C  1 69  ? 36.432  -11.858 -5.043   1.00 26.70  ? 44  ALA C N   1 
ATOM   7746  C  CA  . ALA C  1 69  ? 37.771  -11.354 -5.344   1.00 25.16  ? 44  ALA C CA  1 
ATOM   7747  C  C   . ALA C  1 69  ? 38.532  -10.939 -4.091   1.00 24.46  ? 44  ALA C C   1 
ATOM   7748  O  O   . ALA C  1 69  ? 39.751  -11.108 -4.028   1.00 23.32  ? 44  ALA C O   1 
ATOM   7749  C  CB  . ALA C  1 69  ? 37.717  -10.204 -6.336   1.00 24.28  ? 44  ALA C CB  1 
ATOM   7750  N  N   . VAL C  1 70  ? 37.822  -10.394 -3.101   1.00 24.78  ? 45  VAL C N   1 
ATOM   7751  C  CA  . VAL C  1 70  ? 38.474  -9.988  -1.852   1.00 25.25  ? 45  VAL C CA  1 
ATOM   7752  C  C   . VAL C  1 70  ? 38.911  -11.217 -1.056   1.00 26.99  ? 45  VAL C C   1 
ATOM   7753  O  O   . VAL C  1 70  ? 40.039  -11.261 -0.552   1.00 28.13  ? 45  VAL C O   1 
ATOM   7754  C  CB  . VAL C  1 70  ? 37.598  -9.051  -0.983   1.00 25.18  ? 45  VAL C CB  1 
ATOM   7755  C  CG1 . VAL C  1 70  ? 38.213  -8.866  0.398    1.00 25.10  ? 45  VAL C CG1 1 
ATOM   7756  C  CG2 . VAL C  1 70  ? 37.429  -7.699  -1.650   1.00 24.38  ? 45  VAL C CG2 1 
ATOM   7757  N  N   . GLU C  1 71  ? 38.019  -12.209 -0.950   1.00 27.38  ? 46  GLU C N   1 
ATOM   7758  C  CA  . GLU C  1 71  ? 38.338  -13.476 -0.286   1.00 27.86  ? 46  GLU C CA  1 
ATOM   7759  C  C   . GLU C  1 71  ? 39.503  -14.189 -0.976   1.00 26.29  ? 46  GLU C C   1 
ATOM   7760  O  O   . GLU C  1 71  ? 40.396  -14.713 -0.313   1.00 25.90  ? 46  GLU C O   1 
ATOM   7761  C  CB  . GLU C  1 71  ? 37.105  -14.395 -0.206   1.00 31.28  ? 46  GLU C CB  1 
ATOM   7762  C  CG  . GLU C  1 71  ? 36.006  -13.926 0.747    1.00 34.77  ? 46  GLU C CG  1 
ATOM   7763  C  CD  . GLU C  1 71  ? 36.513  -13.629 2.157    1.00 37.62  ? 46  GLU C CD  1 
ATOM   7764  O  OE1 . GLU C  1 71  ? 36.812  -14.583 2.917    1.00 38.90  ? 46  GLU C OE1 1 
ATOM   7765  O  OE2 . GLU C  1 71  ? 36.613  -12.431 2.503    1.00 38.03  ? 46  GLU C OE2 1 
ATOM   7766  N  N   . SER C  1 72  ? 39.482  -14.205 -2.307   1.00 25.78  ? 47  SER C N   1 
ATOM   7767  C  CA  . SER C  1 72  ? 40.616  -14.663 -3.112   1.00 25.95  ? 47  SER C CA  1 
ATOM   7768  C  C   . SER C  1 72  ? 41.913  -13.972 -2.650   1.00 25.06  ? 47  SER C C   1 
ATOM   7769  O  O   . SER C  1 72  ? 42.903  -14.644 -2.330   1.00 23.96  ? 47  SER C O   1 
ATOM   7770  C  CB  . SER C  1 72  ? 40.333  -14.382 -4.591   1.00 27.04  ? 47  SER C CB  1 
ATOM   7771  O  OG  . SER C  1 72  ? 41.430  -14.695 -5.433   1.00 28.38  ? 47  SER C OG  1 
ATOM   7772  N  N   . ALA C  1 73  ? 41.877  -12.634 -2.579   1.00 25.16  ? 48  ALA C N   1 
ATOM   7773  C  CA  . ALA C  1 73  ? 43.036  -11.816 -2.186   1.00 25.33  ? 48  ALA C CA  1 
ATOM   7774  C  C   . ALA C  1 73  ? 43.481  -12.106 -0.766   1.00 26.72  ? 48  ALA C C   1 
ATOM   7775  O  O   . ALA C  1 73  ? 44.673  -12.186 -0.499   1.00 25.69  ? 48  ALA C O   1 
ATOM   7776  C  CB  . ALA C  1 73  ? 42.742  -10.330 -2.360   1.00 24.20  ? 48  ALA C CB  1 
ATOM   7777  N  N   . LYS C  1 74  ? 42.514  -12.294 0.131    1.00 30.00  ? 49  LYS C N   1 
ATOM   7778  C  CA  . LYS C  1 74  ? 42.799  -12.533 1.550    1.00 31.96  ? 49  LYS C CA  1 
ATOM   7779  C  C   . LYS C  1 74  ? 43.567  -13.817 1.790    1.00 31.62  ? 49  LYS C C   1 
ATOM   7780  O  O   . LYS C  1 74  ? 44.552  -13.824 2.526    1.00 30.83  ? 49  LYS C O   1 
ATOM   7781  C  CB  . LYS C  1 74  ? 41.519  -12.522 2.374    1.00 36.03  ? 49  LYS C CB  1 
ATOM   7782  C  CG  . LYS C  1 74  ? 41.003  -11.118 2.645    1.00 41.71  ? 49  LYS C CG  1 
ATOM   7783  C  CD  . LYS C  1 74  ? 39.635  -11.117 3.312    1.00 47.27  ? 49  LYS C CD  1 
ATOM   7784  C  CE  . LYS C  1 74  ? 39.738  -11.366 4.806    1.00 51.49  ? 49  LYS C CE  1 
ATOM   7785  N  NZ  . LYS C  1 74  ? 38.373  -11.486 5.386    1.00 57.92  ? 49  LYS C NZ  1 
ATOM   7786  N  N   . ALA C  1 75  ? 43.124  -14.895 1.148    1.00 31.33  ? 50  ALA C N   1 
ATOM   7787  C  CA  . ALA C  1 75  ? 43.771  -16.190 1.276    1.00 30.13  ? 50  ALA C CA  1 
ATOM   7788  C  C   . ALA C  1 75  ? 45.204  -16.185 0.738    1.00 30.06  ? 50  ALA C C   1 
ATOM   7789  O  O   . ALA C  1 75  ? 46.063  -16.876 1.270    1.00 31.10  ? 50  ALA C O   1 
ATOM   7790  C  CB  . ALA C  1 75  ? 42.956  -17.256 0.568    1.00 29.37  ? 50  ALA C CB  1 
ATOM   7791  N  N   . ALA C  1 76  ? 45.458  -15.408 -0.310   1.00 28.92  ? 51  ALA C N   1 
ATOM   7792  C  CA  . ALA C  1 76  ? 46.734  -15.485 -1.023   1.00 27.48  ? 51  ALA C CA  1 
ATOM   7793  C  C   . ALA C  1 76  ? 47.799  -14.501 -0.528   1.00 26.09  ? 51  ALA C C   1 
ATOM   7794  O  O   . ALA C  1 76  ? 48.992  -14.791 -0.612   1.00 26.98  ? 51  ALA C O   1 
ATOM   7795  C  CB  . ALA C  1 76  ? 46.509  -15.313 -2.513   1.00 26.28  ? 51  ALA C CB  1 
ATOM   7796  N  N   . GLN C  1 77  ? 47.372  -13.351 -0.017   1.00 24.13  ? 52  GLN C N   1 
ATOM   7797  C  CA  . GLN C  1 77  ? 48.304  -12.256 0.284    1.00 23.56  ? 52  GLN C CA  1 
ATOM   7798  C  C   . GLN C  1 77  ? 49.406  -12.579 1.308    1.00 24.06  ? 52  GLN C C   1 
ATOM   7799  O  O   . GLN C  1 77  ? 50.563  -12.227 1.073    1.00 23.79  ? 52  GLN C O   1 
ATOM   7800  C  CB  . GLN C  1 77  ? 47.548  -10.969 0.656    1.00 22.48  ? 52  GLN C CB  1 
ATOM   7801  C  CG  . GLN C  1 77  ? 48.439  -9.755  0.925    1.00 21.55  ? 52  GLN C CG  1 
ATOM   7802  C  CD  . GLN C  1 77  ? 48.868  -9.639  2.387    1.00 21.03  ? 52  GLN C CD  1 
ATOM   7803  O  OE1 . GLN C  1 77  ? 48.294  -10.281 3.255    1.00 20.90  ? 52  GLN C OE1 1 
ATOM   7804  N  NE2 . GLN C  1 77  ? 49.895  -8.829  2.655    1.00 20.38  ? 52  GLN C NE2 1 
ATOM   7805  N  N   . PRO C  1 78  ? 49.058  -13.234 2.443    1.00 24.83  ? 53  PRO C N   1 
ATOM   7806  C  CA  . PRO C  1 78  ? 50.093  -13.553 3.441    1.00 25.23  ? 53  PRO C CA  1 
ATOM   7807  C  C   . PRO C  1 78  ? 51.308  -14.317 2.881    1.00 25.44  ? 53  PRO C C   1 
ATOM   7808  O  O   . PRO C  1 78  ? 52.438  -13.924 3.135    1.00 25.09  ? 53  PRO C O   1 
ATOM   7809  C  CB  . PRO C  1 78  ? 49.331  -14.389 4.477    1.00 26.39  ? 53  PRO C CB  1 
ATOM   7810  C  CG  . PRO C  1 78  ? 47.937  -13.846 4.410    1.00 26.55  ? 53  PRO C CG  1 
ATOM   7811  C  CD  . PRO C  1 78  ? 47.708  -13.567 2.944    1.00 25.54  ? 53  PRO C CD  1 
ATOM   7812  N  N   . LYS C  1 79  ? 51.088  -15.383 2.120    1.00 26.83  ? 54  LYS C N   1 
ATOM   7813  C  CA  . LYS C  1 79  ? 52.206  -16.122 1.513    1.00 29.33  ? 54  LYS C CA  1 
ATOM   7814  C  C   . LYS C  1 79  ? 53.029  -15.280 0.514    1.00 27.99  ? 54  LYS C C   1 
ATOM   7815  O  O   . LYS C  1 79  ? 54.256  -15.410 0.430    1.00 28.99  ? 54  LYS C O   1 
ATOM   7816  C  CB  . LYS C  1 79  ? 51.693  -17.388 0.842    1.00 34.72  ? 54  LYS C CB  1 
ATOM   7817  C  CG  . LYS C  1 79  ? 52.651  -18.558 0.914    1.00 43.25  ? 54  LYS C CG  1 
ATOM   7818  C  CD  . LYS C  1 79  ? 51.874  -19.869 0.982    1.00 51.62  ? 54  LYS C CD  1 
ATOM   7819  C  CE  . LYS C  1 79  ? 52.801  -21.073 1.082    1.00 59.54  ? 54  LYS C CE  1 
ATOM   7820  N  NZ  . LYS C  1 79  ? 53.618  -21.267 -0.153   1.00 63.28  ? 54  LYS C NZ  1 
ATOM   7821  N  N   . TRP C  1 80  ? 52.350  -14.439 -0.259   1.00 25.52  ? 55  TRP C N   1 
ATOM   7822  C  CA  . TRP C  1 80  ? 53.035  -13.493 -1.137   1.00 23.62  ? 55  TRP C CA  1 
ATOM   7823  C  C   . TRP C  1 80  ? 53.849  -12.456 -0.346   1.00 22.54  ? 55  TRP C C   1 
ATOM   7824  O  O   . TRP C  1 80  ? 54.989  -12.176 -0.703   1.00 22.21  ? 55  TRP C O   1 
ATOM   7825  C  CB  . TRP C  1 80  ? 52.048  -12.822 -2.078   1.00 21.91  ? 55  TRP C CB  1 
ATOM   7826  C  CG  . TRP C  1 80  ? 52.627  -11.745 -2.952   1.00 21.23  ? 55  TRP C CG  1 
ATOM   7827  C  CD1 . TRP C  1 80  ? 52.330  -10.408 -2.901   1.00 19.88  ? 55  TRP C CD1 1 
ATOM   7828  C  CD2 . TRP C  1 80  ? 53.582  -11.906 -4.012   1.00 20.86  ? 55  TRP C CD2 1 
ATOM   7829  N  NE1 . TRP C  1 80  ? 53.039  -9.736  -3.843   1.00 19.64  ? 55  TRP C NE1 1 
ATOM   7830  C  CE2 . TRP C  1 80  ? 53.813  -10.626 -4.551   1.00 20.55  ? 55  TRP C CE2 1 
ATOM   7831  C  CE3 . TRP C  1 80  ? 54.265  -13.009 -4.556   1.00 21.57  ? 55  TRP C CE3 1 
ATOM   7832  C  CZ2 . TRP C  1 80  ? 54.702  -10.406 -5.620   1.00 20.23  ? 55  TRP C CZ2 1 
ATOM   7833  C  CZ3 . TRP C  1 80  ? 55.148  -12.800 -5.614   1.00 21.33  ? 55  TRP C CZ3 1 
ATOM   7834  C  CH2 . TRP C  1 80  ? 55.358  -11.499 -6.135   1.00 21.04  ? 55  TRP C CH2 1 
ATOM   7835  N  N   . ALA C  1 81  ? 53.277  -11.908 0.727    1.00 21.86  ? 56  ALA C N   1 
ATOM   7836  C  CA  . ALA C  1 81  ? 54.012  -10.965 1.589    1.00 22.07  ? 56  ALA C CA  1 
ATOM   7837  C  C   . ALA C  1 81  ? 55.212  -11.642 2.258    1.00 24.07  ? 56  ALA C C   1 
ATOM   7838  O  O   . ALA C  1 81  ? 56.207  -10.979 2.585    1.00 24.53  ? 56  ALA C O   1 
ATOM   7839  C  CB  . ALA C  1 81  ? 53.096  -10.364 2.643    1.00 21.88  ? 56  ALA C CB  1 
ATOM   7840  N  N   . ALA C  1 82  ? 55.115  -12.961 2.455    1.00 23.94  ? 57  ALA C N   1 
ATOM   7841  C  CA  . ALA C  1 82  ? 56.196  -13.733 3.056    1.00 24.84  ? 57  ALA C CA  1 
ATOM   7842  C  C   . ALA C  1 82  ? 57.308  -14.095 2.057    1.00 25.87  ? 57  ALA C C   1 
ATOM   7843  O  O   . ALA C  1 82  ? 58.370  -14.563 2.463    1.00 28.38  ? 57  ALA C O   1 
ATOM   7844  C  CB  . ALA C  1 82  ? 55.644  -14.985 3.742    1.00 25.37  ? 57  ALA C CB  1 
ATOM   7845  N  N   . THR C  1 83  ? 57.063  -13.898 0.764    1.00 24.11  ? 58  THR C N   1 
ATOM   7846  C  CA  . THR C  1 83  ? 58.094  -14.082 -0.262   1.00 24.73  ? 58  THR C CA  1 
ATOM   7847  C  C   . THR C  1 83  ? 59.115  -12.940 -0.211   1.00 24.23  ? 58  THR C C   1 
ATOM   7848  O  O   . THR C  1 83  ? 58.723  -11.771 -0.183   1.00 22.66  ? 58  THR C O   1 
ATOM   7849  C  CB  . THR C  1 83  ? 57.463  -14.103 -1.663   1.00 25.51  ? 58  THR C CB  1 
ATOM   7850  O  OG1 . THR C  1 83  ? 56.407  -15.064 -1.687   1.00 27.29  ? 58  THR C OG1 1 
ATOM   7851  C  CG2 . THR C  1 83  ? 58.476  -14.470 -2.733   1.00 25.83  ? 58  THR C CG2 1 
ATOM   7852  N  N   . ASN C  1 84  ? 60.412  -13.269 -0.202   1.00 24.73  ? 59  ASN C N   1 
ATOM   7853  C  CA  . ASN C  1 84  ? 61.457  -12.232 -0.133   1.00 24.79  ? 59  ASN C CA  1 
ATOM   7854  C  C   . ASN C  1 84  ? 61.404  -11.224 -1.309   1.00 23.70  ? 59  ASN C C   1 
ATOM   7855  O  O   . ASN C  1 84  ? 60.878  -11.559 -2.379   1.00 22.32  ? 59  ASN C O   1 
ATOM   7856  C  CB  . ASN C  1 84  ? 62.850  -12.855 0.070    1.00 26.07  ? 59  ASN C CB  1 
ATOM   7857  C  CG  . ASN C  1 84  ? 63.496  -13.330 -1.213   1.00 27.09  ? 59  ASN C CG  1 
ATOM   7858  O  OD1 . ASN C  1 84  ? 63.605  -12.592 -2.199   1.00 28.28  ? 59  ASN C OD1 1 
ATOM   7859  N  ND2 . ASN C  1 84  ? 63.969  -14.563 -1.196   1.00 27.07  ? 59  ASN C ND2 1 
ATOM   7860  N  N   . PRO C  1 85  ? 61.924  -9.989  -1.108   1.00 23.34  ? 60  PRO C N   1 
ATOM   7861  C  CA  . PRO C  1 85  ? 61.736  -8.947  -2.133   1.00 22.42  ? 60  PRO C CA  1 
ATOM   7862  C  C   . PRO C  1 85  ? 62.371  -9.294  -3.482   1.00 23.00  ? 60  PRO C C   1 
ATOM   7863  O  O   . PRO C  1 85  ? 61.794  -9.000  -4.533   1.00 22.76  ? 60  PRO C O   1 
ATOM   7864  C  CB  . PRO C  1 85  ? 62.391  -7.697  -1.514   1.00 21.77  ? 60  PRO C CB  1 
ATOM   7865  C  CG  . PRO C  1 85  ? 62.482  -7.983  -0.046   1.00 22.58  ? 60  PRO C CG  1 
ATOM   7866  C  CD  . PRO C  1 85  ? 62.633  -9.472  0.080    1.00 23.27  ? 60  PRO C CD  1 
ATOM   7867  N  N   . GLN C  1 86  ? 63.535  -9.931  -3.461   1.00 22.95  ? 61  GLN C N   1 
ATOM   7868  C  CA  . GLN C  1 86  ? 64.182  -10.296 -4.700   1.00 23.49  ? 61  GLN C CA  1 
ATOM   7869  C  C   . GLN C  1 86  ? 63.298  -11.226 -5.515   1.00 25.03  ? 61  GLN C C   1 
ATOM   7870  O  O   . GLN C  1 86  ? 63.137  -11.031 -6.715   1.00 26.14  ? 61  GLN C O   1 
ATOM   7871  C  CB  . GLN C  1 86  ? 65.535  -10.928 -4.426   1.00 24.04  ? 61  GLN C CB  1 
ATOM   7872  C  CG  . GLN C  1 86  ? 66.590  -9.938  -3.964   1.00 23.48  ? 61  GLN C CG  1 
ATOM   7873  C  CD  . GLN C  1 86  ? 67.868  -10.647 -3.554   1.00 24.31  ? 61  GLN C CD  1 
ATOM   7874  O  OE1 . GLN C  1 86  ? 67.875  -11.439 -2.609   1.00 24.37  ? 61  GLN C OE1 1 
ATOM   7875  N  NE2 . GLN C  1 86  ? 68.958  -10.359 -4.258   1.00 24.60  ? 61  GLN C NE2 1 
ATOM   7876  N  N   . ARG C  1 87  ? 62.709  -12.222 -4.858   1.00 25.52  ? 62  ARG C N   1 
ATOM   7877  C  CA  . ARG C  1 87  ? 61.796  -13.145 -5.528   1.00 25.99  ? 62  ARG C CA  1 
ATOM   7878  C  C   . ARG C  1 87  ? 60.539  -12.443 -6.055   1.00 22.81  ? 62  ARG C C   1 
ATOM   7879  O  O   . ARG C  1 87  ? 60.074  -12.764 -7.144   1.00 23.12  ? 62  ARG C O   1 
ATOM   7880  C  CB  . ARG C  1 87  ? 61.456  -14.340 -4.630   1.00 29.45  ? 62  ARG C CB  1 
ATOM   7881  C  CG  . ARG C  1 87  ? 62.650  -15.269 -4.416   1.00 36.82  ? 62  ARG C CG  1 
ATOM   7882  C  CD  . ARG C  1 87  ? 62.307  -16.554 -3.662   1.00 44.26  ? 62  ARG C CD  1 
ATOM   7883  N  NE  . ARG C  1 87  ? 61.260  -17.328 -4.334   1.00 52.22  ? 62  ARG C NE  1 
ATOM   7884  C  CZ  . ARG C  1 87  ? 60.172  -17.820 -3.740   1.00 57.49  ? 62  ARG C CZ  1 
ATOM   7885  N  NH1 . ARG C  1 87  ? 59.284  -18.502 -4.448   1.00 56.35  ? 62  ARG C NH1 1 
ATOM   7886  N  NH2 . ARG C  1 87  ? 59.973  -17.648 -2.437   1.00 61.72  ? 62  ARG C NH2 1 
ATOM   7887  N  N   . ARG C  1 88  ? 60.021  -11.462 -5.321   1.00 20.58  ? 63  ARG C N   1 
ATOM   7888  C  CA  . ARG C  1 88  ? 58.874  -10.688 -5.819   1.00 20.40  ? 63  ARG C CA  1 
ATOM   7889  C  C   . ARG C  1 88  ? 59.281  -9.884  -7.053   1.00 18.93  ? 63  ARG C C   1 
ATOM   7890  O  O   . ARG C  1 88  ? 58.577  -9.891  -8.055   1.00 18.20  ? 63  ARG C O   1 
ATOM   7891  C  CB  . ARG C  1 88  ? 58.250  -9.784  -4.741   1.00 20.76  ? 63  ARG C CB  1 
ATOM   7892  C  CG  . ARG C  1 88  ? 57.931  -10.488 -3.428   1.00 22.22  ? 63  ARG C CG  1 
ATOM   7893  C  CD  . ARG C  1 88  ? 56.856  -9.774  -2.611   1.00 22.31  ? 63  ARG C CD  1 
ATOM   7894  N  NE  . ARG C  1 88  ? 57.281  -8.443  -2.167   1.00 22.88  ? 63  ARG C NE  1 
ATOM   7895  C  CZ  . ARG C  1 88  ? 57.966  -8.191  -1.046   1.00 22.47  ? 63  ARG C CZ  1 
ATOM   7896  N  NH1 . ARG C  1 88  ? 58.324  -9.173  -0.228   1.00 20.99  ? 63  ARG C NH1 1 
ATOM   7897  N  NH2 . ARG C  1 88  ? 58.296  -6.941  -0.743   1.00 22.38  ? 63  ARG C NH2 1 
ATOM   7898  N  N   . ALA C  1 89  ? 60.435  -9.229  -6.984   1.00 19.19  ? 64  ALA C N   1 
ATOM   7899  C  CA  . ALA C  1 89  ? 60.968  -8.468  -8.121   1.00 19.94  ? 64  ALA C CA  1 
ATOM   7900  C  C   . ALA C  1 89  ? 61.100  -9.321  -9.413   1.00 21.20  ? 64  ALA C C   1 
ATOM   7901  O  O   . ALA C  1 89  ? 60.802  -8.847  -10.505  1.00 21.95  ? 64  ALA C O   1 
ATOM   7902  C  CB  . ALA C  1 89  ? 62.301  -7.839  -7.744   1.00 19.53  ? 64  ALA C CB  1 
ATOM   7903  N  N   . ARG C  1 90  ? 61.518  -10.577 -9.282   1.00 21.40  ? 65  ARG C N   1 
ATOM   7904  C  CA  . ARG C  1 90  ? 61.680  -11.476 -10.450  1.00 22.04  ? 65  ARG C CA  1 
ATOM   7905  C  C   . ARG C  1 90  ? 60.375  -11.766 -11.208  1.00 21.08  ? 65  ARG C C   1 
ATOM   7906  O  O   . ARG C  1 90  ? 60.393  -11.963 -12.425  1.00 20.39  ? 65  ARG C O   1 
ATOM   7907  C  CB  . ARG C  1 90  ? 62.381  -12.785 -10.051  1.00 23.44  ? 65  ARG C CB  1 
ATOM   7908  C  CG  . ARG C  1 90  ? 63.772  -12.533 -9.503   1.00 24.38  ? 65  ARG C CG  1 
ATOM   7909  C  CD  . ARG C  1 90  ? 64.575  -13.795 -9.240   1.00 26.03  ? 65  ARG C CD  1 
ATOM   7910  N  NE  . ARG C  1 90  ? 65.903  -13.403 -8.758   1.00 27.76  ? 65  ARG C NE  1 
ATOM   7911  C  CZ  . ARG C  1 90  ? 66.425  -13.736 -7.579   1.00 28.68  ? 65  ARG C CZ  1 
ATOM   7912  N  NH1 . ARG C  1 90  ? 67.630  -13.287 -7.241   1.00 28.52  ? 65  ARG C NH1 1 
ATOM   7913  N  NH2 . ARG C  1 90  ? 65.756  -14.523 -6.741   1.00 28.75  ? 65  ARG C NH2 1 
ATOM   7914  N  N   . VAL C  1 91  ? 59.249  -11.796 -10.497  1.00 20.99  ? 66  VAL C N   1 
ATOM   7915  C  CA  . VAL C  1 91  ? 57.946  -11.902 -11.168  1.00 20.99  ? 66  VAL C CA  1 
ATOM   7916  C  C   . VAL C  1 91  ? 57.796  -10.729 -12.168  1.00 20.68  ? 66  VAL C C   1 
ATOM   7917  O  O   . VAL C  1 91  ? 57.441  -10.936 -13.353  1.00 19.86  ? 66  VAL C O   1 
ATOM   7918  C  CB  . VAL C  1 91  ? 56.770  -11.998 -10.171  1.00 20.29  ? 66  VAL C CB  1 
ATOM   7919  C  CG1 . VAL C  1 91  ? 55.440  -11.897 -10.887  1.00 19.96  ? 66  VAL C CG1 1 
ATOM   7920  C  CG2 . VAL C  1 91  ? 56.828  -13.325 -9.410   1.00 21.15  ? 66  VAL C CG2 1 
ATOM   7921  N  N   . PHE C  1 92  ? 58.134  -9.523  -11.707  1.00 19.73  ? 67  PHE C N   1 
ATOM   7922  C  CA  . PHE C  1 92  ? 58.094  -8.338  -12.556  1.00 19.74  ? 67  PHE C CA  1 
ATOM   7923  C  C   . PHE C  1 92  ? 59.072  -8.368  -13.733  1.00 20.66  ? 67  PHE C C   1 
ATOM   7924  O  O   . PHE C  1 92  ? 58.718  -7.932  -14.839  1.00 21.40  ? 67  PHE C O   1 
ATOM   7925  C  CB  . PHE C  1 92  ? 58.190  -7.060  -11.716  1.00 19.17  ? 67  PHE C CB  1 
ATOM   7926  C  CG  . PHE C  1 92  ? 56.920  -6.761  -10.968  1.00 19.25  ? 67  PHE C CG  1 
ATOM   7927  C  CD1 . PHE C  1 92  ? 55.844  -6.153  -11.616  1.00 19.47  ? 67  PHE C CD1 1 
ATOM   7928  C  CD2 . PHE C  1 92  ? 56.770  -7.129  -9.636   1.00 19.60  ? 67  PHE C CD2 1 
ATOM   7929  C  CE1 . PHE C  1 92  ? 54.652  -5.893  -10.940  1.00 19.56  ? 67  PHE C CE1 1 
ATOM   7930  C  CE2 . PHE C  1 92  ? 55.585  -6.871  -8.957   1.00 19.64  ? 67  PHE C CE2 1 
ATOM   7931  C  CZ  . PHE C  1 92  ? 54.525  -6.251  -9.605   1.00 19.19  ? 67  PHE C CZ  1 
HETATM 7932  N  N   . MSE C  1 93  ? 60.273  -8.905  -13.524  1.00 21.02  ? 68  MSE C N   1 
HETATM 7933  C  CA  . MSE C  1 93  ? 61.244  -9.036  -14.619  1.00 22.74  ? 68  MSE C CA  1 
HETATM 7934  C  C   . MSE C  1 93  ? 60.717  -9.955  -15.681  1.00 22.41  ? 68  MSE C C   1 
HETATM 7935  O  O   . MSE C  1 93  ? 60.860  -9.679  -16.873  1.00 22.74  ? 68  MSE C O   1 
HETATM 7936  C  CB  . MSE C  1 93  ? 62.519  -9.676  -14.124  1.00 26.58  ? 68  MSE C CB  1 
HETATM 7937  C  CG  . MSE C  1 93  ? 63.630  -8.667  -13.904  1.00 34.04  ? 68  MSE C CG  1 
HETATM 7938  SE SE  . MSE C  1 93  ? 65.117  -9.678  -13.086  1.00 43.84  ? 68  MSE C SE  1 
HETATM 7939  C  CE  . MSE C  1 93  ? 64.751  -9.407  -11.169  1.00 35.46  ? 68  MSE C CE  1 
ATOM   7940  N  N   . LYS C  1 94  ? 60.129  -11.075 -15.263  1.00 22.22  ? 69  LYS C N   1 
ATOM   7941  C  CA  . LYS C  1 94  ? 59.514  -12.010 -16.192  1.00 24.17  ? 69  LYS C CA  1 
ATOM   7942  C  C   . LYS C  1 94  ? 58.334  -11.333 -16.887  1.00 22.37  ? 69  LYS C C   1 
ATOM   7943  O  O   . LYS C  1 94  ? 58.175  -11.449 -18.100  1.00 21.79  ? 69  LYS C O   1 
ATOM   7944  C  CB  . LYS C  1 94  ? 59.065  -13.295 -15.480  1.00 28.16  ? 69  LYS C CB  1 
ATOM   7945  C  CG  . LYS C  1 94  ? 60.194  -14.214 -15.017  1.00 35.77  ? 69  LYS C CG  1 
ATOM   7946  C  CD  . LYS C  1 94  ? 60.575  -15.283 -16.053  1.00 41.84  ? 69  LYS C CD  1 
ATOM   7947  C  CE  . LYS C  1 94  ? 61.476  -14.738 -17.168  1.00 44.55  ? 69  LYS C CE  1 
ATOM   7948  N  NZ  . LYS C  1 94  ? 62.131  -15.795 -17.987  1.00 43.55  ? 69  LYS C NZ  1 
ATOM   7949  N  N   . PHE C  1 95  ? 57.536  -10.595 -16.118  1.00 21.67  ? 70  PHE C N   1 
ATOM   7950  C  CA  . PHE C  1 95  ? 56.347  -9.921  -16.662  1.00 21.30  ? 70  PHE C CA  1 
ATOM   7951  C  C   . PHE C  1 95  ? 56.715  -8.925  -17.750  1.00 20.24  ? 70  PHE C C   1 
ATOM   7952  O  O   . PHE C  1 95  ? 56.060  -8.882  -18.794  1.00 20.03  ? 70  PHE C O   1 
ATOM   7953  C  CB  . PHE C  1 95  ? 55.545  -9.243  -15.560  1.00 21.11  ? 70  PHE C CB  1 
ATOM   7954  C  CG  . PHE C  1 95  ? 54.277  -8.592  -16.036  1.00 22.19  ? 70  PHE C CG  1 
ATOM   7955  C  CD1 . PHE C  1 95  ? 53.210  -9.357  -16.498  1.00 23.58  ? 70  PHE C CD1 1 
ATOM   7956  C  CD2 . PHE C  1 95  ? 54.136  -7.209  -15.984  1.00 22.26  ? 70  PHE C CD2 1 
ATOM   7957  C  CE1 . PHE C  1 95  ? 52.028  -8.749  -16.916  1.00 24.92  ? 70  PHE C CE1 1 
ATOM   7958  C  CE2 . PHE C  1 95  ? 52.958  -6.592  -16.399  1.00 23.48  ? 70  PHE C CE2 1 
ATOM   7959  C  CZ  . PHE C  1 95  ? 51.903  -7.364  -16.868  1.00 24.36  ? 70  PHE C CZ  1 
ATOM   7960  N  N   . VAL C  1 96  ? 57.768  -8.149  -17.504  1.00 19.32  ? 71  VAL C N   1 
ATOM   7961  C  CA  . VAL C  1 96  ? 58.257  -7.187  -18.484  1.00 19.81  ? 71  VAL C CA  1 
ATOM   7962  C  C   . VAL C  1 96  ? 58.570  -7.895  -19.804  1.00 21.85  ? 71  VAL C C   1 
ATOM   7963  O  O   . VAL C  1 96  ? 58.161  -7.426  -20.876  1.00 21.36  ? 71  VAL C O   1 
ATOM   7964  C  CB  . VAL C  1 96  ? 59.492  -6.442  -17.952  1.00 19.77  ? 71  VAL C CB  1 
ATOM   7965  C  CG1 . VAL C  1 96  ? 60.255  -5.756  -19.083  1.00 20.38  ? 71  VAL C CG1 1 
ATOM   7966  C  CG2 . VAL C  1 96  ? 59.078  -5.462  -16.862  1.00 18.83  ? 71  VAL C CG2 1 
ATOM   7967  N  N   . GLN C  1 97  ? 59.270  -9.029  -19.720  1.00 23.22  ? 72  GLN C N   1 
ATOM   7968  C  CA  . GLN C  1 97  ? 59.605  -9.799  -20.912  1.00 26.66  ? 72  GLN C CA  1 
ATOM   7969  C  C   . GLN C  1 97  ? 58.349  -10.305 -21.622  1.00 26.99  ? 72  GLN C C   1 
ATOM   7970  O  O   . GLN C  1 97  ? 58.287  -10.326 -22.850  1.00 27.61  ? 72  GLN C O   1 
ATOM   7971  C  CB  . GLN C  1 97  ? 60.563  -10.958 -20.582  1.00 31.04  ? 72  GLN C CB  1 
ATOM   7972  C  CG  . GLN C  1 97  ? 61.215  -11.601 -21.812  1.00 38.93  ? 72  GLN C CG  1 
ATOM   7973  C  CD  . GLN C  1 97  ? 61.545  -10.612 -22.948  1.00 45.74  ? 72  GLN C CD  1 
ATOM   7974  O  OE1 . GLN C  1 97  ? 62.138  -9.543  -22.728  1.00 49.19  ? 72  GLN C OE1 1 
ATOM   7975  N  NE2 . GLN C  1 97  ? 61.163  -10.974 -24.170  1.00 44.46  ? 72  GLN C NE2 1 
ATOM   7976  N  N   . LEU C  1 98  ? 57.342  -10.696 -20.847  1.00 26.25  ? 73  LEU C N   1 
ATOM   7977  C  CA  . LEU C  1 98  ? 56.094  -11.188 -21.426  1.00 25.84  ? 73  LEU C CA  1 
ATOM   7978  C  C   . LEU C  1 98  ? 55.322  -10.100 -22.176  1.00 24.61  ? 73  LEU C C   1 
ATOM   7979  O  O   . LEU C  1 98  ? 54.732  -10.366 -23.245  1.00 24.78  ? 73  LEU C O   1 
ATOM   7980  C  CB  . LEU C  1 98  ? 55.220  -11.860 -20.363  1.00 24.97  ? 73  LEU C CB  1 
ATOM   7981  C  CG  . LEU C  1 98  ? 55.708  -13.249 -19.957  1.00 25.57  ? 73  LEU C CG  1 
ATOM   7982  C  CD1 . LEU C  1 98  ? 54.879  -13.763 -18.787  1.00 26.28  ? 73  LEU C CD1 1 
ATOM   7983  C  CD2 . LEU C  1 98  ? 55.665  -14.214 -21.136  1.00 25.67  ? 73  LEU C CD2 1 
ATOM   7984  N  N   . LEU C  1 99  ? 55.349  -8.886  -21.626  1.00 22.72  ? 74  LEU C N   1 
ATOM   7985  C  CA  . LEU C  1 99  ? 54.744  -7.724  -22.275  1.00 22.62  ? 74  LEU C CA  1 
ATOM   7986  C  C   . LEU C  1 99  ? 55.361  -7.496  -23.643  1.00 24.25  ? 74  LEU C C   1 
ATOM   7987  O  O   . LEU C  1 99  ? 54.630  -7.336  -24.620  1.00 25.69  ? 74  LEU C O   1 
ATOM   7988  C  CB  . LEU C  1 99  ? 54.889  -6.463  -21.424  1.00 21.62  ? 74  LEU C CB  1 
ATOM   7989  C  CG  . LEU C  1 99  ? 54.114  -6.416  -20.101  1.00 20.59  ? 74  LEU C CG  1 
ATOM   7990  C  CD1 . LEU C  1 99  ? 54.475  -5.157  -19.323  1.00 19.24  ? 74  LEU C CD1 1 
ATOM   7991  C  CD2 . LEU C  1 99  ? 52.611  -6.509  -20.349  1.00 20.17  ? 74  LEU C CD2 1 
ATOM   7992  N  N   . ASN C  1 100 ? 56.695  -7.503  -23.705  1.00 23.74  ? 75  ASN C N   1 
ATOM   7993  C  CA  . ASN C  1 100 ? 57.417  -7.372  -24.963  1.00 25.19  ? 75  ASN C CA  1 
ATOM   7994  C  C   . ASN C  1 100 ? 57.072  -8.467  -25.953  1.00 26.20  ? 75  ASN C C   1 
ATOM   7995  O  O   . ASN C  1 100 ? 56.846  -8.176  -27.111  1.00 27.60  ? 75  ASN C O   1 
ATOM   7996  C  CB  . ASN C  1 100 ? 58.933  -7.292  -24.728  1.00 26.19  ? 75  ASN C CB  1 
ATOM   7997  C  CG  . ASN C  1 100 ? 59.358  -5.928  -24.227  1.00 28.11  ? 75  ASN C CG  1 
ATOM   7998  O  OD1 . ASN C  1 100 ? 58.929  -4.911  -24.764  1.00 30.42  ? 75  ASN C OD1 1 
ATOM   7999  N  ND2 . ASN C  1 100 ? 60.173  -5.892  -23.178  1.00 28.08  ? 75  ASN C ND2 1 
ATOM   8000  N  N   . ASP C  1 101 ? 57.005  -9.716  -25.491  1.00 26.61  ? 76  ASP C N   1 
ATOM   8001  C  CA  . ASP C  1 101 ? 56.633  -10.839 -26.356  1.00 29.00  ? 76  ASP C CA  1 
ATOM   8002  C  C   . ASP C  1 101 ? 55.211  -10.721 -26.897  1.00 29.75  ? 76  ASP C C   1 
ATOM   8003  O  O   . ASP C  1 101 ? 54.918  -11.220 -27.977  1.00 32.06  ? 76  ASP C O   1 
ATOM   8004  C  CB  . ASP C  1 101 ? 56.743  -12.174 -25.607  1.00 31.58  ? 76  ASP C CB  1 
ATOM   8005  C  CG  . ASP C  1 101 ? 58.162  -12.512 -25.188  1.00 34.95  ? 76  ASP C CG  1 
ATOM   8006  O  OD1 . ASP C  1 101 ? 59.113  -11.827 -25.617  1.00 35.19  ? 76  ASP C OD1 1 
ATOM   8007  O  OD2 . ASP C  1 101 ? 58.320  -13.480 -24.415  1.00 38.83  ? 76  ASP C OD2 1 
ATOM   8008  N  N   . ASN C  1 102 ? 54.328  -10.091 -26.126  1.00 28.81  ? 77  ASN C N   1 
ATOM   8009  C  CA  . ASN C  1 102 ? 52.908  -10.013 -26.463  1.00 27.26  ? 77  ASN C CA  1 
ATOM   8010  C  C   . ASN C  1 102 ? 52.480  -8.612  -26.941  1.00 25.58  ? 77  ASN C C   1 
ATOM   8011  O  O   . ASN C  1 102 ? 51.282  -8.319  -27.043  1.00 24.11  ? 77  ASN C O   1 
ATOM   8012  C  CB  . ASN C  1 102 ? 52.071  -10.419 -25.249  1.00 26.98  ? 77  ASN C CB  1 
ATOM   8013  C  CG  . ASN C  1 102 ? 52.056  -11.919 -25.013  1.00 29.62  ? 77  ASN C CG  1 
ATOM   8014  O  OD1 . ASN C  1 102 ? 51.060  -12.579 -25.294  1.00 31.07  ? 77  ASN C OD1 1 
ATOM   8015  N  ND2 . ASN C  1 102 ? 53.150  -12.463 -24.479  1.00 30.00  ? 77  ASN C ND2 1 
HETATM 8016  N  N   . MSE C  1 103 ? 53.461  -7.755  -27.219  1.00 24.44  ? 78  MSE C N   1 
HETATM 8017  C  CA  . MSE C  1 103 ? 53.207  -6.349  -27.540  1.00 25.68  ? 78  MSE C CA  1 
HETATM 8018  C  C   . MSE C  1 103 ? 52.192  -6.173  -28.648  1.00 25.94  ? 78  MSE C C   1 
HETATM 8019  O  O   . MSE C  1 103 ? 51.242  -5.408  -28.508  1.00 26.61  ? 78  MSE C O   1 
HETATM 8020  C  CB  . MSE C  1 103 ? 54.535  -5.668  -27.888  1.00 27.25  ? 78  MSE C CB  1 
HETATM 8021  C  CG  . MSE C  1 103 ? 54.414  -4.175  -28.165  1.00 30.04  ? 78  MSE C CG  1 
HETATM 8022  SE SE  . MSE C  1 103 ? 53.876  -3.108  -26.589  1.00 35.27  ? 78  MSE C SE  1 
HETATM 8023  C  CE  . MSE C  1 103 ? 55.416  -3.371  -25.384  1.00 35.02  ? 78  MSE C CE  1 
ATOM   8024  N  N   . ASN C  1 104 ? 52.358  -6.887  -29.746  1.00 25.86  ? 79  ASN C N   1 
ATOM   8025  C  CA  . ASN C  1 104 ? 51.466  -6.695  -30.875  1.00 27.16  ? 79  ASN C CA  1 
ATOM   8026  C  C   . ASN C  1 104 ? 50.024  -7.061  -30.568  1.00 27.56  ? 79  ASN C C   1 
ATOM   8027  O  O   . ASN C  1 104 ? 49.110  -6.320  -30.928  1.00 27.94  ? 79  ASN C O   1 
ATOM   8028  C  CB  . ASN C  1 104 ? 51.980  -7.433  -32.108  1.00 27.88  ? 79  ASN C CB  1 
ATOM   8029  C  CG  . ASN C  1 104 ? 53.249  -6.819  -32.650  1.00 28.85  ? 79  ASN C CG  1 
ATOM   8030  O  OD1 . ASN C  1 104 ? 53.672  -5.758  -32.204  1.00 29.23  ? 79  ASN C OD1 1 
ATOM   8031  N  ND2 . ASN C  1 104 ? 53.860  -7.478  -33.619  1.00 29.90  ? 79  ASN C ND2 1 
ATOM   8032  N  N   . GLU C  1 105 ? 49.839  -8.195  -29.895  1.00 27.53  ? 80  GLU C N   1 
ATOM   8033  C  CA  . GLU C  1 105 ? 48.520  -8.678  -29.484  1.00 28.64  ? 80  GLU C CA  1 
ATOM   8034  C  C   . GLU C  1 105 ? 47.850  -7.689  -28.529  1.00 25.20  ? 80  GLU C C   1 
ATOM   8035  O  O   . GLU C  1 105 ? 46.677  -7.341  -28.704  1.00 23.92  ? 80  GLU C O   1 
ATOM   8036  C  CB  . GLU C  1 105 ? 48.643  -10.044 -28.804  1.00 33.13  ? 80  GLU C CB  1 
ATOM   8037  C  CG  . GLU C  1 105 ? 49.151  -11.174 -29.698  1.00 39.94  ? 80  GLU C CG  1 
ATOM   8038  C  CD  . GLU C  1 105 ? 50.635  -11.082 -30.071  1.00 44.91  ? 80  GLU C CD  1 
ATOM   8039  O  OE1 . GLU C  1 105 ? 51.024  -11.768 -31.038  1.00 51.99  ? 80  GLU C OE1 1 
ATOM   8040  O  OE2 . GLU C  1 105 ? 51.419  -10.343 -29.427  1.00 41.61  ? 80  GLU C OE2 1 
ATOM   8041  N  N   . LEU C  1 106 ? 48.609  -7.235  -27.529  1.00 23.17  ? 81  LEU C N   1 
ATOM   8042  C  CA  . LEU C  1 106 ? 48.101  -6.287  -26.548  1.00 22.01  ? 81  LEU C CA  1 
ATOM   8043  C  C   . LEU C  1 106 ? 47.670  -4.976  -27.220  1.00 22.57  ? 81  LEU C C   1 
ATOM   8044  O  O   . LEU C  1 106 ? 46.605  -4.453  -26.923  1.00 21.29  ? 81  LEU C O   1 
ATOM   8045  C  CB  . LEU C  1 106 ? 49.152  -6.015  -25.475  1.00 20.85  ? 81  LEU C CB  1 
ATOM   8046  C  CG  . LEU C  1 106 ? 49.414  -7.090  -24.413  1.00 20.15  ? 81  LEU C CG  1 
ATOM   8047  C  CD1 . LEU C  1 106 ? 50.698  -6.785  -23.662  1.00 18.85  ? 81  LEU C CD1 1 
ATOM   8048  C  CD2 . LEU C  1 106 ? 48.236  -7.224  -23.450  1.00 19.75  ? 81  LEU C CD2 1 
ATOM   8049  N  N   . ALA C  1 107 ? 48.502  -4.455  -28.126  1.00 23.85  ? 82  ALA C N   1 
ATOM   8050  C  CA  . ALA C  1 107 ? 48.180  -3.219  -28.842  1.00 24.03  ? 82  ALA C CA  1 
ATOM   8051  C  C   . ALA C  1 107 ? 46.907  -3.376  -29.678  1.00 24.09  ? 82  ALA C C   1 
ATOM   8052  O  O   . ALA C  1 107 ? 46.040  -2.495  -29.675  1.00 24.32  ? 82  ALA C O   1 
ATOM   8053  C  CB  . ALA C  1 107 ? 49.346  -2.778  -29.717  1.00 23.88  ? 82  ALA C CB  1 
ATOM   8054  N  N   . GLU C  1 108 ? 46.799  -4.506  -30.374  1.00 23.57  ? 83  GLU C N   1 
ATOM   8055  C  CA  . GLU C  1 108 ? 45.641  -4.791  -31.219  1.00 25.21  ? 83  GLU C CA  1 
ATOM   8056  C  C   . GLU C  1 108 ? 44.321  -4.736  -30.424  1.00 25.07  ? 83  GLU C C   1 
ATOM   8057  O  O   . GLU C  1 108 ? 43.355  -4.104  -30.860  1.00 23.90  ? 83  GLU C O   1 
ATOM   8058  C  CB  . GLU C  1 108 ? 45.818  -6.133  -31.953  1.00 27.69  ? 83  GLU C CB  1 
ATOM   8059  C  CG  . GLU C  1 108 ? 44.849  -6.367  -33.114  1.00 31.67  ? 83  GLU C CG  1 
ATOM   8060  C  CD  . GLU C  1 108 ? 43.480  -6.919  -32.693  1.00 35.43  ? 83  GLU C CD  1 
ATOM   8061  O  OE1 . GLU C  1 108 ? 43.305  -7.333  -31.510  1.00 33.61  ? 83  GLU C OE1 1 
ATOM   8062  O  OE2 . GLU C  1 108 ? 42.567  -6.953  -33.562  1.00 38.51  ? 83  GLU C OE2 1 
HETATM 8063  N  N   . MSE C  1 109 ? 44.291  -5.369  -29.254  1.00 25.47  ? 84  MSE C N   1 
HETATM 8064  C  CA  . MSE C  1 109 ? 43.045  -5.476  -28.491  1.00 27.29  ? 84  MSE C CA  1 
HETATM 8065  C  C   . MSE C  1 109 ? 42.689  -4.142  -27.888  1.00 25.74  ? 84  MSE C C   1 
HETATM 8066  O  O   . MSE C  1 109 ? 41.519  -3.754  -27.894  1.00 26.44  ? 84  MSE C O   1 
HETATM 8067  C  CB  . MSE C  1 109 ? 43.084  -6.639  -27.492  1.00 29.37  ? 84  MSE C CB  1 
HETATM 8068  C  CG  . MSE C  1 109 ? 44.187  -6.528  -26.444  1.00 30.67  ? 84  MSE C CG  1 
HETATM 8069  SE SE  . MSE C  1 109 ? 43.985  -7.990  -25.137  1.00 33.59  ? 84  MSE C SE  1 
HETATM 8070  C  CE  . MSE C  1 109 ? 44.726  -9.488  -26.175  1.00 32.13  ? 84  MSE C CE  1 
ATOM   8071  N  N   . LEU C  1 110 ? 43.707  -3.426  -27.416  1.00 23.65  ? 85  LEU C N   1 
ATOM   8072  C  CA  . LEU C  1 110 ? 43.565  -2.073  -26.884  1.00 22.82  ? 85  LEU C CA  1 
ATOM   8073  C  C   . LEU C  1 110 ? 42.972  -1.121  -27.932  1.00 22.96  ? 85  LEU C C   1 
ATOM   8074  O  O   . LEU C  1 110 ? 41.897  -0.551  -27.714  1.00 23.76  ? 85  LEU C O   1 
ATOM   8075  C  CB  . LEU C  1 110 ? 44.916  -1.543  -26.369  1.00 20.73  ? 85  LEU C CB  1 
ATOM   8076  C  CG  . LEU C  1 110 ? 44.944  -0.480  -25.251  1.00 19.88  ? 85  LEU C CG  1 
ATOM   8077  C  CD1 . LEU C  1 110 ? 46.312  -0.402  -24.578  1.00 18.71  ? 85  LEU C CD1 1 
ATOM   8078  C  CD2 . LEU C  1 110 ? 44.536  0.901   -25.748  1.00 19.83  ? 85  LEU C CD2 1 
ATOM   8079  N  N   . SER C  1 111 ? 43.662  -0.980  -29.066  1.00 21.97  ? 86  SER C N   1 
ATOM   8080  C  CA  . SER C  1 111 ? 43.211  -0.133  -30.185  1.00 21.48  ? 86  SER C CA  1 
ATOM   8081  C  C   . SER C  1 111 ? 41.782  -0.446  -30.653  1.00 21.94  ? 86  SER C C   1 
ATOM   8082  O  O   . SER C  1 111 ? 40.996  0.465   -30.905  1.00 21.25  ? 86  SER C O   1 
ATOM   8083  C  CB  . SER C  1 111 ? 44.176  -0.265  -31.367  1.00 20.95  ? 86  SER C CB  1 
ATOM   8084  O  OG  . SER C  1 111 ? 45.408  0.372   -31.092  1.00 19.86  ? 86  SER C OG  1 
ATOM   8085  N  N   . ARG C  1 112 ? 41.457  -1.738  -30.743  1.00 22.74  ? 87  ARG C N   1 
ATOM   8086  C  CA  . ARG C  1 112 ? 40.150  -2.182  -31.214  1.00 24.23  ? 87  ARG C CA  1 
ATOM   8087  C  C   . ARG C  1 112 ? 39.007  -1.744  -30.282  1.00 25.01  ? 87  ARG C C   1 
ATOM   8088  O  O   . ARG C  1 112 ? 37.900  -1.487  -30.741  1.00 26.85  ? 87  ARG C O   1 
ATOM   8089  C  CB  . ARG C  1 112 ? 40.142  -3.699  -31.451  1.00 25.04  ? 87  ARG C CB  1 
ATOM   8090  C  CG  . ARG C  1 112 ? 38.862  -4.242  -32.069  1.00 26.71  ? 87  ARG C CG  1 
ATOM   8091  C  CD  . ARG C  1 112 ? 39.027  -5.665  -32.599  1.00 27.73  ? 87  ARG C CD  1 
ATOM   8092  N  NE  . ARG C  1 112 ? 39.917  -6.475  -31.759  1.00 27.92  ? 87  ARG C NE  1 
ATOM   8093  C  CZ  . ARG C  1 112 ? 39.643  -6.871  -30.518  1.00 27.85  ? 87  ARG C CZ  1 
ATOM   8094  N  NH1 . ARG C  1 112 ? 38.500  -6.530  -29.933  1.00 28.01  ? 87  ARG C NH1 1 
ATOM   8095  N  NH2 . ARG C  1 112 ? 40.525  -7.601  -29.853  1.00 27.44  ? 87  ARG C NH2 1 
ATOM   8096  N  N   . GLU C  1 113 ? 39.274  -1.631  -28.986  1.00 24.34  ? 88  GLU C N   1 
ATOM   8097  C  CA  . GLU C  1 113 ? 38.235  -1.183  -28.049  1.00 23.57  ? 88  GLU C CA  1 
ATOM   8098  C  C   . GLU C  1 113 ? 38.269  0.322   -27.810  1.00 23.25  ? 88  GLU C C   1 
ATOM   8099  O  O   . GLU C  1 113 ? 37.226  0.945   -27.690  1.00 23.85  ? 88  GLU C O   1 
ATOM   8100  C  CB  . GLU C  1 113 ? 38.331  -1.937  -26.724  1.00 22.20  ? 88  GLU C CB  1 
ATOM   8101  C  CG  . GLU C  1 113 ? 38.222  -3.440  -26.889  1.00 21.72  ? 88  GLU C CG  1 
ATOM   8102  C  CD  . GLU C  1 113 ? 38.262  -4.205  -25.579  1.00 21.19  ? 88  GLU C CD  1 
ATOM   8103  O  OE1 . GLU C  1 113 ? 39.032  -3.818  -24.678  1.00 20.04  ? 88  GLU C OE1 1 
ATOM   8104  O  OE2 . GLU C  1 113 ? 37.533  -5.224  -25.476  1.00 21.53  ? 88  GLU C OE2 1 
ATOM   8105  N  N   . HIS C  1 114 ? 39.470  0.895   -27.774  1.00 22.26  ? 89  HIS C N   1 
ATOM   8106  C  CA  . HIS C  1 114 ? 39.666  2.292   -27.388  1.00 21.49  ? 89  HIS C CA  1 
ATOM   8107  C  C   . HIS C  1 114 ? 39.507  3.252   -28.562  1.00 22.12  ? 89  HIS C C   1 
ATOM   8108  O  O   . HIS C  1 114 ? 38.867  4.294   -28.430  1.00 22.38  ? 89  HIS C O   1 
ATOM   8109  C  CB  . HIS C  1 114 ? 41.047  2.477   -26.753  1.00 20.14  ? 89  HIS C CB  1 
ATOM   8110  C  CG  . HIS C  1 114 ? 41.383  3.901   -26.440  1.00 19.70  ? 89  HIS C CG  1 
ATOM   8111  N  ND1 . HIS C  1 114 ? 41.526  4.864   -27.417  1.00 19.56  ? 89  HIS C ND1 1 
ATOM   8112  C  CD2 . HIS C  1 114 ? 41.617  4.524   -25.259  1.00 19.65  ? 89  HIS C CD2 1 
ATOM   8113  C  CE1 . HIS C  1 114 ? 41.829  6.019   -26.851  1.00 19.71  ? 89  HIS C CE1 1 
ATOM   8114  N  NE2 . HIS C  1 114 ? 41.890  5.842   -25.542  1.00 19.52  ? 89  HIS C NE2 1 
ATOM   8115  N  N   . GLY C  1 115 ? 40.103  2.904   -29.701  1.00 22.07  ? 90  GLY C N   1 
ATOM   8116  C  CA  . GLY C  1 115 ? 40.071  3.761   -30.870  1.00 22.59  ? 90  GLY C CA  1 
ATOM   8117  C  C   . GLY C  1 115 ? 41.441  4.209   -31.339  1.00 23.32  ? 90  GLY C C   1 
ATOM   8118  O  O   . GLY C  1 115 ? 41.672  4.310   -32.551  1.00 24.21  ? 90  GLY C O   1 
ATOM   8119  N  N   . LYS C  1 116 ? 42.353  4.468   -30.394  1.00 22.01  ? 91  LYS C N   1 
ATOM   8120  C  CA  . LYS C  1 116 ? 43.664  5.039   -30.735  1.00 22.36  ? 91  LYS C CA  1 
ATOM   8121  C  C   . LYS C  1 116 ? 44.514  4.158   -31.636  1.00 22.11  ? 91  LYS C C   1 
ATOM   8122  O  O   . LYS C  1 116 ? 44.264  2.960   -31.755  1.00 22.80  ? 91  LYS C O   1 
ATOM   8123  C  CB  . LYS C  1 116 ? 44.449  5.464   -29.482  1.00 22.90  ? 91  LYS C CB  1 
ATOM   8124  C  CG  . LYS C  1 116 ? 44.807  4.377   -28.482  1.00 23.41  ? 91  LYS C CG  1 
ATOM   8125  C  CD  . LYS C  1 116 ? 45.277  5.079   -27.216  1.00 23.80  ? 91  LYS C CD  1 
ATOM   8126  C  CE  . LYS C  1 116 ? 45.762  4.120   -26.172  1.00 23.40  ? 91  LYS C CE  1 
ATOM   8127  N  NZ  . LYS C  1 116 ? 45.793  4.800   -24.855  1.00 22.57  ? 91  LYS C NZ  1 
ATOM   8128  N  N   . THR C  1 117 ? 45.515  4.760   -32.273  1.00 21.28  ? 92  THR C N   1 
ATOM   8129  C  CA  . THR C  1 117 ? 46.363  4.044   -33.221  1.00 21.31  ? 92  THR C CA  1 
ATOM   8130  C  C   . THR C  1 117 ? 47.167  2.954   -32.523  1.00 20.87  ? 92  THR C C   1 
ATOM   8131  O  O   . THR C  1 117 ? 47.396  3.026   -31.317  1.00 21.13  ? 92  THR C O   1 
ATOM   8132  C  CB  . THR C  1 117 ? 47.361  4.983   -33.916  1.00 21.54  ? 92  THR C CB  1 
ATOM   8133  O  OG1 . THR C  1 117 ? 48.410  5.292   -33.003  1.00 21.12  ? 92  THR C OG1 1 
ATOM   8134  C  CG2 . THR C  1 117 ? 46.688  6.290   -34.386  1.00 21.18  ? 92  THR C CG2 1 
ATOM   8135  N  N   . ILE C  1 118 ? 47.598  1.958   -33.289  1.00 20.62  ? 93  ILE C N   1 
ATOM   8136  C  CA  . ILE C  1 118 ? 48.438  0.880   -32.781  1.00 21.65  ? 93  ILE C CA  1 
ATOM   8137  C  C   . ILE C  1 118 ? 49.691  1.408   -32.068  1.00 23.64  ? 93  ILE C C   1 
ATOM   8138  O  O   . ILE C  1 118 ? 50.033  0.941   -30.969  1.00 23.57  ? 93  ILE C O   1 
ATOM   8139  C  CB  . ILE C  1 118 ? 48.807  -0.118  -33.906  1.00 21.03  ? 93  ILE C CB  1 
ATOM   8140  C  CG1 . ILE C  1 118 ? 47.582  -0.963  -34.317  1.00 21.09  ? 93  ILE C CG1 1 
ATOM   8141  C  CG2 . ILE C  1 118 ? 49.953  -1.022  -33.483  1.00 20.45  ? 93  ILE C CG2 1 
ATOM   8142  C  CD1 . ILE C  1 118 ? 47.101  -1.952  -33.274  1.00 20.24  ? 93  ILE C CD1 1 
ATOM   8143  N  N   . ASP C  1 119 ? 50.364  2.387   -32.671  1.00 25.16  ? 94  ASP C N   1 
ATOM   8144  C  CA  . ASP C  1 119 ? 51.542  2.975   -32.034  1.00 27.54  ? 94  ASP C CA  1 
ATOM   8145  C  C   . ASP C  1 119 ? 51.220  3.649   -30.714  1.00 27.13  ? 94  ASP C C   1 
ATOM   8146  O  O   . ASP C  1 119 ? 51.998  3.531   -29.776  1.00 25.74  ? 94  ASP C O   1 
ATOM   8147  C  CB  . ASP C  1 119 ? 52.279  3.942   -32.957  1.00 33.08  ? 94  ASP C CB  1 
ATOM   8148  C  CG  . ASP C  1 119 ? 53.221  3.232   -33.918  1.00 40.76  ? 94  ASP C CG  1 
ATOM   8149  O  OD1 . ASP C  1 119 ? 53.235  1.972   -33.964  1.00 42.24  ? 94  ASP C OD1 1 
ATOM   8150  O  OD2 . ASP C  1 119 ? 53.947  3.946   -34.636  1.00 46.46  ? 94  ASP C OD2 1 
ATOM   8151  N  N   . ASP C  1 120 ? 50.084  4.350   -30.644  1.00 27.67  ? 95  ASP C N   1 
ATOM   8152  C  CA  . ASP C  1 120 ? 49.575  4.899   -29.371  1.00 27.17  ? 95  ASP C CA  1 
ATOM   8153  C  C   . ASP C  1 120 ? 49.436  3.795   -28.345  1.00 23.55  ? 95  ASP C C   1 
ATOM   8154  O  O   . ASP C  1 120 ? 49.874  3.929   -27.198  1.00 21.71  ? 95  ASP C O   1 
ATOM   8155  C  CB  . ASP C  1 120 ? 48.188  5.508   -29.551  1.00 32.56  ? 95  ASP C CB  1 
ATOM   8156  C  CG  . ASP C  1 120 ? 48.222  6.958   -29.950  1.00 42.37  ? 95  ASP C CG  1 
ATOM   8157  O  OD1 . ASP C  1 120 ? 48.912  7.746   -29.266  1.00 49.18  ? 95  ASP C OD1 1 
ATOM   8158  O  OD2 . ASP C  1 120 ? 47.525  7.313   -30.931  1.00 44.89  ? 95  ASP C OD2 1 
ATOM   8159  N  N   . ALA C  1 121 ? 48.771  2.722   -28.765  1.00 22.68  ? 96  ALA C N   1 
ATOM   8160  C  CA  . ALA C  1 121 ? 48.523  1.584   -27.906  1.00 22.40  ? 96  ALA C CA  1 
ATOM   8161  C  C   . ALA C  1 121 ? 49.834  1.006   -27.359  1.00 22.20  ? 96  ALA C C   1 
ATOM   8162  O  O   . ALA C  1 121 ? 49.951  0.753   -26.165  1.00 22.31  ? 96  ALA C O   1 
ATOM   8163  C  CB  . ALA C  1 121 ? 47.712  0.526   -28.638  1.00 22.13  ? 96  ALA C CB  1 
ATOM   8164  N  N   . LYS C  1 122 ? 50.825  0.839   -28.225  1.00 22.61  ? 97  LYS C N   1 
ATOM   8165  C  CA  . LYS C  1 122 ? 52.146  0.375   -27.798  1.00 22.10  ? 97  LYS C CA  1 
ATOM   8166  C  C   . LYS C  1 122 ? 52.802  1.311   -26.778  1.00 20.95  ? 97  LYS C C   1 
ATOM   8167  O  O   . LYS C  1 122 ? 53.465  0.838   -25.855  1.00 20.48  ? 97  LYS C O   1 
ATOM   8168  C  CB  . LYS C  1 122 ? 53.064  0.139   -28.995  1.00 22.23  ? 97  LYS C CB  1 
ATOM   8169  C  CG  . LYS C  1 122 ? 52.697  -1.108  -29.779  1.00 23.70  ? 97  LYS C CG  1 
ATOM   8170  C  CD  . LYS C  1 122 ? 53.513  -1.259  -31.048  1.00 23.36  ? 97  LYS C CD  1 
ATOM   8171  C  CE  . LYS C  1 122 ? 53.036  -2.488  -31.789  1.00 25.08  ? 97  LYS C CE  1 
ATOM   8172  N  NZ  . LYS C  1 122 ? 54.004  -2.921  -32.827  1.00 26.30  ? 97  LYS C NZ  1 
ATOM   8173  N  N   . GLY C  1 123 ? 52.620  2.620   -26.940  1.00 19.42  ? 98  GLY C N   1 
ATOM   8174  C  CA  . GLY C  1 123 ? 53.165  3.597   -25.986  1.00 18.97  ? 98  GLY C CA  1 
ATOM   8175  C  C   . GLY C  1 123 ? 52.482  3.496   -24.631  1.00 20.28  ? 98  GLY C C   1 
ATOM   8176  O  O   . GLY C  1 123 ? 53.128  3.608   -23.583  1.00 21.45  ? 98  GLY C O   1 
ATOM   8177  N  N   . ASP C  1 124 ? 51.164  3.289   -24.668  1.00 19.78  ? 99  ASP C N   1 
ATOM   8178  C  CA  . ASP C  1 124 ? 50.325  3.043   -23.505  1.00 19.72  ? 99  ASP C CA  1 
ATOM   8179  C  C   . ASP C  1 124 ? 50.896  1.852   -22.709  1.00 19.77  ? 99  ASP C C   1 
ATOM   8180  O  O   . ASP C  1 124 ? 51.195  1.983   -21.517  1.00 19.41  ? 99  ASP C O   1 
ATOM   8181  C  CB  . ASP C  1 124 ? 48.888  2.782   -24.005  1.00 21.53  ? 99  ASP C CB  1 
ATOM   8182  C  CG  . ASP C  1 124 ? 47.884  2.500   -22.896  1.00 23.90  ? 99  ASP C CG  1 
ATOM   8183  O  OD1 . ASP C  1 124 ? 48.229  1.896   -21.857  1.00 24.25  ? 99  ASP C OD1 1 
ATOM   8184  O  OD2 . ASP C  1 124 ? 46.704  2.860   -23.096  1.00 25.66  ? 99  ASP C OD2 1 
ATOM   8185  N  N   . ILE C  1 125 ? 51.065  0.712   -23.382  1.00 19.05  ? 100 ILE C N   1 
ATOM   8186  C  CA  A ILE C  1 125 ? 51.654  -0.487  -22.779  0.50 18.88  ? 100 ILE C CA  1 
ATOM   8187  C  CA  B ILE C  1 125 ? 51.643  -0.478  -22.760  0.50 18.84  ? 100 ILE C CA  1 
ATOM   8188  C  C   . ILE C  1 125 ? 53.085  -0.228  -22.307  1.00 18.83  ? 100 ILE C C   1 
ATOM   8189  O  O   . ILE C  1 125 ? 53.448  -0.605  -21.204  1.00 18.57  ? 100 ILE C O   1 
ATOM   8190  C  CB  A ILE C  1 125 ? 51.670  -1.677  -23.769  0.50 18.94  ? 100 ILE C CB  1 
ATOM   8191  C  CB  B ILE C  1 125 ? 51.578  -1.709  -23.699  0.50 18.85  ? 100 ILE C CB  1 
ATOM   8192  C  CG1 A ILE C  1 125 ? 50.254  -2.018  -24.248  0.50 19.20  ? 100 ILE C CG1 1 
ATOM   8193  C  CG1 B ILE C  1 125 ? 50.121  -2.125  -23.953  0.50 19.01  ? 100 ILE C CG1 1 
ATOM   8194  C  CG2 A ILE C  1 125 ? 52.315  -2.903  -23.141  0.50 18.69  ? 100 ILE C CG2 1 
ATOM   8195  C  CG2 B ILE C  1 125 ? 52.356  -2.882  -23.125  0.50 18.58  ? 100 ILE C CG2 1 
ATOM   8196  C  CD1 A ILE C  1 125 ? 50.230  -2.607  -25.641  0.50 18.92  ? 100 ILE C CD1 1 
ATOM   8197  C  CD1 B ILE C  1 125 ? 49.442  -2.762  -22.765  0.50 18.61  ? 100 ILE C CD1 1 
ATOM   8198  N  N   . VAL C  1 126 ? 53.906  0.410   -23.149  1.00 19.47  ? 101 VAL C N   1 
ATOM   8199  C  CA  . VAL C  1 126 ? 55.321  0.633   -22.772  1.00 21.24  ? 101 VAL C CA  1 
ATOM   8200  C  C   . VAL C  1 126 ? 55.471  1.448   -21.484  1.00 22.10  ? 101 VAL C C   1 
ATOM   8201  O  O   . VAL C  1 126 ? 56.289  1.108   -20.637  1.00 23.94  ? 101 VAL C O   1 
ATOM   8202  C  CB  . VAL C  1 126 ? 56.185  1.222   -23.910  1.00 22.21  ? 101 VAL C CB  1 
ATOM   8203  C  CG1 . VAL C  1 126 ? 57.507  1.777   -23.375  1.00 21.77  ? 101 VAL C CG1 1 
ATOM   8204  C  CG2 . VAL C  1 126 ? 56.454  0.161   -24.968  1.00 22.17  ? 101 VAL C CG2 1 
ATOM   8205  N  N   . ARG C  1 127 ? 54.665  2.496   -21.328  1.00 21.81  ? 102 ARG C N   1 
ATOM   8206  C  CA  . ARG C  1 127 ? 54.686  3.323   -20.118  1.00 21.85  ? 102 ARG C CA  1 
ATOM   8207  C  C   . ARG C  1 127 ? 54.228  2.561   -18.857  1.00 19.16  ? 102 ARG C C   1 
ATOM   8208  O  O   . ARG C  1 127 ? 54.686  2.851   -17.755  1.00 17.26  ? 102 ARG C O   1 
ATOM   8209  C  CB  . ARG C  1 127 ? 53.883  4.616   -20.304  1.00 25.06  ? 102 ARG C CB  1 
ATOM   8210  C  CG  . ARG C  1 127 ? 54.509  5.603   -21.287  1.00 30.54  ? 102 ARG C CG  1 
ATOM   8211  C  CD  . ARG C  1 127 ? 54.292  7.047   -20.858  1.00 38.27  ? 102 ARG C CD  1 
ATOM   8212  N  NE  . ARG C  1 127 ? 53.089  7.674   -21.424  1.00 48.36  ? 102 ARG C NE  1 
ATOM   8213  C  CZ  . ARG C  1 127 ? 52.323  8.571   -20.789  1.00 51.10  ? 102 ARG C CZ  1 
ATOM   8214  N  NH1 . ARG C  1 127 ? 51.250  9.078   -21.385  1.00 50.27  ? 102 ARG C NH1 1 
ATOM   8215  N  NH2 . ARG C  1 127 ? 52.600  8.938   -19.541  1.00 49.54  ? 102 ARG C NH2 1 
ATOM   8216  N  N   . GLY C  1 128 ? 53.347  1.574   -19.031  1.00 17.84  ? 103 GLY C N   1 
ATOM   8217  C  CA  . GLY C  1 128 ? 52.991  0.664   -17.939  1.00 16.77  ? 103 GLY C CA  1 
ATOM   8218  C  C   . GLY C  1 128 ? 54.155  -0.266  -17.633  1.00 16.04  ? 103 GLY C C   1 
ATOM   8219  O  O   . GLY C  1 128 ? 54.487  -0.517  -16.471  1.00 13.94  ? 103 GLY C O   1 
ATOM   8220  N  N   . LEU C  1 129 ? 54.773  -0.766  -18.705  1.00 17.17  ? 104 LEU C N   1 
ATOM   8221  C  CA  . LEU C  1 129 ? 55.943  -1.625  -18.636  1.00 18.07  ? 104 LEU C CA  1 
ATOM   8222  C  C   . LEU C  1 129 ? 57.054  -0.928  -17.855  1.00 19.82  ? 104 LEU C C   1 
ATOM   8223  O  O   . LEU C  1 129 ? 57.766  -1.577  -17.071  1.00 20.71  ? 104 LEU C O   1 
ATOM   8224  C  CB  . LEU C  1 129 ? 56.412  -1.987  -20.056  1.00 18.25  ? 104 LEU C CB  1 
ATOM   8225  C  CG  . LEU C  1 129 ? 57.660  -2.844  -20.300  1.00 18.34  ? 104 LEU C CG  1 
ATOM   8226  C  CD1 . LEU C  1 129 ? 57.531  -3.494  -21.659  1.00 18.12  ? 104 LEU C CD1 1 
ATOM   8227  C  CD2 . LEU C  1 129 ? 58.948  -2.030  -20.230  1.00 17.99  ? 104 LEU C CD2 1 
ATOM   8228  N  N   . GLU C  1 130 ? 57.190  0.388   -18.047  1.00 19.21  ? 105 GLU C N   1 
ATOM   8229  C  CA  . GLU C  1 130 ? 58.269  1.119   -17.377  1.00 18.77  ? 105 GLU C CA  1 
ATOM   8230  C  C   . GLU C  1 130 ? 58.092  1.207   -15.869  1.00 18.57  ? 105 GLU C C   1 
ATOM   8231  O  O   . GLU C  1 130 ? 59.080  1.256   -15.136  1.00 20.17  ? 105 GLU C O   1 
ATOM   8232  C  CB  . GLU C  1 130 ? 58.514  2.481   -18.019  1.00 18.94  ? 105 GLU C CB  1 
ATOM   8233  C  CG  . GLU C  1 130 ? 59.149  2.319   -19.391  1.00 20.74  ? 105 GLU C CG  1 
ATOM   8234  C  CD  . GLU C  1 130 ? 59.436  3.617   -20.118  1.00 23.62  ? 105 GLU C CD  1 
ATOM   8235  O  OE1 . GLU C  1 130 ? 58.948  4.697   -19.702  1.00 25.44  ? 105 GLU C OE1 1 
ATOM   8236  O  OE2 . GLU C  1 130 ? 60.172  3.549   -21.130  1.00 24.55  ? 105 GLU C OE2 1 
ATOM   8237  N  N   . VAL C  1 131 ? 56.845  1.196   -15.403  1.00 16.68  ? 106 VAL C N   1 
ATOM   8238  C  CA  . VAL C  1 131 ? 56.570  1.104   -13.959  1.00 15.89  ? 106 VAL C CA  1 
ATOM   8239  C  C   . VAL C  1 131 ? 56.949  -0.266  -13.379  1.00 15.50  ? 106 VAL C C   1 
ATOM   8240  O  O   . VAL C  1 131 ? 57.508  -0.358  -12.280  1.00 15.25  ? 106 VAL C O   1 
ATOM   8241  C  CB  . VAL C  1 131 ? 55.103  1.449   -13.618  1.00 16.05  ? 106 VAL C CB  1 
ATOM   8242  C  CG1 . VAL C  1 131 ? 54.913  1.501   -12.100  1.00 16.15  ? 106 VAL C CG1 1 
ATOM   8243  C  CG2 . VAL C  1 131 ? 54.708  2.779   -14.244  1.00 15.60  ? 106 VAL C CG2 1 
ATOM   8244  N  N   . CYS C  1 132 ? 56.650  -1.325  -14.126  1.00 16.31  ? 107 CYS C N   1 
ATOM   8245  C  CA  . CYS C  1 132 ? 57.094  -2.674  -13.785  1.00 17.08  ? 107 CYS C CA  1 
ATOM   8246  C  C   . CYS C  1 132 ? 58.623  -2.782  -13.715  1.00 17.45  ? 107 CYS C C   1 
ATOM   8247  O  O   . CYS C  1 132 ? 59.147  -3.502  -12.866  1.00 17.96  ? 107 CYS C O   1 
ATOM   8248  C  CB  . CYS C  1 132 ? 56.550  -3.679  -14.786  1.00 18.23  ? 107 CYS C CB  1 
ATOM   8249  S  SG  . CYS C  1 132 ? 54.753  -3.746  -14.874  1.00 20.05  ? 107 CYS C SG  1 
ATOM   8250  N  N   . GLU C  1 133 ? 59.330  -2.072  -14.600  1.00 17.46  ? 108 GLU C N   1 
ATOM   8251  C  CA  . GLU C  1 133 ? 60.802  -1.999  -14.564  1.00 17.31  ? 108 GLU C CA  1 
ATOM   8252  C  C   . GLU C  1 133 ? 61.312  -1.355  -13.276  1.00 17.20  ? 108 GLU C C   1 
ATOM   8253  O  O   . GLU C  1 133 ? 62.269  -1.836  -12.663  1.00 18.09  ? 108 GLU C O   1 
ATOM   8254  C  CB  . GLU C  1 133 ? 61.358  -1.248  -15.781  1.00 17.48  ? 108 GLU C CB  1 
ATOM   8255  C  CG  . GLU C  1 133 ? 61.345  -2.050  -17.075  1.00 18.77  ? 108 GLU C CG  1 
ATOM   8256  C  CD  . GLU C  1 133 ? 61.870  -1.269  -18.266  1.00 20.51  ? 108 GLU C CD  1 
ATOM   8257  O  OE1 . GLU C  1 133 ? 61.906  -0.016  -18.211  1.00 22.86  ? 108 GLU C OE1 1 
ATOM   8258  O  OE2 . GLU C  1 133 ? 62.249  -1.907  -19.270  1.00 20.46  ? 108 GLU C OE2 1 
ATOM   8259  N  N   . PHE C  1 134 ? 60.653  -0.277  -12.867  1.00 16.30  ? 109 PHE C N   1 
ATOM   8260  C  CA  . PHE C  1 134 ? 61.005  0.460   -11.655  1.00 15.20  ? 109 PHE C CA  1 
ATOM   8261  C  C   . PHE C  1 134 ? 60.812  -0.400  -10.391  1.00 15.32  ? 109 PHE C C   1 
ATOM   8262  O  O   . PHE C  1 134 ? 61.676  -0.428  -9.517   1.00 15.51  ? 109 PHE C O   1 
ATOM   8263  C  CB  . PHE C  1 134 ? 60.184  1.748   -11.628  1.00 14.59  ? 109 PHE C CB  1 
ATOM   8264  C  CG  . PHE C  1 134 ? 60.255  2.512   -10.337  1.00 14.50  ? 109 PHE C CG  1 
ATOM   8265  C  CD1 . PHE C  1 134 ? 61.404  3.197   -9.980   1.00 14.09  ? 109 PHE C CD1 1 
ATOM   8266  C  CD2 . PHE C  1 134 ? 59.151  2.559   -9.488   1.00 14.39  ? 109 PHE C CD2 1 
ATOM   8267  C  CE1 . PHE C  1 134 ? 61.457  3.922   -8.800   1.00 14.55  ? 109 PHE C CE1 1 
ATOM   8268  C  CE2 . PHE C  1 134 ? 59.200  3.267   -8.297   1.00 14.45  ? 109 PHE C CE2 1 
ATOM   8269  C  CZ  . PHE C  1 134 ? 60.356  3.955   -7.953   1.00 14.42  ? 109 PHE C CZ  1 
ATOM   8270  N  N   . VAL C  1 135 ? 59.712  -1.140  -10.301  1.00 14.95  ? 110 VAL C N   1 
ATOM   8271  C  CA  . VAL C  1 135 ? 59.489  -1.957  -9.099   1.00 14.92  ? 110 VAL C CA  1 
ATOM   8272  C  C   . VAL C  1 135 ? 60.313  -3.252  -9.033   1.00 16.21  ? 110 VAL C C   1 
ATOM   8273  O  O   . VAL C  1 135 ? 60.246  -3.984  -8.046   1.00 17.65  ? 110 VAL C O   1 
ATOM   8274  C  CB  . VAL C  1 135 ? 57.992  -2.241  -8.806   1.00 14.11  ? 110 VAL C CB  1 
ATOM   8275  C  CG1 . VAL C  1 135 ? 57.218  -0.935  -8.659   1.00 13.58  ? 110 VAL C CG1 1 
ATOM   8276  C  CG2 . VAL C  1 135 ? 57.372  -3.155  -9.860   1.00 14.11  ? 110 VAL C CG2 1 
ATOM   8277  N  N   . ILE C  1 136 ? 61.072  -3.554  -10.079  1.00 16.04  ? 111 ILE C N   1 
ATOM   8278  C  CA  . ILE C  1 136 ? 62.117  -4.578  -9.973   1.00 15.81  ? 111 ILE C CA  1 
ATOM   8279  C  C   . ILE C  1 136 ? 63.093  -4.180  -8.847   1.00 15.50  ? 111 ILE C C   1 
ATOM   8280  O  O   . ILE C  1 136 ? 63.648  -5.043  -8.163   1.00 15.56  ? 111 ILE C O   1 
ATOM   8281  C  CB  . ILE C  1 136 ? 62.837  -4.807  -11.334  1.00 15.00  ? 111 ILE C CB  1 
ATOM   8282  C  CG1 . ILE C  1 136 ? 61.854  -5.424  -12.345  1.00 15.06  ? 111 ILE C CG1 1 
ATOM   8283  C  CG2 . ILE C  1 136 ? 64.069  -5.686  -11.173  1.00 14.67  ? 111 ILE C CG2 1 
ATOM   8284  C  CD1 . ILE C  1 136 ? 62.315  -5.342  -13.789  1.00 14.81  ? 111 ILE C CD1 1 
ATOM   8285  N  N   . GLY C  1 137 ? 63.270  -2.871  -8.641   1.00 15.20  ? 112 GLY C N   1 
ATOM   8286  C  CA  . GLY C  1 137 ? 64.098  -2.372  -7.542   1.00 14.89  ? 112 GLY C CA  1 
ATOM   8287  C  C   . GLY C  1 137 ? 63.432  -2.340  -6.175   1.00 15.24  ? 112 GLY C C   1 
ATOM   8288  O  O   . GLY C  1 137 ? 63.885  -1.631  -5.274   1.00 15.37  ? 112 GLY C O   1 
ATOM   8289  N  N   . ILE C  1 138 ? 62.358  -3.105  -5.995   1.00 15.75  ? 113 ILE C N   1 
ATOM   8290  C  CA  . ILE C  1 138 ? 61.652  -3.105  -4.709   1.00 16.26  ? 113 ILE C CA  1 
ATOM   8291  C  C   . ILE C  1 138 ? 62.528  -3.459  -3.477   1.00 18.40  ? 113 ILE C C   1 
ATOM   8292  O  O   . ILE C  1 138 ? 62.349  -2.856  -2.418   1.00 19.14  ? 113 ILE C O   1 
ATOM   8293  C  CB  . ILE C  1 138 ? 60.332  -3.928  -4.750   1.00 16.22  ? 113 ILE C CB  1 
ATOM   8294  C  CG1 . ILE C  1 138 ? 59.446  -3.589  -3.546   1.00 16.21  ? 113 ILE C CG1 1 
ATOM   8295  C  CG2 . ILE C  1 138 ? 60.585  -5.436  -4.849   1.00 16.05  ? 113 ILE C CG2 1 
ATOM   8296  C  CD1 . ILE C  1 138 ? 58.979  -2.154  -3.519   1.00 15.96  ? 113 ILE C CD1 1 
ATOM   8297  N  N   . PRO C  1 139 ? 63.496  -4.402  -3.606   1.00 19.09  ? 114 PRO C N   1 
ATOM   8298  C  CA  . PRO C  1 139 ? 64.336  -4.644  -2.417   1.00 19.30  ? 114 PRO C CA  1 
ATOM   8299  C  C   . PRO C  1 139 ? 64.989  -3.353  -1.887   1.00 18.82  ? 114 PRO C C   1 
ATOM   8300  O  O   . PRO C  1 139 ? 64.968  -3.087  -0.683   1.00 19.28  ? 114 PRO C O   1 
ATOM   8301  C  CB  . PRO C  1 139 ? 65.415  -5.610  -2.932   1.00 19.53  ? 114 PRO C CB  1 
ATOM   8302  C  CG  . PRO C  1 139 ? 64.832  -6.231  -4.159   1.00 19.69  ? 114 PRO C CG  1 
ATOM   8303  C  CD  . PRO C  1 139 ? 63.970  -5.173  -4.774   1.00 19.02  ? 114 PRO C CD  1 
ATOM   8304  N  N   . HIS C  1 140 ? 65.534  -2.538  -2.770   1.00 17.60  ? 115 HIS C N   1 
ATOM   8305  C  CA  . HIS C  1 140 ? 66.133  -1.276  -2.317   1.00 17.94  ? 115 HIS C CA  1 
ATOM   8306  C  C   . HIS C  1 140 ? 65.035  -0.284  -1.905   1.00 18.37  ? 115 HIS C C   1 
ATOM   8307  O  O   . HIS C  1 140 ? 65.130  0.380   -0.859   1.00 18.56  ? 115 HIS C O   1 
ATOM   8308  C  CB  . HIS C  1 140 ? 67.046  -0.687  -3.398   1.00 18.56  ? 115 HIS C CB  1 
ATOM   8309  C  CG  . HIS C  1 140 ? 67.435  0.732   -3.148   1.00 20.38  ? 115 HIS C CG  1 
ATOM   8310  N  ND1 . HIS C  1 140 ? 68.381  1.090   -2.214   1.00 21.15  ? 115 HIS C ND1 1 
ATOM   8311  C  CD2 . HIS C  1 140 ? 67.003  1.888   -3.709   1.00 21.10  ? 115 HIS C CD2 1 
ATOM   8312  C  CE1 . HIS C  1 140 ? 68.507  2.405   -2.198   1.00 21.56  ? 115 HIS C CE1 1 
ATOM   8313  N  NE2 . HIS C  1 140 ? 67.684  2.913   -3.097   1.00 21.84  ? 115 HIS C NE2 1 
ATOM   8314  N  N   . LEU C  1 141 ? 63.983  -0.207  -2.715   1.00 17.61  ? 116 LEU C N   1 
ATOM   8315  C  CA  . LEU C  1 141 ? 62.953  0.811   -2.507   1.00 17.62  ? 116 LEU C CA  1 
ATOM   8316  C  C   . LEU C  1 141 ? 62.178  0.674   -1.205   1.00 18.02  ? 116 LEU C C   1 
ATOM   8317  O  O   . LEU C  1 141 ? 61.740  1.681   -0.658   1.00 17.72  ? 116 LEU C O   1 
ATOM   8318  C  CB  . LEU C  1 141 ? 61.988  0.862   -3.683   1.00 16.60  ? 116 LEU C CB  1 
ATOM   8319  C  CG  . LEU C  1 141 ? 62.535  1.338   -5.033   1.00 16.03  ? 116 LEU C CG  1 
ATOM   8320  C  CD1 . LEU C  1 141 ? 61.574  0.896   -6.133   1.00 15.38  ? 116 LEU C CD1 1 
ATOM   8321  C  CD2 . LEU C  1 141 ? 62.733  2.858   -5.044   1.00 15.99  ? 116 LEU C CD2 1 
ATOM   8322  N  N   . GLN C  1 142 ? 62.014  -0.558  -0.717   1.00 18.08  ? 117 GLN C N   1 
ATOM   8323  C  CA  . GLN C  1 142 ? 61.219  -0.817  0.481    1.00 18.48  ? 117 GLN C CA  1 
ATOM   8324  C  C   . GLN C  1 142 ? 62.019  -0.714  1.794    1.00 18.81  ? 117 GLN C C   1 
ATOM   8325  O  O   . GLN C  1 142 ? 61.466  -0.931  2.875    1.00 18.51  ? 117 GLN C O   1 
ATOM   8326  C  CB  . GLN C  1 142 ? 60.525  -2.186  0.386    1.00 19.60  ? 117 GLN C CB  1 
ATOM   8327  C  CG  . GLN C  1 142 ? 59.184  -2.242  1.110    1.00 21.07  ? 117 GLN C CG  1 
ATOM   8328  C  CD  . GLN C  1 142 ? 58.312  -3.435  0.723    1.00 23.12  ? 117 GLN C CD  1 
ATOM   8329  O  OE1 . GLN C  1 142 ? 58.589  -4.146  -0.242   1.00 24.80  ? 117 GLN C OE1 1 
ATOM   8330  N  NE2 . GLN C  1 142 ? 57.243  -3.652  1.481    1.00 22.44  ? 117 GLN C NE2 1 
ATOM   8331  N  N   . LYS C  1 143 ? 63.310  -0.383  1.696    1.00 18.89  ? 118 LYS C N   1 
ATOM   8332  C  CA  . LYS C  1 143 ? 64.164  -0.205  2.868    1.00 19.50  ? 118 LYS C CA  1 
ATOM   8333  C  C   . LYS C  1 143 ? 63.577  0.795   3.829    1.00 18.69  ? 118 LYS C C   1 
ATOM   8334  O  O   . LYS C  1 143 ? 62.963  1.763   3.419    1.00 18.24  ? 118 LYS C O   1 
ATOM   8335  C  CB  . LYS C  1 143 ? 65.561  0.283   2.465    1.00 20.84  ? 118 LYS C CB  1 
ATOM   8336  C  CG  . LYS C  1 143 ? 66.441  -0.767  1.818    1.00 20.30  ? 118 LYS C CG  1 
ATOM   8337  C  CD  . LYS C  1 143 ? 67.661  -0.085  1.236    1.00 19.89  ? 118 LYS C CD  1 
ATOM   8338  C  CE  . LYS C  1 143 ? 68.729  -1.084  0.821    1.00 19.44  ? 118 LYS C CE  1 
ATOM   8339  N  NZ  . LYS C  1 143 ? 69.708  -0.456  -0.118   1.00 19.29  ? 118 LYS C NZ  1 
ATOM   8340  N  N   . SER C  1 144 ? 63.770  0.548   5.117    1.00 20.08  ? 119 SER C N   1 
ATOM   8341  C  CA  . SER C  1 144 ? 63.376  1.485   6.149    1.00 20.65  ? 119 SER C CA  1 
ATOM   8342  C  C   . SER C  1 144 ? 64.613  1.939   6.927    1.00 21.96  ? 119 SER C C   1 
ATOM   8343  O  O   . SER C  1 144 ? 65.736  1.554   6.587    1.00 22.65  ? 119 SER C O   1 
ATOM   8344  C  CB  . SER C  1 144 ? 62.308  0.861   7.058    1.00 21.86  ? 119 SER C CB  1 
ATOM   8345  O  OG  . SER C  1 144 ? 62.645  -0.471  7.425    1.00 22.18  ? 119 SER C OG  1 
ATOM   8346  N  N   . GLU C  1 145 ? 64.402  2.743   7.967    1.00 22.77  ? 120 GLU C N   1 
ATOM   8347  C  CA  . GLU C  1 145 ? 65.481  3.444   8.675    1.00 23.06  ? 120 GLU C CA  1 
ATOM   8348  C  C   . GLU C  1 145 ? 65.894  2.757   9.972    1.00 22.60  ? 120 GLU C C   1 
ATOM   8349  O  O   . GLU C  1 145 ? 65.052  2.204   10.670   1.00 24.31  ? 120 GLU C O   1 
ATOM   8350  C  CB  . GLU C  1 145 ? 65.043  4.882   8.978    1.00 23.29  ? 120 GLU C CB  1 
ATOM   8351  C  CG  . GLU C  1 145 ? 64.612  5.660   7.740    1.00 25.39  ? 120 GLU C CG  1 
ATOM   8352  C  CD  . GLU C  1 145 ? 64.089  7.057   8.060    1.00 28.18  ? 120 GLU C CD  1 
ATOM   8353  O  OE1 . GLU C  1 145 ? 63.306  7.218   9.032    1.00 29.83  ? 120 GLU C OE1 1 
ATOM   8354  O  OE2 . GLU C  1 145 ? 64.468  8.007   7.337    1.00 27.52  ? 120 GLU C OE2 1 
ATOM   8355  N  N   . PHE C  1 146 ? 67.182  2.820   10.310   1.00 21.19  ? 121 PHE C N   1 
ATOM   8356  C  CA  . PHE C  1 146 ? 67.693  2.243   11.567   1.00 20.73  ? 121 PHE C CA  1 
ATOM   8357  C  C   . PHE C  1 146 ? 68.551  3.242   12.333   1.00 20.24  ? 121 PHE C C   1 
ATOM   8358  O  O   . PHE C  1 146 ? 69.439  3.875   11.760   1.00 19.55  ? 121 PHE C O   1 
ATOM   8359  C  CB  . PHE C  1 146 ? 68.511  0.965   11.281   1.00 20.98  ? 121 PHE C CB  1 
ATOM   8360  C  CG  . PHE C  1 146 ? 68.963  0.211   12.520   1.00 21.36  ? 121 PHE C CG  1 
ATOM   8361  C  CD1 . PHE C  1 146 ? 70.064  0.638   13.266   1.00 21.91  ? 121 PHE C CD1 1 
ATOM   8362  C  CD2 . PHE C  1 146 ? 68.318  -0.959  12.909   1.00 21.64  ? 121 PHE C CD2 1 
ATOM   8363  C  CE1 . PHE C  1 146 ? 70.492  -0.060  14.390   1.00 22.87  ? 121 PHE C CE1 1 
ATOM   8364  C  CE2 . PHE C  1 146 ? 68.732  -1.663  14.035   1.00 22.58  ? 121 PHE C CE2 1 
ATOM   8365  C  CZ  . PHE C  1 146 ? 69.825  -1.219  14.775   1.00 23.57  ? 121 PHE C CZ  1 
ATOM   8366  N  N   . THR C  1 147 ? 68.302  3.345   13.639   1.00 20.39  ? 122 THR C N   1 
ATOM   8367  C  CA  . THR C  1 147 ? 69.158  4.125   14.534   1.00 20.06  ? 122 THR C CA  1 
ATOM   8368  C  C   . THR C  1 147 ? 69.714  3.283   15.678   1.00 20.49  ? 122 THR C C   1 
ATOM   8369  O  O   . THR C  1 147 ? 68.953  2.674   16.433   1.00 20.28  ? 122 THR C O   1 
ATOM   8370  C  CB  . THR C  1 147 ? 68.400  5.329   15.132   1.00 19.40  ? 122 THR C CB  1 
ATOM   8371  O  OG1 . THR C  1 147 ? 67.986  6.203   14.073   1.00 19.46  ? 122 THR C OG1 1 
ATOM   8372  C  CG2 . THR C  1 147 ? 69.281  6.098   16.130   1.00 18.93  ? 122 THR C CG2 1 
ATOM   8373  N  N   . GLU C  1 148 ? 71.035  3.276   15.822   1.00 20.79  ? 123 GLU C N   1 
ATOM   8374  C  CA  . GLU C  1 148 ? 71.648  2.638   16.964   1.00 22.25  ? 123 GLU C CA  1 
ATOM   8375  C  C   . GLU C  1 148 ? 71.837  3.649   18.101   1.00 22.52  ? 123 GLU C C   1 
ATOM   8376  O  O   . GLU C  1 148 ? 72.282  4.783   17.873   1.00 22.90  ? 123 GLU C O   1 
ATOM   8377  C  CB  . GLU C  1 148 ? 72.991  2.020   16.609   1.00 23.10  ? 123 GLU C CB  1 
ATOM   8378  C  CG  . GLU C  1 148 ? 73.658  1.390   17.820   1.00 25.63  ? 123 GLU C CG  1 
ATOM   8379  C  CD  . GLU C  1 148 ? 75.064  0.906   17.542   1.00 28.51  ? 123 GLU C CD  1 
ATOM   8380  O  OE1 . GLU C  1 148 ? 75.926  1.732   17.163   1.00 29.81  ? 123 GLU C OE1 1 
ATOM   8381  O  OE2 . GLU C  1 148 ? 75.300  -0.303  17.705   1.00 29.10  ? 123 GLU C OE2 1 
ATOM   8382  N  N   . GLY C  1 149 ? 71.499  3.227   19.314   1.00 21.78  ? 124 GLY C N   1 
ATOM   8383  C  CA  . GLY C  1 149 ? 71.709  4.052   20.505   1.00 22.16  ? 124 GLY C CA  1 
ATOM   8384  C  C   . GLY C  1 149 ? 70.912  5.346   20.473   1.00 21.32  ? 124 GLY C C   1 
ATOM   8385  O  O   . GLY C  1 149 ? 71.448  6.413   20.764   1.00 21.54  ? 124 GLY C O   1 
ATOM   8386  N  N   . ALA C  1 150 ? 69.637  5.245   20.095   1.00 20.50  ? 125 ALA C N   1 
ATOM   8387  C  CA  . ALA C  1 150 ? 68.695  6.355   20.209   1.00 20.15  ? 125 ALA C CA  1 
ATOM   8388  C  C   . ALA C  1 150 ? 68.560  6.742   21.674   1.00 21.39  ? 125 ALA C C   1 
ATOM   8389  O  O   . ALA C  1 150 ? 68.272  7.894   21.986   1.00 21.63  ? 125 ALA C O   1 
ATOM   8390  C  CB  . ALA C  1 150 ? 67.345  5.971   19.640   1.00 19.11  ? 125 ALA C CB  1 
ATOM   8391  N  N   . GLY C  1 151 ? 68.735  5.756   22.557   1.00 22.48  ? 126 GLY C N   1 
ATOM   8392  C  CA  . GLY C  1 151 ? 68.904  5.968   24.003   1.00 23.59  ? 126 GLY C CA  1 
ATOM   8393  C  C   . GLY C  1 151 ? 69.970  4.980   24.474   1.00 25.29  ? 126 GLY C C   1 
ATOM   8394  O  O   . GLY C  1 151 ? 70.489  4.228   23.654   1.00 24.84  ? 126 GLY C O   1 
ATOM   8395  N  N   . PRO C  1 152 ? 70.278  4.941   25.794   1.00 27.34  ? 127 PRO C N   1 
ATOM   8396  C  CA  . PRO C  1 152 ? 71.321  4.052   26.341   1.00 28.64  ? 127 PRO C CA  1 
ATOM   8397  C  C   . PRO C  1 152 ? 71.001  2.563   26.147   1.00 28.56  ? 127 PRO C C   1 
ATOM   8398  O  O   . PRO C  1 152 ? 70.080  2.033   26.767   1.00 28.65  ? 127 PRO C O   1 
ATOM   8399  C  CB  . PRO C  1 152 ? 71.326  4.385   27.846   1.00 29.62  ? 127 PRO C CB  1 
ATOM   8400  C  CG  . PRO C  1 152 ? 70.461  5.588   28.019   1.00 29.23  ? 127 PRO C CG  1 
ATOM   8401  C  CD  . PRO C  1 152 ? 69.505  5.589   26.871   1.00 28.47  ? 127 PRO C CD  1 
ATOM   8402  N  N   . GLY C  1 153 ? 71.755  1.899   25.280   1.00 28.21  ? 128 GLY C N   1 
ATOM   8403  C  CA  . GLY C  1 153 ? 71.464  0.513   24.913   1.00 27.35  ? 128 GLY C CA  1 
ATOM   8404  C  C   . GLY C  1 153 ? 70.131  0.330   24.193   1.00 24.78  ? 128 GLY C C   1 
ATOM   8405  O  O   . GLY C  1 153 ? 69.614  -0.793  24.115   1.00 23.63  ? 128 GLY C O   1 
ATOM   8406  N  N   . ILE C  1 154 ? 69.577  1.428   23.670   1.00 23.86  ? 129 ILE C N   1 
ATOM   8407  C  CA  . ILE C  1 154 ? 68.279  1.387   22.989   1.00 23.24  ? 129 ILE C CA  1 
ATOM   8408  C  C   . ILE C  1 154 ? 68.382  1.690   21.493   1.00 23.42  ? 129 ILE C C   1 
ATOM   8409  O  O   . ILE C  1 154 ? 68.848  2.764   21.106   1.00 23.74  ? 129 ILE C O   1 
ATOM   8410  C  CB  . ILE C  1 154 ? 67.274  2.374   23.604   1.00 22.85  ? 129 ILE C CB  1 
ATOM   8411  C  CG1 . ILE C  1 154 ? 67.129  2.138   25.104   1.00 24.06  ? 129 ILE C CG1 1 
ATOM   8412  C  CG2 . ILE C  1 154 ? 65.935  2.273   22.877   1.00 22.06  ? 129 ILE C CG2 1 
ATOM   8413  C  CD1 . ILE C  1 154 ? 66.479  3.283   25.858   1.00 24.62  ? 129 ILE C CD1 1 
ATOM   8414  N  N   . ASP C  1 155 ? 67.918  0.750   20.666   1.00 23.00  ? 130 ASP C N   1 
ATOM   8415  C  CA  . ASP C  1 155 ? 67.880  0.912   19.208   1.00 21.82  ? 130 ASP C CA  1 
ATOM   8416  C  C   . ASP C  1 155 ? 66.453  1.195   18.719   1.00 21.46  ? 130 ASP C C   1 
ATOM   8417  O  O   . ASP C  1 155 ? 65.472  0.763   19.338   1.00 21.29  ? 130 ASP C O   1 
ATOM   8418  C  CB  . ASP C  1 155 ? 68.406  -0.338  18.498   1.00 22.84  ? 130 ASP C CB  1 
ATOM   8419  C  CG  . ASP C  1 155 ? 69.849  -0.684  18.868   1.00 25.13  ? 130 ASP C CG  1 
ATOM   8420  O  OD1 . ASP C  1 155 ? 70.634  0.234   19.211   1.00 25.56  ? 130 ASP C OD1 1 
ATOM   8421  O  OD2 . ASP C  1 155 ? 70.195  -1.894  18.812   1.00 25.98  ? 130 ASP C OD2 1 
HETATM 8422  N  N   . MSE C  1 156 ? 66.356  1.909   17.596   1.00 21.07  ? 131 MSE C N   1 
HETATM 8423  C  CA  . MSE C  1 156 ? 65.081  2.364   17.052   1.00 21.52  ? 131 MSE C CA  1 
HETATM 8424  C  C   . MSE C  1 156 ? 65.087  2.169   15.558   1.00 21.11  ? 131 MSE C C   1 
HETATM 8425  O  O   . MSE C  1 156 ? 65.955  2.691   14.849   1.00 20.91  ? 131 MSE C O   1 
HETATM 8426  C  CB  . MSE C  1 156 ? 64.952  3.844   17.386   1.00 21.75  ? 131 MSE C CB  1 
HETATM 8427  C  CG  . MSE C  1 156 ? 63.594  4.377   16.969   1.00 23.68  ? 131 MSE C CG  1 
HETATM 8428  SE SE  . MSE C  1 156 ? 63.323  6.131   17.833   1.00 27.11  ? 131 MSE C SE  1 
HETATM 8429  C  CE  . MSE C  1 156 ? 63.133  5.553   19.705   1.00 24.30  ? 131 MSE C CE  1 
ATOM   8430  N  N   . TYR C  1 157 ? 64.116  1.426   15.050   1.00 20.77  ? 132 TYR C N   1 
ATOM   8431  C  CA  . TYR C  1 157 ? 64.100  1.150   13.603   1.00 20.34  ? 132 TYR C CA  1 
ATOM   8432  C  C   . TYR C  1 157 ? 62.702  0.934   13.080   1.00 20.41  ? 132 TYR C C   1 
ATOM   8433  O  O   . TYR C  1 157 ? 61.824  0.449   13.807   1.00 19.91  ? 132 TYR C O   1 
ATOM   8434  C  CB  . TYR C  1 157 ? 65.001  -0.038  13.245   1.00 19.48  ? 132 TYR C CB  1 
ATOM   8435  C  CG  . TYR C  1 157 ? 64.689  -1.330  13.980   1.00 19.60  ? 132 TYR C CG  1 
ATOM   8436  C  CD1 . TYR C  1 157 ? 65.145  -1.546  15.270   1.00 19.69  ? 132 TYR C CD1 1 
ATOM   8437  C  CD2 . TYR C  1 157 ? 63.960  -2.348  13.359   1.00 20.54  ? 132 TYR C CD2 1 
ATOM   8438  C  CE1 . TYR C  1 157 ? 64.879  -2.729  15.935   1.00 20.77  ? 132 TYR C CE1 1 
ATOM   8439  C  CE2 . TYR C  1 157 ? 63.692  -3.545  14.013   1.00 21.20  ? 132 TYR C CE2 1 
ATOM   8440  C  CZ  . TYR C  1 157 ? 64.155  -3.726  15.301   1.00 21.78  ? 132 TYR C CZ  1 
ATOM   8441  O  OH  . TYR C  1 157 ? 63.894  -4.909  15.967   1.00 23.01  ? 132 TYR C OH  1 
ATOM   8442  N  N   . SER C  1 158 ? 62.499  1.313   11.818   1.00 20.43  ? 133 SER C N   1 
ATOM   8443  C  CA  . SER C  1 158 ? 61.209  1.106   11.166   1.00 19.13  ? 133 SER C CA  1 
ATOM   8444  C  C   . SER C  1 158 ? 61.239  -0.082  10.206   1.00 17.91  ? 133 SER C C   1 
ATOM   8445  O  O   . SER C  1 158 ? 62.305  -0.595  9.868    1.00 18.04  ? 133 SER C O   1 
ATOM   8446  C  CB  . SER C  1 158 ? 60.699  2.387   10.498   1.00 18.48  ? 133 SER C CB  1 
ATOM   8447  O  OG  . SER C  1 158 ? 61.732  3.077   9.822    1.00 19.04  ? 133 SER C OG  1 
ATOM   8448  N  N   . ILE C  1 159 ? 60.050  -0.527  9.821    1.00 17.27  ? 134 ILE C N   1 
ATOM   8449  C  CA  . ILE C  1 159 ? 59.842  -1.571  8.835    1.00 17.87  ? 134 ILE C CA  1 
ATOM   8450  C  C   . ILE C  1 159 ? 58.661  -1.105  7.985    1.00 18.71  ? 134 ILE C C   1 
ATOM   8451  O  O   . ILE C  1 159 ? 57.657  -0.640  8.515    1.00 19.01  ? 134 ILE C O   1 
ATOM   8452  C  CB  . ILE C  1 159 ? 59.486  -2.942  9.473    1.00 18.61  ? 134 ILE C CB  1 
ATOM   8453  C  CG1 . ILE C  1 159 ? 60.452  -3.324  10.606   1.00 18.94  ? 134 ILE C CG1 1 
ATOM   8454  C  CG2 . ILE C  1 159 ? 59.472  -4.037  8.407    1.00 18.32  ? 134 ILE C CG2 1 
ATOM   8455  C  CD1 . ILE C  1 159 ? 60.207  -4.701  11.197   1.00 19.53  ? 134 ILE C CD1 1 
ATOM   8456  N  N   . ARG C  1 160 ? 58.784  -1.203  6.668    1.00 19.65  ? 135 ARG C N   1 
ATOM   8457  C  CA  . ARG C  1 160 ? 57.670  -0.868  5.792    1.00 20.77  ? 135 ARG C CA  1 
ATOM   8458  C  C   . ARG C  1 160 ? 56.973  -2.158  5.407    1.00 21.08  ? 135 ARG C C   1 
ATOM   8459  O  O   . ARG C  1 160 ? 57.532  -2.979  4.685    1.00 22.45  ? 135 ARG C O   1 
ATOM   8460  C  CB  . ARG C  1 160 ? 58.162  -0.162  4.550    1.00 23.57  ? 135 ARG C CB  1 
ATOM   8461  C  CG  . ARG C  1 160 ? 58.926  1.116   4.829    1.00 27.13  ? 135 ARG C CG  1 
ATOM   8462  C  CD  . ARG C  1 160 ? 58.649  2.057   3.698    1.00 31.33  ? 135 ARG C CD  1 
ATOM   8463  N  NE  . ARG C  1 160 ? 59.857  2.699   3.222    1.00 39.87  ? 135 ARG C NE  1 
ATOM   8464  C  CZ  . ARG C  1 160 ? 59.910  3.449   2.129    1.00 42.22  ? 135 ARG C CZ  1 
ATOM   8465  N  NH1 . ARG C  1 160 ? 58.814  3.656   1.397    1.00 39.23  ? 135 ARG C NH1 1 
ATOM   8466  N  NH2 . ARG C  1 160 ? 61.056  3.997   1.775    1.00 45.54  ? 135 ARG C NH2 1 
ATOM   8467  N  N   . GLN C  1 161 ? 55.763  -2.345  5.920    1.00 19.82  ? 136 GLN C N   1 
ATOM   8468  C  CA  . GLN C  1 161 ? 55.044  -3.590  5.728    1.00 19.73  ? 136 GLN C CA  1 
ATOM   8469  C  C   . GLN C  1 161 ? 53.842  -3.350  4.801    1.00 19.33  ? 136 GLN C C   1 
ATOM   8470  O  O   . GLN C  1 161 ? 53.378  -2.209  4.647    1.00 18.82  ? 136 GLN C O   1 
ATOM   8471  C  CB  . GLN C  1 161 ? 54.650  -4.201  7.108    1.00 19.46  ? 136 GLN C CB  1 
ATOM   8472  C  CG  . GLN C  1 161 ? 55.849  -4.662  7.959    1.00 18.73  ? 136 GLN C CG  1 
ATOM   8473  C  CD  . GLN C  1 161 ? 55.448  -5.419  9.230    1.00 19.17  ? 136 GLN C CD  1 
ATOM   8474  O  OE1 . GLN C  1 161 ? 54.483  -5.051  9.887    1.00 19.18  ? 136 GLN C OE1 1 
ATOM   8475  N  NE2 . GLN C  1 161 ? 56.194  -6.497  9.574    1.00 18.61  ? 136 GLN C NE2 1 
ATOM   8476  N  N   . PRO C  1 162 ? 53.336  -4.415  4.164    1.00 19.53  ? 137 PRO C N   1 
ATOM   8477  C  CA  . PRO C  1 162 ? 52.173  -4.246  3.293    1.00 19.11  ? 137 PRO C CA  1 
ATOM   8478  C  C   . PRO C  1 162 ? 50.982  -3.611  4.021    1.00 19.30  ? 137 PRO C C   1 
ATOM   8479  O  O   . PRO C  1 162 ? 50.801  -3.826  5.222    1.00 19.64  ? 137 PRO C O   1 
ATOM   8480  C  CB  . PRO C  1 162 ? 51.817  -5.689  2.912    1.00 19.74  ? 137 PRO C CB  1 
ATOM   8481  C  CG  . PRO C  1 162 ? 53.082  -6.454  3.067    1.00 20.00  ? 137 PRO C CG  1 
ATOM   8482  C  CD  . PRO C  1 162 ? 53.808  -5.815  4.205    1.00 20.02  ? 137 PRO C CD  1 
ATOM   8483  N  N   . VAL C  1 163 ? 50.171  -2.840  3.310    1.00 18.64  ? 138 VAL C N   1 
ATOM   8484  C  CA  . VAL C  1 163 ? 48.896  -2.418  3.882    1.00 19.08  ? 138 VAL C CA  1 
ATOM   8485  C  C   . VAL C  1 163 ? 47.898  -3.565  3.889    1.00 20.70  ? 138 VAL C C   1 
ATOM   8486  O  O   . VAL C  1 163 ? 46.954  -3.544  4.679    1.00 22.87  ? 138 VAL C O   1 
ATOM   8487  C  CB  . VAL C  1 163 ? 48.277  -1.186  3.190    1.00 18.25  ? 138 VAL C CB  1 
ATOM   8488  C  CG1 . VAL C  1 163 ? 49.193  0.030   3.345    1.00 17.68  ? 138 VAL C CG1 1 
ATOM   8489  C  CG2 . VAL C  1 163 ? 47.972  -1.479  1.728    1.00 17.70  ? 138 VAL C CG2 1 
ATOM   8490  N  N   . GLY C  1 164 ? 48.112  -4.559  3.023    1.00 19.75  ? 139 GLY C N   1 
ATOM   8491  C  CA  . GLY C  1 164 ? 47.243  -5.738  2.940    1.00 19.67  ? 139 GLY C CA  1 
ATOM   8492  C  C   . GLY C  1 164 ? 46.645  -5.951  1.553    1.00 20.29  ? 139 GLY C C   1 
ATOM   8493  O  O   . GLY C  1 164 ? 47.226  -6.634  0.695    1.00 19.61  ? 139 GLY C O   1 
ATOM   8494  N  N   . ILE C  1 165 ? 45.477  -5.359  1.330    1.00 21.08  ? 140 ILE C N   1 
ATOM   8495  C  CA  . ILE C  1 165 ? 44.768  -5.495  0.065    1.00 21.86  ? 140 ILE C CA  1 
ATOM   8496  C  C   . ILE C  1 165 ? 44.390  -4.120  -0.446   1.00 21.80  ? 140 ILE C C   1 
ATOM   8497  O  O   . ILE C  1 165 ? 43.707  -3.371  0.237    1.00 21.32  ? 140 ILE C O   1 
ATOM   8498  C  CB  . ILE C  1 165 ? 43.495  -6.346  0.215    1.00 23.58  ? 140 ILE C CB  1 
ATOM   8499  C  CG1 . ILE C  1 165 ? 43.851  -7.746  0.731    1.00 25.01  ? 140 ILE C CG1 1 
ATOM   8500  C  CG2 . ILE C  1 165 ? 42.758  -6.438  -1.121   1.00 23.63  ? 140 ILE C CG2 1 
ATOM   8501  C  CD1 . ILE C  1 165 ? 42.652  -8.530  1.199    1.00 26.28  ? 140 ILE C CD1 1 
ATOM   8502  N  N   . GLY C  1 166 ? 44.852  -3.792  -1.647   1.00 22.91  ? 141 GLY C N   1 
ATOM   8503  C  CA  . GLY C  1 166 ? 44.490  -2.537  -2.280   1.00 22.33  ? 141 GLY C CA  1 
ATOM   8504  C  C   . GLY C  1 166 ? 43.555  -2.727  -3.449   1.00 22.15  ? 141 GLY C C   1 
ATOM   8505  O  O   . GLY C  1 166 ? 43.300  -3.852  -3.882   1.00 23.36  ? 141 GLY C O   1 
ATOM   8506  N  N   . ALA C  1 167 ? 43.038  -1.615  -3.952   1.00 21.26  ? 142 ALA C N   1 
ATOM   8507  C  CA  . ALA C  1 167 ? 42.165  -1.612  -5.106   1.00 21.85  ? 142 ALA C CA  1 
ATOM   8508  C  C   . ALA C  1 167 ? 42.445  -0.368  -5.908   1.00 22.51  ? 142 ALA C C   1 
ATOM   8509  O  O   . ALA C  1 167 ? 42.821  0.654   -5.346   1.00 24.31  ? 142 ALA C O   1 
ATOM   8510  C  CB  . ALA C  1 167 ? 40.713  -1.644  -4.678   1.00 22.36  ? 142 ALA C CB  1 
ATOM   8511  N  N   . GLY C  1 168 ? 42.272  -0.469  -7.222   1.00 21.54  ? 143 GLY C N   1 
ATOM   8512  C  CA  . GLY C  1 168 ? 42.507  0.639   -8.130   1.00 20.18  ? 143 GLY C CA  1 
ATOM   8513  C  C   . GLY C  1 168 ? 41.386  0.723   -9.137   1.00 20.01  ? 143 GLY C C   1 
ATOM   8514  O  O   . GLY C  1 168 ? 40.904  -0.302  -9.626   1.00 20.59  ? 143 GLY C O   1 
ATOM   8515  N  N   . ILE C  1 169 ? 40.954  1.949   -9.411   1.00 18.41  ? 144 ILE C N   1 
ATOM   8516  C  CA  . ILE C  1 169 ? 39.877  2.223   -10.344  1.00 18.66  ? 144 ILE C CA  1 
ATOM   8517  C  C   . ILE C  1 169 ? 40.472  3.102   -11.445  1.00 18.02  ? 144 ILE C C   1 
ATOM   8518  O  O   . ILE C  1 169 ? 41.025  4.161   -11.157  1.00 16.82  ? 144 ILE C O   1 
ATOM   8519  C  CB  . ILE C  1 169 ? 38.709  2.961   -9.647   1.00 18.81  ? 144 ILE C CB  1 
ATOM   8520  C  CG1 . ILE C  1 169 ? 38.190  2.136   -8.462   1.00 19.33  ? 144 ILE C CG1 1 
ATOM   8521  C  CG2 . ILE C  1 169 ? 37.595  3.256   -10.645  1.00 18.74  ? 144 ILE C CG2 1 
ATOM   8522  C  CD1 . ILE C  1 169 ? 37.663  2.963   -7.303   1.00 19.18  ? 144 ILE C CD1 1 
ATOM   8523  N  N   . THR C  1 170 ? 40.357  2.653   -12.695  1.00 18.19  ? 145 THR C N   1 
ATOM   8524  C  CA  . THR C  1 170 ? 41.083  3.273   -13.806  1.00 18.21  ? 145 THR C CA  1 
ATOM   8525  C  C   . THR C  1 170 ? 40.153  3.710   -14.937  1.00 18.90  ? 145 THR C C   1 
ATOM   8526  O  O   . THR C  1 170 ? 39.027  3.222   -15.038  1.00 18.12  ? 145 THR C O   1 
ATOM   8527  C  CB  . THR C  1 170 ? 42.193  2.347   -14.361  1.00 17.88  ? 145 THR C CB  1 
ATOM   8528  O  OG1 . THR C  1 170 ? 41.612  1.136   -14.844  1.00 17.67  ? 145 THR C OG1 1 
ATOM   8529  C  CG2 . THR C  1 170 ? 43.214  2.012   -13.272  1.00 18.28  ? 145 THR C CG2 1 
ATOM   8530  N  N   . PRO C  1 171 ? 40.618  4.655   -15.778  1.00 20.24  ? 146 PRO C N   1 
ATOM   8531  C  CA  . PRO C  1 171 ? 39.745  5.237   -16.791  1.00 21.74  ? 146 PRO C CA  1 
ATOM   8532  C  C   . PRO C  1 171 ? 39.927  4.567   -18.148  1.00 22.73  ? 146 PRO C C   1 
ATOM   8533  O  O   . PRO C  1 171 ? 40.810  3.708   -18.295  1.00 23.87  ? 146 PRO C O   1 
ATOM   8534  C  CB  . PRO C  1 171 ? 40.227  6.685   -16.852  1.00 20.18  ? 146 PRO C CB  1 
ATOM   8535  C  CG  . PRO C  1 171 ? 41.687  6.589   -16.572  1.00 19.27  ? 146 PRO C CG  1 
ATOM   8536  C  CD  . PRO C  1 171 ? 41.911  5.362   -15.719  1.00 19.35  ? 146 PRO C CD  1 
ATOM   8537  N  N   . PHE C  1 172 ? 39.111  4.967   -19.124  1.00 21.26  ? 147 PHE C N   1 
ATOM   8538  C  CA  . PHE C  1 172 ? 39.143  4.354   -20.454  1.00 20.15  ? 147 PHE C CA  1 
ATOM   8539  C  C   . PHE C  1 172 ? 40.420  4.634   -21.267  1.00 20.02  ? 147 PHE C C   1 
ATOM   8540  O  O   . PHE C  1 172 ? 40.777  3.834   -22.118  1.00 20.59  ? 147 PHE C O   1 
ATOM   8541  C  CB  . PHE C  1 172 ? 37.892  4.744   -21.273  1.00 20.31  ? 147 PHE C CB  1 
ATOM   8542  C  CG  . PHE C  1 172 ? 38.014  6.076   -21.977  1.00 21.13  ? 147 PHE C CG  1 
ATOM   8543  C  CD1 . PHE C  1 172 ? 38.634  6.167   -23.229  1.00 21.49  ? 147 PHE C CD1 1 
ATOM   8544  C  CD2 . PHE C  1 172 ? 37.523  7.239   -21.389  1.00 21.35  ? 147 PHE C CD2 1 
ATOM   8545  C  CE1 . PHE C  1 172 ? 38.777  7.395   -23.867  1.00 22.33  ? 147 PHE C CE1 1 
ATOM   8546  C  CE2 . PHE C  1 172 ? 37.650  8.466   -22.029  1.00 22.24  ? 147 PHE C CE2 1 
ATOM   8547  C  CZ  . PHE C  1 172 ? 38.282  8.545   -23.271  1.00 22.83  ? 147 PHE C CZ  1 
ATOM   8548  N  N   . ASN C  1 173 ? 41.080  5.773   -21.048  1.00 19.39  ? 148 ASN C N   1 
ATOM   8549  C  CA  . ASN C  1 173 ? 42.035  6.265   -22.051  1.00 20.05  ? 148 ASN C CA  1 
ATOM   8550  C  C   . ASN C  1 173 ? 43.395  5.570   -22.062  1.00 18.64  ? 148 ASN C C   1 
ATOM   8551  O  O   . ASN C  1 173 ? 44.035  5.488   -23.118  1.00 17.91  ? 148 ASN C O   1 
ATOM   8552  C  CB  . ASN C  1 173 ? 42.184  7.793   -22.032  1.00 21.83  ? 148 ASN C CB  1 
ATOM   8553  C  CG  . ASN C  1 173 ? 42.772  8.313   -20.728  1.00 23.40  ? 148 ASN C CG  1 
ATOM   8554  O  OD1 . ASN C  1 173 ? 42.634  7.695   -19.666  1.00 25.21  ? 148 ASN C OD1 1 
ATOM   8555  N  ND2 . ASN C  1 173 ? 43.417  9.463   -20.804  1.00 22.06  ? 148 ASN C ND2 1 
ATOM   8556  N  N   . PHE C  1 174 ? 43.815  5.065   -20.903  1.00 17.75  ? 149 PHE C N   1 
ATOM   8557  C  CA  . PHE C  1 174 ? 45.022  4.246   -20.805  1.00 17.67  ? 149 PHE C CA  1 
ATOM   8558  C  C   . PHE C  1 174 ? 44.755  2.977   -19.982  1.00 18.02  ? 149 PHE C C   1 
ATOM   8559  O  O   . PHE C  1 174 ? 45.129  2.917   -18.803  1.00 18.07  ? 149 PHE C O   1 
ATOM   8560  C  CB  . PHE C  1 174 ? 46.141  5.029   -20.123  1.00 17.62  ? 149 PHE C CB  1 
ATOM   8561  C  CG  . PHE C  1 174 ? 46.736  6.138   -20.949  1.00 17.97  ? 149 PHE C CG  1 
ATOM   8562  C  CD1 . PHE C  1 174 ? 47.777  5.881   -21.836  1.00 18.44  ? 149 PHE C CD1 1 
ATOM   8563  C  CD2 . PHE C  1 174 ? 46.311  7.455   -20.777  1.00 19.15  ? 149 PHE C CD2 1 
ATOM   8564  C  CE1 . PHE C  1 174 ? 48.365  6.914   -22.574  1.00 19.16  ? 149 PHE C CE1 1 
ATOM   8565  C  CE2 . PHE C  1 174 ? 46.895  8.496   -21.507  1.00 20.36  ? 149 PHE C CE2 1 
ATOM   8566  C  CZ  . PHE C  1 174 ? 47.933  8.226   -22.401  1.00 19.58  ? 149 PHE C CZ  1 
ATOM   8567  N  N   . PRO C  1 175 ? 44.108  1.958   -20.587  1.00 18.24  ? 150 PRO C N   1 
ATOM   8568  C  CA  . PRO C  1 175 ? 43.764  0.713   -19.860  1.00 18.24  ? 150 PRO C CA  1 
ATOM   8569  C  C   . PRO C  1 175 ? 44.938  -0.262  -19.677  1.00 18.56  ? 150 PRO C C   1 
ATOM   8570  O  O   . PRO C  1 175 ? 44.772  -1.319  -19.081  1.00 19.01  ? 150 PRO C O   1 
ATOM   8571  C  CB  . PRO C  1 175 ? 42.693  0.085   -20.745  1.00 18.73  ? 150 PRO C CB  1 
ATOM   8572  C  CG  . PRO C  1 175 ? 43.057  0.545   -22.118  1.00 18.99  ? 150 PRO C CG  1 
ATOM   8573  C  CD  . PRO C  1 175 ? 43.609  1.941   -21.973  1.00 18.19  ? 150 PRO C CD  1 
ATOM   8574  N  N   . GLY C  1 176 ? 46.104  0.076   -20.212  1.00 18.72  ? 151 GLY C N   1 
ATOM   8575  C  CA  . GLY C  1 176 ? 47.321  -0.661  -19.908  1.00 19.18  ? 151 GLY C CA  1 
ATOM   8576  C  C   . GLY C  1 176 ? 48.178  0.117   -18.921  1.00 19.13  ? 151 GLY C C   1 
ATOM   8577  O  O   . GLY C  1 176 ? 48.496  -0.371  -17.826  1.00 18.50  ? 151 GLY C O   1 
HETATM 8578  N  N   . MSE C  1 177 ? 48.544  1.339   -19.301  1.00 19.04  ? 152 MSE C N   1 
HETATM 8579  C  CA  . MSE C  1 177 ? 49.461  2.159   -18.491  1.00 18.34  ? 152 MSE C CA  1 
HETATM 8580  C  C   . MSE C  1 177 ? 48.956  2.365   -17.081  1.00 17.79  ? 152 MSE C C   1 
HETATM 8581  O  O   . MSE C  1 177 ? 49.684  2.126   -16.119  1.00 17.56  ? 152 MSE C O   1 
HETATM 8582  C  CB  . MSE C  1 177 ? 49.710  3.500   -19.149  1.00 18.90  ? 152 MSE C CB  1 
HETATM 8583  C  CG  . MSE C  1 177 ? 50.615  4.338   -18.267  1.00 21.77  ? 152 MSE C CG  1 
HETATM 8584  SE SE  . MSE C  1 177 ? 50.867  6.077   -19.144  1.00 26.49  ? 152 MSE C SE  1 
HETATM 8585  C  CE  . MSE C  1 177 ? 49.237  6.971   -18.489  1.00 25.12  ? 152 MSE C CE  1 
ATOM   8586  N  N   . ILE C  1 178 ? 47.747  2.864   -16.926  1.00 17.80  ? 153 ILE C N   1 
ATOM   8587  C  CA  . ILE C  1 178 ? 47.232  3.179   -15.607  1.00 17.88  ? 153 ILE C CA  1 
ATOM   8588  C  C   . ILE C  1 178 ? 47.007  2.030   -14.620  1.00 17.34  ? 153 ILE C C   1 
ATOM   8589  O  O   . ILE C  1 178 ? 47.417  2.145   -13.504  1.00 17.41  ? 153 ILE C O   1 
ATOM   8590  C  CB  . ILE C  1 178 ? 46.027  4.130   -15.681  1.00 18.63  ? 153 ILE C CB  1 
ATOM   8591  C  CG1 . ILE C  1 178 ? 46.430  5.393   -16.421  1.00 18.72  ? 153 ILE C CG1 1 
ATOM   8592  C  CG2 . ILE C  1 178 ? 45.478  4.421   -14.315  1.00 18.17  ? 153 ILE C CG2 1 
ATOM   8593  C  CD1 . ILE C  1 178 ? 45.373  6.406   -16.600  1.00 18.99  ? 153 ILE C CD1 1 
ATOM   8594  N  N   . PRO C  1 179 ? 46.404  0.925   -15.039  1.00 17.19  ? 154 PRO C N   1 
ATOM   8595  C  CA  . PRO C  1 179 ? 46.374  -0.236  -14.138  1.00 17.67  ? 154 PRO C CA  1 
ATOM   8596  C  C   . PRO C  1 179 ? 47.763  -0.633  -13.645  1.00 17.43  ? 154 PRO C C   1 
ATOM   8597  O  O   . PRO C  1 179 ? 47.935  -0.915  -12.457  1.00 16.56  ? 154 PRO C O   1 
ATOM   8598  C  CB  . PRO C  1 179 ? 45.801  -1.323  -15.029  1.00 17.66  ? 154 PRO C CB  1 
ATOM   8599  C  CG  . PRO C  1 179 ? 44.815  -0.575  -15.843  1.00 17.58  ? 154 PRO C CG  1 
ATOM   8600  C  CD  . PRO C  1 179 ? 45.504  0.718   -16.185  1.00 16.98  ? 154 PRO C CD  1 
HETATM 8601  N  N   . MSE C  1 180 ? 48.747  -0.609  -14.551  1.00 17.82  ? 155 MSE C N   1 
HETATM 8602  C  CA  . MSE C  1 180 ? 50.134  -0.951  -14.199  1.00 18.32  ? 155 MSE C CA  1 
HETATM 8603  C  C   . MSE C  1 180 ? 50.731  0.065   -13.263  1.00 18.20  ? 155 MSE C C   1 
HETATM 8604  O  O   . MSE C  1 180 ? 51.480  -0.318  -12.343  1.00 18.54  ? 155 MSE C O   1 
HETATM 8605  C  CB  . MSE C  1 180 ? 51.035  -1.189  -15.410  1.00 19.13  ? 155 MSE C CB  1 
HETATM 8606  C  CG  . MSE C  1 180 ? 50.698  -2.542  -16.038  1.00 22.09  ? 155 MSE C CG  1 
HETATM 8607  SE SE  . MSE C  1 180 ? 51.870  -2.978  -17.567  1.00 26.19  ? 155 MSE C SE  1 
HETATM 8608  C  CE  . MSE C  1 180 ? 50.871  -2.134  -19.037  1.00 26.28  ? 155 MSE C CE  1 
ATOM   8609  N  N   . TRP C  1 181 ? 50.408  1.348   -13.466  1.00 17.05  ? 156 TRP C N   1 
ATOM   8610  C  CA  . TRP C  1 181 ? 50.848  2.416   -12.549  1.00 17.09  ? 156 TRP C CA  1 
ATOM   8611  C  C   . TRP C  1 181 ? 50.629  1.960   -11.124  1.00 16.95  ? 156 TRP C C   1 
ATOM   8612  O  O   . TRP C  1 181 ? 51.512  2.088   -10.293  1.00 16.38  ? 156 TRP C O   1 
ATOM   8613  C  CB  . TRP C  1 181 ? 50.036  3.698   -12.741  1.00 17.26  ? 156 TRP C CB  1 
ATOM   8614  C  CG  . TRP C  1 181 ? 50.581  4.712   -13.714  1.00 18.49  ? 156 TRP C CG  1 
ATOM   8615  C  CD1 . TRP C  1 181 ? 51.631  4.558   -14.588  1.00 18.52  ? 156 TRP C CD1 1 
ATOM   8616  C  CD2 . TRP C  1 181 ? 50.060  6.027   -13.939  1.00 18.84  ? 156 TRP C CD2 1 
ATOM   8617  N  NE1 . TRP C  1 181 ? 51.800  5.708   -15.324  1.00 19.41  ? 156 TRP C NE1 1 
ATOM   8618  C  CE2 . TRP C  1 181 ? 50.848  6.623   -14.948  1.00 19.74  ? 156 TRP C CE2 1 
ATOM   8619  C  CE3 . TRP C  1 181 ? 49.006  6.766   -13.374  1.00 19.70  ? 156 TRP C CE3 1 
ATOM   8620  C  CZ2 . TRP C  1 181 ? 50.619  7.932   -15.405  1.00 20.17  ? 156 TRP C CZ2 1 
ATOM   8621  C  CZ3 . TRP C  1 181 ? 48.767  8.061   -13.837  1.00 19.73  ? 156 TRP C CZ3 1 
ATOM   8622  C  CH2 . TRP C  1 181 ? 49.572  8.627   -14.844  1.00 19.78  ? 156 TRP C CH2 1 
HETATM 8623  N  N   . MSE C  1 182 ? 49.434  1.425   -10.877  1.00 16.97  ? 157 MSE C N   1 
HETATM 8624  C  CA  . MSE C  1 182 ? 48.950  1.124   -9.549   1.00 18.01  ? 157 MSE C CA  1 
HETATM 8625  C  C   . MSE C  1 182 ? 49.301  -0.270  -9.092   1.00 18.29  ? 157 MSE C C   1 
HETATM 8626  O  O   . MSE C  1 182 ? 49.833  -0.436  -7.993   1.00 18.31  ? 157 MSE C O   1 
HETATM 8627  C  CB  . MSE C  1 182 ? 47.422  1.229   -9.569   1.00 19.61  ? 157 MSE C CB  1 
HETATM 8628  C  CG  . MSE C  1 182 ? 46.908  2.645   -9.785   1.00 20.88  ? 157 MSE C CG  1 
HETATM 8629  SE SE  . MSE C  1 182 ? 44.969  2.431   -10.055  1.00 24.92  ? 157 MSE C SE  1 
HETATM 8630  C  CE  . MSE C  1 182 ? 44.514  4.304   -10.448  1.00 23.38  ? 157 MSE C CE  1 
ATOM   8631  N  N   . PHE C  1 183 ? 49.011  -1.275  -9.903   1.00 17.77  ? 158 PHE C N   1 
ATOM   8632  C  CA  . PHE C  1 183 ? 49.236  -2.639  -9.469   1.00 17.68  ? 158 PHE C CA  1 
ATOM   8633  C  C   . PHE C  1 183 ? 50.692  -3.058  -9.322   1.00 17.33  ? 158 PHE C C   1 
ATOM   8634  O  O   . PHE C  1 183 ? 50.992  -3.874  -8.492   1.00 17.73  ? 158 PHE C O   1 
ATOM   8635  C  CB  . PHE C  1 183 ? 48.356  -3.650  -10.221  1.00 17.86  ? 158 PHE C CB  1 
ATOM   8636  C  CG  . PHE C  1 183 ? 48.963  -4.237  -11.469  1.00 17.43  ? 158 PHE C CG  1 
ATOM   8637  C  CD1 . PHE C  1 183 ? 50.164  -4.902  -11.438  1.00 16.55  ? 158 PHE C CD1 1 
ATOM   8638  C  CD2 . PHE C  1 183 ? 48.272  -4.179  -12.664  1.00 17.64  ? 158 PHE C CD2 1 
ATOM   8639  C  CE1 . PHE C  1 183 ? 50.686  -5.463  -12.573  1.00 17.23  ? 158 PHE C CE1 1 
ATOM   8640  C  CE2 . PHE C  1 183 ? 48.791  -4.742  -13.806  1.00 17.87  ? 158 PHE C CE2 1 
ATOM   8641  C  CZ  . PHE C  1 183 ? 50.000  -5.385  -13.758  1.00 17.63  ? 158 PHE C CZ  1 
ATOM   8642  N  N   . ALA C  1 184 ? 51.592  -2.468  -10.090  1.00 17.35  ? 159 ALA C N   1 
ATOM   8643  C  CA  . ALA C  1 184 ? 53.012  -2.805  -9.980   1.00 16.99  ? 159 ALA C CA  1 
ATOM   8644  C  C   . ALA C  1 184 ? 53.610  -2.475  -8.598   1.00 17.27  ? 159 ALA C C   1 
ATOM   8645  O  O   . ALA C  1 184 ? 54.196  -3.356  -7.968   1.00 20.05  ? 159 ALA C O   1 
ATOM   8646  C  CB  . ALA C  1 184 ? 53.827  -2.174  -11.107  1.00 16.44  ? 159 ALA C CB  1 
ATOM   8647  N  N   . PRO C  1 185 ? 53.493  -1.219  -8.119   1.00 15.35  ? 160 PRO C N   1 
ATOM   8648  C  CA  . PRO C  1 185 ? 54.039  -0.980  -6.759   1.00 14.43  ? 160 PRO C CA  1 
ATOM   8649  C  C   . PRO C  1 185 ? 53.254  -1.651  -5.640   1.00 15.39  ? 160 PRO C C   1 
ATOM   8650  O  O   . PRO C  1 185 ? 53.837  -2.028  -4.623   1.00 15.61  ? 160 PRO C O   1 
ATOM   8651  C  CB  . PRO C  1 185 ? 53.945  0.541   -6.575   1.00 12.99  ? 160 PRO C CB  1 
ATOM   8652  C  CG  . PRO C  1 185 ? 53.169  1.054   -7.742   1.00 13.14  ? 160 PRO C CG  1 
ATOM   8653  C  CD  . PRO C  1 185 ? 53.279  0.043   -8.848   1.00 14.02  ? 160 PRO C CD  1 
ATOM   8654  N  N   . ALA C  1 186 ? 51.936  -1.761  -5.804   1.00 15.05  ? 161 ALA C N   1 
ATOM   8655  C  CA  . ALA C  1 186 ? 51.120  -2.357  -4.773   1.00 14.65  ? 161 ALA C CA  1 
ATOM   8656  C  C   . ALA C  1 186 ? 51.514  -3.823  -4.578   1.00 14.38  ? 161 ALA C C   1 
ATOM   8657  O  O   . ALA C  1 186 ? 51.671  -4.288  -3.444   1.00 14.03  ? 161 ALA C O   1 
ATOM   8658  C  CB  . ALA C  1 186 ? 49.650  -2.228  -5.119   1.00 14.75  ? 161 ALA C CB  1 
ATOM   8659  N  N   . ILE C  1 187 ? 51.711  -4.532  -5.692   1.00 14.03  ? 162 ILE C N   1 
ATOM   8660  C  CA  . ILE C  1 187 ? 52.044  -5.946  -5.637   1.00 14.49  ? 162 ILE C CA  1 
ATOM   8661  C  C   . ILE C  1 187 ? 53.518  -6.161  -5.261   1.00 15.14  ? 162 ILE C C   1 
ATOM   8662  O  O   . ILE C  1 187 ? 53.839  -7.047  -4.458   1.00 15.27  ? 162 ILE C O   1 
ATOM   8663  C  CB  . ILE C  1 187 ? 51.632  -6.671  -6.943   1.00 14.80  ? 162 ILE C CB  1 
ATOM   8664  C  CG1 . ILE C  1 187 ? 50.107  -6.777  -7.034   1.00 15.14  ? 162 ILE C CG1 1 
ATOM   8665  C  CG2 . ILE C  1 187 ? 52.251  -8.058  -7.035   1.00 14.85  ? 162 ILE C CG2 1 
ATOM   8666  C  CD1 . ILE C  1 187 ? 49.599  -7.144  -8.420   1.00 15.88  ? 162 ILE C CD1 1 
ATOM   8667  N  N   . ALA C  1 188 ? 54.410  -5.342  -5.820   1.00 15.57  ? 163 ALA C N   1 
ATOM   8668  C  CA  . ALA C  1 188 ? 55.831  -5.419  -5.467   1.00 16.06  ? 163 ALA C CA  1 
ATOM   8669  C  C   . ALA C  1 188 ? 56.030  -5.229  -3.942   1.00 17.35  ? 163 ALA C C   1 
ATOM   8670  O  O   . ALA C  1 188 ? 56.916  -5.841  -3.335   1.00 16.77  ? 163 ALA C O   1 
ATOM   8671  C  CB  . ALA C  1 188 ? 56.633  -4.391  -6.252   1.00 14.83  ? 163 ALA C CB  1 
ATOM   8672  N  N   . CYS C  1 189 ? 55.188  -4.391  -3.336   1.00 18.20  ? 164 CYS C N   1 
ATOM   8673  C  CA  . CYS C  1 189 ? 55.286  -4.111  -1.894   1.00 18.99  ? 164 CYS C CA  1 
ATOM   8674  C  C   . CYS C  1 189 ? 54.760  -5.221  -1.011   1.00 19.69  ? 164 CYS C C   1 
ATOM   8675  O  O   . CYS C  1 189 ? 54.939  -5.154  0.195    1.00 20.25  ? 164 CYS C O   1 
ATOM   8676  C  CB  . CYS C  1 189 ? 54.538  -2.837  -1.526   1.00 19.01  ? 164 CYS C CB  1 
ATOM   8677  S  SG  . CYS C  1 189 ? 55.423  -1.346  -1.974   1.00 19.43  ? 164 CYS C SG  1 
ATOM   8678  N  N   . GLY C  1 190 ? 54.090  -6.216  -1.603   1.00 20.07  ? 165 GLY C N   1 
ATOM   8679  C  CA  . GLY C  1 190 ? 53.658  -7.415  -0.874   1.00 19.04  ? 165 GLY C CA  1 
ATOM   8680  C  C   . GLY C  1 190 ? 52.163  -7.470  -0.608   1.00 18.33  ? 165 GLY C C   1 
ATOM   8681  O  O   . GLY C  1 190 ? 51.688  -8.345  0.112    1.00 18.51  ? 165 GLY C O   1 
ATOM   8682  N  N   . ASN C  1 191 ? 51.429  -6.523  -1.182   1.00 17.92  ? 166 ASN C N   1 
ATOM   8683  C  CA  . ASN C  1 191 ? 49.968  -6.510  -1.134   1.00 17.85  ? 166 ASN C CA  1 
ATOM   8684  C  C   . ASN C  1 191 ? 49.344  -7.362  -2.233   1.00 18.46  ? 166 ASN C C   1 
ATOM   8685  O  O   . ASN C  1 191 ? 50.009  -7.744  -3.199   1.00 18.67  ? 166 ASN C O   1 
ATOM   8686  C  CB  . ASN C  1 191 ? 49.456  -5.082  -1.317   1.00 17.46  ? 166 ASN C CB  1 
ATOM   8687  C  CG  . ASN C  1 191 ? 50.113  -4.112  -0.382   1.00 18.13  ? 166 ASN C CG  1 
ATOM   8688  O  OD1 . ASN C  1 191 ? 49.786  -4.073  0.812    1.00 19.12  ? 166 ASN C OD1 1 
ATOM   8689  N  ND2 . ASN C  1 191 ? 51.042  -3.311  -0.908   1.00 17.45  ? 166 ASN C ND2 1 
ATOM   8690  N  N   . ALA C  1 192 ? 48.058  -7.651  -2.070   1.00 19.31  ? 167 ALA C N   1 
ATOM   8691  C  CA  . ALA C  1 192 ? 47.226  -8.156  -3.142   1.00 19.73  ? 167 ALA C CA  1 
ATOM   8692  C  C   . ALA C  1 192 ? 46.441  -6.965  -3.688   1.00 19.57  ? 167 ALA C C   1 
ATOM   8693  O  O   . ALA C  1 192 ? 46.253  -5.969  -2.987   1.00 19.81  ? 167 ALA C O   1 
ATOM   8694  C  CB  . ALA C  1 192 ? 46.297  -9.243  -2.634   1.00 20.37  ? 167 ALA C CB  1 
ATOM   8695  N  N   . PHE C  1 193 ? 46.008  -7.056  -4.939   1.00 19.65  ? 168 PHE C N   1 
ATOM   8696  C  CA  . PHE C  1 193 ? 45.401  -5.920  -5.610   1.00 19.24  ? 168 PHE C CA  1 
ATOM   8697  C  C   . PHE C  1 193 ? 44.141  -6.309  -6.390   1.00 19.71  ? 168 PHE C C   1 
ATOM   8698  O  O   . PHE C  1 193 ? 44.115  -7.314  -7.100   1.00 20.59  ? 168 PHE C O   1 
ATOM   8699  C  CB  . PHE C  1 193 ? 46.425  -5.286  -6.534   1.00 18.65  ? 168 PHE C CB  1 
ATOM   8700  C  CG  . PHE C  1 193 ? 46.046  -3.922  -7.025   1.00 18.68  ? 168 PHE C CG  1 
ATOM   8701  C  CD1 . PHE C  1 193 ? 46.300  -2.795  -6.253   1.00 18.74  ? 168 PHE C CD1 1 
ATOM   8702  C  CD2 . PHE C  1 193 ? 45.449  -3.758  -8.270   1.00 19.06  ? 168 PHE C CD2 1 
ATOM   8703  C  CE1 . PHE C  1 193 ? 45.957  -1.530  -6.706   1.00 18.64  ? 168 PHE C CE1 1 
ATOM   8704  C  CE2 . PHE C  1 193 ? 45.114  -2.492  -8.737   1.00 18.79  ? 168 PHE C CE2 1 
ATOM   8705  C  CZ  . PHE C  1 193 ? 45.369  -1.380  -7.959   1.00 18.20  ? 168 PHE C CZ  1 
ATOM   8706  N  N   . ILE C  1 194 ? 43.101  -5.497  -6.251   1.00 19.34  ? 169 ILE C N   1 
ATOM   8707  C  CA  . ILE C  1 194 ? 41.875  -5.662  -7.011   1.00 19.61  ? 169 ILE C CA  1 
ATOM   8708  C  C   . ILE C  1 194 ? 41.762  -4.480  -7.961   1.00 20.35  ? 169 ILE C C   1 
ATOM   8709  O  O   . ILE C  1 194 ? 41.645  -3.323  -7.533   1.00 20.36  ? 169 ILE C O   1 
ATOM   8710  C  CB  . ILE C  1 194 ? 40.637  -5.758  -6.088   1.00 19.87  ? 169 ILE C CB  1 
ATOM   8711  C  CG1 . ILE C  1 194 ? 40.782  -6.957  -5.150   1.00 21.05  ? 169 ILE C CG1 1 
ATOM   8712  C  CG2 . ILE C  1 194 ? 39.355  -5.906  -6.899   1.00 19.86  ? 169 ILE C CG2 1 
ATOM   8713  C  CD1 . ILE C  1 194 ? 39.864  -6.903  -3.950   1.00 22.40  ? 169 ILE C CD1 1 
ATOM   8714  N  N   . LEU C  1 195 ? 41.826  -4.775  -9.257   1.00 20.33  ? 170 LEU C N   1 
ATOM   8715  C  CA  . LEU C  1 195 ? 41.688  -3.758  -10.274  1.00 19.33  ? 170 LEU C CA  1 
ATOM   8716  C  C   . LEU C  1 195 ? 40.237  -3.683  -10.735  1.00 20.17  ? 170 LEU C C   1 
ATOM   8717  O  O   . LEU C  1 195 ? 39.633  -4.717  -11.070  1.00 21.00  ? 170 LEU C O   1 
ATOM   8718  C  CB  . LEU C  1 195 ? 42.609  -4.074  -11.449  1.00 18.27  ? 170 LEU C CB  1 
ATOM   8719  C  CG  . LEU C  1 195 ? 42.495  -3.176  -12.693  1.00 18.20  ? 170 LEU C CG  1 
ATOM   8720  C  CD1 . LEU C  1 195 ? 42.946  -1.744  -12.436  1.00 16.96  ? 170 LEU C CD1 1 
ATOM   8721  C  CD2 . LEU C  1 195 ? 43.264  -3.784  -13.850  1.00 18.69  ? 170 LEU C CD2 1 
ATOM   8722  N  N   . LYS C  1 196 ? 39.674  -2.504  -10.773  1.00 19.71  ? 171 LYS C N   1 
ATOM   8723  C  CA  . LYS C  1 196 ? 38.421  -2.262  -11.425  1.00 20.57  ? 171 LYS C CA  1 
ATOM   8724  C  C   . LYS C  1 196 ? 38.623  -1.302  -12.557  1.00 20.35  ? 171 LYS C C   1 
ATOM   8725  O  O   . LYS C  1 196 ? 38.561  -0.129  -12.369  1.00 20.70  ? 171 LYS C O   1 
ATOM   8726  C  CB  . LYS C  1 196 ? 37.349  -1.768  -10.458  1.00 21.10  ? 171 LYS C CB  1 
ATOM   8727  C  CG  . LYS C  1 196 ? 35.933  -1.814  -11.009  1.00 21.71  ? 171 LYS C CG  1 
ATOM   8728  C  CD  . LYS C  1 196 ? 35.351  -0.513  -11.524  1.00 21.53  ? 171 LYS C CD  1 
ATOM   8729  C  CE  . LYS C  1 196 ? 35.549  -0.258  -12.991  1.00 21.52  ? 171 LYS C CE  1 
ATOM   8730  N  NZ  . LYS C  1 196 ? 34.626  0.698   -13.583  1.00 21.12  ? 171 LYS C NZ  1 
ATOM   8731  N  N   . PRO C  1 197 ? 38.816  -1.829  -13.762  1.00 19.53  ? 172 PRO C N   1 
ATOM   8732  C  CA  . PRO C  1 197 ? 39.110  -0.964  -14.895  1.00 18.74  ? 172 PRO C CA  1 
ATOM   8733  C  C   . PRO C  1 197 ? 37.864  -0.381  -15.561  1.00 19.56  ? 172 PRO C C   1 
ATOM   8734  O  O   . PRO C  1 197 ? 36.731  -0.747  -15.221  1.00 20.36  ? 172 PRO C O   1 
ATOM   8735  C  CB  . PRO C  1 197 ? 39.829  -1.893  -15.852  1.00 18.86  ? 172 PRO C CB  1 
ATOM   8736  C  CG  . PRO C  1 197 ? 39.261  -3.245  -15.566  1.00 19.36  ? 172 PRO C CG  1 
ATOM   8737  C  CD  . PRO C  1 197 ? 38.852  -3.255  -14.122  1.00 19.22  ? 172 PRO C CD  1 
ATOM   8738  N  N   . SER C  1 198 ? 38.081  0.536   -16.493  1.00 19.90  ? 173 SER C N   1 
ATOM   8739  C  CA  . SER C  1 198 ? 37.000  1.088   -17.292  1.00 21.24  ? 173 SER C CA  1 
ATOM   8740  C  C   . SER C  1 198 ? 36.288  0.002   -18.092  1.00 22.33  ? 173 SER C C   1 
ATOM   8741  O  O   . SER C  1 198 ? 36.935  -0.788  -18.786  1.00 21.44  ? 173 SER C O   1 
ATOM   8742  C  CB  . SER C  1 198 ? 37.540  2.118   -18.272  1.00 21.12  ? 173 SER C CB  1 
ATOM   8743  O  OG  . SER C  1 198 ? 36.492  2.580   -19.116  1.00 22.03  ? 173 SER C OG  1 
ATOM   8744  N  N   . GLU C  1 199 ? 34.955  0.006   -18.018  1.00 23.63  ? 174 GLU C N   1 
ATOM   8745  C  CA  . GLU C  1 199 ? 34.120  -0.955  -18.746  1.00 25.42  ? 174 GLU C CA  1 
ATOM   8746  C  C   . GLU C  1 199 ? 34.094  -0.680  -20.255  1.00 26.11  ? 174 GLU C C   1 
ATOM   8747  O  O   . GLU C  1 199 ? 33.588  -1.497  -21.034  1.00 26.82  ? 174 GLU C O   1 
ATOM   8748  C  CB  . GLU C  1 199 ? 32.701  -1.023  -18.144  1.00 26.57  ? 174 GLU C CB  1 
ATOM   8749  C  CG  . GLU C  1 199 ? 31.906  0.273   -18.200  1.00 27.25  ? 174 GLU C CG  1 
ATOM   8750  C